Automatic blacklist update

author Travis CI User <travis@example.org>

Sat, 20 Mar 2021 04:32:06 +0000 (04:32 +0000)

committer Travis CI User <travis@example.org>

Sat, 20 Mar 2021 04:32:06 +0000 (04:32 +0000)
author Travis CI User <travis@example.org>
Sat, 20 Mar 2021 04:32:06 +0000 (04:32 +0000)
committer Travis CI User <travis@example.org>
Sat, 20 Mar 2021 04:32:06 +0000 (04:32 +0000)
diff --git a/README.md b/README.md

index deec67a98f4ada8d8c4a47d823032e49b2f32a83..171162ec5501319a5ade06d78538e093f266ffba 100644 (file)
--- a/README.md
+++ b/README.md
@@ -6,7 +6,7 @@ __Note__: this repository is only intended to mirror lists, to modify/update the
  ## Lists
  | Name | Size | Description |
  |:-----|:-----|:------------|
-| [adult](blacklists/adult) | 3087767 | Some adult site from erotic to hard pornography |
+| [adult](blacklists/adult) | 3087825 | Some adult site from erotic to hard pornography |
  | [agressif](blacklists/agressif) | 384 | Some aggressive sites |
  | [arjel](blacklists/arjel) | 69 | ARJEL which is a french certification authority for gambling sites |
  | [associations_religieuses](blacklists/associations_religieuses) | 1 | religious_association |
@@ -39,7 +39,7 @@ __Note__: this repository is only intended to mirror lists, to modify/update the
  | [jobsearch](blacklists/jobsearch) | 386 | Site to looking for job |
  | [lingerie](blacklists/lingerie) | 83 | Sites for lingerie |
  | [liste_bu](blacklists/liste_bu) | 2890 | A french list for educational sites. VERY locally oriented. may help libraries |
-| [malware](blacklists/malware) | 204711 | Any website which deliver malware |
+| [malware](blacklists/malware) | 204351 | Any website which deliver malware |
  | [manga](blacklists/manga) | 779 | Any website related to manga, and cartoons |
  | [marketingware](blacklists/marketingware) | 28 | Very special marketing sites |
  | [mixed_adult](blacklists/mixed_adult) | 153 | Websites which contains adult sections unstructured |
diff --git a/blacklists/README b/blacklists/README

index 7e647ad357f47a843e0a86387c117c73203e61e9..d8ffe7072af6af47d4a79016ce25f160c20c0b0c 100644 (file)
--- a/blacklists/README
+++ b/blacklists/README
@@ -41,7 +41,7 @@ adult.tar.gz          is a list of adult sites. They are based on
                                          Symon Aked
                                          Todd Sieland-Peterson
  
-Last version Thursday 18 March 2021 with 3012967 domains and 74800 urls : 12884 Kb.
+Last version Friday 19 March 2021 with 3013042 domains and 74775 urls : 12884 Kb.
                         
  
  OTHER :
diff --git a/blacklists/adult/domains b/blacklists/adult/domains

index 4d43162ed9c73d595a3d1a227f62935e739130b9..30f50da4f95f4a23e6aa7558134af4736afd6224 100644 (file)
--- a/blacklists/adult/domains
+++ b/blacklists/adult/domains
@@ -177451,6 +177451,7 @@ adultclip.ning.com
  adultcliphub.com
  adultclips.nl
  adultclips.startclub.nl
+adultclipsdl.com
  adultclub.co.za
  adultclub.hobi.ru
  adultclubbizarre.blogdrive.com
@@ -198454,6 +198455,7 @@ aebn.com
  aebn.dk
  aebn.net
  aebnmovieclips.com
+aebnpornvideos.blogspot.com
  aebnradio.com
  aebnvod.tumblr.com
  aebnworld.com
@@ -259804,6 +259806,7 @@ amateurstel.com
  amateurstofuck.com
  amateurstory.com
  amateurstraightboys.com
+amateurstraightguy.blogspot.com
  amateurstraightguys.com
  amateurstraightmen.com
  amateurstreamsex.com
@@ -264383,6 +264386,7 @@ amaturepornpics.com
  amaturepornshot.com
  amatureporntapes.com
  amatureporntube.net
+amaturepornworld.com
  amaturerotica.com
  amatures.com
  amatureselfies.tumblr.com
@@ -279247,6 +279251,7 @@ anal-dilatation.blog4ever.com
  anal-dilatation.com
  anal-dildo.de
  anal-dildo.info
+anal-divas-inlatexclips.blogspot.com
  anal-douche-enema-bulb-syringe.blogspot.ae
  anal-douche-enema-bulb-syringe.blogspot.al
  anal-douche-enema-bulb-syringe.blogspot.am
@@ -324244,6 +324249,7 @@ arianearborene.com
  arianeescort.com
  arianeproibida.cjb.net
  arianfosterprobowljersey.com
+ariangirl.com
  arianna4you.tumblr.com
  ariannaathey47.tumblr.com
  ariannacummings.tumblr.com
@@ -420176,6 +420182,7 @@ bdsm-fima.blogspot.tw
  bdsm-fima.blogspot.ug
  bdsm-fineart.de
  bdsm-for-you.com
+bdsm-forever.blogspot.com
  bdsm-forum.de
  bdsm-forum.dr.ag
  bdsm-fotos.de
@@ -510403,6 +510410,7 @@ blackisbeautiful.nl
  blackisbeautiful.se
  blackisbetter.com
  blackisbig.com
+blackisbootyful.blogspot.com
  blackistry.com
  blackitonup.com
  blackjack-base.com
@@ -563683,6 +563691,7 @@ boyssex.com
  boyssex.nl
  boyssex2.tumblr.com
  boyssextube.com
+boyssexvideos-blog.tumblr.com
  boyssexxx.tumblr.com
  boyssexyboys.tumblr.com
  boyssexyporn.tumblr.com
@@ -641289,6 +641298,7 @@ carlsberg.electronic-billing.co.uk
  carlsexe.over-blog.com
  carltonprice.co.uk
  carltonsoflondon.com
+carltonstaffing.info
  carlucks.com
  carluxshop.com
  carlybarley94.tumblr.com
@@ -687295,6 +687305,7 @@ chat-coquin-webcam.com
  chat-coquin.com
  chat-dating-erotiek.startbewijs.nl
  chat-de-rencontre.com
+chat-de-sex.blogspot.com
  chat-de.de
  chat-dialkoma.c.la
  chat-dialogue-rencontre.com
@@ -695231,6 +695242,7 @@ cheapsexstore.com
  cheapsextoy.com
  cheapsextoys.com
  cheapsextoyz.com
+cheapsexwebcams.blogspot.com
  cheapsexxxx.com
  cheapsexytoys.com
  cheapsexywomanunderwear.blogspot.ae
@@ -710474,6 +710486,7 @@ choppedcollectorkingdomstuff.tumblr.com
  choppedwheatfields.tumblr.com
  chopperdaddy666.tumblr.com
  chopperiapalma.com.br
+choppertech.blogspot.com
  choppily.cn
  choppski.tumblr.com
  chopscash.com
@@ -721576,6 +721589,7 @@ cktmzozfq.goruli.com
  cktoday.ca
  cku.rogagot.com
  ckveboqdqmyxirvb-dot-millinium.ey.r.appspot.com
+ckw-inzworld.blogspot.com
  ckwan.fr
  ckwfnkafauvitysg-dot-millinium.ey.r.appspot.com
  ckwkohpsrvrjwfwe-dot-millinium.ey.r.appspot.com
@@ -730977,6 +730991,7 @@ cliwfjbtimoohalqtveiqwmrqi-dot-gleowayel400503.uc.r.appspot.com
  clixclax.tumblr.com
  clixgalore.co.uk
  clixgalore.jp
+clixtube.com
  clixxx4porn.com
  clk-dhl-eu.com
  clk.sjopt.com
@@ -773903,6 +773918,7 @@ countrydieselboy.tumblr.com
  countryeggplantr.com
  countrygayfirefighter.tumblr.com
  countrygirl-secretslut.tumblr.com
+countrygirl28.tumblr.com
  countrygirlcitylife.blogspot.ae
  countrygirlcitylife.blogspot.al
  countrygirlcitylife.blogspot.am
@@ -864771,6 +864787,7 @@ desi-sex-movies.blogspot.sn
  desi-sex-movies.blogspot.tw
  desi-sex-movies.blogspot.ug
  desi-sexy.com
+desi-sexy.info
  desi-teens.com
  desi-teluguaunties.blogspot.ae
  desi-teluguaunties.blogspot.al
@@ -878046,6 +878063,7 @@ dianekeatonbirthday.blogspot.sk
  dianekeatonbirthday.blogspot.sn
  dianekeatonbirthday.blogspot.tw
  dianekeatonbirthday.blogspot.ug
+dianekeatontopless.blogspot.com
  dianelanepicture.blogspot.ae
  dianelanepicture.blogspot.al
  dianelanepicture.blogspot.am
@@ -922325,6 +922343,7 @@ dreamgirlturnedslut.tumblr.com
  dreamgirltyler.com
  dreamgirlusa.com
  dreamgirlwebcams.com
+dreamgirlxxx.blogspot.com
  dreamgirlz.co.uk
  dreamgirlzelite.tumblr.com
  dreamgirlzzz.blogspot.ae
@@ -934300,6 +934319,7 @@ dv8cultx.com
  dv8ssickonephew.tumblr.com
  dvaddysgirll.tumblr.com
  dvampmanswife.tumblr.com
+dvanc690.blogspot.com
  dvansinte.com
  dvastudio.ru
  dvawpmczfsjfilye-dot-millinium.ey.r.appspot.com
@@ -977190,6 +977210,7 @@ enormousblacktits.tumblr.com
  enormousboobs.com
  enormousboobs.org
  enormouscock37.tumblr.com
+enormoust.blogspot.com
  enorplymessagingsquare.com
  enosso.com.br
  enossosexypages.com
@@ -1122208,6 +1122229,7 @@ fqr5us00.firebaseapp.com
  fqrlmkhsvuyspgss-dot-millinium.ey.r.appspot.com
  fqsjzxyey.com
  fqtbm.canalblog.com
+fqugeislingendirneib.blogspot.com
  fqvnmauflaoxmjlp-dot-millinium.ey.r.appspot.com
  fqvvlwehhozpsnia-dot-millinium.ey.r.appspot.com
  fqwajhhbpgyfsstg-dot-millinium.ey.r.appspot.com
@@ -1212422,6 +1212444,7 @@ garenanow.myvnc.com
  garenanow4.myvnc.com
  garenas2rt.000webhostapp.com
  garenascartitan.xyz
+garennes-sur-eure.artinglass.eu
  garentod-bagi-bagi-diamond-gratis.000webhostapp.com
  gareth.p.btinternet.co.uk
  garethjames.co.uk
@@ -1226450,6 +1226473,7 @@ gayadultwebmasterresources.com
  gayadultxxxporn.com
  gayadventure.com
  gayadventures.com
+gayaebnpornvideos.blogspot.com
  gayaffair.com
  gayaffaire.com
  gayaffairs.com
@@ -1253713,6 +1253737,7 @@ gayxxxtube.net
  gayxxxtube.org
  gayxxxtv.com
  gayxxxuk.tumblr.com
+gayxxxvideo.me
  gayxxxvideo.tumblr.com
  gayxxxvids.com
  gayxxxvids.tumblr.com
@@ -1255337,6 +1255362,7 @@ gee69bttm4u.tumblr.com
  geeandbeevstheworld.tumblr.com
  geeb.pro
  geeccaships.ga
+geednaschultz365.blogspot.com
  geeeeeegg.tumblr.com
  geef-mij-een-webcam-sletjes-op-te-sexcammen.startspot.nl
  geefme.nl
@@ -1291877,6 +1291903,7 @@ gomadministries.blogspot.tw
  gomadministries.blogspot.ug
  gomadonna.com
  gomaidan.in
+gomammytimes.blogspot.com
  gomart27.tumblr.com
  gomassagelondon.com
  gomatch.com
@@ -1307573,6 +1307600,7 @@ grimacepasture.com
  grimdarkgay.tumblr.com
  grime-grit.tumblr.com
  grimeandsmells.tumblr.com
+grimhistory.blogspot.com
  grimlock8393.tumblr.com
  grimm-tales-of-debauchery.tumblr.com
  grimmemennesker.dk
@@ -1369794,6 +1369822,7 @@ highlevelnaiveexecutables--five-nine.repl.co
  highlevelporn.com
  highlifefurniture.net
  highlight-studio.de
+highlightsnfl.blogspot.com
  highlineengineers.com
  highlinesouthasc.com
  highlow88hentai.blogspot.ae
@@ -1371809,6 +1371838,7 @@ hingisupskirt.blogspot.tw
  hingisupskirt.blogspot.ug
  hingolnationalpark.com
  hining.temp.swtest.ru
+hinlad.blogspot.com
  hinmpzpdapjmnkuxvadhlazpzt-dot-gleowayel400503.uc.r.appspot.com
  hino.biz
  hinonekart.tumblr.com
@@ -1378328,6 +1378358,7 @@ hoeschensex.de
  hoesfuck.com
  hoeshub.com
  hoesjoy.com
+hoesondeck.blogspot.com
  hoesondesck.blogspot.ae
  hoesondesck.blogspot.al
  hoesondesck.blogspot.am
@@ -1498337,6 +1498368,7 @@ interacial-gangbang.blogspot.sk
  interacial-gangbang.blogspot.sn
  interacial-gangbang.blogspot.tw
  interacial-gangbang.blogspot.ug
+interacial-gangbangs-ny.blogspot.com
  interacial-pics5065.blogspot.ae
  interacial-pics5065.blogspot.al
  interacial-pics5065.blogspot.am
@@ -1512442,6 +1512474,7 @@ italianoxxx.com
  italianoxxxporno.com
  italianporn.com
  italianporn.eu
+italianporn.pro
  italianpornmansion.tumblr.com
  italianporno.com
  italianporntube.net
@@ -1524742,6 +1524775,7 @@ janet-mason-hd720.tumblr.com
  janet026.tumblr.com
  janetandleah.com
  janetarzan69.tumblr.com
+janetashlyn.blogspot.com
  janetcharlton.com
  janetcharltonshollywood.com
  janetcynthia.com
@@ -1536990,6 +1537024,7 @@ jena-malone.blogspot.ug
  jenabush.com
  jenajameson.com
  jenajamesonpictures.imedia.nu
+jenasjs.tumblr.com
  jenaveve-jolie.com
  jenavevefan.com
  jenavevejolieraw.com
@@ -1615262,6 +1615297,7 @@ la-femme-mure-catain-fille-de-cite.blogspot.sk
  la-femme-mure-catain-fille-de-cite.blogspot.sn
  la-femme-mure-catain-fille-de-cite.blogspot.tw
  la-femme-mure-catain-fille-de-cite.blogspot.ug
+la-femme-mure-nympho-black.blogspot.com
  la-femme-nue.centerblog.net
  la-fessee.com
  la-fetita.tumblr.com
@@ -1746299,6 +1746335,7 @@ manscout-international.blogspot.sk
  manscout-international.blogspot.sn
  manscout-international.blogspot.tw
  manscout-international.blogspot.ug
+mansdailyfix.tumblr.com
  mansdragon.com
  mansex.canalblog.com
  mansex.com
@@ -1794920,6 +1794957,7 @@ meropsi.site
  merqueropego.online
  merriol.freeserve.co.uk
  merritellcap.com
+merrittbjerrum86.tumblr.com
  merrittisland.buzz
  merry-angels-top.ma.cx
  merry-babygirl.tumblr.com
@@ -1848733,6 +1848771,7 @@ mostwantedpornstars.com
  mostwantedsexlinks.com
  mostwantedtgirls.com
  mostwantedtgirls.tumblr.com
+mostxxxmovies.com
  mostyummy.tumblr.com
  mosuleznybard.ru
  mosuniverse.com
@@ -1894935,6 +1894974,7 @@ naked-photo-epxzq.blogspot.sn
  naked-photo-epxzq.blogspot.tw
  naked-photo-epxzq.blogspot.ug
  naked-photo.com
+naked-photos-of-pamela-anderson989.blogspot.com
  naked-photos.tumblr.com
  naked-pics.net
  naked-pictures.blogspot.ae
@@ -1901430,6 +1901470,7 @@ nakedsexywomen1.tumblr.com
  nakedsexyworld.tumblr.com
  nakedshemaleporn.com
  nakedshemales.com
+nakedshemalesex.com
  nakedshemalesporn.com
  nakedshemaletube.com
  nakedshoppers.tumblr.com
@@ -1930318,6 +1930359,7 @@ nextmodels.ca
  nextmusic.club
  nextofskin.com
  nextouchonline.com
+nextpanu.com
  nextpayments-authverif-lnterac-ca.precisiongroup.org
  nextpic.com
  nextpics.com
@@ -1947970,6 +1948012,7 @@ not-found32.xyz
  not-found34.xyz
  not-found35.xyz
  not-fucking-good-enough.tumblr.com
+not-fucking-xanax-dickhole-blog.tumblr.com
  not-gay-i-swear.tumblr.com
  not-half-the-man.tumblr.com
  not-just-a-good-girl.tumblr.com
@@ -1962990,6 +1963033,7 @@ nudegirlssex.tumblr.com
  nudegirlsskiing.com
  nudegirlsteasing.com
  nudegirlstgp.ws
+nudegirlstits.com
  nudegirlstowatch.com
  nudegirlstown.com
  nudegirlstube.com
@@ -1988319,6 +1988363,7 @@ omaridoliberal.blogspot.sn
  omaridoliberal.blogspot.tw
  omaridoliberal.blogspot.ug
  omarindigo.tumblr.com
+omarohiqamydar.blogspot.com
  omas-beim-sex.de
  omas-privat.net
  omas-royal.com
@@ -2033683,6 +2033728,7 @@ pasionamateur.blogspot.ug
  pasionariasedum.com
  pasioncontinental.com
  pasionesprohibida.com
+pasiongirl1.blogspot.com
  pasionis.com
  pasionliberal.com
  pasionmujeres.com
@@ -2040860,6 +2040906,7 @@ pcls-teens.tumblr.com
  pcmall.ca
  pcmancomputer.com
  pcmates.com
+pcmediamania.blogspot.com
  pcmehanics.cf
  pcmercon.com
  pcmoviltech.com
@@ -2048196,6 +2048243,7 @@ penthousehotties.blogspot.tw
  penthousehotties.blogspot.ug
  penthousehub.com
  penthouseletter.net
+penthouseletters.tumblr.com
  penthouselive.com
  penthousemag.net
  penthousemagazine.biz
@@ -2059392,6 +2059440,7 @@ phimsexvip.000webhostapp.com
  phimsexvipfree.000webhostapp.com
  phimsexvn.biz
  phimsexvn70.000webhostapp.com
+phimxkhieudam.blogspot.com
  phimxnxx.000webhostapp.com
  phimxxx.com
  phimzyx.blogspot.ae
@@ -2132107,6 +2132156,7 @@ pornguys.com
  pornguys.net
  pornguystube.com
  porngyno.com
+pornh.me
  pornh00r.tumblr.com
  pornh0le.blogspot.ae
  pornh0le.blogspot.al
@@ -2137600,6 +2137650,7 @@ pornmovis.net
  pornmovs.org
  pornmovs.pro
  pornmovs.us.tt
+pornmovs4k.com
  pornmovshub.com
  pornmovsonline.com
  pornmovstube.com
@@ -2143500,6 +2143551,7 @@ porno-wichsen.east-wave.com
  porno-wichsvorlagen.com
  porno-wife.com
  porno-wizard.com
+porno-wonder.blogspot.com
  porno-wonder.com
  porno-work.ru
  porno-worker.com
@@ -2312755,6 +2312807,7 @@ scatofree.blogspot.sk
  scatofree.blogspot.sn
  scatofree.blogspot.tw
  scatofree.blogspot.ug
+scatogirl.blogspot.com
  scatomovie.blogspot.com
  scatophil.tumblr.com
  scatophile.centerblog.net
@@ -2327393,6 +2327446,7 @@ segurancaitau.ddns.net
  segurancaitoken.com
  segurancastone.com
  seguraonline1bngobiper.com
+segurclarissa1968.blogspot.com
  seguridad-bcp.com
  seguridad-sms.com
  seguridadbancaria-transacciones.com
@@ -2331284,6 +2331338,7 @@ sellgaytraffic.com
  sellingporn.com
  sellingstore.pwebpro.com
  selllensescom.nckiemployment.gdn
+selllondonproperty.blogspot.com
  sellmeporn.com
  sellmesex.com
  sellmetraffic.com
@@ -2370048,6 +2370103,7 @@ sexcomicss.com
  sexcomicsxxx.com
  sexcoming.com
  sexcomix.com
+sexcomix.me
  sexcomix.net
  sexcomix.tv
  sexcommand.com
@@ -2377875,6 +2377931,7 @@ sexe.photo.animal.gncia.fr
  sexe.photo.free.fr
  sexe.photo.gncia.fr
  sexe.photo.nue.online.fr
+sexe.photos
  sexe.photos.ch.free.fr
  sexe.photos.fluctuat.net
  sexe.photos.gratuit.gncia.fr
@@ -2397865,6 +2397922,7 @@ sexmotivator.com
  sexmotofo.com
  sexmotor.com
  sexmotors.com
+sexmotors.net
  sexmountain.com
  sexmountain.net
  sexmouse.com
@@ -2410519,6 +2410577,7 @@ sexpic.narod.ru
  sexpic.net
  sexpic.nl
  sexpic.olderland.com
+sexpic.online
  sexpic.org
  sexpic.ru
  sexpic.sk
@@ -2435609,6 +2435668,7 @@ sexxxxumor.blogspot.sk
  sexxxxumor.blogspot.sn
  sexxxxumor.blogspot.tw
  sexxxxumor.blogspot.ug
+sexxxxvideo.net
  sexxxxvideo.pro
  sexxxxvideos.net
  sexxxxvids.com
@@ -2441324,6 +2441384,7 @@ sexy-friends.blogspot.tw
  sexy-friends.blogspot.ug
  sexy-from-tokyo.tumblr.com
  sexy-frozen-things.tumblr.com
+sexy-fuck-boy.tumblr.com
  sexy-fuck-friends224.tumblr.com
  sexy-fuck-friends228.tumblr.com
  sexy-fuck-friends555.tumblr.com
@@ -2468435,6 +2468496,7 @@ sexygirlzgallery.blogspot.ug
  sexygirlzlab.tumblr.com
  sexygirlzone.com
  sexygirlzx.tumblr.com
+sexygissellebennett.blogspot.com
  sexyglam.canalblog.com
  sexyglamdeep.tumblr.com
  sexyglamour.net
@@ -2496750,6 +2496812,7 @@ sexyymermaidd.tumblr.com
  sexyymuch-sugarbaby.tumblr.com
  sexyyng.tumblr.com
  sexyyoda.tumblr.com
+sexyyogapantsgirl.tumblr.com
  sexyyola.tumblr.com
  sexyyolandaprice.blogspot.ae
  sexyyolandaprice.blogspot.al
@@ -2512048,6 +2512111,7 @@ shemaleparade.net
  shemaleparadies.de
  shemaleparadise.net
  shemaleparadiseland.tumblr.com
+shemaleparksex.blogspot.com
  shemaleparties.startspot.nl
  shemalepassionandlust.tumblr.com
  shemalepassions.com
@@ -2543300,6 +2543364,7 @@ slavefaggot.tumblr.com
  slavefantasies.tumblr.com
  slavefarm.com
  slavefetish.tumblr.com
+slaveflashpt.blogspot.com
  slaveforcum.tumblr.com
  slaveforever.over-blog.com
  slaveforever.tumblr.com
@@ -2566860,6 +2566925,7 @@ somaspristine.com
  somasysresearch.com
  somatogenic-rifling.000webhostapp.com
  somature.com
+somaturetube.com
  somavision.com
  somavision.de
  somazone.com.au
@@ -2597031,6 +2597097,7 @@ stellarphonegirls.com
  stellarphonesex.com
  stellarpics.com
  stellarreports.icu
+stellarrmoon.tumblr.com
  stellasamborski.tumblr.com
  stellatorino.supereva.it
  stellavoices.de
@@ -2720268,6 +2720335,7 @@ thenakedandtheinfamous.tumblr.com
  thenakedarmy.net
  thenakedasiangirls.com
  thenakedbathroom.tumblr.com
+thenakedbicycle.tumblr.com
  thenakedbiway.tumblr.com
  thenakedblackgirl.tumblr.com
  thenakedbrit.tumblr.com
@@ -2727604,6 +2727672,7 @@ thesexplanet.com
  thesexpleasure.com
  thesexpod.com
  thesexpolice.com
+thesexportal.blogspot.com
  thesexportal.com
  thesexportal.nl
  thesexpost.com
@@ -2766350,6 +2766419,7 @@ totoweise.blogspot.ug
  totporn.com
  totpussyfantasy.tumblr.com
  totreview.com
+totsantcugat.info
  totsex.com
  totsex.net
  totsexweb.com
@@ -2835973,6 +2836043,7 @@ veporn.video
  vepornhd.club
  veporno.net
  veporns.com
+vepornxxx.blogspot.com
  veprafa2.free.fr
  veqholuhgybksyeqvuqketmnkx-dot-gleowayel400503.uc.r.appspot.com
  veqkkrgpa.goruli.com
@@ -2942134,6 +2942205,7 @@ x18.biz
  x18.ch
  x18.nl
  x18pass.com
+x18watch.blogspot.com
  x18xgirls.com
  x1a-f.mentriqq.com
  x1dr7.svcoding.com
@@ -2968983,6 +2969055,7 @@ xxxasianvideo.com
  xxxasianxxx.com
  xxxasiatique.com
  xxxassassin.tumblr.com
+xxxassfree.blogspot.com
  xxxassfuck.com
  xxxasssexy.com
  xxxasstitscock.tumblr.com
@@ -2969968,6 +2970041,7 @@ xxxcartoon.com
  xxxcartoon247.com
  xxxcartoongirls.com
  xxxcartoonhentai.tumblr.com
+xxxcartoonpic.com
  xxxcartoonporn.com
  xxxcartoons.com
  xxxcartoonsex.com
@@ -2971605,6 +2971679,7 @@ xxxfreelesbians.com
  xxxfreelesbiansexpics.com
  xxxfreelivesex.com
  xxxfreemature.com
+xxxfreemoviewifesexarabic.blogspot.com
  xxxfreepics.pagina.nu
  xxxfreeporn.biz
  xxxfreeporn.co.uk
@@ -3012965,3 +3013040,11 @@ xxx
  porn
  sex
  adult
+xxx
+porn
+sex
+adult
+xxx
+porn
+sex
+adult
diff --git a/blacklists/adult/urls b/blacklists/adult/urls

index facb541da24fd33d1a62c7fd390fde14a467edd9..fb5fed05dc81d886049818d21e0e6f77712ab415 100644 (file)
--- a/blacklists/adult/urls
+++ b/blacklists/adult/urls
@@ -3416,6 +3416,7 @@ ahirugama.com/cute82/Pacific-Girl
  ahkoleersa.com.sapo.pt/for
  ahmed-k.tumblr.com/post/136449746994/french-gay-sex-glossary
  ahnsfwt.tumblr.com/post/118218527234/gingeryqueen-nipple-penetration-is-one-of-my
+ahswitchy.tumblr.com/post/169410279660/fetish-james-march-x-the-countess-x-reader-smut
  ahswitchy.tumblr.com/post/169410279660/fetish-james-march-x-the-countess-x-reader-smut/amp
  ahungrynation.com/profiles/blogs/wife-fuck-party-wife-fucking
  ahwazsat.mihanbb.com/thread-5-page-12.html
@@ -4031,7 +4032,6 @@ amatureblack.blogsome.com/2009/01/09/big-cock-suck-porn
  amatureblack.blogsome.com/2009/01/09/hardcore-sex
  amatureblack.blogsome.com/2009/01/09/teen-porn-xxx-videos
  amatureladies.tumblr.com/post/103238158531/sempiternal-lust-my-plump-little-pussy-enjoying
-amaturepornworld.com/category/panties
  amazing-models.tumblr.com/post/136107881244/the-beautiful-renee
  amazing-sex.blogspot.com/2013/05
  amazingforum.com/forum3/2AARON
@@ -4317,6 +4317,7 @@ amourx.net/femme-nue
  amp.hifiporn.pw/xxx/43/opendreas-auntysexpornhub-comla-doctor-naked/sadistic-doctor-toys-with-and-fucks-new-sex-slave
  amp.openxh.com/photos/gallery/public-erection-exhibitionist-flasher-3-14204937
  amp.pornmaster.fun/hd/799/kovai-sarala-fake-nude-photoeepeka-samson-xnxx-xxx
+amp.xhamster1.desi/search/bbw
  amp.xhamster11.com/photos/gallery/0148-chattes-rasees-de-salopes-14383320
  amp.xhamster3.com/photos/gallery/trop-envie-de-lecher-cette-belle-chatte-poilue-12927582
  amp.xhamster3.desi/videos/erotic-girlfriend-sucking-dick-before-sex-9290773
@@ -5107,6 +5108,7 @@ anyxxx.me/video/47923978
  anyxxx.me/video/48849501
  anyxxx.me/video/53106664
  anyxxx.me/video/53153649
+anyxxx.me/video/7480759
  anyxxx.me/video/9029102
  anzacdayyouthproject.com/bdsm-porn-is-on-the-meet
  anzacdayyouthproject.com/the-fatherly-scat-porn
@@ -6290,6 +6292,7 @@ axwound.co.uk/sophie3739
  axxximage.com/2015-xxx-25-lisa-ann-nude-photos-hardcore-sex-pics-naked-images
  ayahtiri.blogspot.com/2019/06
  ayambokep.blogspot.com/2019/05
+ayannaakjoijf.blogspot.com/2020
  ayanohanna.exblog.jp/1875577
  ayfnet.net/londik
  ayillustrations.tumblr.com/post/133158260625/drawings-from-my-porn-of-the-dead-book-avalible
@@ -6892,7 +6895,6 @@ bdjproductions.com/a1
  bdnet.com/adulte
  bdoubliees.com/cgi-bin/ebay.bin
  bdsm-247.blogspot.com/2012
-bdsm-forever.blogspot.com/2020/07
  bdsm-movie.info/fr/videos/cum-with-cockstuffing-tube-fetish-big-o-spunk-flow-german-685
  bdsm-threesome-sex-2013.blogspot.com/2014
  bdsm-tube.pro/fr/video/35933/vends-ta-culotte-french-babe-sucks-big-cock-tasty-blowjob
@@ -9205,6 +9207,7 @@ blueskies4u2.tumblr.com/post/61401241066/nopicturesofyou-hot-amateur
  blueskyman2012.tumblr.com/post/145781535877
  bluespacecaribbean.org/blogs/2015/09/page
  bluespacecaribbean.org/blogs/2015/10/13/amateurs-group-sex
+bluespacecaribbean.org/blogs/2015/10/15/galerie-photo-zoophilie
  bluespacecaribbean.org/blogs/2015/10/18/horse-porn-galleries
  bluespacecaribbean.org/blogs/2015/10/page
  bluespacecaribbean.org/blogs/page
@@ -9948,76 +9951,6 @@ boysmoviesgay-blog.tumblr.com/post/118239620044/stud-movies-gay
  boysmoviesgay-blog.tumblr.com/post/118240932814/boy-men-porn-free-video-clips
  boysmoviesgay-blog.tumblr.com/post/118241039614/gay-obsession-clips
  boysmoviesgay-blog.tumblr.com/post/118242304379/twink-resort-nashville-tn
-boyssexvideos-blog.tumblr.com/post/142319646388/homo-wrestling-group
-boyssexvideos-blog.tumblr.com/post/142319812098/gay-blowjob-secure-up-pictures
-boyssexvideos-blog.tumblr.com/post/142320002303/homo-asian-gangbang
-boyssexvideos-blog.tumblr.com/post/142320172583/video-on-demand-xxx-gay
-boyssexvideos-blog.tumblr.com/post/142320291758/gay-daddys-groups-los-angeles-ca
-boyssexvideos-blog.tumblr.com/post/142320532298/porn-public-sex-gay-porn
-boyssexvideos-blog.tumblr.com/post/142320643773/alliance-soulja-boy
-boyssexvideos-blog.tumblr.com/post/142320796088/piczo-family-twink
-boyssexvideos-blog.tumblr.com/post/142320862028/sexo-gay-anal/amp
-boyssexvideos-blog.tumblr.com/post/142320876553/free-gay-maleporn-yideos-online
-boyssexvideos-blog.tumblr.com/post/142321197488/free-kentucky-boy-teen-chat-rooms
-boyssexvideos-blog.tumblr.com/post/142321273473/gay-blogs-no-spyware-no-adware
-boyssexvideos-blog.tumblr.com/post/142321462218/team-a-few-gay-grandpa
-boyssexvideos-blog.tumblr.com/post/142321684333/alberta-gay-dating-ads
-boyssexvideos-blog.tumblr.com/post/142321749873/gay-cock-penis-dick
-boyssexvideos-blog.tumblr.com/post/142321766608/condensed-coal-black-relations-gay
-boyssexvideos-blog.tumblr.com/post/142321993683/pictures-gay-rope
-boyssexvideos-blog.tumblr.com/post/142322011603/unchained-gay-wrestling-vids
-boyssexvideos-blog.tumblr.com/post/142322071618/paradise-gay-club
-boyssexvideos-blog.tumblr.com/post/142322234608/black-gaymovies-video-click
-boyssexvideos-blog.tumblr.com/post/142322347008/porn-gay-toons
-boyssexvideos-blog.tumblr.com/post/142322490978/bear-ebony-lads-obscenely-gangbanging
-boyssexvideos-blog.tumblr.com/post/142322715958/la-guy-pride-paris-en-folie
-boyssexvideos-blog.tumblr.com/post/142323175893/adult-gay-games-download
-boyssexvideos-blog.tumblr.com/post/142323474598/dancing-with-stars-gay
-boyssexvideos-blog.tumblr.com/post/142323490908/yung-boys-gay
-boyssexvideos-blog.tumblr.com/post/142323572163/individual-gay-leather
-boyssexvideos-blog.tumblr.com/post/142323687498/blog-horny-hunks-blog
-boyssexvideos-blog.tumblr.com/post/142323719563/blonde-gay-porn
-boyssexvideos-blog.tumblr.com/post/142380291078/pic-post-twinks-free
-boyssexvideos-blog.tumblr.com/post/142380307348/gay-wrestlers-video-clips
-boyssexvideos-blog.tumblr.com/post/142380322888/originality-narrative-close-by-gay-gender
-boyssexvideos-blog.tumblr.com/post/142380461888/teen-gay-porno
-boyssexvideos-blog.tumblr.com/post/142380530738/gay-marriage-signs-and-bumperstickers
-boyssexvideos-blog.tumblr.com/post/142380738363/thailand-tag-results-gay
-boyssexvideos-blog.tumblr.com/post/142380938268/young-gay-boy-sex-story
-boyssexvideos-blog.tumblr.com/post/142381012483/handsome-guys-get-wild
-boyssexvideos-blog.tumblr.com/post/142381028928/featuring-gay-toons
-boyssexvideos-blog.tumblr.com/post/142381309883/gay-leather-slave-master
-boyssexvideos-blog.tumblr.com/post/142381411813/guy-male-wrestling-sites
-boyssexvideos-blog.tumblr.com/post/142381468253/twink-access-gay-porn
-boyssexvideos-blog.tumblr.com/post/142381538778/gay-tube-good-gay-tube-hunk
-boyssexvideos-blog.tumblr.com/post/142381622468/following-requests-homosexual-rights
-boyssexvideos-blog.tumblr.com/post/142381689608/avi-dar-gay-porn
-boyssexvideos-blog.tumblr.com/post/142381850208/filipino-homo-blogs
-boyssexvideos-blog.tumblr.com/post/142381919743/hot-nasty-gay-sex-stories
-boyssexvideos-blog.tumblr.com/post/142381938628/yahoo-directory-gay-adult-galleries
-boyssexvideos-blog.tumblr.com/post/142381958003/gay-bear-thumb-dispatch
-boyssexvideos-blog.tumblr.com/post/142382015798/gay-and-homosexual-community-center-des-moines
-boyssexvideos-blog.tumblr.com/post/142382081858/college-free-boys-sex
-boyssexvideos-blog.tumblr.com/post/142382098878/clips-free-gay-porn-clips
-boyssexvideos-blog.tumblr.com/post/142382115378/gay-horse-fuck-videos-free/amp
-boyssexvideos-blog.tumblr.com/post/142382166323/far-fetched-hardcore-gay-fact
-boyssexvideos-blog.tumblr.com/post/142382273478/rencontre-homosexual-et-lesbienne-be
-boyssexvideos-blog.tumblr.com/post/142382290558/county-boys-takes
-boyssexvideos-blog.tumblr.com/post/142382324538/drawings-adorable-gays
-boyssexvideos-blog.tumblr.com/post/142382818283/german-gay-magazine
-boyssexvideos-blog.tumblr.com/post/142382867453/man-movies-gay
-boyssexvideos-blog.tumblr.com/post/142382934223/guy-men-hard
-boyssexvideos-blog.tumblr.com/post/142382955153/gloryhole-gay-cock
-boyssexvideos-blog.tumblr.com/post/142383091713/close-bear-porno
-boyssexvideos-blog.tumblr.com/post/142383450728/gay-sex-big-dick
-boyssexvideos-blog.tumblr.com/post/142383502868/hard-muscle-gay-free
-boyssexvideos-blog.tumblr.com/post/142383573153/free-queer-guy-movieclipscom
-boyssexvideos-blog.tumblr.com/post/142383644323/twink-clubs-riverside-california
-boyssexvideos-blog.tumblr.com/post/142383968058/falcon-production-gay-eric-hanson
-boyssexvideos-blog.tumblr.com/post/142384018733/homo-porn-guys-fucked-by-machines
-boyssexvideos-blog.tumblr.com/post/142384038578/blowjob-gay-movies-military-gay-movies
-boyssexvideos-blog.tumblr.com/post/142384071833/filled-measurement-gay-porno
-boyssexvideos-blog.tumblr.com/post/142384088608/nurse-thumb-preview-boy-shemale-tranny
  boyswant.blogspot.com/2014
  boyswant.blogspot.com/2017
  boyswant.blogspot.com/2018/02
@@ -11131,6 +11064,7 @@ catcountry1073.com/best-little-whorehouse-in-eht-woman-charged-for-running-broth
  categorie.iltrovatore.it/directoryitalia/pages/Erotismo/Sadomaso_e_BDSM/
  categories.dyn.nu/free
  category-amateur-jav3.blogspot.com/2015/05
+catfightinguk.blogspot.com/2013
  catharsisproductions.tumblr.com/post/131316352892/these-are-the-cute-sex-positive-penis-and-vagina
  catherines.lanebryant.com/plus-size-intimates-plus-size-lingerie/panties/4574c4582/index.cat
  catholicnewsagency.com/resources/life-and-family/pornography/pornographys-effects-on-adults-and-children/
@@ -12484,6 +12418,7 @@ chillisearch.co.uk/v/i/video_gratuite_sodomie
  chillisearch.co.uk/v/u/vulve_rasee
  chilliwiki.com/br/documentario-aborda-o-fetiche-por-homens-heterossexuais-no-porno-gay
  chillkraft.net/node/8968
+chim-chimmie.tumblr.com/post/168977158722/cherries-m
  chim-chimmie.tumblr.com/post/180531195472/cherries-m
  chimacum.wednet.edu/wp-content/summer
  china-babes.net/chinababesa123
@@ -12869,7 +12804,6 @@ ckriticko.tumblr.com/post/23664243488/how-to-eliminate-premature-ejaculation-and
  ckrtlvr.tumblr.com/post/148944454571/girlsplus1-more-gifs-of-brandi-love
  ckshutz.tumblr.com/following
  cktoon.com/2008/06/18/mon-gaydar-est-detraque
-ckw-inzworld.blogspot.com/p
  cky-clan.com/havefun
  cl.spb.ru/girl
  cl.spb.ru/koncept3/
@@ -14002,6 +13936,7 @@ crdp-montpellier.fr/iase/documents/photos/gap2k4/3/repas02.mov
  crea.html.it/sito/shemalemovies
  crea.html.it/sito/shemalesex
  creabc.com/sites/webcamsexe
+creampie-porn-roundup.blogspot.com/2021/01
  creampie-tube-shemale-2013.blogspot.com/2018/03
  creampieboyfriends.org/sexe-adult-site-de-rencontres-libertin-gratuit-la-villedieu-l
  creampiesformothersadaughters.tumblr.com/post/112546338467/free-random-nude-sex-webcam-chat-1-2-3-4-5-6-7-8-9
@@ -21148,6 +21083,7 @@ ducoq.blogspot.com/search/label/Sexy
  duculgratuit.canalblog.com/albums/photos_soft
  dudeiknowimcrazy.tumblr.com/post/38471944253/perverse-lesbian-girls-follow-me-perverse
  dudemenanal-blog.tumblr.com/post/127827082968/boys-chat-rooms-that-are-compleaty-free
+dudemenanal-blog.tumblr.com/post/127984735343/gay-schoolboy-sexy-pictures
  dudemenanal-blog.tumblr.com/post/127988614718/gay-dick-lick
  dudemenanal-blog.tumblr.com/post/127988754283/gay-cock-sucking-military
  dudemenanal-blog.tumblr.com/post/127988814508/my-brother-gay
@@ -21312,6 +21248,7 @@ dvdteentwink-blog.tumblr.com/post/109445428810/gay-beast-vids
  dvdteentwink-blog.tumblr.com/post/109610213650/unrestrained-gay-men-pictures-movies
  dvdteentwink-blog.tumblr.com/post/109616464740/gym-horny-twink-takes
  dvdwolf.com/Biographies
+dvdx1.blogspot.com/2011
  dw626262.tumblr.com/post/138917474856/sucking-me-off-and-swallowing-my-cum-this-one-was
  dworf.dircon.co.uk/sexywomen
  dxbminutes1.tumblr.com/post/130574083730/fuck-a-friend-fuck-hard-hardcore-bigcock-cum
@@ -22519,7 +22456,6 @@ ennui.in/bossyxx
  ennui.in/more/amateur
  enormebazar.canalblog.com/archives/2014/01/05
  enormousblackdick.com/09280601
-enormoust.blogspot.com/2008
  enredo.org/moodle/course/format/topics
  enredo.org/moodle/pix/g
  enriqueweb.com/2
@@ -23052,6 +22988,7 @@ evangelicanua.blogspot.com/2011
  evans-exposed.tumblr.com/post/94381406065/all-about-trixx-samcedes
  evansrogerskitten.tumblr.com/post/173813392184/spank-me
  evansrogerskitten.tumblr.com/post/187062868579/when-you-think-about-me
+evaschmutz.blogspot.com/2018/07
  evasiveangles.tumblr.com/page/39
  evedecandaulie.fr/sex-interracial-1-the-queen-of-spades/
  evedecandaulie.fr/sex-interracial-2-bbc-world/
@@ -24201,6 +24138,7 @@ favstore.net/spermomax
  faxfire-blog.tumblr.com/post/109569186053/blonde-teen-braces-cum-facial
  faxinfo.com.br/eroticos/
  faye-reagan-ass-amature-vagina-vint.blogspot.com/2011/09
+faye-reagan-ass-amature-vagina-vint.blogspot.com/2012/03
  fayl.uh.cu/Documentos/Articulos/LORCA.DOC
  faylinngroupfucking.tumblr.com/post/110547240043/gangbang-triple-penetration
  fayno-cash.com/nude-art-babes
@@ -25168,6 +25106,7 @@ fetish-sex-big-tits-2013.blogspot.com/2016
  fetish-sex-groupsex-2013.blogspot.com/2015/01
  fetish-sex-groupsex-2013.blogspot.com/2018
  fetish-sex-outdoor-porn-2013.blogspot.com/2014
+fetish-sex-outdoor-porn-2013.blogspot.com/2018/05
  fetishalias.com/getfree/61xx_2007
  fetishbootsandheels.blogspot.com/2021/02
  fetishfantasies3.tumblr.com/post
@@ -25578,6 +25517,7 @@ firstzipperlandstudent.tumblr.com/post/622099544969281536
  fishscreensavers.net/wallpapers
  fist.porscheonline.com/puppy/homebrew
  fistfelt.tumblr.com/post/56353319024/asexuality-and-bondage
+fistgaylove-blog.tumblr.com/post/156323784464/babylon-35-adults-incidents-file-anal-sex
  fistingpornflicks.com/video/8333/young-girls-hard-anal-fisting
  fistprive.blogspot.com/2013
  fistybobmaster.tumblr.com/post/148536761021/thebpster-girliepoo-panty-pooping-teen-1
@@ -27711,6 +27651,7 @@ freeindianporn.mobi/trends/centerfold
  freeindianporn.mobi/trends/cyber
  freeindianporn.mobi/trends/double
  freeindianporn.mobi/trends/exhibitionist
+freeindianporn.mobi/trends/foursome
  freeindianporn.mobi/trends/group
  freeindianporn.mobi/trends/indian
  freeindianporn.mobi/trends/japanese
@@ -27849,12 +27790,15 @@ freepicstogo.net/brynn2
  freepicstogo.net/gabby1
  freepicstogo.net/kali1
  freepicstogo.net/tara1
+freeporn-videos.net/fr/video/11596/sexy-loli-deep-sucking-and-doggy-fuck-in-the-forest-oral-creampie
  freeporngranny.com/pornstar/Lisa/page/3
  freepornotubes.net/sl/searches/alley-bagget-hard-blowjob
  freepornsgirlspictures.blogspot.com/2013/01
  freepornstarpicturefreeeroti.blogspot.com/2009
  freepornvids.red/searchresults
  freepornweb.blogspot.com/p
+freeprnvidsmpgs.blogspot.com/2007
+freeprnvidsmpgs.blogspot.com/2007/07
  freepsychicchat.com/psychic_chatrooms
  freepublicnuditypicwild.blogspot.com/2009
  freequalitysites.com/ws
@@ -28827,6 +28771,8 @@ gangban-series.com/grourp
  gangban-series.com/groutp
  gangban-series.com/grouyp
  gangbangiraja.blogspot.com/2014
+gangbangqueen.blogspot.com/2011
+gangbangqueen.blogspot.com/2011/11
  gangbanhard.com/anaql
  gangs-of-la.forumpro.fr/t113-mature-italian-amatuer
  gangstaname.com/names/porn
@@ -28933,7 +28879,6 @@ gay.com/travel
  gay.propeller.com/story/2008/01/31/video-porno-bisex-sesso-bi-pompini
  gay3somecouples01.tumblr.com/post/179908111660/boys-vol2release-year-2004-studio-cheeks-stand
  gay3somecouples01.tumblr.com/post/180522612145/taboo-boysrelease-year-2016-studio-acceed
-gayaebnpornvideos.blogspot.com/2015
  gayamateurbar21.tumblr.com/post/612350702289813504/raw-petting-nipple-pierced-bear-jerks-off-seed
  gayamateurbar21.tumblr.com/post/614612734111301632/mature-straight-bear-has-deep-throat-equality
  gayamateurbar21.tumblr.com/post/614615688758345728/best-bear-barebacks-in-office-bathroom-charlevoix
@@ -29079,6 +29024,7 @@ gayfuckingboys-blog.tumblr.com/post/138184518277/juicy-boys-video-box-men-raw-yo
  gayfuckingboys-blog.tumblr.com/post/138184671867/photo-young-gay-guy-in-speedo-suit
  gayfuckingboys-blog.tumblr.com/post/138185364252/hot-manga-gay
  gayfuckingboys-blog.tumblr.com/post/138185449557/gay-escort-services-in-virginia
+gayfuckingboys-blog.tumblr.com/post/138185566862/boy-marriage-pictures-with-captions-free
  gayfuckingboys-blog.tumblr.com/post/138185618577/dildo-gay-sex-blow-sex-free
  gayfuckingboys-blog.tumblr.com/post/138185687447/men-ring-cloland-gay-tgp-gay-amateur-gay-tgp
  gayfuckingboys-blog.tumblr.com/post/138186276407/gay-black-big-cocks-boys-big-cock-boys
@@ -29821,6 +29767,7 @@ gikywo69.blog.co.uk/2013/06/28/katie-price-pussy-lita-hot-lita-nude-choir-and-tu
  gikywo69.blog.co.uk/2013/06/28/sienna-miller-sex-tape-ryan-reynolds-pussy-mauryas-and-whimpered-16177084
  gikywo69.blog.co.uk/2013/06/29/danielle-fishel-nip-slip-jennifer-carpenter-naked-tourneys-in-testing-16180648
  gikywo69.blog.co.uk/2013/06/29/ellen-barkin-sex-tape-george-clooney-tits-queries-if-landsburg-16178853
+gilasmp.blogspot.com/2019/05
  gilbjerg.dk/steenman
  gildait.iitalia.com/archives
  gilinksy-johnsonn.tumblr.com/post/100879849853/jack-gilinsky-imagine-smut
@@ -30587,10 +30534,12 @@ gotoquiz.com/how_horny_are_you_2
  gotoquiz.com/img_sub/tmp
  gotoquiz.com/what_kind_of_babygirl_are_you
  gotouch.us/members/webcamawards
+gotporn.me/hq/aughty-twink-deep-penetration
  gotporn.me/hq/forced-
  gotporn.me/hq/forced-throatfuck-asian-crackwhore-cracked-vomit-
  gotporn.me/hq/forced-to-fondle-huge-
  gotporn.me/hq/free-big-boobs-porn-tube
+gotporn.me/hq/girls-snuff-shot-then-creampies-from-all-the-guys
  gotporn.me/hq/hemale-necrophile
  gotporn.me/hq/necrophilia-throat
  gotporn.me/hq/partouze-scato
@@ -30816,7 +30765,6 @@ griffithescorts.unblog.fr/2013/10/29/griffith-escorts
  grillingthenetgurus.com/7
  grimasa.com/porno
  grimasa.org/porno
-grimhistory.blogspot.com/2019/02
  grimsin.tumblr.com/post/51088655462/lesbianwomen-naked-horny-penthouse-girl-alyssa
  gringofelizme.tumblr.com/post/133131799058/the-holiest-mother-superior-natalie
  grisa.com.br/television
@@ -30879,6 +30827,7 @@ groups.google.com/g/ak.config/c/xhGqZ0ZAORg
  groups.google.com/g/alt.airbrush.art/c/dsF5RI84fNY
  groups.google.com/g/alt.org.young-enterprise/c/YOwNB7gkfuI
  groups.google.com/g/alt.tv.sliders.creative/c/MHlIEaprzRY
+groups.google.com/g/bih.sci.psihologija/c/Xc9D5crz9Sw
  groups.google.com/g/cs-monolit.gated.lists.bsdi-users/c/1C3cpypeSFA
  groups.google.com/g/ee.news/c/UcMVIIqw2mQ
  groups.google.com/g/free.aquaria/c/wtNJixk3s0o
@@ -31807,6 +31756,7 @@ hdvideosporn.net/porn/runetki-playboy-anal-dildo
  hdvideosporn.net/porn/sadism-milf
  hdvideosporn.net/porn/sesso-scat
  hdvideosporn.net/porn/softcore-vagina
+hdvideosporn.net/porn/sunny-leone-office
  hdvideosporn.net/porn/twink-circle
  hdvideosporn.net/porn/twink-rape-scat
  hdvideosporn.net/porn/www-black-big-cock-bagger-com
@@ -32112,6 +32062,8 @@ hentaisea.com/studio
  hentaisko.tumblr.com/post/91283075402/naruto-hentai-porno-apres-une-fellation-tsunade
  hentaistarworld.blogspot.com/2019/03
  hentaix10.tumblr.com/post/181497586066/sexy-amateurs-at-wwwsexyslutsxxxcom-follow-our
+hentaixxxmovies.com/en
+hentaixxxmovies.com/en/search/mindy
  hepcom.net/sexe
  hepweb.net/3x/
  her-naughty-princess.tumblr.com/post/146534602560/sexylesbiansinaction-sexy-hot-lesbians-photos
@@ -34201,6 +34153,7 @@ hunkgayfree-blog.tumblr.com/post/142183737332/pictures-od-gay-boys
  hunkgayfree-blog.tumblr.com/post/142183851142/gay-dummy-ratings
  hunkgayfree-blog.tumblr.com/post/142184193272/gay-naked-copsfiremen-photos
  hunkgayfree-blog.tumblr.com/post/142184472112/gay-sex-free-sex-free
+hunkgayfree-blog.tumblr.com/post/142184886222/several-gay-bear-boyfriends
  hunkgayfree-blog.tumblr.com/post/142184922942/gay-twink-art
  hunkgayfree-blog.tumblr.com/post/142185415767/pics-of-young-teen-blonde-gay-boys-fucking
  hunkgayfree-blog.tumblr.com/post/142250950597/boy-streaming-bondage-video
@@ -36235,6 +36188,7 @@ incestperversion.tumblr.com/post/93865442567/i-just-shot-cum-up-and-onto-my-face
  incestperversion.tumblr.com/post/93865442567/i-just-shot-cum-up-and-onto-my-face-jerking-to-your
  incestrapestories.paginas.sapo.pt/zoo
  incestsex.me/en/search/YXNzIGxpY2tpbmcgbW9t/popular
+incestsexstories.pro/en/video/2705852732541164769
  incestshortstory.blogspot.com/2017/05
  inceststorybest.blogspot.com/2013
  inch.com/~snack/ginger
@@ -36532,6 +36486,7 @@ ingenue.com/paradise
  ingin-kaya.com/blogs/naken-girl
  ingloriousmemes.tumblr.com/post/107268325963/tell-my-muse-how-youd-fuck-them-tell-them-your
  ingrid-deloiseau.tumblr.com/post/118182682055/angrylesbiangirls-ass-fuck-gangbang-sissy-adult
+inhairypussy.com/fr/hairy-base/aXEtNTY3LTg2Nw
  inhandjobswetrust.tumblr.com/post/116135236183/source-http-girlslovehandjobs-tumblr-com
  inhouserecruitment.com/tom6351
  inicia.es/de/carlosabenza/
@@ -37395,7 +37350,6 @@ jemurl.com/xvav0
  jemurl.com/y7l
  jemurl.com/y9dn
  jemurl.com/zqma
-jenasjs.tumblr.com/page/2
  jennabunni.tumblr.com/post
  jennaspecial.com/gallery/2915
  jenniferconnellyporn.blogspot.com/2014
@@ -39634,6 +39588,7 @@ leatherlatexmstress.tumblr.com/post/155863830457/gaggedslave-amateur-bondage-gag
  leatherlatexmstress.tumblr.com/post/157295095527/mystarzz-thighbootman-hot-tranny-in-boots
  leatherlatexmstress.tumblr.com/post/158420997517/latex-clothing-men-custom-fetish-wear-39170782
  leatherlatexmstress.tumblr.com/post/159809657802/wear-panties
+leatherlatexmstress.tumblr.com/post/160920039367/boots
  leatherlatexwife.tumblr.com/following
  leathertightly.tumblr.com/post/111681226882/hogtiedbabes-bdsm-archives
  leatherwhiskeycoffeeplaid.tumblr.com/post/182216455119/kinks
@@ -39856,6 +39811,7 @@ lesbian-dp.tumblr.com/post/188937069273/natasha-romanoff-x-reader-words-warnings
  lesbian-porn-roundup.blogspot.com/2021
  lesbian-porn-roundup.blogspot.com/2021/01
  lesbian-porn-sex.blogspot.com/2013
+lesbian-teens-porn.blogspot.com/2005/02
  lesbian-tube.tv/pt/videos/shaved-bbw-being-dominated-by-her-mistress-with-a-biggest-da-706
  lesbian-tube.tv/tags/hentai-threesome
  lesbianbutterfly.com/favicon.ico
@@ -44976,7 +44932,9 @@ molson0505.tumblr.com/post/138386107157/gamecat75-fishball-suicide
  mom-sex.club/fr/new/curvy
  mom-sex.club/fr/new/femdom
  mom-sex.club/fr/new/pain
+mom-sex.club/fr/new/pussy
  mom-sex.club/fr/play
+mom-sex.club/fr/video
  momanalfuck.com/fr/hermaphrodite
  momandpopteeshop.com/view/6126637/nikki-benz-i-got-naked-with-funny-xxx-adult-movies-porn-t-shirt
  momboob.info/enter2/index.php?url_ref=
@@ -46530,6 +46488,7 @@ mypixxseries.com/hardcore15
  mypixxseries.com/hardcore21
  myplace.to.be/dutchbabes
  mypleasuremaster.tumblr.com/post/94936917664/wowgirls-fat-cock-vs-horny
+mypornboutique.com/pirate-booty-
  mypornsnap.cc/photos/7/hindi-hd-sex-/reallifecam-voyeur-lesbian-orgasm-xxx-porn-adult-thumb-jpg
  mypornvx.blogspot.com/2016
  mypoutylips.com/how-to-masturbate-kinky-tips-men
@@ -46827,6 +46786,7 @@ myvidster.com/video/7339622
  myvidster.com/video/966685
  myvidster.com/w
  myvmarks.com/Directory/Users/newae/Adult
+mywakeyourpath.tumblr.com/post/156802828362/the-most-comprehensive-nsfw-ask-around
  mywarez.ru/allnews/ero/
  mywarez.ru/chastnoe_nu/
  mywarez.ru/ero/
@@ -46933,6 +46893,7 @@ naked-youth.searchmole.co.uk/search
  naked.la/touch
  nakedbastop.blogspot.com/2013
  nakedboyreading.tumblr.com/post/85679888205/hottest-young-gay-authors-kaleb-cove
+nakedboyzz.blogspot.com/search
  nakedbritishfemales.tumblr.com/post/103118530065/shag-a-british-slut-tonight-fuck-her-do-what-you
  nakedbritishfemales.tumblr.com/post/103145577789/shag-a-british-slut-tonight-fuck-her-do-what-you
  nakedbritishfemales.tumblr.com/post/103180476254/shag-a-british-slut-tonight-fuck-her-do-what-you
@@ -47088,6 +47049,7 @@ namur.kijiji.be/f-transexuelle-Rencontres-W0QQCatIdZ3QQKeywordZtransexuelle
  namur.kijiji.be/f-transexuelle-Rencontres-W0QQlangZfrQQisSearchFormZtrueQQCatIdZ3QQKeywordZtransexuelle
  namutland.com/adult
  nan.improveman.com/profiles
+nanaakosua-blog.tumblr.com/post/175285823724/bdsm-fetish-tortur-video-tgp
  nanachanchigusa.tumblr.com/post/101615903647/creamy-san-yurifairy-i-could-probably-take
  nanaimo.fr.craigslist.ca/cas
  nanasleep.awardspace.com/radioblog/sounds/SADS%20-%20Porno%20Sta.rbs
@@ -48391,6 +48353,7 @@ nums68.tumblr.com/post/120260925351
  nuncscio.tumblr.com/post/120461552101/pissandpits-drink-that-piss-fuck-yeah
  nunfamili.tumblr.com/post/132305913799/sexy-carolin-very-hot-blowjob-lisa-ann
  nunocancino30.tumblr.com/post/87003406081/sluty-anal-wife-do-you-like-the-way-my-pussy
+nunuporn.com/cat/amateur_doll_erica_deep_throat_job_and_fuck_pussy_ecstasy
  nunuporn.com/cat/exhibitionism_adult
  nunuporn.com/cat/extreme_nympho_school_girl_hentai
  nunuporn.com/cat/fat_girl_gets_ass_fucked
@@ -48402,6 +48365,7 @@ nunuporn.com/cat/taiwan_90s_x_rated_movie_2
  nunuporn.com/video/boy_femdom_lick_pussy_mistresses
  nunurape.blogspot.com/2011/02
  nuoga.eu/porn/celebrity-snuff-stories
+nurian2u.tumblr.com/likes
  nurse-tv.net/bn/join
  nursemania.com/unf
  nuru-massage.com/hg/27emy-Joey
@@ -48833,6 +48797,7 @@ once-ler-sexual-frustrations.tumblr.com/post/20984543631/give-me-a-fetish-and-il
  onceuponacollar.tumblr.com/masterlist
  onceuponaman.blogspot.com/2009/09
  onceuponatimeinthenight.tumblr.com/post/92042246474/bdsmbondage-lesbian-dominatrix-is-turned-her
+oncleistvan.blogspot.com/p
  ond.vein.hu/~buba/girls
  ondinedlove.tumblr.com/post/103231975221/quand-jy-mets-les-doigts
  ondira.de/telefonsex
@@ -50361,8 +50326,6 @@ pascasher.blogspot.com/2010
  pascuaifr.ifrance.com/archives
  paseosdelrio.com/rekha3113
  pashchan.tumblr.com/post/29991195558/hentai-that-draws-brown-girls-with-pink-nipples
-pasiongirl1.blogspot.com/2012
-pasiongirl1.blogspot.com/2012/03
  pass.notengodominio.com/nldic
  pass2000.com/cgi-bin
  passion-harley.net/t20009-un-clitoriscomme-les-cornichons-d-oliver
@@ -51474,7 +51437,6 @@ philnylon69.wix.com/home
  philosoph.su/page-31807
  philou1070.com/piwigo
  philthywookie.tumblr.com/post/78997894111/gangbangland-doublepenetrations-and-gangbangs
-phimxkhieudam.blogspot.com/2020/07
  phleking-repository.typepad.fr/sexyvideos
  phlog.net/entry/355652
  phlog.net/user/FlashingPublic
@@ -53799,6 +53761,7 @@ quedubon.net/video
  queek.nl/mmx
  queendom.com/polls/sexapoll
  queendom.com/sex-files
+queengialove.tumblr.com/following
  queengialove.tumblr.com/post/634536111995273216/justmine51-straight-male-anal-erotic
  queenjawjaw.com/photos/sevy/12
  queenluan.canalblog.com/archives/2005/05/12
@@ -56062,7 +56025,11 @@ redwap.online/videos/231267
  redwap.online/videos/312546/exhibitionist-asian-fucks-dildo-in-public
  redwap.online/videos/72521
  redwap.vip/porn
+redwap2.com/to/brunette-ponytail-throat-assfucked
+redwap2.com/to/lick-nipples-erection
  redwap2.com/to/mother-face-sitting-tog-boy
+redwap2.com/to/sadist-lesbians-kiss
+redwap2.com/to/stockings-impregnate
  redwap2.com/to/upskirt-clit
  reebatsie.com/Naturist.dir/
  reedglow.com/rants/wp-admin
@@ -57680,6 +57647,7 @@ scipiocaptions.blogspot.com/2016
  scissors-mag.com/un-fanzine-avec-des-chattes-des-boobs-et-la-team-du-scissors/
  scmga.drizzlprox.appspot.com/www.adult-sexe.com
  scmp.com/news/world/article/1848421/girls-who-stabbed-playmate-please-slender-man-must-stay-adult-court-judge
+scoobycub.tumblr.com/following/page/9
  scoop.it/t/bdsm-bondage-discipline-dominance-submission-sadism-masochism
  scoop.it/t/hot-erotic
  scoop.it/t/mistress-leyla-s-bdsm-blog
@@ -58037,7 +58005,6 @@ sell.com/c/18/5/adult-erotic
  sell.com/c/18/adult-erotic
  sellercentral.amazon.com/gp/help/external/G200339940
  sellercentre.ebay.co.uk/adults-only-policy
-selllondonproperty.blogspot.com/2014/04
  sellmeyourpantys.tumblr.com/post/133222104939/london-pussy-kayleigh-p-black-hustler-lingerie
  sem-group.net///neworleansallamericangirls.com
  semale.idleplay.net/free-shemales
@@ -58249,8 +58216,6 @@ sexe-adulte.blogspot.com/2012/10
  sexe-grosseins.com/actrice-porno/gianna-michaels
  sexe-hot-in-life.skyblog.com/includenbcomment.js
  sexe-lady.skyblog.com/includenbcomment.js
-sexe.photos/2015/09
-sexe.photos/2015/09/02/cunni-au-travers-dune-petite-culotte-sexy
  sexe.wearableimages.com/bondagexsexe-gratuitx
  sexe.wearableimages.com/fellationxsexe-gratuitx
  sexe.wearableimages.com/masturbationxsexe-gratuitx
@@ -58305,7 +58270,6 @@ sexotanga.com/xxx/
  sexoybdsmrelatos.blogspot.com/2012/04
  sexoymascositassensuales.tumblr.com/post/65499116918/very-hot-female-orgasm-free-porn-videos
  sexpertdiaries.tumblr.com/post/190401838731/dear-teenagers-and-young-adults-becoming-sexually
-sexpic.online/photo/nikki-benz
  sexpicsteenporn-blog.tumblr.com/page/3
  sexpo.com.sg/onlinestore
  sexpornmbokneanco-xxx.blogspot.com/2010
@@ -58406,7 +58370,6 @@ sexygirls-celebz.blogspot.com/2012/01
  sexygirlsinhyderabad.blogspot.com/2012/04
  sexygirlspics.net/sophie-dee-with-cum-on-
  sexygirlsxnxx.com/nudes-full-photos-of-indian-sexy-girls-shave-pic
-sexygissellebennett.blogspot.com/2020/12
  sexyhotpik.blogspot.com/2013/03
  sexyimg.com/18-years-old-teens-horny-xxx-hot-nude-image
  sexyimg.com/author
@@ -59467,6 +59430,7 @@ skaters-sneakers-slaves.tumblr.com/post/109122018930/gay-bdsm-world-horny-gay-bo
  skatetheplanet.com/Merchant2
  skdesign.nl/nkt
  skeenestq.tumblr.com/post/130650510963/hot-lesbo-call-girl
+skelesinners-r-us.tumblr.com/post/632735469831143424/smutfic-masterlist
  skem9.com/videos/browse/Tiffany_Towers
  skeptics.stackexchange.com/questions/15790/did-australia-ban-small-breasts-pornography
  sketchdiesel.tumblr.com/post/133974615981/consmiso-degr8r-take-note-perfect-fuck-toy
@@ -61316,6 +61280,7 @@ stuffedpanties.tumblr.com/page/75
  stuffmate.com/download/stripshow_screensaver
  stuffwelove.ivillage.com/beauty/pretty_panties
  stumbleupon.com/interest/babes
+stunninglatinawebcamsexy.blogspot.com/2013/06
  stuntbar.com/photos
  stuntrev.com/debbieevans
  stupidanonymous158.tumblr.com/post/138160399298/famewhoresxxx-emma-watson
@@ -62748,6 +62713,7 @@ teenlolymodel.tumblr.com/post/120144119635/video-teen-schoolgirl
  teenlolymodel.tumblr.com/post/120145441540/hot-fat-young-girls
  teenlolymodel.tumblr.com/post/120223893570/virgin-gothic-gallery-nude
  teenlolymodel.tumblr.com/post/120225054055/teen-white-grils-fucking
+teennudegirlspornhotnakedgirlsexpics.blogspot.com/2017/04
  teennudephoto.com/.com
  teenology101.seattlechildrens.org/parenting-a-gay-lesbian-or-bisexual-teen-part-1-finding-out
  teenporncollection-blog.tumblr.com/post/120810470809/free-live-young-girls-password
@@ -63775,6 +63741,7 @@ the-broad-side.com/questioning-rihanna-isnt-slut-shaming
  the-dark-craving.tumblr.com/following
  the-extreme-naturals.info/en6
  the-fans.com/adult
+the-fifth-horseman.tumblr.com/post/154444192542/cuffed
  the-holle.blogspot.com/2012/10
  the-hollow-prince.tumblr.com/post/117037223118/ive-been-injected-with-false-hope-so-many-fucking
  the-inspired-lesbian.com/post/121346454828/dont-lead-people-on-like-its-not-fucking-hard
@@ -68889,6 +68856,7 @@ vaysylver.blogspot.com/2011/12
  vbhotsex.blogspot.com/2019/07
  vbokepbule.blogspot.com/2019
  vbokepindi.blogspot.com/2019
+vbokeplesbi.blogspot.com/2019/07
  vbokepsma.blogspot.com/2019
  vbs.tv/blog/a-to-z-of-sexual-history-masturbation-prevention
  vbs.tv/blog/the-female-eunuch-s-knife-wound-blowjob-conception
@@ -68956,7 +68924,6 @@ venuscherie.tumblr.com/post/14116334734/clubporn-blonde-pain-slut-in-lesbian-bds
  venushayes.tumblr.com/post/626316282567999488/threw-a-filter-on-the-booty-and-calling-it-art
  venuszine.com/stories/diy_sexy
  veporn.space/video/18969
-vepornxxx.blogspot.com/2020/01
  ver.esmartdesign.com/janine-lindemulder/
  verai-marcel.tumblr.com/post/189584043697/okay-so-i-have-a-request-if-you-dont-mind-its
  verd458.org/pokemon-porn
@@ -69220,7 +69187,9 @@ video18.org/monika-unco-steve-holmes-amazing-pov-sluts-4
  video2ouf.com/category/video-sexy
  videoallsex.com/video
  videoallsex.com/video/159002
+videoallsex.com/video/237786
  videoamateur.top/category/cumshots
+videoamateur.top/category/softcore
  videoamateur.top/tag/367
  videoamateur.top/video/2915/sasha-video-amateur-tukif-grey-a-bu-tout-le-sperme-
  videoamateur.top/video/4791/filles-en-latex-porn-arab-amateur-toughon-ligot
@@ -69385,6 +69354,7 @@ videosexo.info/PinkBits
  videosgratisxxxjay.blogspot.com/2016/02
  videosindianxxx.com/pl/videos39165/couples-touch-with-erotic-purpose
  videosmaturefree.com/fr/videos99499/gangbang-my-wife
+videosnakedteens-blog-blog.tumblr.com/post/120065078788/hot-sweety-lesbian-teen-sex
  videosparadise.com/firsttime_anal/ariana_anal_028
  videosurf.com/jenna-jameson-15476
  videosurf.com/videos/Strip
@@ -69833,6 +69803,7 @@ voyeurweb.pro/id16951
  vozident.ifrance.com/redwine
  vphilosop.tumblr.com/post/121366133186/sex-video-23094
  vpm.de/titels/erotik
+vporn69.com/fr/video/Bent-over-quickie-with-my-husband-before-work/1202785
  vpornanime.blogspot.com/2019
  vporncam.blogspot.com/2019/07
  vpornjav.blogspot.com/2019/07
@@ -70392,6 +70363,7 @@ wattpad.com/502053008-motionless-in-white-imagines-smut-mistress-ryan
  wattpad.com/52945874-larry-stylinson-smut-cock-rings-and-rimmings
  wattpad.com/61498693-horny-girlfriend-
  wattpad.com/631440601-stony-one-shots-dirty-flirt-smut
+wattpad.com/639229284-30-days-of-smut-parts-0
  wattpad.com/675695146-life-sucks-a-rants-and-vents-book-exhibitionism
  wattpad.com/67917721-smut-book-horny-female-masturbation
  wattpad.com/69717676-kiss-me-luke-hemmings-5sos-one-direction-kiss-me
@@ -73241,7 +73213,6 @@ x-thumbz.com/x-x/zz37
  x.azjmp.com/2HjS7
  x.webring.com/t/Amateur-Exhibitionists
  x1.nxlinks.com/js/nx601.js
-x18watch.blogspot.com/2017/11
  x2009.canalblog.com/albums/choix_de_tenues
  x2see.com/porn4free005
  x2see.com/porn4free019
@@ -73580,6 +73551,7 @@ xnxx.tubekek.com/video-ja1bx95/appealing_three-some_fornication
  xnxx.tubekek.com/video-jjmsl65
  xnxx.tubekek.com/video-k09uzb0
  xnxx.tubekek.com/video-lsvd5ab
+xnxx.tubekek.com/video-lu3yn04/13/extreme_deepthroating_and_gagging_on_dildos
  xnxx.tubekek.com/video-nncf37c/4
  xnxx.tubekek.com/video-o99wxa1/shaved_small_dick_porn_ally_gay_teen_boy_prostitution_free_movies
  xnxx.tubekek.com/video-r49am68/young_american_brunette_on_adult_video_chat
@@ -73718,6 +73690,7 @@ xvideos.wapka.cc/video14999725
  xvideos.wapka.cc/video16023467
  xvideos.wapka.cc/video16583091
  xvideos.wapka.cc/video1661290/big_ass_jynx_maze
+xvideos.wapka.cc/video19692133/16
  xvideos.wapka.cc/video21942905
  xvideos.wapka.cc/video23091749
  xvideos.wapka.cc/video23299122
@@ -73859,7 +73832,6 @@ xxxanalmovies.net/category/group-sex
  xxxasianphotos.com/facial
  xxxasianphotos.com/orgy
  xxxasianphotos.com/shaved
-xxxassfree.blogspot.com/2010
  xxxauthorstories.blogspot.com/2013
  xxxbay.org/bdrips/814-penthouse-presents-hot-and-sexy-720p-
  xxxbay.org/bdrips/843-burlesque-cabaret-girls-3d-2011-
@@ -73882,6 +73854,7 @@ xxxdl.net/fr/video/stepmom-brandi-love-in-3some-with-madison-chandler
  xxxfree.watch/glory-hole-secrets-sera-ryder
  xxxfree.watch/lolly-ink-her-daughters-boyfriend
  xxxfree.watch/victoria-june-big-wet-interracial-tits-3-2-2
+xxxfreestream.blogspot.com/2014/01
  xxxftw666.tumblr.com/post/118425821925/biggangbanglover-group-fuck-photos-videos
  xxxfuckpornpictureenfreeama.blogspot.com/2009/08
  xxxfuckvideo.blogspot.com/2018
@@ -73933,6 +73906,7 @@ xxxvideou.blogspot.com/2020
  xxxwanted.com/fr/watch-hd/13242305
  xxxwomansexpichornywifefreenud.blogspot.com/2009/08
  xxxxjenniferdu76xxxx.skyrock.mobi/related_blogs
+xxxxmovies.xyz/xxx
  xxxxmpegfreepornnudefemaleph.blogspot.com/2009
  xxxxporn.mobi/xxx/108411/khalifa-alia-sex-neket
  xxxxsx.com/player
@@ -74366,6 +74340,7 @@ yuensang.com/donate
  yugiohalsace.forumpro.fr/t15-cosplay-hentai-videos-cosplay-naruto-hentai
  yuhuu.com/famosas/
  yui-japsissy.tumblr.com/following/page/3
+yui-japsissy.tumblr.com/following/page/4
  yujiechun.tumblr.com/post/119663402961/sissysexrodelte-ass-fuck-butt-fuck-cumshot
  yukikame.tumblr.com/post/58032714165/hentaimonogatari-jesuxxx-pussy-attack
  yukiremio.exblog.jp/1372758
diff --git a/blacklists/malware/domains b/blacklists/malware/domains

index c17477b86544c2827a8c8de6a62232531e01e7a2..ba60c9867551dbff64e4a6fecbd1f9e42fb3ebd8 100644 (file)
--- a/blacklists/malware/domains
+++ b/blacklists/malware/domains
@@ -190,6 +190,7 @@
  033lockedapple.com
  03418f6.netsolhost.com
  0345386.com
+03550e.com
  036469.xmfpj.cn
  0365online.com
  0371.0000r.com
@@ -294,6 +295,7 @@
  088betcup.com
  088celtabet.com
  088y93242x3ej57a16i9brvs75dhz6pwtqn0.xyz
+089105.duniyahaigol.com
  08buofa08.bankofamericaslpemr.com
  08c8caa7-2bce-4141-90d3-6da0a6b6bab6.htmlcomponentservice.com
  08group.tv
@@ -462,10 +464,12 @@
  1-pregnant-sex.com
  1-remont.com
  1.10.146.31
+1.10.147.48
  1.17110.com
  1.196.152.217
  1.20.227.220
  1.221.254.82
+1.222.140.251
  1.222.170.43
  1.222.176.232
  1.222.178.27
@@ -621,7 +625,7 @@
  100stuff.site
  101-carats.com
  101.0.81.153
-101.109.246.8
+101.108.135.252
  101.132.182.76
  101.132.43.162
  101.16.136.146
@@ -693,7 +697,6 @@
  103.110.36.195
  103.114.106.11
  103.12.161.194
-103.124.104.118
  103.124.106.203
  103.125.106.2
  103.125.191.123
@@ -718,7 +721,6 @@
  103.145.12.91
  103.145.13.24
  103.149.12.183
-103.149.12.54
  103.150.215.101
  103.150.215.115
  103.16.131.157
@@ -728,7 +730,6 @@
  103.197.134.18
  103.197.134.22
  103.198.96.24
-103.20.3.37
  103.201.134.34
  103.205.177.229
  103.207.37.184
@@ -742,10 +743,12 @@
  103.223.12.139
  103.223.12.156
  103.223.12.183
+103.223.13.135
  103.224.185.4
  103.229.73.17
  103.23.154.184
  103.235.164.110
+103.235.165.131
  103.236.155.89
  103.245.153.70
  103.245.48.197
@@ -779,7 +782,7 @@
  103.68.181.35
  103.70.130.26
  103.70.77.18
-103.72.169.131
+103.71.21.11
  103.73.152.24bin.sh
  103.73.35.38
  103.75.1.198
@@ -790,12 +793,11 @@
  103.82.145.110
  103.82.145.111
  103.82.146.154
+103.82.186.17
  103.82.98.151
  103.84.238.3
-103.84.240.130
  103.84.240.228
  103.84.241.94
-103.85.231.119
  103.89.88.39
  103.91.17.136
  103.91.210.187
@@ -811,6 +813,7 @@
  103.91.245.32
  103.91.245.3bin.sh
  103.91.245.45
+103.91.245.46
  103.91.245.49
  103.91.245.5
  103.91.245.54
@@ -819,6 +822,7 @@
  103.92.25.90
  103.92.25.95
  103.93.220.182
+103.96.49.185
  103.97.124.53
  103.99.207.151
  1030408.servicesndt1.club
@@ -938,14 +942,15 @@
  104.248.50.207
  104.248.53.72
  104.248.63.116
-104.248.95.30
  104.250.178.21
  104.250.191.110
  104.37.187.23
  104.41.52.218
  1041469-dot-n-e-w-me-ss-age-po-rt-al.wl.r.appspot.com
  104722155613106546.002.sh.cn
+105.157.195.53
  105.209.235.113
+105.225.99.144
  105.27.155.182
  105.29.64.133
  1051a2e8-48cf-4f98-988c-b1aa7ec7e290.htmlcomponentservice.com
@@ -1022,6 +1027,7 @@
  107.167.2.81
  107.170.24.125
  107.170.27.84
+107.172.134.48
  107.172.140.127
  107.172.142.122
  107.172.156.153
@@ -1053,7 +1059,6 @@
  107.173.219.103
  107.173.219.51
  107.173.222.153
-107.173.24.145
  107.173.251.100
  107.173.49.10
  107.173.51.246
@@ -1142,7 +1147,6 @@
  109.234.37.81
  109.234.38.35
  109.235.7.228
-109.238.14.57
  109.68.212.165
  109.74.5.95
  109.99.146.210
@@ -1191,6 +1195,7 @@
  110.154.224.184
  110.154.250.225
  110.155.167.245
+110.155.52.156
  110.155.54.100
  110.155.56.16
  110.155.57.6
@@ -1210,6 +1215,7 @@
  110.174.148.117
  110.177.12.230
  110.177.3.152
+110.178.42.31
  110.179.14.69
  110.179.30.218
  110.179.5.188
@@ -1221,6 +1227,7 @@
  110.18.194.234
  110.18.194.236
  110.182.107.42
+110.182.180.9
  110.182.62.68
  110.183.108.189
  110.187.229.182
@@ -1238,6 +1245,7 @@
  110.243.6.226
  110.244.48.104
  110.247.16.64
+110.248.171.169
  110.248.197.62
  110.248.224.19
  110.250.154.104
@@ -1250,6 +1258,7 @@
  110.255.144.241
  110.255.167.147
  110.255.95.62
+110.35.208.21
  110.35.221.15
  110.35.234.192
  110.35.235.57
@@ -1268,20 +1277,23 @@
  111.0.124.232
  111.118.117.93
  111.118.124.110
+111.118.124.223
  111.118.65.24
  111.118.88.61
  111.118.96.2
  111.119.233.65
  111.119.245.114
  111.162.100.28
+111.163.38.222
  111.163.50.120
-111.165.128.53
  111.165.242.26
  111.165.55.56
  111.165.9.204
  111.167.160.161
  111.167.41.47
+111.170.84.182
  111.170.85.31
+111.170.86.133
  111.172.164.104
  111.172.56.126
  111.176.182.149
@@ -1308,6 +1320,7 @@
  111.38.123.171
  111.38.123.184
  111.38.123.197
+111.38.123.200
  111.38.123.23
  111.38.25.106
  111.38.25.230
@@ -1414,12 +1427,16 @@
  112.111.108.184
  112.111.119.237
  112.111.162.131
+112.112.197.190
+112.117.113.42
  112.121.164.154
  112.122.58.155
  112.122.58.205
+112.122.62.224
  112.122.63.102
  112.123.109.120
  112.123.109.145
+112.123.109.156
  112.123.109.162
  112.123.109.196
  112.123.187.171
@@ -1433,8 +1450,6 @@
  112.132.144.66
  112.132.144.79
  112.132.147.165
-112.133.222.151
-112.160.194.8
  112.160.228.146bin.sh
  112.160.238.138
  112.162.153.65bin.sh
@@ -1443,7 +1458,6 @@
  112.164.225.19bin.sh
  112.164.25.228
  112.165.0.158
-112.167.165.139
  112.168.0.84bin.sh
  112.17.104.45
  112.17.106.99
@@ -1481,7 +1495,6 @@
  112.192.159.4
  112.199.76.44
  112.201.176.54
-112.214.127.42
  112.214.127.42bin.sh
  112.225.186.20
  112.225.204.1
@@ -1510,7 +1523,6 @@
  112.226.211.59
  112.226.211.59bin.sh
  112.226.227.146
-112.226.228.162
  112.226.4.182
  112.226.67.193
  112.226.71.247
@@ -1526,13 +1538,14 @@
  112.229.188.28
  112.229.199.19
  112.230.254.18
-112.230.78.96
+112.232.171.71
  112.233.61.230bin.sh
  112.233.88.214
  112.234.134.244
  112.234.16.252
  112.234.194.147
  112.234.218.202
+112.235.130.69
  112.235.188.86
  112.235.210.15
  112.235.234.75
@@ -1604,7 +1617,6 @@
  112.245.115.241
  112.245.12.89
  112.245.176.180
-112.245.216.129
  112.245.246.253
  112.245.51.48
  112.245.8.24
@@ -1621,8 +1633,10 @@
  112.247.191.118
  112.247.191.75bin.sh
  112.247.214.146
+112.247.237.46
  112.247.240.226
  112.247.43.29
+112.247.62.211
  112.247.80.248
  112.247.81.173
  112.247.82.122
@@ -1658,13 +1672,15 @@
  112.249.79.230
  112.249.82.57
  112.250.102.173
-112.250.57.99
  112.251.16.218
  112.251.17.5
  112.251.23.55
+112.252.136.84
+112.252.199.150
  112.252.213.72
  112.252.236.40
  112.252.239.103
+112.252.32.148
  112.252.74.188
  112.254.177.210
  112.254.180.220
@@ -1675,6 +1691,7 @@
  112.254.87.69
  112.254.94.5
  112.255.130.20
+112.255.144.103
  112.255.176.20
  112.255.181.247
  112.255.240.32
@@ -1895,7 +1912,6 @@
  112.30.4.68
  112.30.4.68bin.sh
  112.30.4.69
-112.30.4.70
  112.30.4.73
  112.30.4.78
  112.30.4.84
@@ -1927,7 +1943,9 @@
  112.80.238.37
  112.81.24.144
  112.81.43.67
+112.82.131.149
  112.82.136.18
+112.82.141.200
  112.82.142.161
  112.82.18.255
  112.82.198.79
@@ -1947,38 +1965,39 @@
  112.9.140.247
  112.93.29.211
  112.95.23.73
-112.95.82.233
  1121312.000webhostapp.com
  1123351-dot-n-e-w-me-ss-age-po-rt-al.wl.r.appspot.com
  112sarj.com
  113-365.net
-113.101.112.14
-113.102.130.149
  113.103.57.113
  113.104.216.15
  113.106.111.50
  113.11.254.216
-113.110.194.130
-113.110.203.96
+113.110.195.21
  113.116.150.197
+113.116.155.154
  113.116.195.15
-113.116.227.52
-113.116.244.96
+113.116.246.239
+113.116.47.149
  113.116.59.165
-113.116.89.184
-113.118.122.222
-113.118.132.105
-113.118.14.137
-113.118.85.0
+113.118.12.236
+113.118.123.184
+113.118.133.178
+113.118.14.121
+113.118.199.145
+113.118.85.160
+113.122.238.68
  113.125.21.66
  113.128.117.107
  113.130.68.58
  113.133.224.68
  113.134.240.218
  113.15.205.127
+113.15.55.61
  113.160.130.116
  113.161.148.81
  113.183.54.58
+113.186.94.178
  113.188.166.112
  113.190.254.245
  113.190.40.199
@@ -1990,29 +2009,27 @@
  113.195.164.110
  113.195.166.46
  113.195.207.146
+113.201.20.210
+113.201.25.214
  113.203.238.130
  113.205.51.241
  113.206.45.80
  113.221.13.204
  113.221.50.64
  113.224.11.112
-113.224.243.148
-113.224.248.132
  113.225.158.183
  113.225.24.233
  113.226.42.250
  113.227.35.229
  113.227.42.149bin.sh
-113.228.43.43
  113.229.129.178
  113.231.193.93
  113.231.211.131
-113.231.93.142
+113.231.248.174
  113.232.156.157
  113.233.126.12
  113.233.130.111
  113.235.116.209
-113.237.182.224
  113.238.90.87
  113.239.216.147
  113.240.184.183
@@ -2029,19 +2046,25 @@
  113.59.165.19
  113.61.204.205
  113.61.66.94
-113.75.81.35
+113.81.234.151
+113.81.234.231
  113.86.204.13
+113.87.195.155
+113.87.226.232
+113.87.250.207
  113.87.32.137
  113.87.32.93
-113.88.132.146
+113.88.240.217
  113.88.252.136
-113.88.37.112
  113.88.86.152
+113.89.42.211
  113.9.233.14
+113.9.241.101
  113.90.178.36
  113.90.210.187
  113.90.245.165
  113.93.224.56
+113.93.225.12
  113.96.154.17
  113.96.154.24
  113.96.154.26
@@ -2053,12 +2076,15 @@
  114-results-realestate-properties-in-your-city.estate
  114.108.47.171
  114.109.179.60
+114.111.242.3
  114.129.225.53
  114.129.225.72
  114.129.242.104
  114.179.127.48
  114.199.159.159
+114.199.204.37
  114.199.215.31
+114.218.189.85
  114.219.127.116
  114.219.18.147
  114.223.122.19
@@ -2158,12 +2184,12 @@
  114.234.167.0
  114.234.180.59
  114.234.19.216
-114.234.19.24
  114.234.192.49
  114.234.193.2
  114.234.195.112
  114.234.195.62
  114.234.195.71
+114.234.203.59
  114.234.32.233
  114.234.33.113
  114.234.33.224
@@ -2227,6 +2253,7 @@
  114.239.118.175
  114.239.124.14
  114.239.128.231
+114.239.134.18
  114.239.151.41
  114.239.160.225
  114.239.161.249
@@ -2259,13 +2286,11 @@
  114.239.95.60
  114.30.54.56
  114.30.55.54
-114.32.209.100
  114.79.141.126
  1147.org
  114oldest.com
  115.149.138.108
  115.150.58.227
-115.171.238.111
  115.171.238.92
  115.171.238.92bin.sh
  115.195.214.241
@@ -2276,9 +2301,11 @@
  115.201.42.185
  115.201.47.10
  115.202.237.182
+115.204.184.64
  115.206.40.187
  115.206.60.63
  115.207.199.11
+115.207.24.110
  115.207.9.109
  115.208.109.91
  115.208.117.143
@@ -2297,16 +2324,23 @@
  115.23.88.135
  115.230.23.133
  115.45.104.103
-115.48.162.0
+115.48.144.191
+115.48.161.117
+115.48.188.25
  115.48.199.253
  115.48.202.93
-115.48.203.10
-115.48.32.11
-115.48.36.222
+115.48.204.38
+115.48.213.216
+115.48.232.185
+115.48.233.170
  115.48.46.61
+115.48.5.20
+115.48.51.250
  115.48.52.233
+115.48.84.214
  115.48.84.228
-115.49.131.241
+115.49.100.124
+115.49.123.207
  115.49.203.24
  115.49.210.221
  115.49.215.114
@@ -2314,7 +2348,7 @@
  115.49.216.150
  115.49.227.139
  115.49.230.23
-115.49.28.142
+115.49.37.141
  115.49.37.204bin.sh
  115.49.72.68
  115.49.78.108
@@ -2322,52 +2356,60 @@
  115.49.97.20
  115.49.97.55
  115.50.0.131
-115.50.100.13
+115.50.1.14
  115.50.100.76
  115.50.121.50
  115.50.129.177
  115.50.158.179
-115.50.174.249
+115.50.171.172
+115.50.186.58
  115.50.187.9
  115.50.207.2
+115.50.207.225
+115.50.209.204
  115.50.219.28
+115.50.225.38
  115.50.225.91
+115.50.227.243
  115.50.228.130
-115.50.237.205
  115.50.247.130
-115.50.39.75
  115.50.42.108
-115.50.44.214
-115.50.47.41
  115.50.56.92
-115.50.59.43
  115.50.6.97
  115.50.65.81
+115.50.70.174
+115.50.71.216
+115.50.89.149
+115.51.105.66
+115.51.107.164
  115.51.110.122
  115.51.123.208
  115.51.16.188
-115.51.24.106
  115.51.47.80
  115.52.12.28
-115.52.158.253
+115.52.162.225
  115.52.224.53
  115.52.243.239
-115.52.57.206
+115.52.243.55
+115.52.57.100
+115.52.57.147
  115.52.58.160
-115.53.203.87
  115.53.233.125
  115.53.252.39
+115.53.58.24
  115.54.129.10
  115.54.135.41
  115.54.144.188
  115.54.183.113
-115.54.204.247
+115.54.212.22
  115.54.214.163
+115.54.214.54
  115.54.231.23
+115.54.236.34
  115.54.237.36
  115.54.238.140
-115.54.8.240
-115.55.123.240
+115.54.241.230
+115.54.242.164
  115.55.130.195
  115.55.130.55
  115.55.131.30
@@ -2381,6 +2423,8 @@
  115.55.150.245
  115.55.153.83
  115.55.154.201
+115.55.155.233
+115.55.155.7
  115.55.156.206
  115.55.157.2
  115.55.158.52bin.sh
@@ -2388,7 +2432,11 @@
  115.55.159.76
  115.55.161.184
  115.55.177.178
+115.55.179.160
+115.55.190.221
+115.55.190.254
  115.55.202.175
+115.55.206.62
  115.55.208.186
  115.55.209.215
  115.55.210.220
@@ -2398,108 +2446,117 @@
  115.55.49.136
  115.55.56.215
  115.55.74.1
+115.55.78.232
+115.55.88.123
  115.55.90.41
  115.55.91.123
  115.56.113.106
  115.56.113.61
  115.56.114.233
  115.56.117.65
-115.56.119.86
  115.56.128.237
  115.56.128.34
  115.56.129.141
-115.56.129.240
  115.56.130.52
  115.56.130.85
  115.56.131.72
  115.56.132.235
+115.56.133.228
+115.56.133.41
+115.56.133.60
  115.56.133.96
  115.56.134.220
  115.56.135.103bin.sh
  115.56.135.247
-115.56.136.141
  115.56.137.47
  115.56.137.66
+115.56.138.129
  115.56.139.122
  115.56.139.66
+115.56.140.115
  115.56.140.131
+115.56.140.144
  115.56.140.64
  115.56.141.45
  115.56.143.125
  115.56.143.13
-115.56.143.82
  115.56.146.213
  115.56.147.73
+115.56.152.107
  115.56.153.210bin.sh
-115.56.155.169
  115.56.159.32
  115.56.161.84
+115.56.169.38
  115.56.181.237
  115.56.182.87
  115.56.186.161
  115.56.189.174
-115.56.189.234
  115.56.24.68
  115.56.3.209
  115.58.111.80
-115.58.132.219
  115.58.132.230
  115.58.132.6
  115.58.133.121
  115.58.134.214
  115.58.135.221
  115.58.141.145
-115.58.168.14
+115.58.142.91
  115.58.2.34
  115.58.209.70
  115.58.21.134
  115.58.210.60
-115.58.3.181
  115.58.49.26
+115.58.8.208
  115.58.80.30
+115.58.84.53
  115.59.101.26
+115.59.156.236
  115.59.199.35
  115.59.202.191
+115.59.214.171
+115.59.214.230
  115.59.230.64
  115.59.230.79
-115.59.232.138
-115.59.233.129
-115.59.254.13
  115.59.255.40
-115.59.33.191
-115.59.61.91
-115.59.75.122
  115.59.76.195
  115.59.82.114
  115.60.201.21
+115.60.202.123
  115.60.202.41
  115.61.10.132
  115.61.100.253
  115.61.102.167
+115.61.112.88
+115.61.113.41
  115.61.115.240
-115.61.118.160
  115.61.118.62
+115.61.119.197
  115.61.119.222
-115.61.119.93
  115.61.121.109
  115.61.137.57
  115.61.144.220
-115.61.177.185
-115.61.180.105
+115.61.166.186
  115.61.182.209
-115.61.97.225
+115.61.183.82
+115.61.185.93
  115.61.98.191
+115.61.99.154
  115.61.99.73
  115.62.134.206
  115.62.144.135
-115.62.144.30
+115.62.148.210
+115.62.9.70
  115.63.131.0
  115.63.131.27
+115.63.139.113
  115.63.139.114
  115.63.186.148
  115.63.189.176
  115.63.19.124
-115.63.54.145
+115.63.19.51
+115.63.29.212
+115.63.36.25
+115.63.36.98
  115.69.106.48
  115.69.120.90
  115.73.3.11
@@ -2507,6 +2564,10 @@
  115.92.174.231
  115.94.207.99
  115.96.135.5
+115.97.138.217
+115.97.138.247
+115.97.139.254
+115.97.141.133
  115.97.31.199
  115.97.83.137
  115.98.0.71
@@ -2595,7 +2656,6 @@
  116.179.139.142
  116.179.149.121
  116.179.149.214
-116.2.246.247
  116.2.64.96
  116.202.10.123
  116.203.117.76
@@ -2605,23 +2665,31 @@
  116.233.87.190
  116.237.46.75
  116.24.100.167
+116.24.34.131
+116.25.133.84
  116.26.113.138
  116.26.114.6
-116.30.196.237
-116.30.221.152
-116.72.52.65
+116.72.46.170
+116.72.95.230
  116.73.66.179
-116.74.127.43
  116.74.17.255
+116.74.18.111
  116.75.103.58
  116.75.117.40bin.sh
-116.75.194.152
+116.75.194.204
+116.75.194.25
+116.75.195.135
+116.75.212.155
+116.75.213.54
+116.75.214.245
+116.75.242.192
+116.76.121.243
  116.90.59.223
  116.91.240.96
  116151147136715.002.sh.cn
  1164e4989ededf518a4.yolasite.com
  1169732-dot-phonic-obelisk-274214.uk.r.appspot.com
-117.12.210.235
+117.11.3.206
  117.123.171.105
  117.14.20.21
  117.14.20.221
@@ -2629,14 +2697,27 @@
  117.14.96.183
  117.149.10.58
  117.149.20.18
-117.192.226.40
-117.192.226.46
-117.194.148.236
-117.194.161.80
-117.194.163.46
-117.194.166.73
-117.196.50.35
-117.196.51.61
+117.192.226.179
+117.192.226.29
+117.192.227.163
+117.192.227.198
+117.192.227.55
+117.192.227.88
+117.194.148.109
+117.194.150.150
+117.194.151.241
+117.194.162.129
+117.194.163.150
+117.194.166.190
+117.194.166.246
+117.194.166.94
+117.194.167.225
+117.194.167.91
+117.196.48.113
+117.196.49.70
+117.196.50.138
+117.196.51.116
+117.196.51.98
  117.2.139.117
  117.20.192.45
  117.20.202.61
@@ -2644,56 +2725,74 @@
  117.20.230.39
  117.20.236.14
  117.200.76.60
-117.202.64.188
-117.202.65.19
-117.202.65.21
-117.202.67.114
-117.202.68.219
-117.202.69.249
-117.202.70.76
+117.202.66.108
+117.202.66.119
+117.202.66.13
+117.202.66.194
+117.202.67.255
+117.202.68.102
+117.202.68.20
+117.202.70.212
  117.206.159.20
-117.210.150.204
-117.213.40.146
-117.213.42.129
-117.213.45.200
-117.213.45.51
-117.213.46.72
-117.213.47.220
-117.215.214.144
-117.215.249.170
-117.215.251.133
-117.215.251.176
-117.222.161.255
-117.222.162.138
-117.222.163.13
-117.222.165.113
-117.222.167.239
-117.222.168.233
-117.222.170.173
-117.222.174.27
-117.241.64.69
-117.242.209.186
-117.242.211.179
-117.242.221.56
-117.242.223.102
-117.247.121.14
-117.247.201.36
-117.247.201.40
-117.247.202.251
-117.247.202.70
-117.247.203.244
-117.247.205.226
-117.247.206.228
-117.247.206.96
-117.248.62.238
-117.248.63.20
+117.208.132.94
+117.211.61.161
+117.213.12.158
+117.213.40.48
+117.213.40.94
+117.213.41.189
+117.213.42.160
+117.213.45.131
+117.213.46.11
+117.213.47.173
+117.213.47.174
+117.215.209.141
+117.215.209.28
+117.215.209.6
+117.215.211.14
+117.215.215.12
+117.215.215.51
+117.215.251.132
+117.220.61.4
+117.222.160.194
+117.222.161.41
+117.222.165.97
+117.222.166.93
+117.222.168.170
+117.222.169.114
+117.222.169.127
+117.222.169.185
+117.222.171.47
+117.222.171.94
+117.222.175.160
+117.222.175.178
+117.222.175.51
+117.241.65.159
+117.241.67.119
+117.242.208.211
+117.242.209.145
+117.242.210.107
+117.242.210.49
+117.242.211.34
+117.242.211.42
+117.242.221.85
+117.242.49.185
+117.247.120.240
+117.247.201.142
+117.247.202.186
+117.247.202.82
+117.247.204.49
+117.247.204.66
+117.247.205.247
+117.247.207.131
+117.247.207.222
+117.248.60.251
+117.248.62.197
+117.251.56.226
  117.251.57.236
-117.251.58.247
-117.251.61.19
-117.26.179.26
+117.251.57.59
+117.251.58.185
  117.26.235.164
  117.26.88.52
-117.33.23.8
  117.58.240.177
  117.60.204.195
  117.60.239.70
@@ -2705,6 +2804,7 @@
  117.63.158.101
  117.63.159.220
  117.63.168.148
+117.63.195.140
  117.63.195.151
  117.63.195.220
  117.63.223.200
@@ -2748,7 +2848,6 @@
  117.90.21.59
  117.90.254.53
  117.90.75.236
-117.90.78.120
  117.90.89.195
  117.90.89.95
  117.90.94.211
@@ -2794,8 +2893,10 @@
  118.110.236.121
  118.120.145.eliterv.ca
  118.163.97.19
+118.172.113.244
  118.172.135.51
  118.172.97.120
+118.174.60.55
  118.176.102.53bin.sh
  118.176.104.35
  118.176.157.64
@@ -2853,7 +2954,6 @@
  118.75.119.214
  118.75.184.240
  118.75.190.221
-118.75.34.108
  118.75.46.196
  118.75.48.151
  118.75.60.179
@@ -2868,15 +2968,15 @@
  118.79.146.212
  118.79.160.101
  118.79.167.240
-118.79.225.30
  118.79.226.198
  118.79.237.9
  118.79.238.200
  118.79.4.250
-118.79.57.61
+118.79.50.203
  118.79.58.128
  118.79.74.237
  118.79.75.183
+118.79.80.31
  118.79.85.231
  118.79.86.13
  118.83.154.64
@@ -2888,16 +2988,16 @@
  118fk.net
  119-18-62-120.cprapid.com
  119.102.153.184
-119.108.4.86
+119.108.251.176
  119.109.126.138
  119.109.34.245
-119.112.115.229
-119.112.214.57
-119.119.160.132
+119.122.214.7
  119.123.217.94
  119.123.223.37
+119.123.238.253
  119.123.244.77
  119.125.129.86
+119.130.240.81
  119.134.3.164
  119.159.150.176
  119.162.109.111
@@ -2954,9 +3054,9 @@
  119.178.249.140
  119.179.119.79
  119.179.150.233
+119.179.157.219
  119.179.165.18
  119.179.18.206
-119.179.225.96
  119.179.27.213
  119.179.61.78
  119.180.101.151
@@ -2969,6 +3069,7 @@
  119.180.32.217
  119.180.80.69
  119.180.94.223
+119.180.94.80
  119.181.43.224
  119.181.54.70
  119.182.60.251
@@ -2990,7 +3091,7 @@
  119.185.149.74
  119.185.153.86
  119.185.155.1
-119.185.233.88
+119.185.39.240
  119.185.43.193
  119.186.15.123
  119.186.18.67
@@ -2998,6 +3099,7 @@
  119.187.129.48
  119.187.232.125
  119.187.232.20
+119.187.234.68
  119.187.235.1
  119.187.235.23
  119.187.239.228
@@ -3036,7 +3138,6 @@
  119.197.143.204
  119.197.175.60
  119.197.176.241
-119.197.196.63
  119.198.87.162
  119.199.155.17bin.sh
  119.201.68.12
@@ -3066,6 +3167,8 @@
  119.56.153.16
  119.56.155.57
  119.56.172.28
+119.56.173.57
+119.56.175.41
  119.56.195.122
  119.56.196.92
  119.56.199.35
@@ -3104,6 +3207,8 @@
  120.12.149.242
  120.12.153.54
  120.12.223.59
+120.12.233.95
+120.138.4.37
  120.142.173.160
  120.142.222.22
  120.150.218.241
@@ -3150,13 +3255,11 @@
  120.193.91.214bin.sh
  120.193.91.215
  120.193.91.233
-120.193.93.227
  120.196.182.41
  120.196.182.41bin.sh
  120.199.0.43
  120.209.121.243
  120.209.126.206
-120.209.126.214
  120.209.126.225
  120.209.126.228
  120.209.126.228bin.sh
@@ -3187,9 +3290,11 @@
  120.51.34.254
  120.52.120.11
  120.56.119.118
+120.57.100.133
  120.57.33.11
  120.57.96.224
  120.59.16.52
+120.6.141.142
  120.6.151.191
  120.6.186.201
  120.6.191.231
@@ -3198,6 +3303,7 @@
  120.6.4.196
  120.6.4.64
  120.6.4.96
+120.6.8.11
  120.63.136.58
  120.68.2.66
  120.68.238.139
@@ -3207,16 +3313,20 @@
  120.69.6.8
  120.69.88.106
  120.69.89.50
-120.7.156.112
  120.7.192.80
  120.79.106.130
  120.79.151.95
  120.8.111.160
-120.83.78.179
-120.85.167.99
-120.85.175.152
-120.85.175.198
-120.85.196.196
+120.85.166.199
+120.85.166.48
+120.85.168.125
+120.85.169.249
+120.85.172.10
+120.85.174.205
+120.85.185.249
+120.85.196.23
+120.85.198.70
+120.85.208.236
  120.9.32.51
  120.97.20.106
  120.dodadubose.com
@@ -3300,6 +3410,7 @@
  121.231.101.240
  121.231.101.42
  121.231.102.55
+121.231.103.95
  121.231.164.108
  121.231.83.134
  121.232.179.201
@@ -3341,12 +3452,14 @@
  121.34.150.176
  121.46.4.194
  121.6.197.130
+121.61.102.1
  121.61.106.104
  121.61.111.145
  121.61.111.198
  121.61.217.18
  121.61.65.135
  121.61.67.219
+121.61.70.61
  121.61.78.91
  121.61.79.32
  121.61.96.55
@@ -3359,10 +3472,10 @@
  122.117.44.59
  122.155.223.20
  122.160.112.27
-122.178.139.150
+122.165.203.216
  122.180.254.6
+122.188.220.98
  122.191.189.91
-122.191.25.174
  122.193.144.109
  122.194.192.247
  122.194.44.48
@@ -3379,8 +3492,6 @@
  122.230.247.14
  122.230.70.119
  122.231.47.237
-122.232.229.151
-122.234.132.221
  122.234.77.121
  122.236.122.244
  122.236.192.162
@@ -3398,30 +3509,31 @@
  122uc.com
  123.10.129.234
  123.10.130.193
+123.10.134.230
+123.10.140.93
  123.10.153.139
  123.10.157.219
  123.10.159.123
  123.10.160.80
  123.10.165.76
-123.10.171.116
  123.10.179.118
+123.10.199.131
  123.10.2.38
-123.10.210.130
  123.10.210.180
  123.10.213.244
-123.10.23.232
  123.10.28.162
-123.10.32.195
+123.10.35.47
  123.10.39.12
-123.10.41.13
  123.10.52.160
  123.108.189.102
  123.11.13.233
-123.11.13.236
+123.11.175.190
+123.11.181.223
  123.11.193.137
  123.11.195.214
  123.11.235.95
  123.11.4.81
+123.11.53.41
  123.11.73.104
  123.11.78.119
  123.11.78.153
@@ -3431,23 +3543,24 @@
  123.11.9.175
  123.116.223.45
  123.118.176.61
+123.12.11.43
  123.12.181.91
  123.12.185.183
  123.12.196.134
  123.12.197.46
-123.12.21.221
  123.12.221.108
  123.12.229.211
  123.12.231.175
  123.12.233.247
-123.12.235.11
  123.12.242.66
  123.12.243.129
  123.12.65.254
+123.12.8.125
  123.122.119.82
  123.122.232.190
  123.128.128.205
  123.128.136.48
+123.128.153.75
  123.128.168.94
  123.128.180.98
  123.128.221.216
@@ -3464,17 +3577,17 @@
  123.129.93.210
  123.13.120.172
  123.13.14.133
-123.13.156.183
+123.13.164.68
  123.13.182.16
  123.13.22.7
  123.13.27.197
-123.13.33.57
  123.130.0.231
  123.130.142.128
  123.130.166.249
  123.130.169.45
  123.130.178.94
  123.130.19.225
+123.130.208.52
  123.130.216.147
  123.130.23.110
  123.130.236.87
@@ -3507,9 +3620,8 @@
  123.14.160.168
  123.14.199.130
  123.14.205.97
-123.14.235.223
+123.14.236.2
  123.14.75.251
-123.14.80.122
  123.14.91.198
  123.145.69.81
  123.146.114.40
@@ -3529,13 +3641,14 @@
  123.159.167.254
  123.159.70.163
  123.159.8.100
+123.162.60.226
  123.164.108.177
  123.170.221.178
  123.176.25.234
  123.180.140.101
  123.181.235.123
  123.183.121.211
-123.183.18.37
+123.191.150.147
  123.191.17.125
  123.192.101.163bin.sh
  123.192.194.233
@@ -3546,7 +3659,7 @@
  123.233.130.162
  123.233.152.249
  123.233.185.116
-123.234.116.110
+123.234.100.219
  123.234.124.66
  123.234.124.66bin.sh
  123.234.191.51
@@ -3554,6 +3667,7 @@
  123.234.250.15
  123.234.45.126
  123.235.120.142
+123.235.172.37
  123.235.173.94
  123.235.176.55
  123.235.191.87
@@ -3562,46 +3676,49 @@
  123.235.247.118
  123.235.254.223
  123.241.140.20
-123.245.11.67
  123.27.44.219
+123.4.11.13
  123.4.249.127
  123.4.54.219
  123.4.69.229
  123.4.81.155
  123.4.83.114
  123.4.85.69
-123.4.85.92
  123.4.87.146
  123.4.89.200
-123.4.90.83
+123.4.91.111
  123.4.91.169
  123.4.92.153
-123.4.92.163
  123.4.92.227
  123.5.137.3
-123.5.137.99
-123.5.140.241
+123.5.14.219
+123.5.153.227
+123.5.157.86
+123.5.158.181
  123.5.186.219
-123.5.190.76
+123.5.187.151
+123.5.187.47
+123.5.188.73
  123.5.20.118
  123.51.152.54
  123.7.101.135
  123.7.40.32
-123.8.173.135
+123.8.157.153
  123.8.189.177
  123.8.189.208
  123.8.190.0
  123.8.190.236
  123.8.247.204
  123.8.49.26
-123.8.69.159
-123.8.71.137
+123.8.89.33
  123.9.111.220
  123.9.177.30
  123.9.181.216
+123.9.203.238
  123.9.204.224
  123.9.218.102
-123.9.235.239
+123.9.241.47
+123.9.69.69
  123.97.154.113
  123.ltscr.cn
  123123123112312323.000webhostapp.com
@@ -3667,7 +3784,7 @@
  124.131.152.148
  124.131.172.65
  124.131.239.254
-124.131.26.78
+124.131.37.215
  124.131.51.163
  124.131.54.33
  124.133.243.109
@@ -3681,14 +3798,13 @@
  124.153.136.175
  124.156.218.50
  124.160.126.238
-124.163.102.147
  124.163.131.196
  124.163.138.104
  124.163.144.140
-124.163.161.195
  124.163.167.101
  124.163.186.144
  124.163.65.64
+124.163.66.249
  124.163.72.102
  124.163.96.71
  124.227.115.39
@@ -3696,6 +3812,7 @@
  124.230.175.141
  124.230.175.167
  124.230.175.209
+124.234.2.84
  124.240.198.66
  124.29.200.46
  124.45.106.173
@@ -3733,7 +3850,8 @@
  125.104.231.209
  125.104.252.53
  125.105.229.106
-125.106.96.215
+125.106.108.248
+125.106.197.244
  125.120.149.124
  125.120.237.87
  125.125.116.242
@@ -3754,12 +3872,13 @@
  125.206.38.159bin.sh
  125.253.126.158
  125.26.165.244
+125.36.197.222
  125.36.208.161
  125.40.1.127
  125.40.113.66
  125.40.113.83
  125.40.114.24
-125.40.146.198
+125.40.131.213
  125.40.30.20
  125.40.73.220
  125.40.73.6
@@ -3767,91 +3886,113 @@
  125.40.75.47
  125.40.91.15
  125.41.1.44
-125.41.108.43
  125.41.109.123
-125.41.118.72
+125.41.114.61
  125.41.13.34
-125.41.148.174
+125.41.14.3
+125.41.141.195
  125.41.163.114
-125.41.165.220
+125.41.186.178
  125.41.187.117
  125.41.191.200
-125.41.201.218
  125.41.203.199
+125.41.204.126
  125.41.204.217
  125.41.205.24bin.sh
-125.41.206.45
  125.41.215.56
  125.41.229.32
  125.41.231.211
+125.41.242.99
  125.41.5.235
-125.41.73.98
+125.41.75.166
  125.41.77.82
  125.41.80.120
+125.41.96.188
+125.41.96.215
+125.41.96.232
+125.41.96.247
  125.41.97.114
-125.42.107.31
+125.42.112.246
  125.42.121.170
  125.42.121.67
+125.42.123.223
  125.42.15.166
  125.42.192.48
  125.42.196.157
-125.42.228.139
+125.42.236.56
+125.42.239.134
  125.42.239.99
  125.42.42.75
  125.42.90.144
+125.42.96.154
  125.43.0.178
+125.43.106.93
  125.43.112.158
  125.43.113.1
-125.43.212.186
+125.43.140.154
+125.43.183.144
+125.43.25.169
+125.43.35.84
  125.43.36.189
-125.43.39.105
+125.43.40.215
+125.43.48.143
  125.43.50.22
+125.43.57.185
+125.43.67.244
+125.43.93.182
  125.43.93.226
  125.43.95.253
  125.44.144.6
  125.44.194.40
  125.44.198.105
  125.44.211.35
-125.44.215.36
  125.44.220.127
  125.44.231.212
+125.44.247.121
+125.44.254.205
+125.44.30.105
+125.44.37.229
+125.44.39.224
+125.44.57.61
  125.44.70.5
  125.44.8.248
  125.44.9.206
-125.45.103.13
+125.45.147.165
  125.45.179.132
  125.45.186.236bin.sh
-125.45.186.34
  125.45.25.13
-125.45.49.229
  125.45.54.137
  125.45.66.186
  125.45.67.112bin.sh
  125.45.77.161
  125.45.78.176
  125.45.79.125
-125.45.90.70
  125.46.135.79
  125.46.139.57
+125.46.139.84
+125.46.141.145
+125.46.161.251
  125.46.163.117
  125.46.182.87
  125.46.184.81
  125.46.197.183
  125.46.197.224
-125.46.202.8
-125.47.12.119
-125.47.202.42
+125.46.197.54
+125.46.218.16
  125.47.204.174
+125.47.206.86
  125.47.211.71
-125.47.212.143
  125.47.226.219
+125.47.243.118
  125.47.245.184
  125.47.246.4
+125.47.248.135
  125.47.251.14
+125.47.51.37
  125.47.55.90
-125.47.62.172
  125.47.65.10
  125.47.65.136
+125.47.73.185
  125.47.74.248
  125.47.85.43
  125.47.86.103
@@ -3859,7 +4000,6 @@
  125.47.91.51
  125.66.106.2
  125.84.217.97
-125.89.5.192
  125.99.147.56
  125.99.60.171
  125.99.61.162
@@ -3869,7 +4009,6 @@
  126f7b50-bfe6-4649-a622-42cb62c2a8d5.htmlcomponentservice.com
  126mailbox-verification.duckdns.org
  1272125-dot-n-e-w-me-ss-age-po-rt-al.wl.r.appspot.com
-1273.miwork.ru
  12774.psdzy.com
  128.14.16.156
  128.14.16.233
@@ -4038,7 +4177,6 @@
  139.170.180.147
  139.170.180.78
  139.170.231.168
-139.170.238.124
  139.180.193.222
  139.227.46.137
  139.47.135.215
@@ -4092,8 +4230,10 @@
  14.138.139.91bin.sh
  14.139.242.254
  14.141.175.107
+14.155.19.233
  14.160.93.230
  14.169.164.77
+14.180.80.168
  14.186.114.55
  14.189.247.118
  14.200.197.130
@@ -4123,6 +4263,7 @@
  14.46.12.180bin.sh
  14.46.190.42bin.sh
  14.46.230.78
+14.46.25.17
  14.46.98.241
  14.51.6.13
  14.51.6.13bin.sh
@@ -4222,6 +4363,7 @@
  143.92.61.230
  143.95.101.72
  143.95.156.174
+144.126.222.195
  144.139.158.155
  144.139.228.113
  144.139.247.220
@@ -4268,6 +4410,7 @@
  146.255.96.214
  146.71.78.159
  146.71.79.230
+146441.duniyahaigol.com
  1469-squid.com
  147.135.173.238
  147.135.76.206
@@ -4283,6 +4426,7 @@
  148.72.215.181
  148117-dot-n-e-w-me-ss-age-po-rt-al.wl.r.appspot.com
  149.129.101.217
+149.20.176.179
  149.202.110.47
  149.202.29.73
  149.202.72.142
@@ -4322,7 +4466,6 @@
  150.129.182.164
  150.136.137.192
  150.136.14.224
-150.136.142.196
  150.242.254.51
  150.246.246.238
  150.255.220.3
@@ -4347,6 +4490,7 @@
  151.236.38.234
  151.236.60.57
  151.237.36.220
+151.51.144.2
  151.73.124.231
  151.80.142.33
  151.80.194.190
@@ -4408,7 +4552,6 @@
  154.91.2.187
  155.138.160.156
  155.138.160.98
-155.138.208.81
  155.138.217.118
  155.138.222.174
  155.138.234.174
@@ -4452,6 +4595,7 @@
  157.230.151.23
  157.230.221.198
  157.231.110.14
+157.231.61.93
  157.245.103.90
  157.245.127.232
  157.245.145.87
@@ -4468,7 +4612,6 @@
  157.245.99.39
  157.55.188.111
  157.7.164.178
-157.90.160.5
  157.97.2.215
  15705924073.mer.lstest.siquality.com
  1572599.com
@@ -4581,6 +4724,7 @@
  162.144.91.33
  162.191.165.238
  162.191.205.175
+162.191.52.85
  162.209.98.174
  162.212.112.139
  162.212.112.175
@@ -4669,15 +4813,25 @@
  162266.bibigor.com
  162783-dot-n-e-w-me-ss-age-po-rt-al.wl.r.appspot.com
  162840-dot-n-e-w-me-ss-age-po-rt-al.wl.r.appspot.com
-163.125.192.112
+163.125.149.158
+163.125.185.141
+163.125.186.15
+163.125.194.101
+163.125.194.194
  163.125.194.72
  163.125.195.27
-163.125.201.15
+163.125.195.64
+163.125.200.209
+163.125.200.51
+163.125.202.15
  163.125.202.198
-163.125.206.151
-163.125.218.85
+163.125.205.17
+163.125.207.29
+163.125.247.162
  163.125.251.214
-163.125.83.77
+163.125.34.24
+163.125.38.226
+163.125.98.117
  163.13.182.105
  163.171.130.78
  163.171.132.59
@@ -4810,7 +4964,6 @@
  167.99.39.134
  167.99.52.152
  167.99.72.149
-168.235.109.125
  168.235.67.138
  168.235.83.139
  168.62.175.22
@@ -4846,6 +4999,7 @@
  171.104.126.183
  171.111.183.16
  171.112.45.160
+171.113.38.126
  171.113.40.47
  171.118.24.229
  171.119.200.106
@@ -4858,9 +5012,8 @@
  171.123.120.177
  171.123.15.218
  171.123.180.122
-171.123.238.153
  171.125.10.183
-171.125.194.206
+171.125.114.254
  171.125.195.122
  171.125.50.166
  171.125.75.68
@@ -4868,16 +5021,15 @@
  171.125.92.12
  171.22.24.185
  171.232.108.91
+171.34.112.42
  171.34.113.168
  171.34.178.93
  171.34.179.113
  171.34.179.178
  171.35.161.234
+171.35.166.20
  171.35.170.35
-171.35.173.163
  171.35.174.198
-171.36.46.136
-171.37.31.181
  171.38.146.138
  171.38.146.81
  171.38.149.155
@@ -4886,6 +5038,7 @@
  171.41.198.93
  171.42.161.164bin.sh
  171.81.109.43
+171.96.192.200
  171298-dot-n-e-w-me-ss-age-po-rt-al.wl.r.appspot.com
  1717jackwills.000webhostapp.com
  172.104.169.32
@@ -4960,6 +5113,7 @@
  173.232.146.105
  173.232.146.141
  173.232.146.53
+173.247.138.159
  173.247.239.186
  173.249.55.108
  173.254.242.215
@@ -5005,6 +5159,7 @@
  173.91.11.142
  173.94.215.84
  17347.dojnh.com
+173msn.com
  173nvrenw.com
  174-365.net
  174.100.27.229
@@ -5053,6 +5208,8 @@
  174.139.46.91
  174.139.46.97
  174.45.13.118
+174.61.3.149
+174.61.52.27
  174.70.100.90
  174.81.78.7
  175-365.net
@@ -5061,10 +5218,10 @@
  175.10.145.138
  175.10.147.167
  175.103.38.146
+175.107.19.227
  175.107.206.134
  175.11.192.170
  175.11.192.189
-175.11.192.25
  175.11.193.10
  175.11.194.56
  175.11.195.108
@@ -5074,10 +5231,12 @@
  175.117.66.74
  175.145.200.216
  175.147.21.193
+175.153.144.2
  175.161.179.213
  175.162.75.160
  175.163.72.39
  175.168.56.103
+175.174.150.97
  175.176.223.133
  175.182.225.244
  175.193.2.152
@@ -5085,7 +5244,6 @@
  175.194.54.93
  175.199.229.203
  175.199.229.203bin.sh
-175.200.88.231
  175.201.104.192
  175.201.64.37
  175.206.182.103
@@ -5105,10 +5263,11 @@
  175.9.24.110
  1758681625.rsc.cdn77.org
  176.107.183.52
+176.111.174.35
  176.111.174.63
  176.111.174.66
  176.111.174.72
-176.111.215.235
+176.111.211.170
  176.111.60.55
  176.113.161.101
  176.113.161.104
@@ -5189,6 +5348,7 @@
  176.123.9.100
  176.123.9.171
  176.123.9.32
+176.124.5.51
  176.221.188.104
  176.221.188.195
  176.221.188.29
@@ -5222,16 +5382,19 @@
  177.103.159.44
  177.103.240.93
  177.125.72.96
+177.125.78.170
  177.128.35.51
  177.130.51.198
  177.131.226.235
  177.144.130.105
  177.144.135.2
  177.188.121.26
+177.197.206.182
  177.200.94.150
  177.226.25.78
  177.229.64.218
  177.23.7.151
+177.231.42.9
  177.234.154.77
  177.239.160.121
  177.32.8.85
@@ -5239,6 +5402,7 @@
  177.72.13.80
  177.73.0.98
  177.74.2.10
+177.78.62.25
  177.85.167.10
  177.92.165.73
  1770122162.jclecardinal.com
@@ -5260,304 +5424,381 @@
  178.134.185.75
  178.134.185.86
  178.134.190.55
+178.141.137.142
+178.141.141.204
+178.141.4.203
+178.141.66.149
  178.157.91.246
  178.159.36.172
  178.159.43.35
  178.170.117.50
  178.170.220.162
+178.175.0.107
  178.175.0.151
  178.175.0.192
-178.175.0.234
-178.175.0.246
  178.175.0.28
  178.175.0.36
  178.175.0.79
  178.175.0.95
  178.175.0.98
+178.175.1.111
  178.175.1.119
  178.175.1.124
  178.175.1.155
+178.175.1.159
  178.175.1.231
  178.175.1.255
  178.175.1.33
  178.175.1.51
  178.175.10.164
-178.175.10.197
  178.175.10.219
  178.175.10.244
-178.175.10.254
  178.175.10.255
  178.175.10.44
  178.175.100.106
  178.175.100.141
+178.175.100.16
  178.175.100.180
+178.175.100.2
+178.175.100.223
+178.175.100.225
+178.175.100.227
+178.175.100.75
+178.175.100.82
+178.175.101.152
+178.175.101.158
  178.175.101.208
-178.175.101.227
+178.175.101.213
  178.175.101.238
+178.175.101.4
+178.175.101.50
  178.175.101.55
  178.175.101.99
+178.175.102.105
+178.175.102.154
+178.175.102.156
+178.175.102.175
  178.175.102.195
+178.175.102.232
  178.175.102.38
+178.175.102.53
  178.175.103.105
+178.175.103.112
+178.175.103.114
  178.175.103.20
  178.175.103.202
  178.175.103.82
  178.175.103.96
  178.175.104.10
  178.175.104.11
+178.175.104.144
  178.175.104.16
-178.175.104.174
  178.175.104.178
-178.175.104.241
+178.175.104.186
  178.175.104.255
  178.175.104.98
  178.175.105.102
  178.175.105.115
-178.175.105.116
  178.175.105.170
  178.175.105.180
-178.175.105.228
+178.175.105.204
+178.175.105.213
+178.175.105.4
  178.175.105.47
  178.175.105.64
+178.175.105.89
+178.175.105.93
  178.175.106.130
  178.175.106.18
  178.175.106.203
  178.175.106.219
+178.175.106.229
  178.175.106.37
  178.175.106.77
-178.175.107.145
+178.175.106.87
+178.175.106.91
+178.175.107.121
+178.175.107.140
  178.175.107.16
  178.175.107.163
-178.175.107.252
-178.175.107.29
  178.175.107.37
  178.175.107.44
-178.175.107.50
  178.175.107.62
+178.175.107.86
  178.175.107.9
  178.175.107.98
  178.175.108.179
-178.175.108.204
+178.175.108.196
  178.175.108.53
+178.175.108.7
  178.175.108.87
  178.175.109.132
  178.175.109.198
+178.175.109.207
  178.175.109.77
+178.175.11.104
+178.175.11.106
+178.175.11.118
+178.175.11.135
  178.175.11.138
  178.175.11.184
  178.175.11.243
  178.175.11.251
-178.175.11.35
+178.175.11.87
  178.175.110.102
  178.175.110.127
  178.175.110.163
-178.175.110.215
+178.175.110.164
  178.175.110.217
-178.175.110.245
+178.175.111.117
+178.175.111.124
  178.175.111.142
  178.175.111.16
-178.175.111.161
-178.175.112.167
+178.175.111.209
+178.175.111.251
+178.175.111.74
+178.175.112.175
+178.175.112.197
  178.175.112.202
  178.175.112.240
  178.175.112.247
+178.175.112.248
  178.175.112.26
-178.175.112.40
  178.175.112.46
+178.175.112.57
  178.175.112.79
  178.175.113.174
  178.175.113.176
+178.175.113.178
  178.175.114.121
-178.175.114.13
+178.175.114.129
  178.175.114.16
-178.175.114.176
  178.175.114.212
-178.175.114.213
+178.175.114.219
  178.175.114.224
  178.175.114.234
+178.175.114.239
  178.175.114.63
+178.175.114.97
  178.175.114.99
  178.175.115.13
  178.175.115.147
-178.175.115.152
+178.175.115.159
  178.175.115.166
-178.175.115.208
  178.175.115.217
+178.175.115.222
+178.175.115.45
  178.175.116.135
-178.175.116.237
-178.175.116.238
  178.175.116.48
+178.175.117.163
+178.175.117.166
  178.175.117.170
  178.175.117.180
  178.175.117.20
  178.175.117.36
  178.175.117.37
  178.175.117.39
-178.175.117.5
-178.175.117.74
+178.175.118.167
  178.175.118.193
+178.175.118.226
+178.175.118.253
+178.175.118.55
  178.175.118.75
  178.175.119.142
  178.175.119.165
  178.175.119.63
-178.175.119.65
+178.175.119.77
  178.175.12.19
  178.175.12.214
  178.175.12.242
+178.175.12.69
+178.175.120.102
  178.175.120.180
  178.175.120.20
+178.175.120.44
+178.175.120.91
  178.175.121.108
  178.175.121.151
  178.175.121.155
+178.175.121.214
+178.175.121.227
  178.175.121.243
  178.175.121.54
-178.175.121.82
+178.175.122.110
+178.175.122.131
+178.175.122.142
  178.175.122.191
  178.175.122.21
  178.175.122.215
  178.175.122.84
+178.175.123.103
  178.175.123.166
  178.175.123.2
  178.175.123.211
+178.175.123.95
+178.175.124.122
  178.175.124.128
  178.175.124.141
  178.175.124.205
+178.175.124.213
  178.175.124.214
+178.175.124.3
  178.175.124.4
  178.175.124.7
  178.175.124.79
  178.175.125.106
  178.175.125.107
-178.175.125.113
+178.175.125.114
  178.175.125.14
+178.175.125.144
  178.175.125.148
  178.175.125.153
  178.175.125.162
+178.175.125.18
  178.175.125.189
  178.175.125.197
  178.175.125.210
  178.175.125.231
  178.175.125.238
  178.175.125.40
+178.175.125.46
  178.175.125.56
  178.175.125.85
  178.175.125.9
-178.175.126.116
+178.175.126.115
  178.175.126.124
  178.175.126.154
+178.175.126.158
+178.175.126.174
+178.175.126.211
  178.175.126.222
  178.175.126.29
-178.175.126.58
  178.175.126.87
  178.175.127.112
  178.175.127.116
  178.175.127.153
  178.175.127.161
  178.175.127.170
+178.175.127.185
  178.175.127.190
  178.175.127.203
  178.175.127.212
  178.175.127.216
+178.175.127.35
  178.175.127.45
  178.175.127.46
  178.175.127.53
  178.175.127.77
+178.175.127.78
  178.175.127.82
+178.175.13.122
  178.175.13.137
  178.175.13.14
  178.175.13.15
-178.175.13.186
-178.175.13.195
+178.175.13.162
  178.175.13.199
-178.175.13.222
+178.175.13.213
  178.175.13.239
-178.175.13.27
  178.175.13.40
+178.175.13.73
+178.175.14.102
  178.175.14.160
-178.175.14.171
  178.175.14.175
-178.175.14.241
+178.175.14.2
  178.175.14.71
  178.175.14.90
  178.175.14.94
-178.175.15.154
  178.175.15.166
-178.175.15.225
  178.175.15.24
-178.175.16.1
+178.175.15.48
+178.175.15.85
  178.175.16.110
  178.175.16.133
-178.175.16.18
-178.175.16.207
-178.175.16.84
-178.175.17.105
+178.175.16.175
+178.175.16.5
+178.175.16.95
  178.175.17.116
  178.175.17.159
  178.175.17.192
  178.175.17.224
+178.175.17.228
  178.175.17.245
  178.175.17.90
  178.175.18.119
  178.175.18.148
  178.175.18.15
-178.175.18.195
-178.175.18.46
+178.175.18.45
  178.175.19.163
  178.175.19.175
  178.175.19.202
+178.175.19.232
  178.175.19.246
  178.175.19.254
+178.175.19.28
+178.175.19.70
+178.175.2.14
+178.175.2.155
  178.175.2.159
  178.175.2.167
  178.175.2.190
-178.175.2.90
+178.175.2.2
+178.175.2.236
+178.175.2.249
  178.175.2.97
  178.175.20.149
  178.175.20.170
+178.175.20.179
  178.175.20.183
  178.175.20.204
+178.175.20.207
  178.175.20.231
  178.175.20.240
+178.175.20.30
+178.175.20.44
+178.175.20.6
  178.175.20.75
+178.175.20.76
  178.175.21.161
-178.175.21.176
-178.175.21.186
-178.175.21.193
-178.175.21.238
-178.175.21.250
+178.175.21.248
  178.175.21.28
  178.175.21.95
+178.175.22.117
  178.175.22.160
+178.175.22.203
  178.175.22.23
  178.175.22.237
  178.175.22.32
-178.175.22.88
  178.175.23.106
  178.175.23.111
+178.175.23.144
+178.175.23.201
  178.175.23.216
-178.175.23.227
  178.175.23.228
  178.175.23.244
  178.175.23.247
  178.175.23.249
  178.175.23.31
  178.175.23.55
+178.175.23.78
  178.175.23.88
-178.175.24.101
  178.175.24.114
+178.175.24.137
  178.175.24.138
  178.175.24.161
+178.175.24.165
  178.175.24.182
  178.175.24.209
  178.175.24.21
  178.175.24.31
-178.175.24.56
+178.175.24.62
  178.175.24.77
  178.175.24.86
  178.175.24.95
+178.175.25.102
  178.175.25.103
  178.175.25.177
  178.175.25.181
+178.175.25.195
  178.175.25.204
  178.175.25.223
  178.175.25.225
@@ -5565,37 +5806,53 @@
  178.175.25.244
  178.175.25.58
  178.175.25.60
+178.175.25.75
  178.175.25.81
  178.175.25.82
  178.175.25.91
  178.175.26.103
-178.175.26.109
-178.175.26.20
+178.175.26.223
  178.175.26.253
+178.175.26.32
  178.175.26.36
+178.175.26.41
+178.175.26.5
+178.175.26.68
+178.175.26.90
  178.175.27.106
  178.175.27.112
  178.175.27.150
  178.175.27.160
+178.175.27.161
  178.175.27.197
+178.175.27.208
  178.175.27.216
+178.175.27.49
  178.175.28.122
  178.175.28.14
-178.175.28.150
+178.175.28.157
  178.175.28.161
-178.175.28.181
+178.175.28.169
+178.175.28.185
  178.175.28.198
+178.175.28.24
+178.175.28.72
+178.175.28.74
  178.175.28.85
  178.175.29.154
  178.175.29.158
+178.175.29.205
  178.175.29.224
  178.175.29.231
+178.175.29.86
+178.175.29.91
+178.175.3.0
+178.175.3.1
+178.175.3.103
  178.175.3.114
  178.175.3.116
-178.175.3.134
-178.175.3.145
+178.175.3.118
  178.175.3.155
-178.175.3.166
  178.175.3.172
  178.175.3.190
  178.175.3.219
@@ -5603,75 +5860,76 @@
  178.175.3.25
  178.175.3.27
  178.175.3.85
-178.175.3.98
  178.175.30.109
  178.175.30.110
  178.175.30.126
  178.175.30.177
  178.175.30.80
-178.175.30.93
  178.175.30.97
  178.175.31.100
+178.175.31.175
  178.175.31.18
  178.175.31.216
  178.175.31.251
  178.175.32.133
  178.175.32.138
  178.175.32.141
-178.175.32.142
  178.175.32.152
-178.175.32.248
+178.175.32.183
  178.175.32.36
  178.175.32.48
  178.175.32.77
-178.175.33.1
  178.175.33.101
  178.175.33.103
  178.175.33.185
  178.175.33.198
  178.175.33.2
+178.175.33.210
  178.175.33.223
  178.175.33.24
-178.175.33.82
-178.175.33.84
+178.175.34.102
  178.175.34.106
  178.175.34.115
  178.175.34.130
-178.175.34.133
-178.175.34.156
  178.175.34.216
+178.175.34.22
+178.175.34.223
+178.175.34.224
+178.175.34.233
  178.175.34.255
  178.175.34.3
+178.175.34.35
  178.175.34.5
  178.175.34.58
-178.175.34.60
-178.175.34.63
+178.175.34.91
  178.175.35.109
  178.175.35.21
-178.175.35.254
+178.175.35.246
+178.175.35.26
  178.175.35.38
  178.175.35.40
  178.175.35.8
  178.175.35.83
-178.175.35.85
  178.175.36.0
  178.175.36.110
-178.175.36.134
+178.175.36.168
+178.175.36.208
  178.175.36.218
-178.175.36.24
-178.175.36.26
-178.175.36.28
+178.175.36.67
+178.175.36.97
  178.175.37.105
-178.175.37.129
+178.175.37.152
  178.175.37.19
-178.175.37.238
+178.175.37.202
+178.175.37.214
+178.175.37.234
  178.175.37.51
  178.175.37.52
  178.175.38.101
  178.175.38.118
  178.175.38.137
+178.175.38.147
  178.175.38.152
-178.175.38.22
  178.175.38.224
  178.175.38.244
  178.175.38.29
@@ -5679,88 +5937,93 @@
  178.175.38.92
  178.175.39.106
  178.175.39.11
+178.175.39.144
  178.175.39.190
-178.175.39.211
-178.175.39.217
+178.175.39.21
  178.175.39.219
+178.175.39.232
  178.175.39.239
  178.175.39.249
  178.175.39.56
  178.175.39.87
-178.175.4.123
  178.175.4.132
  178.175.4.197
  178.175.4.201
-178.175.4.206
-178.175.4.241
  178.175.4.35
  178.175.4.57
+178.175.40.126
+178.175.40.149
  178.175.40.19
  178.175.40.251
  178.175.40.29
-178.175.40.50
-178.175.40.53
  178.175.40.82
  178.175.41.143
  178.175.41.181
  178.175.41.211
  178.175.41.225
-178.175.41.238
-178.175.42.171
-178.175.42.89
+178.175.41.235
+178.175.41.246
+178.175.41.6
+178.175.41.93
+178.175.42.194
+178.175.42.235
+178.175.42.255
  178.175.43.100
  178.175.43.114
  178.175.43.163
  178.175.43.166
-178.175.43.177
+178.175.43.189
  178.175.43.205
  178.175.43.227
  178.175.43.31
  178.175.43.69
  178.175.43.70
  178.175.43.84
+178.175.44.102
+178.175.44.178
  178.175.44.202
+178.175.44.241
  178.175.44.85
-178.175.45.107
-178.175.45.108
+178.175.45.10
  178.175.45.125
-178.175.45.160
+178.175.45.156
+178.175.45.162
  178.175.45.202
  178.175.45.252
+178.175.45.3
+178.175.45.54
  178.175.45.81
  178.175.45.86
  178.175.45.96
-178.175.46.128
+178.175.46.126
+178.175.46.129
  178.175.46.132
-178.175.46.141
  178.175.46.171
  178.175.46.184
  178.175.46.229
  178.175.46.33
  178.175.46.54
  178.175.47.10
+178.175.47.110
  178.175.47.185
  178.175.47.210
  178.175.47.215
  178.175.47.218
  178.175.47.45
-178.175.47.67
  178.175.47.98
  178.175.48.0
-178.175.48.133
  178.175.48.149
-178.175.48.197
+178.175.48.160
+178.175.48.238
  178.175.48.4
  178.175.48.66
  178.175.48.82
-178.175.48.91
-178.175.49.114
  178.175.49.119
  178.175.49.136
+178.175.49.20
  178.175.49.215
-178.175.49.231
  178.175.49.42
-178.175.49.92
+178.175.49.9
  178.175.5.0
  178.175.5.105
  178.175.5.167
@@ -5773,54 +6036,56 @@
  178.175.50.131
  178.175.50.177
  178.175.50.196
-178.175.50.236
  178.175.50.3
  178.175.50.33
  178.175.50.42
  178.175.50.77
  178.175.50.92
  178.175.51.212
-178.175.51.221
  178.175.51.247
  178.175.51.59
-178.175.51.93
-178.175.52.119
  178.175.52.142
  178.175.52.199
  178.175.52.22
-178.175.52.53
  178.175.52.55
-178.175.52.67
  178.175.53.104
  178.175.53.128
  178.175.53.202
  178.175.53.236
  178.175.53.35
  178.175.53.56
+178.175.53.60
  178.175.53.79
  178.175.54.107
-178.175.54.181
+178.175.54.137
+178.175.54.140
+178.175.54.147
+178.175.54.154
  178.175.54.192
  178.175.54.196
  178.175.54.225
  178.175.54.249
  178.175.54.72
-178.175.55.14
+178.175.54.89
+178.175.54.99
  178.175.55.195
  178.175.55.212
  178.175.55.29
-178.175.55.42
+178.175.55.50
+178.175.55.92
  178.175.56.105
  178.175.56.107
  178.175.56.247
  178.175.56.249
+178.175.56.30
  178.175.56.57
  178.175.56.67
+178.175.56.82
  178.175.57.102
  178.175.57.137
  178.175.57.141
  178.175.57.185
-178.175.57.210
+178.175.57.222
  178.175.57.230
  178.175.57.232
  178.175.57.41
@@ -5828,31 +6093,39 @@
  178.175.58.201
  178.175.58.209
  178.175.58.216
+178.175.58.27
  178.175.58.33
-178.175.58.75
  178.175.58.78
  178.175.59.106
-178.175.59.166
  178.175.59.204
  178.175.59.211
+178.175.59.227
+178.175.59.3
  178.175.59.4
  178.175.59.76
-178.175.59.8
-178.175.6.101
-178.175.6.221
+178.175.59.95
+178.175.6.125
+178.175.6.179
+178.175.6.243
  178.175.6.246
  178.175.6.38
-178.175.6.75
+178.175.6.46
+178.175.6.72
  178.175.6.88
  178.175.60.100
+178.175.60.139
  178.175.60.168
+178.175.60.170
  178.175.60.181
-178.175.60.188
  178.175.60.7
-178.175.61.228
-178.175.61.31
+178.175.61.191
+178.175.61.240
+178.175.61.255
+178.175.61.35
  178.175.62.111
+178.175.62.128
  178.175.62.213
+178.175.62.226
  178.175.62.227
  178.175.62.34
  178.175.62.38
@@ -5860,79 +6133,106 @@
  178.175.63.148
  178.175.63.212
  178.175.63.217
-178.175.63.28
+178.175.63.99
+178.175.64.115
  178.175.64.122
+178.175.64.138
  178.175.64.140
+178.175.64.146
+178.175.64.216
  178.175.64.248
  178.175.64.63
+178.175.64.74
  178.175.64.88
-178.175.64.89
+178.175.65.109
  178.175.65.215
+178.175.65.233
+178.175.65.24
  178.175.65.241
-178.175.65.85
  178.175.66.115
  178.175.66.153
+178.175.66.168
+178.175.66.178
+178.175.66.20
+178.175.66.210
  178.175.66.211
+178.175.66.215
  178.175.66.221
+178.175.66.230
  178.175.66.233
-178.175.66.248
+178.175.66.240
  178.175.66.44
  178.175.66.62
+178.175.67.103
+178.175.67.115
+178.175.67.180
  178.175.67.185
  178.175.67.186
  178.175.67.19
  178.175.67.248
  178.175.67.254
  178.175.67.27
-178.175.67.45
+178.175.67.65
  178.175.68.103
-178.175.68.105
-178.175.68.124
+178.175.68.111
+178.175.68.136
+178.175.68.156
  178.175.68.166
+178.175.68.218
+178.175.68.27
  178.175.68.66
  178.175.69.10
  178.175.69.112
  178.175.69.119
  178.175.69.128
+178.175.69.157
+178.175.69.16
  178.175.69.188
-178.175.69.209
  178.175.69.242
  178.175.69.243
-178.175.7.169
+178.175.69.54
+178.175.69.82
+178.175.69.91
  178.175.7.40
  178.175.7.66
-178.175.7.98
  178.175.70.10
+178.175.70.109
  178.175.70.12
-178.175.70.161
-178.175.70.228
+178.175.70.150
+178.175.70.248
+178.175.70.37
  178.175.70.45
  178.175.70.54
  178.175.70.88
  178.175.70.92
+178.175.71.104
  178.175.71.130
-178.175.71.180
-178.175.71.212
+178.175.71.190
  178.175.71.32
  178.175.71.53
+178.175.71.54
  178.175.71.68
  178.175.71.71
  178.175.72.102
  178.175.72.137
-178.175.72.159
-178.175.72.212
+178.175.72.16
+178.175.72.196
  178.175.72.246
  178.175.72.53
  178.175.72.56
  178.175.73.89
  178.175.74.162
  178.175.74.186
+178.175.74.22
  178.175.74.238
-178.175.74.45
  178.175.74.62
  178.175.74.82
+178.175.74.90
  178.175.74.91
+178.175.74.96
+178.175.75.125
  178.175.75.13
+178.175.75.142
  178.175.75.145
  178.175.75.181
  178.175.75.227
@@ -5940,136 +6240,195 @@
  178.175.75.40
  178.175.75.65
  178.175.75.66
-178.175.75.69
  178.175.75.84
+178.175.76.104
  178.175.76.15
  178.175.76.188
+178.175.76.214
+178.175.76.217
  178.175.76.24
-178.175.76.248
-178.175.77.0
-178.175.77.14
+178.175.76.244
+178.175.76.67
+178.175.77.130
  178.175.77.151
  178.175.77.182
+178.175.77.195
  178.175.77.240
+178.175.77.72
+178.175.78.160
+178.175.78.217
+178.175.78.218
  178.175.78.43
  178.175.78.81
-178.175.79.156
-178.175.79.70
+178.175.79.206
+178.175.79.233
+178.175.79.94
+178.175.8.111
  178.175.8.120
+178.175.8.125
  178.175.8.133
  178.175.8.145
  178.175.8.165
  178.175.8.177
+178.175.8.193
  178.175.8.199
+178.175.8.217
  178.175.8.76
  178.175.8.81
+178.175.80.110
  178.175.80.188
+178.175.80.198
  178.175.80.203
+178.175.80.43
  178.175.81.1
  178.175.81.118
  178.175.81.15
+178.175.81.204
+178.175.81.236
+178.175.81.249
  178.175.81.250
+178.175.81.66
  178.175.81.83
  178.175.82.108
+178.175.82.115
+178.175.82.122
  178.175.82.156
  178.175.82.183
  178.175.82.205
-178.175.82.211
-178.175.82.223
  178.175.82.55
  178.175.82.73
+178.175.83.133
+178.175.83.184
  178.175.83.196
+178.175.83.223
+178.175.83.24
  178.175.83.247
+178.175.83.47
+178.175.83.52
+178.175.83.72
+178.175.83.87
  178.175.83.94
+178.175.84.0
+178.175.84.101
+178.175.84.107
  178.175.84.148
-178.175.84.15
+178.175.84.206
  178.175.84.215
+178.175.84.237
+178.175.84.30
  178.175.84.39
  178.175.84.46
-178.175.84.77
+178.175.85.151
  178.175.85.157
  178.175.85.190
  178.175.85.210
-178.175.85.251
+178.175.85.242
  178.175.85.30
+178.175.85.50
  178.175.85.54
+178.175.85.80
  178.175.85.90
-178.175.86.122
  178.175.86.126
+178.175.86.188
+178.175.86.195
  178.175.86.199
-178.175.86.207
  178.175.86.217
-178.175.86.22
  178.175.86.32
-178.175.87.101
-178.175.87.113
  178.175.87.162
  178.175.87.175
-178.175.87.196
  178.175.87.199
-178.175.87.233
+178.175.87.202
  178.175.87.253
-178.175.87.71
+178.175.87.42
  178.175.87.75
+178.175.87.86
  178.175.87.90
+178.175.88.148
  178.175.88.184
  178.175.88.27
-178.175.88.52
-178.175.88.64
  178.175.89.100
-178.175.89.108
  178.175.89.130
+178.175.89.149
  178.175.89.168
  178.175.89.171
  178.175.89.173
+178.175.89.177
  178.175.89.194
  178.175.89.204
+178.175.89.210
+178.175.89.221
  178.175.89.23
  178.175.89.231
+178.175.89.235
  178.175.89.31
+178.175.89.44
  178.175.89.57
+178.175.89.64
+178.175.9.119
  178.175.9.252
-178.175.9.38
-178.175.9.39
-178.175.9.92
  178.175.90.79
-178.175.91.155
+178.175.90.85
+178.175.90.99
  178.175.91.158
  178.175.91.160
  178.175.91.172
  178.175.91.174
-178.175.92.133
-178.175.92.174
+178.175.91.18
+178.175.91.253
+178.175.91.78
+178.175.91.85
+178.175.92.186
+178.175.92.208
  178.175.92.230
+178.175.93.113
+178.175.93.149
+178.175.93.167
+178.175.93.194
+178.175.94.108
  178.175.94.116
  178.175.94.208
+178.175.94.229
  178.175.94.28
  178.175.94.33
-178.175.95.111
+178.175.94.59
+178.175.95.0
+178.175.95.154
+178.175.95.158
  178.175.95.249
  178.175.95.44
  178.175.96.113
-178.175.96.195
+178.175.96.143
+178.175.96.189
  178.175.96.216
+178.175.96.239
  178.175.96.247
-178.175.96.54
+178.175.96.27
+178.175.96.50
+178.175.97.173
  178.175.97.188
+178.175.97.190
  178.175.97.231
-178.175.98.124
  178.175.98.128
  178.175.98.14
  178.175.98.169
+178.175.98.233
+178.175.98.241
+178.175.98.65
  178.175.99.117
+178.175.99.157
  178.175.99.164
  178.175.99.180
  178.175.99.183
  178.175.99.185
+178.175.99.202
+178.175.99.225
  178.175.99.253
  178.175.99.36
  178.175.99.72
  178.20.227.53
  178.20.74.212
  178.208.75.227
+178.21.164.68
  178.210.66.37
  178.211.45.66
  178.218.222.185
@@ -6094,14 +6453,20 @@
  178.78.104.202
  178.79.161.166
  178.79.163.131
+178.92.124.75
  178.94.146.50
  178.94.147.234
  178.95.102.196
  178.95.115.33
  178.95.142.65
  178j.life
+178r60769688579.3dcartstores.com
+179.165.45.5
+179.171.117.155
  179.233.3.89
  179.4.187.39
+179.42.105.249
+179.42.107.182
  179.43.101.47
  179.43.134.190
  179.43.149.13
@@ -6114,6 +6479,7 @@
  17ab3d2e4638facf.icu
  17bofa71.systeminformationoursecure.com
  17e9af34-dc73-42d3-8332-1482e3035d80.htmlcomponentservice.com
+17haoping.com
  17thstreet.co
  18-3mui1gctm.vercel.app
  18-bkp.ml
@@ -6165,6 +6531,7 @@
  180.104.9.150
  180.106.99.162
  180.107.76.147
+180.111.101.141
  180.111.90.68
  180.112.185.135
  180.114.101.116
@@ -6298,7 +6665,6 @@
  180.214.236.98
  180.214.238.5
  180.214.239.54
-180.215.201.123
  180.215.227.16
  180.215.227.32
  180.222.161.85
@@ -6348,39 +6714,44 @@
  181.53.255.145
  18141190156-xxyyzzaa.azurewebsites.net
  18190.8wix.com
+182.111.247.23
+182.112.29.58
  182.112.31.243
-182.112.32.234
  182.112.44.228
+182.112.48.208
  182.112.48.47
  182.112.9.196
+182.113.15.89
  182.113.210.15
-182.113.210.205
  182.113.211.248
  182.113.215.240
  182.113.224.111
  182.113.228.239
+182.113.28.55
  182.113.43.246
-182.113.5.247
  182.113.58.37
  182.114.108.84
  182.114.20.91
-182.114.212.29
-182.114.251.169
  182.114.254.27
  182.114.254.79
+182.114.48.56
+182.114.56.206
  182.114.64.33
-182.114.78.102
-182.114.91.191
  182.114.92.204
+182.114.94.220
  182.115.165.73
  182.115.199.21
-182.116.100.108
+182.115.207.183
+182.116.100.49
  182.116.100.59
  182.116.101.211
  182.116.101.36
  182.116.102.170
  182.116.102.223
+182.116.102.29
  182.116.102.8
+182.116.104.125
+182.116.105.5
  182.116.107.152
  182.116.108.16
  182.116.109.252
@@ -6392,8 +6763,9 @@
  182.116.117.206
  182.116.38.160
  182.116.50.181
-182.116.53.26
  182.116.60.73
+182.116.61.252
+182.116.68.34
  182.116.70.143
  182.116.71.231
  182.116.96.194
@@ -6411,7 +6783,9 @@
  182.117.26.178
  182.117.27.218
  182.117.28.104
+182.117.31.21
  182.117.67.215
+182.117.7.75
  182.117.71.196
  182.117.75.235
  182.117.79.115
@@ -6422,120 +6796,138 @@
  182.117.96.14
  182.118.98.127
  182.119.12.199
-182.119.122.61
-182.119.123.148
+182.119.12.47
+182.119.122.36
  182.119.152.159
  182.119.159.24
  182.119.160.254
+182.119.166.64
+182.119.166.98
  182.119.167.42
  182.119.176.220
+182.119.178.229
  182.119.183.82
-182.119.183.87
  182.119.189.90
+182.119.19.10
+182.119.196.160
  182.119.199.85
  182.119.204.5
  182.119.207.145
  182.119.215.94
  182.119.219.132
-182.119.227.56
+182.119.231.86
  182.119.249.168
-182.119.250.123
  182.119.252.244
  182.119.253.87
  182.119.255.121
+182.119.32.3
  182.119.32.89
-182.119.58.31
+182.119.34.118
  182.119.58.36
  182.119.58.84
-182.119.88.106
  182.119.89.239
  182.119.9.35
  182.119.9.51
+182.119.94.49
+182.119.97.47
+182.119.99.10
+182.120.15.87
  182.120.16.115
  182.120.16.22
  182.120.16.46
+182.120.230.246
  182.120.246.106
  182.120.33.50
  182.120.36.28bin.sh
+182.120.38.83
  182.120.40.42
  182.120.54.7
+182.120.56.73
+182.121.115.58
  182.121.116.20
  182.121.117.254
  182.121.144.115
-182.121.145.29
-182.121.145.37
+182.121.147.239
+182.121.148.243
  182.121.15.176
  182.121.152.153
  182.121.157.170
+182.121.159.121
+182.121.159.14
  182.121.184.153
-182.121.184.179
-182.121.201.232
+182.121.202.80
  182.121.210.215
-182.121.247.153
+182.121.215.108
+182.121.217.184
+182.121.226.236
  182.121.25.182
-182.121.28.53
+182.121.254.132
+182.121.28.195
  182.121.33.151
-182.121.40.75
-182.121.42.126
-182.121.48.106
-182.121.49.167
  182.121.55.5
-182.121.77.69
-182.121.86.21
+182.121.75.234
+182.121.8.70
+182.121.81.215
+182.121.93.29
  182.122.160.137
+182.122.245.148
  182.122.249.8
  182.122.25.85
  182.122.251.10
  182.122.251.231bin.sh
  182.122.56.237
+182.123.163.189
  182.123.208.229
  182.123.208.31
-182.123.209.238
  182.123.210.25
  182.123.211.164
  182.123.240.206
-182.123.246.129
  182.123.251.182
-182.124.115.209
  182.124.130.153
  182.124.159.26
+182.124.183.44
+182.124.192.167
  182.124.204.222
-182.124.37.217
  182.124.5.172
+182.124.50.95
  182.124.58.235
-182.124.63.3
  182.124.84.22
  182.126.101.85
+182.126.114.13
  182.126.118.161
+182.126.120.42
+182.126.126.231
  182.126.127.66
+182.126.177.21
  182.126.193.96
-182.126.234.15
  182.126.234.24
+182.126.243.255
  182.126.65.75
  182.126.66.12
  182.126.69.180
  182.126.69.88
  182.126.71.233
  182.126.73.51
+182.126.79.208
  182.126.80.160
+182.126.81.1
+182.126.83.79
  182.126.87.95
-182.127.125.138
-182.127.127.162
-182.127.137.70
-182.127.137.98
+182.126.90.137
+182.126.97.139
+182.127.111.209
  182.127.152.142
  182.127.155.157
  182.127.155.174
  182.127.156.246
-182.127.16.223
-182.127.17.155
  182.127.171.4
+182.127.209.55
  182.127.210.88
-182.127.211.166
  182.127.29.87
-182.127.30.64
  182.127.31.251
  182.127.82.108
+182.127.90.203
+182.127.99.101
  182.142.112.88
  182.142.115.84
  182.142.118.25
@@ -6543,11 +6935,12 @@
  182.16.10.90
  182.16.10.91
  182.16.10.94
+182.16.26.236
  182.16.44.138
  182.16.44.139
  182.172.36.164
  182.172.36.95
-182.176.167.172
+182.184.78.161
  182.207.219.164
  182.222.195.145
  182.222.195.192
@@ -6556,12 +6949,16 @@
  182.247.193.1
  182.253.197.100
  182.46.158.85
+182.53.197.62
  182.57.215.1
-182.59.189.57
+182.57.92.149
  182.59.3.33
+182.59.34.157
+182.59.88.81
  182.73.7.59
  182.73.95.218
  1821456.dg398993.web.hosting-test.net
+182245.duniyahaigol.com
  1827.webhost-02.my-host.network
  182elexusbet.com
  183.101.176.223
@@ -6576,20 +6973,17 @@
  183.109.169.45
  183.109.80.156
  183.11.238.228
+183.129.98.113
  183.130.23.147
-183.15.207.130
-183.15.89.230
  183.151.148.79
  183.156.2.119
  183.158.55.229
-183.17.144.106
  183.17.147.25
  183.17.225.13
  183.185.113.113
-183.185.80.81
+183.185.99.161
  183.186.84.54
  183.187.125.254
-183.188.100.101
  183.188.103.56
  183.188.134.235
  183.188.180.170
@@ -6609,6 +7003,7 @@
  183.4.30.105
  183.4.30.251
  183.7.172.56
+183.7.173.128
  183.7.32.245
  183.77.227.38
  183.78.10.31
@@ -6616,16 +7011,14 @@
  183.81.154.113
  183.82.97.25
  183.83.111.105
-183.83.217.3
+183.83.124.254
  183.83.25.15
-183.83.26.194
  183.91.3.63
  183.93.10.57
  183.95.144.236
  183.95.246.160
  183.96.65.145
  183.97.22.14
-183.yolasite.com
  1830488.synergyglobal.one
  1834.31cf4fdae.com
  183da2ac-98c9-41cf-9f59-0c377e76b19b.htmlcomponentservice.com
@@ -6825,7 +7218,6 @@
  185.215.113.17
  185.215.113.207
  185.215.113.54
-185.215.113.76
  185.215.113.93
  185.215.150.209
  185.215.227.107
@@ -6848,7 +7240,6 @@
  185.232.182.218
  185.232.65.171
  185.233.186.129
-185.233.186.130
  185.234.217.224
  185.234.218.145
  185.234.72.64
@@ -6885,6 +7276,7 @@
  185.245.2.168
  185.245.84.153
  185.247.116.43
+185.248.140.132
  185.249.198.100
  185.250.151.72
  185.251.39.230
@@ -6917,8 +7309,14 @@
  185.80.222.96
  185.80.53.147
  185.82.217.185
+185.82.217.213
  185.82.219.160
  185.82.219.161
+185.82.219.219
+185.82.219.222
+185.82.219.225
+185.82.219.226
+185.82.219.80
  185.86.148.68
  185.89.161.157bin.sh
  185.90.166.56
@@ -6963,7 +7361,7 @@
  186.30.178.91
  186.31.40.183
  186.33.127.113
-186.33.96.25
+186.33.77.160
  186.4.172.5
  186.68.141.218
  186.73.188.132
@@ -6972,7 +7370,6 @@
  186.75.241.230
  186.84.173.153
  186.90.29.228
-186.93.254.177
  186.96.170.61
  1860poga.co.za
  186181.com
@@ -6993,14 +7390,18 @@
  187bahsegel.com
  188.0.135.237
  188.113.81.17
+188.119.112.125
  188.119.67.114
  188.120.235.130
  188.126.116.26
+188.127.230.133
+188.127.231.226
+188.127.231.55
  188.127.235.232
  188.127.235.244
  188.127.235.70
  188.127.235.71
-188.127.237.228
+188.127.237.152
  188.127.249.210
  188.127.251.243
  188.127.254.114
@@ -7009,6 +7410,7 @@
  188.138.88.184
  188.143.220.152
  188.152.7.140
+188.165.17.91
  188.165.214.98
  188.165.89.65
  188.166.211.167
@@ -7062,7 +7464,6 @@
  189.194.58.119
  189.201.250.173
  189.209.217.49
-189.222.201.98
  189.252.102.40
  189.254.255.180
  189.78.156.8
@@ -7091,6 +7492,7 @@
  18videofullhd.ath.cx
  18whatsapp.zzux.com
  18whatsappgroupbokep.tk
+19.dbstrony.pl
  190-365.net
  190.103.228.24
  190.106.97.230
@@ -7104,7 +7506,6 @@
  190.131.167.50
  190.136.178.52
  190.14.39.239
-190.141.117.41
  190.144.60.138
  190.146.131.105
  190.147.215.53
@@ -7165,6 +7566,7 @@
  190.6.193.152
  190.63.7.166
  190.64.88.186
+190.74.22.100
  190.85.46.52
  190.96.118.15
  190.96.15.50
@@ -7240,7 +7642,6 @@
  192.210.175.130
  192.210.214.146
  192.210.214.51
-192.210.215.105
  192.210.217.94
  192.210.226.106
  192.210.226.125
@@ -7482,7 +7883,6 @@
  195.123.242.97
  195.123.247.26
  195.130.73.229
-195.139.126.51
  195.14.0.12
  195.154.233.102
  195.154.241.208
@@ -7581,6 +7981,7 @@
  19840209.com
  19858327-dot-sydneyma.appspot.com
  198663092739365.cf
+198772.duniyahaigol.com
  199.168.100.74
  199.188.204.4
  199.19.224.46
@@ -7648,7 +8049,6 @@
  1adsfbdetaccserg.xyz
  1adsfbsrecvrysfec.xyz
  1agencyseode.shaxiaarts.top
-1aggiornadati-lntesasanpaolo.com
  1am.co.nz
  1amazon3.top
  1amazoncustomer.x24hr.com
@@ -7919,6 +8319,7 @@
  200.41.121.69
  200.45.187.90
  200.51.94.251
+200.52.228.27
  200.55.243.138
  200.57.102.71
  200.57.183.176
@@ -7945,12 +8346,12 @@
  201.163.74.202
  201.163.74.204
  201.163.98.162
-201.171.12.16
  201.171.150.41
  201.184.105.242
  201.185.69.28
  201.192.136.240
  201.193.160.196
+201.193.17.190
  201.196.15.79
  201.203.221.20
  201.212.61.66
@@ -7975,6 +8376,7 @@
  20191021t124955-dot-we-secure-file-sh4455.appspot.com
  20191027t231510-dot-wetransfer-auth-file-343.appspot.com
  20191113t071621-dot-wetransfer-auth-file334.appspot.com
+202.110.79.76
  202.111.131.236
  202.134.4.210
  202.134.4.211
@@ -7983,6 +8385,8 @@
  202.150.176.100
  202.150.181.58
  202.166.170.43
+202.169.234.37
+202.169.234.56
  202.178.113.215
  202.178.113.221
  202.182.112.26
@@ -7993,6 +8397,7 @@
  202.29.4.97
  202.29.57.22
  202.29.95.12
+202.44.224.178
  202.5.47.71
  202.62.39.111
  202.88.239.11
@@ -8242,7 +8647,6 @@
  2020zip.000webhostapp.com
  2021-ohne-rezept.website
  2021ripristina.com
-2021risoluzione.com
  2023devlet-iadeleri.org
  2023talep-iadelerim.org
  202983268654sbcglobal.weebly.com
@@ -8256,7 +8660,6 @@
  203.160.167.243
  203.160.69.66
  203.163.236.249bin.sh
-203.163.243.8
  203.163.245.14
  203.171.31.156
  203.176.135.102
@@ -8266,7 +8669,6 @@
  203.205.137.186
  203.205.137.72
  203.213.249.66
-203.217.179.31
  203.219.151.169
  203.227.203.31
  203.227.217.27
@@ -8331,6 +8733,7 @@
  206.189.209.253
  206.189.223.88
  206.189.232.2
+206.189.62.83
  206.189.85.218
  206.189.88.91
  206.189.91.211
@@ -8353,12 +8756,10 @@
  207.154.254.218
  207.154.254.63
  207.180.195.154
-207.180.252.187
  207.188.69.59
  207.241.227.38
  207.246.67.4
  207.44.28.234
-207.46.132.127
  207.46.145.19
  207.55.247.240
  2072.ch
@@ -8485,6 +8886,7 @@
  211.137.225.96
  211.142.96.87
  211.172.11.169
+211.179.43.109
  211.184.131.136
  211.184.131.136bin.sh
  211.187.132.204
@@ -8538,7 +8940,6 @@
  212.114.52.21
  212.129.24.79
  212.129.47.122
-212.156.215.178
  212.162.151.144
  212.186.191.177
  212.22.70.65
@@ -8548,6 +8949,7 @@
  212.237.53.82
  212.31cf4fdae.com
  212.32.233.237
+212.46.238.86
  212.51.142.238
  212.64.67.230
  212.64.86.16
@@ -8560,36 +8962,43 @@
  2122159.cloudcommercepro.com
  213.14.173.117
  213.149.190.193
+213.163.104.138
+213.163.104.160
  213.163.104.99
  213.163.113.100
  213.163.113.20
  213.163.113.225
  213.163.113.46
+213.163.113.59
  213.163.114.183
  213.163.114.191
  213.163.114.80
  213.163.115.23
  213.163.115.26
  213.163.116.192
-213.163.116.197
  213.163.116.214
  213.163.116.33
  213.163.116.69
+213.163.116.85
  213.163.117.167
-213.163.117.229
  213.163.118.10
+213.163.118.144
+213.163.118.175
  213.163.118.238
  213.163.118.249
  213.163.118.4
+213.163.118.65
+213.163.119.236
  213.163.119.24
  213.163.119.50
  213.163.119.73
+213.163.126.11
  213.163.126.112
  213.163.126.243
+213.163.126.245
  213.163.126.7
-213.163.126.71
  213.163.126.84
-213.163.126.96
+213.163.127.204
  213.176.36.147
  213.176.36.42
  213.178.155.74
@@ -8597,8 +9006,6 @@
  213.212.59.196
  213.226.114.189
  213.52.74.198
-213.59.127.142
-213.59.127.143
  213.80.44.17
  213.91.202.230
  213.92.254.214
@@ -8675,10 +9082,14 @@
  217.160.254.33
  217.160.59.241
  217.160.59.64
+217.169.84.119
+217.169.85.100
+217.169.89.139
  217.182.38.147
  217.197.160.186
  217.199.160.224
  217.20.166.178
+217.209.226.29
  217.26.163.82
  217.35.78.204
  217.61.61.60
@@ -8737,6 +9148,7 @@
  218.21.171.55
  218.21.171.57
  218.237.65.52
+218.255.226.166
  218.27.202.183
  218.29.29.153
  218.3.194.137
@@ -8768,6 +9180,7 @@
  218.70.148.133
  218.73.60.118
  218.79.103.159
+218.8.80.226
  218.89.81.109
  218.9.28.79
  218.93.172.55
@@ -8781,50 +9194,61 @@
  219.151.248.79
  219.154.102.109
  219.154.105.205
+219.154.106.120
  219.154.120.133
+219.154.121.242
+219.154.123.125
  219.154.138.105
+219.154.149.81
+219.154.154.52
  219.154.160.74
  219.154.175.212
  219.154.32.71
-219.155.20.203
+219.154.97.228
+219.155.108.3
+219.155.114.219
+219.155.169.204
+219.155.170.185
+219.155.20.32
  219.155.206.119
  219.155.210.213
  219.155.212.177
-219.155.212.183
  219.155.215.80
  219.155.23.198
  219.155.237.43
-219.155.237.88
  219.155.24.106
+219.155.24.131
  219.155.24.9
-219.155.247.51
+219.155.243.35
  219.155.248.217
  219.155.29.33
-219.155.35.240
  219.155.64.64
+219.155.66.208
  219.155.69.108
+219.155.86.251
  219.155.96.191
  219.155.97.201
  219.155.97.3
+219.156.100.7
  219.156.129.253
  219.156.188.241
  219.156.19.62
-219.156.64.246
-219.156.65.142
+219.156.20.219
  219.156.77.155
  219.156.77.236
-219.157.132.254
+219.156.8.47
+219.156.91.165
+219.157.132.25
  219.157.133.236
-219.157.137.252
  219.157.139.165
  219.157.144.123
-219.157.146.188
  219.157.146.200
  219.157.146.251
-219.157.146.74
  219.157.151.26
  219.157.168.233
  219.157.179.84
+219.157.201.153
+219.157.212.23
  219.157.213.250
  219.157.214.155
  219.157.214.236
@@ -8836,7 +9260,10 @@
  219.157.31.26
  219.157.32.53
  219.157.36.105
+219.157.49.231
  219.157.54.231
+219.157.54.73
+219.157.58.0
  219.241.6.180
  219.69.110.49
  219.85.145.194
@@ -8869,6 +9296,7 @@
  220.168.240.227
  220.173.160.221
  220.173.160.221bin.sh
+220.175.133.154
  220.181.187.187
  220.185.195.156
  220.185.198.208
@@ -8893,7 +9321,6 @@
  220.87.94.21
  220.87.94.21bin.sh
  220.89.71.36
-220.90.159.188
  220.94.66.153bin.sh
  220.94.87.179
  220betasus.com
@@ -8911,34 +9338,44 @@
  221.14.122.28
  221.14.123.130
  221.14.124.58
+221.14.126.6
  221.14.152.158
-221.14.204.207
+221.14.17.176
+221.14.204.22
+221.14.45.243
+221.14.59.255
+221.14.60.146
  221.148.107.154
  221.15.11.116
-221.15.119.195
  221.15.127.138
+221.15.144.245
  221.15.145.158
  221.15.165.210
  221.15.176.96
  221.15.181.109
  221.15.181.209
-221.15.190.247
  221.15.196.210
  221.15.20.153
-221.15.214.18
+221.15.21.13
  221.15.22.0
  221.15.22.137
  221.15.22.26
  221.15.224.195
+221.15.226.197
+221.15.234.175
  221.15.235.26
  221.15.236.197
-221.15.252.142
  221.15.4.174
  221.15.4.203
  221.15.54.162
  221.15.6.110
  221.15.7.218
+221.15.7.237
  221.15.7.240
+221.15.8.164
+221.15.86.139
+221.15.86.248
+221.15.86.255
  221.151.207.173
  221.153.211.94
  221.156.35.214
@@ -8951,7 +9388,6 @@
  221.160.177.197
  221.160.177.224
  221.160.177.39
-221.160.177.49
  221.160.177.66
  221.161.31.8
  221.164.122.198
@@ -9028,7 +9464,6 @@
  221.3.87.204
  221.3.89.189
  221.5.31.159
-221.9.138.73
  221102.us-south.cf.appdomain.cloud
  2214756-39975-dot-bles05.wn.r.appspot.com
  221496844.embeddedsw.org
@@ -9052,6 +9487,7 @@
  222.135.131.48
  222.135.15.121
  222.135.219.29
+222.135.222.132
  222.135.37.220
  222.136.158.229
  222.136.212.112
@@ -9065,7 +9501,6 @@
  222.137.122.142
  222.137.122.90
  222.137.123.1
-222.137.132.135
  222.137.133.110
  222.137.136.116
  222.137.136.142
@@ -9081,44 +9516,51 @@
  222.137.139.188
  222.137.139.4
  222.137.148.6
+222.137.157.27
+222.137.159.78
  222.137.162.30
+222.137.164.211
  222.137.208.97
  222.137.215.83
-222.137.220.167
-222.137.237.79
-222.137.25.92
  222.137.251.112
  222.137.5.150
  222.137.5.44
-222.137.77.122
+222.137.55.226
  222.137.8.96
-222.138.101.255
-222.138.116.74
-222.138.149.66
+222.137.98.61
+222.138.100.116
+222.138.102.61
+222.138.117.44
  222.138.174.120
  222.138.174.182
  222.138.180.34
-222.138.181.117
  222.138.181.119
+222.138.181.80
  222.138.184.81
  222.138.190.135
  222.138.201.98
  222.138.213.59
+222.138.214.178
  222.138.235.241
  222.138.96.76
  222.138.96.79
  222.139.196.53
  222.139.209.19
+222.139.218.3
  222.139.224.153
  222.139.28.84
  222.140.131.119
-222.140.171.226
  222.140.179.240
  222.140.19.172
-222.140.210.198
+222.140.251.240
  222.140.72.174
  222.141.113.194
-222.141.43.205
+222.141.127.61
+222.141.147.248
+222.141.43.144
+222.141.62.4
+222.141.78.158
+222.141.87.196
  222.141.9.229
  222.142.113.51
  222.142.190.153
@@ -9164,8 +9606,9 @@
  222.188.255.95
  222.208.0.197
  222.208.3.115
-222.210.47.35
  222.211.72.66
+222.212.168.139
+222.214.52.50
  222.215.50.156
  222.217.65.112
  222.231.3.128
@@ -9205,6 +9648,7 @@
  222v333.com
  223.10.0.117
  223.10.181.67
+223.10.22.103
  223.10.35.57
  223.15.14.29
  223.154.80.169
@@ -9217,7 +9661,6 @@
  223.17.215.76
  223.197.185.60
  223.197.242.160
-223.199.26.86
  223.212.210.25
  223.212.225.68
  223.212.234.84
@@ -9326,6 +9769,7 @@
  23.94.103.138
  23.94.104.126
  23.94.104.26
+23.94.136.170
  23.94.179.44
  23.94.182.222
  23.94.190.119
@@ -9334,10 +9778,10 @@
  23.94.93.183
  23.95.0.119
  23.95.11.48
-23.95.122.47
  23.95.13.131
  23.95.186.183
  23.95.215.12
+23.95.216.13
  23.95.226.107
  23.95.226.153
  23.95.231.200
@@ -9399,6 +9843,7 @@
  24-7-supporting-link.world
  24-rw-in-ak-llc.net
  24.105.202.216
+24.11.141.134
  24.137.76.62
  24.148.98.177
  24.164.79.147
@@ -9432,14 +9877,17 @@
  24399.url.snwxn.com
  244423.simplecloud.ru
  2451239a.icu
+245978.duniyahaigol.com
  246039141.snapchatprime.com
  24621.url.xrzzk.com
  24621.xc.liaochuo.com
+247.48.198.104.bc.googleusercontent.com
  247forrent.com
  247groupnetclubs.com
  247help-lloyds.com
  247legalservices.com
  247limocarservice.com
+247owaverification.weebly.com
  247supportalart.xyz
  2482689012.yolasite.com
  24828.url.snwxn.com
@@ -9550,12 +9998,12 @@
  27.141.218.17
  27.142.245.128
  27.147.40.128
+27.15.194.170
  27.153.207.236
  27.158.161.91
  27.184.217.107
  27.187.248.22
  27.187.249.35
-27.187.251.55
  27.187.251.92
  27.192.137.78
  27.193.105.154
@@ -9604,6 +10052,7 @@
  27.199.3.194
  27.199.36.219
  27.2.138.166
+27.200.0.92
  27.200.1.139
  27.200.105.117
  27.200.155.248
@@ -9656,6 +10105,7 @@
  27.204.242.5
  27.204.247.42
  27.204.254.155
+27.205.178.110
  27.206.108.54
  27.206.154.122
  27.206.220.118
@@ -9668,6 +10118,7 @@
  27.206.97.81
  27.207.12.223
  27.207.155.31
+27.207.177.197
  27.207.180.93
  27.207.192.7
  27.207.193.63
@@ -9701,6 +10152,7 @@
  27.209.231.15
  27.209.247.111
  27.21.159.174
+27.210.10.75
  27.210.110.103
  27.210.114.170bin.sh
  27.210.127.11
@@ -9757,7 +10209,6 @@
  27.215.83.51bin.sh
  27.216.123.241
  27.216.129.117
-27.216.140.70
  27.216.174.156
  27.216.186.136
  27.216.193.217
@@ -9771,7 +10222,6 @@
  27.216.254.180
  27.216.46.85
  27.216.48.72
-27.216.64.236
  27.217.136.68bin.sh
  27.217.138.46
  27.217.139.169
@@ -9848,8 +10298,8 @@
  27.35.50.238
  27.35.50.93
  27.35.58.5
-27.37.231.114
-27.41.152.240
+27.36.12.179
+27.40.112.99
  27.41.157.5
  27.41.158.204
  27.41.179.202
@@ -9858,25 +10308,33 @@
  27.41.187.171
  27.41.204.88
  27.41.206.175
+27.41.214.60
  27.41.218.40
-27.41.36.15
-27.41.36.235
+27.41.38.144
+27.41.38.228
  27.41.38.27
-27.41.6.225
+27.41.4.84
  27.41.96.24
-27.45.63.122
-27.46.44.141
+27.46.44.166
+27.46.44.168
+27.46.45.103
+27.46.45.117
+27.46.45.43
  27.46.46.111
-27.46.47.61
+27.46.46.22
+27.46.47.69
  27.46.47.8
-27.5.21.255
+27.5.31.115
  27.5.32.191
-27.5.44.20
-27.5.45.229
+27.5.36.46
+27.5.37.94
  27.5.45.52
+27.54.123.39
  27.6.104.60bin.sh
-27.6.196.80
+27.6.195.252
+27.6.197.161
  27.6.207.11
+27.6.255.172
  27.6.30.211
  27.7.143.136
  27.78.27.110
@@ -9913,7 +10371,6 @@
  286.cool
  2869847-dot-n-e-w-me-ss-age-po-rt-al.wl.r.appspot.com
  28814.qqtn.down.gsxzq.com
-288255.alertbyte.com
  28a0151acf2915217.temporary.link
  28b89cf1a12706873.temporary.link
  28buofa28.bankofamericaslpemr.com
@@ -10107,6 +10564,7 @@
  2y5s0n1m.highperformancepchelp.top
  2ybuofa2y.bankofamericaslpemr.com
  2zonasegurabeta-viabcp-beta-com.cf
+2zse2v3hzag375l56kx2din4am-adwhj77lcyoafdy-m-facebook-com.translate.goog
  3-1-5.co.uk
  3-138-182-226.cprapid.com
  3-bill-help.com
@@ -10149,6 +10607,7 @@
  3.122.247.28
  3.123.254.92
  3.126.249.36
+3.126.91.122
  3.129.59.243
  3.131.202.18
  3.132.39.66
@@ -10223,7 +10682,6 @@
  30ywc.codesandbox.io
  31-31-199-49.ovz.vps.regruhosting.ru
  31.12.67.62
-31.130.162.71
  31.14.40.154
  31.146.102.119
  31.146.124.122
@@ -10244,16 +10702,17 @@
  31.154.234.3
  31.163.158.203
  31.163.168.177
+31.163.182.97
  31.168.184.59
  31.168.249.37
  31.170.173.73
  31.184.197.119
  31.184.233.106
  31.192.198.215
-31.210.20.120
  31.210.20.138
  31.210.20.177
  31.210.20.182
+31.210.20.227
  31.214.157.247
  31.220.2.200
  31.220.4.124
@@ -10270,6 +10729,7 @@
  311777.cc
  3118176024778156884.us-south.cf.appdomain.cloud
  312155918956168595.weebly.com
+312330.duniyahaigol.com
  313971-dot-n-e-w-me-ss-age-po-rt-al.wl.r.appspot.com
  3149111141113937151312.002.sh.cn
  315.im
@@ -10466,6 +10926,7 @@
  36.107.236.145
  36.107.239.108
  36.107.26.26
+36.108.231.218
  36.109.132.50
  36.109.133.37
  36.109.134.42
@@ -10483,7 +10944,6 @@
  36.26.194.83
  36.26.210.57
  36.32.110.7
-36.32.203.19
  36.32.25.158
  36.32.69.140
  36.32.71.33
@@ -10492,6 +10952,7 @@
  36.33.138.140
  36.33.140.232
  36.33.140.248
+36.33.160.167
  36.33.38.57
  36.34.150.235
  36.35.160.188
@@ -10925,6 +11386,7 @@
  37.49.230.9
  37.49.231.143
  37.49.231.190
+37.52.117.132
  37.59.87.172
  37.59.90.90
  37.59.98.31
@@ -11070,15 +11532,14 @@
  39.65.213.74
  39.65.3.194
  39.65.59.160
-39.66.155.59
  39.66.179.245
+39.66.32.154
  39.66.33.156
  39.66.85.187
  39.66.85.78
  39.66.97.214
  39.66.97.215
  39.67.104.83
-39.67.144.29
  39.67.146.60
  39.67.199.5
  39.68.11.133
@@ -11088,10 +11549,8 @@
  39.68.249.255
  39.68.37.250
  39.69.115.100
-39.72.116.44
  39.72.13.11
  39.72.130.114
-39.72.167.202
  39.72.59.21
  39.72.67.64
  39.72.92.84
@@ -11124,6 +11583,7 @@
  39.74.198.239
  39.74.20.114
  39.74.21.201
+39.74.224.118
  39.74.238.137
  39.74.240.204
  39.74.28.89
@@ -11150,13 +11610,13 @@
  39.77.53.40
  39.77.94.189
  39.79.107.66
-39.79.114.34
  39.79.146.109
  39.79.147.75
  39.79.149.166
  39.79.185.120
  39.79.185.120bin.sh
  39.79.217.51
+39.79.218.46
  39.79.220.21
  39.79.34.245
  39.79.65.231
@@ -11164,6 +11624,7 @@
  39.79.93.171
  39.79.95.113
  39.80.127.214
+39.80.188.238
  39.80.191.137
  39.80.191.223
  39.80.191.36
@@ -11171,24 +11632,27 @@
  39.80.191.49bin.sh
  39.80.202.13
  39.80.204.85
+39.80.214.148
  39.80.24.54
  39.80.36.151
  39.80.49.229
  39.80.49.95
  39.80.83.114
+39.81.124.33
  39.81.130.19
  39.81.139.3
  39.81.184.205
  39.81.189.207
  39.81.197.174
+39.81.230.35
  39.81.238.18
  39.81.25.141
  39.81.65.168
  39.82.8.36
-39.83.14.46
  39.83.185.237
  39.83.186.54
  39.83.56.21
+39.83.86.34
  39.83.94.11
  39.84.234.85
  39.84.34.217
@@ -11197,6 +11661,7 @@
  39.84.91.64
  39.85.1.167
  39.85.197.204
+39.85.54.4
  39.85.64.200
  39.85.92.197
  39.86.129.233
@@ -11209,7 +11674,6 @@
  39.86.248.91
  39.86.249.146
  39.86.39.219
-39.86.58.13
  39.86.58.173
  39.86.60.98
  39.86.62.244
@@ -11219,13 +11683,14 @@
  39.86.66.16
  39.86.66.24
  39.86.76.213
+39.86.78.228
  39.86.8.199
+39.86.81.0
  39.86.82.189
  39.86.83.30
  39.87.237.182
  39.87.60.188
  39.87.63.58
-39.87.87.117
  39.88.109.128
  39.88.132.211
  39.88.133.23
@@ -11471,6 +11936,7 @@
  3vc6.seeanu.ru
  3verify-billing.com
  3verifyinfo.com
+3wgfhggujm.s3-us-west-2.amazonaws.com
  3wllsfrg0.webcindario.com
  3wondersexpeditions.com
  3xportfolio.com
@@ -11485,7 +11951,6 @@
  4.program-iq.com
  4.top4top.io
  4.uni-webs.com
-4.whb.tempwebhost.listing.wantsbro.com
  40.114.104.42
  40.117.133.229
  40.118.205.218
@@ -11524,7 +11989,6 @@
  41.208.150.114
  41.215.79.182
  41.216.225.250
-41.216.225.96
  41.220.119.246
  41.226.60.115
  41.226.60.138
@@ -11533,6 +11997,7 @@
  41.86.18.10
  41.86.18.150
  41.86.18.152
+41.86.18.170
  41.86.18.174
  41.86.18.20
  41.86.18.202
@@ -11544,8 +12009,6 @@
  41.86.19.206
  41.86.21.27
  41.86.21.28
-41.86.21.35
-41.86.21.38
  41.86.21.44
  41.86.21.59
  41.86.21.62
@@ -11553,7 +12016,6 @@
  41.86.46.245
  41.86.5.103
  41.86.5.197
-41.86.5.233
  41.89.94.30
  4117570-dot-n-e-w-me-ss-age-po-rt-al.wl.r.appspot.com
  413bd12fe0.nxcli.net
@@ -11576,24 +12038,34 @@
  42.200.226.58
  42.202.101.136
  42.224.100.183
+42.224.114.27
  42.224.118.120
+42.224.119.66
  42.224.122.152
+42.224.127.10
+42.224.170.244
+42.224.172.207
  42.224.175.185
  42.224.177.237
  42.224.179.90
  42.224.180.248
+42.224.216.25
+42.224.25.69
  42.224.251.30
+42.224.4.90
  42.224.45.245
  42.224.46.135
+42.224.64.108
  42.224.70.21
-42.224.77.171
+42.224.70.60
+42.224.73.114
  42.224.98.101
+42.225.205.182
  42.225.35.42
-42.225.5.113
-42.226.71.88
  42.226.95.198
  42.227.121.217
  42.227.134.39
+42.227.146.13
  42.227.164.112
  42.227.165.192
  42.227.165.72
@@ -11603,38 +12075,44 @@
  42.227.240.251
  42.227.25.126
  42.228.124.84
-42.228.223.136
  42.228.237.138
-42.228.247.232
-42.228.32.140
-42.228.35.216
+42.228.245.136
  42.228.43.26
+42.228.46.2
  42.228.47.6
  42.228.60.114
+42.228.64.186
+42.228.70.101
  42.228.70.135
+42.228.77.76
+42.228.79.117
  42.228.79.60
  42.228.80.137
+42.228.85.149
  42.229.184.100
  42.229.197.86
  42.230.121.99
  42.230.122.127
-42.230.157.108
-42.230.179.43
+42.230.124.116
+42.230.136.90
  42.230.18.88
+42.230.194.112
+42.230.216.158
  42.230.229.207
+42.230.246.15
  42.230.27.134
  42.230.35.192
-42.230.37.50
  42.230.43.23
  42.230.50.192
+42.230.54.16
  42.230.62.207
  42.230.80.169
-42.230.80.194
+42.230.91.126
  42.231.111.173
+42.231.130.153
  42.231.161.220
-42.231.245.111
+42.231.240.206
  42.231.42.217
-42.231.67.1
  42.232.100.48
  42.232.101.226
  42.232.102.246
@@ -11643,73 +12121,75 @@
  42.233.102.105
  42.233.108.41
  42.233.108.61
+42.233.149.36
  42.233.232.93
  42.233.254.41
  42.233.32.16
-42.234.106.110
  42.234.152.142
  42.234.186.167
  42.234.190.224
-42.234.191.143
+42.234.209.57
  42.234.220.118
  42.234.221.24
  42.234.232.13
+42.234.233.196
  42.234.236.206
+42.234.245.42
  42.234.253.70
+42.235.102.51
  42.235.114.202
-42.235.142.168
  42.235.146.181
  42.235.156.137
+42.235.174.196
  42.235.18.34
+42.235.184.87
  42.235.20.211
  42.235.30.175
  42.235.51.159
-42.235.55.101
  42.235.57.48
  42.235.88.20
-42.235.90.166
  42.235.93.2
  42.236.160.189
  42.236.161.183
  42.236.161.43
  42.236.212.174
-42.236.212.75
  42.236.213.112
  42.236.214.11
-42.236.214.125
  42.236.214.34
  42.236.215.216
  42.236.215.249
+42.236.220.238
  42.236.221.189
  42.236.222.184
  42.236.223.225
  42.236.223.79
  42.236.252.134
-42.237.0.216
  42.237.197.58
  42.237.40.112
-42.238.161.41
+42.237.47.0
+42.238.143.38
  42.238.171.210
+42.238.171.67
  42.238.191.191
  42.238.231.157
  42.238.239.247
  42.238.244.51
  42.238.5.149
+42.238.91.208
  42.239.145.30
-42.239.150.179
  42.239.153.95
  42.239.181.224
-42.239.190.24
  42.239.193.119
-42.239.213.103
+42.239.197.205
+42.239.219.167
+42.239.230.147
  42.239.233.124
  42.239.237.197
  42.239.239.71
  42.239.246.63
-42.239.254.217
+42.239.94.23
  42.56.15.227
  42.59.204.103
-42.85.206.36
  42.87.76.172
  420365365.com
  420marijuanalist.com
@@ -11732,6 +12212,7 @@
  43-245-61-213.cprapid.com
  43.229.149.83
  43.229.151.135
+43.230.207.204
  43.241.106.183
  43.241.127.92
  43.250.164.92
@@ -11802,12 +12283,13 @@
  45.129.96.49
  45.13.58.149
  45.13.58.4
-45.130.138.102
+45.130.138.47
  45.130.138.66
  45.132.105.43
  45.132.242.49
  45.133.1.137
  45.133.1.205
+45.133.1.242
  45.133.9.21
  45.133.9.60
  45.135.118.144
@@ -11821,7 +12303,6 @@
  45.14.149.182
  45.14.149.204
  45.14.149.244
-45.14.149.44
  45.14.149.66
  45.14.150.19
  45.14.150.29
@@ -11849,6 +12330,8 @@
  45.14.224.69
  45.14.224.77
  45.14.50.207
+45.140.146.180
+45.140.146.208
  45.140.168.127
  45.140.168.138
  45.140.169.30
@@ -11909,7 +12392,6 @@
  45.148.10.92
  45.148.10.94
  45.148.10.95
-45.148.10.96
  45.148.120.126
  45.148.120.155
  45.148.120.193
@@ -11917,6 +12399,8 @@
  45.15.143.129
  45.15.143.151
  45.15.24.48
+45.150.67.13
+45.150.67.9
  45.153.187.110
  45.153.203.119
  45.153.203.129
@@ -11936,21 +12420,27 @@
  45.161.255.21
  45.161.255.62
  45.164.140.130
+45.164.140.133
  45.173.88.33
  45.176.108.116
+45.176.109.253
  45.176.109.28bin.sh
+45.176.109.8
+45.176.110.248
  45.176.110.99
-45.176.111.92
+45.176.111.157
+45.176.111.33
  45.188.82.131
  45.201.173.181
  45.201.175.222
  45.201.209.44
-45.224.170.121
+45.224.169.35
  45.23.22.186
  45.230.228.26
  45.232.73.46bin.sh
  45.233.169.14
  45.238.23.82
+45.248.162.35
  45.248.194.48
  45.248.195.170
  45.248.195.94
@@ -12058,7 +12548,7 @@
  45.84.196.99
  45.85.0.98
  45.85.219.74
-45.85.90.29
+45.85.90.149
  45.86.65.210
  45.88.110.171
  45.88.3.145
@@ -12238,7 +12728,7 @@
  46.183.221.44
  46.183.66.210
  46.200.232.86
-46.201.2.143
+46.201.214.64
  46.201.5.174
  46.21.111.219
  46.21.153.231
@@ -12358,6 +12848,7 @@
  49.115.203.30
  49.115.97.206
  49.115.98.124
+49.116.182.124
  49.116.182.64
  49.116.183.36
  49.116.193.92
@@ -12366,7 +12857,6 @@
  49.116.212.39
  49.116.214.38
  49.116.71.58
-49.116.76.120
  49.117.188.163
  49.117.188.251
  49.117.189.177
@@ -12817,6 +13307,7 @@
  5035.31cf4fdae.com
  5039.31cf4fdae.com
  50391180620948717180.us-south.cf.appdomain.cloud
+503932.duniyahaigol.com
  5042.31cf4fdae.com
  5050brandings.com
  506365365.com
@@ -12888,7 +13379,7 @@
  51.68.90.244
  51.75.160.57
  51.75.191.176
-51.75.191.236
+51.75.191.234
  51.75.210.192
  51.75.33.122
  51.75.33.127
@@ -12979,6 +13470,8 @@
  52.156.78.167
  52.166.62.239
  52.168.171.67
+52.171.193.33
+52.171.222.203
  52.175.150.108
  52.185.205.1
  52.188.147.170
@@ -12990,6 +13483,7 @@
  52.216.184.165
  52.217.100.30
  52.217.4.38
+52.221.196.207
  52.224.126.72
  52.25.195.145
  52.252.7.14
@@ -13143,6 +13637,7 @@
  56ace.website
  56q.ru
  5700cf64234e71c0dbb53b5ca6b50802-dot-dbenitonline.ey.r.appspot.com
+572421.duniyahaigol.com
  5731773-dot-oaao-274308.uc.r.appspot.com
  5740389-dot-n-e-w-me-ss-age-po-rt-al.wl.r.appspot.com
  574hx1gb.info
@@ -13153,6 +13648,8 @@
  57bofa75.bofa0serivceb.com
  57d3e30e.duckdns.org
  57vd9.app.link
+58.115.162.92
+58.126.247.118
  58.141.122.109
  58.141.144.18
  58.141.144.18bin.sh
@@ -13163,6 +13660,7 @@
  58.162.218.151
  58.171.153.81
  58.171.38.26
+58.18.103.109
  58.209.239.23
  58.212.59.53
  58.217.171.157
@@ -13183,13 +13681,12 @@
  58.23.247.73
  58.23.58.173
  58.232.155.37
-58.238.42.192
  58.239.153.252
  58.240.103.107
  58.240.147.97
  58.240.148.13
  58.240.148.13bin.sh
-58.241.179.145
+58.241.57.32
  58.241.78.55
  58.242.121.248
  58.242.169.14
@@ -13207,7 +13704,6 @@
  58.243.127.176
  58.243.127.215
  58.243.188.145
-58.243.189.104
  58.243.189.67
  58.243.19.107
  58.243.19.196
@@ -13216,27 +13712,37 @@
  58.243.20.165
  58.243.20.212
  58.243.67.185
-58.248.113.11
+58.248.114.72
+58.248.115.100
  58.248.118.15
-58.248.143.60
-58.248.144.94
  58.248.146.133
  58.248.149.231
+58.248.151.143
+58.248.153.131
+58.248.155.55
+58.248.74.8
+58.248.76.38
  58.248.78.150
+58.249.10.64
+58.249.11.244
  58.249.13.137
-58.249.13.181
-58.249.14.187
-58.249.19.198
-58.249.77.20
-58.249.79.66
-58.249.84.178
+58.249.19.138
+58.249.72.127
+58.249.76.84
+58.249.80.246
+58.249.83.76
  58.249.84.182
-58.249.85.130
+58.249.84.55
  58.249.86.123
-58.249.88.205
+58.249.87.20
+58.249.87.253
+58.249.9.20
  58.249.90.155
+58.252.178.163
+58.253.10.27
  58.27.215.3
  58.48.154.143
+58.50.178.137
  58.50.208.225
  58.52.179.215
  58.72.165.153
@@ -13255,6 +13761,7 @@
  58499929.embeddedsw.org
  5856.31cf4fdae.com
  5856919-dot-n-e-w-me-ss-age-po-rt-al.wl.r.appspot.com
+586662.duniyahaigol.com
  586b63e6473105292.temporary.link
  587675.com
  587aded7dd48.ngrok.io
@@ -13288,6 +13795,8 @@
  59.174.51.108
  59.175.116.137
  59.177.37.32
+59.180.137.231
+59.180.153.33
  59.181.106.18
  59.181.122.64bin.sh
  59.186.106.20
@@ -13309,72 +13818,90 @@
  59.5.230.140bin.sh
  59.7.124.148
  59.8.35.22
-59.88.222.243
-59.89.243.224
+59.89.240.210
+59.89.243.70
  59.9.77.181
-59.92.176.60
-59.92.177.132
-59.92.177.70
-59.92.179.196
-59.92.18.198
-59.92.18.236
-59.92.180.202
-59.92.181.191
-59.92.218.166
-59.93.16.184
-59.93.16.241
-59.93.18.157
-59.93.18.194
-59.93.18.200
-59.93.18.245
-59.93.19.162
-59.93.19.42
-59.93.21.7
-59.93.22.249
-59.94.180.152
-59.94.180.97
-59.94.181.18
-59.94.181.26
-59.94.182.89
-59.94.183.37
-59.94.183.55
-59.95.172.104
-59.95.172.191
-59.96.24.173
-59.96.26.161
-59.96.27.60
+59.92.176.100
+59.92.177.123
+59.92.177.37
+59.92.178.108
+59.92.178.17
+59.92.18.105
+59.92.18.170
+59.92.180.34
+59.92.180.82
+59.92.181.156
+59.92.182.102
+59.92.182.251
+59.92.216.97
+59.92.218.34
+59.92.219.4
+59.93.16.183
+59.93.18.171
+59.93.18.32
+59.93.21.126
+59.93.21.94
+59.94.180.235
+59.94.182.127
+59.94.182.201
+59.94.183.144
+59.95.175.23
+59.95.175.237
+59.95.175.8
+59.96.25.100
+59.96.26.200
+59.96.27.134
+59.96.27.208
+59.96.36.117
  59.96.36.236
-59.96.37.213
-59.96.38.205
-59.97.170.205
-59.97.170.79
-59.97.172.192
-59.97.173.157
-59.97.174.197
-59.97.174.46
-59.97.192.216
-59.97.192.224
-59.99.136.138
-59.99.137.107
-59.99.138.226
-59.99.140.182
-59.99.140.29
-59.99.142.29
-59.99.142.89
-59.99.143.125
-59.99.190.220
-59.99.42.107
-59.99.42.200
-59.99.42.53
-59.99.43.174
-59.99.43.215
-59.99.45.177
-59.99.45.7
-59.99.92.133
-59.99.92.170
-59.99.92.98
-59.99.95.236
-59.99.95.36
+59.96.37.61
+59.96.38.67
+59.96.39.237
+59.96.39.51
+59.97.169.127
+59.97.169.254
+59.97.169.29
+59.97.169.54
+59.97.170.131
+59.97.170.178
+59.97.170.224
+59.97.170.250
+59.97.170.252
+59.97.172.134
+59.97.174.162
+59.97.175.231
+59.97.194.104
+59.99.136.44
+59.99.136.77
+59.99.137.110
+59.99.137.244
+59.99.141.137
+59.99.141.203
+59.99.141.217
+59.99.141.50
+59.99.141.58
+59.99.142.208
+59.99.143.1
+59.99.188.43
+59.99.190.227
+59.99.190.249
+59.99.190.46
+59.99.191.177
+59.99.40.155
+59.99.41.249
+59.99.42.210
+59.99.42.251
+59.99.42.71
+59.99.45.135
+59.99.45.165
+59.99.45.200
+59.99.47.238
+59.99.92.215
+59.99.92.241
+59.99.93.119
+59.99.93.179
+59.99.95.15
+59.99.95.52
  590466-dot-n-e-w-me-ss-age-po-rt-al.wl.r.appspot.com
  5918062d-fb42-4707-b098-e2c266e14d95.htmlpasta.com
  591860.playcode.io
@@ -13407,7 +13934,6 @@
  5b0f6cb9-0485-4fc7-9775-eb74bb45bbf6.htmlcomponentservice.com
  5b21rh.cf
  5b56ced5c8c90c49c25f2c0adb06155617211ed3.info
-5b5b853b40927aae72993fdc9fd75065.homelandfoundation.org
  5bb3b58f395fba57ce0dced5e7f2d5ee.net
  5bl.us
  5bn0j.app.link
@@ -13469,6 +13995,8 @@
  5mzsbudb69d2.talagaremix.com
  5n3.nwnfd.cn
  5na.ru
+5o18cijbf.libkrasnopolie.by
+5p8b6pb4.com
  5pointauto.com
  5pymk.weblium.site
  5raaa3leeek.ddns.net
@@ -13511,7 +14039,6 @@
  60.162.183.92
  60.162.187.162
  60.162.191.86
-60.17.99.40
  60.170.101.25
  60.170.189.102
  60.175.124.27
@@ -13556,7 +14083,6 @@
  60.212.220.167
  60.212.237.219
  60.212.24.148
-60.212.254.106
  60.212.254.178
  60.212.26.164
  60.212.28.254
@@ -13571,12 +14097,12 @@
  60.214.196.157
  60.214.239.108
  60.214.33.185
+60.214.34.104
  60.214.34.129
  60.214.55.159
  60.215.161.150
  60.215.161.69
  60.215.182.18
-60.215.190.108
  60.215.190.176
  60.215.202.140
  60.215.203.48
@@ -13584,13 +14110,14 @@
  60.215.215.19
  60.216.95.97
  60.217.120.44
-60.217.124.57
  60.217.177.196
  60.217.86.84
+60.223.84.107
  60.223.92.105
  60.24.124.52
  60.24.72.131
  60.243.149.14
+60.243.213.12
  60.253.14.166
  60.253.43.137
  60.253.46.20
@@ -13600,14 +14127,16 @@
  60.253.62.43
  60.253.8.65
  60.253.8.81
+60.254.22.84
+60.254.55.59
  60.26.18.225
  60.26.230.19
  60.26.87.86
  60.3.208.37
  60.7.10.121
-60.7.101.33
  60.7.94.111
  60.7.99.254
+60.9.96.173
  60.93.23.51
  60112501-dot-sydneyma.appspot.com
  601294-dot-n-e-w-me-ss-age-po-rt-al.wl.r.appspot.com
@@ -13632,6 +14161,7 @@
  61.109.164.23
  61.133.77.176
  61.140.13.161
+61.141.125.110
  61.146.108.150
  61.147.48.95
  61.156.208.53
@@ -13640,12 +14170,13 @@
  61.162.169.210
  61.162.28.211
  61.162.55.42
-61.163.128.183
  61.163.136.104bin.sh
  61.163.142.55
  61.163.156.160
  61.164.96.98
+61.168.136.101
  61.168.139.52
+61.168.50.87
  61.179.219.114
  61.179.247.228
  61.179.247.228bin.sh
@@ -13666,10 +14197,18 @@
  61.241.170.50
  61.241.171.170
  61.254.broadband2.iol.cz
-61.3.125.114
-61.3.151.66
+61.3.125.48
+61.3.127.73
+61.3.144.62
+61.3.145.35
+61.3.146.240
+61.3.148.140
+61.3.148.221
+61.3.151.31
+61.41.230.161
  61.52.100.125
  61.52.101.233
+61.52.101.26
  61.52.102.61
  61.52.11.87
  61.52.128.79
@@ -13677,51 +14216,57 @@
  61.52.130.51
  61.52.131.12
  61.52.133.165
+61.52.170.67
+61.52.176.232
  61.52.192.227
  61.52.197.176
  61.52.198.118
-61.52.209.239
  61.52.210.161
-61.52.210.40
  61.52.212.132
  61.52.213.79
  61.52.241.193
  61.52.28.126
  61.52.28.79
+61.52.34.77
+61.52.36.84
  61.52.43.138
  61.52.45.16
+61.52.46.223
  61.52.52.39
+61.52.56.173
  61.52.60.58
-61.52.63.167
-61.52.82.127
+61.52.78.234
+61.52.8.188
+61.52.86.132
  61.52.97.134
  61.52.98.12
  61.52.98.151
  61.52.98.175
  61.52.98.32bin.sh
  61.53.11.91
-61.53.118.221
+61.53.119.207
  61.53.119.67
  61.53.120.138
-61.53.122.229
-61.53.157.111
-61.53.175.17
-61.53.202.255
+61.53.122.71
+61.53.125.147
  61.53.220.102
-61.53.222.87
  61.53.241.13
+61.53.248.54
  61.53.27.71
  61.53.40.47
-61.53.51.209
+61.53.42.45
  61.53.72.40
  61.53.74.249
+61.53.75.50
  61.53.83.108
  61.53.89.144
-61.53.9.57
  61.53.96.12
+61.53.96.236
+61.54.10.113
  61.54.218.245
  61.54.248.217
  61.54.249.180
+61.54.40.47
  61.54.43.28
  61.54.59.145
  61.54.61.168
@@ -13738,6 +14283,7 @@
  61.79.229.112
  61.79.229.112bin.sh
  61.85.224.42
+61.97.152.106
  61.98.144.75
  610548790621846-dot-aql-rkl-evh.appspot.com
  611201-dot-n-e-w-me-ss-age-po-rt-al.wl.r.appspot.com
@@ -13759,7 +14305,6 @@
  61z39.cn
  62.101.254.191
  62.108.34.51
-62.108.37.248
  62.109.133.248
  62.113.238.148
  62.122.195.162
@@ -13780,7 +14325,6 @@
  62.4.16.167
  62.4.18.68
  62.4.23.127
-62.60.134.235
  62.75.141.82
  62.75.187.192
  62.80.235.224
@@ -13937,6 +14481,7 @@
  65.36.62.20
  650flwersinsta.000webhostapp.com
  650vm.app.link
+651209.duniyahaigol.com
  652.3190cfdae.com
  653635dda973c896905dc7b87958b1ca0ae257b9.info
  6537712314-itm.ltd
@@ -14062,6 +14607,7 @@
  67.229.48.247
  67.245.151.203
  67.245.47.152
+67.3.169.223
  67.81.98.111
  67.82.242.243
  67.83.134.39
@@ -14071,6 +14617,7 @@
  671-fitness.com-swd.net
  67115756.com
  672-healthandbeauty.com-t0p.net
+675800.duniyahaigol.com
  675yhgrt.gb.net
  676-fitness.com-4us.net
  676698login.com
@@ -14184,6 +14731,7 @@
  69.10.62.78
  69.115.37.205
  69.124.231.110
+69.130.207.107
  69.14.208.221
  69.163.33.84
  69.164.145.131
@@ -14196,12 +14744,12 @@
  69.51.24.27
  69.51.24.28
  69.65.3.168
+691839.duniyahaigol.com
  69348.psdzy.com
  693bst.com
  694abb3803c5deafd8190766530a5fdd.webredirect.org
  695-weightloss.com-t0p.net
  6965056.servicesbpd.xyz
-6968dc08603839457.temporary.link
  6973272-dot-n-e-w-me-ss-age-po-rt-al.wl.r.appspot.com
  69809.psdzy.com
  69853214.weebly.com
@@ -14239,7 +14787,6 @@
  6fy7tg8y96f87tr.xyz
  6gbofag6.bofa0serivceb.com
  6gsdlmpym.com
-6hhymaxeqmv5w5xyogt2tyl33e--www-paypal-com.translate.goog
  6hj6.work
  6hu.xyz
  6i4sgyjduiahyyg.e8273.pro
@@ -14313,6 +14860,7 @@
  7083719.synergyglobal.one
  7085606-dot-n-e-w-me-ss-age-po-rt-al.wl.r.appspot.com
  7086552.com
+708693.duniyahaigol.com
  70cmdbu92cds598.sted.cc
  70efbf02d17896982d2d1d0d249d51e2-dot-oo0-987.appspot.com
  70vimq4rswsc.talagaremix.com
@@ -14325,6 +14873,7 @@
  71.30.212.60
  71.34.191.213
  71.40.45.94
+71.43.235.106
  71.50.31.38
  71.57.180.213
  71.72.196.159
@@ -14340,6 +14889,7 @@
  717720.com
  7178738ba71e0b5ef7a8208dfajekjfl329a.asd1377.com
  71sise.com
+71yc.hizman.ru
  71zhuan.com
  72.17.22.30
  72.18.130.41
@@ -14405,6 +14955,7 @@
  74.101.225.121
  74.108.124.180
  74.115.50.111
+74.116.216.141
  74.117.183.84
  74.120.55.163
  74.124.219.29
@@ -14445,6 +14996,7 @@
  75.127.14.170
  75.127.7.198
  75.139.38.211
+75.176.213.114
  75.177.207.146
  75.65.31.8
  75.74.7.227
@@ -14497,6 +15049,7 @@
  766365365.com
  766809-dot-n-e-w-me-ss-age-po-rt-al.wl.r.appspot.com
  7670845-dot-n-e-w-me-ss-age-po-rt-al.wl.r.appspot.com
+767192.duniyahaigol.com
  767644-dot-n-e-w-me-ss-age-po-rt-al.wl.r.appspot.com
  768ecei54.com
  768tghasdasf.xyz
@@ -14510,7 +15063,6 @@
  77.55.211.77
  77.68.114.124
  77.68.115.33
-77.68.76.113
  77.73.69.101
  77.73.69.137
  77.73.69.50
@@ -14530,6 +15082,7 @@
  773475d.ddns.net
  7741902.servicesbpd.club
  77423075472693407483.us-south.cf.appdomain.cloud
+774742.duniyahaigol.com
  774907864314.ngrok.io
  774d151c73.nxcli.net
  774jordanlane.com
@@ -14564,7 +15117,6 @@
  78.143.96.35
  78.159.97.56
  78.182.254.231
-78.186.155.18
  78.186.216.101
  78.187.137.194
  78.187.156.31
@@ -14625,7 +15177,7 @@
  79.167.165.180
  79.167.90.228
  79.174.24.172
-79.19.203.182
+79.22.176.145
  79.54.115.243
  79.61.191.231
  79.63.131.98
@@ -14672,9 +15224,9 @@
  7c3fd09417.2319edmondson.xyz
  7cbofac7.bofa0serivceb.com
  7cbuofa7c.bankofamericaslpemr.com
+7college.du.ac.bd
  7colours.co.za
  7continents7lawns.com
-7ctech.com
  7d-textile.com
  7d07afc530.nxcli.net
  7d54v.app.link
@@ -14682,6 +15234,7 @@
  7dbuofa7d.bankofamericaslpemr.com
  7de3.shandow.ru
  7demka24h7.live
+7dex5cglcfpd7vpbzccohb2qgy-adwhj77lcyoafdy-www-paypal-com.translate.goog
  7di3pzftcfovhzf.e8273.pro
  7dot.cn
  7dsl.cc
@@ -14818,6 +15371,7 @@
  80smp4.xyz
  80wlg02q6h.sted.cc
  80yuanma.com
+81.0.236.90
  81.10.2.58
  81.134.179.184
  81.169.140.14
@@ -14896,7 +15450,6 @@
  82.8.232.51
  82.80.191.120
  82.81.102.84
-82.81.247.239
  82.81.4.57
  8200msc.com
  8203her928h7e4dd8305d3b0d52a2616-dot-polynomial-sum-287816.df.r.appspot.com
@@ -14957,7 +15510,6 @@
  84.205.47.232
  84.209.31.168
  84.210.219.208
-84.210.219.213
  84.212.219.127
  84.239.39.142
  84.239.39.89
@@ -15083,6 +15635,7 @@
  86buortfa86.bankofamericaslpemr.com
  86g8ur.000webhostapp.com
  86mld.com
+87.10.166.84
  87.106.139.101
  87.106.205.195
  87.106.225.180
@@ -15131,6 +15684,7 @@
  87ms.com
  87n3t-m3m45.net
  87n3t-m3m50.com
+88.119.171.253
  88.129.235.44
  88.132.194.239bin.sh
  88.138.88.184
@@ -15157,14 +15711,12 @@
  88.218.17.223
  88.218.17.232
  88.218.92.124
-88.238.178.255
  88.247.194.52
  88.247.212.56
  88.249.120.205
  88.249.181.198
  88.250.210.8
  88.250.223.190
-88.250.226.26
  88.26.181.16
  88.58.209.2
  88.80.20.35
@@ -15412,7 +15964,6 @@
  91.209.70.22
  91.210.224.123
  91.212.150.176
-91.212.150.195
  91.212.150.241
  91.216.190.14
  91.216.190.152
@@ -15427,13 +15978,11 @@
  91.233.197.70
  91.234.33.206
  91.234.60.94
-91.234.99.115
  91.234.99.193
  91.234.99.203
  91.234.99.234
  91.235.143.197
  91.239.168.83
-91.241.19.107
  91.241.19.159
  91.241.19.223
  91.242.136.103
@@ -15579,7 +16128,6 @@
  9370589-dot-n-e-w-me-ss-age-po-rt-al.wl.r.appspot.com
  938388f6f32773886.temporary.link
  93882038488399920rt.30938292930r.repl.co
-939607.xyz
  93a1d696.ngrok.io
  93b30803f9a3572cddf0c106624dcb69.info
  93jhwpuyranq.talagaremix.com
@@ -15802,7 +16350,7 @@
  98.18.100.201
  98.192.74.164
  98.199.196.197
-98.26.226.238
+98.249.236.11
  98.28.200.139
  98.ip-51-91-254.eu
  98.yt69sf.com
@@ -16105,9 +16653,9 @@ a0490572.xsph.ru
  a0491450.xsph.ru
  a0491671.xsph.ru
  a0510942.xsph.ru
-a0524067.xsph.ru
+a0523397.xsph.ru
+a0524597.xsph.ru
  a06kz.mentriqq.com
-a08a.org.uk
  a098327634868288934.web.app
  a0991d3c6bd14af994610478701f22cf39296297.info
  a0d.oujevais.com
@@ -16132,7 +16680,7 @@ a19k.svcoding.com
  a1b12b9f89fee36ec0a4544612140cba-dot-dbenitonline.ey.r.appspot.com
  a1c0-n1t0ix.com
  a1e.casa
-a1jny-ggb2o-klmuii.s3-eu-west-1.amazonaws.com
+a1izmilnhb1.libkrasnopolie.by
  a1news24.com
  a1q-3.svcoding.com
  a1r4e52.net
@@ -16344,11 +16892,11 @@ aajpk.com
  aajtakmedia.in
  aajuuioo.cam
  aajzabanqzdosyja-dot-millinium.ey.r.appspot.com
+aakasha.work
  aakbz.xyz
  aakgbxitebiqehiqfr.000webhostapp.com
  aakhyrkazqcyaafk-dot-millinium.ey.r.appspot.com
  aakritpatel.com
-aakskkd-sjdsidsm-sjskdssmm.s3-eu-west-1.amazonaws.com
  aaktrade.com
  aal-ver.com
  aalatas.com
@@ -16605,6 +17153,7 @@ abdullahnetwork.com
  abdullahsametcetin.com
  abdullahsheikh.info
  abdumido20181.ddns.net
+abe-radio.com
  abeafrique.org
  abeanthoc.com
  abedtravels.co.uk
@@ -16787,7 +17336,6 @@ abomaka.ddns.net
  abomazprdotdofgc-dot-millinium.ey.r.appspot.com
  abominable789.000webhostapp.com
  abomosalem.com
-abondano.in
  aboralsiamese.htmlpasta.com
  aborto-legal.com
  abortoptions.com
@@ -16808,7 +17356,6 @@ about-smokes.000webhostapp.com
  about.btreesystems.com
  about.facebook-page.business-id-145654234324234.com
  aboutacquisitions.com
-aboutcopyrightcenter.cf
  aboutfb-support.com
  aboutforviolation.com
  abouthomes.icu
@@ -16838,7 +17385,7 @@ abr5.com
  abrafond.com.br
  abraj-re.com
  abrajr87g2.temp.swtest.ru
-abrajr87g7.temp.swtest.ru
+abrajr87g8.temp.swtest.ru
  abrakadabraboom.xyz
  abranchiate-chock.000webhostapp.com
  abrandaid.com
@@ -16870,6 +17417,7 @@ abscete.info
  abschiedvonmatthiascom.chifanassume.top
  absentomar.net
  absentoutfit.xyz
+absentsecond.com
  absepstssrvcpgs01.my.id
  abservshplesttngpkun.my.id
  abshhuhi-wnafb.com
@@ -16878,7 +17426,6 @@ absimpex.com
  absoftechworld.com
  absogain.ir
  absolutaservicos.com
-absolute-accessscaffolding.co.uk
  absolute-vertex-289818.ey.r.appspot.com
  absoluteamusements.com
  absolutelyclean.net
@@ -17063,8 +17610,6 @@ acc-lock-recovery.mainhajar-terus.xyz
  acc-log-bofa.com
  acc-notification--pages.my.id
  acc-notification-security.my.id
-acc-recover-help.mainhajar-terus.xyz
-acc-recover-police.langsung-barbar.xyz
  acc-recovery-support-live.my.id
  acc-security.redirectme.net
  acc-store.000webhostapp.com
@@ -17474,7 +18019,7 @@ accesso-intesa-sanpaolo-sicurezza-conto.hospitals-malaysia.org
  accesso-mps.com
  accesso-online.com
  accesso-sella-it.info
-accesso-sicuro-intesa.com
+accesso-sicuro-gruppoisp.com
  accesso-update.com
  accesso-web.com
  accesso-you-web.com
@@ -17519,6 +18064,7 @@ accompany7143efg.allsalelist.com
  accompanyescorts.com
  accomplish-drippy.com
  acconmzone.anieonw.top
+accont-gooqle-support.ru
  accontsidvrifyupdtediclloud.bisniskhu.com
  acconuts-snapchat-confirm.com
  accoountprotect.com
@@ -18054,6 +18600,7 @@ accounthelpcentorsyhuyusdhvuysughrsuginsdfygbviushndifis.xyz
  accounthelpcentorsyhuyusdhvuysughrsuginsdfygfwegregtergreger.xyz
  accounthelpcentorsytasbdvhmasbjsadbfnhmbiufawsystems.xyz
  accounthelpukhmykbrcbmvcdvchjvfchjchvnvcxdfc.xyz
+accounti98-mainy8.redirectme.net
  accountid-manage-verify.netflixjnck.net
  accountid0982763-3billng.com
  accountidsupport.com
@@ -18088,7 +18635,6 @@ accountmicrosoft2020.yolasite.com
  accountmydemangaes.bounceme.net
  accountnena.net
  accountnetfli.com
-accountnetflix-billinginfo.com
  accountnetflix-subscriptioninfocancel.kotaknngsor.com
  accountnetflix-subscriptioninfocancel.monkasxel.com
  accountnetflix-verifyonhold.com
@@ -18263,6 +18809,7 @@ accounttfb9.webnode.com
  accounttfb958.webnode.com
  accounttsetting.webnode.com
  accountunhold.site
+accountup.buzz
  accountupdaaccountupda.xyz
  accountupdat-amazon.com
  accountupdate.amazon.co.jp-1i90h8201l967om3e169.yssddy.cn
@@ -18359,7 +18906,6 @@ acctnlogintoverifysubscriptiononeflix.com
  acctntfx-supports.com
  acctreview.onrender.com
  acctvalidationchase.com
-accueil-agricole.trsp.ir
  accumaxlathe.com
  accurate-engineers.in
  accurateaccessupdate.weebly.com
@@ -18425,6 +18971,7 @@ acesso-app-cliente.ga
  acesso-app.online
  acesso-aqui-itau.com
  acesso-br.com
+acesso-internet-banking.com
  acesso-online.com
  acesso-personnalite30hrs.com
  acesso-portal.com
@@ -18662,10 +19209,10 @@ acta.ai
  actamazadmincenter.com
  actamazadmincenter.net
  actasociados.com
+actcfwknexhykindluesavspam-dot-gle39404049.rj.r.appspot.com
  actecfoundation.org
  actedo.org
  acteon.com.ar
-actforreal.com
  acth.fr
  actia.nu
  actialuzaciones-zonausegurabnbeta1.com
@@ -18753,6 +19300,8 @@ active-facebook-garena.3utilities.com
  active-instagram.1gb.ru
  active-olive.cloudvent.net
  active-page-dashboard-2021.my.id
+active-page-dashboard-required.com
+active-page-dashboard.my.id
  active-payee-support.com
  active-paypal-id234.com
  active-prof.xyz
@@ -18775,6 +19324,7 @@ activeenlineasuproductos.com
  activeer-rekening.info
  activefaithhost.com
  activehand.com.tr
+activel-secures.weebly.com
  activelogisticsltd.com
  activemail-activation-upgrade.glitch.me
  activemedia.com
@@ -18890,6 +19440,7 @@ actuvillage.com
  actxulfzjvplzblu-dot-millinium.ey.r.appspot.com
  actyn.byethost17.com
  actyouth.eu
+acumecsg.com
  acumeninfralko.com
  acumfaegovan.com
  acumulepontosdeviagem.com
@@ -18988,6 +19539,7 @@ adastravanlines.com
  adatechconsulting.com
  adb4889mnwe3665dh38nn.mattsenior1.repl.co
  adbagbiz.batwoqishipping.top
+adbavancemsimunssystems.us
  adbeaver.org
  adbee.tk
  adbf5a778175ee757c34d0eba4e932bc.buzz
@@ -19034,8 +19586,7 @@ addhun.ml
  addiamentali.org
  addicted-forum.dvrlists.com
  addictionexplained.icu
-addidas202020211.000webhostapp.com
-addidasnike20202021.000webhostapp.com
+addictivecosmically.top
  addingsecure.link
  addirector.cc
  addireengg.logicalat.com
@@ -19090,6 +19641,7 @@ adentarim.com.tr
  adeovdnohugpeoac-dot-millinium.ey.r.appspot.com
  adept-partners.com
  adeptdifferentspellchecker--five-nine.repl.co
+adeptmassages.com
  adequatedoubleglazing.co.uk
  adequateoddmegahertz--five-nine.repl.co
  aderadom.com
@@ -19232,8 +19784,9 @@ admin.fragoimpex.com
  admin.gentbcn.org
  admin.grandoceanvilla.com
  admin.hopehorseback.org
-admin.hostpoint.ch-customer-shop.buy42-0093e803.abogadodedecasoscriminales.com
-admin.hostpoint.ch-customer-shop.buy43-5b567b49.abogadodedecasoscriminales.com
+admin.hostpoint.ch-customer-shop.buy-33aae650.piramide-engineering.com
+admin.hostpoint.ch-customer-shop.buy-ac5b7ca3.piramide-engineering.com
+admin.hostpoint.ch-customer-shop.buy-e66683b4.piramide-engineering.com
  admin.hostpoint.ch.arcangelopiai.it
  admin.hostpoint.ch.wanafood.com
  admin.intall.ru
@@ -19287,6 +19840,7 @@ administratorr.website
  administratress.info
  adminlogin.ligonuver.xyz
  adminnatt.weebly.com
+admino.andrewbasso.it
  adminofficedesk3.com
  adminofficeverificationattnetqa.weebly.com
  adminonlineserviceattverification.weebly.com
@@ -19418,7 +19972,6 @@ adorned-judge.000webhostapp.com
  adotuderigonimixz.xyz
  adplife.com
  adpm.ir
-adporbe.club
  adpostgroup.com.au
  adqaietkhnictjoadlldyoqtyyqhizkxkmhv-dot-cryptic-now-290917.ey.r.appspot.com
  adqnwewsfabxdsgv-dot-millinium.ey.r.appspot.com
@@ -19983,7 +20536,6 @@ afet.ml
  affableguru.com
  affaldsbeholderskraldecontainercom.shaxiaca.top
  affancollections.com
-affanyesvi.com
  affectionate-northcutt-f7f341.netlify.com
  affettuoso-diameter.000webhostapp.com
  afficu.com
@@ -20184,7 +20736,6 @@ agbo-chinaonline.com
  agbofx.goruli.com
  agboolafarms.com
  agcpgdtovqjkipkjqglbhcswgnwlyvwnhrrv-dot-cryptic-now-290917.ey.r.appspot.com
-agcsajpqcezxrcsmofafycsoki-dot-gle39404049.rj.r.appspot.com
  ageawidduhkmoheg-dot-millinium.ey.r.appspot.com
  agec.svcoding.com
  agedcareps.org
@@ -20344,7 +20895,6 @@ agglutinate-airs.000webhostapp.com
  aggressorecotone.com
  aggripure.com
  aghayenan.com
-aghexztxopuoktsfkswveeonci-dot-gle39404049.rj.r.appspot.com
  aghloeshgh.ir
  aghoskjbyjevynta-dot-millinium.ey.r.appspot.com
  aghpl.com
@@ -20367,6 +20917,7 @@ agilerigaday.lv
  agilesoftwarehouse.com
  agiletecnologia.net
  agilityanddungeoneeringonline.cf
+agilityhurdles.net
  agilityrt.website
  agilweb.cnt.br
  agincourt-finance.com
@@ -20383,6 +20934,7 @@ agirlsvideos6.xyz
  agirlsvideos7.xyz
  agirlsvideos8.xyz
  agitated-panini-ed4eeb.netlify.app
+agitated-swanson-2400de.netlify.app
  agitiste.com
  agiye.com
  agkewqorzxmcbvznfqiroeid-97550011473jp.com.zxzlhtj.cn
@@ -20434,6 +20986,7 @@ agrarimmo24.com
  agrarwirtschaftbiz.shaxiaprivacy.top
  agratama.xyz
  agrawalpackersmovers.com
+agreeablelividuserinterface.adasdfff.repl.co
  agreehillcheek.xyz
  agreekillsleep.xyz
  agreement-id019.com
@@ -20495,6 +21048,7 @@ agropecuariasantamonica.com.br
  agrosdoo.rs
  agrossarb.blogspot.com
  agrostarauto.com
+agrothesis.ir
  agrotmissa.com
  agrotodo.com.co
  agroup-adh.com
@@ -20503,6 +21057,7 @@ agrtyijpsbilcxsmlftwjcbnjlykzzuzjmbf-dot-cryptic-now-290917.ey.r.appspot.com
  agrularl.com
  agrupaciocongres.cat
  agrupobancolombia.com.co
+agrzsxrfr.gotdns.ch
  agsan.org
  agsdfcxzvdfshdasf.cf
  agsdfcxzvdfshdasf.gq
@@ -20701,7 +21256,6 @@ aibaccountreview.live
  aibat.ru
  aibd.sn
  aibreviewpayment.com
-aibservicebankingroi.com
  aibverifypayment.com
  aica.co.jp
  aicaiqwpvjhpqesulkhjlyhgjq-dot-gleowayel400503.uc.r.appspot.com
@@ -20760,7 +21314,6 @@ aihtmmotkmsgdfan-dot-millinium.ey.r.appspot.com
  aihuidesarrolloweb.com.ar
  aihustxstiljjkyylogexrwfrbofsrsrzwaa-dot-glxcel49934343434.rj.r.appspot.com
  aiiaiafrzrueuedur.ru
-aiii-iiib-mkiiu.s3-eu-west-1.amazonaws.com
  aiineh.com
  aiizntarbygbucom-dot-millinium.ey.r.appspot.com
  aijcs.blogspot.com
@@ -20782,6 +21335,7 @@ ailovchbiqkxiwjcaxtqobuuyw-dot-glmar9393293232323.uk.r.appspot.com
  ailtkqmraxazenvg-dot-millinium.ey.r.appspot.com
  ailvgo.com
  aimarketers.in
+aimdirectprint.com
  aimeelewis.oucreate.com
  aimeept.com
  aimevolution.com
@@ -21502,7 +22056,6 @@ albumdepremios.com.br
  albumfoto2.000webhostapp.com
  albums-01075691.nemsawy.com
  albums-28291265.nemsawy.com
-alburjrealestate.com
  albzhdmayyuluqzn-dot-millinium.ey.r.appspot.com
  alc-ao.com
  alcaido.com
@@ -21528,6 +22081,7 @@ aldealaspampas.com.ar
  aldeasuiza.com
  aldebaranjuicy.com
  aldeburghcirilo11profile.online
+aldeiavelha.com
  aldenia.xyz
  aldershvile.no
  aldery.linkpc.net
@@ -21628,6 +22182,7 @@ alert-support-wells-fargo.com
  alert-text.me
  alert-three-account.link
  alert-unknownlogin.cc
+alert-verify-new-payee.com
  alert-wells-blocked.site
  alert-wellsfargosupportdepartment.tk
  alert.bank.wf.reference-id4284.work
@@ -21752,7 +22307,6 @@ alerts3-billing.com
  alerts72paypal.com
  alertscotia4mobiie1.com
  alertservicelogin.com
-alertservicesouperdasfafasgdsdfdsf.duckdns.org
  alertsgoldcf.messagesaccesspoints.ga
  alertsignin-paypal.3utilities.com
  alertso2-restrictions.com
@@ -21898,7 +22452,6 @@ algomatreeservices.com
  algorithmshargh.com
  algosurg.com
  algotextil.com.br
-algreenstdykegfixtal.dns.army
  algreno.com
  algtechsolutions.com
  alhabbash.com
@@ -21911,7 +22464,6 @@ alharshagroup.com
  alhasanein.com
  alhaseebcorp.com
  alhashem.net
-alhattabholding.com
  alhelli.com
  alhopital.apps-1and1.net
  alhssoon123.ddns.net
@@ -21953,7 +22505,6 @@ aliceparker25010profiile.club
  alicetruecolors.com.mx
  alicia630.000webhostapp.com
  aliciabot.azurewebsites.net
-aliciaifry.tk
  aliciajarmanlcsw.com
  alicopvtltd.com
  alicuotanet.com
@@ -22131,7 +22682,6 @@ allegro.secfence.lesavik.net
  allegro4.pl
  allegro5.pl
  allegrofinanse2.pl
-allegroglaucoma.com
  allegrolokalkie.oferta458732.xyz
  allegrolokalne.su
  allegrolokalnie.club
@@ -22166,6 +22716,7 @@ allgroupnewwhtsapp.tk
  allgrupbokepersscrooot.v-25.com
  allhealthylifestyles.com
  allhouseappliances.com
+allianc.eu
  alliance-credit.com
  alliance-vent.ru
  alliance27.ru
@@ -22249,6 +22800,7 @@ allpl.club
  allprintecuador.net
  allprojectsunlimited.top
  allpropertyall.com
+allrealtorsusa.com
  allrepair.it
  allrightge.temp.swtest.ru
  allromsidns.com
@@ -22347,6 +22899,7 @@ almondmilkoils.com
  almonkarhadahiho.gotdns.ch
  almonosop.com
  almosthomedogrescue.dog
+almotamadris.com
  almotorrental.com
  almousa.net
  almoutawa.com
@@ -22396,7 +22949,6 @@ alowse1.com
  aloxrcnohrvpfeqz-dot-millinium.ey.r.appspot.com
  alp-aptitude-test-onlinevidhyasarthi.com
  alpacham.com
-alpaisviviendas.com
  alpanacrafts.com
  alpasa.net
  alpaser.com.pe
@@ -22510,6 +23062,7 @@ alstaetteinfo.baerseventhere.top
  alstaetteinfo.baerseventhings.top
  alstoday-notes.com
  alsulayl.org
+alsupllc.com
  alsusannarentjo.com
  alt-jabel.de
  alta-brasiil.com
@@ -22728,6 +23281,8 @@ amaliaplace.buzz
  amaliasmith466887.info
  amalicjkda.top
  amalouiba.com
+amamanzon.buzz
+amamanzon.xyz
  amamazonn.xyz
  amamds.info
  amammazonm.temp.swtest.ru
@@ -22858,7 +23413,6 @@ amaz0n.iozua.com
  amaz0nc0jp.xyz
  amaz0nemaill.buzz
  amaz0ness-updateee.from-il.com
-amaz0nsystemerror.com
  amazan.c0.jp-b8fd2329d8fe15239c560874ea31d34842e5104b.ph
  amazan.c0.jp-c163358b6b1a5093f8b9e1c7574af32f22708d71.ph
  amazan.c0.jp-cc88bf7a2dec8226431c919526a7ec2bf8dd5a1f.ph
@@ -22995,7 +23549,6 @@ amazon-account-services-support.com
  amazon-account-support-app.com
  amazon-account-suspicious.com
  amazon-account-update-verify-system.gleeze.com
-amazon-account-verification.lokimblematics.com
  amazon-account.live
  amazon-account0.com
  amazon-account1.serveirc.com
@@ -23129,7 +23682,6 @@ amazon-date-for-covid-19.gleeze.com
  amazon-e.top
  amazon-ef.xyz
  amazon-eh.xyz
-amazon-eight.top
  amazon-email-jp.buzz
  amazon-email-jp.wtf
  amazon-email-redirect-clientid00001547847.tk
@@ -23255,11 +23807,11 @@ amazon-primeverification.tk
  amazon-pro.preienm-sighin-co-jp.xyz
  amazon-recovery-accounts.com
  amazon-recovery-service.com
+amazon-recovery-uk.com
  amazon-recoveryacc.servehalflife.com
  amazon-refer.com
  amazon-reportdaily-service.accountsummaryxmcn.com
  amazon-resolutioncentre-verificationaccount.giize.com
-amazon-rly.date
  amazon-s.top
  amazon-s2ek2.xyz
  amazon-safety-center-id-max-signin-pape-openid-bgp-return.szhkled.com
@@ -23340,7 +23892,6 @@ amazon-try-account-covid19.gleeze.com
  amazon-u.com
  amazon-u.top
  amazon-ua.xyz
-amazon-update-account.hujimako.info
  amazon-update-date-covid19.theworkpc.com
  amazon-update-date-covid2020.giize.com
  amazon-update-date5-covid19.giize.com
@@ -23636,7 +24187,6 @@ amazon.co.jp.atoucet.xyz
  amazon.co.jp.av6w4vb2e-v3w-2eq21vq.party
  amazon.co.jp.axmacap.com
  amazon.co.jp.az1sdfahl1239i4o51saj.monster
-amazon.co.jp.aza.buzz
  amazon.co.jp.b1df6sert87jest6jm5416sry41k6w48swr874kxr3x14mk35l74k68yt4y1km5.buzz
  amazon.co.jp.b3993f830e0962fc711bdcde6.info
  amazon.co.jp.b3b5a8357f30a9ed.icu
@@ -23669,7 +24219,6 @@ amazon.co.jp.clka5.buzz
  amazon.co.jp.cnhik.cn
  amazon.co.jp.coioad8975azopj0987fs7d2faf2as00adfac.jp
  amazon.co.jp.confiirmm.com
-amazon.co.jp.countdomaailpartdate.tk
  amazon.co.jp.cow1gw6q8q-es1r-w5.golf
  amazon.co.jp.crhzkj.ph
  amazon.co.jp.cs2s1fvfyj9r-v1-we34q12.run
@@ -23969,6 +24518,7 @@ amazon.com.hrwallingfords.com
  amazon.com.manageauthen-acces.fraud-payment.com
  amazon.com.manageauthen-acces.securepage-alertservice.com
  amazon.com.manageauthen-acces.support-accountalert.com
+amazon.com.myaccount-resolution-manage.service-aws.info
  amazon.com.on.accountpreferredpayment.nz-clasic.cf
  amazon.com.order211-4834817-789957.amazon.emailserver.network
  amazon.com.page-idhome.webpage-secure.com
@@ -24227,6 +24777,7 @@ amazonbu.axrbr.cn
  amazonburger.com.br
  amazonbz.icu
  amazoncareservice.duckdns.org
+amazoncc.icu
  amazoncc.top
  amazonccex.buzz
  amazonccm.buzz
@@ -24307,6 +24858,7 @@ amazonhelp.buzz
  amazonhelpaccount.serveirc.com
  amazonhelpdesks.com
  amazonhelps.xyz
+amazonhh.icu
  amazonhost.shop
  amazonhu.qmtzirc.cn
  amazoni-verification.com
@@ -24457,6 +25009,7 @@ amazonsxs.buzz
  amazonteam-us.ddnsking.com
  amazontedes0.com
  amazonts.icu
+amazontt.icu
  amazonty.ydequkqb.cn
  amazontysf.5jbc.cn
  amazonuam.buzz
@@ -24652,6 +25205,7 @@ ameabril.com
  ameaexpreas.com
  ameagoraespecial.com
  ameamericanas-shoploja.com
+ameaoazon.com
  ameboid-stencils.000webhostapp.com
  amechegoucomtuuudo.com
  amedigital-ofertasemanal.com.br
@@ -24704,8 +25258,8 @@ amenitysupport.com
  amensalisme2.000webhostapp.com
  amenterprise.info
  ameofertassemana.com
-ameoun.co.jp.sning-jpamzaon.shop
  amepromomais.com
+ameqsina.xyz
  amerallas.xyz
  amerarani.com
  amerbaby.com
@@ -25101,8 +25655,6 @@ amozanm-rrcrc.net
  amozanm-rrdrd.cc
  amozanm-rrdrd.org
  amozanm-rrere.cc
-amozen.co.jp.hdizo.cn
-amozen.co.jp.njybg.cn
  amozinesc.bzymzchxfjg.top
  amoznon.webstarterz.com
  amozon-co-jp.guru
@@ -25138,7 +25690,6 @@ ampunnengnabillah.servebeer.com
  ampvaqourgjkjcngsofezmklcwvjkxjcnwvx-dot-cedar-code-289917.nn.r.appspot.com
  amqelendez.com
  amqkasiveongxbal-dot-millinium.ey.r.appspot.com
-amqvuznlprhutjgmjhdvbijytr-dot-gle39404049.rj.r.appspot.com
  amr16pzcp03omerd.com
  amr16pzcp03omerd.xyz
  amrcdukmhypsffbcyq.top
@@ -25203,7 +25754,6 @@ amurehotel.mn
  amusedpersonals.com
  amushknm.beget.tech
  amuyetrse.com
-amuzon.co.jp.amzonu-jp.shop
  amv.org.mx
  amvbylrohzowzfrsbqjpmvsivf-dot-gleowayel400503.uc.r.appspot.com
  amvhikbqodpolbwh-dot-millinium.ey.r.appspot.com
@@ -25275,7 +25825,6 @@ amzn-ca.xyz
  amzn-information.ddns.net
  amzn-job-center-802659631401396130.tk
  amzn-order-error.info
-amzn-primeaccount.com
  amzn-ref.app
  amzn-ref.net
  amzn-servceaccount.serveirc.com
@@ -25283,7 +25832,6 @@ amzn-verifys.serveftp.com
  amzn.customers-jp.top
  amzn66854.uc.r.appspot.com
  amzncdm.xyz
-amznetworking.com
  amznncard.com
  amznncard.xyz
  amznprime-service.serveirc.com
@@ -25381,6 +25929,7 @@ analyticsladder.com
  analyticsonline.top
  analyzable-burglari.000webhostapp.com
  anamariajerez.com
+anamazom.xyz
  anameplate.com
  anamikaindanegas.in
  anamma.com.br
@@ -25867,12 +26416,10 @@ annesutton-profile-91852.online
  annetdonahue.com
  annetkarsten.nl
  annette634533247.xyz
-annettehammond.com
  annettentownsend.xyz
  annetteworkpublicrelations.com
  annewilliams-profile-92571.online
  annfdqlvm.vipsnapchatsexting.com
-annftcpqerpqnyabwgjlnblilu-dot-gle39404049.rj.r.appspot.com
  annhienco.com.vn
  annhmkkbdfdlupnc-dot-millinium.ey.r.appspot.com
  annhorfzdgkmajuoys.top
@@ -26032,6 +26579,7 @@ antiaginghealthbenefits.com
  antibot-pw.com
  anticcolonial.cf
  anticivic-pleasure.000webhostapp.com
+anticlimactickill.top
  anticogiardinosiciliano.it
  anticom.eu
  anticoronaproducts.com
@@ -26117,6 +26665,7 @@ anuid-santander-com-br.ddnslive.com
  anuintegrity.com
  anul-facture.ddns.net
  anummod.xyz
+anunjxefjmniofrzuhxiqmtuel-dot-gle39404049.rj.r.appspot.com
  anuonkoooredammn.com
  anuopypanhsrsuqzlhdgztiqqrzvsqruepzf-dot-glegen303939423233.ue.r.appspot.com
  anupath.in
@@ -26171,6 +26720,7 @@ anzerbrokers.com
  anzo.capital
  ao.jandigitalstudios.com
  aoaonline.org
+aoazome.top
  aobyvmfuxxealtqj-dot-millinium.ey.r.appspot.com
  aoc-connect.weebly.com
  aocarnaval2020.com
@@ -26255,6 +26805,7 @@ aolupgrade2.yolasite.com
  aolverificatior-mgbqiuhkj.now.sh
  aolverizonaccountupdate.yolasite.com
  aoman-longing.shop
+aomaomsndn.com
  aomazonniu.sujp.mingjiuweiiou.cn
  aomcs.org
  aomgvhrxl.goruli.com
@@ -26388,7 +26939,6 @@ apaseppol.com.br
  apasitez.000webhostapp.com
  apasspost-upgrade.ga
  apazsre.000webhostapp.com
-apbardvcqufjfbzfczmvuxakhb-dot-gle39404049.rj.r.appspot.com
  apbarmegoodp.tk
  apbf.agencia-digitals.com
  apbn.com.au
@@ -26441,7 +26991,6 @@ apgneedles.com
  apgvunwjwtrmkqsvocazuhkmmuslnmudstll-dot-cryptic-now-290917.ey.r.appspot.com
  aphetitor.com
  aphl.lu
-aphomes.in
  aphoritt.com
  aphriapub.com
  aphrodisia.be
@@ -26560,7 +27109,6 @@ aplicarfirma.com
  aplicativo-app.com
  aplicativo-seguro.tk
  aplicativo30horas.sytes.net
-aplicativobancodobrasil.com
  aplicativobbonline.com
  aplicativobbonline.xyz
  aplicativocadastro.com
@@ -26617,10 +27165,8 @@ apollonassunshine.gr
  apolomarcas.com
  apolopp.net
  apoolcondo.com
-apostando.org
  apostelgeschichtenet.shaxiaact.top
  apostelgeschichtenet.shaxiacommittee.top
-apostle.mangospot.net
  apostlemoney.duckdns.org
  apostropheboil.com
  apostrophemousert.com
@@ -26634,7 +27180,6 @@ apoxnew.com
  apoyocuenta.blogspot.com
  apoyoweb.net.ve
  app--resgate--seguro-online.preview-domain.com
-app-12.s3.amazonaws.com
  app-1530173649.000webhostapp.com
  app-1532425138.000webhostapp.com
  app-1537966966.000webhostapp.com
@@ -26702,6 +27247,8 @@ app-gestaocaixaonline.com
  app-gestaodeatualizacao.com
  app-go.website
  app-halifax-mobileapp-verify.com
+app-host-list-72241.casa
+app-host-list-94231.casa
  app-id-verification-online-account.haustierberatung.info
  app-idserviceaccountcloudactivator12392312.boldexperiencebyme.info
  app-intesa.com
@@ -27289,7 +27836,6 @@ apple-myfind.com
  apple-noticeaccountacc.najafajflights.com
  apple-olb2.info
  apple-online.duckdns.org
-apple-os.xyre.cn
  apple-payment.order-canceleds.com
  apple-payment121.serveirc.com
  apple-pie.in
@@ -27358,6 +27904,7 @@ apple-support.tech-br.info
  apple-support78914.ddnsking.com
  apple-support7930.ddnsking.com
  apple-support90.xyz
+apple-supports.cn
  apple-supportusa.com
  apple-suppost-case.com
  apple-suspends.serveirc.com
@@ -27858,7 +28405,6 @@ appleid-appvrf-infodata.camdvr.org
  appleid-authverify.ddns.net
  appleid-available.com
  appleid-canada.apple-mobile.os-mobile.info
-appleid-confirm.com
  appleid-confirmacc.serveirc.com
  appleid-connect.com
  appleid-esc-apple.com
@@ -28766,7 +29312,6 @@ apponlinehelp.info
  appopularenlinea.com
  apporg.yolasite.com
  apportt.net
-apppconstructed.com
  apppepiymaxpgsjgbtblx.ru
  appr5fqepuqtnyxt.futurehost.net.pl
  apprackspaceupdates.bounceme.net
@@ -28792,7 +29337,6 @@ approvedequipmentonedrive.gibsonlawfirm299.com
  approvedlink.uk
  approvedrefund-covid-19.com
  approvefitness.com
-approvehostage.com
  approvelogin.com
  apps-accountmaildasdas.com
  apps-acessodigital.com
@@ -28879,6 +29423,8 @@ apps.mymobilebusinessapp.co.uk
  apps.nakshatrajewells.com
  apps.offerplant.com
  apps.owawebapps.tk
+apps.pagedontactive.xyz
+apps.pagedontactivefb.xyz
  apps.payment-ios.srlamxeaxupzbm.com
  apps.payments-profile-ak409.com
  apps.personasmx.xyz
@@ -28930,6 +29476,7 @@ appsecurityupdateas.causeeverytimeiopenupithurts.com
  appseguro.ngrok.io
  appseguro30horas.dxpsites.net
  appsemprepresente.com
+appsemsairdecasasohojenamega.com
  appsendgrid.s3.eu-west-2.amazonaws.com
  appsendgridapps.web.app
  appsendgridsession.com
@@ -29025,7 +29572,6 @@ appv2.org
  appvalidation2020.autolineesmec.xyz
  appverify.servebeer.com
  appviagespontosbr.com
-appvideo02.eoldal.hu
  appvirtue.com
  appvnapkdownload.com
  appvrf-0chase.serveirc.com
@@ -29116,7 +29662,6 @@ apzpage.000webhostapp.com
  apztsz.000webhostapp.com
  aqa-q116com-sua-bela-semana-venha-conferir.com
  aqarione.com
-aqasqftvdkkvcoarlmvszbmqqg-dot-gle39404049.rj.r.appspot.com
  aqbpato.goruli.com
  aqcr8bp0gud-3vqcr8bp0gudandlc103andid6485andmkten-usandcbcxta.pantheonsite.io
  aqew-com-suaotimasemanaparavoce.com
@@ -29230,7 +29775,6 @@ arafinmedia.com
  aragjqoxili.gikorip.net
  aragonmetal.com
  aragonnm.buzz
-aragornfin.net
  arahanta.com
  arahd.aramlicy.com
  araichos.com
@@ -29322,6 +29866,7 @@ archiv.bg
  archive.moral-lock.com
  archive1.inflearn.com
  archives.subscribermail.com
+archiveserver7910.z22.web.core.windows.net
  archivesign16.yolasite.com
  archivesly.com
  archivio-lucaborgioli.belortoscana.it
@@ -29511,7 +30056,6 @@ arfajbd.com
  arfegdpoqhcqxtmg-dot-millinium.ey.r.appspot.com
  arferdimpex.biz
  arg.inloggen.teronderzoek.live
-argaautorepair.com
  argclient.opdrachtgeving.xyz
  argenblogs.com.ar
  argensudalimentaria.com.ar
@@ -29700,7 +30244,6 @@ arokdtyptuejckbg-dot-millinium.ey.r.appspot.com
  arolebank.com
  aroma-italiano.xyz
  aromaandcare.com
-aromabiensa.com
  aromarabica.com
  aromaterapiaclinicabrasil.com.br
  aromaticfragrances.com
@@ -29824,7 +30367,6 @@ artesacracremona.it
  artesaniasbanda.com
  artescan.net
  arteservicefabbro.com
-artesweb.xyz
  artetal.com.br
  arteum.eu
  artewebestudio.com
@@ -29999,7 +30541,6 @@ arugambay.com
  arumment.xyz
  arunach.work
  arundarekar.com
-arup.mavencube.com
  arures.000webhostapp.com
  arushaone.co.tz
  arux.gikorip.net
@@ -30085,7 +30626,6 @@ asatelectricals.com
  asatkotugmmcjbis-dot-millinium.ey.r.appspot.com
  asawawu.dynamic-dns.net
  asayil.net
-asb-secured-asb-secured-2021.asbtax.ml
  asb.co.nz.authe-online.info
  asb.co.nz.bex-net.ga
  asb.co.nz.online-auth.logon1-auth.ga
@@ -30160,13 +30700,13 @@ asddnbhfjiurw9.com
  asddwe.lauenkdaneiozd.com
  asdeg.xyz
  asderd.xyz
+asderyuop.cam
  asdet.xyz
  asdf2g.xyz
  asdfasfasfd.cchos.network
  asdfawefwaerfawefpaypal.daterinisde.com
  asdfcxb44.duckdns.org
  asdfdsecccx.net
-asdfdsza.s3-ap-southeast-1.amazonaws.com
  asdfe.xyz
  asdfg457d.duckdns.org
  asdfgcvvf45.duckdns.org
@@ -30270,6 +30810,7 @@ asfg.futbol
  asfhuq-fsafb.com
  asfkhandaq.info
  asfmarkets.com
+asforthemines99.uno
  asfrj.baydiboo.com
  asfzxc45asf.ksydhdsnmcc.top
  asgardiastore.space
@@ -30283,6 +30824,7 @@ asghr.duckdns.org
  asgre.xyz
  asgsemarang2019.com
  asgsx.xyz
+asgtfvdfs1.ml
  asgxbfdr3.duckdns.org
  asgy71.ml
  ash-sun-comic.glitch.me
@@ -30467,10 +31009,12 @@ asodeuwgbeads.com
  asoehqjmmlckuxtp-dot-millinium.ey.r.appspot.com
  asoerxzs.000webhostapp.com
  asofezrh.gikorip.net
+asoftcro-micrae-tohfcve.s3-ap-southeast-2.amazonaws.com
  asojournerproject.com
  asoklaxcugysropjjsyliorgin-dot-gleowayel400503.uc.r.appspot.com
  asokopro.com.ar
  asolucaonetwork.com.br
+asomiqs.bar
  asomzon.webstarterz.com
  asoprocanor.com.co
  asoquefez.com.br
@@ -30543,7 +31087,6 @@ assecon.com.br
  assegurcorretora.com
  asseguridad.com.uy
  assel.life
-assemblyrung.com
  assenio.com
  assenmacher-online.de
  assenting-possibili.000webhostapp.com
@@ -30575,6 +31118,7 @@ assetstorage.net
  assexyas.com
  assi-gbe.com
  assicurazione-online.xyz
+assicurazioni4a.com
  assicurazioniweb.top
  assicuriamoci.net
  assiduousenterprising.com
@@ -30608,6 +31152,7 @@ assistant-web.com
  assistantfamiliar.com
  assistantusamazon.serveirc.com
  assistentebb.online
+assistenza-bancaria.su
  assistenza-conti.com
  assistenza-digitale-per-i-nuovi-criteri.org
  assistenza-gruppoisp.com
@@ -30736,6 +31281,7 @@ astrologize.xyz
  astrologysikhen.com
  astrom2.com
  astronica.org
+astronmic.tk
  astroshankersegurukulam.com
  astroyogi.app
  astsarsttsrfff.weebly.com
@@ -30866,7 +31412,6 @@ atbxjtockqsuybhe-dot-millinium.ey.r.appspot.com
  atccn3.it
  atcenterla.com
  atchec.com
-atcoding2.sakura.ne.jp
  atcq.jaysbrand.com
  atd-636-jf73-jfj6-65e.weebly.com
  atdontrepluth.weebly.com
@@ -30953,6 +31498,7 @@ atfs.online
  atftcwpdjwwfanbe-dot-millinium.ey.r.appspot.com
  atg7yhp0t45tlty.godaddysites.com
  atgdfd.weebly.com
+atglobalservice.godaddysites.com
  atgoddss.com
  atguyxjifniqxnlmpvqdbwsmpthbynqugevj-dot-glenxpecial3009493.ey.r.appspot.com
  athabascaphalange.com
@@ -31061,6 +31607,7 @@ atlogiiinssss.weebly.com
  atlp106t511tr5typy.godaddysites.com
  atltdf.net
  atm2003web.000webhostapp.com
+atmasa.work
  atme.cl
  atmen.top
  atmisgrdmnjlvxdx-dot-millinium.ey.r.appspot.com
@@ -31589,7 +32136,7 @@ attmailsignup.weebly.com
  attmailslink.weebly.com
  attmailslinks.weebly.com
  attmailsserv.weebly.com
-attmailsupportadmin.weebly.com
+attmailsubject.weebly.com
  attmailsupportive.weebly.com
  attmailsupportservice.weebly.com
  attmailudate.weebly.com
@@ -31605,7 +32152,6 @@ attmailupgradin.weebly.com
  attmailupruge.weebly.com
  attmailvalidationservice-loginscreen.weebly.com
  attmailverificationlink.weebly.com
-attmailverificationms.weebly.com
  attmailverificationnetworkiing.weebly.com
  attmailverificationupgardeloginaccountdomainpage.weebly.com
  attmailweb.weebly.com
@@ -31711,7 +32257,6 @@ attonlineservicemaill.weebly.com
  attonlineservicesteam.weebly.com
  attonlineserviceupdated.weebly.com
  attonlineservicevericationupdate.weebly.com
-attonlineserviceverificationadmin.weebly.com
  attonlineserviices.weebly.com
  attonlinesevvicess.weebly.com
  attonlinetrubelverification.weebly.com
@@ -32198,6 +32743,7 @@ au-jjg.com
  au-jjh.com
  au-security.info
  au-user-online.services
+au.12xlwin5.net
  au.1fbe.com
  au.beakon.io
  au.big.goodtimenews.org
@@ -32314,6 +32860,7 @@ aumentolimiteltaucard.unaux.com
  aumhealings.org
  auminhtriet.com
  aumxmvlsahhzaaoizwwdcztpdg-dot-gleowayel400503.uc.r.appspot.com
+aumzondesloce.com
  aunazoin.quba.marylly.club
  aunexis.ch
  auniqueart.co.uk
@@ -32393,7 +32940,6 @@ austinturnpike.buzz
  austintxlawn.com
  austonstore.cf
  australiabeyondbroadband.com.au
-australiabiliaminu.com
  australiahousinginformation.online
  australianautoprotection.com.au
  australiangaragesales.buyresidentialinvestmentproperty.com
@@ -32438,6 +32984,7 @@ auth-amazon.verification.customer.revover-amzintl.com
  auth-amazonsecure.serveirc.com
  auth-appleid.apple.com-verification.loseyourip.com
  auth-appleid.apple.lockedverification.customer.intiausly.com
+auth-assist.me
  auth-cancelpayees.com
  auth-cancelpayment.com
  auth-captivatebilling.tk
@@ -32758,8 +33305,6 @@ authusrapple-signin.servehttp.com
  authv8pro2jz.service-appmanager.com
  authvadscien.devauthvad.fr
  authverificaitaliano-managed.xrnedw.com
-authverify-cancelpayee.com
-authverify-securesupport.com
  authverlfyapp1eld.com
  authvk-com.000webhostapp.com
  authvocauxplus.wixsite.com
@@ -33171,11 +33716,13 @@ avkpaemvlgsfcqkf-dot-millinium.ey.r.appspot.com
  avl-makler.de
  avlabormanagement.org
  avlolpahsuvbhjvsilqceotnoyhrsklbxkiu-dot-solar-vertex-285913.rj.r.appspot.com
+avlondehradun.com
  avlto.im
  avmaxvip.com
  avmpnecndw.web.app
  avo23.ddns.net
  avo4.ddns.net
+avocado5754000.brizy.site
  avocat-bonnard-plancke.com
  avocatafangbedji.com
  avocatenfloride.com.ru
@@ -33216,7 +33763,6 @@ avs-config.invalid-appleo.resource-gb.com
  avs-config.secure-identity.custevo.com
  avsdvvsh5.site
  avsecure.avsecure.cf
-avservicesorlando.com
  avsesovs.000webhostapp.com
  avsiii.gr
  avsproduction.am
@@ -33381,7 +33927,6 @@ aws--vn.com
  aws-account-office-clicking-records.hbzcjt.net
  aws-account-team-department-datacenter3.buelevard-alphard.gq
  aws-account-update-web-safty.sentosa323k.top
-aws-account-update-web-safty.tbkjzx.club
  aws-amazon.hugodiamond.com
  aws-amz.secure-verify-account.cc
  aws-amzn.servehalflife.com
@@ -33783,6 +34328,7 @@ aziznews.ru
  azizulhasandu.com
  azjbjgaeptxrtsit-dot-millinium.ey.r.appspot.com
  azjones.info
+azkawrgajwuesoxwnaoyyyxbhr-dot-gle39404049.rj.r.appspot.com
  azkids.az
  azkomfrimz.000webhostapp.com
  azlkmcserv437.xyz
@@ -33927,7 +34473,6 @@ b-access.com
  b-akt.addroits.com
  b-cube.shop
  b-faceit.fun
-b-falabellape.com
  b-jkh.svcoding.com
  b-litjens.nl
  b-lop.com
@@ -33989,7 +34534,6 @@ b2bprints.co.uk
  b2bseller.ga
  b2c.regnault.free.fr
  b2dbt.jaysbrand.com
-b2ernps9po7.libkrasnopolie.by
  b2fdetto-s4f-fq5e6y14vqg.run
  b2r7.awaykart.com
  b2w.americanas.sacfinanceiro.digital
@@ -33997,6 +34541,7 @@ b3125863685361d1b0cbd6fec.xyz
  b31868d66e3064433.temporary.link
  b334d676282688490.tempsite.link
  b34gz1.com
+b35cy33kkbcu3lmdz5rmpbeomi-adwhj77lcyoafdy-www-paypal-com.translate.goog
  b36fd433d0f62fa7c753263db51708e5-dot-dbenitonline.ey.r.appspot.com
  b3c78078.ngrok.io
  b3cc381d.com
@@ -34046,6 +34591,7 @@ b7a797fb8bfe2a8860258dd0d256f8f5fb75249f.ph
  b7d0n.svcoding.com
  b7d4b59dd52910274.temporary.link
  b7dc45b4974a96bcc3e7dfc211ad77038c5cbfcc.info
+b7f.top
  b7kge.svcoding.com
  b7np.jaysbrand.com
  b7pwf.awaykart.com
@@ -34183,6 +34729,7 @@ bacebookmerdeka.000webhostapp.com
  bacelauzi.com
  baceldeniz.com
  bacene.nl
+bacfasu.paoloterrapieno.com
  bachhoatrangia.com
  bachir7.hopto.org
  bachnongmiennam.com
@@ -34205,7 +34752,6 @@ backendproject.com
  backgash.com
  background1.xyz
  backgrounds.pk
-backlashalwen.com
  backlashworkers.club
  backlightcreative.com
  backlinkers.de
@@ -34215,6 +34761,7 @@ backlogchidek.com
  backlogphew.top
  backmatchst.com
  backmz.com
+backofficesolutionsteam.com
  backpack-vacuum-cleaners.com
  backpackapp.webpayapps03.com
  backpackersandbrew.com
@@ -34301,7 +34848,6 @@ badgesforbullies.org
  badgess-help.ml
  badgesverify-lnstagram.tk
  badhacking.ddns.net
-badhae.com
  badhaee.com
  badinfluence.xyz
  badjsnprwtmeanna-dot-millinium.ey.r.appspot.com
@@ -34444,6 +34990,7 @@ baitapp.com
  baiteboats.ru
  baitian28.com
  baitulhikmah.org.uk
+baitulmaalku.org
  baiventura.000webhostapp.com
  baivjlwmcxbepcmgsumjyniwes-dot-gleowayel400503.uc.r.appspot.com
  baixenoibai24h.com
@@ -34941,7 +35488,6 @@ bandarwinsbobet.com
  bandbcreuse.com
  bandbsa.be
  bandep.ru
-banderu.us
  bandgutter.cyou
  bandirmamegatemizlik.com
  bandit.godsshopp.com
@@ -35376,7 +35922,6 @@ barclaysco.com
  barclayssecureonlineverificationpage.abusalma.net
  barcljhjkn.weebly.com
  barcomincompany.com
-barcsreview.com
  bardiastore.com
  bareabwsbsv.com
  barearsbsvs.com
@@ -35483,7 +36028,6 @@ bary.sz4h.com
  bary.xyz
  barylak.pl
  basa.nutarborg.com
-basah.basah.ddewasa-18plust.ml
  basahom.000webhostapp.com
  basalt-mixed-sardine.glitch.me
  basanalpos.bayraktarlaraksaray.com.tr
@@ -35705,7 +36249,6 @@ bayraktepeetmangal.com
  bayramuygulamasivkf.ml
  bayrinakliyat.com
  baysaint.buzz
-baysidetransportation.com
  bayswaterautomotiveservice.com.au
  bayte.net
  baytkidz.com
@@ -35754,6 +36297,7 @@ bb.programadevantagenssmiles.com
  bb.truepresencela.com
  bb2-c.svcoding.com
  bb2kcom.shaxiaaccommodation.top
+bb3t4-t27sec3.com
  bb4l1vv.ue.r.appspot.com
  bb630content.com
  bb7c815de691667fe74cd6222201504f84a8d0c7.info
@@ -36204,7 +36748,6 @@ bcvbnmmain.com
  bcvbnmroute.com
  bcvbnmsys.com
  bcvbnmvard.com
-bcvpqkfwzgbsquxbfdclbdafvs-dot-gl099898987fhkl.uk.r.appspot.com
  bcwdfwclienthelpsupport.paubhwservice.com
  bcwmeztdtenjjcph-dot-millinium.ey.r.appspot.com
  bcwuofrcwylinkxf-dot-millinium.ey.r.appspot.com
@@ -36416,6 +36959,7 @@ beatnyama.com
  beatricenyarko.com
  beatsdrops.ru
  beattykeys.buzz
+beatyamerican.com
  beatygirl10.xyz
  beau-mondes.com
  beauficder.com
@@ -36454,6 +36998,7 @@ beautychance.se
  beautychicrose.ru
  beautyhealthcareclub.com
  beautyhealthnav.life
+beautyiconltd.cn
  beautyinssa.shop
  beautymeacademy.gr
  beautynams.com
@@ -36559,6 +37104,7 @@ beechworthautomotive.com
  beedev.io
  beegale.com
  beeiz.com
+beelohimauctioneers.co.za
  beenakker.eu
  beepingrate.ch
  beepme.eu
@@ -36635,6 +37181,7 @@ beibei.xx007.cc
  beibfqywug.duckdns.org
  beicapellipdx.com
  beiercrescentapt.buzz
+beigebiodegradablebackend.josealbertoal21.repl.co
  beihai.06wi.com
  beiifightcovid.com
  beijingdelay.com
@@ -36689,7 +37236,6 @@ belhao.com
  beli2020.000webhostapp.com
  belickyo.com
  belielat.co.uk
-believable16442130.blob.core.windows.net
  believedinyourself.tk
  believemytravels.com
  belieyz-custumerprimeamzmembersh.com
@@ -36863,7 +37409,6 @@ benjamin.cahot.webconcepteur.fr
  benjaminbrodsky.com
  benjaminctse.com
  benjesinfo.bfx-mailer.com
-benjim.com
  benjos.karaokemelo.com
  benjw.net
  benkacey.com
@@ -37036,6 +37581,7 @@ berror01.azurewebsites.net
  berrycash.ru
  berrycollege2-my.sharepoint.com
  berryessakokaneefishing.com
+berryplasticslindanewcomb.com
  berrytiipe.top
  bersama1.jeffxcmore.com
  berserker.berserkerforone.top
@@ -37235,7 +37781,6 @@ bestrapbeats.com
  bestrategic.asia
  bestravelor.co.il
  bestrayban1.xyz
-bestrayban2.xyz
  bestrealestatesystems.com
  bestrealtime.com
  bestrealtime.net
@@ -37249,7 +37794,6 @@ bestsemarangguide.com
  bestservicehelper.com
  bestservis.site
  bestservis161.ru
-bestsevenhillsmassage.com.au
  bestsexologist.xyz
  bestshareland.com
  bestshariaproperty.com
@@ -37507,6 +38051,7 @@ betterlastbestflashlite.icu
  betterloosenup.com
  betternameszimbradesking.com
  betternowandforver.ga
+bettersimulator.work
  bettika.com
  bettinamarks.com
  bettingcampus.com
@@ -37870,7 +38415,6 @@ bhuwy.xyz
  bhvamkxymcnyoscuoiensegimoahbxlqsqsb-dot-glegen303939423233.ue.r.appspot.com
  bhvegypt.com
  bhwlawfirm.com
-bhxpqzmnkqjpnihwfqtmerkbho-dot-gle39404049.rj.r.appspot.com
  bhxuhvcvnkatbkfr-dot-millinium.ey.r.appspot.com
  bhya.hyperphp.com
  bhytyyuu.cam
@@ -37921,7 +38465,6 @@ bicimas.co
  bicscfyxtvllpxgd-dot-millinium.ey.r.appspot.com
  bicycles.ebay.itm50283658.cycling.sporting-goods.llc50283658.com
  bicyclesstugustine.com
-bicyzggnaqwluajgghspiertfv-dot-gle39404049.rj.r.appspot.com
  bida123.pw
  bidao.edu.mx
  bidaphucphat.com
@@ -38079,6 +38622,7 @@ bike-nomad.com
  bikeath1337.com
  bikefabricate.com
  bikemyday.se
+bikerentaljaisalmer.com
  bikergirls.za.net
  bikerouteshop.com
  bikerzonebd.com
@@ -38145,6 +38689,7 @@ billdiscountsvw.com
  billdrop.la
  billek.ru
  billenloe.com
+billetterie.angers-sco.dspsport.com
  billgates.capital
  billgatesfunds.com
  billgateshelp.com
@@ -38160,7 +38705,6 @@ billing-details-update.com
  billing-ee-help.com
  billing-ee-support.com
  billing-ee-update.com
-billing-ee-updatevia.com
  billing-ee.com
  billing-eeaccount21657652.com
  billing-failures.com
@@ -38229,7 +38773,6 @@ billing653.com
  billing77.com
  billingacceserror.com
  billingconfirmation-access.yourorder.haramintai.org
-billingetransfer.org
  billingfailed.cc
  billingform-network.co.uk
  billinghelp-o2.com
@@ -38313,6 +38856,7 @@ bimetv.com
  bimformation.co.nz
  bimihome.ir
  bimland.info
+bimmundope.com
  bimnapratica.com
  bimovia.com
  bimsqhwadwjsffyc-dot-millinium.ey.r.appspot.com
@@ -38490,7 +39034,6 @@ birlanavyaa.com
  birlasoft.threatcop.ai
  birmetalciningezinotlari.com
  birminghamg.buzz
-birminghamhockeyclub.com
  birminghamlink.org
  birn.xyz
  birnam-wood.com
@@ -38844,13 +39387,11 @@ bkp2020trbruyukgabunggroupwaskrng.000webhostapp.com
  bkp69.dynamic-dns.net
  bkp87435.claimholl.me
  bkp9373.hotzx9.com
-bkpcgvxbtlkyajebiepozrlrlj-dot-gle39404049.rj.r.appspot.com
  bkpco.renewfreefireget.tk
  bkpgratis.4free9.com
  bkpgroup18.hicam.net
  bkphot163.dynamic-dns.net
  bkpindo-wa.join-gruphot.com
-bkpinfo.kozoww7.cf
  bkpjoin.send20.gq
  bkpjoinwhatsapp.claimholl.me
  bkpnew.oryio.com
@@ -38862,7 +39403,6 @@ bkps11.duckdns.org
  bkpsange63.zzux.com
  bkpsugionovsmiakhalifa.m-whatsapp.ml
  bkpviralsex18tbruh0tsgt7.2waky.com
-bkpwanew.wikaba.com
  bkpwhtaspp.whatsappyub.tk
  bkpwhyaaa.hoaztbokep.ga
  bkqhvpvbglhrekgw-dot-millinium.ey.r.appspot.com
@@ -38882,7 +39422,6 @@ bkwriting.com
  bkyjpsjceapampdg-dot-millinium.ey.r.appspot.com
  bkzfgrujhoivgczf-dot-millinium.ey.r.appspot.com
  bkzjluhdcukxjxmw-dot-millinium.ey.r.appspot.com
-bkzqglzraxnkewggzgwsbdewyd-dot-glmar9393293232323.uk.r.appspot.com
  bkztfunyowndzkrj-dot-millinium.ey.r.appspot.com
  bl0ckchain.ug
  blaackjack.com
@@ -39114,7 +39653,6 @@ bln-product.com
  blobfeed.com
  blobim.club
  blocco.intesa-servizio.info
-block-fbid.ga
  block-lloyds.co.uk
  block-payee-halifax.com
  block72-paypal.com
@@ -39334,7 +39872,6 @@ bloodveinscruffy.com
  bloodybits.com
  bloohash.com
  bloomasiaus.com
-bloomb2b.com
  bloombex-options.com
  bloombrainz.com
  bloomcapitalmarkets.com
@@ -39384,13 +39921,11 @@ blue.engprod.consumer.fe-spectrum.net
  blue02.club
  bluebadge-instagram.epizy.com
  bluebadge-lnstagram.com
-bluebadgeapplicationsform.ml
  bluebadgeinstagram2020.gq
  bluebadgeinstagramform.ml
  bluebadges-instagram.com
  bluebadgesclientslnstagrams.com
  bluebadgesform.ga
-bluebadgesupport-team.com
  bluebadgeverify.cf
  blueberrybaygrad.com
  blueberryoasis.net
@@ -39422,6 +39957,7 @@ blueendless.com
  blueeyesvan.com
  bluef.jav2.org
  bluefish-digital.com
+blueflamemarketing.us
  blueflystudios.com
  bluegantt.com
  bluegreen.marketing
@@ -39448,6 +39984,7 @@ bluenet888.000webhostapp.com
  bluenewsletter.ml
  blueoaksestates.co.uk
  blueoil.xyz
+blueone.cyou
  blueozchile.cl
  bluepacificcomputer.com
  bluepalm.tech
@@ -39485,6 +40022,7 @@ bluetickforfree.000webhostapp.com
  bluetickfre.0fees.us
  bluetickfree.0fees.us
  bluetickinstagram.ga
+bluetickserviceinnnstagram4409x.ga
  blueticksform.com
  bluetickverification.ml
  bluewaterappco.com
@@ -39540,7 +40078,6 @@ bmainstrurnent.com
  bmapctgbhyednqkp-dot-millinium.ey.r.appspot.com
  bmaqequkkjwfuglu-dot-millinium.ey.r.appspot.com
  bmarini.com
-bmatic.com.pe
  bmattorneygroup.com
  bmbell.com
  bmcconsulting.dk
@@ -39627,7 +40164,6 @@ bnc24.in
  bnca-ingresow-estadopersonas.xyz
  bnccavknqtlnssdp-dot-millinium.ey.r.appspot.com
  bnckdramhutjxhxyen.top
-bnclhorrmoqmitobyevkdrfbog-dot-gle39404049.rj.r.appspot.com
  bncm.qiuvienr.com
  bncmb.co
  bncollege.co.in
@@ -39843,6 +40379,7 @@ bobehughes.ru
  bobevents.myap.co.za
  bobliddycoat.com
  bobmaritime.com
+bobonimi.com
  bobothe.com
  bobruisk-arena.by
  bobryangood.ga
@@ -40039,7 +40576,6 @@ bokep-grup.newgroups-bokepers.com
  bokep-grup.vipx3.com
  bokep-grupwa.get-free.net
  bokep-hot.vh5.xyz
-bokep-hot1.ga
  bokep-hott-panas.000webhostapp.com
  bokep-hotvideos-wa-group-invite.000webhostapp.com
  bokep-japan-hd1.000webhostapp.com
@@ -40106,7 +40642,6 @@ bokepduniamalam.new9.my.id
  bokepenak2020.v-25.com
  bokepers-grup-whatsap23.v-25.com
  bokepfajarfirmansyah.000webhostapp.com
-bokepfreevideo163.tk
  bokepgadis.zyns.com
  bokepgroup18.whatsapp-k.com
  bokepgrup.hot1.shop
@@ -40169,7 +40704,6 @@ bokepterbaru2020.xvip.my.id
  bokepterbaru2020grubnew.getsviip7.com
  bokepterbruviral2020indonesialih.000webhostapp.com
  bokepterupdate.com
-bokepviral-colmek2.otzo.com
  bokepviral.19covidd.com
  bokepviral.sexy80.com
  bokepviral2020.myftp.biz
@@ -40747,7 +41281,6 @@ boxxbirry.ru
  boxyfy.com
  boy-juragan.site
  boyabadanaustasi.net
-boycode.org
  boydfiber.com
  boydswa.icu
  boygirlbang.za.net
@@ -40770,7 +41303,6 @@ bozziro.ir
  bp-atualiza-app.com
  bp-direct.com
  bp-formularios-covid19.azurewebsites.net
-bp-home-idd-ui-nwo.qa.dlgdigitalapi.com
  bp-n5.drofortho.com
  bp-servicesenligne.com
  bp.ferjjf.com
@@ -40799,7 +41331,6 @@ bpgoxpqzqxnwmebd-dot-millinium.ey.r.appspot.com
  bpgza.com
  bphentertainment.com
  bphonlawradjmbph-dot-millinium.ey.r.appspot.com
-bphuvbnzhxuwxdoielchuusrxy-dot-gle39404049.rj.r.appspot.com
  bpi-clent.com
  bpi.cloudaccess.host
  bpihdwgfdtxvihcx-dot-millinium.ey.r.appspot.com
@@ -40823,7 +41354,6 @@ bpm-privacypolicy.ml
  bpm-privacypolicy.tk
  bpmsicurezzapsd.online
  bpnedvtwas.duckdns.org
-bpntgkprwwsicllwstubrzhjjz-dot-gle39404049.rj.r.appspot.com
  bpnzf.ithd-flixconto.shop
  bpo.correct.go.th
  bpo2india.com
@@ -40837,7 +41367,6 @@ bpolsbloccare5333.com
  bpolsicurezzaweb.com
  bpost-pakketservice.su
  bpostverify.com
-bposvjawocxszsndcrqhqgzjxh-dot-gle39404049.rj.r.appspot.com
  bpoxnet.com
  bppgov.ng
  bppnbhigvgdteocx-dot-millinium.ey.r.appspot.com
@@ -40904,7 +41433,6 @@ bqqzfeakmasxpjuq-dot-millinium.ey.r.appspot.com
  bqrhfdnwoqjczavg-dot-millinium.ey.r.appspot.com
  bqtvunkiyhrbzikg-dot-millinium.ey.r.appspot.com
  bqtzgrbdcbzqcjry-dot-millinium.ey.r.appspot.com
-bqubixgnfhhkrhtkfcmvmojrlx-dot-gl099898987fhkl.uk.r.appspot.com
  bqvkzzmtlxbifrfd-dot-millinium.ey.r.appspot.com
  bqwrqoujurgbfetm-dot-millinium.ey.r.appspot.com
  bqx12lnjk03rrdio.xyz
@@ -41070,7 +41598,6 @@ bradesco.news
  bradesco.nextdigital.website
  bradesco.realvideosbr.kiev.ua
  bradesco.servicosac24horas.com
-bradescoacesse.dipositiv.com
  bradescoatualizacao.ddns.net
  bradescodentalcnpj.com.br
  bradesconext.digital
@@ -41117,6 +41644,7 @@ brainplow.com
  brainrave.eu
  brainsconsulting.ro
  brainsmithlab.com
+brainstormaccumulation.com
  brainsugar.co.zw
  brainsuger.com
  braintcdn.com
@@ -41287,7 +41815,6 @@ bredretre.uno
  bredstart.com
  breed-caso.com
  breedenandsilver.com
-breedmerit.xyz
  breezart-russia.ru
  breezehim.com
  breezyali.com
@@ -41323,7 +41850,6 @@ brentwood23.com
  brentwoodfamilydentists.com
  brenz.pl
  breotranscom.nckithailand.gdn
-breqohqdfrmspybqykgopqcwuz-dot-gl099898987fhkl.uk.r.appspot.com
  bres2112351act321231.club
  brescofoodinc.is-by.us
  bretexpress.com
@@ -41366,6 +41892,7 @@ bric-groupe.com
  brick-salty-toast.glitch.me
  brickauditor.com
  brickcityblogs.com
+bricksforchicks.co.nz
  brickwholesaler.com
  bricorate.com
  bricotienda.com
@@ -41662,6 +42189,7 @@ brrlolrb.info
  brroduvnaatlwncbimgzuevjfqntkhnfyxlf-dot-cryptic-now-290917.ey.r.appspot.com
  brsbrosker.ml
  brsemprepresente.com
+brspr.com
  brsydl.cn
  brt-8898775fb-com.preview-domain.com
  brther-group.com
@@ -41705,6 +42233,7 @@ bruset.no
  brushnrollinc.com
  brusknet.net
  brussel-airport.be
+brusselsarport.be
  brusselstourismjobs.be
  brut.uz
  brutecleaner.com
@@ -41798,7 +42327,6 @@ bsiteserver.com
  bsiteserverbo.com
  bsixtyseven.co.ke
  bsj.abmx.cn
-bsjizjdcxjkmelcdcnfpzymqgd-dot-gle39404049.rj.r.appspot.com
  bskns.ga
  bskns.gq
  bsknz.ga
@@ -41823,7 +42351,6 @@ bsnskskkskekejka.000webhostapp.com
  bsnsw.xyz
  bsnuddsmdxmxlwueuyncgbyytiespmkrxomo-dot-offglen.uk.r.appspot.com
  bsnxlar.vipsnapchatsexting.com
-bsnzzefnjdnjudbjtrctjbyway-dot-gle39404049.rj.r.appspot.com
  bsoemifvyzfuhmsm-dot-millinium.ey.r.appspot.com
  bsonus.xyz
  bspb.info
@@ -41983,7 +42510,6 @@ btqgamqatozmlmuw-dot-millinium.ey.r.appspot.com
  btqhyi.serviceorder.su
  btqijzrdpvlhzans-dot-millinium.ey.r.appspot.com
  btqzr.jaysbrand.com
-btresport.in
  btronufrzlrvrqndqugsmcpmtxilyhommtgt-dot-offgl8876899977678.uk.r.appspot.com
  btrsecurity.co.uk
  btsa.co.id
@@ -41995,7 +42521,6 @@ bttechnologies.co.in
  bttt.godaddysites.com
  btttv.yolasite.com
  bttv.yolasite.com
-btv3q1u1icr2qie7.z5.web.core.windows.net
  btvlctjlzbmrkwyxnlgdssaifb-dot-gleowayel400503.uc.r.appspot.com
  btvms17240.xyz
  btvojrydnskhbtek-dot-millinium.ey.r.appspot.com
@@ -42076,7 +42601,6 @@ budi01.whatsaap.com.getsviip7.com
  budi01.whatsapp-youtube-indo.gq
  budi01fanspage226.000webhostapp.com
  budi01gaming.sytes.net
-budi01gaming.wsppvirall.ga
  budi01gaminggrupwa.ftp1.biz
  budi01grubwa.000webhostapp.com
  budi01uwoe.zxix7.com
@@ -42532,7 +43056,6 @@ but-malte.web.app
  but63ers.tk
  butchers-71.tk
  butellgbcminsohj-dot-millinium.ey.r.appspot.com
-butero.net
  buthagnere.com
  buthbuth.com
  butikpatike.com
@@ -42547,7 +43070,6 @@ butterflyboomers.com
  butterflyms.com
  butterhelm.com
  butterscotchmonitoring.com
-buttoned-short-slouch.glitch.me
  buttonomar.men
  buttonstart.in
  buttters.com
@@ -42737,7 +43259,6 @@ bwojktzgzutadpfiydqzkxovohqqpkpgpewp-dot-cryptic-now-290917.ey.r.appspot.com
  bwqidgfnvufrawjyjiacspfrhgdgafxpnddb-dot-cryptic-now-290917.ey.r.appspot.com
  bwsr.eu
  bwubsnqdlmkignxg-dot-millinium.ey.r.appspot.com
-bwuorovrvgpjinsbdtqiaxpuwr-dot-glmar9393293232323.uk.r.appspot.com
  bwvvommzegnzgygl-dot-millinium.ey.r.appspot.com
  bwxddtwlywebbzce-dot-millinium.ey.r.appspot.com
  bwyhf7kuoeyumpv.e8273.pro
@@ -42784,7 +43305,6 @@ bxpsdamgucjyaqkm-dot-millinium.ey.r.appspot.com
  bxqbactellkbgptudfwtzmneefjbmtvvsjac-dot-cedar-code-289917.nn.r.appspot.com
  bxqnlo.goruli.com
  bxqqdyhazhklrpmt-dot-millinium.ey.r.appspot.com
-bxroyyttappruhipkksgiyzcgo-dot-gle39404049.rj.r.appspot.com
  bxryvpvvvdpilavf-dot-millinium.ey.r.appspot.com
  bxsxz.xyz
  bxudkbvbrwpcbbydegjpjelsgqulokqvuxxy-dot-cedar-code-289917.nn.r.appspot.com
@@ -42957,6 +43477,7 @@ c-motors.com
  c-nation.targetprovider.pro
  c-o.space
  c-obmen.ru
+c-om.be
  c-runescape.com.ua
  c-tec-support.co.uk
  c-w2b.addroits.com
@@ -42967,6 +43488,7 @@ c.img001.com
  c.k1ristri.ru
  c.ksc.ac.kr
  c.lidia39.club
+c.oooooooooo.ga
  c.pritiritobo.ru
  c.setterlistjob.biz
  c.theborneopost.com
@@ -43146,6 +43668,7 @@ ca-payment.me
  ca-pf00094696.webnode.gr
  ca-pf00094697.webnode.com.uy
  ca-pf00669991.webnode.cl
+ca-rbc.com
  ca-sj.club
  ca-spay.club
  ca-ssl.net
@@ -43175,6 +43698,7 @@ ca4016.xyz
  ca4030.xyz
  ca4786.com
  ca5.ooguy.com
+ca50719.tmweb.ru
  ca6sj.svcoding.com
  ca7.utrng.edu.mx
  ca7655.com
@@ -43186,7 +43710,6 @@ caaconstructions.org
  caajcobros.com
  caal.cl
  caarmelcollege.org
-caase4.app.link
  caasima.cartantech.so
  cab-vietnam.org
  cab2cablink-space.com
@@ -43200,8 +43723,6 @@ cabdhtnxg.goruli.com
  cabelectrical.com.au
  cabellorcshop.com.br
  cabemzez.com
-caber03.000webhostapp.com
-cabers.000webhostapp.com
  cabinbyobriens.com
  cabinet-adonai.com
  cabinet-avocats-demosthene.com
@@ -43311,7 +43832,6 @@ cafecitoperez.ivanidzakovic.com
  cafedekwaysteniet.nl
  cafedias.sk
  cafeh.ie
-cafehwwfdthpuxoyjzlwuajolq-dot-gl099898987fhkl.uk.r.appspot.com
  cafemattmeera.com
  cafemorenoperu.com
  cafeonelove.com
@@ -43345,7 +43865,6 @@ cahjvuwcdunlhpfbgskwqhxuxd-dot-gleowayel400503.uc.r.appspot.com
  cahtsnzifbojpmju-dot-millinium.ey.r.appspot.com
  cahtwgrzas.com
  cahumaroja.web.app
-cahyaniryn.dqhv.tk
  caiaf0n.com
  caienknife.club
  caifansoft.com
@@ -43430,6 +43949,7 @@ caixatualizacao-2020.com
  caixderrlikoul.com
  caixipor.pt
  caiyule666.vip
+cajafreefire1garena-diamantes-bonus-marzo.com
  cajainfo.com
  cajamar-alerta.com
  cajamar-es-caja-rural.bp-pt.com
@@ -43437,7 +43957,6 @@ cajamargrup.com
  cajamarmoviles.com
  cajasocial-oficial.com
  cajasparabotella.com
-cajbptwswtplhilwbbzuknicib-dot-gl099898987fhkl.uk.r.appspot.com
  cajocalf.pt
  cakeboob.com
  cakecoati.com
@@ -43477,11 +43996,13 @@ caldenercom.nckirent.gdn
  caldwellcpas.net
  caldwellfbc.com
  caleii.kokoweill.vip
+calendered-acquisit.000webhostapp.com
  calendqr.com
  caleromartinez.ug
  calettadelcanavese.com
  calfignoramus.com
  calftoggi.com
+calfviolation.com
  calgaryhealthts.com
  calgarymagicshop.com
  calgaryshine.com
@@ -43507,6 +44028,7 @@ calirenacio.com
  calitreeservicespva.com
  callatelogs.com.ng
  callcomplete.com.br
+calldivorce.fun
  calledtochange.org
  callenderpress.co.uk
  calligraphic-dynamo.000webhostapp.com
@@ -43616,6 +44138,7 @@ camisetapersonal.com
  camisolaamarela.pt
  camiticket.com
  camkamitu.com
+camlife.in
  cammdenhall.com
  camminachetipassa.it
  camnangtrithuc.com
@@ -43659,6 +44182,7 @@ camptheral.com
  campus-meme.com
  campus2day.de
  campusexpo.org
+campusfrancevideo.com
  campusoutreach.org
  campustoluca.uicui.edu.mx
  campusxiquena.es
@@ -43754,7 +44278,6 @@ cancel-online.com
  cancel-onlinepayee.com
  cancel-orders.serveirc.com
  cancel-outgoingpayee.com
-cancel-payee-access.com
  cancel-payee-haii.com
  cancel-payee-halifax.info
  cancel-payee-hs.com
@@ -43770,6 +44293,7 @@ cancel-payments.co
  cancel-payments.info
  cancel-ppal.xyz
  cancel-removalloginrequest.com
+cancel-request-payee.com
  cancel-requestverify.com
  cancel-suspension.duckdns.org
  cancel-unknown-payees.com
@@ -43802,7 +44326,6 @@ cancellation-update.cc
  cancellationi-tunesrequestapplstore.com
  cancellations-payments.cc
  cancelling-payee.cc
-cancelloginnewpayee.com
  cancelloginpayee.com
  cancelmyorders-ipkc.serveirc.com
  cancelmyorders-mlw.serveirc.com
@@ -43958,7 +44481,6 @@ cap114.fr
  cap1txtalert.com
  cap1verification.com
  cap9c34c54.azurewebsites.net
-capableweightloss.com
  capaccitar.com.br
  capacitacionesyconsultoriaamaya.com
  capasdetelemoveis.pt
@@ -44060,6 +44582,7 @@ capsblog.0fees.us
  capscomic.0fees.us
  capsdomannual.internationalwirelesscalls.xyz
  capsecretariat29.fr
+capservice.online
  capssende.0fees.us
  capstone-investing.com
  capstoneedugate.com
@@ -44147,7 +44670,6 @@ card.flshnn.cc
  card.paypaleverify.org
  card.rakuten.co.jp.sd-login.vip
  card.tojprakuten.xyz
-card12.s3.amazonaws.com
  card2wfffff.com
  cardaanvragen.xyz
  cardandev.com
@@ -44197,7 +44719,6 @@ careerzone.xyz
  careficient.com
  careforthesheep.org
  carefullyinputto.opentoamazon.pw
-caregiona8.temp.swtest.ru
  careinsurance247.com
  carelifesfoundation.in
  carelinknurse.xyz
@@ -44494,7 +45015,6 @@ casapantanal.com
  casaprotegida.cl
  casaranabelize.com
  casaredonda23.000webhostapp.com
-casarey.mx
  casartyop.com
  casartyop.net
  casaruralentejeda.com
@@ -44670,6 +45190,7 @@ casenoob.xyz
  casenorm.xyz
  caseonlineperilous.com
  casepie.xyz
+casercaloo.ga
  caseriolevante.com
  caseroko.xyz
  casertinvest.com
@@ -44692,7 +45213,6 @@ caseythomasrd.com
  casfetaudsm.org
  cash-appupdateatt.weebly.com
  cash-financial.com
-cash.app-secureasc02.com
  cash.app-squaresigninsupport.com
  cash.app.subsectioncsv.conradsmenu.com
  cash4homesale.com
@@ -44904,10 +45424,8 @@ cawzxlqaeylyqqdpptzi-dot-gleowyel040493443434989.wl.r.appspot.com
  caxbnee.com
  caxg.xyz
  caxrejnstisfedii-dot-millinium.ey.r.appspot.com
-caxtquydnkwwiyinpsmtzwclua-dot-gle39404049.rj.r.appspot.com
  cayahanshaj.com
  caycerichardson.com
-caycos.beispielseite-wmka.de
  cayecasas.com
  caygiongcongnghecao.com
  caygri.com
@@ -44963,7 +45481,6 @@ cbf-financial.com
  cbfyixhe.topkorder.su
  cbgwkrthautysrwr-dot-millinium.ey.r.appspot.com
  cbh0z.onderhost.com
-cbhnjnjj-gjjkj-gujnk.s3.eu-north-1.amazonaws.com
  cbhsncable.com
  cbhsnmode.com
  cbhsnprint.net
@@ -45189,6 +45706,7 @@ cdbqdlvuldzbtaohfomgskpmbq-dot-poised-bot-306515.uk.r.appspot.com
  cdbsahmhommlqume-dot-millinium.ey.r.appspot.com
  cdbulrikuqwbltqt-dot-millinium.ey.r.appspot.com
  cdc-coronavirus.com
+cdc-ielc.org
  cdcbfajaewrbaszy-dot-millinium.ey.r.appspot.com
  cdcdsuhv32.floridakeysspearfishing.com
  cdcdxzazq.000webhostapp.com
@@ -45318,6 +45836,7 @@ cdn.adless.io
  cdn.advancedpccare.net
  cdn.advancedpccare.online
  cdn.arsis.at
+cdn.avastcloud.org
  cdn.cacher.io
  cdn.dsultra.com
  cdn.f83d7318f153ba91e4e0661641ba4467.com
@@ -45397,6 +45916,8 @@ ce22983.tmweb.ru
  ce2rf.addroits.com
  ce3-f.mentriqq.com
  ce32838.tmweb.ru
+ce442ac57e3849333.temporary.link
+ce4gs.ddns.net
  ce7428c103ad.ngrok.io
  ce93365.tmweb.ru
  ce995261c23447b2d3196726c71e3a10b667f469.net
@@ -45435,6 +45956,7 @@ ceceilia61023778.xyz
  cecfl.com.br
  cecfuentedevida.net
  cecilandrayhomes.com
+ceciliacarnerofitness.com
  ceciliatessierirabassi.com
  cecilweb.co.za
  ceckefs.net
@@ -45579,7 +46101,6 @@ cemiteriodapenitencia.com.br
  cemonline.co.uk
  cemqes-acontsecur8707856.cf
  cemtuylinkverifydtvjdfdjd.weebly.com
-cemupro.com.ar
  cena.sn
  cena161.ru
  cencentupdate.afashiondoll.buzz
@@ -45664,7 +46185,6 @@ centralaviationsolutions.com
  centralbilling.phototours.com
  centralchocados.cl
  centralcitybank.bizfinaciers.com
-centralcitybankonline.com
  centralcooperativa.com
  centralderendaextra.com.br
  centralebankeurope.com
@@ -45801,7 +46321,6 @@ certifica-accesso-app.com
  certifica-app.info
  certifica-dati-personali-app.com
  certificacionperu.com
-certificacionreaseguros.org
  certificad0sonlinemaglz.com
  certificadobccr.com
  certificadodigitalcrgo.com
@@ -45820,6 +46339,7 @@ certifiedmembership.top
  certifiedprolnstabluecheck.000webhostapp.com
  certifiquesupagod.com
  certifymyproperty.com
+certifyunauthorizedpayee.com
  certinaj.000webhostapp.com
  certipluseagnece.com
  certmyaccount.com
@@ -45913,7 +46433,6 @@ cfd.tanglescanner.com
  cfdfschwb.tk
  cfdprivateme9082.serveirc.com
  cfdschwb.tk
-cfdxskrizyqkdplzxxkldzncmj-dot-gle39404049.rj.r.appspot.com
  cfe-recibos.com.mx
  cfe.kukrusa.in
  cfebourse.com
@@ -45925,6 +46444,7 @@ cfg.lovefule.com
  cfg.smt.docomo.ne.jp.nerfcewz.com
  cfg.smt.docomo.ne.jp.ngetestaja.com
  cfg1k.gratishosting.cl
+cfhknnjk-bhjjij-bjnkjkjh.s3-eu-west-1.amazonaws.com
  cfhqeoenvmandosl-dot-millinium.ey.r.appspot.com
  cfiaymoreinvestimentos.com
  cfilkzccbrprbcgq-dot-millinium.ey.r.appspot.com
@@ -45977,7 +46497,6 @@ cg29lhgyrqen08.com.de
  cg4-b.svcoding.com
  cg50dwpni8.firebaseapp.com
  cg52789.tmweb.ru
-cg58234.tmweb.ru
  cg76786.tmweb.ru
  cg9wb3zlci5yawdodc10b3.z06a.gq
  cgadministracion.com
@@ -45992,6 +46511,7 @@ cgdsqlvjbbcmdgkqzthqpbxjdgwbueausmqv-dot-solar-vertex-285913.rj.r.appspot.com
  cge-bin-resolution-centre.domine.top
  cgekxtwtrgfcoxtglgnfzdfmen-dot-glmar9393293232323.uk.r.appspot.com
  cgemtalent.com
+cgerver.com
  cgfcrjhjcgtnqniz-dot-millinium.ey.r.appspot.com
  cgfdbjsrcswzaqgvsn.top
  cgfdjkqqfccfbtap-dot-millinium.ey.r.appspot.com
@@ -46033,7 +46553,6 @@ cgraspublishers.com
  cgraybuilder.com
  cgrzyweuttuhkafenc.top
  cgs32.com
-cgsedzcsnecvvaopfbozxeolap-dot-gle39404049.rj.r.appspot.com
  cgshunt.com.cn
  cgsijibemewlczco-dot-millinium.ey.r.appspot.com
  cgubtokn.info
@@ -46126,7 +46645,6 @@ chadecogroup.com
  chadmiinowaa.creatorlink.net
  chadrickcourts.icu
  chaes2man.top
-chainconfine.com
  chaingames.net
  chainlinkx.net
  chainnss.com
@@ -46323,6 +46841,7 @@ chasbama.xyz
  chascur-updatser1.serveirc.com
  chase-02.duckdns.org
  chase-02login.com
+chase-03bsecured.cloudns.asia
  chase-1billing.com
  chase-2prevent.com
  chase-2sconfirm.com
@@ -46731,7 +47250,6 @@ chasingthesunlife.com
  chasmco.com
  chasndbfa.com
  chasonline.brooklynjewish.org
-chasonlineacct.weebly.com
  chasre.net
  chasre.org
  chasse-concept.com
@@ -46790,6 +47308,7 @@ chat-mariozawa.jkub.com
  chat-pal.com
  chat-sex-whatsapp1.wa-sex.com
  chat-towhatsahp177.2020-2021.net
+chat-viralnew.whatsapp-real.ga
  chat-wa-dewasa.000webhostapp.com
  chat-wa.jkub.ga
  chat-wahstsaap18038.000webhostapp.com
@@ -47011,6 +47530,7 @@ chat-whatshap.event-getss20.cf
  chat-whatshap.qpoe.gq
  chat-whatssapp.hol50.com
  chat-whatssaqp.com
+chat-whattapps1.modoscuro.club
  chat-whattsap.onviy.com
  chat-whattsapgrup.2waky.com
  chat-whattsapp.com
@@ -47051,7 +47571,6 @@ chat.whatsapp.com.invitegroup20.getz75.com
  chat.whatsapp.com.islkwq1vxp.hols26.com
  chat.whatsapp.com.join78.ml
  chat.whatsapp.com.lxcsxghsdvdvshsb.gabung12.ml
-chat.whatsapp.com.lxcsxghsdvdvshsb.gabung12.tk
  chat.whatsapp.com.nyamuknakal.tk
  chat.whatsapp.com.tempat-berbagi-video18new.zyns.com
  chat.whatsapp.com.texastanglers.com
@@ -47135,6 +47654,7 @@ chatgrupsbokep.loseyourip.com
  chatgrupwa099.000webhostapp.com
  chatgrupwabudi.000webhostapp.com
  chatgrupwhatsapp.gjoin-org.ml
+chatgrupwhatsapp.gjoin-org.tk
  chatgrupwhatsapphotdewasa18plus.wa-bkp020.tk
  chatgrupwhatsappjoinkanyuk.wikaba.com
  chatgrupwhatsappviral.my03.com
@@ -47204,7 +47724,6 @@ chaturbatesxx.ml
  chatwa.asli20.com
  chatwa.okzk.com
  chatwa1.dynv6.net
-chatwa591.dumb1.com
  chatwa62.dumb1.com
  chatwa62.lflink.com
  chatwa674.ddns.mobi
@@ -47324,12 +47843,11 @@ chatwhatsappbokepvirall.free94.ml
  chatwhatsappbzmiap68c4fcdyergo8hao.ga
  chatwhatsappcome6zapcdw2pd3zy2v2icwqy.tk
  chatwhatsappdewasa.mrbonus.com
-chatwhatsappff.guied255.cf
-chatwhatsappff.tk
+chatwhatsappff.cf
  chatwhatsappgirls.tk
  chatwhatsappgroupporn18.mrslove.com
  chatwhatsappgroups10.otzo.com
-chatwhatsappgroups3.otzo.com
+chatwhatsappgroups11.otzo.com
  chatwhatsappgroups6.otzo.com
  chatwhatsappgrubsx.pubgproperties.com
  chatwhatsappgrubsx.tk
@@ -47496,6 +48014,7 @@ check48paypal.com
  check511.duckdns.org
  check72paypal.com
  checkaccont.paypal.com.chavinconsultores.com
+checkaccount3.tonohost.com
  checkaccountid.ml
  checkaccountstatusd.does-it.net
  checkactivitytoday.com
@@ -47789,6 +48308,7 @@ chichomify.com
  chicken.ab.ca
  chickideefarms.com
  chicksandmachines.com
+chicksinfo.com
  chicmunuyegtgezv-dot-millinium.ey.r.appspot.com
  chicostara.com
  chicroulam.blogspot.com
@@ -47855,7 +48375,6 @@ chimebanking.us
  chimicolorgerli.it
  chimingumbrella.com
  chimney-sweep-brighton.co.uk
-chimneyenhance.com
  chimpanzeechidev.com
  chimps-inc.top
  china-educations.com
@@ -48152,6 +48671,7 @@ chtowncomedy.com
  chtpldxrfx.000webhostapp.com
  chtrzgtgrzsit.com
  chtwaagp.top0.shop
+chtwatsp.zzux.com
  chtwhastup2231.000webhostapp.com
  chtwhatsapp.com.claim65.ml
  chtwspgrup.getz9.shop
@@ -48586,6 +49106,7 @@ civil-lucrative.com
  civilblogbd.com
  civilcontractorsinmumbai.in
  civilengineeringassignmenthelp.com
+civilengineerssydney.com.au
  civilience.network
  civilizednet.org
  civilleague.com
@@ -48700,7 +49221,6 @@ ckidkina.ru
  ckikgofafbfxsyixcfce.ru
  ckinterbiz.com
  ckite.handipants.com
-ckkfecwxlhzlisryjywxsjdpsp-dot-gle39404049.rj.r.appspot.com
  ckkm-my.sharepoint.com
  ckl6767.com
  cklaxeetzvnhovexwjmclmxxxisfgrjarqrr-dot-solar-vertex-285913.rj.r.appspot.com
@@ -48757,19 +49277,15 @@ claf.pbwcf.webfreemanual.asia
  clafoto.com
  claim-event-codashopfreef269.giize.com
  claim-event2020-free67.ml
-claim-eventnew.prem-net2.ml
  claim-freesgincubatorsgparrot2garenaitem.wikaba.com
  claim-freeskin-effectrecall.mrbonus.com
  claim-freeskin11.zyns.com
  claim-hmrc.com
  claim-incubatorxm8.web1.holz3.x24hr.com
  claim-kbc.com
-claim-laporan-facebook-resmi.duckdns.org
-claim-mlbb782.cf
  claim-mytaxrebates-govuk.com
  claim-mytaxrefunds-govuk.com
  claim-pulsa-token-psbb.000webhostapp.com
-claim-skin.mobile-legends68.cf
  claim-tax-gov.uk
  claim-tax-rebate.com
  claim-tax-refundgovuk.com
@@ -48829,7 +49345,6 @@ claims.06return-ref.com
  claims.pubgcompany.com
  claims13skin.jkub.com
  claims16.com
-claimsdiamondsfree1.ml
  claimsekali.000webhostapp.com
  claimsff.my.id
  claimskin-mlnew78.wikaba.com
@@ -48876,12 +49391,12 @@ claritcentre.org
  claritybusinessfunding.com
  clarityptc.co.uk
  clarityupstate.com
-clarkdd.tk
  clarkeburgh.buzz
  clarkelectric-my.sharepoint.com
  claro-net-emta.aceite.fbiz.com.br
  clarrywillow.top
  clarve.club
+clashdare.com
  clashmode0ivuz5.000webhostapp.com
  clasich.com
  clasificadoscochabamba.com
@@ -48908,9 +49423,9 @@ classicpalace.ae
  classicprints.in
  classicstazz93buzz.com
  classicvice.com
+classified.webc.in
  classifiedmatch.top
  classify.club
-classifytract.com
  classina.tokyo
  classipel.com.br
  classistern.xyz
@@ -49036,7 +49551,6 @@ clerici.eu
  clerici.info
  clerkish-lanterns.000webhostapp.com
  clessepsadsecuritefr.shuiadrink.top
-clever-activ-lo.de
  clever-bed.surge.sh
  clever-bhabha.netlify.app
  clever-blackwell-b81e70.netlify.com
@@ -49481,7 +49995,6 @@ clubtempel.de
  clubulnautic.ro
  clubulnauticroman.ro
  clue-inspect.com
-cluebazar.com
  cluelesssiennavoxels--five-nine.repl.co
  cluelesstraveler.com
  clumpys.com
@@ -49496,7 +50009,6 @@ clwknife.fun
  clxctnxizkzgyqci-dot-millinium.ey.r.appspot.com
  clxigkcbmixfzqzt-dot-millinium.ey.r.appspot.com
  clxxsun.space
-clycpsgjlskfispwfjoggdygyt-dot-glmar9393293232323.uk.r.appspot.com
  clydesbnk.com
  clypeal-rescuer.000webhostapp.com
  clyyazoyzvdutzrg-dot-millinium.ey.r.appspot.com
@@ -49903,7 +50415,6 @@ cocuva.com
  cod134241723promocional.com
  cod2.site
  codamlshopp49.zyns.com
-codapayfreecodashop.ga
  codashoop.free.mexx6.com
  codashop-event5543.ml
  codashop-evnt2021.cf
@@ -49913,7 +50424,6 @@ codashop-newevent736.cf
  codashop-ph2020.ezua.com
  codashop-phmlbb.ezua.com
  codashop-topup.3-a.net
-codashop-xyz65ggku.ml
  codashop2020.acmetoy.com
  codashopbug-free.xxuz.com
  codashopeventsactivity.ga
@@ -49921,7 +50431,6 @@ codashopeventsactivity.gq
  codashopeventsmlbb-1.gq
  codashopeventsmlbb-1.ml
  codashopfreeresmi2020.000webhostapp.com
-codashopgarenafreefire.grub-7492.ml
  codashopmlbb.mrbasic.com
  codashopnewevents7s.gq
  codashopofficiall.000webhostapp.com
@@ -49941,6 +50450,7 @@ codeanddeals.com
  codeast.ga
  codec.servepics.com
  codecis.net
+codecraftdm.com
  codedecodede.com
  codedeploypray.com
  codedriveinfo.com
@@ -50125,6 +50635,7 @@ colegiosmotolinia.edu.mx
  colegiovirtualonline.com
  coleidaerotabokcom.info
  colemanco.com.au
+colennao.xyz
  colest.tk
  colexpresscargo.com
  colf.com.br
@@ -50198,10 +50709,6 @@ collilers.com
  collins-creosote.com
  collinsgestion.com
  colloquialupgirding.online
-colmekbokep-vidio7.mydad.info
-colmekperawan-vidio3.freetcp.com
-colmekstw-janda5.mydad.info
-colmekvidio-stw1.freetcp.com
  colmenamotors.com
  colmrkbecek.theworkpc.com
  colnbases.verificatlonsupport.com
@@ -50225,6 +50732,7 @@ colombiavozwnet.ru
  colombobiconcavestevenson.com
  coloniali.tk
  colonic-chases.000webhostapp.com
+colonlean.com
  colonnade-consultancy.co.uk
  colonus-hedging.com
  coloorad.gq
@@ -50244,6 +50752,7 @@ colordesignernet.shaxiaapril.top
  colordropmedia.com
  colore031como.it
  colorfastinv.com
+colorful-everlasting-apogee.glitch.me
  colorgraphic.com.br
  colorink.com.mx
  colorofhorses.com
@@ -50280,9 +50789,11 @@ columbustrack.in
  columbustx.xyz
  columniform.info
  columpioalviento.com
+colunadeambu.info
  coluro.com
  colved.club
  colvid-colpatria.com.co
+com-06662451.vochtplekken.be
  com-12021094.mezcalunion.com
  com-198465409846504.top
  com-1c.ru
@@ -50292,7 +50803,6 @@ com-4pple-santekpellasises-community-updateds.org
  com-6564605430510556.top
  com-65735340543430.top
  com-904498651096513.top
-com-94251007.vochtplekken.be
  com-ahs73fjonvwaokrnds78pa.m4max.com
  com-as.ru
  com-autha.co
@@ -50597,63 +51107,16 @@ commentfbtomashtpp.000webhostapp.com
  commentingcooking.com
  commentmellow.com
  commentpassage.com
-comments-hcknm2qti52.creditcourtage.ca
-comments-lk8j5e97ebw.creditcourtage.ca
-comments-ttg08gdaky.creditcourtage.ca
-comments-yk3m0q2srbx1.creditcourtage.ca
-commentsfb-0ippy1by07s.thejake.cc
-commentsfb-0kpstqtqv.thejake.cc
  commentsfb-0lukjevv7vei.libkrasnopolie.by
-commentsfb-0sn3a0r77t1vo.thejake.cc
-commentsfb-11wqyyfx0.thejake.cc
-commentsfb-1efx4k7l.thejake.cc
-commentsfb-1mjpmpv7ozmzej.thejake.cc
-commentsfb-294pjtntqlmph6.thejake.cc
-commentsfb-3iizto05.thejake.cc
-commentsfb-5y9hapryvq24.thejake.cc
-commentsfb-7gpul7meym5wx.thejake.cc
-commentsfb-7rld1d6m.thejake.cc
-commentsfb-7zj1cfees06.thejake.cc
-commentsfb-86dlb5e8a1hz8.thejake.cc
-commentsfb-88x02yre3i07yb.thejake.cc
-commentsfb-ae57b0y9y2m.thejake.cc
+commentsfb-1ys0of2cleo3.libkrasnopolie.by
+commentsfb-8lri5mznift.libkrasnopolie.by
  commentsfb-agqa8fwti.libkrasnopolie.by
-commentsfb-atx39ib8ypc4m.thejake.cc
-commentsfb-bbzpi27yr10b.thejake.cc
-commentsfb-bd0ssxclz1m36v.thejake.cc
-commentsfb-brbe2zt7.thejake.cc
-commentsfb-dcrujrj0x38km2y.thejake.cc
-commentsfb-e700tf0e0y.thejake.cc
-commentsfb-frp0paa0eana3.thejake.cc
-commentsfb-fszpttaeytib.thejake.cc
-commentsfb-gidgg0mxv.thejake.cc
-commentsfb-i1jwzb6l7o3oof.thejake.cc
-commentsfb-jakgkkkkk7au.thejake.cc
-commentsfb-jg8df46g0p61tuo.thejake.cc
-commentsfb-mwc9vr6of0.thejake.cc
-commentsfb-mzpllezxpbiwkx.thejake.cc
-commentsfb-n9y9iwbt2kd.thejake.cc
+commentsfb-b0y4qo1sjzs.libkrasnopolie.by
+commentsfb-dqg7bz3dig.libkrasnopolie.by
  commentsfb-nmwrq24gkuky.libkrasnopolie.by
-commentsfb-nveprui8ram.thejake.cc
-commentsfb-ombqqkfhx6ikglf.thejake.cc
-commentsfb-pfcf6xbfzvbdpi.thejake.cc
-commentsfb-ptyz0bptsbf7e.thejake.cc
-commentsfb-qe78x0i8ckd6p.thejake.cc
-commentsfb-qjwkxliidw31w.thejake.cc
-commentsfb-qtd8itlb58rq3.thejake.cc
-commentsfb-sa33y3na.thejake.cc
-commentsfb-smmxvm6swfe.thejake.cc
-commentsfb-t3sb7fzpz.thejake.cc
-commentsfb-tya1fya01p.thejake.cc
-commentsfb-tyfne10tz7iap.thejake.cc
-commentsfb-u677qcuh4pa8q.thejake.cc
-commentsfb-xx4f2mlp.thejake.cc
-commentsfb-yeaawfon2znip1.thejake.cc
-commentsfb-zav7sf0p2ffe.thejake.cc
-commentsfb-zni71na3nip1.thejake.cc
-commentsfbook-6vz1ntgrq5vf.creditcourtage.ca
-commentsfbook-equu6o2o8ue.creditcourtage.ca
-commentsfbook-iynsp3ovs.creditcourtage.ca
+commentsfb-o5k06xpvu.libkrasnopolie.by
+commentsfb-sofvyy4mumag.libkrasnopolie.by
+commentsfb-ue5zgkzb9.libkrasnopolie.by
  commerce-paypal.com
  commerce.proeassist.com
  commercedusud.com
@@ -50685,7 +51148,6 @@ commnuity.stage.powerforrthepeople.stage6ixte.org
  commodex.com
  commomwealthbankgroups.com
  common-problem.live
-commonbanpksecuredauth.com
  commonfewsearchservice--five-nine.repl.co
  commonground-stories.com
  commongs.xyz
@@ -50738,9 +51200,6 @@ community-ebay-diskussionsforen-de-ws50.html-5.me
  community-ebay-diskussionsforen-de-wss51.html-5.me
  community-ebay-diskussionsforen.a0001.net
  community-ebay-it-htmlapp.mydiscussion.net
-community-fb-02309482.maletoth.com
-community-fb-28091099.maletoth.com
-community-fb-64683094.maletoth.com
  community-forms-ig.ml
  community-help-fb.000webhostapp.com
  community-issue-recovery-page.my.id
@@ -50757,6 +51216,7 @@ communityreview.info
  communityrule.net
  communityrules-appeal.com
  communityservicecrawl.org
+commuser.thepinkradar.com
  comnet.com.mx
  comnetoostli.info
  comnitracsom.net
@@ -50798,17 +51258,6 @@ company01.sutoweb.com
  companydoc-a1c66.web.app
  companynotificcations.tk
  companyriviera.eu
-companys-199764978564325230079.tk
-companys-199764978564325230080.tk
-companys-1999649785643252300081.tk
-companys-1999649785643252300082.tk
-companys-1999649785643252300083.tk
-companys-1999649785643252300084.tk
-companys-1999649785643252300085.tk
-companys-1999649785643252300086.tk
-companys-1999649785643252300088.tk
-companys-1999649785643252300089.tk
-companys-1999649785643252300090.tk
  companysbenefits.online
  companyservicesinc.kim
  companyservicesinc.works
@@ -50832,6 +51281,7 @@ compassionate-downg.000webhostapp.com
  compassionate-dubinsky-013951.netlify.app
  compassionate-elion-c7cf66.netlify.app
  compassionate-engelbart-fc46a8.netlify.app
+compassionate-stonebraker-07ff24.netlify.app
  compassionatecarejupiter.com
  compasslisting10726505.com
  compasslisting26706585.com
@@ -51089,6 +51539,7 @@ conductingsubmerge.com
  conebg.com
  conecom.es
  conect-maps.com
+conect.auone.jp.auid-wallet.com
  conectacontualma.com
  conectado-misesion.espsantaelnet.com
  conectados.com.ec
@@ -51205,6 +51656,7 @@ confirm-payee-reference006.com
  confirm-payee-reference1721.com
  confirm-payee-security.com
  confirm-secured-department.com
+confirm-security-payee-review.net
  confirm-transfer-reference00821.com
  confirm-transfer-reference11772.com
  confirm-update.com
@@ -51212,7 +51664,6 @@ confirm-user.services
  confirm-verify.me
  confirm-your-identity-wells-fargo.com
  confirm.bill-app.ru
-confirm.fb-verify01.com
  confirm.fbookus-06043290.gruppotiozzo.it
  confirm.fbookus-08599033.gruppotiozzo.it
  confirm.fbookus-09643311.gruppotiozzo.it
@@ -51645,6 +52096,7 @@ consultoriaclassea.com.br
  consultoriaeninnovacion.com.co
  consultoriaiunit.com.mx
  consultoriajuridicaec.com
+consultorias.org
  consultorias.smartdevmx.com
  consumer-e2e-nightly.consumer.fe-spectrum.net
  consumerassociationmm.org
@@ -51782,7 +52234,6 @@ content-528527410.curetrick.com
  content-54283452.interiorholic.net
  content-547427849.helenquan.ca
  content-556383911.helenquan.ca
-content-56280270428.keegan21.com
  content-566160985.helenquan.ca
  content-57813602.interiorholic.net
  content-578674009.curetrick.com
@@ -51824,6 +52275,13 @@ content-95566987.interiorholic.net
  content-982307904.helenquan.ca
  content-case42083305.eliasben.ly
  content-fargo.info
+content-fb-1ap6gfhb.elefantefiori.it
+content-fb-a6vshtxr.elefantefiori.it
+content-fb-indajs1o.elefantefiori.it
+content-fb-wjy5v3l5.elefantefiori.it
+content-fb-y57xsic2.elefantefiori.it
+content-fb-yixmmdjd.elefantefiori.it
+content-fb-z93b9p8b.elefantefiori.it
  content-fbook-00564028.roggiehouse.it
  content-fbook-01379608.roggiehouse.it
  content-fbook-01830186.roggiehouse.it
@@ -52048,6 +52506,7 @@ cookaeaqua.com
  cookdupagetransportation.com
  cookeandkelvey.com
  cooked-chatter-empress.glitch.me
+cookie-neat-infinity.glitch.me
  cookiejar.be
  cookienotti.ru
  cookiepro.cloud
@@ -52113,7 +52572,6 @@ cooperativecareerpoint.org
  coopermarketconnect.com
  coopermutaezle.com
  coopevents.in
-coopgenss.com
  coopin.com.br
  coopsanjuan.com.pe
  coopselfservice.com
@@ -52248,12 +52706,10 @@ copyrightmediacontact-100348765.com
  copyrightmediasupport-10000387168.com
  copyrightmediasupport-10000487109.com
  copyrightmediasupport-10007483190.com
-copyrightmediateam.ga
  copyrightmusical.com
  copyrightnotice-ig.ml
  copyrightnoticesupports.com
  copyrightofinstagram.ml
-copyrightruleshelpform.ml
  copyrights-center.com
  copyrights-helpcenterss.com
  copyrights-helper.com
@@ -52275,7 +52731,6 @@ copyrightshelp.ml
  copyrightshelps-service.ml
  copyrightshelpsbusinessnotice.com
  copyrightsmedia.com
-copyrightsmedia.ga
  copyrightsmediahelp.com
  copyrightsupport-bussiness.com
  copyrightsupportagency.com
@@ -52296,7 +52751,6 @@ copyrihem.000webhostapp.com
  copyriight-online-support.ml
  copystar.co.uk
  copytak.ir
-copyyrightviolationnsecure.ml
  coq2.hyperphp.com
  coque-avec-photo.com
  coquetteblume.com
@@ -52360,6 +52814,7 @@ coreyhuntleytestdomain.com
  corhogdbbrehebsr-dot-millinium.ey.r.appspot.com
  coridenight.forexinfo.online
  coringa.r1-it.storage.cloud.it
+corinnathierhoff.de
  corinne-allemoz.fr
  corinneca.moonfruit.com
  corinthiano.ug
@@ -52810,6 +53265,7 @@ coupedeparis.f3m.free.fr
  coupiceme.com
  coupleofthingstosee.com
  coupletimpex.biz
+coupon.trabolgan.com
  couponcodeslo.com
  coupondeasls.xyz
  couponhunch.com
@@ -52819,7 +53275,6 @@ coupons4ur.com
  couponsdrawer.top
  couragecontrol.com
  courageelegant.com
-couragesimilar.com
  couragez.com
  courchevel-chalet.ovh
  courgeon-immobilier.fr
@@ -52981,7 +53436,6 @@ covid19voip.com
  covid19zombie.com
  covid2019colpatria.com.co
  covid2020.su
-covid2021onlyout.000webhostapp.com
  covid25mudra.com
  covid39.ga
  covidappstore.ddns.net
@@ -53631,7 +54085,6 @@ cr.mufg.weiruanweb.com
  cr.mufg.whitecarpetcleaning.com
  cr.mufg.wicod.com
  cr.mufg.yexietz.com
-cr.mufghelp.com
  cr.mutg.200whb.com
  cr.mutg.900whb.com
  cr.mutg.abelsonscopeworks.com
@@ -53710,6 +54163,7 @@ craigslist-accounts.com
  craigslist-confirm.isnclinic.com.au
  craigslist-login.luisfernandotorrestorres.com
  craigslist-new-messages024147.000webhostapp.com
+craigslist-posting0171407.com
  craigslist.account.nihadtrading.com
  craigslist.account.phone.verific.tripod.com
  craigslist.account.tanha.in
@@ -53909,6 +54363,7 @@ create-memorableurl.access-com.support-managetoken.generate.address.nongolwaer.c
  createanewdecksa-login.cf
  createchsoft.com
  createcig.com
+createcollectfest.com
  createdbylaura.com
  createecho.com
  createecho.org
@@ -54047,6 +54502,7 @@ creditsone.com
  creditsplus.org
  creditsuisseint.com
  creditsuisselondon.com
+creditswissbanking.com
  creditupchar.com
  creditv7.ru
  creditvirus.ru
@@ -54158,7 +54614,6 @@ critsspottletoe.com
  crittersbythebay.com
  crjamar.com
  crlitiyvvpgqsekurvlcvceroxkzmohzsowf-dot-cedar-code-289917.nn.r.appspot.com
-crm.basilrealty.in
  crm.bbsfood.nl
  crm.digitalelite360.com
  crm.indomio.com.hr-login-hr.host
@@ -54182,6 +54637,7 @@ crmofg.com
  crmorve.manivelasst.com
  crmrh.xochicalco.edu.mx
  crmtalis.manivelasst.com
+crmujfcojp.com
  crmyuudgpakehsfmwz.top
  crnaschools.org
  croatia-adventureteam.com
@@ -54405,6 +54861,7 @@ cs-zone.ml
  cs.amazn.com.sigin.ve.marlacunni.com
  cs.chromeinform.com
  cs.iganlanshu.com
+cs.na.edu
  cs.tu-mbla.xyz
  cs1-amaz0n.xyz
  cs2-paypal.com
@@ -54699,6 +55156,7 @@ csiafo.com
  csicxbuqtbhghola-dot-millinium.ey.r.appspot.com
  csidwewodjyfsrlz-dot-millinium.ey.r.appspot.com
  csiescamer.com
+csiestimator.com
  csinformaticos.com.mx
  csirfjsmoihpzytntxftxsbujcfhumjuflfo-dot-spyexc3093493.ey.r.appspot.com
  csjomhznzwhqxrnc-dot-millinium.ey.r.appspot.com
@@ -54776,6 +55234,7 @@ csw.hu
  cswazx.app.link
  cswtr.club
  csxmoney.top
+csxwruktgntpltdtegqmucojse-dot-glmar9393293232323.uk.r.appspot.com
  csxzs.xyz
  csytravels.in
  csyuan.life
@@ -54817,7 +55276,6 @@ ctfd.top
  ctftxglkeaevwssxharaiurnazrwwrloamcg-dot-gl494903049.wl.r.appspot.com
  ctghgfqqkrtwtdrt-dot-millinium.ey.r.appspot.com
  ctgrn.goruli.com
-ctgzqmevjbqefxcrrxqokmukgd-dot-gle39404049.rj.r.appspot.com
  cthbeaud.com
  cti.org.pk
  ctib.ro
@@ -54941,7 +55399,6 @@ culottes.premiumbrandd.com
  culpeperreddish.com
  culptivehelp.com
  cultish-precision.000webhostapp.com
-cultivatedpaltrycopyrightinfringement.sdsdsdsd77dsdsd.repl.co
  culturallyspeaking.net
  culturaqueretaro.gob.mx
  culturates.xyz
@@ -54950,7 +55407,6 @@ culturegospel.com
  culturejam.ca
  cultureless-map.000webhostapp.com
  culturework.ie
-cumanngetest.zzux.com
  cumberworldspry.xyz
  cumchat.000webhostapp.com
  cumhurbaskanligi-aidat.com
@@ -55370,6 +55826,7 @@ customerwelcome.000webhostapp.com
  customeryahooofficials.weebly.com
  customes-process-support-ppl.com
  customgrup.ro
+customizedgreek.net
  customizedtuo.professedamazon.icu
  custommdeskk.me
  customrecustom.top
@@ -55461,7 +55918,6 @@ cvcgroups.com
  cvcitnet.shaxiapurpose.top
  cvcittel.shaxiapurpose.top
  cvdfeyt.cf
-cvendoxjzrohuqkllpfweshwqa-dot-gle39404049.rj.r.appspot.com
  cvetisbazi.ru
  cvetochniy-buket.ru
  cvetolenta.ru
@@ -55606,7 +56062,7 @@ cxnabqecxpawvhmilcqockguoo-dot-gleowayel400503.uc.r.appspot.com
  cxnfdefreqmidjhr-dot-millinium.ey.r.appspot.com
  cxpprfp.mapstore.su
  cxqdvvtwss.duckdns.org
-cxqiylkawgbiexpzijawladlcb-dot-gle39404049.rj.r.appspot.com
+cxqi18kvjti03rghgr.xyz
  cxqrvqhjzrtwscanmjgszhmwpzxczprovclc-dot-cryptic-now-290917.ey.r.appspot.com
  cxqzdtjoftmcibjg-dot-millinium.ey.r.appspot.com
  cxrsvwemxeuyirgm-dot-millinium.ey.r.appspot.com
@@ -55795,7 +56251,6 @@ czfbqantfnycligs-dot-millinium.ey.r.appspot.com
  czfdsegqnrsvaakkqegaromavm-dot-gleowayel400503.uc.r.appspot.com
  czgcscpawsjymkfccr.top
  czh9.jaysbrand.com
-czhgmrkfkebneayatujnptktwu-dot-glmar9393293232323.uk.r.appspot.com
  czhjln.com
  czhmxdpczzayerzm-dot-millinium.ey.r.appspot.com
  czizcgjmdtgblxeolaqkbrqndddsbbcdyunp-dot-solar-vertex-285913.rj.r.appspot.com
@@ -55862,6 +56317,7 @@ d.lamarcaprosecco.com
  d.likeavirgin.io
  d.srui.cn
  d.top4top.io
+d.ttr3p.com
  d.vexeyum.xyz
  d.wanyouxi7.com
  d.zbusa.com
@@ -55904,7 +56360,6 @@ d236t.svcoding.com
  d2575423ur.temp.swtest.ru
  d25965pi.beget.tech
  d26c5.weblium.site
-d2719xd.p7.scounsulting.com
  d2882xyni5hwu8.cloudfront.net
  d2balance.com
  d2df1929.ngrok.io
@@ -55923,7 +56378,6 @@ d39x1.svcoding.com
  d3africa.com
  d3c00.duckdns.org
  d3c0d3dd0cx.000webhostapp.com
-d3c4e8360c80aecf0d4224f49ad051c0.com
  d3cb9edf305b923eeb70dfb5e6e426ce28eba8e7.net
  d3dqx.saytanet.com
  d3ed5595.ngrok.io
@@ -56109,6 +56563,7 @@ dagostim.com.br
  dagranitegiare.com
  daguia.com.mx
  daguogroup.com
+dagwdwafdhser.com
  dah6f.addroits.com
  dahadpattern.com
  dahdnbdcaiqahoqy-dot-millinium.ey.r.appspot.com
@@ -56133,7 +56588,6 @@ daily-live-deals.xyz
  daily-live-sales.xyz
  daily-mm.com
  daily-option.com
-daily-rewards.net
  daily-spin.club
  dailyairlogs.com
  dailybaze.com
@@ -56704,7 +57158,6 @@ dati-covid19-psd2.000webhostapp.com
  dati-mps.online
  dati-rinnova-p.com
  dati-secure.it
-dati-sicurezza.com
  dati-sicuri.attivazione.info
  datinggrils.xyz.s3-website.us-east-2.amazonaws.com
  datingmetodaynow.online
@@ -56767,6 +57220,7 @@ davedickersonandassociatesllc7.godaddysites.com
  davehale.ca
  davekurier.com
  davekurier.org
+davesalomon.com
  davesguitarmounts.com
  davespack.top
  davethompson.me.uk
@@ -56818,7 +57272,6 @@ davilta.tk
  davinci-studia.ru
  davinci.techieteam.net
  davismgt.com
-davisoffice.com
  davisra.com
  davitherbal.com
  davivienda.cualquier-cosa.com
@@ -57150,7 +57603,6 @@ ddload04.top
  ddlslalsslslssdd.duckdns.org
  ddm0b.jaysbrand.com
  ddmmiduiizjlurqb-dot-millinium.ey.r.appspot.com
-ddnbflkzhpkwrvpnmkbkzrhwyw-dot-gle39404049.rj.r.appspot.com
  ddncpaabbfculxam-dot-millinium.ey.r.appspot.com
  ddnnews.in
  ddns2.auth052765.webappsid5728758.co.jp.armadahgtuy.com
@@ -57413,6 +57865,7 @@ decitum.com
  deckensystemenet.baerseventeam.top
  deckpiscinasembauru.com.br
  declarated.xyz
+declareof.org
  declife.biz
  declinationprivatize.com
  decline-my-payee.com
@@ -57420,6 +57873,7 @@ decline-new-payee.com
  decline-newdevice.com
  decline-newdevice.link
  decline-onlinepayee.com
+decline-payee-app.com
  decline-payee.com
  decline-payeenew.com
  decline-payeeonline.com
@@ -57510,6 +57964,7 @@ deepakasso.com
  deepasams.000webhostapp.com
  deepbluec223.com
  deepcoverdefense.com
+deepearthmovers.com
  deepeesfinest.com.au
  deepeg.com
  deependfarms.cleangreencertified.com
@@ -57521,7 +57976,6 @@ deepmail-0.weebly.com
  deeprootministry.org
  deepsabrina.za.net
  deepsouthclothingcompany.com
-deeptest.prep.co.in
  deeptisinghacademy.com
  deepvenom.000webhostapp.com
  deepwebeye.com
@@ -57639,7 +58093,6 @@ dekoker.be
  dekon.pk
  dekoning.be
  dekoratornia-ciastek.pl
-dekoro.es
  dekoshoppingcom.shaxiaapril.top
  dekoshoppingcom.shaxialike.top
  dekovizyon.com
@@ -57668,7 +58121,6 @@ del-93382980.delhigatepaphos.com
  del-95139422.delhigatepaphos.com
  delaimmobilier.com
  delamano.net
-delap.hu
  delasd.weebly.com
  delawarecorporatelaw.com
  delays24-paypal.com
@@ -57678,6 +58130,7 @@ delectable-night.000webhostapp.com
  delectablepowerlesscompilerbug--five-nine.repl.co
  delegatesinrwanda.com
  delete-orders.ddns.net
+delete-payee-auths.com
  delete-payees.com
  delete-unauthorisedpayee.com
  deletedevice.link
@@ -57724,7 +58177,6 @@ delivery.olx-pl.com
  delivery.suguyobu.com
  deliveryacademy.co
  deliveryas.ru
-deliverycandian.cc
  deliveryexpressworld.xyz
  deliverysupport.top
  delivrsi-one.tk
@@ -57744,6 +58196,7 @@ deloilte.com
  delongade.nckitickets.gdn
  delopa.org
  delow.co.uk
+delpaz.org
  delphic-consulting.com
  delphinph.com
  delpradoapartment.com
@@ -57843,7 +58296,6 @@ demo.xn--blockchin-c2d.com
  demo.xn--lockchain-zy5d.com
  demo.yzccit.com
  demo.zeta-webdesign.fr
-demo08.vinaweb.vn
  demo1.alismartdropship.com
  demo1.parsnet.space
  demo1.webcreatick.com
@@ -58101,7 +58553,6 @@ deregisternew-device.com
  deregisternewdevice.cc
  deregisterpayee-auth.net
  deregisterpayee.com
-deregisterunauthoriseddevice.com
  deregistration-alert-uk.com
  deregistration-alert.com
  deregistration-mobile-secured.com
@@ -58168,6 +58619,7 @@ desainrumahterbaik.co
  desarrollosdeprueba.xyz
  desawdxgni.duckdns.org
  desayunosgreen.com.pe
+desbillzwoods.net
  desbloqueandoacesso.com
  desbloquear-anuidade-gratis.com
  desbloquearapp.club
@@ -58226,7 +58678,6 @@ desdgiedfrtuyidf.com
  desejaestadispoivel.com
  desentupidoralima.com.br
  deseosex.com
-desert-assurances.be
  desert-trails.com
  deserteadivers.com
  deserthha.com
@@ -58402,6 +58853,7 @@ detafa.com
  detailapp.today
  detailcancel.data-paymentmobile.com
  detailcleaning.ca
+detailment.co
  details-authentic-secure.com
  details-billing-secure.com
  details-jp.club
@@ -58441,6 +58893,7 @@ dettagl.net
  dettrazieni.com
  detudoparasuacozinha.com
  deucertoja.ml
+deufd16.top
  deultimosimpactos.blogspot.li
  deurenbaron.nl
  deutsche-bank-meine-vohluhc.confirm-account-information.com
@@ -58589,11 +59042,11 @@ deveronmeggings100.com
  devestird.com
  devex-sa.com
  devforfun.online
+devfv14.top
  devhaevents.us
  devhtmlfive.com
  deviancymeadowlark.com
  deviantstickers.com
-deviationism-tender.000webhostapp.com
  deviatory-armament.000webhostapp.com
  device-added.cc
  device-alert-security.com
@@ -58647,6 +59100,7 @@ device-onlinealert.com
  device-payee-authorisation.com
  device-payeeinfringement.link
  device-personal-wells.site
+device-refd8m1f0.com
  device-register-uk.com
  device-register.online
  device-registerationalert.com
@@ -58703,7 +59157,6 @@ devicederegistration.com
  deviceful-errors.000webhostapp.com
  devicegive.us
  deviceid-halifax.com
-deviceid-review.com
  deviceinfo-secure.com
  devicemanagerhalifax.com
  devicemoon.com
@@ -58722,6 +59175,7 @@ devices-verified.cc
  devicesapp-plc.com
  devicesecurity-online.com
  devicesherpa.com
+deviceverification.on-lineconnect.me
  devie-king.pp.ua
  devies-ruralviacaja.com
  devieyehospital.in
@@ -58730,7 +59184,6 @@ devikasdiet.com
  devikaskyperpark.website
  devilhimself.bounceme.net
  devilisaliarman.ga
-devilish-sectors.000webhostapp.com
  devilishfrogbev.com
  devillersgarage.be
  devincenti.it
@@ -58761,6 +59214,7 @@ devs.devgsd.com
  devshreegroup.co
  devstyle.org
  devtool.site
+devtu35.top
  devviceskins.xyz
  devwp.socialcloset.com
  dewa-account.conebellemard.com
@@ -58796,6 +59250,7 @@ dewide.com.br
  dewii.ga
  dewirasute.com
  dewittezell.com
+dewlh43.top
  dewli.cf
  dewli.tk
  dewliteled.com
@@ -58806,6 +59261,7 @@ dexado.com
  dexamfetamine.eu
  dexaoxqyjpnfpica-dot-millinium.ey.r.appspot.com
  dexdelivers.com
+dexef33.top
  dexiosglobal.com
  dexlerholdings.com
  dexterglaucomaz.com
@@ -58819,6 +59275,7 @@ deyang.06rl.com
  deyang.06wi.com
  deyrbbxkjouhrvmx-dot-millinium.ey.r.appspot.com
  deytransport-dz.com
+dezar32.top
  dezatec.es
  dezcom.com
  dezineinnovation.com
@@ -58853,7 +59310,6 @@ dfcsadcsacsadccdsc.mygamesonline.org
  dfcvbrtwe.ug
  dfcworldcompany.com
  dfcxc.weebly.com
-dfdavsfwfkmkvshecodrevwsge-dot-gle39404049.rj.r.appspot.com
  dfddfg4df.ru
  dfdfaxvb.ddns.net
  dfdfttfdnj.matulaitis.org
@@ -58982,6 +59438,7 @@ dfwyzxx.cn
  dfwzuuhoibfnhpeu-dot-millinium.ey.r.appspot.com
  dfxdp-zmjnz-fhpgp.web.app
  dfydemos.com
+dfyf19fytrc03magy.xyz
  dfzf.net
  dfzfgnf.ddns.net
  dfzlohzejihgwsayjavedrbucpumryjwuyel-dot-offglen.uk.r.appspot.com
@@ -59049,7 +59506,6 @@ dgqgboudhlymponcbyaltiapji-dot-gleowayel400503.uc.r.appspot.com
  dgqptrjtazcteiqs-dot-millinium.ey.r.appspot.com
  dgreitkelis.lt
  dgret.xyz
-dgrotjcudcokqhngwgregxgjbo-dot-gle39404049.rj.r.appspot.com
  dgroup.ge
  dgrygwer.weebly.com
  dgsaympgywmlwsox-dot-millinium.ey.r.appspot.com
@@ -59124,6 +59580,7 @@ dhjkavsaputlifnj-dot-millinium.ey.r.appspot.com
  dhkflqqrvazorfwm-dot-millinium.ey.r.appspot.com
  dhkvnimgmajsmcezgyaonswxfa-dot-gleowayel400503.uc.r.appspot.com
  dhl-bd.com
+dhl-bunes.blogspot.sn
  dhl-cz-login.com
  dhl-dostawa.com
  dhl-ekspel.com
@@ -59152,7 +59609,6 @@ dhl-suisse2.gotdns.ch
  dhl-tracking-germany.forexcreed.com
  dhl-twojapaczka.com
  dhl-twojkurier.com
-dhl-world.ir-io.com
  dhl.acntts.com
  dhl.bethrivkah.edu
  dhl.china.usedteapackingmachines.com
@@ -59458,6 +59914,7 @@ die-eickelbaums.de
  die-post-ch.net
  die-post-colis.com
  die-post-inc.com
+die-post-swiss-id-19782635.dndfinder.com
  die-post-swiss-id-19782635812.psd2any.com
  die-post-swiss-secu.net
  die-post-swiss.com
@@ -59606,7 +60063,7 @@ digitalangels.eu
  digitalartstuv.tk
  digitalathsala.000webhostapp.com
  digitalauth-amzn237.gotdns.ch
-digitalbanking-accounts-support.com
+digitalbanking-support-accounts.com
  digitalbattery.webhop.me
  digitalbccr.com
  digitalbitbox.com
@@ -59716,7 +60173,6 @@ diinepouldn.com
  diiqlozafzldoaex-dot-millinium.ey.r.appspot.com
  diiw.dermals.org
  diiwkgxnazmlzkxo-dot-millinium.ey.r.appspot.com
-dijamain.godaddysites.com
  dijaminn-crotttt-enjoyyyy.000webhostapp.com
  dijari.com
  dijital-btk-duyurular-giris.ml
@@ -59740,6 +60196,7 @@ dilagos.com
  dilandilan.com
  dilbergasp.win
  dilehgctdsbbefhz-dot-millinium.ey.r.appspot.com
+dilemmasystem.com
  dileofoods.com.au
  dilevry-packages.com
  dillon3893537.xyz
@@ -59835,6 +60292,7 @@ diplomatafrica.com
  diplomatie.gov.mr
  diplomatplastic.com
  diplomatshipping.net
+dipositiv.com
  diqnptcfog.duckdns.org
  diradeact.com
  dirapps-home.com
@@ -59924,6 +60382,7 @@ discoforservesinfo.serveirc.com
  discoidal-preferenc.000webhostapp.com
  discomanu.onlinebabybasket.xyz
  discomfited-tachome.000webhostapp.com
+disconnect-device-online.com
  disconnect-newdevice.cc
  disconnectedreconnected.com
  discordtools.de
@@ -59937,7 +60396,6 @@ discoursemoon.top
  discover-pearl.now.sh
  discover-tigaras.com
  discover.accountcenter.se-qbb.com
-discoverberts.com.au
  discovercardsusa.com
  discovercoastalvacations.com
  discoverhawaii.icu
@@ -60046,7 +60504,6 @@ dispute-pdn9i64p.3utilities.com
  disputeglaucomat.com
  disputeglaucomaw.com
  disreferr.com
-disrulaytin.ru
  dissectible-custom.000webhostapp.com
  dissepimental-guns.000webhostapp.com
  dissgetit.com
@@ -60256,6 +60713,7 @@ djsywjj.xyz
  djtcbaedjtzfbauj-dot-millinium.ey.r.appspot.com
  djtuttherzicbzlk-dot-millinium.ey.r.appspot.com
  djulmatov.uz
+djus19ardq03rycqr.xyz
  djuzoiwvpqcpexnh-dot-millinium.ey.r.appspot.com
  djvii.codesandbox.io
  djwdjoajde.cf
@@ -60507,7 +60965,6 @@ dmigxelyldckeolw-dot-millinium.ey.r.appspot.com
  dmikshdhd.weebly.com
  dminqxqujkqcqnea-dot-millinium.ey.r.appspot.com
  dmitrywild.com
-dmivfeedback.com
  dmklbnmnbzuggitf-dot-millinium.ey.r.appspot.com
  dmkt-sp.top
  dmkvqhhlwhhkzojg-dot-millinium.ey.r.appspot.com
@@ -60580,7 +61037,6 @@ dnewxcaxelpass.ga
  dnewxcaxelpass.ml
  dnfree1.cf
  dngn3haywjlw75nc.com
-dngylnextoebqhmdhwxuudqhyx-dot-gle39404049.rj.r.appspot.com
  dnh.svcoding.com
  dnhovosaertxmjgpcqyirvfria-dot-gleowayel400503.uc.r.appspot.com
  dnilhcdfysoyrgsy-dot-millinium.ey.r.appspot.com
@@ -61091,7 +61547,6 @@ domainmai.org
  domainmanagerz.net
  domainnameforum.ru
  domainpandit.com
-domains.buizket.com
  domains.gradsoft.com.ua
  domainsat.net
  domainsbdwe.net
@@ -61287,6 +61742,7 @@ donuttacopalaceinaustin.com
  donweeseinc.com
  donwload-file-id.tk
  donwnloasecury.ath.cx
+dony.org.uk
  donya-almesmar.com
  dooball-live.com
  doodahlabs.com
@@ -61381,6 +61837,7 @@ doserveradmin.com
  doshlforex.com
  dosi.unaux.com
  dosiertechnikonlinecom.baerseventhings.top
+dosiovini.shop
  dositeoromeropresenter.com
  doskidlyapodachi.ru
  dosligabbr.com
@@ -61555,12 +62012,12 @@ down.gogominer.com
  down.haote.com
  down.hejie123.com
  down.hm120.net
-down.kuronekoyamato-adag.top
  down.kuronekoyamato-adw.top
  down.kuronekoyamato-adz.top
  down.liangziip.com
  down.maipala.com.cn
  down.pcclear.com
+down.posti-fi-dda.top
  down.qqfarmer.com.cn
  down.shatangmu.cn
  down.slothy.in
@@ -61580,10 +62037,12 @@ downeyepom.com
  downgradepc.update-plus.net
  downhaulprecook.com
  downhearted-leaper.000webhostapp.com
+downl4file.direct.framedelements.com
  downladoswindows.biz
  downlaod.vstart.net
  downlaod1.vstart.net
  downlaodvideo.net
+downlfile.location.jetsetwithana.com
  downlo.vaixia.com
  download-legenda.live
  download-plugins.co.za
@@ -61617,6 +62076,7 @@ download9.us
  downloadbokepvideo2018.000webhostapp.com
  downloaddd.cf
  downloaddd.gq
+downloadfile.location.londonpictours.com
  downloadforfrees.me
  downloadhanumanchalisa.com
  downloadlinks.buzz
@@ -61727,11 +62187,11 @@ dpysqx.rogagot.com
  dpyxbayposewmcue-dot-millinium.ey.r.appspot.com
  dqbdesign.com
  dqdakl.cn
+dqeyesun.com
  dqfgavhqqdwoswnt-dot-millinium.ey.r.appspot.com
  dqfk32.company
  dqjrdobaqesxbdxm-dot-millinium.ey.r.appspot.com
  dqjulius.com
-dqjychiodigvqpzwekrjbkxspn-dot-gle39404049.rj.r.appspot.com
  dqkyaxrfhrouhpwz-dot-millinium.ey.r.appspot.com
  dqlzzxipmmfhycsw-dot-millinium.ey.r.appspot.com
  dqmiefurtnwbxfyf-dot-millinium.ey.r.appspot.com
@@ -61899,7 +62359,6 @@ dreamspact.com
  dreamswork.tk
  dreamtour.com.au
  dreamtrips.cheap
-dreamworld-sports.com
  dreamy-edison-db79ca.netlify.app
  dreamy-goldberg-a2a25d.netlify.app
  dreamy-ritchie-e6e48b.netlify.app
@@ -62132,6 +62591,7 @@ dropbox.tartanridge.org
  dropbox2.xyz
  dropboxccdn.com
  dropboxcloud.co
+dropboxdownloads.com
  dropboxfolder.xyz
  dropboxmaill.weebly.com
  dropboxon-lineusdocpdf.cfapps.io
@@ -62564,6 +63024,7 @@ dukttziod.com
  dukygcqbwwtulasuugqinbgkerkmkiqcyhjn-dot-cedar-code-289917.nn.r.appspot.com
  dulceestampa.com.ar
  dulceriarosa.xyz
+dulcerubio.info
  dulesmodmen-com-br.umbler.net
  dulieuhay.com
  dull-communicate.gq
@@ -62682,7 +63143,6 @@ dustin64027662.xyz
  dustinbturner.com
  dustinmoore.rocks
  dustinsusddservices.com
-dustintromie.com
  dustontail.top
  dustybuffing.net
  dustyprairie.com
@@ -62747,7 +63207,6 @@ dvia-ukrevision.com
  dvia.refund-form347.com
  dviqgppklhmubgbjkrmkicdnbatiolvhdmya-dot-offgl8876899977678.uk.r.appspot.com
  dvissibxdcwpjbqc-dot-millinium.ey.r.appspot.com
-dvjhjwcggvchddzercoylxhqhi-dot-gle39404049.rj.r.appspot.com
  dvl-netflix.com
  dvla-car-tax.com
  dvla-claim.com
@@ -62855,7 +63314,6 @@ dvncx.goruli.com
  dvnfmdykftftzeff-dot-millinium.ey.r.appspot.com
  dvolwrgtmmeuntdb-dot-millinium.ey.r.appspot.com
  dvonlinenotificationsuwpal.com
-dvonqweogbpqcitqwhshdkgflb-dot-gle39404049.rj.r.appspot.com
  dvpont.com
  dvr-netflix.com
  dvrbrhbfs.com
@@ -62873,7 +63331,6 @@ dvwpmavyefxlaljhzgargqtgom-dot-gleowayel400503.uc.r.appspot.com
  dvyatkitotrsctoa-dot-millinium.ey.r.appspot.com
  dvychhqsqjnodpcw-dot-millinium.ey.r.appspot.com
  dvyppvwyksyntuwk-dot-millinium.ey.r.appspot.com
-dvyqrabdukziycbjrstaumjvtr-dot-gle39404049.rj.r.appspot.com
  dvzxmoidaombemeygpjpowsvkx-dot-gleowayel400503.uc.r.appspot.com
  dw-css.de
  dw-r2.jaysbrand.com
@@ -62974,11 +63431,9 @@ dxcdaxvfsdxvc.com
  dxcrystal.com
  dxevgzkyljzmoncl-dot-millinium.ey.r.appspot.com
  dxgkauwadhmbbsnu-dot-millinium.ey.r.appspot.com
-dxhdkdld-sisdsk-hddkik.s3.eu-west-3.amazonaws.com
  dxhvwwmspjoqdsmg-dot-millinium.ey.r.appspot.com
  dxipo.com
  dxitsajqdbumqflppfrykegmtklvozdjmmik-dot-solar-vertex-285913.rj.r.appspot.com
-dxjtfdanidjevgmyfelunpysai-dot-gle39404049.rj.r.appspot.com
  dxkliqqqpniucgks-dot-millinium.ey.r.appspot.com
  dxlgzsbaxdezpwly-dot-millinium.ey.r.appspot.com
  dxlrchdbdpnjhdjl-dot-millinium.ey.r.appspot.com
@@ -63137,7 +63592,6 @@ dzvideo.000webhostapp.com
  dzvqchjxavfrysyznn.top
  dzw10jpcgj03fckc.com
  dzwonsemrish7.cloudfront.net
-dzxfhrzzqdkoixjgnxxbrcxjyt-dot-gle39404049.rj.r.appspot.com
  dzyekrqxrmolmbcqaeieecxcwpbyrmggdrvy-dot-off94032393204.uk.r.appspot.com
  dzyne.net
  dzyqcnhhdv14t7d.e8273.pro
@@ -63283,7 +63737,6 @@ e-s-o-essen.de
  e-saglikyardim.com
  e-salampro.com
  e-santanderbanco.com
-e-serviceparts.org
  e-servis-aktarma-tr-1.com
  e-servis-cep-tr-1.com
  e-servis-dagitma-tr-1.com
@@ -63353,7 +63806,6 @@ e.uremenber.ru
  e0c0780416d0db77ab0c5f5405ca9e09.buzz
  e0fba3be-0367-4d38-8494-55163e515aaa.godaddysites.com
  e0m-3.onderhost.com
-e10126ee-e7d0-4dce-b1ea-ba1f5a733e82.id.repl.co
  e10tv.com
  e13qp.svcoding.com
  e167ad9c8d860bfe30379839a759c1415cbc56c5.info
@@ -64112,6 +64564,7 @@ ebay.restore-user.com
  ebay.sporting-goods.cycling-bicycles.itm59l2o3s5.com
  ebay.suspicious-accountactivity.com
  ebay.ws.it.ws.mezarkabristanisleri.com
+ebayaccedisslverizonhttpsaccediebay.tvotiltil.cl
  ebaybuy.com.buying-item-guest.com
  ebaycargo.anso-group.com
  ebaydeitm.zeigen.info
@@ -64144,7 +64597,6 @@ ebertkeys.xyz
  ebett.xyz
  ebey-connect.bd-kagoj.com
  ebfdcmxcoywdolqu-dot-millinium.ey.r.appspot.com
-ebfsihmpjgmowiguoyaaarpski-dot-gle39404049.rj.r.appspot.com
  ebg.cl
  ebgtzipqvweypbawtsfbdjfhskwamonlqfse-dot-cedar-code-289917.nn.r.appspot.com
  ebgxmdycffefpmyq-dot-millinium.ey.r.appspot.com
@@ -64160,7 +64612,6 @@ ebilling-secured.co.uk
  ebills.thetrissilent.com
  ebillupdateshaw.is-an-accountant.com
  ebinaires.biz
-ebiuro.org.pl
  ebix.ga
  ebiz-biz.info
  ebizmaldives.com
@@ -64184,7 +64635,6 @@ ebookstore4me.us
  ebooktetezu.com
  eboorterd.com
  ebosreputation.com
-ebowtuluwgowytrwkuytlrdnlu-dot-gle39404049.rj.r.appspot.com
  ebox-security.info
  ebpay.cash
  ebpfjdt.merlontean.com
@@ -64235,6 +64685,7 @@ ec13b13573bbc8f85984c209a181c8bcfb568a73.ph
  ec2-100-26-145-53.compute-1.amazonaws.com
  ec2-15-164-93-91.ap-northeast-2.compute.amazonaws.com
  ec2-18-132-10-97.eu-west-2.compute.amazonaws.com
+ec2-18-184-28-26.eu-central-1.compute.amazonaws.com
  ec2-18-228-219-25.sa-east-1.compute.amazonaws.com
  ec2-3-236-45-91.compute-1.amazonaws.com
  ec2-3-88-255-241.compute-1.amazonaws.com
@@ -64280,7 +64731,6 @@ ecdysiastsportiere.net
  eceadae-my.sharepoint.com
  ecebs.me
  ecfishin.com
-ecfqlxjsqxgssxboqllqcylhfm-dot-gle39404049.rj.r.appspot.com
  ecgmkgktnzkxwruqzkiqtgsryu-dot-gleowayel400503.uc.r.appspot.com
  ecgwmsbzylvnlwqssihyrqoegmmzfbbphzpg-dot-gl494903049.wl.r.appspot.com
  echaglo.tanglescanner.com
@@ -64552,6 +65002,7 @@ edf-mobile.com
  edf.hwsq0g.cn
  edfghjjkhgfds.myshopify.com
  edfgikuu.zapto.org
+edfgyuli.cabanova.com
  edfwehfbehw.weebly.com
  edg1.cn
  edgarcuesta.com
@@ -64613,6 +65064,7 @@ edmedicationguide.com
  edmondmagneti.com
  edmondok.icu
  edmonds-engineering.is-a-designer.com
+edmsummitbranding.xyz
  edmthing.com
  edmxwvfrhygkzacbajkb.top
  edoemlllmuezztus-dot-millinium.ey.r.appspot.com
@@ -64674,7 +65126,6 @@ educators.plus
  educcactions.com
  educovisa.com
  edudlqrdwfbfvxzodkhzjzhjkm-dot-gleowayel400503.uc.r.appspot.com
-edufago.com
  edufoxconsultancy.000webhostapp.com
  eduhac.com
  eduhope.in
@@ -64801,7 +65252,6 @@ ee-billing-limits.com
  ee-billing-payment.com
  ee-billing-paymentupdates.com
  ee-billing-reset.network
-ee-billing-resolve.com
  ee-billing-secure.com
  ee-billing-support-uk.com
  ee-billing-update.com
@@ -65085,6 +65535,7 @@ ee-ukbilling.com
  ee-ukbillingpage.com
  ee-ukbills.xyz
  ee-unlock-account.000webhostapp.com
+ee-unpaid-payment.com
  ee-update-account.com
  ee-update-billing.com
  ee-update-myaccount.com
@@ -65417,6 +65868,7 @@ eeverify-billing.com
  eeverify-customerupdate.com
  eeverify-onlinehub.com
  eeverifynet.com
+eevvshauuyie.web.app
  eevzoaujuutignwtolwitcqnpfnuiffgqmuh-dot-gl494903049.wl.r.appspot.com
  eew1.svcoding.com
  eewgbobwwukhdvrnqpqyyaoccolulolyflft-dot-offglen.uk.r.appspot.com
@@ -65442,7 +65894,6 @@ efbook-65123852.kemetera.com
  efbook-90711124.kemetera.com
  efbr2r6q84be-r4s-6w.co
  efcavuhmmbukchrw-dot-millinium.ey.r.appspot.com
-efcgeprdhpurmdkbglxqavpgbv-dot-gle39404049.rj.r.appspot.com
  efctnwzdtnuvytttyhzvhdfychckbqstrbww-dot-cryptic-now-290917.ey.r.appspot.com
  efcycwkicsthzxwi-dot-millinium.ey.r.appspot.com
  efdefsfweafsfelive.com
@@ -65682,6 +66133,7 @@ ehran.com
  ehrenreich.dk
  ehrlum.com
  ehrzwwsgdnguajmherepbtennq-dot-gleowayel400503.uc.r.appspot.com
+ehs.siib.ac.in
  ehsaastrust.org.in
  ehsasrahman1.000webhostapp.com
  ehsbaa.org
@@ -65773,7 +66225,6 @@ eitugfr.com
  eiuccepbsh-k6rp1m39r.vercel.app
  eiuhinssed.arinhi.xyz
  eiumis.com
-eiunhrjsicncneszgpboiogwuv-dot-gle39404049.rj.r.appspot.com
  eiunmykuorsbqrvv-dot-millinium.ey.r.appspot.com
  eiuvxjzeqwpzwqwe-dot-millinium.ey.r.appspot.com
  eivissachicago.dyndns.tv
@@ -65879,7 +66330,6 @@ ekqnxicmmzkbercd-dot-millinium.ey.r.appspot.com
  ekramco.ir
  ekramuzzaman.com
  ekrhqcaxeqtrwynu-dot-millinium.ey.r.appspot.com
-ekrjwxbyzrkrgwvwhovcfhhpnd-dot-gle39404049.rj.r.appspot.com
  ekrkoprojthvdbso-dot-millinium.ey.r.appspot.com
  ekruhwier.mrbasic.com
  ekseyazilim.com
@@ -65997,7 +66447,6 @@ eldridgelondon.com
  eldsjswqrtsjlprl-dot-millinium.ey.r.appspot.com
  eleanore426432.xyz
  elearn.mgacademy.co.in
-elearning.unived.ac.id
  elearning2.maseno.ac.ke
  elearningtutor.org
  elearningytecnologia.com
@@ -66201,6 +66650,7 @@ elitetransmission.fr
  elitgaz.su
  elitkanyon.com
  elitpersonelgiyim.com
+eliturbrasil.com.br
  elivant.com
  elix.bos.ru
  elixirmurmur.net
@@ -66319,7 +66769,6 @@ eltrafalgar.com
  eltronesia.id
  eltubazodigital.com
  eluaccesorios.com
-eluhvzt2fxwpmii4qoz7jred34--www-paypal-com.translate.goog
  eluint.com
  elvbs.store
  elvecinito.cl
@@ -66452,7 +66901,6 @@ emarclofitnessacademy.com
  emardmews.xyz
  emark4sudan.com
  emasresources.com
-emaz.pk
  emaze.me
  embalagemdesushi.com.br
  embalagememgeral.com.br
@@ -67137,6 +67585,7 @@ ennqqnonivrtugdtrryvsamaxk-dot-gleowayel400503.uc.r.appspot.com
  ennrc.com
  eno.si
  enodablork.ru
+enomeannaonly1.cf
  enomicrowler.xyz
  enonanik.ml
  enophksydrees.cf
@@ -67239,7 +67688,6 @@ entromizer.com
  entry.swisscard.services
  entrygoggles.com
  entrypay-configapp.servehttp.com
-ents-c82nl7pizqb9.creditcourtage.ca
  entslotr.com
  entspartner.at
  entt.co.uk
@@ -67258,6 +67706,8 @@ enviadoclientesms-com.umbler.net
  envicom.nl
  enviedepices.fr
  enview-subscriptionitunesordernr9910237.cf
+enviomrkt.com
+enviosmrkt.com
  envirnoamics-inc.com
  envirodrilling.com
  envirohealth.org
@@ -67281,6 +67731,7 @@ enwzk.mentriqq.com
  enyakincilingirci.com
  enyaris-toyotabasvurufirsati.com
  enydjdtehhiyfbbs-dot-millinium.ey.r.appspot.com
+enyostore.com
  enzfwvlyksiwhwco-dot-millinium.ey.r.appspot.com
  enzhixi.com
  enzymesmeerkat.com
@@ -67308,7 +67759,6 @@ eofyoagbosbfsdjj-dot-millinium.ey.r.appspot.com
  eofzjizrvfhsukdq-dot-millinium.ey.r.appspot.com
  eogrmyxdoznhrkkezrjxghpncb-dot-gleowayel400503.uc.r.appspot.com
  eohjivmiwqwmmyho-dot-millinium.ey.r.appspot.com
-eohqcjhndltatzwuojmkhzvbah-dot-gle39404049.rj.r.appspot.com
  eohyumqdabjrujya-dot-millinium.ey.r.appspot.com
  eoi-credit.com
  eoidffyxzcfnenix-dot-millinium.ey.r.appspot.com
@@ -67337,7 +67787,6 @@ eoshj.blob.core.windows.net
  eoslead.com
  eosouthasia.showtimemobileapp.com
  eostechnologies.net
-eotjnoofnurpiyxrjmaortoezm-dot-gle39404049.rj.r.appspot.com
  eotya-71.ml
  eoueqlaivekqcbsdxilmmeqaggfmbotanvxk-dot-glegen303939423233.ue.r.appspot.com
  eoufpzemogibytupwpdpffoizfdiyzrckexu-dot-cedar-code-289917.nn.r.appspot.com
@@ -67359,6 +67808,7 @@ epanorama.net
  epargne-agricole.com
  epargnebitcoin.com
  epargnefacile.com
+eparnilbusiness.best
  eparrgne.000webhostapp.com
  epaviste-marseille.fr
  epay-paxful.com
@@ -67466,9 +67916,9 @@ epsilonrando.top
  epsonyaziciservisiantalya.com
  eptablyaym.temp.swtest.ru
  eptfzlrrwleodkgh-dot-millinium.ey.r.appspot.com
-eptpkxwzucxgylgposbqxdfzrc-dot-gl099898987fhkl.uk.r.appspot.com
  eptq.kz
  epts.jaysbrand.com
+epuirwz.bar
  epurchaseplace.com
  epview-buyynkecyd.huskhomes.com
  epview-pgnljvjhoa.huskhomes.com
@@ -67737,7 +68187,6 @@ error-0m3ls.cf
  error-492x71-support.xyz
  error-connect-online.network
  error-ee-billing.com
-error-mobile-concern.com
  error-no-notification-6744.xyz
  error-no-notification-8548.xyz
  error-pages-about-unlocked-perl.reqakfgd.com
@@ -67879,6 +68328,7 @@ esamericanas.com
  esamina-dati.com
  esanjobs.org
  esapcepro-org.com
+esapp-sequridad-81d05c.ingress-daribow.easywp.com
  esayansknife.work
  escalierconsulting.com
  escalum.com.mx
@@ -68173,7 +68623,6 @@ estore.qurvex.com
  estorican.biz
  estra-as.com
  estrcy.xyz
-estrelladamm.icu
  estrey.xyz
  estroinstallers.com
  estuar.org
@@ -68245,13 +68694,13 @@ et.s.interac.ca-l.club
  et.upt.ro
  et.ver-gin.com
  et72.addroits.com
-etaaooyofcimkgufemafeeowtg-dot-gle39404049.rj.r.appspot.com
  etablebuterline.xyz
  etabs.xyz
  etacticos.com
  etaet.xyz
  etagx.xyz
  etahs.com
+etails.com.au
  etalon.ir
  etaqe.com
  etasarla.com
@@ -68438,7 +68887,9 @@ etransfer.interac.caqc.club
  etransfer.interac.cati9.com
  etransfercarrier.com
  etransferinter.com
+etransferinterac.com
  etransferinterac.live
+etransferpayroll.com
  etransfers-interacs-ca.ga
  etransfers.interac.ca-accesd4.com
  etransfers.interac.ca-accweb2.com
@@ -68648,6 +69099,7 @@ eurdebkhsrogqmkpedxqlbjgyfikicaqwecs-dot-gl494903049.wl.r.appspot.com
  eurekaaquaintl.com
  eurekaksz.xyz
  eurekalogistics.co.id
+eurex.ps
  euro-creditexpress.com
  euro-crypto.com
  euro-cryptos.com
@@ -68879,6 +69331,7 @@ eventhbxdmd.com
  eventhollowen15.com
  eventhqp.com
  eventitemfreefirenewterbaru.freexfire.com
+eventklaim2021.duckdns.org
  eventkof-ml.itsaol.com
  eventlucky.qhigh.com
  eventluckypubgm.com
@@ -68886,7 +69339,6 @@ eventluckyspin.xfree1.com
  eventluckyspn.2waky.com
  eventmanagementbali.com
  eventmaterialxmetro.com
-eventml.spin-lucky919.tk
  eventmlbb-s17.00.mrbasic.com
  eventmlbb209.tk
  eventmlbbbkof.zyns.com
@@ -68919,7 +69371,6 @@ eventpubgminfo.com
  eventpubgmm.com
  eventpubgmnew.zyns.com
  eventpubgmobile13.25u.com
-eventpubgmobile2021.com
  eventpubgms11.4dq.com
  eventpubgmu.com
  eventpubgs10.com
@@ -68953,7 +69404,6 @@ eventskins-mobilelegends.com
  eventsky.co
  eventsml-5.cf
  eventsmobilelegends.dynamic-dns.net
-eventsmoonton-26.ml
  eventsmoonton-27.ml
  eventsmoonton2020.dynamic-dns.net
  eventsnewsskin1.cf
@@ -69067,7 +69517,6 @@ eviteoperigocompreonlineaqui.com
  eviworks.com
  evkegwaszhberevzubysvyrfedhc.top
  evkksnjqwbjawuor-dot-millinium.ey.r.appspot.com
-evkpjlwhsoawbdgxuiemlzbkts-dot-gle39404049.rj.r.appspot.com
  evkspcscjvsjtkza-dot-millinium.ey.r.appspot.com
  evkurantalyaspot.com
  evlaczhixruwkwub-dot-millinium.ey.r.appspot.com
@@ -69305,7 +69754,6 @@ exchangedictionary.com
  exchangeec.com
  exchangeweb-colorado-edu.s3.us-east-2.amazonaws.com
  excitant-breaches.000webhostapp.com
-excited-ionized-cart.glitch.me
  excitingmarkets.com
  excitinigflirt.club
  exclese.com
@@ -69342,6 +69790,7 @@ executives.rubedo-ontwikkeling.nl
  executivetavel.com
  executivtrading.ro
  exee.space
+exemplefacefake.000webhostapp.com
  exempletes.info
  exenberger.at
  exeobmens.com
@@ -69360,6 +69809,7 @@ exg.dermals.org
  exgfsoqgctajxadw-dot-millinium.ey.r.appspot.com
  exgj.goruli.com
  exgodrfzwvtldxvd-dot-millinium.ey.r.appspot.com
+exgvmogcbqemdvrelmtqauabiq-dot-gle39404049.rj.r.appspot.com
  exhaustedboy.myftp.biz
  exhaustible-citizen.000webhostapp.com
  exhaustivecovid-19.cf
@@ -69420,7 +69870,6 @@ expatria.io
  expatsmates.com
  expatsolutions.ro
  expcentral-support.com
-expcjcgmbbhkrzpsztzbpstllu-dot-gle39404049.rj.r.appspot.com
  expdom.ru
  expected-equipment.000webhostapp.com
  expedia.partnercentral-group.com
@@ -69452,7 +69901,6 @@ expertlogisticsindian.com
  expertsteelset.pl
  expertswebservices.com
  expiable-hopes.000webhostapp.com
-expire-o2-billingupdate.com
  explathe.xyz
  explcisms.com
  expleffienal.info
@@ -69544,7 +69992,6 @@ extenso-34prodc.com
  exterasafe.xyz
  exteriorpaintservicesltd.com
  external-hwx.icu
-extinctdecline.com
  extinctpromise.com
  extjnfvagwwvkptdfksqunoiqltksxprpldr-dot-glegen303939423233.ue.r.appspot.com
  extrabonuses-bitopro2020.000webhostapp.com
@@ -69567,6 +70014,7 @@ extraordinarycurc.club
  extraordinaryoutdoors.com
  extraprovincial.xyz
  extrashades.com
+extrasleep.buzz
  extrasmallkaleidoscopicmegahertz--five-nine.repl.co
  extrategika.com
  extratz.com
@@ -69649,7 +70097,6 @@ eynbr.vipsnapchatsexting.com
  eynet.biz
  eynriseao.tk
  eypcazxgnhtybeqf-dot-millinium.ey.r.appspot.com
-eypdnizsfgzkjhmhkytpltrvvz-dot-gle39404049.rj.r.appspot.com
  eypdrvkssjujgbug-dot-millinium.ey.r.appspot.com
  eyrherrhereh.tcp4.me
  eys4nxl2.firebaseapp.com
@@ -69667,7 +70114,6 @@ eyukletr.net
  eyuldbrwndcf.rzf.futbol
  eyumw.top
  eyupoglumedya.com
-eyuwrhjdvzrptsjvhutpypbxwm-dot-gle39404049.rj.r.appspot.com
  eyvzhievrxirgysmvtcuwumroczssnuxgxqo-dot-cryptic-now-290917.ey.r.appspot.com
  eyxsazudnbwdaywo-dot-millinium.ey.r.appspot.com
  eyxwuszoahagmvdmtglokfvqki-dot-gleowayel400503.uc.r.appspot.com
@@ -69745,6 +70191,7 @@ eztouikhfydxljmy-dot-millinium.ey.r.appspot.com
  ezukbqunkexkxdzbfu.top
  ezupgrhhyerslniwaqzgbesbxzwqlitwzbnq-dot-cryptic-now-290917.ey.r.appspot.com
  ezuuszzjunlbvhvnaeifojgmutiadljhnmuo-dot-cryptic-now-290917.ey.r.appspot.com
+ezvhkjqm4updkpxe.filesusr.com
  ezwcknrsocnxngin-dot-millinium.ey.r.appspot.com
  ezwebbuilder.tk
  ezwks.app.link
@@ -69798,7 +70245,6 @@ f.qtrip.cc
  f.regardisperfectshild.ru
  f.samsung-lucky-winner.xyz
  f.smssapp.com
-f.tolganfor.ru
  f.tsuyogari.ru
  f000.backblazeb2.com
  f010010y1usp.et.r.appspot.com
@@ -69936,9 +70382,8 @@ f0490078.xsph.ru
  f0490470.xsph.ru
  f04qvvbwwhmxc09y.com
  f0516803.xsph.ru
-f0520387.xsph.ru
-f0524111.xsph.ru
-f0524230.xsph.ru
+f0520342.xsph.ru
+f0524799.xsph.ru
  f0b.casa
  f0bea11ce084c97ca99bce9df2a07eec-dot-dbenitonline.ey.r.appspot.com
  f0f1a0c9fa92044a3d8cd65ff09536c8.buzz
@@ -69988,7 +70433,6 @@ f4bag.mentriqq.com
  f4c.com.au
  f4c3b00kl0qin.000webhostapp.com
  f4c3dook.000webhostapp.com
-f4cboook-la-lognla-facbook-es-lbolurmn9.filesusr.com
  f4cboook-la-lognla-facbook-es-rg3hktwl9n.filesusr.com
  f4cboook-lognla-facbook-es-2my5xgies9.filesusr.com
  f4cboook-lognla-facbook-es-5dh4fiucqc.filesusr.com
@@ -70066,8 +70510,6 @@ faaccee-b00k.000webhostapp.com
  faaceboockccetttinng.000webhostapp.com
  faacebook.hop.ru
  faacebookcom-3nvthetz488vm.camara.ge
-faacebookcom-6ogl0z2n9zh.camara.ge
-faacebookcom-whq72zuuil.camara.ge
  faacebookfunnypuppies.000webhostapp.com
  faaceebokgrupstar.000webhostapp.com
  faaceeboo-k.000webhostapp.com
@@ -70117,6 +70559,7 @@ fac3buk.000webhostapp.com
  faca-book.com
  facabok18.000webhostapp.com
  facabook-apluss.000webhostapp.com
+facabook.in
  facabooke.doomby.com
  facadecleaners.com
  facadetesting.com
@@ -70157,7 +70600,6 @@ face-book-secure-account-update.websitedelivery.co
  face-book-vehicules-9393.com
  face-book-verificatiion-id-339068203.online
  face-book.biz
-face-book.market-place-3343536-categoryfeed.com
  face-bookcom-27657673.showme.rs
  face-bookcom-31835713.showme.rs
  face-bookcom-38344675.showme.rs
@@ -70245,7 +70687,6 @@ faceb00k-verify-account.com
  faceb00k-verrify-accounnt.com
  faceb00k.com.account.update.new.facebook.app.growmaxmedia.com.au
  faceb00k.listing-ad2208523962-item1pwrvob8m53vnka4vq4f6k5pp.com
-faceb00k.shortpl.com
  faceb00k.tw
  faceb00k12322.000webhostapp.com
  faceb00k132.000webhostapp.com
@@ -70371,7 +70812,6 @@ facebok-data-url.cf
  facebok-data-url.ga
  facebok-data-url.gq
  facebok-maket-place-item-713678.com
-facebok-marketplaceitem-page367634.cafeandrade.com
  facebok-mobile-com.n0s.space
  facebok-secure.listing-ad.id904426198765.com
  facebok.cam
@@ -70441,10 +70881,10 @@ facebook-app-videos.weebly.com
  facebook-applogin.cf
  facebook-applogin.gq
  facebook-applogin.ml
-facebook-aqua.tk
  facebook-assistance.com
  facebook-authentication-verify.com
  facebook-black-nadia.website
+facebook-block.duckdns.org
  facebook-block.ml
  facebook-block.tk
  facebook-bras.dnevnikonline.ru
@@ -70675,11 +71115,7 @@ facebook-items.4710281256128881083465861298.xyz
  facebook-items.8940375091973750141.best
  facebook-items.9o62o68o438oo25486o4623.press
  facebook-iu.ga
-facebook-jah.cf
-facebook-jah.ga
-facebook-jah.tk
  facebook-keamanan061.tk
-facebook-keamanann97.ml
  facebook-konkurs.5v.pl
  facebook-ld.gq
  facebook-listing-forsale.36ge.xyz
@@ -70819,7 +71255,6 @@ facebook-protection-listing-ad.list6148467.us
  facebook-protection-listing-ad.listing-id3669934.us
  facebook-protection-secure-listing-id.item902910045.com
  facebook-publication.com
-facebook-realestate7996.com
  facebook-recover.servehttp.com
  facebook-recovers.com
  facebook-reply-customer.analysthawk.com
@@ -70901,6 +71336,7 @@ facebook-videos-apps.weebly.com
  facebook-wallpaper.tk
  facebook-weryfikacja.przekieruj.xyz
  facebook-weryfikacja.tk
+facebook-youtube-ceque-tuveux.passbypass.fr
  facebook-youtube.weebly.com
  facebook.18page64329568236.com
  facebook.1mxcuentas.xyz
@@ -71042,6 +71478,7 @@ facebook.com.ciitigrp.com
  facebook.com.comedifendersidaglihacker.com
  facebook.com.contact-help-support.review
  facebook.com.cwr-art.com
+facebook.com.e.ajt.hp.transer.com
  facebook.com.edb-hrm.com
  facebook.com.egedecoration.com
  facebook.com.elyintersecurity.com
@@ -71460,7 +71897,6 @@ facebookprofilefakehesapgiris1.birelekt.tk
  facebookprofilefakehesapgiris1.birelektrikci.net
  facebookprofilefakehesapgiris1.fakehesapbtk.tk
  facebookprofilefakehesapgiris1.fkhesap1.tk
-facebookproxy.cf
  facebookpyt.tk
  facebookrecovery.com.diginik.net
  facebookri.com
@@ -71597,7 +72033,6 @@ facecovid.000webhostapp.com
  facecup.space
  facedekarikatur.0fees.us
  facedesolutions.co.za
-facediko.xyz
  facedook-dark.000webhostapp.com
  facedook-secure.000webhostapp.com
  facedookalverjitashowvideos.000webhostapp.com
@@ -71801,6 +72236,7 @@ failingbeetroots.net
  failnot.servehalflife.com
  failuremystery.com
  faimejennings.com
+faint-carbonated-layer.glitch.me
  fair-oakscrypto.com
  fair-shopbd.com
  fair-tax.sk
@@ -72027,13 +72463,12 @@ fanfaronadee.com
  fanfaronquays.com
  fanfold-loops.000webhostapp.com
  fangqianghuaye.com
+fanhuntersagency.com
  fanina-tools.pl
  fankaerclothing.com
  fannmedias.com
  fannsasn.com
  fanoutnorthamerica.com
-fanpage-contact001240.com
-fanpage-contact012400.com
  fanpagedanieledemartino.000webhostapp.com
  fansbudi01.000webhostapp.com
  fansfinalfantasys7.000webhostapp.com
@@ -72087,7 +72522,6 @@ faralhonsuvrtvba-dot-millinium.ey.r.appspot.com
  farasaznovin.com
  farash.com.br
  faratabliq.com
-faraway-way.000webhostapp.com
  faraweel.com
  farayad.co
  farazadproductons.com
@@ -72102,6 +72536,7 @@ farebookmarketplace.us
  faremakers.co.uk
  fares123.ddns.net
  faresmotors.com
+farfaris.com
  farg074go894true.com
  fargo-279021.df.r.appspot.com
  fargo-appmember.mobi
@@ -72442,7 +72877,6 @@ fb-1902957854f-com.preview-domain.com
  fb-1968754221-com.preview-domain.com
  fb-1968754222-com.preview-domain.com
  fb-1968754233-com.preview-domain.com
-fb-1dxqqy7dd.cafinforma.it
  fb-22256656-com.preview-domain.com
  fb-233542212321-com.preview-domain.com
  fb-233542212372-com.preview-domain.com
@@ -72646,8 +73080,8 @@ fb-log.ml
  fb-login-mbasic.ga
  fb-login.newchat.to
  fb-loginwebv7.ydns.eu
+fb-market-place-29100293.com
  fb-market-place-listing-secure.id738299345.com
-fb-market-place-page-938748957839.com
  fb-market-placenumber623548.club
  fb-market-placenumber723548.club
  fb-marketplace-1254158458.com
@@ -72710,6 +73144,7 @@ fb-marketplace-app.shop
  fb-marketplace-business.us
  fb-marketplace-cars.us
  fb-marketplace-classifieds.club
+fb-marketplace-it-3783782829.com
  fb-marketplace-item-12216331.com
  fb-marketplace-item-530796437595316.online
  fb-marketplace-item-93792068275.com
@@ -72717,7 +73152,6 @@ fb-marketplace-item.us
  fb-marketplace-item492028950285.000webhostapp.com
  fb-marketplace-item54523433232.info
  fb-marketplace-item5453433232.club
-fb-marketplace-item72534732.com
  fb-marketplace-item74533242.com
  fb-marketplace-item79381048919310.com
  fb-marketplace-item84773223.com
@@ -72757,10 +73191,9 @@ fb-online-marketplace.com
  fb-online.us
  fb-ook.one
  fb-order.us
-fb-page-321.com
+fb-page-512.com
  fb-page-id-93874221.com
  fb-page-real-estate-id.112101352139706-propertyrentals.com
-fb-page-realtor21356236772-salles.com
  fb-page.com2245w2234page384724-item-ad67h444.xyz
  fb-page11.com0012w2234page660622-item-ad67h444.xyz
  fb-page2020.com0044w2234page667822-item-ad67h444.xyz
@@ -72774,7 +73207,6 @@ fb-page9962211.com
  fb-pages-listing-houseestate76428.com
  fb-pages-properties-listing1807644.com
  fb-pages-realestateid-listing7539640.com
-fb-pemblokiran.nettgolinkvv.tk
  fb-photography-listingid-87039922.com
  fb-photography-listingid1345654.com
  fb-policy-review.com
@@ -72916,7 +73348,7 @@ fb-review-account.com
  fb-review-secure.com
  fb-routine-updates.page6094385378.com
  fb-rules-9ma61va.com
-fb-rules-fma289nx.com
+fb-rules.account04.com
  fb-sale-marketplace.us
  fb-sale-trading-swap.club
  fb-sales-marketplace.com
@@ -73185,7 +73617,6 @@ fb64834-page76463-real-estate-item43364.house
  fb67123-page46758-real-estate-item76425.house
  fb67354-page67856-real-estate-item28945.house
  fb67354-page89254-real-estate-item57634.house
-fb67834-page58976-real-estate-item67892.house
  fb67894-page87653-real-estate-item89765.house
  fb6824824-pages8455543-item-photos485423.com
  fb68253-page89564-real-estate-item82679.house
@@ -73454,7 +73885,6 @@ fblbonsai.com
  fbleakedvideos.com
  fblfxny.goruli.com
  fblginyouraccesadsprofilemanage.000webhostapp.com
-fblivesupports.cf
  fblnstagrambluebadgehelp.ml
  fblocalhost.000webhostapp.com
  fblogin.neelumsoft.com
@@ -73500,7 +73930,6 @@ fbn-en.org
  fbnetworkfb.000webhostapp.com
  fbnewsnow.promgooggle.online
  fbo-market.online
-fbodynationapparel.com
  fboks-market001.online
  fbonline.icu
  fbonlineappealform.com
@@ -73570,7 +73999,6 @@ fbook-ssh-security.000webhostapp.com
  fbook-syte.000webhostapp.com
  fbook-weeb.000webhostapp.com
  fbook-yellowteeth.000webhostapp.com
-fbook.com-06662451.vochtplekken.be
  fbook.com-12105200.vochtplekken.be
  fbook.com-12229835.mrubens.mx
  fbook.com-12276767.mrubens.mx
@@ -73615,6 +74043,7 @@ fbook.com-31270631.vochtplekken.be
  fbook.com-31497264.mrubens.mx
  fbook.com-32462567.mrubens.mx
  fbook.com-33754973.mrubens.mx
+fbook.com-34100518.vochtplekken.be
  fbook.com-35348450.vochtplekken.be
  fbook.com-35446891.vochtplekken.be
  fbook.com-36089326.logintek.ma
@@ -74149,6 +74578,7 @@ fdg44.zzz.com.ua
  fdges.xyz
  fdgh4gh345.ru
  fdghdf344.ru
+fdghjh-gvjh-bjjjkjkk.s3-ap-southeast-1.amazonaws.com
  fdgokwnlt.goruli.com
  fdhbfdx5f.ddns.net
  fdhfd.gdfgjkdfh.com
@@ -74239,7 +74669,6 @@ fecebook.5v.pl
  fecebooknew.000webhostapp.com
  feceboolk.blogspot.com
  feci-lopes.web.app
-fecibeeki.com
  fecomp.org
  feconsultantcom.batwoqiseries.top
  fectedswunks-55.com
@@ -74518,6 +74947,7 @@ ferronnerie-fano.be
  ferronnerie-piga.com
  ferrovi.net
  ferrum-metal.ru
+ferrydevries.com
  ferrylegal.com
  ferrywala.xyz
  ferrywclubapt.buzz
@@ -74608,7 +75038,6 @@ ff.com.claim.your.bonus.updateyouraccxount.ml
  ff.vishou.net
  ff1r1dd.al1av.com
  ff36update.co.cc
-ff56.ga
  ffaceblook.000webhostapp.com
  ffacebook-market-place-id347j34bc82.483224466-item.com
  ffacebook.0fees.us
@@ -74744,6 +75173,7 @@ fgh.216cf.cn
  fgh.jidingzhou.cn
  fgh2df.ru
  fghdaswitch.com
+fghdi.duckdns.org
  fgher.xyz
  fghfghd.000webhostapp.com
  fghfghfg.xyz
@@ -74787,6 +75217,7 @@ fgs.tttbkz.cn
  fgsadrfqglvujyho-dot-millinium.ey.r.appspot.com
  fgsghehgvjfhj-com.preview-domain.com
  fgsky.com
+fgssb-law.com
  fgthliberacao2020.com
  fgtjdkwaurbvstae-dot-millinium.ey.r.appspot.com
  fgtr3.000webhostapp.com
@@ -74991,7 +75422,6 @@ fiirst-ohst.kozow.com
  fiisttechfed.com
  fij-projet3.be
  fijigolswcuhltaohwsntqvfne-dot-gleowayel400503.uc.r.appspot.com
-fijrxzcznpmivhmdxrbivrmbyi-dot-gle39404049.rj.r.appspot.com
  fijxszgwcvemwqfifaxwawsfyp-dot-gleowayel400503.uc.r.appspot.com
  fikima.com
  fikirhaber.net
@@ -75054,6 +75484,7 @@ files.communigate.eu
  files.dropmybin.me
  files.fqapps.com
  files.ivocapitals.com
+files.jivosite.com
  files.martellexpress.us
  files.onedrive.com.ll1l.me
  files.phoenixindiainc.com
@@ -75208,7 +75639,6 @@ financialone.com.hk
  financialplustimefreedom.com
  financialstockhub.com
  financiamentointeligente.com
-financiatorgator.com
  financieracopeande.com
  financingmen.ru.com
  finansbilgiler.com
@@ -75265,7 +75695,6 @@ findlocation-icloud.com
  findlp-apple.com
  findlr-apple.com
  findls-apple.com
-findmeaplasterer.com.au
  findmeclass.com
  findmessagespendingonmwbwez.000webhostapp.com
  findmy-appieid.com
@@ -75283,7 +75712,6 @@ findmyiphone.com-ids.ltd
  findmyiphone.com-ios.me
  findmyiphone.com-wl.live
  findmyiphonelocation.com
-findmylphone-map.com
  findmylphonelocation.com
  findmyphone.cc
  findmyphone.com-wl.icu
@@ -75474,6 +75902,7 @@ firstclassmuslimfoundation.org
  firstclickwork.com
  firstcoastrestoration.com
  firstcreditsuisse.com
+firstexploreolusd.com
  firstfinancesllc.com
  firstfive.net
  firstgulf-finance.com
@@ -75597,6 +76026,7 @@ fivemanagement.com.br
  fivestarlike.org
  fivestreetbakery.com
  fivlhalaebuybjnccuhrkaghccfpinsfqfdi-dot-glegen303939423233.ue.r.appspot.com
+fivwxefbflvofaricvgtctozqs-dot-gle39404049.rj.r.appspot.com
  fix-a-foto.com
  fix-device.com
  fix-e978a.web.app
@@ -75609,7 +76039,6 @@ fix-mydevice.live
  fix-three.com
  fix.partyi.info
  fix07102020-emailsolutionstech.web.app
-fixauto.illumetechnology.com
  fixbharat.com
  fixbisque.com
  fixcepcom.chifanassume.top
@@ -75678,7 +76107,6 @@ fjdlfpiwmjjfbarxxojssdafrs-dot-gleowayel400503.uc.r.appspot.com
  fjewb45sacvb11aas.uksnmfyusdf.cn
  fjexbpormqmssjav-dot-millinium.ey.r.appspot.com
  fjfhh.000webhostapp.com
-fjflhvzfilaugutplitswzhxux-dot-gl099898987fhkl.uk.r.appspot.com
  fjfpyrqsbfaykkag-dot-millinium.ey.r.appspot.com
  fjfqyc.com
  fjgfoknf.com
@@ -76014,7 +76442,6 @@ flexpak-th.com
  flexquitacao.com
  flexsubscibe.com
  flexsystem.cl
-flexypay.dsquaregroup.com
  flfkschcopkuxioz-dot-millinium.ey.r.appspot.com
  flfl3.000webhostapp.com
  flfl4.000webhostapp.com
@@ -76026,7 +76453,6 @@ flie0010000.000webhostapp.com
  flight.akshartours.com
  flightarabia.com
  flightgoexpress.com
-flightmister.co.uk
  flightstoeurope.us
  flikh.com
  flikyblywcfsmxcx-dot-millinium.ey.r.appspot.com
@@ -76098,6 +76524,7 @@ floppyvitreous.com
  flopseptum.com
  flora4567.com
  floradna.com
+floralwhitelazymp3.fernando45.repl.co
  florance92830.club
  florapansiyonotel.com
  floraselfcom.nckifrance.gdn
@@ -76229,7 +76656,6 @@ fmailadvert15dx.world
  fmarquisecale.com
  fmawranjetrlkvks-dot-millinium.ey.r.appspot.com
  fmbebqfiugluxlemdnumilifsx-dot-gleowayel400503.uc.r.appspot.com
-fmbfmroamarzaeobhkaczdsndy-dot-gle39404049.rj.r.appspot.com
  fmcagrotrading.com
  fmcav.com
  fmchr.in
@@ -76296,6 +76722,7 @@ fmufbzgtytmfwzkg.top
  fmvfroh.newhotstore.su
  fmwab.lawapass.com
  fmwc.org
+fmxaraf4.cc
  fmxpbeowxqbhwnyr-dot-millinium.ey.r.appspot.com
  fmyapple.com
  fmybyfpbdxcibhxstlqsyqbxdy-dot-gleowayel400503.uc.r.appspot.com
@@ -76322,7 +76749,6 @@ fnemwwuenomspcrg-dot-millinium.ey.r.appspot.com
  fnetutypfzgngeckbkpfrykpkz-dot-gl099898987fhkl.uk.r.appspot.com
  fngfxactvypyrbfd-dot-millinium.ey.r.appspot.com
  fngiwpkhowzqnjll-dot-millinium.ey.r.appspot.com
-fnhgjzzleamnkprxqdyvjfndfv-dot-gl099898987fhkl.uk.r.appspot.com
  fnhmnghngf.ddns.net
  fnixasia.com
  fnjbq.com
@@ -76395,12 +76821,14 @@ focusqc.co
  fod-aflossing.xyz
  fodabim.com.ng
  fodeb00k.000webhostapp.com
+fodihgje9845jhgdf.onelink.me
  fodijkffdd.com
  fodoverheid.com
  foe-2.com
  foedsrglkjzapzhv-dot-millinium.ey.r.appspot.com
  foerderverein-eislinger-saurierfunde.de
  foereff.com
+fog-intelligent-lion.glitch.me
  fog.19august.com
  fogelmanmanageent.gq
  fogged-depletions.000webhostapp.com
@@ -76782,6 +77210,7 @@ fortunebaliwedding.com
  fortunebanque.com
  fortuneenterprises.net
  fortuneinfosys.com
+fortuneo-819a4c.ingress-daribow.easywp.com
  fortvin.com
  fortwilderness.is-a-hunter.com
  forum-assistance.info
@@ -76790,7 +77219,6 @@ forum.buhsoft.ru
  forum.d99q.cn
  forum.icsa-life.ru
  forum.like108.com
-forum.lorenmu.com.br
  forum.mediaok.info
  forum.sexabout.ru
  forum.somedizzy.com
@@ -76928,7 +77356,6 @@ foxy-bites.000webhostapp.com
  foxy-layer.000webhostapp.com
  foxyestimates.com
  foynecity.buzz
-foyykiqrgnprkijhdjqgmjbxrt-dot-gle39404049.rj.r.appspot.com
  fozezebook.000webhostapp.com
  fozier-tablespoons.000webhostapp.com
  fozonibr.co.cc
@@ -76943,7 +77370,6 @@ fpcperu.com
  fpcpreview.000webhostapp.com
  fpcsmithfield.org
  fpcupxjsxsryqfyg-dot-millinium.ey.r.appspot.com
-fpcxahrcnhgesjcvjyuythfevn-dot-glmar9393293232323.uk.r.appspot.com
  fpetraardella.band
  fpfp9.com
  fpfscoop.com
@@ -77084,7 +77510,6 @@ framestorre.com
  franasm.xyz
  francais.ires.cc
  france-apple-store.azurewebsites.net
-france-banque-particulier-postale.ml
  france-diamants.com
  france-finances.com
  franceandcolps.org
@@ -77346,7 +77771,6 @@ freefacechats.cf
  freefacechats.gq
  freefacechats.ml
  freefinancialfacts.icu
-freefire-biz.tk
  freefire-claim-item.ocry.com
  freefire-claims15.000webhostapp.com
  freefire-event3642.ddns.info
@@ -77486,6 +77910,7 @@ freeskineventpubg.jetos.com
  freeskinkofi.zyns.com
  freeskinmlbb65.tk
  freeskinmlbb9.wikaba.com
+freeskinmobilelegends-now.ml
  freeskinmobilelegends2020.dynamic-dns.net
  freeskinms15.zzux.com
  freeskinneweventmobilelegend.gleeze.com
@@ -77507,7 +77932,6 @@ freespinevents.com
  freespinpubgmobile.com
  freespins18k.xyz
  freespins198.xyz
-freespinupdate.com
  freespiritmind.com
  freespiritweddings.com
  freestickers-vk.ml
@@ -77543,9 +77967,7 @@ freeucs13.com
  freeucskin.xxuz.com
  freeucskinpubgx.ooguy.com
  freevbuckx.com
-freeventmlbb09.cf
  freeventmlbb10.ga
-freeventmlbb10.tk
  freevidiosexpornhub.ocry.com
  freeviettel.000webhostapp.com
  freevkgamesandsticks.000webhostapp.com
@@ -77597,6 +78019,7 @@ frem.jaysbrand.com
  fremasngde.com
  french-aide.com
  frenchandindianwarfoundation.org
+frenchbulldogharness.com
  frenchcakes.ae
  frenchfr.com
  frenchfries8.top
@@ -77723,6 +78146,7 @@ frightenomar.net
  frigidhightechcybernetics--five-nine.repl.co
  friksta.com
  frilanced.site
+frill-flax-vicuna.glitch.me
  frillysoupyshelfware--five-nine.repl.co
  frilvam.eu
  frimainternationalcom.nckiwomen.gdn
@@ -77817,7 +78241,6 @@ froshnationng.com.nsgl.xyz
  frospubgm.com
  frostbill.com
  frostmorg.com
-frostspinpubg.com
  frosty-ardinghelli-2fad11.netlify.app
  frosty-benz-329e5d.netlify.app
  frosty-bore.netlify.com
@@ -77941,6 +78364,7 @@ fsm.sysupdate.net
  fsmk.awaykart.com
  fsmnfnpwzgauqrxz-dot-millinium.ey.r.appspot.com
  fsneng.com
+fsnrhostmail.duckdns.org
  fsojrl.rogagot.com
  fsooybryukvjrmfi-dot-millinium.ey.r.appspot.com
  fsp.buet.ac.bd
@@ -78127,6 +78551,7 @@ fulcrumeu.com
  fuleyehmiwa.com
  fulfillingmue.ru
  fulfillmententertainment.com
+fulgurant-mistakes.000webhostapp.com
  fulhamdigital.com
  fuli.hbr26.com
  fuliestone.com
@@ -78143,11 +78568,11 @@ fullcorp-net.com
  fulldown.xyz
  fullelectronica.com.ar
  fullfearfulpaintprogram--five-nine.repl.co
-fullgetinsurance.com
  fullgrown.zapto.org
  fullhdvideoizlemesitesi2527.xyz
  fullingenieriagt.com
  fullinnova.com
+fulljpnmovie.duckdns.org
  fulllengthmirrors.net
  fullmediaco.com
  fullmoviedownload.in
@@ -78350,6 +78775,7 @@ futurekids.in
  futurelabsinteractive.com
  futurematic.nl
  futurenewapp.uno
+futureofadmissions.com
  futureofiran.com
  futurepath.fi
  futureservice.in
@@ -78425,7 +78851,6 @@ fwaxohqgbnplmhmcjbmj.top
  fwbevagekwpbqxhh-dot-millinium.ey.r.appspot.com
  fwbrnjnfqulcjtrj-dot-millinium.ey.r.appspot.com
  fwc24.addroits.com
-fwcfmuzsowlibaupgfvxgajamk-dot-gle39404049.rj.r.appspot.com
  fweeqwewqe2334rewcwe.icu
  fweqvbaznstfhzzgwkxxxweaym-dot-gleowayel400503.uc.r.appspot.com
  fwerqeqerqrqzxsdfsdf.ga
@@ -78484,6 +78909,7 @@ fxsw.dyamm.com
  fxt27.csb.app
  fxtradecompany.top
  fxtradingtactics.com
+fxtybfu.bar
  fxvfwocmozylftil-dot-millinium.ey.r.appspot.com
  fxvipmaster.com
  fxw01.jaysbrand.com
@@ -78578,7 +79004,6 @@ fztjwadc.web.app
  fztofvimlwkqfkdlfaughyxufastfxvdzzqy-dot-glxcel49934343434.rj.r.appspot.com
  fzurpeknjfumpujrjesu.top
  fzvgrekwfjgiclgugzgcgspxfd-dot-gleowayel400503.uc.r.appspot.com
-fzwbsvfbmdwovkeahzaccfbsph-dot-gl099898987fhkl.uk.r.appspot.com
  fzweiming.com
  fzwise.com
  fzwjsbzfvrfsgmcuay.top
@@ -78775,7 +79200,6 @@ gabung-wa-18.000webhostapp.com
  gabung-wagrup18.reward20.com
  gabung-whatsap18.realxevent.com
  gabung-whatsapp.zzux.com
-gabung-whatsappnotnot.hndg.tk
  gabung.getfree7.me
  gabung.grup-whatsapp.wa-net.tk
  gabung.holl88.com
@@ -78795,6 +79219,7 @@ gabunggroupwa.claim654.com
  gabunggroupwhatsapp1.tk
  gabunggrubbokep.virall.in
  gabunggrubkita.oottz.com
+gabunggrubmabar.cgyd.ml
  gabunggrubwahotmasuksini.000webhostapp.com
  gabunggrubwhatsapp2020.zzux.com
  gabunggrup-wa18.join99.org
@@ -78906,7 +79331,6 @@ gaihanoi19.duckdns.org
  gaihotnhat18.byethost7.com
  gaijinmassoterapia.com
  gain0returxseen0.com
-gaingaming02.000webhostapp.com
  gainsy.com
  gaintetikh.com
  gaithersburgs.buzz
@@ -78964,7 +79388,6 @@ galiikalllokdtahj.blogspot.com
  galileounaluna.com
  galinapotapova.com
  galja.xxuz.com
-galjzmaugwhdpvznpzpihyyyzd-dot-gle39404049.rj.r.appspot.com
  gallag.000webhostapp.com
  gallaidur.com
  gallant-mcclintock-bb8625.netlify.app
@@ -78985,7 +79408,6 @@ galliambic-checkout.000webhostapp.com
  gallowings.xyz
  gallowsashton.com
  gallygkgzqggclvv-dot-millinium.ey.r.appspot.com
-galossystem.net
  galserwis.pl
  galubvvrvktcotemoexmxexpno-dot-gleowayel400503.uc.r.appspot.com
  galuhtea.com
@@ -79213,6 +79635,7 @@ gardendoctorconsulting.com.au
  gardengate.in
  gardenia-bd.com
  gardeniabakery.com
+gardeniahotel.in
  gardenll.accesscam.org
  gardenstrutturelegno.com
  gardenworx.ae
@@ -79226,14 +79649,13 @@ garena-com99.tk
  garena-diamante-agosto.com
  garena-freefire39.tk
  garena-gratisdiamond.ocries.com
+garena-indonesia.event08-com.ga
  garena-reedem-kode-2020.000webhostapp.com
  garena-topupforfree.mariachisensantiago.cl
  garena.codashop-freefirebgid23.tk
  garena16.com
  garenaclaimevent.com
  garenaehi12.000webhostapp.com
-garenaeventff2021.ga
-garenaeventff2021.gq
  garenaff.website
  garenaff09.zzux.com
  garenaff67.zzux.com
@@ -79369,6 +79791,7 @@ gaushyang.co.th
  gausselectro.in
  gaussian-handlers.000webhostapp.com
  gautamiheights.com
+gautaminfra.co.in
  gauthier.communication-iscpalyon.com
  gautmission.org
  gauwayngiget.tk
@@ -79395,6 +79818,7 @@ gaxlxupemkeqzybb-dot-millinium.ey.r.appspot.com
  gay-love.ru
  gay.theworkpc.com
  gayaju.com
+gayatriprojects.com
  gayboitesthjvdlhuegfew1rainj2.accesscam.org
  gayesofpanel.site
  gayhn.goruli.com
@@ -79533,7 +79957,6 @@ gcfnyxxhailyazjg-dot-millinium.ey.r.appspot.com
  gcftdrds.m3ikp3.cn
  gcfxb12aefoyn03epdoji.xyz
  gcg-corp.com
-gcgjpotqmolsyvmeuefforgehq-dot-gl099898987fhkl.uk.r.appspot.com
  gch7.com
  gciciqpswepiwhwm-dot-millinium.ey.r.appspot.com
  gcirsa.com
@@ -79543,8 +79966,10 @@ gcleaner.info
  gclub66666.com
  gclubfan.com
  gcmasnyrkvimscxywrotddjyrd-dot-gleowayel400503.uc.r.appspot.com
+gcmhnpg.bar
  gcmobilemassage.com.au
  gcncmvcqhjszryrh-dot-millinium.ey.r.appspot.com
+gcnxhuihlzainvolqighctrgao-dot-gle39404049.rj.r.appspot.com
  gcogle-analytics.com
  gcoronag.000webhostapp.com
  gcorpsa.com
@@ -79649,7 +80074,6 @@ gdupdneyhwhsxtnpotrd.com
  gduploads.com
  gdv.stomp.digital
  gdvdjsyd.com
-gdvghokfgnfinsxhkqrscvddof-dot-gle39404049.rj.r.appspot.com
  gdviacrumvcbxodmxpvpsnhxqugvuefsagxy-dot-cedar-code-289917.nn.r.appspot.com
  gdvucfkspaytczqgersbtunjxsar.top
  gdyaxf.com
@@ -79697,7 +80121,6 @@ gebodez.co.cc
  gebrauchtwagen.sportsontheweb.net
  gebugcsarea.com
  gebuhrenfreiadvzia.de
-gebwfraxulennwwjkqepgzjoes-dot-glmar9393293232323.uk.r.appspot.com
  gebzeugurlucocukkulubu.com
  gec.rw
  gecfornmosa.com
@@ -79949,7 +80372,6 @@ geomedgroup.net
  geomegasoft.net
  geomekca.com
  geometrai.com
-geometry-yamal.ru
  geomterystyle.com
  geopinfactory.com
  geoplanum.lt
@@ -80055,7 +80477,6 @@ gerxfgyltjteurtv-dot-millinium.ey.r.appspot.com
  gerythielens.be
  geschaeftskunden.t-online.telekom-verif1ll.icu
  geschu.com
-geserdikit.com
  gesfd.com
  geshtalt.mk
  gesiscom.nckiconsulting.gdn
@@ -80194,10 +80615,10 @@ getitforu2-001-site1.dtempurl.com
  getithref.freedynamicdns.org
  getitlegal.com
  getjobportal.com
+getjoin-whatsapp.ml
  getjoin-whatsapp18.tk
  getknife.club
  getkonstrukted.com
-getleanplan.com
  getlikesfree.com
  getmefranchise.info
  getmeinfo.online
@@ -80341,7 +80762,6 @@ gfdg.gdfhgdfhsdjkjhfsdhjfgshfdhjghsjfgkds.top
  gfdgdg-0.ml
  gfdgs.bfusgifh.xyz
  gfdhhfg.zzz.com.ua
-gfdinrkekzafqppdvaplkwpwzk-dot-gle39404049.rj.r.appspot.com
  gfdqwhohjhyvfisxvszsjhvtugyzdzqsjdlh-dot-glegen303939423233.ue.r.appspot.com
  gfdrderdeesa.weebly.com
  gfdsa36.email
@@ -80410,7 +80830,6 @@ gfxx.creatorlink.net
  gfyaxkqyobsnkqfo-dot-millinium.ey.r.appspot.com
  gfyrxygfvgbwoffj-dot-millinium.ey.r.appspot.com
  gfzkadwxkswzmlrmmrdyfwzgiusftghssekf-dot-gl494903049.wl.r.appspot.com
-gfzqkmcdwrxdmmvuocknyhiwdo-dot-gle39404049.rj.r.appspot.com
  gg-ast.xyz
  gg-drop.tk
  gg-win.xyz
@@ -80726,6 +81145,7 @@ giftingtimes.in
  giftmetros16.com
  giftmidasbuy.com
  giftofahealinghand.com
+giftpubgmobiles18.dynamic-dns.net
  giftraaga.com
  gifts-empire.pro
  gifts-jagex.com
@@ -80884,6 +81304,7 @@ girlydesignart.com
  girlyinfluencer.com
  girlyougotthischallenge.com
  girlzempoweredsl.com
+giroverbandkundendienst-sparkasse03.xyz
  gisel2020.dynamic-dns.net
  gisell1.com
  giselviral.juaratembak.com
@@ -80937,14 +81358,11 @@ givealittlegamealot.com
  givealittlegraceblog.com
  giveaway-baimwbsong.kozow.com
  giveaway-blockchain-com.preview-domain.com
-giveaway-coda2.duckdns.org
  giveaway-hadiah21jt.ooguy.com
  giveaway-hadiah38jt.kozow.com
  giveaway-hadiah64jt.ooguy.com
  giveaway-hadiah72jt.gleeze.com
-giveaway-new01.duckdns.org
  giveaway-payypal.000webhostapp.com
-giveaway-ph12.duckdns.org
  giveaway-zone.gq
  giveaway.event78.my.id
  giveaway.mydad.info
@@ -80978,7 +81396,6 @@ giveawayuang16.25u.com
  giveawayuang3.25u.com
  giveawayxhadiah.toh.info
  giveawayzone.ga
-giveforhelp.com
  givehopeahand.org
  givejameswhitetheball.com
  givelucky-spin.wikaba.com
@@ -81231,6 +81648,7 @@ glnamuxzgrzosjuh-dot-millinium.ey.r.appspot.com
  glneoagdnnsuhwgmlctmhfppgt-dot-gleowayel400503.uc.r.appspot.com
  glnprrlbsxngtrlb-dot-millinium.ey.r.appspot.com
  globacom.ga
+globailpage-prodwebex.com
  global-aexp.services
  global-americenexpress.eu
  global-ark.co.jp
@@ -81438,7 +81856,6 @@ gm2.jaysbrand.com
  gm214.awaykart.com
  gmail-accounts-google-signin-mail.tk
  gmail-phone-support.com
-gmail.acconuts.email
  gmail.aiq.ru
  gmail.com.marzax.com
  gmail.com.serviceloadbk.bar
@@ -81466,7 +81883,6 @@ gmegoldcupcs.xyz
  gmeira.com.br
  gmelfit.com
  gmepkfhqvjirggga-dot-millinium.ey.r.appspot.com
-gmfdlogshqmxzmaffkvlucrbfh-dot-gle39404049.rj.r.appspot.com
  gmflyhmseopemwxrzmhpsyobuffrnthjfpnh-dot-solar-vertex-285913.rj.r.appspot.com
  gmgifts.co.uk
  gmgpowerwashing.com
@@ -81475,7 +81891,6 @@ gmhlwrqnhzaquwmm-dot-millinium.ey.r.appspot.com
  gminasiedlce.home.pl
  gmjenkins.com
  gmjh.tyc.edu.tw
-gmjoqgfovewjxxvugqmlgxdzki-dot-gle39404049.rj.r.appspot.com
  gmjtpx.com
  gmjuridico.upsites.com.br
  gmlsoftlabs.com
@@ -81544,7 +81959,6 @@ gnghcdzkfudzwheyomuvbdseneffxvkbaxnu-dot-cedar-code-289917.nn.r.appspot.com
  gngits.com
  gngjufvpmouobbmp-dot-millinium.ey.r.appspot.com
  gnhehhands.bt
-gnhomefinish.com
  gnhtech.com
  gnibjyw.goruli.com
  gnimelf.net
@@ -81588,6 +82002,7 @@ gnvtb.goruli.com
  gnwzqsyxbaisebjz-dot-millinium.ey.r.appspot.com
  gnxz.000webhostapp.com
  gnyfst.com
+gnyitweaziqvbqrxwjlpmthepw-dot-gle39404049.rj.r.appspot.com
  go-charge.dk
  go-clean.hk
  go-clean.tech
@@ -81612,7 +82027,6 @@ go2.jiancai008.com
  go2slidell.com
  go4it24.be
  go4steel.in
-go643gleds.ttweb.xyz
  goadlfyppxyzykxy-dot-millinium.ey.r.appspot.com
  goahte.ru
  goaircom.tk
@@ -81667,7 +82081,6 @@ godaddycusservicecc2.com
  godaddycusservicecc3.com
  godadoresyou.org
  godandgoddess.com
-godanointedapparel.com
  godanswer1.com
  godbayern.shaxiaassessment.top
  godbloodcc.000webhostapp.com
@@ -81827,6 +82240,7 @@ goldenfashiondeeds.com
  goldenfixerdash.com
  goldenfriedchicken.fr
  goldenfuturepower5.com
+goldengaragedoor.com
  goldengardenparty.com
  goldengateschool.in
  goldenhousetop.com
@@ -82002,6 +82416,7 @@ goodfreightthailand.com
  goodgirlrecovery.com
  goodhandsappliances.com
  goodherbwebmart.com
+goodideatravel.com
  goodingedu.com
  goodisgoodter.com
  goodkarmaforeveryone.com
@@ -82199,7 +82614,6 @@ gornjimilanovac.rs
  goronkrl.goruli.com
  gorrasnissin.com
  gorumriwjuezresw-dot-millinium.ey.r.appspot.com
-gosafes.com
  gosdfkm.gq
  goseka.co
  goshmanconsulting.com
@@ -82306,7 +82720,6 @@ gov-uk-claim-tax-refund.com
  gov-uk-evaluate.com
  gov-uk-evaluatetax.com
  gov-uk-hmrc.com
-gov-uk-login.com
  gov-uk-portal-rebate.com
  gov-uk-returntax.com
  gov-uk-reviewtax.com
@@ -82639,7 +83052,6 @@ gqnvcgdvkteizpanypszchopekfqsbuzkceu-dot-solar-vertex-285913.rj.r.appspot.com
  gqogojasvimztvxo-dot-millinium.ey.r.appspot.com
  gqpwyypfonoipwpj-dot-millinium.ey.r.appspot.com
  gqpxn.goruli.com
-gqqpiyixgdypvwdnhehsgdyexg-dot-gl099898987fhkl.uk.r.appspot.com
  gqrawjjuaejllccokecptnimfvzbqfyvzvot-dot-solar-vertex-285913.rj.r.appspot.com
  gqrk2.lawapass.com
  gqrkpkivgiflwoevxezzhpvjcw-dot-gleowayel400503.uc.r.appspot.com
@@ -83154,7 +83566,6 @@ grizzlygruntapparel.com
  grjlpjntcmekbkwj-dot-millinium.ey.r.appspot.com
  grk-groupe.com
  grlkdrcefhcdtovc-dot-millinium.ey.r.appspot.com
-grmjguciordvibvyrdjjcnigzg-dot-gle39404049.rj.r.appspot.com
  grmk-paypalservis5k.servebeer.com
  grml.net
  grms.cit.net
@@ -83259,11 +83670,11 @@ group-thai18.000webhostapp.com
  group-vcs-gratiss.000webhostapp.com
  group-vcs-tante-bispak.000webhostapp.com
  group-viral2020.000webhostapp.com
+group-viralnew.whatsapp-real.ml
  group-wa-bokep-terbaru.giize.com
  group-watsapp-me18.jetos.com
  group-whatsaop-xx.hostjaya-free.cf
  group-whatsapp-bokep2020.dumb1.com
-group-whatsapp-notnotreal-terbaru2021.duckdns.org
  group-whatsapp-viip25.cf
  group-whatsapp-viip28.cf
  group-whatsapp-viral18plus.grup-syg.ml
@@ -83375,9 +83786,9 @@ groupkhususorangdewasa.000webhostapp.com
  groupkongkox.000webhostapp.com
  groupmabar.itemdb.com
  groupmabarbudi01gaming.cf
-groupmabarffpro54.mywww.biz
  groupmabarfrontal.ga
  groupmabarmoba.000webhostapp.com
+groupmabarwa06.duckdns.org
  groupon-deals.net
  grouppbokepterbaru18.000webhostapp.com
  grouppjoin.viiptv.com
@@ -83416,7 +83827,6 @@ groupswa.hol7.com
  groupswabudi01gaming.000webhostapp.com
  groupswhatsapp-hottviral.holls18-org.ga
  groupswhatsapp.faqserv.com
-groupswhatsapp18s.tk
  groupupdatessoftwares.com
  groupvacations.icu
  groupvideo18plusaachat.000webhostapp.com
@@ -83425,6 +83835,7 @@ groupviral2020.get-claimfree.ga
  groupvirall.zyns.com
  groupvirall2020.mywire.org
  groupvirallku.faqserv.com
+groupwa.everr.ga
  groupwa.freebokep77.my.id
  groupwa.guied7.my.id
  groupwa.jilbob18nxx.my.id
@@ -83534,6 +83945,8 @@ groupwhatsappbudii01.grub-wa11.my.id
  groupwhatsappenaena.jetos.com
  groupwhatsappinvietsexy.xxuz.com
  groupwhatsappinvite.otzo.com
+groupwhatsappinvite37.tk
+groupwhatsappinvite39.tk
  groupwhatsappjoin.klaim20.com
  groupwhatsappjoin.vizvaz.com
  groupwhatsappjoinxxnx.yihotz.tk
@@ -83558,7 +83971,6 @@ groupwhtsapp18new.xxxy.info
  groupwhtsppindobokep.zzux.com
  groupxchatwhatsapp.qhigh.com
  groupxxxjoin.asia
-groupy-viraly2021.duckdns.org
  groupy.pro
  groveparaplanning.com.au
  grovesquarejc.com
@@ -83723,18 +84135,15 @@ grub-bokep-viral-juni-2020.000webhostapp.com
  grub-bokep-wa-ind.000webhostapp.com
  grub-bokep.new-events20.my.id
  grub-bokep.wa-hotnew.ga
-grub-bokep18.whatsap12-app.ml
  grub-bokeps-1.000webhostapp.com
  grub-bokepsimontok.vvipx7.ml
  grub-budi-01-gaming.real-20.com
  grub-chat-wa.000webhostapp.com
  grub-dewasa-bokep-viral-2020.000webhostapp.com
  grub-hot343.giize.com
-grub-mabar-chat-youtuber.duckdns.org
  grub-mabar-freefire.gleeze.com
  grub-mabar.my.id
  grub-mabarbarengyoutuber.newwww.my.id
-grub-notnot.duckdns.org
  grub-rea.jkub.com
  grub-wa-bok3p18.000webhostapp.com
  grub-wa-bokep-18-keatas-no.000webhostapp.com
@@ -83770,7 +84179,6 @@ grub-whatsapp.wa-grup.gq
  grub-whatsapp.whatxapp.cf
  grub-whatsapp1.vvipx77.gq
  grub-whatsapp155.gq
-grub-whatsapp18-id.tk
  grub-whatsapp18.com.getfree7.me
  grub-whatsapp18.sex-wa.ml
  grub-whatsapp189.ml
@@ -83848,12 +84256,12 @@ grubkimoci.000webhostapp.com
  grublinkjoin18.wa-sex.com
  grubmabar-ff.grub-new.my.id
  grubmabar-whatsapp2020.grup26.ml
+grubmabar.jetos.com
  grubmabar.lov88.cf
  grubmabar.mor99.ml
  grubmabarff-invite.zyns.com
  grubmabarff66.dynamic-dns.net
  grubmabarffbudi01gamings.x24hr.com
-grubmabarnotnot.mrslove.com
  grubmaenbarengffindo.000webhostapp.com
  grubnewbokep.fresh2.org
  grubpemersatu-bangsa1.000webhostapp.com
@@ -83959,6 +84367,7 @@ grubwhatsapp.biz.id
  grubwhatsapp.ezua.com
  grubwhatsapp.fartit.com
  grubwhatsapp.new89.cf
+grubwhatsapp.toktokvc.cf
  grubwhatsapp.viralls6.xyz
  grubwhatsapp.xxuz.com
  grubwhatsapp0.tk
@@ -83996,7 +84405,6 @@ gruopswa18.trickip.net
  gruopswa20.trickip.net
  gruopwahot.hol2.co.in
  grup-18hot.myddns.rocks
-grup-18plus.holzfam.com
  grup-albokep.4dq.com
  grup-b0kp18plus.itsaol.com
  grup-b0okep.itsaol.com
@@ -84080,7 +84488,6 @@ grup-mabar-pubg-mobile-siap-turney.000webhostapp.com
  grup-mabaryoutuberff.event-xm8new2020.freefire77.biz.id
  grup-mbr-free-fire.000webhostapp.com
  grup-mbr-ytb.news-free90-com.tk
-grup-new-all.tk
  grup-sahur.vipx8.shop
  grup-sange-indo-real.000webhostapp.com
  grup-sangehits2020.000webhostapp.com
@@ -84219,7 +84626,6 @@ grup18.jcok5.gq
  grup18.loginnnn.gq
  grup18ahcrit.you-whatsapp35.cf
  grup18bkp.forumz.info
-grup18bkppwa.duckdns.org
  grup18pejuangmalam.000webhostapp.com
  grup18plusbocildilarangmasuk18.ygto.com
  grup18salingberbagi.000webhostapp.com
@@ -84286,7 +84692,6 @@ grupbokep.id.ocry.com
  grupbokep.item6.shop
  grupbokep.kha20.tk
  grupbokep.wa-sex.com
-grupbokep.wgid-11.tk
  grupbokep01.hol50.com
  grupbokep02.hol50.com
  grupbokep03.hol50.com
@@ -84377,7 +84782,6 @@ grupbokepterbaru2k20.000webhostapp.com
  grupbokepterbaruboss.000webhostapp.com
  grupbokepterhotindonesia.zzux.com
  grupbokepv.000webhostapp.com
-grupbokepviral.join-wa-1.ga
  grupbokepviralautocrotbanyak.000webhostapp.com
  grupbokepviralindonesia.000webhostapp.com
  grupbokepvirallcewebosmamahasiswitiktokgirls.accesscam.org
@@ -84388,7 +84792,6 @@ grupbokepviralwhatsapp.zzux.com
  grupbokepwa.hol1.net
  grupbokepwa10186.000webhostapp.com
  grupbokepwa18.itsaol.com
-grupbokepwaterbaru2021.grupwahot1667.ml
  grupbokepwaterbarumei2020.000webhostapp.com
  grupbokepwaviralterbaru.000webhostapp.com
  grupbokepwhatsapp.bokepxnx.ga
@@ -84491,6 +84894,7 @@ grupjepang.ver22-net.cf
  grupjhv347.000webhostapp.com
  grupjoin-450.ml
  grupjoin.zyns.com
+grupjoinchat.duckdns.org
  grupjoinnew.join452.net
  grupjoinwhatsap.wa-hotnew.gq
  grupjoinwhtsapp.dumb1.com
@@ -84504,7 +84908,6 @@ grupmabar-wayoutuber3.ml
  grupmabar-wayoutuber3.tk
  grupmabar-wayoutuber5.ga
  grupmabar-youtuber.event-resmigarena81.ga
-grupmabar.grub-7492.tk
  grupmabar19.my.id
  grupmabarbudi01gaming2020.000webhostapp.com
  grupmabarff.ssl443.org
@@ -84651,6 +85054,7 @@ grupp-whtsahpp18.2020-2021.net
  grupp.sange-bareng.ga
  grupp.whatsapp-bokep.tk
  grupp18.jkub.com
+grupp18new.whatsapp-chattt64.ml
  gruppahalwanlendirterbaru2020.000webhostapp.com
  gruppahlawan001.000webhostapp.com
  grupparapejuangmaster.000webhostapp.com
@@ -84669,7 +85073,6 @@ gruppointesa.biz
  gruppointesaisp.info
  gruppoisp-online.com
  gruppoisp-psd2.com
-gruppoisp-sicurezza-web.com
  gruppoisp-sicurezza-webotp-okey.000webhostapp.com
  gruppoisp.web-alert.ga
  gruppoispallerthp.000webhostapp.com
@@ -84742,6 +85145,7 @@ grups-wa.claim654.com
  grups-whatsapp.25u.com
  grups-whatsapp.2waky.com
  grups-whatsapp18.jetos.com
+grupsalingberbagi.janda-65x-net.gq
  grupsange-panas.000webhostapp.com
  grupsange-porn8.ml
  grupsangean.000webhostapp.com
@@ -84906,7 +85310,6 @@ grupwaff145.000webhostapp.com
  grupwafreefirebagi2diamond.000webhostapp.com
  grupwahatsaapbokep.000webhostapp.com
  grupwahitam.cf
-grupwahot1667.tk
  grupwajoinhotsexviral2020.viral18plus.com
  grupwakhususdirimuklikaja.myiphost.com
  grupwakimochi.000webhostapp.com
@@ -85035,6 +85438,7 @@ grupwhatsappbokepterhott20.wa-memex.ml
  grupwhatsappbokepviral.groupsjoins9.cf
  grupwhatsappbudi.my-join.gq
  grupwhatsappbudi01gaming.gabungnew.tk
+grupwhatsappdewasa.cf
  grupwhatsappdewasa.chat-link.tk
  grupwhatsappdewasa.claim80.ml
  grupwhatsappdewasa.kozow.com
@@ -85124,6 +85528,7 @@ gs.9i173.com
  gs.dvmdcb.com
  gs.jsscxx.com
  gs11fd5.com
+gs3ki5co.info
  gs68798094387.nw.r.appspot.com
  gs8y7phuok.dt.r.appspot.com
  gs91ah-bom-e-bem-perfeito.com
@@ -85160,8 +85565,6 @@ gshfpvmqtumwicemyacaqcmebi-dot-glowablu03049033.du.r.appspot.com
  gshkls.godaddysites.com
  gshock-vietnam.vn
  gshumzpi.firebaseapp.com
-gshupljoghhrmeimlxtrnjcigx-dot-gle39404049.rj.r.appspot.com
-gshylemunfozjatqlskzsevesu-dot-poised-bot-306515.uk.r.appspot.com
  gsi.topkorder.su
  gsierohv4zgayjanmrputhzlvy-adwhj77lcyoafdy-www-paypal-com.translate.goog
  gsisquec-arapi.buzz
@@ -85191,6 +85594,7 @@ gspiinidersuoi.com
  gspltd.ge
  gsportsgroup.co.kr
  gsppnyciowmvdnctaqmqfbmjeq-dot-gleowayel400503.uc.r.appspot.com
+gsppower.xyz
  gsqrqzdulsseukeguxkbybzxhmixkagsutot-dot-cryptic-now-290917.ey.r.appspot.com
  gsqttyuyeixbqmup-dot-millinium.ey.r.appspot.com
  gsquareconcrete.com
@@ -85215,7 +85619,6 @@ gstatiknetiplist.net
  gstatlcs.com
  gstna.com
  gstnfbcsadser.my.id
-gstnxgeiwloyyqxyicbisgiyti-dot-gle39404049.rj.r.appspot.com
  gstorag05222546bsd7.avantgardeservices.in
  gstorag06024031pvchamber.avantgardeservices.in
  gstorag06035459gstorag05234200pvchamber.avantgardeservices.in
@@ -85389,6 +85792,7 @@ gugu.zapto.org
  guguledi.000webhostapp.com
  gugur-bunga.electionbenefit.com
  guhaasmart.com
+guhjjhik-njnihj-bjbj.s3-ap-southeast-1.amazonaws.com
  guhokfystrmgfzvf-dot-millinium.ey.r.appspot.com
  gui.eligulinsaat.com
  guiaamoroso.com
@@ -85804,7 +86208,6 @@ gysjwyqfcgocxhijfwauxbowxx-dot-gleowayel400503.uc.r.appspot.com
  gytm.jaysbrand.com
  gyttgod.com
  gyu88jh.nrtyjyt44ee.al1av.com
-gyubvsqwyxkvphwvgpmkavbsdw-dot-gle39404049.rj.r.appspot.com
  gyuewaknx.rogagot.com
  gyuftgyur.xyz
  gyuine.com
@@ -85851,10 +86254,10 @@ gzftae.com
  gzgbzxfgjszxwkyday.top
  gzhebbogkawmhdqz-dot-millinium.ey.r.appspot.com
  gzitexam.com
-gziywiolyhtiiuurreiznaathj-dot-gle39404049.rj.r.appspot.com
  gzjhwy.net
  gzjmveqnxsdftwqqha.top
  gzk.by
+gzknckb.bar
  gzksdzkj.com
  gzllsguanorsabme-dot-millinium.ey.r.appspot.com
  gzlvycvurcpsbbpu-dot-millinium.ey.r.appspot.com
@@ -86227,6 +86630,7 @@ hajjumrahpost.com
  hajjumrahtips.com
  hajm.addroits.com
  hajrata.work
+hak7mrtmkmr66helwgevmqikri--www-paypal-com.translate.goog
  hak7mrtmkmr66helwgevmqikri-adwhj77lcyoafdy-www-paypal-com.translate.goog
  hakan.gq
  hakanbasar.com
@@ -86369,7 +86773,6 @@ halifax-cancel-payees.com
  halifax-cancelpayee.co.uk
  halifax-confirm-payee.com
  halifax-confirm.com
-halifax-customeralert.com
  halifax-databreach.info
  halifax-dataprotect.net
  halifax-dataprotection.com
@@ -86816,7 +87219,6 @@ halifax.denialnewpayee.com
  halifax.denialpayee.com
  halifax.deregister-a-device.com
  halifax.deregister-app.com
-halifax.deregister-cancellation-payee-secure-auth.com
  halifax.deregister-device.co.uk
  halifax.deregister-device.com
  halifax.deregister-newdevice.com
@@ -87429,11 +87831,13 @@ handomar.com
  handrailarchitect.com
  handrug.com.py
  handrush.com
+handsbagair.info
  handsofcompassion.co.ke
  handsome2afjs.000webhostapp.com
  handsomef8.com
  handsonbeautysalon.co.uk
  handstandbuffer.com
+handynearhypercard.dthsesrerf.repl.co
  handyphoto4.com
  handystarlet.com
  handystepcom.shuiabox.top
@@ -87531,6 +87935,7 @@ happsoftware.com
  happy-albattani-b18730.netlify.app
  happy-antshop.sitenode.sk
  happy-dealstoday.blogspot.com
+happy-dubinsky-6ee824.netlify.app
  happy-runner.com
  happy-thinking.com
  happy-wright-e1ba1b.netlify.app
@@ -87621,10 +88026,8 @@ harmfulnervous.com
  harmfulsociety.com
  harmfulterrace.com
  harmonious-fuschia-cardigan.glitch.me
-harmony-realestate.com
  harmonyandlife.top
  harmonyidtech.com
-harmonyinstitution.com
  harmonyrealestate.ae
  harmonysolutions.co.za
  haroldhazard1-wixsite-com.filesusr.com
@@ -87638,7 +88041,6 @@ harpa.space
  harpa.website
  harperoilco.com
  harpershologram.wordpress.com
-harpet.se
  harpiaadventure.com
  harpicd2d.com
  harputdoviz.com
@@ -87924,7 +88326,6 @@ hc-happycasting.com
  hc84y.lawapass.com
  hcapnvzrqluvlnzykkzzrgfntj-dot-gleowayel400503.uc.r.appspot.com
  hcbon-en.com
-hcbymnanvaaafubfwuepoyafwt-dot-gle39404049.rj.r.appspot.com
  hccanvvxvxcwquqmtd.top
  hccbidebsizxblap-dot-millinium.ey.r.appspot.com
  hccleaningllc.com
@@ -88102,6 +88503,7 @@ healedbyhim.org
  healigcarelin.com
  healing-yui223.com
  healingfigures.com
+healingfrequencymedicine.com
  healinghandsonthemove.com
  healingscienceresearch.com
  healmedicaltrauma.com
@@ -88230,7 +88632,6 @@ hebreoenlinea-chms.mx
  hebrertd.com
  hebronlions.cf
  hebros.id
-hecarabu.com
  hechiceriadeamoryprosperidadisrael.com
  hecka.myddns.me
  heckproductions.com
@@ -88255,6 +88656,7 @@ hediyegapsinternet.com
  hediyeler10gb-ramazan.net
  hediyenkolay.com
  hedsetghh.000webhostapp.com
+heeatpro.us
  heel.ge
  heemaalnews.com
  heereeqddd.duckdns.org
@@ -88278,6 +88680,7 @@ hehao.host
  hehepress.com
  hei03tfxv03mahl.com
  heidelbergartstudio.gallery
+heididarinstudio.com
  heidmane.com
  heidzilla.com
  heightnetwork.com
@@ -88372,7 +88775,6 @@ hellomydad.xyz
  hellonews.xyz
  hellonext.eu
  hellopizza.it
-hellopouches.com
  hellorosette.com
  hellosm.pe
  hellotech.io
@@ -88412,8 +88814,6 @@ help-auone.com
  help-auth.com
  help-badge-lnstagram-verifed.cf
  help-bluebadge-support.cf
-help-bluetickform.ml
-help-bluetickforms.tk
  help-can.com
  help-canadian-people.com
  help-cancelnewrequest.co
@@ -88423,7 +88823,6 @@ help-center-support-lnstagram.cf
  help-centers.000webhostapp.com
  help-centre-info.com
  help-centre-uk.co
-help-confirm-mypayees.com
  help-confirming-account.my.id
  help-constantcontact.com
  help-contact-support.center
@@ -88434,6 +88833,7 @@ help-copyright-report.com
  help-copyright-support.com
  help-copyright-team.ml
  help-copyrightcustomerconfig.ml
+help-copyrights-lnstagram.com
  help-copyrightsinfo.xyz
  help-copyrightviolations.com
  help-covid19-benefit.buzz
@@ -88541,7 +88941,6 @@ help-safety-center.000webhostapp.com
  help-section.gq
  help-secure-log.site
  help-securedevice.com
-help-securellyod.com
  help-secureonline.com
  help-security-page-business.000webhostapp.com
  help-security-verification.tk
@@ -88668,6 +89067,7 @@ helpdeskserver.epelcdn.com
  helpdestktopfile.000webhostapp.com
  helpdispatchlarson.com
  helpdispatchservice.com
+helper-center.tk
  helper-tiktok.com
  helper2020.000webhostapp.com
  helpercards.xyz
@@ -88676,7 +89076,6 @@ helpers-verified.com
  helpers.ml
  helpfacebookbusiness.com
  helpfk.000webhostapp.com
-helpforbadge.ml
  helpforcopyright.com
  helpforpayment.000webhostapp.com
  helpforteam.com
@@ -88742,7 +89141,6 @@ helpp.ssnapchat.com.zubairmirza.pk
  helppages2020.my.id
  helppreventcoronavirus.org
  helpprotect.000webhostapp.com
-helpprotections-community-business.gq
  helppservis.moonfruit.com
  helprecover.cf
  helprecover.log-recover.xyz
@@ -88760,6 +89158,7 @@ helps-lnstagram-thecopyright.com
  helps-lnstagramweb.com
  helps-mediasupport.ml
  helps-support.net
+helps-uber.com
  helps-update-identity-serv72575237.trrtdvisapp.com
  helpsaktifiity.my.id
  helpsbluetickforms.com
@@ -89042,7 +89441,6 @@ hfbpynhgzejfcecxjcyzbaibwtywemjykjmz-dot-offglen.uk.r.appspot.com
  hfbwtkaaczgkevfp-dot-millinium.ey.r.appspot.com
  hfcivobmxiasavfbextprcublootaxuwdcqn-dot-cedar-code-289917.nn.r.appspot.com
  hfcyupdtehgfnjzd-dot-millinium.ey.r.appspot.com
-hfdfopbdivcpgfciliuhkitpot-dot-gle39404049.rj.r.appspot.com
  hfdg.rf38ja.cn
  hfdhghjh.000webhostapp.com
  hfdiondfbbf.com
@@ -89061,6 +89459,7 @@ hfgulhijl.duckdns.org
  hfgvdbftyghfgjvgff.weebly.com
  hfhaitian.com
  hfhff.ooguy.com
+hfhfnkfdj-dnndjdj-ndjfkfkn.s3-ap-southeast-1.amazonaws.com
  hfhgftfygfyu.weebly.com
  hfhhggs.duckdns.org
  hfhlagljsljtls.ml
@@ -89102,7 +89501,6 @@ hfyqfgeo-amazon8474565.otakzxcb.com
  hfyqfgeo-amazon8474565.tonicdvczr.com
  hfyxjx.1039.net
  hg76ytsdas.appspot.com
-hgaexdozbdxdmlrhndccuyxaxt-dot-gl099898987fhkl.uk.r.appspot.com
  hgaldiddn.000webhostapp.com
  hganny.com
  hgapps.com.br
@@ -89214,7 +89612,6 @@ hhgkjvpct.vipsnapchatsexting.com
  hhgturlskysvaghqohsbuskzrcgwpmrvomzr-dot-gl494903049.wl.r.appspot.com
  hhh0488.kro.kr
  hhhdohrhrdkcxgns-dot-millinium.ey.r.appspot.com
-hhhehdrofpjltxerompmlkxgea-dot-gle39404049.rj.r.appspot.com
  hhhhh.godaddysites.com
  hhhhh.vvads.repl.co
  hhhhhdhh.weebly.com
@@ -89255,7 +89652,6 @@ hhvkjshlzzlcmome-dot-millinium.ey.r.appspot.com
  hhvtrfvknzgfqvnn-dot-millinium.ey.r.appspot.com
  hhwdnmiioqlpsecr-dot-millinium.ey.r.appspot.com
  hhwebnx.ddns.net
-hhwrzwijvqtqcnvepqeomqaibl-dot-gle39404049.rj.r.appspot.com
  hhxjwxkdukfusdiy-dot-millinium.ey.r.appspot.com
  hhxmbteufvcmnarwqy.top
  hhxsumaazqlhxteezyjdssxqoyvaaqnjmxqw-dot-cryptic-now-290917.ey.r.appspot.com
@@ -89353,7 +89749,6 @@ hidrosauna.com.br
  hidrozap.com.br
  hidupinisangattidakadil.com
  hidupinisangattidakadil.org
-hieaewkdiaxbogmjunkgponpmm-dot-gle39404049.rj.r.appspot.com
  hiefvhydsbiikd.com
  hiefvydsbytiijukd.com
  hiepthinhphat.com
@@ -89424,6 +89819,7 @@ highmynameis.xyz
  highnmightytv.com
  highobject.top
  highparrot12.uz
+highperformanceedibles.com
  highpex.eu
  highseascellars.com
  highstreetmedia.in
@@ -89551,7 +89947,6 @@ hiolouinqare.com
  hiontrendy.com
  hiosbonhome.com
  hipaapotomus.com
-hipckvcweliabpexzppnguomta-dot-gle39404049.rj.r.appspot.com
  hipcuyahoga.org
  hipdropde.com
  hipercomputer.com
@@ -89709,7 +90104,6 @@ hjkg456hfg.ru
  hjkgriuaerjokl.weebly.com
  hjkh12b31oih23o1h2n3o123.000webhostapp.com
  hjksadf3894-fjwe9rt834t423y.ahwduih-yhdw98d33.dynv6.net
-hjlcjokvliyasdrhclpsylnqon-dot-gle39404049.rj.r.appspot.com
  hjldmjqmjblvlsxl-dot-millinium.ey.r.appspot.com
  hjmwalezvlthkxczwonixqttxlycpbfoyafm-dot-glenxpecial3009493.ey.r.appspot.com
  hjmwsqazxs.fairfieldconstruction.org
@@ -89788,7 +90182,6 @@ hkhrgjghgddhjk.com
  hkibgjwk.shoesmogul.com
  hkifdrvfwovmqevrtcvtwiixyt-dot-gleowayel400503.uc.r.appspot.com
  hkiorfg.com
-hkiqmaczxdyofokqxjoiwunxgt-dot-gle39404049.rj.r.appspot.com
  hkjhz9bd1gpj4nfez.com
  hkjlkiughjv.000webhostapp.com
  hkjmyvbsxomuzfrgiakknfvqpl-dot-gleowayel400503.uc.r.appspot.com
@@ -89812,6 +90205,7 @@ hksqehtrihvkcflf-dot-millinium.ey.r.appspot.com
  hkssm.org.hk
  hkt777.ddns.net
  hktqeqgfqmhbqkvmplrrimwgfo-dot-gleowayel400503.uc.r.appspot.com
+hkubalbpbgk3tvuxn6pyosa2we-adwhj77lcyoafdy-www-paypal-com.translate.goog
  hkuuezspltafbofq-dot-millinium.ey.r.appspot.com
  hkvdzqwbpqfesyyv-dot-millinium.ey.r.appspot.com
  hkwarppoepvxrirpotrzparhcpaprfnvukfi-dot-gl494903049.wl.r.appspot.com
@@ -89857,7 +90251,6 @@ hllcoglobal.com
  hllzygebaqjqkrlh-dot-millinium.ey.r.appspot.com
  hlmxasdhcd.duckdns.org
  hlmxiaohua.icu
-hlnnrbjdtizsbcgjsrpthadrrp-dot-gle39404049.rj.r.appspot.com
  hlnv49za.firebaseapp.com
  hlp01pgercvrsrvce01.my.id
  hlpbxgocnkklfhhp-dot-millinium.ey.r.appspot.com
@@ -89895,7 +90288,6 @@ hm-fill.com
  hm-gov-uk.com
  hm-onlineservices.com
  hm-returnmymoney.com
-hm-revenue-costums.ciclosew.com
  hm-revenue-gov-secure-details.com
  hm-revenue-secure-login-claim-refund.gov-info.services
  hm-revenue-tax-form-secure.com
@@ -90155,7 +90547,6 @@ hmrc.gov.support-return.net
  hmrc.gov.support-uk.net
  hmrc.gov.uk-reclaim.com
  hmrc.gov.uk-tax-refund.lastinfoup.co.uk
-hmrc.gov.uk.mechcaddesign.com.au
  hmrc.govtaxclaim.com
  hmrc.govtaxingrefund.com
  hmrc.help-rebate.com
@@ -90312,7 +90703,6 @@ hmrlfwugkbbgveid-dot-millinium.ey.r.appspot.com
  hmrlogonlinr.link
  hmrtaxrebate-uk-info.com
  hmrtaxreturn-info.com
-hmsarnzjrtroorgybkxphrlyos-dot-gle39404049.rj.r.appspot.com
  hmsdanmark.dk
  hmsdg.cn
  hmsecure-refund.com
@@ -90392,6 +90782,7 @@ hnweize.com
  hnwlycg.com
  hnwnunet.nckifitness.gdn
  hnwsrcayylttdjwrofjcpdzqsp-dot-gleowayel400503.uc.r.appspot.com
+hnwzkbljyneqxpifvdqchzbser-dot-gle39404049.rj.r.appspot.com
  hnxhcdzgumytwwatgsstycpevgctisphqtvi-dot-solar-vertex-285913.rj.r.appspot.com
  hnxugytzqbzkgkla-dot-millinium.ey.r.appspot.com
  hnyapgehlp01recvrsrvce01.my.id
@@ -90400,7 +90791,6 @@ hnzbkuiemggkhiwnfjypaaexop-dot-gloff849483.uk.r.appspot.com
  hoagietesting10.com
  hoahong.info
  hoala-cs.com
-hoalgf.tk
  hoancauauto.com
  hoangan.top
  hoangdolce.000webhostapp.com
@@ -90581,6 +90971,7 @@ holliderast.info
  hollie250.000webhostapp.com
  holliemsouthern.com
  hollistershop.gr
+hollivision1.casa
  hollomanair.xyz
  hollowlazylocatorprogram.figueroaads123.repl.co
  hollowmarches.com
@@ -90655,6 +91046,10 @@ home-maid.org
  home-paypa1.com-1imited-solution.info
  home-pick.co.uk
  home-pkw-mobile.de
+home-post-die-sendungsstatus.company-bonuscard.com
+home-post-die-sendungsstatus.support-bonuscard.com
+home-post-die-sendungsstatus.tracking-diepost.com
+home-post-die-sendungsstatus.trackingdietpost.com
  home-realtor.ca
  home-ukgovweb.com
  home-updatebevestiging.com
@@ -90680,7 +91075,6 @@ home.unitedbkusa.com
  home.webadmin.syscoinc.org
  home098act001.my.id
  home0customer00alertshoersystemcpo42fwon.000webhostapp.com
-home258191.com
  home2btconnectcomasptl.firebaseapp.com
  homeaccountletteradminalertsdgdsgfs.000webhostapp.com
  homeallertswebsiteactivity3r8f.000webhostapp.com
@@ -90813,7 +91207,6 @@ homieshing.temp.swtest.ru
  homietv.com
  homigo.io
  homiletic-submarine.000webhostapp.com
-homlogkamijah.duckdns.org
  hommane.cloudns.asia
  hommebt.weebly.com
  homneeds.com
@@ -90830,6 +91223,7 @@ homotrone-71.ml
  homotypic-decimals.000webhostapp.com
  homoxide4948nsudsdf.gotdns.org
  homs.cf
+homs.cl
  homs.com.br
  homsindbf.tk
  homstore.pk
@@ -90872,6 +91266,7 @@ honorwave.com
  honpfucvywnkcctx-dot-millinium.ey.r.appspot.com
  hont.ml
  hontam.net
+honushearth.com
  hoo.gl
  hoobpromoticon.gq
  hoochie.ga
@@ -91016,7 +91411,6 @@ host-listing-77875.casa
  host-listing-82741.casa
  host-listing-89513.casa
  host-listing-89875.casa
-host-listing-94971.casa
  host-listing-98413.casa
  host-pub1.info
  host-und-updatedomain-b7986330.hotelportlagalere.com
@@ -91065,6 +91459,7 @@ hostically.info
  hostikoooo.duckdns.org
  hosting-search-services-web.com
  hosting-security.com
+hosting-statistic.com
  hosting.3utilities.com
  hosting.csebusiness.solutions
  hosting.drupwayinfotech.in
@@ -91084,7 +91479,6 @@ hostingcloud.racing
  hostingmatter.com
  hostingnetweb.com
  hostingpaneldmc.com
-hostingparacolombia.com
  hostingplugsnet.com
  hostingranloginsee.buzz
  hostingservicesloyal.com
@@ -91297,6 +91691,7 @@ hots.evenxfree.com
  hots.freeventing.com
  hots.videoxxporn.com
  hots18.com
+hotsevent-mlbb4949.gq
  hotsexylovedolls.com
  hotsgrup18.001www.com
  hotshots.best
@@ -91337,6 +91732,7 @@ houltonme.buzz
  houltonme.xyz
  houmaboujompe.com
  houmadpjoiser.com
+houmangallery.ir
  houpeerard.com
  hour.menu
  hourchildren.org
@@ -91388,7 +91784,6 @@ houseresale.duckdns.org
  houses-gulf.com
  houses-realtor.xyz
  housesittingreference.com
-housesxtrip.reisen
  housetutor.wasseela.com
  housewifes.co
  houshds.com
@@ -91627,6 +92022,7 @@ hrmicrc.com
  hrmiwc.com
  hrmkgtclyshhzcko-dot-millinium.ey.r.appspot.com
  hrmqoczx.goruli.com
+hrms.markettaging.com
  hrmtcrydqbwbwqnrevyuflcydy-dot-gleowayel400503.uc.r.appspot.com
  hrngfn.com
  hrnpmixy.handipants.com
@@ -91715,7 +92111,6 @@ hs-resprosecfto.com
  hs-secnotify.com
  hs-secprotifes.com
  hs-secure-payee-removal.com
-hs-secure-payment.com
  hs-secure-services.com
  hs-secure.net
  hs-secured.co.uk
@@ -91739,7 +92134,6 @@ hs-suspicious-activity.co.uk
  hs-tonotifprosec.com
  hs-transaction-support.com
  hs-uk-remove-payee.com
-hs-unathorisedpayment.com
  hs-verify-alertpayee.com
  hs-verify-me.net
  hs-verify-payments.com
@@ -91814,6 +92208,7 @@ hsbc.1i-b-en.cloud
  hsbc.access-restore.com
  hsbc.account-10reset.com
  hsbc.authenticate-payee.co.uk
+hsbc.authorise-prevent.com
  hsbc.authsupport.org
  hsbc.bc-confirm.ltd
  hsbc.billing-safedesk.com
@@ -91881,7 +92276,6 @@ hsbc.my-payee.co.uk
  hsbc.mypayee-cancel.com
  hsbc.mypayee-manage.co.uk
  hsbc.mysecurity-instruction.co.uk
-hsbc.new-dev-check.com
  hsbc.newpayee-request.co.uk
  hsbc.newpayee-request.com
  hsbc.newpayments-verify.com
@@ -91939,6 +92333,7 @@ hsbc.secure-authority.co.uk
  hsbc.secure-cancel.co.uk
  hsbc.secure-cancel.com
  hsbc.secure-id77.com
+hsbc.secure-new-attempt.com
  hsbc.secure-payee.co.uk
  hsbc.secure-ref153.com
  hsbc.secure-valid.com
@@ -92237,7 +92632,6 @@ httpseguritylogin.com
  httpsgmaii.000webhostapp.com
  httpsjoingrupbokep18.000webhostapp.com
  httpsloginorangefr.weblium.site
-httpsloginorangefr50.yolasite.com
  httpsmtp.ddns.net
  httpsoutlook-webapp-owa0rmicrith146ur.infoaxewa.repl.co
  httpssucursalpersonastransaccionesbancolombiacom.com
@@ -92297,6 +92691,7 @@ hubchannel.fr
  hubercutively.info
  hubinternational-sharepoint.ml
  hubjavane05.cf
+hubjavane05.ga
  hubjavane05.ml
  hubloot.ml
  hubloot.tk
@@ -92342,7 +92737,6 @@ hugeroll.ru
  hugesumlily.000webhostapp.com
  hughesnet.club
  huginyazarkasa.com
-hugncfsdzueqmirbtqcnsnslrb-dot-gle39404049.rj.r.appspot.com
  hugomartinez.lopedevega.es
  hugout.tk
  hugoversichert.de
@@ -92453,10 +92847,10 @@ hungtintong.co
  hunianrakyat.com
  hunin-one.web.app
  hunjunkred.ml
-hunkmoglen.com
  hunmao.net
  hunnybunnyschool.com
  hunopk.xyz
+huntaget.cn
  huntdogs.ge
  hunteralan.typeform.com
  hunterbase.xyz
@@ -92471,7 +92865,6 @@ huntingomar.com
  huntington.clothnfurnitures.com
  huntington.digital
  huntington.mypi.co
-huntington.net.au
  huntingtonalert.cf
  huntingtonbank.ns02.info
  huntingtonbankingservices.com
@@ -92509,7 +92902,6 @@ huschhus.ch
  husgozqtciqsevyk-dot-millinium.ey.r.appspot.com
  hushavefritid.dk
  hushkush.net
-hushmonte.com
  hushnsh.ddns.net
  husjklm.com
  huskedeggplantr.com
@@ -92555,7 +92947,6 @@ huyahoo.weebly.com
  huyazhibop.emilqunfa.xyz
  huycute2k.000webhostapp.com
  huydoandeptrainhe1213.tk
-huyeqphrpkstuztximdkdbcqzp-dot-gle39404049.rj.r.appspot.com
  huygwupwklwoomuh-dot-millinium.ey.r.appspot.com
  huyhoof.com
  huyndai3sthanhhoa.com
@@ -92614,7 +93005,6 @@ hvwaxkbgnykzecgh-dot-millinium.ey.r.appspot.com
  hvwenivurremuspweyuetfemhjpufwxckckd-dot-solar-vertex-285913.rj.r.appspot.com
  hvwyrylvhsrdolpy-dot-millinium.ey.r.appspot.com
  hvzkmehwglojsvjb-dot-millinium.ey.r.appspot.com
-hvzsusrfhrfnuaxljbzdrwgnki-dot-gl099898987fhkl.uk.r.appspot.com
  hw3leonardand.000webhostapp.com
  hw591.com
  hw60.ru
@@ -92644,6 +93034,7 @@ hwlgmercquydskcn-dot-millinium.ey.r.appspot.com
  hwltbkcaknjderbpsklu.com
  hwmtorw.goruli.com
  hwnjwfot.firebaseapp.com
+hwoodburnmed.com
  hwork.com.mx
  hwpqqxujqvfcojdnzjcoiwwnkjdvgnefvwue-dot-cryptic-now-290917.ey.r.appspot.com
  hwqkujxvgumyrtetqoffwxfupkesalijhezi-dot-offglen.uk.r.appspot.com
@@ -92682,7 +93073,6 @@ hxmlahmhflevdyjvipmdvwsmhj-dot-gloff849483.uk.r.appspot.com
  hxmmqadxwrodkzfuqqborpdbwr-dot-gleowayel400503.uc.r.appspot.com
  hxnaxygicfnypzttmguwiqyatcssyoxsnwpi-dot-glenxpecial3009493.ey.r.appspot.com
  hxnbanzmio.com
-hxnfmkgswxvwbamzgwjknmbhlo-dot-gle39404049.rj.r.appspot.com
  hxnnscapzqsbogsi-dot-millinium.ey.r.appspot.com
  hxnvjhcquvbazroiytkasbyneeazkpduuive-dot-gl494903049.wl.r.appspot.com
  hxoakshjskshkaskmxn.000webhostapp.com
@@ -92718,7 +93108,6 @@ hyaaquatic.com
  hyadegari.ir
  hyapdgbibysshgyp-dot-millinium.ey.r.appspot.com
  hyattforkwe.buzz
-hyberian.com
  hybernationstock.space
  hybfyzgsecrgckzqdefncnynxb-dot-glexcel9494434.uk.r.appspot.com
  hybnexvbpsoxacclbmpwctddjdplvxpvlavt-dot-solar-vertex-285913.rj.r.appspot.com
@@ -92812,6 +93201,7 @@ hyperioncapital.net
  hyperlan.xyz
  hyperpay.miniswap.com
  hyperravand.ir
+hyperurl.co
  hyperxinternational.com
  hyperxtop.com
  hypesthesiaiconoscope.club
@@ -92845,9 +93235,9 @@ hytzswe.ocobk.cn
  hyundai-item1077156079316599.site
  hyundaibinhduongoto.com
  hyundailamdong.com.vn
-hyundal-ce.com
  hyuqgfhfynrfqobd-dot-millinium.ey.r.appspot.com
  hyurtrae.work
+hyusioo.work
  hyusiyty.cam
  hyusoo.cam
  hyuueper.ml
@@ -92913,7 +93303,6 @@ i-arslan.de
  i-bazaar.net
  i-buyq-----login.ygber.com
  i-cloud-log-in.cf
-i-clouds.org
  i-cloudsupport.000webhostapp.com
  i-cs-opstuur-procedure.link
  i-ctectest.com
@@ -93010,6 +93399,7 @@ ia-patrimoine.com
  ia801005.us.archive.org
  ia801408.us.archive.org
  ia801503.us.archive.org
+ia801802.us.archive.org
  iaak12.org
  iabbtlhyyjlhmhdk-dot-millinium.ey.r.appspot.com
  iabeaydxcrcbkvte-dot-millinium.ey.r.appspot.com
@@ -93033,7 +93423,6 @@ iadevatandasportalda.com
  iadfgbank.xyz
  iadjnciasa.com
  iadpwe.dhhlch.club
-iaeaqrcydrnkpqbmhmdtrluoku-dot-gle39404049.rj.r.appspot.com
  iafflocal290.org
  iagixaolihjbyyce-dot-millinium.ey.r.appspot.com
  iahinmylmhgvfszbybmcinkrkr-dot-triple-upgrade-293822.rj.r.appspot.com
@@ -93095,7 +93484,6 @@ iasgoogle.com
  iat-ti.theworkpc.com
  iats.com.br
  iatu.ulstu.ru
-iatuhaedsmskaxbvptxymhrqob-dot-gle39404049.rj.r.appspot.com
  iaujdfyomiuaksan-dot-millinium.ey.r.appspot.com
  iausnqwa.com
  iauth-securepayee.com
@@ -93112,6 +93500,7 @@ ib.www.ldayl.com
  ib12-exclusive.myvnc.com
  ib12-internet.serveirc.com
  ib2-caixa.com
+ib2-security.com
  ib22-bradesco22.gotdns.ch
  ib2wacesso.com
  ib9.bradesco.com.ibpro.store
@@ -93157,7 +93546,6 @@ ibffzvwihqbsarqezyqeobnopg-dot-gleowayel400503.uc.r.appspot.com
  ibfreulrtxibuodnhxfhuqeoua-dot-gleowayel400503.uc.r.appspot.com
  ibgd.org
  ibglkncrcygpffjq-dot-millinium.ey.r.appspot.com
-ibgreenstdyfestivers.dns.army
  ibhucunltcockhtr-dot-millinium.ey.r.appspot.com
  ibibjpafytqhwjuw-dot-millinium.ey.r.appspot.com
  ibidfsquecou.buzz
@@ -93266,7 +93654,6 @@ ice-cold-guy.000webhostapp.com
  ice-cube-frosts.000webhostapp.com
  icecontrolsaltcom.baerseventerm.top
  icecorporation.org
-icecosenergyltd.com
  icecreamvanila.xyz
  iced-factory.com
  iced.blue
@@ -93793,7 +94180,6 @@ icxufvibzhhdyqgw-dot-millinium.ey.r.appspot.com
  icyte.com
  icywwlbqyssyyygnwvrnolhfzhkfnvvgmlzl-dot-solar-vertex-285913.rj.r.appspot.com
  iczttqhemxcbndbh-dot-millinium.ey.r.appspot.com
-iczvayilwnhafzsnxekvdymnmq-dot-gl099898987fhkl.uk.r.appspot.com
  id-03919864.suakids.com
  id-06375329.faizen.eu
  id-198808035.updatecheckinfo.com
@@ -93895,7 +94281,6 @@ id.ttz5.cn
  id.url.nszmz.com
  id.wobalawaigyeolgug.com
  id002839.com
-id003928.wpengine.com
  id023933955.xyz
  id0645050531052.000webhostapp.com
  id0720.icu
@@ -94018,6 +94403,7 @@ idealdriving.institute
  ideale-ds.eu
  ideale-sendai.com
  idealfxtrade.com
+idealhostel.com.np
  idealimpressos.com
  idealink.com.hk
  idealista012321pt-desbloquearaconta78444.xyz
@@ -94066,8 +94452,6 @@ identifiez-vous-avec-votre-compte.yolasite.com
  identifiez-vous-pour-continuezfr.yolasite.com
  identifiez-vous-pour-continuezfrk.yolasite.com
  identifiez-vous-pour-continuezfrt.yolasite.com
-identifiez-vous397.yolasite.com
-identifiez-vous400.yolasite.com
  identifiez-vous63.yolasite.com
  identifiez-vousavecvotrecompteorange12345.yolasite.com
  identifiez-voussurvotreadresse.yolasite.com
@@ -94096,6 +94480,7 @@ identity-society-secur-privacy-recovery.com
  identity-tescobank.onlinecoz.cloudns.asia
  identity-tescobanl-com.us-south.cf.appdomain.cloud
  identity.jp-verify-identity99101289.net
+identityalert-newpayees.com
  identitypages0420.my.id
  identitysecurelog.ddns.net
  ideosuofdnelcmja-dot-millinium.ey.r.appspot.com
@@ -94155,7 +94540,6 @@ idls-gps.com
  idltd.ru
  idmanageappsign20.servebeer.com
  idmarkets.com
-idme-docusignauthorizedadmin.weebly.com
  idmediatech.com
  idmessagerie.yolasite.com
  idmini.ddns.net
@@ -94298,7 +94682,6 @@ idstripe.com
  idsupport.secure.store.cristlizz.com
  idsupports-netflix.com
  idsupportweb.biz
-idtbgsdlumknvzncviozvgdcvc-dot-gle39404049.rj.r.appspot.com
  idtgyljtuniygeme-dot-millinium.ey.r.appspot.com
  idthomes.com
  idtilvqdocubxlrzmftdjqrkkaydiexguisc-dot-solar-vertex-285913.rj.r.appspot.com
@@ -94343,7 +94726,6 @@ iecorp.co
  iedizzcwuxcbhfua-dot-millinium.ey.r.appspot.com
  ieeawoqoiuhd.top
  ieeccoshocs.com
-ieecenhuovqsikthkxzmechvkt-dot-gl099898987fhkl.uk.r.appspot.com
  ieedqgsalnwofwkt-dot-millinium.ey.r.appspot.com
  ieex.xyz
  ieexploreinternet.duckdns.org
@@ -94540,7 +94922,6 @@ ig-grow.000webhostapp.com
  ig-growth.000webhostapp.com
  ig-helpabouts.com
  ig-helpcenter-supportss.ml
-ig-helpmanager.ml
  ig-helpservice.com
  ig-helpsviolation.ml
  ig-helpteamcopyrights.com
@@ -94594,6 +94975,7 @@ igdemosecure.000webhostapp.com
  igdfbvtwxepbrknn-dot-millinium.ey.r.appspot.com
  igeczsxqnvzgjcekfaqmedigokxtejcztiqj-dot-cedar-code-289917.nn.r.appspot.com
  igeneattsbcglobalnetsecuremailer2.weebly.com
+igeq18tumr03njyxn.xyz
  igfap.com
  igfejjbnqktepxro-dot-millinium.ey.r.appspot.com
  igfmarket.com
@@ -94608,6 +94990,7 @@ iggrudmhmuvohajugpowybofbvhnwwgghwvg-dot-glegen303939423233.ue.r.appspot.com
  igh-aruba.com
  ighbawqjqwkzihtlrbiwjvdrdo-dot-triple-upgrade-293822.rj.r.appspot.com
  ighbawqjqwkzihtlrbiwjvdrdo.triple-upgrade-293822.rj.r.appspot.com
+ighelp-busines.com
  ighelp-form.com
  ighelp.center
  ighelperscenter.com
@@ -94657,11 +95040,11 @@ igonlinesupportservice.com
  igonnafuckyougood.com
  igorbarbosa.com
  igorpovolski.ddns.net
+igovafrica.com
  igp24info.shuiadrink.top
  igpatents.com
  igpfwrtmqozliihfyznengzazp-dot-gleowayel400503.uc.r.appspot.com
  igphotos.site
-igpthai.org
  igpxarpgrrddcihg-dot-millinium.ey.r.appspot.com
  igrawycekqwyrvxk-dot-millinium.ey.r.appspot.com
  igrconsultores.com.mx
@@ -94788,6 +95171,7 @@ iihycglewqzviqewoagzylfukqaqzgmsatkq-dot-cryptic-now-290917.ey.r.appspot.com
  iii-asiacarqo.com
  iiidentifiezvous.yolasite.com
  iiifreefollowers.000webhostapp.com
+iiiiipkmnnbvgv.facebook111.cf
  iiioiio.ru.com
  iiipercentidaho.org
  iiirxytvavfcqedo-dot-millinium.ey.r.appspot.com
@@ -94855,6 +95239,7 @@ ijnsozxjsycsggoxnsyjqtorgx-dot-gloff849483.uk.r.appspot.com
  ijobs.vn
  ijojjxnlciirhdvm-dot-millinium.ey.r.appspot.com
  ijqhngmgkohkmunf-dot-millinium.ey.r.appspot.com
+ijqwdjqa.tk
  ijriktbsg.rogagot.com
  ijsocwfdmnbtsvuh-dot-millinium.ey.r.appspot.com
  ijsykumztfimaqpn-dot-millinium.ey.r.appspot.com
@@ -95078,7 +95463,6 @@ imagejoyas.ml
  imagelinetech.com
  imagemanipulation.ca
  imagenesmentales.com
-imageoptimizer.org
  imagephoto-video.com
  images.discipulo21.org
  images.hearme.xyz
@@ -95096,7 +95480,6 @@ imaginescience.in
  imaginesuweb.com
  imaginetourist.com
  imagineyours.xyz
-imaglnausb.com
  imagnenitina.com
  imagodd.com
  imajbet881.com
@@ -95124,6 +95507,7 @@ imbizogroup.co.za
  imc-cr.us
  imcbroker.com
  imchm.com
+imcyqxoj.cc
  imd-inc.com
  imd2001.com
  imda.loqato.com
@@ -95134,6 +95518,7 @@ imeb.com.my
  imebooksgiveaway.com
  imectrica.com
  imedu.org
+imeetu.icu
  imeijf.com
  imellda.com
  imemxmrpgwtsjlii-dot-millinium.ey.r.appspot.com
@@ -95581,7 +95966,6 @@ incres1-actiu6.xyz
  incrivel-jjlhocorra.com
  incruises-clubedecruzeiros.com.br
  incservice100casb.ddnslive.com
-incservice11oiean.ddnslive.com
  incservice2iaed.ddnslive.com
  incservice2is.ddnslive.com
  incservice6iad.ddnslive.com
@@ -95657,7 +96041,6 @@ indianapoli.xyz
  indianapresbyterian.org
  indianatechwedu.ru
  indianblackhead.com
-indiancurrentaffair.top
  indiandosakadai.nl
  indianescortsabudhabi.com
  indianewsradio.in
@@ -95755,7 +96138,6 @@ industrialesud.com
  industrialonline.in.th
  industrialspares.to
  industriasasi.com.mx
-industriascarmont.com
  industriasrofo.com
  industriasyuli.com
  industrid3.nusch.id
@@ -96064,6 +96446,7 @@ infokhususfm.000webhostapp.com
  infokid.softwareelite.com
  infokscents.com
  infolockedunlock.serveirc.com
+infomad.ru
  infomagia.com.br
  infomailer.temp.swtest.ru
  infomailgoogle.com
@@ -96184,6 +96567,7 @@ inforpencom.shaxiapurpose.top
  inforsecuritypass.serveirc.com
  inforsir.com
  infortecdf.com.br
+infortronics.com.br
  infos-activation2020.site44.com
  infos-actualitefrance.webnode.sk
  infos-lockedmy.redmis2xiaomi.com
@@ -96320,7 +96704,6 @@ ing.my-homebank.site
  ing.nl.inloggen-mijning.klanteservicetoegang-nl.website
  ing.online-check.info
  ing.overheidfod.com
-ing.pl.proxy.c7s.io
  ing.pyctor.network
  ing.verlengtoegang-nl.website
  ingacceso.com
@@ -96339,7 +96722,6 @@ ingdavidguerrero.com.co
  ingdirect-acceso-es.com
  ingdirect-acceso.com
  ingdirectespagne.com
-ingegneriaingonlin.com
  ingegroup.cl
  ingelse.net
  ingeniamarcasypatentes.com
@@ -96349,7 +96731,6 @@ inghdab.com
  ingielay.com
  ingingintercep.xyz
  ingitafashion.com
-ingles-fbb.blogspot.com
  inglesesimovel.com.br
  inglobalmarkets.com
  inglobaltrade.com
@@ -96581,7 +96962,6 @@ inodeyplsafe.higlobal-safe.com
  inodpudayewauzhg-dot-millinium.ey.r.appspot.com
  inoltro-dati-web.com
  inomoto.vn
-inopnhgolgkepdrlfiproniapo-dot-gle39404049.rj.r.appspot.com
  inopportuneness.xyz
  inoutapps.com
  inovamaxx.com.br
@@ -96657,6 +97037,7 @@ inquiry.space
  inr.dermals.org
  inrajahmundry.co.in
  inrdxsgbhy.com
+inre19asjztw03tnnc.xyz
  inreconfrimpagesrecoverys.cf
  inrhxwnsfusbbwuo-dot-millinium.ey.r.appspot.com
  inrogoie37.com
@@ -96788,7 +97169,6 @@ instaagrram.com
  instaalfa.000webhostapp.com
  instaalpha2020.000webhostapp.com
  instaaprofil.0fees.us
-instaautoo.com.br
  instaberg.com
  instabilorg.shaxiaauthority.top
  instablauwevink.com
@@ -96856,6 +97236,7 @@ instagram-badges.verifikasicenter.ml
  instagram-blue-badge-verification-service.ml
  instagram-blue-teak-confirm.com
  instagram-bluebadge-verification.tk
+instagram-bussines-center.ga
  instagram-center-support-com.ml
  instagram-check.servehttp.com
  instagram-cloud.ikook.ir
@@ -97052,8 +97433,10 @@ instagram-web.de
  instagram-webapp.de
  instagram-webclient.de
  instagram-websupport.com
+instagram-wep-app.web.app
  instagram-whatsapp-contact.ml
  instagram-whatshapp-business.cf
+instagram.4freenow.cf
  instagram.abpnews.xyz
  instagram.adobeprime.com
  instagram.alfadanal.com
@@ -97124,7 +97507,6 @@ instagram.mobile-loginpage.com
  instagram.muzegrafi.com
  instagram.myftp.org
  instagram.new24.ga
-instagram.nofipay.net
  instagram.npayout.com
  instagram.oauth.repl.co
  instagram.officials.email.mulyatitety.my.id
@@ -97313,7 +97695,6 @@ instagramhelpincentral.com
  instagramhelpingservice.com
  instagramhelpingsupport.com
  instagramhelpingteam.tk
-instagramhelpline.net
  instagramhelpnotice.com
  instagramhelppro.com
  instagramhelpq.0fees.us
@@ -97343,7 +97724,6 @@ instagramlivesupportteam.ml
  instagramlogin.0fees.us
  instagramlogin.us
  instagramloginpage.xyz
-instagramloginphotopost.herokuapp.com
  instagramlogins.netlify.app
  instagramlogn332.0fees.us
  instagramlookup.tk
@@ -97575,7 +97955,6 @@ instapaneliniz1.0fees.us
  instapiccollage.000webhostapp.com
  instapicturelog.000webhostapp.com
  instapisin.000webhostapp.com
-instapressnohesca.000webhostapp.com
  instaprofilebakan.000webhostapp.com
  instaproplus.000webhostapp.com
  instaprotect123.000webhostapp.com
@@ -97619,6 +97998,7 @@ instaverification.com
  instaverifyorg.0fees.us
  instaverivy.000webhostapp.com
  instavideowebcam.000webhostapp.com
+instaweargift.com
  instawebgirr.com
  instawords.000webhostapp.com
  instazztmvk.000webhostapp.com
@@ -97748,7 +98128,6 @@ intelligainscom.chifanaudit.top
  intelligence-art.com
  intelligence.com.sg
  intelligent-biz.info
-intelligentia.be
  intelligential-mass.000webhostapp.com
  intelsearch.com
  intelservecovid.com
@@ -97776,6 +98155,7 @@ interac-etransfer.net
  interac-prestationqc.ca
  interac-urgenceqc.ca
  interac.alamocitycleaning.com
+interac.arandanoseldinde.com
  interac.ca.cetakstruk-ppob.com
  interac.ca.myaccountsecure.manjumakhana.com
  interac.caqc0.com
@@ -97852,7 +98232,6 @@ interia-poczta.email
  interibericos.com
  interimmanagement.uk.com
  interinter.online
-interior1.club
  interior8282.com
  interiordesignersmumbai.in
  interiordesignindia.co.in
@@ -97988,7 +98367,6 @@ internetnc2programasemprepresente.com
  internetnc3.com
  internetnc4.com
  internetodds.co.cc
-internetonline-banking-secure-info.com
  internetorange-messageriefixe.web.app
  internetpf2.app.servicosfinance.ml
  internetservicetech.com
@@ -98358,7 +98736,6 @@ inyantra.com
  inyjrfrulwvyuxne-dot-millinium.ey.r.appspot.com
  inyourspacefitness.net
  inz2z.info
-inzpthnpgouwpkhdrsmaehizqz-dot-gle39404049.rj.r.appspot.com
  io-capital.net
  io.honglamcourt.house.hk
  io7617121.gq
@@ -98381,7 +98758,6 @@ ioeojpsbkqndpfypvgofvwsmyb-dot-triple-upgrade-293822.rj.r.appspot.com
  ioesewio.com
  ioesnes.com
  ioez.xyz
-ioffkbbdbsvrvcrtayzejawvfu-dot-gle39404049.rj.r.appspot.com
  ioflndriztxvolth-dot-millinium.ey.r.appspot.com
  iogaki.com
  iogivfpezcwxvwfasmcnbnnfjrrjsbxpjjpd-dot-solar-vertex-285913.rj.r.appspot.com
@@ -98583,6 +98959,7 @@ iproceed-verify.com
  iprogressivemed.ru
  iproinfotech.com
  iprointeractive.ca
+ips-support.info
  ipserversix.com
  ipsolutions.cc
  ipstagram.000webhostapp.com
@@ -98614,7 +98991,6 @@ iqekkknxpuaivqlurucdpqufuyqahsjvkrvv-dot-offglen.uk.r.appspot.com
  iqeuaoixbwummctk-dot-millinium.ey.r.appspot.com
  iqevmopfhr.duckdns.org
  iqfilms.com
-iqgtovjiamufwgokltvqukyemi-dot-glmar9393293232323.uk.r.appspot.com
  iqhjmhofforzdthu-dot-millinium.ey.r.appspot.com
  iqhnwerpfzpwmasb-dot-millinium.ey.r.appspot.com
  iqhomeyapi.com
@@ -98914,7 +99290,6 @@ isecure-irequest-cancel.com
  isecure-paypalus.serveirc.com
  isecure-request.com
  isecure-verify.com
-iseema.avitadt.com
  iseethesky.top
  iseler.net
  iseltd.ru
@@ -99038,7 +99413,6 @@ issue40.xyz
  issue50.xyz
  issue60.xyz
  issue70.xyz
-issuefb-zo9nh23gcmp.iayspph.org
  issuefixed.co.in
  issuelessundrafted.com
  issuelessundraftedato0102.com
@@ -99079,6 +99453,7 @@ isuzu-mientrung.com
  isviralgram.com.ng
  isxagpdjuv.duckdns.org
  isyou.nsky.jp
+isysny.fi
  isystemupdates.info
  iszafwzyzgcshpljxzlccnodpdpigijqodko-dot-off94032393204.uk.r.appspot.com
  iszqxaqgwbocsjzgvomvvcdivnioyflvznav-dot-glegen303939423233.ue.r.appspot.com
@@ -99403,7 +99778,6 @@ item-94365432.com
  item-982714.com
  item-cl-20938.com
  item-fb-15258782.com
-item-gratis-bvk.ml
  item-id09029022-fb.com
  item-id7389201-promotion-product.com
  item-marketplace-125145584.com
@@ -99456,7 +99830,6 @@ item.facebook.54724351o54724oo52368o3.press
  item.fb-4725product.xyz
  item1002934882.com
  item2848212.buybookscheaper.com
-item289839-marketplace.com
  item3.shop
  item3228264972342.itm8273.icu
  item38020.com
@@ -99554,7 +99927,6 @@ itiregistercadbonus.gq
  itisrighi.fg.it
  itisverygoodqq.com
  itjoho.work
-itkrduskavqysizkizuahecmau-dot-gle39404049.rj.r.appspot.com
  itleadz.com
  itlogica.ru
  itltnzid.com
@@ -99616,7 +99988,6 @@ itsididti.ga
  itsiegertcom.shaxiaoh.top
  itsindev.pro
  itsl.com.bd
-itsmestewe.com
  itsmetees.com
  itsmyfirst.000webhostapp.com
  itsnewone.000webhostapp.com
@@ -99697,6 +100068,7 @@ itzonex.com
  itzpxcojerqvcczggcibqzlwffqisumqsowj-dot-cryptic-now-290917.ey.r.appspot.com
  iuapple.top
  iucejpsjklkxorqpudxuuwcjvn-dot-gleowayel400503.uc.r.appspot.com
+iucrklhzljbbgblqxfntbantlq-dot-gle39404049.rj.r.appspot.com
  iudcqjbekcrbudpl-dot-millinium.ey.r.appspot.com
  iudemangessucure.bounceme.net
  iudk.rogagot.com
@@ -99776,8 +100148,6 @@ ivixtbrttpcgrhbwzzgwuwbwza-dot-gloff00403993445.uk.r.appspot.com
  ivkiqcamxusjzpkq-dot-millinium.ey.r.appspot.com
  ivluizyhoqdquayw-dot-millinium.ey.r.appspot.com
  ivmksxdvokbtlpfg-dot-millinium.ey.r.appspot.com
-ivnlmwaqidryiznxwfbxrwieqf-dot-gle39404049.rj.r.appspot.com
-ivnsfamnyollwiyqdufobgfehq-dot-glmar9393293232323.uk.r.appspot.com
  ivobfuqhsqgsarjy-dot-millinium.ey.r.appspot.com
  ivobktgdnsclqitdxgjqxvcetylsyyzwbque-dot-cryptic-now-290917.ey.r.appspot.com
  ivobrandao.com
@@ -99850,7 +100220,6 @@ iwncjkfhjka.weebly.com
  iwomjuypyjmylydj-dot-millinium.ey.r.appspot.com
  iworknab.com
  iworms.pl
-iwpaepjkbbjfgowcustdicikdr-dot-gle39404049.rj.r.appspot.com
  iwpiddpkvktkdaun-dot-millinium.ey.r.appspot.com
  iwqjy.cn
  iwqwsi.tanglescanner.com
@@ -100305,7 +100674,7 @@ janberger.ch
  janbklein.com
  janda-duda.freepubg.org
  jandaanakdua.kozow.com
-jandacolmek-stw7.freetcp.com
+jandabokep-colmek2.mydad.info
  jandahobicolmek.zzux.com
  jandamuda.wa-18.com
  jandamudapujaan.com
@@ -100390,6 +100759,7 @@ japanmade.com
  japanpartsltd.com
  japanpsat.com
  japanpsot.com
+japanregseat.biz
  japansecure.online
  japansmithoutlet.com
  japantbk.com
@@ -100435,6 +100805,7 @@ jascondienterprisesltd.com
  jaserie-cajamares.com
  jaservicioscontables.casteviajes.com
  jasilte.com
+jasirifund.org
  jasitatu.com
  jasminbet.me
  jasminblanche.com
@@ -100457,7 +100828,6 @@ jasonfunds.net
  jasonfundz88.com
  jasonherring.com
  jasonsteffen.com
-jasper-power-melon.glitch.me
  jasperwaterworks.com
  jassyjash-fbgrouppost.000webhostapp.com
  jastelectric.com
@@ -100532,7 +100902,6 @@ jayhobyksftzdmqv-dot-millinium.ey.r.appspot.com
  jayjgarciamd.com
  jayjwezfutvsdsog-dot-millinium.ey.r.appspot.com
  jaykhodiyarengg.com
-jaylaatikforsaakhiralataaichcharon.blogspot.com
  jaymeetanasiuk.com
  jaymesplace.com
  jayogroup.com.cn
@@ -100593,7 +100962,6 @@ jbfrryrbambhqgsw-dot-millinium.ey.r.appspot.com
  jbfzuckmdacfgyop-dot-millinium.ey.r.appspot.com
  jbgjerrxbbzjbdvl-dot-millinium.ey.r.appspot.com
  jbgmus.com
-jbgroup.com.py
  jbgxp.jaysbrand.com
  jbhnet.net
  jbhqkd.ph
@@ -100616,6 +100984,7 @@ jbnortonandco.com
  jbnw.onderhost.com
  jbqs.awaykart.com
  jbqzpqkvullvkeqg-dot-millinium.ey.r.appspot.com
+jbrbro7.xyz
  jbrealestategroups.com
  jbsk.com.pe
  jbslafdxsapimurerjihtlqsqksgyogifgqf-dot-cedar-code-289917.nn.r.appspot.com
@@ -100642,14 +101011,12 @@ jcagro835.com
  jcaiekb.shoesmogul.com
  jcair.com.cn
  jcalgxiinvshmqabjiklourwvdtvwyhgvxei-dot-solar-vertex-285913.rj.r.appspot.com
-jcapi.chimpgroup.com
  jcarmoeventos.com.br
  jcarxkkdhjffccrvgztn.top
  jcautosalesmedford.com
  jcauyojuiwtphpeu-dot-millinium.ey.r.appspot.com
  jcb-co-jp.monster
  jcb-co.vip
-jcb-jp.cc
  jcb-safty-center.ttacp8.com
  jcb.best
  jcb.co.jp.6das45k7d8.xyz
@@ -100707,7 +101074,6 @@ jcwomens.com
  jcwyqyakgtjtvpqtquxxqvpxryyhapswhvdb-dot-gl494903049.wl.r.appspot.com
  jcx86.dilshantg.com
  jcxdlfy.com
-jcxlxcxqdhpxehtrwbnehlpneu-dot-glmar9393293232323.uk.r.appspot.com
  jcyeelufwvkhfgijjhjzbhpaqffbluygielt-dot-gl494903049.wl.r.appspot.com
  jcyvfbrtqbovxhrd-dot-millinium.ey.r.appspot.com
  jd-studio.net
@@ -100743,7 +101109,6 @@ jdl639mvtnua.talagaremix.com
  jdlkqaxxnz.duckdns.org
  jdnwnsdhejuuxcdj-dot-millinium.ey.r.appspot.com
  jdoucettermt.ca
-jdpiisjtfcsbtyvpwwgnpmxdqd-dot-gle39404049.rj.r.appspot.com
  jdpmuyxe.goruli.com
  jdpwwyifikkgwlmzqxgtjukxztyjnbekusdm-dot-glenxpecial3009493.ey.r.appspot.com
  jdqllajjufqpqendvugkipwgtr-dot-gleowayel400503.uc.r.appspot.com
@@ -100840,6 +101205,7 @@ jehnydomy.topkorder.su
  jehuzwgsctitzrrr-dot-millinium.ey.r.appspot.com
  jejach.net
  jejakdesa.com
+jejendjcjfhh.com
  jejeopen2000.dyndns.tv
  jejetrans.com
  jejkuvtsvfmxnivdevamwgtqas-dot-gleowayel400503.uc.r.appspot.com
@@ -100910,6 +101276,7 @@ jepit.000webhostapp.com
  jepmllc.rogagot.com
  jepri-link.org
  jepyonixcsgrrekb-dot-millinium.ey.r.appspot.com
+jeqnq18vdhkmb03bzva.xyz
  jeqveyxpggnevics-dot-millinium.ey.r.appspot.com
  jeqyxqhzdrcjruxo-dot-millinium.ey.r.appspot.com
  jeremiahmcurbeaux.com
@@ -101035,7 +101402,6 @@ jezjncpzseyetggqvbegaxzcfvjnpzzyxxax-dot-glxcel49934343434.rj.r.appspot.com
  jezobdoiilqjvnhl-dot-millinium.ey.r.appspot.com
  jf.jjconcreteseattle.com
  jfabdetnaasiiryg-dot-millinium.ey.r.appspot.com
-jfalybrnjqsqlvrmfcxjwmazge-dot-gle39404049.rj.r.appspot.com
  jfapp.zhenxinguoji.com
  jfastore.com
  jfawyfxtzujotghu-dot-millinium.ey.r.appspot.com
@@ -101068,7 +101434,6 @@ jfteabd.com
  jftwtlobisqwguyrgkkpaxrymn-dot-gloff849483.uk.r.appspot.com
  jfvbiizoznzbpgxv-dot-millinium.ey.r.appspot.com
  jfwshtvtljuxxwoynwsqemfausuubsogpgvd-dot-glegen303939423233.ue.r.appspot.com
-jfwukbdrmbogyezzvcomyoqjcx-dot-gle39404049.rj.r.appspot.com
  jfxabck.bar
  jg-trading.com
  jg.jdal.cloudns.asia
@@ -101145,7 +101510,6 @@ jhcyqopvdjgniqfs-dot-millinium.ey.r.appspot.com
  jhdvgappqyghpuvkvucmxfajyvrwzvadcvyj-dot-solar-vertex-285913.rj.r.appspot.com
  jhebley.com
  jhfdjh5.com
-jhfehwmdkakgdrrujxxzcwkzqt-dot-gle39404049.rj.r.appspot.com
  jhfhshptbojqbxtw-dot-millinium.ey.r.appspot.com
  jhfilolxoplbhlexbbquwxgfvtmmetlmxmcq-dot-cedar-code-289917.nn.r.appspot.com
  jhfinancialpartners.com.au
@@ -101259,6 +101623,7 @@ jidan666.cn
  jidindia.com
  jiedianvip.com
  jiedu89.com
+jieeins8.cf
  jiehost.com
  jiehun.cn
  jiehun.party
@@ -101277,7 +101642,6 @@ jihezu.com
  jihsoknnbvncafcryejvleboco-dot-gloff849483.uk.r.appspot.com
  jiihvoh.senandungmerana.info
  jijidncxfpivxvch-dot-millinium.ey.r.appspot.com
-jijillee.online
  jijimn.com
  jijineptunium.com
  jikiloltwqygsnll-dot-millinium.ey.r.appspot.com
@@ -101339,6 +101703,7 @@ jinruifeng.xyz
  jinshengguojiyulecheng.tavmo.com
  jintan.06rl.com
  jinterweb.com
+jintong.info
  jinyande.xyz
  jinyatri.com
  jinyuan2013.zapto.org
@@ -101431,6 +101796,7 @@ jjcardsandgifts.com
  jjd22.com
  jjdjkjd12.com
  jjdng.xyz
+jjdrvzj.bar
  jjfdfctcmzpgbxsa-dot-millinium.ey.r.appspot.com
  jjffjkkooe.com
  jjgivewaysteam.ml
@@ -101469,7 +101835,6 @@ jjrinigudjhlrfjzzfgmmfayph-dot-gleowayel400503.uc.r.appspot.com
  jjrunthlqxpskwxqnwukgmdxnboyybhaqfkv-dot-cryptic-now-290917.ey.r.appspot.com
  jjscdc.cn
  jjsdjdfjdfjdjdd.weebly.com
-jjskydfalsjugcplftgzqqgngj-dot-gle39404049.rj.r.appspot.com
  jjsuusnnow.000webhostapp.com
  jjsvinhealnoxebp-dot-millinium.ey.r.appspot.com
  jjtsrgmbmdlrqwbs-dot-millinium.ey.r.appspot.com
@@ -101510,7 +101875,6 @@ jkibxyzqmpknzjmo-dot-millinium.ey.r.appspot.com
  jkjjd.myfirewall.org
  jkjryimzqoquhlbjqypxzbhepjjxafgcqlvb-dot-cryptic-now-290917.ey.r.appspot.com
  jkkhvv.weebly.com
-jkkjbj-vhhj-bgjjjk.s3-eu-west-1.amazonaws.com
  jkkjl1422jmgjhgf4nm.com
  jkkn.ac.in
  jkknife.fun
@@ -101598,7 +101962,6 @@ jmb.shoesmogul.com
  jmbjhrvulpqcwtymylouzzcwznwvqqqwxkzd-dot-gl494903049.wl.r.appspot.com
  jmbmqyxemnxxeihk-dot-millinium.ey.r.appspot.com
  jmboyue.com
-jmbvwjobprxlwrwxzcyuuxjhrf-dot-gle39404049.rj.r.appspot.com
  jmcdermo.com
  jmcnoack.cl
  jmd-be.com
@@ -101904,6 +102267,7 @@ johnstonlocaloption.com
  johnstranovsky.com
  johnsulston-edu.uk
  johntillerygolf.com
+johntoursperu.com.pe
  johr.page.link
  joicemiller.com
  joigrupbokep2020asiansex.000webhostapp.com
@@ -101970,7 +102334,6 @@ join-group--18plus.000webhostapp.com
  join-group-18456.000webhostapp.com
  join-group-18plus-2020.000webhostapp.com
  join-group-5587.000webhostapp.com
-join-group-ambiyahhh.ga
  join-group-bkpwhattapps18.000webhostapp.com
  join-group-bokep-18-ke-atas.000webhostapp.com
  join-group-bokep-2020-makincrott.000webhostapp.com
@@ -101998,6 +102361,7 @@ join-group-whatsap-videobokep-sex.2waky.com
  join-group-whatsap-videobokep-sexx.2waky.com
  join-group-whatsap-viral.2waky.com
  join-group-whatsap-xxx.2waky.com
+join-group-whatsapp-terbaru1.duckdns.org
  join-group-whatsapp-virall-2020.vipxz7.com
  join-group-whatsapp.org
  join-group-whatsapp9.myftp.info
@@ -102019,6 +102383,7 @@ join-groupbokeps-autocrots-kuyyy.000webhostapp.com
  join-groupmabar.25u.com
  join-groupp.whattsap.net
  join-groups-whatsapp.join-new87.tk
+join-groupviral.prem-net8.ml
  join-groupwhataptxx.xxuz.com
  join-groupwhatsaapsbudi01gamingiw.ga
  join-groupwhatsap3cc.itsaol.com
@@ -102048,7 +102413,6 @@ join-grub-bokep.ml
  join-grub-bokepindo-2020.000webhostapp.com
  join-grub-bokeppers-00.gq
  join-grub-bokepv12.000webhostapp.com
-join-grub-dewasa99.duckdns.org
  join-grub-mabar-freefire-terbaru.000webhostapp.com
  join-grub-wa-budi01-gaming.ga
  join-grub-wa-free-sv.000webhostapp.com
@@ -102076,7 +102440,6 @@ join-grubohoh.000webhostapp.com
  join-grubwa2020.my.id
  join-grubwabokeptantenya.hotzx9.com
  join-grubwanlpajdlajsap.claimfree.net
-join-grubwhatsappny.duckdns.org
  join-grubytberbudi01gaming.hotzx9.com
  join-gruo-sange-yok.000webhostapp.com
  join-grup-18-sex-crot.000webhostapp.com
@@ -102140,7 +102503,9 @@ join-grup-whatsaphot12.ss-zz5.gq
  join-grup-whatsapp18.qhigh.com
  join-grup-whatsapp2.holl-vips.com
  join-grup-whatsapp2020.sexidude.com
+join-grup-whatsappseleb2021.cf
  join-grup-wjatsapp-terbaru-10-juni-2020.000webhostapp.com
+join-grup-youtuber887.gq
  join-grup.new9.my.id
  join-grup.wa-18.com
  join-grup.wa-sex.com
@@ -102170,6 +102535,7 @@ join-grupwatshapp.000webhostapp.com
  join-grupwayoutuber2020.tk
  join-grupwhatsaapp18.000webhostapp.com
  join-grupwhatsapp-bokep-terbaru2020.xnxxx.my.id
+join-grupwhatsapp.eventtt.cf
  join-grupwhatsapp.my03.com
  join-grupwhatsapp18.tk
  join-grupwhatsappbkpnew2020.vidio-hotme17.cf
@@ -102295,7 +102661,6 @@ join-whatsapput5cc.xxuz.com
  join-whatsapputay.xxuz.com
  join-whatsappuye.xxuz.com
  join-whatsappx3f.jetos.com
-join-whatsappxx.get-line24.gq
  join-whattsapp19.gbwabokep.tk
  join-whtsappgrupebkp18.hitsss76.ga
  join-youtuber.jhte.my.id
@@ -102438,6 +102803,7 @@ joingroupbokepwhatsapp2020mantap.w4tsup.ml
  joingroupbudi.otzo.com
  joingroupchatwhatsapp.wa-bokep18.gq
  joingroupcroots.movie20.net
+joingroupdewasawhatsapp.zyns.com
  joingrouphot18.group-hot.com
  joingroupjoinnewwa189.reall5.tk
  joingroupp-bkpwhattapps18.pytf.gq
@@ -102461,6 +102827,7 @@ joingroupwhatsaapsexx.sexidude.com
  joingroupwhatsap.gabung-grup20.tk
  joingroupwhatsap8762.000webhostapp.com
  joingroupwhatsapp-new.mrbasic.com
+joingroupwhatsapp.duckdns.org
  joingroupwhatsapp.freejoin78.tk
  joingroupwhatsapp.movie20.net
  joingroupwhatsapp.new55.ml
@@ -102474,6 +102841,7 @@ joingroupwhatsappbkp18.verification-web.tk
  joingroupwhatsappbkp21.dns05.com
  joingroupwhatsappbokepterbaru2020.gamees.my.id
  joingroupwhatsappbokepterbott2020.getz-claim06.my.id
+joingroupwhatsappjapanese.zyns.com
  joingroupx.jkub.com
  joingroupxsex.25u.com
  joingrouwhatsapp.vvipz5.ml
@@ -102523,6 +102891,7 @@ joingrubdewasanobocilandbicah.000webhostapp.com
  joingrubenaena.000webhostapp.com
  joingrubkokeb-hot.000webhostapp.com
  joingrubngentoteoe.vip5x.com
+joingrubnot-not.duckdns.org
  joingrubnotnot23.duckdns.org
  joingrubokep.dumb4.my.id
  joingrubshot.hol21.design
@@ -102561,8 +102930,6 @@ joingrup-budi01.wa-21.com
  joingrup-crott.ooguy.com
  joingrup-dewasa.ooguy.com
  joingrup-gow1.ga
-joingrup-kulgar.duckdns.org
-joingrup-puppy.eventz78223.tk
  joingrup-whatsapp-newjoin.vvip-79.gq
  joingrup-whatsapp.holl-viip9.me
  joingrup-whatsapp18.join-now99.tk
@@ -102574,7 +102941,6 @@ joingrup.b88kp.event63.cf
  joingrup.ddnsfree.com
  joingrup.facebook-good.ga
  joingrup.freefire-gratisitem2021.gq
-joingrup.gifoo--yeh73.cf
  joingrup.hot-grup421.ml
  joingrup.sexidude.com
  joingrup.wa-sex.com
@@ -102718,6 +103084,7 @@ joingrupmabarsamabangbudi01geming.000webhostapp.com
  joingrupmantapmantappokoknya.000webhostapp.com
  joingrupmemberwa.dumb1.com
  joingrupmemek.grup-invite18.ml
+joingrupnikoyahbngek.eventtnewgarena17.cf
  joingrupnobarbokepbersama.000webhostapp.com
  joingrupnokep2k2018.000webhostapp.com
  joingruppbokepp18.000webhostapp.com
@@ -102731,8 +103098,6 @@ joingrupsex.mrbasic.com
  joingrupsex.wa-bokep71.ml
  joingrupsexhot.bokepinfo.org
  joingrupsharewamember.cf
-joingruptante.ga
-joingrupterbaruuwhatsap.grupwahot1667.ml
  joingrupuslukuslukmantaptenan.000webhostapp.com
  joingrupvidhot.zzux.com
  joingrupviral2020.mild-78.tk
@@ -102893,6 +103258,7 @@ joinn-grupsex.v-25.com
  joinn-wasexxcrot.hol8.me
  joinned-whatsapp.dns05.com
  joinnew-grup18bokepsexnew.wa-18.com
+joinnew-whatsapp.duckdns.org
  joinnewappgrup.viral20.net
  joinnewchat.whatsappsexx.gq
  joinnewgroups.otzo.com
@@ -103194,13 +103560,11 @@ joshjohnsonrealty.com
  joshtobye.com
  joshton.ddns.net
  joshuaccarroll.com
-joshuaggarner.ga
  joshuagonzalezmd.com
  joshuaiio.com
  joshuajablon.com
  joshuakayefoundation.org
  joshualroberts.com
-joshuargarner.ga
  joshuateres.com
  joshuavonderhaar.com
  joshworld.top
@@ -103275,7 +103639,6 @@ joyed-bin.com
  joyeggplante.com
  joyeriainternacional.com.ve
  joyeriaorindia.com
-joyeriasdefranco.com
  joyfullmove.xyz
  joyfullycracks.com
  joyfullyme.org
@@ -103776,7 +104139,6 @@ jqwzhsbhpjsrbbajmz.top
  jqxawfavcb.duckdns.org
  jqxgyfzenhhkyeve-dot-millinium.ey.r.appspot.com
  jqxuhwpnbe.kaonrybtgm.top
-jqyenafeadrrjmgikrnxnpjfuc-dot-gle39404049.rj.r.appspot.com
  jqyg7.com
  jqzfzyxdjuafacvcu.top
  jqzidabuyxddcnfsrenkezblyjhogredgqpr-dot-cryptic-now-290917.ey.r.appspot.com
@@ -103878,7 +104240,6 @@ jscrp.jp
  jsd618.com
  jsdachang.com
  jsdasywdys.co.vu
-jsdbagowxulrjotclqfpszqybe-dot-gle39404049.rj.r.appspot.com
  jsdfhjbdsjbsdds.moonfruit.com
  jsdhkjkl.weebly.com
  jsdhtxw.top
@@ -103898,6 +104259,7 @@ jshappening.com
  jshh9s9vs7sdfv.com
  jshjusjgs.ml
  jshjybqsoildelkdjyrnngihjt-dot-gleowayel400503.uc.r.appspot.com
+jshkdlkelkwld.fra1.digitaloceanspaces.com
  jsholdingbv.com
  jshpzd.com
  jshwe.y.uthe.ty3.iaczeg6124.ga
@@ -103924,7 +104286,6 @@ jspconsultants.co.uk
  jsplivenews.com
  jspspesstor.com
  jsq.m.dodo52.com
-jsqiujinofevlhxqcyfihersru-dot-gle39404049.rj.r.appspot.com
  jsr.org.cn
  jsrftyhertyayghfdhstrhyrtfdg.ewgjhsrfgjhjtr.top
  jsrhjweb.com
@@ -104025,7 +104386,6 @@ jubkecbwboakcjsx-dot-millinium.ey.r.appspot.com
  jubpszgvikzkoozlyrdhvwsnjm-dot-gleowayel400503.uc.r.appspot.com
  jucabas.000webhostapp.com
  juchetu.com
-juciana-market.com
  judaye.host
  judgertet.com
  judgestill.xyz
@@ -104051,7 +104411,6 @@ juegabien.com
  juegosaleo.com
  juegosdemesamodernos.com
  jueidsbd.com
-jueimssdnngahlnvuwcfalvuby-dot-gl099898987fhkl.uk.r.appspot.com
  juelsautoogcamp.dk
  juengert.de
  juercytatert.com
@@ -104137,10 +104496,10 @@ jumiliaintl.ml
  jumonaki.ml
  jump-amazon-co-sfc1q.buzz
  jumpas.clearpointsupplies.com
-jumpfestas.com
  jumpingjetz.net
  jumpmanualjacobhiller.com
  jumpniarena23sjda.us-south.cf.appdomain.cloud
+jumpnjamchicago.com
  jumpo2.com
  junakart.com
  junctionsapt.buzz
@@ -104291,7 +104650,6 @@ justinlist.org
  justinmurphyirishmusic.com
  justinmus1546.com
  justinnews.nu
-justinschlaefli.net
  justinscolary.com
  justinscott.com.au
  justinventive.co
@@ -104361,7 +104719,6 @@ jvlqwmutmhhlhups-dot-millinium.ey.r.appspot.com
  jvnhlhudivfksxcg-dot-millinium.ey.r.appspot.com
  jvpgxukrhcnutttfskjulmulnl-dot-gleowayel400503.uc.r.appspot.com
  jvphdmrfgeiutrow-dot-millinium.ey.r.appspot.com
-jvpkdmcjchenqgkhtkngwmxegh-dot-gl099898987fhkl.uk.r.appspot.com
  jvppfkeneoyskrck-dot-millinium.ey.r.appspot.com
  jvpub.org
  jvqdkhqymhuyqhdajrix.com
@@ -104389,7 +104746,6 @@ jwarrior319.ml
  jwawdwiyzwjbriqbmocoaubzgtzssrlllxez-dot-cedar-code-289917.nn.r.appspot.com
  jwbj.svcoding.com
  jwdell.me
-jwdvdlqajexgxabvekezlgxhsu-dot-gle39404049.rj.r.appspot.com
  jwdy.mentriqq.com
  jwebnetworks.com
  jwely.gikorip.net
@@ -104411,7 +104767,6 @@ jwohdrbwnbocwewg-dot-millinium.ey.r.appspot.com
  jwongs.com
  jwotzvytjuurmkojqxwlxhsxty-dot-gleowayel400503.uc.r.appspot.com
  jwqfppokuwazcrsy-dot-millinium.ey.r.appspot.com
-jwrmdctbhstpklcdvbfgznhkii-dot-gle39404049.rj.r.appspot.com
  jwsexvvyhmhkdsrfqoinwxaaigxocgqoqals-dot-spyexc3093493.ey.r.appspot.com
  jwuudlefqhieyrbr-dot-millinium.ey.r.appspot.com
  jwuurywkndpwsfppwjaupguokgbajjsjfdal-dot-cryptic-now-290917.ey.r.appspot.com
@@ -104453,7 +104808,6 @@ jxqiohetayrhhrap-dot-millinium.ey.r.appspot.com
  jxqkh.dogestocks.com
  jxrq8.jaysbrand.com
  jxrvveajvmelfzhw-dot-millinium.ey.r.appspot.com
-jxttvkkciklexbtaoscwzjkihn-dot-gle39404049.rj.r.appspot.com
  jxucpdnlsgspqvoz-dot-millinium.ey.r.appspot.com
  jxvjqacgxkelumcg-dot-millinium.ey.r.appspot.com
  jxwymm.com
@@ -104508,7 +104862,6 @@ jyugkzwlvljndkht-dot-millinium.ey.r.appspot.com
  jyunke.top
  jyurovzprbwypragfxtnfgnxzu-dot-gleowayel400503.uc.r.appspot.com
  jyv.fi
-jyvd.ml
  jywp.onderhost.com
  jyws.svcoding.com
  jyyqutdvguciwcnk-dot-millinium.ey.r.appspot.com
@@ -104597,6 +104950,7 @@ k1fxk.svcoding.com
  k1n3pxnd5e6x2h09a-df.com
  k1pze.awaykart.com
  k1ta.oujevais.com
+k1vzs1x1wpe63kh8z.xyz
  k1we.anahkedm.com
  k1zc.svcoding.com
  k20access.xyz
@@ -104610,6 +104964,7 @@ k2wte.awaykart.com
  k3-58966-com.preview-domain.com
  k3-m.jaysbrand.com
  k340.mentriqq.com
+k3grjkgrfjk.ga
  k3j.addroits.com
  k3jewelry.com
  k3lv4.weblium.site
@@ -104626,6 +104981,7 @@ k563.jaysbrand.com
  k58designs.com
  k5fxs.weblium.site
  k5n3c.onderhost.com
+k5yhekrfhkl.ga
  k5zde.onderhost.com
  k67oo32g76.info
  k6afg.weblium.site
@@ -104681,7 +105037,6 @@ kabelbaru-danpanassekalilagi.socomeoutside.com
  kabelfern1.moonfruit.com
  kabilya.bounceme.net
  kabiphotography.xyz
-kabirinstitute.com
  kabiru.ru
  kabookapp.com
  kabrandialharb.flywheelsites.com
@@ -104814,6 +105169,7 @@ kalamfaadhi.com
  kalamfoundation.org
  kalaminnovation.com
  kalandraka.pt
+kalarada.com
  kalaujujur.com
  kalawatihomes.com
  kalayekhabeyas.ir
@@ -104935,6 +105291,7 @@ kandzasi.su
  kanenfgttion.win
  kangaroosagan.com
  kangendealer.us
+kangenkonnection.com
  kangihaiyetupag.com
  kangkang.com.au
  kangnamroomsalong.creatorlink.net
@@ -104992,7 +105349,6 @@ kapreaq02.top
  kaprebi07.top
  kapreja09.top
  kapreks10.top
-kapreqm01.top
  kaprexr04.top
  kaprezw03.top
  kapsonsdryfruits.ooo
@@ -105000,7 +105356,6 @@ kapurthala.city
  kapztldvlxhfejil-dot-millinium.ey.r.appspot.com
  kaq0.jaysbrand.com
  kaq5.awaykart.com
-kara-door.com
  karaba-ko.net
  karabu.quebec
  karacaoglu.nl
@@ -105044,7 +105399,6 @@ karehcoy.my.id
  karemjdomizio.com
  karen2401202profile.online
  karen613profile.review-items-store.xyz
-karenalllk.com
  karenburton-profile-099482.com
  karenburton-profile-19572.online
  karenbuss.com.br
@@ -105204,6 +105558,8 @@ katherinerouboslcsw.com
  kathiacam.com
  kathing.000webhostapp.com
  kathleecdornellas.tk
+kathleenmxpeake.com
+kathrein-ae.xyz
  kathy453463.xyz
  kathyafarley.com
  kathyesimpson.com
@@ -105217,7 +105573,6 @@ katiliw.com
  katiuoshiletinen.xyz
  katja9.xxuz.com
  katjaundfelix.de
-katjrobertson.top
  katketytaanet.fi
  katleriokebai.smshostingas.lt
  katlynstreetpicke.xyz
@@ -105291,6 +105646,7 @@ kaylabdverif.com
  kaylerealms-group.com
  kayojhqkqdmdpulr-dot-millinium.ey.r.appspot.com
  kaysdinettes.com
+kayserikornisci.com
  kayserimobilyam.com
  kaz.shariki1.kz
  kaz.xtechspro.com
@@ -105447,7 +105803,6 @@ kdjf.guzaosf.com
  kdjredw.com
  kdkaamixjklkuvrq-dot-millinium.ey.r.appspot.com
  kdkpztzefdxqdyas-dot-millinium.ey.r.appspot.com
-kdlbxegfbxbblbumjtwefgnvgp-dot-gle39404049.rj.r.appspot.com
  kdmfacilityservices.com
  kdminesminerals.com
  kdmvhcnhjduvgrixonwjsnhuzw-dot-gloff849483.uk.r.appspot.com
@@ -105552,6 +105907,7 @@ keetuny.site
  keewmtzkkgcyvdpr-dot-millinium.ey.r.appspot.com
  kefalosrestaurant-lassi.com
  kefelharis.com
+kefex18bwhh03tjwgij.xyz
  kefflee.net
  kefqthngihwpmtlz-dot-millinium.ey.r.appspot.com
  kefybcxaduolgdxq-dot-millinium.ey.r.appspot.com
@@ -105886,7 +106242,6 @@ kfjyzoitkspprqct-dot-millinium.ey.r.appspot.com
  kfkfnqidkt.duckdns.org
  kfkokpjvbltbwezd-dot-millinium.ey.r.appspot.com
  kfmrn.addroits.com
-kfmtzjtfjwnqrrlhbdwqvlyogv-dot-gle39404049.rj.r.appspot.com
  kfn7.jaysbrand.com
  kfojgfdlg.000webhostapp.com
  kforzybemabac.ml
@@ -105894,7 +106249,6 @@ kfph.co.za
  kfqqzbplqkqbncwnhmjggxqrdvddylyuclie-dot-gl494903049.wl.r.appspot.com
  kfsxyw.com
  kft.sk
-kftbhedcwnfrixvstaozdizgjc-dot-gl099898987fhkl.uk.r.appspot.com
  kfthzaftfucdimod-dot-millinium.ey.r.appspot.com
  kftkn.com
  kftzewdwluntjvse-dot-millinium.ey.r.appspot.com
@@ -105925,7 +106279,6 @@ kgheamkujcvgzszmzg.top
  kghja-812.tk
  kghm.awaykart.com
  kgintarnational.com
-kgipjmghlubmjiodgxybyqeavj-dot-gle39404049.rj.r.appspot.com
  kgjfbjdns.com
  kgjffjbjdk.com
  kgljnzsdp.goruli.com
@@ -106165,6 +106518,7 @@ kiana-leather.com
  kianafrooz.com
  kiancar.lh.pl
  kiandoors.com
+kianranginco.com
  kiansazan.com
  kianyadak.com
  kiaopfg.org
@@ -106322,6 +106676,7 @@ kimorazcinfolap.com
  kimotokisen.com
  kimpatterson.net
  kimpot.ga
+kimraewon.cn
  kimsassen.com
  kimscon.com
  kimtaylormft.com
@@ -106338,17 +106693,18 @@ kind-meitner-91e0a2.netlify.com
  kind-spence-b0840b.netlify.app
  kindapal.com
  kinder-camp.com.ua
+kinderasia.com
  kindergreen.com
  kinderkochi.com
  kindermusikwithgosiacom.shaxiapotential.top
  kindersitze-vergleich.de
  kinderstubetomundjenny.com
  kindertagespflege-arcoiris.de
+kindheartedanchoredcgi.adasdfff.repl.co
  kindingme.sfo2.digitaloceanspaces.com
  kindled-buffer.000webhostapp.com
  kindleedxded.ru
  kindlyfrequenttransfer--five-nine.repl.co
-kindlyletkeepyuor-accountupgrade.weebly.com
  kindom.com.co
  kindral.ee
  kinduseerattcu.weebly.com
@@ -106550,7 +106906,6 @@ kitsunecomplements.com
  kittrellglass.com
  kittrezepecas.com
  kittyapi.live
-kituecqdxturzuoyoetfakerbe-dot-gle39404049.rj.r.appspot.com
  kitugec.com
  kitulonationalpark.com
  kitzeromp.com
@@ -106615,7 +106970,6 @@ kjiaalzwx.club
  kjilod.000webhostapp.com
  kjj23bdfb1edntr13qwfd.shop
  kjjjlneucnkzrhpjzmmkiyflhioxnkwsrwah-dot-glenxpecial3009493.ey.r.appspot.com
-kjkaarcxgfowtbuqftheclyumr-dot-gle39404049.rj.r.appspot.com
  kjkjjuuiiigght.weebly.com
  kjlbmpfdtjabckvkqpilsbeqapljbbcomvns-dot-cryptic-now-290917.ey.r.appspot.com
  kjmbwjxfejcjxbmcbem.top
@@ -106662,7 +107016,6 @@ kkentpmm.xyz
  kkentpp.xyz
  kkentppppp.xyz
  kkentppppppppp.xyz
-kkfbpakgmeeqefkcuaqgjgljby-dot-gle39404049.rj.r.appspot.com
  kkfcken.xyz
  kkfinances.com
  kkgzs.top
@@ -106700,7 +107053,6 @@ kkvmaj.com
  kkwmpuvnutepdoij-dot-millinium.ey.r.appspot.com
  kkwofokoqdzlwsvopsixmtmoomnffsoogmil-dot-cryptic-now-290917.ey.r.appspot.com
  kkx63.jaysbrand.com
-kkycdtzjxjjkieompnxmcfnsgl-dot-gle39404049.rj.r.appspot.com
  kkywhvhqdx.duckdns.org
  kkz.ej5.dalians.cn
  kl-df-d.com
@@ -106746,6 +107098,7 @@ klbay.net
  klbehuchhyhpekmi-dot-millinium.ey.r.appspot.com
  klczrmtbcu.duckdns.org
  kldfkdkfdkdf.com
+kldfvjd.godaddysites.com
  kldkjfdfjkddhf.com
  kleanjack.com
  kleanup.com
@@ -106895,13 +107248,11 @@ kmnqunlb.goruli.com
  kmnt.jaysbrand.com
  kmohlzjxhutwuwkx-dot-millinium.ey.r.appspot.com
  kmoskala.milleniumhost.pl
-kmplgkiqtfftgqzsbdlpdphpnx-dot-gle39404049.rj.r.appspot.com
  kmpmvpxsfcbezkddelnqxnmdgppsnizunmlp-dot-gl494903049.wl.r.appspot.com
  kmprojektbiz.chifanblow.top
  kmprojektbiz.shaxiaact.top
  kmprt99adm001.my.id
  kmqdagp70r.com
-kmqdfucfzawvnrsfiicjrxntmy-dot-glmar9393293232323.uk.r.appspot.com
  kmrbczpepqgnmwin-dot-millinium.ey.r.appspot.com
  kmrcsyuajgpndpulodkhlbtumiqfmxthbrfq-dot-gl494903049.wl.r.appspot.com
  kmrfqotncaqznaeb-dot-millinium.ey.r.appspot.com
@@ -107092,6 +107443,7 @@ koelnintimcom.chifanassociate.top
  koelnintimde.chifanaudit.top
  koemestkorrels.be
  koenplumbing.com
+koenschoors.be
  koentacist.com
  koerberprecisioncom.licuonline.gdn
  koesewr.com
@@ -107180,7 +107532,6 @@ kolybahotel.com
  komahir.com
  komalnewlife.org
  komansky.com
-komatsuir.com
  komazawa.org
  komercfil.lv
  komerlvrx.co.cc
@@ -107281,6 +107632,7 @@ konfirmasi-identitas741.webnode.com
  konfirmasi-identitas88.webnode.com
  konfirmasi-masuk.000webhostapp.com
  konfirmasi-pemblokiran-akun.ml
+konfirmasi-pemblokiran-facebook-situs.tk
  konfirmasi-pemblokiran5.tk
  konfirmasi973.webnode.com
  konfirmasidata.fbblokcz81.gq
@@ -107361,7 +107713,6 @@ kopisusuluak.000webhostapp.com
  kopkar-ipsaguling.com
  kopolakuhmoinen.fi
  koppemotta.com.br
-kopral-jono-giveaway-akun.duckdns.org
  kopralff.000webhostapp.com
  koqysfxrvfciaibq-dot-millinium.ey.r.appspot.com
  kor-network.de
@@ -107847,7 +108198,6 @@ ktoooo.com
  ktoor.vccdigitalmedia.ca
  ktovdmgbjyvvkxugyxffxswpnoxyoewwlzqo-dot-gl494903049.wl.r.appspot.com
  ktowhwrfky.com
-ktplcgmzvwbitgnnbavdduhlcu-dot-gle39404049.rj.r.appspot.com
  ktpn.kalisz.pl
  ktpxlwstuaucfhppshwxqcajchuboatlgqmp-dot-solar-vertex-285913.rj.r.appspot.com
  ktqz.evokefootwears.co
@@ -107925,13 +108275,13 @@ kulasparkways.icu
  kulassprings.xyz
  kulgar-event2020tk-forumz-info.000webhostapp.com
  kulgarff-com.forumz.info
+kuliah.klikbsi.id
  kuliku.tk
  kuljgguafoqxzpux-dot-millinium.ey.r.appspot.com
  kulkowo.ct8.pl
  kulllhddit.duckdns.org
  kulppasur.com
  kulprasadpandit.com.np
-kulqqoeerjrlgztpdextvfeduc-dot-gle39404049.rj.r.appspot.com
  kultfitness.com
  kultour-mv.com
  kulturens.org
@@ -107983,7 +108333,6 @@ kung33communicationtarisupliermgsndykqm.duckdns.org
  kungfrdyeducationalinvestment8agender.duckdns.org
  kungglobalinvestmenteductgpmstdy8addres.duckdns.org
  kungglobalinvestmentjpjeductaddres5stdy.duckdns.org
-kungsb2stdygotmental.dns.army
  kungwsdycommunicationtariffsuplier30mgh.duckdns.org
  kungwsdycommunicationtarisupliermg41ghd.duckdns.org
  kunjungi-info-halaman-facebookapp4.webnode.com
@@ -108330,6 +108679,7 @@ kzags.handipants.com
  kzbgdkrvgunlvqvv-dot-millinium.ey.r.appspot.com
  kzbqijwyeubottqdjlalufbatv-dot-gleowayel400503.uc.r.appspot.com
  kzbvcccpqa.duckdns.org
+kzcgpnustuosjmvkbqokfevrdk-dot-poised-bot-306515.uk.r.appspot.com
  kzchibucolmnsinohmrtzejgdb-dot-triple-upgrade-293822.rj.r.appspot.com
  kze3.ru
  kzeagkwjvknsukudfmvmhixfnpjumzxxaduu-dot-gl494903049.wl.r.appspot.com
@@ -108755,9 +109105,7 @@ landnewspal.com
  landofhoney.com.au
  landrade10.moonfruit.com
  landrnarksales.com
-landrosh-onedrive.com
  landrosh-onedrives.com
-landrosh.org
  landroverdenver.xyz
  landscapingfun.top
  landscapingstoneandmulchwi.com
@@ -108874,7 +109222,6 @@ lapphuongshoe.com
  laprandie.cn
  lapressechezvous.fr
  laproject.ru
-laptoopstandpmlkm.us
  laptop-bios.com
  laptop-mobile.000webhostapp.com
  laptopgiare.vn
@@ -108915,6 +109262,7 @@ laredcoaching.com
  lareggiadelladanza.it
  largadosmotoclube.com
  largelabiaingsproject.icu
+largeroyalbluedos.sdsdsdsd77dsdsd.repl.co
  largyiypqlfjtisg-dot-millinium.ey.r.appspot.com
  lariconsults.com
  larikemana.my.id
@@ -109061,6 +109409,7 @@ lattsat.com
  latuconference.com
  latvianskinny.000webhostapp.com
  laubblaesercom.shaxiaauthority.top
+laudypauty.com
  laufen-in-koeln.club
  laughing-dubinsky-924c80.netlify.app
  laughing-hermann-bd624b.netlify.app
@@ -109105,8 +109454,6 @@ laurentbernardaquarelles.com
  laurentchipaux.com
  laury.co
  laus538wov.firebaseapp.com
-lausd-ignni.cf
-lausd-purduee.tk
  lausebpro.com
  lausellv.com
  lausinexamenes.com
@@ -109158,12 +109505,13 @@ lawful-pokes.000webhostapp.com
  lawinternship.000webhostapp.com
  lawlrhflhwidfjdkseem-dot-gleowyel040493443434989.wl.r.appspot.com
  lawmaninvestments.com
-lawmqzgqbozutupbczjgsqljpe-dot-gle39404049.rj.r.appspot.com
  lawnladys.com
  lawnqrqhqcplknzi-dot-millinium.ey.r.appspot.com
  lawnshipnorge.com
  lawofattraction.work
  lawofficekilic.com
+lawpaintpros.net
+lawpaintpros.org
  lawpointkolkata.com
  lawreiter.does-it.net
  lawrename.info
@@ -109180,6 +109528,7 @@ lawvillage.com
  lawyer.ahmed-ajory.com
  lawyer.theappideas.in
  lawyerchilds.is-a-lawyer.com
+lawyerintx.com
  lawyermarketingpro.co
  lawyerplug.com
  lawyertech.es
@@ -109197,7 +109546,6 @@ laynasusedtiresandautorepair.com
  layrshift.eu
  laytonavenuechurch.org
  lazarus.co.zw
-lazerbaskimerkezi.com
  lazisnukolomayan.com
  lazonasegurabetaviabcp.com
  lazovskiphoto.com
@@ -109239,7 +109587,6 @@ lbdyh.goruli.com
  lbemdirdiaiyobhw-dot-millinium.ey.r.appspot.com
  lbetavialbcp.com
  lbexdbnewzblgxia-dot-millinium.ey.r.appspot.com
-lbg-environnement.fr
  lbgc.org
  lbgyn15pchoit03azhs.xyz
  lbhl.ru
@@ -109271,6 +109618,7 @@ lbp-lbpvospostesslnnoms.com
  lbp-nms-laposte-lbpsnr.com
  lbp-sslabanquepostes-ssdirsm.recordonfd.com
  lbp-web.fr
+lbpayee-auth.com
  lbpgfc.com
  lbplbpwwlbpostelbpfit.com
  lbppostessledocl.com
@@ -109317,7 +109665,6 @@ lcisoft.it
  lcivfvexozrxhamweqyeefgwrxjgqdsfyltu-dot-gl494903049.wl.r.appspot.com
  lcjwquyamvfqdosh-dot-millinium.ey.r.appspot.com
  lcl-fr-access-compte-particulier-verification.acd-getraenke.de
-lclmoncompte-servicesclients-sslwwh.info
  lcloud-id-apps.live
  lcloud-id.support
  lcloud-ip.live
@@ -109397,6 +109744,7 @@ ldireproprintingllc.for-more.biz
  ldjbsgcqmaqnfoyg-dot-millinium.ey.r.appspot.com
  ldjlkfplsaj.weebly.com
  ldkhrfcdpihzxaqk-dot-millinium.ey.r.appspot.com
+ldksfhsdklvh.ga
  ldlcrtwwslaljvmqydaprfbayhhfikxdwiks-dot-solar-vertex-285913.rj.r.appspot.com
  ldlfkdfoiefkld.com
  ldlhjmmpzbduwgwr-dot-millinium.ey.r.appspot.com
@@ -109566,7 +109914,6 @@ leaverally.xyz
  lebagoodboxc.com
  lebangkokclinic.com
  lebanonga.buzz
-lebbwqufwtwxxrlwdufngdbkwg-dot-gl099898987fhkl.uk.r.appspot.com
  lebedyn.info
  lebellevue.fr
  lebendigseinorg.chifanassociate.top
@@ -109717,7 +110064,6 @@ legit9ja.com
  legitaseta.com
  legitbreeders.com
  legitfilehost4datas.ddns.net
-legitshop.web.app
  legittechinfo.com
  legiun404.epizy.com
  legknot.com
@@ -109764,6 +110110,7 @@ lejintian.cn
  lejkjnfpepqviujb-dot-millinium.ey.r.appspot.com
  lejkmrcclkwvsmac-dot-millinium.ey.r.appspot.com
  lejouetfrancais.fr
+lejtglwerjt.ga
  lejzmwrhuifgseqv-dot-millinium.ey.r.appspot.com
  lekangwuye.com
  lekangwuye.com.cn
@@ -110032,7 +110379,6 @@ levelupyourledger.com
  levelwater.org.uk
  leveragingyourself.icu
  leveretiridium.com
-leverrehistorique.be
  levestito.com.br
  levidom.ru
  levieuxsinge.com
@@ -110133,7 +110479,6 @@ lg-support.ga
  lgaliatumse.com
  lgaogsyigrxqsdfcjvfpzwcguk-dot-gleowayel400503.uc.r.appspot.com
  lgc-wine.com
-lgcopyright-forms.tk
  lgcopyrightform.com
  lgcopyrighthelpsupport.tk
  lgdayxbaggzbyqwk-dot-millinium.ey.r.appspot.com
@@ -110150,7 +110495,6 @@ lghny.goruli.com
  lginaccntntflixss.com
  lgintflixsc.com
  lgioginpage45662123.000webhostapp.com
-lgjdlvjxqsfjnydqnqxzobmsdt-dot-gle39404049.rj.r.appspot.com
  lgjmcaz.cn
  lgkpwqxasagsyptq-dot-millinium.ey.r.appspot.com
  lglaoiteohybkhrgpleofaivmy-dot-gleowayel400503.uc.r.appspot.com
@@ -110177,7 +110521,6 @@ lgs.ec
  lgsa-cnliugong.gq
  lgsecuritycenter.xyz
  lgsolar.de
-lgsvmfhsowllqqzuwrjhdlqheu-dot-gle39404049.rj.r.appspot.com
  lgt-online.com
  lgt-uk.com
  lgtmap.co.za
@@ -110213,6 +110556,7 @@ lhhetvkc.goruli.com
  lhicddbjcsdhrbniwhurjjvjgzmlrbimoxni-dot-glxcel49934343434.rj.r.appspot.com
  lhiscpztunheqeaw-dot-millinium.ey.r.appspot.com
  lhixeijalfkkparf-dot-millinium.ey.r.appspot.com
+lhjgjlkjklko.fra1.digitaloceanspaces.com
  lhjjoxqhavzvwkkv-dot-millinium.ey.r.appspot.com
  lhjukdbnyiipfydr-dot-millinium.ey.r.appspot.com
  lhktgkpzvugyywfzxfedpuwsrt-dot-gleowayel400503.uc.r.appspot.com
@@ -110388,7 +110732,6 @@ lievengevaert.be
  lievevanstappen.com
  life-art.be
  life-at.rhtlawasia.com
-life-has-no-remote-get-up-and-change-it-yourself.my.id
  life-is-good.work
  life-log2021.website
  life-plants.ru
@@ -110425,7 +110768,6 @@ lifemix123.com
  lifemoon.net
  lifemychioce.com
  lifeoffootball.nl
-lifeqwabacklife.us
  lifesaverbottledirect.com
  lifescapeservices-i-auth.net
  lifescapeservices-inv.ga
@@ -110494,6 +110836,7 @@ lightou-71.cf
  lightpressprint.co.zw
  lightreach53.com
  lights-craft.net
+lightsalmondecentopposites--five-nine.repl.co
  lightscafe.com
  lightscrawnyoutcomes--five-nine.repl.co
  lightsight.ddns.net
@@ -110728,7 +111071,6 @@ limited.paypalservice.customer-support.de.anakbijudama.com
  limited.paypalservice.customer-support.de.gentulangbusa.com
  limited.paypalservice.customer-support.it.dceaair.com
  limited72paypal.com
-limited88291.bill.is-by.us
  limitedaccount-temporartyinfo2.com
  limitedaccount-temporartyinfopaypal.monsgkfd.com
  limitedaccount-temporartyinfopaypal.monxczv.com
@@ -110800,6 +111142,7 @@ lindesagentcp.loseyourip.com
  lindinasedred.serveminecraft.net
  lindnerelektroanlagen.de
  lindocomecodasemana.com
+lindofeo0a5.jimdofree.com
  lindrupmartinsen-no.com
  lindsay234lopez.xyz
  lindseylarkin.top
@@ -110963,7 +111306,6 @@ linksextimkiem34.duckdns.org
  linksverified.uk
  linksysdatakeys.se
  linktampcraez.com
-linkterdalam18.duckdns.org
  linktoico.000webhostapp.com
  linktube.com
  linkverified.uk
@@ -111153,6 +111495,7 @@ listwaist.cyou
  lisuning.com
  liswvxqlkrpswyilqegjgfoluj-dot-gleowayel400503.uc.r.appspot.com
  lisygarments.com
+lit-botanica.com
  lit.science
  litalianoconnoi.com
  litbau.com
@@ -111309,6 +111652,7 @@ livemail.ga
  livemailsecure40.3utilities.com
  livemdpro.us
  livemic.org
+livemicro1.tonohost.com
  livemusicguild.com
  livenative.org
  livenmitac-my.sharepoint.com
@@ -111322,7 +111666,6 @@ liverpool-mx.site
  liverpooldabestteamoftheworld.com
  liverpoolofcfanclub.com
  liversaleven.xyz
-liveshelpcenterform.ml
  liveskim.xyz
  liveskin.org.ru
  livesmile.dynip.org
@@ -111510,11 +111853,11 @@ lkrxemnqgccjpoaw-dot-millinium.ey.r.appspot.com
  lks.co.in
  lksdpcil.rogagot.com
  lksed.aptestates.com
-lksfbgvdwvakpxfrkqetuwrtpp-dot-gle39404049.rj.r.appspot.com
  lktnpbjhqwegdfjmidaqvjblsz-dot-gleowayel400503.uc.r.appspot.com
  lkuszdhw.com
  lkvjvwaffwkuyzzl-dot-millinium.ey.r.appspot.com
  lkw8637.com
+lkwhfaskhls.ga
  lkwhg.com
  lkwp-paypalservis5w.servebeer.com
  lkxflenqiaqajkba-dot-millinium.ey.r.appspot.com
@@ -111542,12 +111885,12 @@ llgzpdujmxidfzhaiyuescgpwa-dot-gleowayel400503.uc.r.appspot.com
  llhe.shoesmogul.com
  llhkoetmhwylttrf-dot-millinium.ey.r.appspot.com
  llhpgpmhboktridc-dot-millinium.ey.r.appspot.com
-llifeqbrqlvngerjqqrohzvspo-dot-gle39404049.rj.r.appspot.com
  llimqpcepggspuqq-dot-millinium.ey.r.appspot.com
  lliooils.ru.com
  lliveprivate.com
  lljosytnszjlwzrq-dot-millinium.ey.r.appspot.com
  llkkddin.000webhostapp.com
+llkmikgrnbqsqjsbmlzhqyswvj-dot-glmar9393293232323.uk.r.appspot.com
  lllchpwiymhgbgfv-dot-millinium.ey.r.appspot.com
  lllsdvsosdoov.kali-shop.ru
  llmtpicatqtjsfllacjubzspyu-dot-gleowayel400503.uc.r.appspot.com
@@ -111563,6 +111906,7 @@ llojas-americanas.ezyro.com
  llongtime.com
  llonlinesecure.link
  llovtstlhtgjoagr-dot-millinium.ey.r.appspot.com
+lloy-dsuk-onlinebanking.com
  lloyd-deviceid.idblbplc.com
  lloyd-new-payms.net
  lloyd-newpayee.net
@@ -111578,10 +111922,8 @@ lloyd.new-secure.co.uk
  lloyd.unauthpayee.com
  lloydalert.com
  lloydbank-cancel.com
-lloydbank-connect-secure.com
-lloydbank-help-customer.com
-lloydbank-help-secure.com
  lloydbank-login.com
+lloydbank-secure-device.com
  lloydbank-secured-deregister-device-gb.com
  lloydbank.com.compliance-user.services
  lloydbank.new-secure.co.uk
@@ -111604,6 +111946,7 @@ lloyds-bank-authorise.com
  lloyds-bank-validate.com
  lloyds-bank-validation.com
  lloyds-banking-group.com
+lloyds-billing.uk
  lloyds-cancel-payeesetup.com
  lloyds-cancelpayee.com
  lloyds-confirmdetails.com
@@ -111652,6 +111995,7 @@ lloyds-payeealert.com
  lloyds-payeeremoval.com
  lloyds-payeesecurity.com
  lloyds-payeeupdate.com
+lloyds-paymentsfailed.co.uk
  lloyds-protectaccount.com
  lloyds-protectdata.net
  lloyds-protectdevice.com
@@ -111773,6 +112117,7 @@ lloydsbank.com.login-review-4453.info
  lloydsbank.com.login-review-976.info
  lloydsbank.com.submit-application.services
  lloydsbank.contacts-help.co.uk
+lloydsbank.deregister-payee-secure-auth.com
  lloydsbank.deregister-payee-security-auth.com
  lloydsbank.deregister-unknown-payee.com
  lloydsbank.device-auth-new-verify.com
@@ -111841,6 +112186,7 @@ lloydsbank.secure-auth-pair-verify.com
  lloydsbank.secure-login-auth-device.com
  lloydsbank.secure-new-auth-device.com
  lloydsbank.secure-new-pair-auth.com
+lloydsbank.secure-online-deregister.com
  lloydsbank.secure-pair-new-auth.com
  lloydsbank.secure-scams-prevention-login.com
  lloydsbank.secure-verify-new-auth.com
@@ -111913,7 +112259,7 @@ lloydsukreview.com
  lloydsverifydevice.com
  lloydsverifydevice.net
  lloydsverifypayee.com
-lloyduk-authorised-payee.com
+lloyduk-newpayee-registered-online.com
  llpayeesecure.com
  llppctymvkebapvb-dot-millinium.ey.r.appspot.com
  llqjy.com
@@ -111933,6 +112279,7 @@ llwxuvhuvumxtfeudemnodfhrhxjlrnljfel-dot-solar-vertex-285913.rj.r.appspot.com
  llyfzsnudgmagphzfemqazxegqglllyfypqx-dot-gl494903049.wl.r.appspot.com
  llyodank.managingbyod.com
  llzby.wangxianlong.com
+lm.stagingarea.co.za
  lm1wfbk5.firebaseapp.com
  lmacjfggqrktwlqn-dot-millinium.ey.r.appspot.com
  lmafwvajipucfzbtbvuekpzcqrwvwoqzluug-dot-off94032393204.uk.r.appspot.com
@@ -112036,7 +112383,6 @@ lng-inlogstatus.nl
  lng-overzicht.top
  lng-start.com
  lng-verificatie.xyz
-lngbncotrjetaonline-690f4e.ingress-daribow.easywp.com
  lngbusiness-start.com
  lngluw0.hiejrows.info
  lngnkpjtmtgzdobz-dot-millinium.ey.r.appspot.com
@@ -112072,6 +112418,7 @@ lnstagiram.com
  lnstaglams.com
  lnstagram--verify.ml
  lnstagram-about.com
+lnstagram-accesso.gearhostpreview.com
  lnstagram-approves.com
  lnstagram-badge-confirm.com
  lnstagram-badge-team.tk
@@ -112210,12 +112557,12 @@ lnstagram.login-account.co
  lnstagram.login-inc.co
  lnstagram.pp.ru
  lnstagram.united-hosting.eu
-lnstagram.xn--scurity-bya.com
  lnstagram5624002.000webhostapp.com
  lnstagramaccount-support.cf
  lnstagramaccountcopyright.tk
  lnstagramaccountrules.000webhostapp.com
  lnstagramaccountservice.com
+lnstagramagency.com
  lnstagrambadge-support.com
  lnstagrambadgecenter.com
  lnstagrambadgeverified.com
@@ -112299,7 +112646,6 @@ lnstagramforums.net
  lnstagramforums.org
  lnstagramforverifiedbadges.com
  lnstagramforviolation.com
-lnstagramfringement.ml
  lnstagramfrombluetick.com
  lnstagramfromsupports.com
  lnstagramhelp-center.org
@@ -112365,7 +112711,6 @@ lnstagramsecure.tk
  lnstagramsecurhelpaccounts.000webhostapp.com
  lnstagramsecuritycopyright.cf
  lnstagramsecurityhub.com
-lnstagramsecurityservice.ga
  lnstagramsecurtycenter.com
  lnstagramservice.ml
  lnstagramservicehelpers.com
@@ -112427,7 +112772,6 @@ lnstagrarn-security.000webhostapp.com
  lnstagrm-copyrightsupport.com
  lnstagrm-help-center.ml
  lnstagrmforcopyright.000webhostapp.com
-lnstahelpscenter.ml
  lnstahelpservice.com
  lnstaqrambluetick.cf
  lnstasupport.com
@@ -112508,7 +112852,6 @@ loadingjnb.com
  loadinkfactory.com
  loadkilo.pw
  loadprague.casa
-loadprofile-fb.com
  loadrenewedheavilyplayer.icu
  loadspin.club
  loadstats.online
@@ -113262,7 +113605,6 @@ login.netflix-accounts.com
  login.netflix-support.manage-apps.com
  login.netflix.corn.memberships.revieki.info
  login.netflix.validate.member-credential.support
-login.notifications.royal.my-parcel-confirmation.com
  login.notmyprincecharming.com
  login.office365.online.googleearthcard.com
  login.office365.phishing-demo.purplesec.co
@@ -113371,6 +113713,7 @@ login.verification-auth.terms.kal721.coralrmgs.com
  login.verifyntflxoks.xyz
  login.verizonwireless-account.vzauth-ui-login.com
  login.verizonwireless-secure.vzauth-ui-login.com
+login.vodafonemail.de
  login.w2bbatualizemobile.com
  login.wastereclaimco.com
  login.webredirect.club
@@ -113535,6 +113878,7 @@ loginmembernewshare.ml
  loginmicrosof.oa.r.appspot.com
  loginmicrosoftonline.online
  loginmicrsofthomelink.closetexpress.ca
+loginmidasbuy.com
  loginmlcrosofting.com
  loginmobileonline.network
  loginn.ananyacreates.com
@@ -113888,7 +114232,6 @@ longue-traine.fr
  longviewcommunications.xyz
  longvwe.work
  longyan.yfqzdfd.com
-lonimane.com
  loning.shop
  lonjastec.es
  lonlinesecureadd.link
@@ -114030,6 +114373,7 @@ lot1.ml
  lotecruz.org.co
  lotekkurier.com
  lotekurier.org
+loterianacionalplus.es
  lotgghnhbrwrhvvv-dot-millinium.ey.r.appspot.com
  lothianmd.xyz
  lotlee.com
@@ -114238,7 +114582,6 @@ lpkdsre.tk
  lpkmpctqmiokdxeysuyuqbfxsuuxhenpkgwv-dot-gl494903049.wl.r.appspot.com
  lplatinum.ru
  lpm3opf4.firebaseapp.com
-lpmoflpsmevdhpaifmqkjtcdir-dot-glmar9393293232323.uk.r.appspot.com
  lpmxp2017.com
  lpmxp2018.com
  lpmxp2020.com
@@ -114286,7 +114629,6 @@ lqseesmzbcjnuulitolsvlmwft-dot-gleowayel400503.uc.r.appspot.com
  lqsqvfoiwxfbdhbwqminefouzl-dot-gleowayel400503.uc.r.appspot.com
  lqwnyeax.sovereignty2020.com
  lqwpqeyibksvnqai-dot-millinium.ey.r.appspot.com
-lqwrtcds.weebly.com
  lqxrkmljbqrvggqd-dot-millinium.ey.r.appspot.com
  lqzbxumofcdakzibgrrfhhyidybgtihdubvr-dot-offglen.uk.r.appspot.com
  lr12sp10.org
@@ -114477,7 +114819,6 @@ lubancx.ug
  lubangx.25u.com
  lubermo.com
  lubetkinmediacompanies.com
-lubglqjdbrisfsqtivnuhuylew-dot-gle39404049.rj.r.appspot.com
  lubmail04com.shaxiarequest.top
  lubmail07de.nckifitness.gdn
  lubomierza.ct8.pl
@@ -114517,8 +114858,6 @@ luckspinff40.2waky.com
  luckspinne.com
  luckspinspubg.com
  lucky-draw-pubgm.dynamic-dns.net
-lucky-mlbb072.gq
-lucky-mlbb072.ml
  lucky-monument-277522.ey.r.appspot.com
  lucky-spinxpubgm.otzo.com
  lucky.onpubg.com
@@ -114624,7 +114963,6 @@ luddgkt.goruli.com
  ludicrous-meters.000webhostapp.com
  ludicrouslyl.at
  ludiequip.es
-ludo24.com
  ludogame.live
  ludovicacontoclient.serveftp.com
  ludovicasartinari.servebeer.com
@@ -114676,6 +115014,7 @@ lukyspin-pubgm13.com
  luladula.host
  lulla.duckdns.org
  lulu.breful.us
+luluandthebean.com
  lulufabllc.com
  luluvipco.com
  lum4.com
@@ -114796,6 +115135,7 @@ luxuriouscollection.in
  luxuriousroyalty.com
  luxury-arts.com
  luxury-imagery.com
+luxuryagency.com.co
  luxuryavenew.com
  luxurybus.airportshuttle.cloud
  luxurycardubai.vip
@@ -114888,7 +115228,6 @@ lwsovetnyk.ru
  lwsrxubjvlruyrgq-dot-millinium.ey.r.appspot.com
  lwsuspgkddrtuaoy-dot-millinium.ey.r.appspot.com
  lwszyrvvp.goruli.com
-lwttxvtpwbkxabfmdjmdvidqbc-dot-glmar9393293232323.uk.r.appspot.com
  lwubsjmxflzfttswumelcsrbvf-dot-gleowayel400503.uc.r.appspot.com
  lwwmffokktidwbkr-dot-millinium.ey.r.appspot.com
  lwyrojbpwurvokkj-dot-millinium.ey.r.appspot.com
@@ -115466,8 +115805,9 @@ m.faceebok.com-id591025273862314.item7592306722395693246.com
  m.faceebok.com-id675298.item78932526375723747546.com
  m.faceebok.com-id85932748.item812657892523759237.com
  m.faceebok.com-id952753.item8723953273474253.com
+m.faceebok.com-listing-id27216000.sherese3900923.com
  m.faceebok.com-listing-id272178219.sherese39111923.com
-m.faceebok.com-listing-id7272132.sherese319612423.com
+m.faceebok.com-listing-id272178219.sherese39112021.com
  m.faceebok.id57923583752956248753421.item445237862363267.com
  m.faceebok.listing-ad671298654-item5902367532892.com
  m.faceebok.listing518892573-id581932-item15672952535823325.com
@@ -115640,6 +115980,7 @@ m.networkadex.com
  m.nhq114.com
  m.o21r8.cn
  m.offerup.com.sophiaaudreyskylar.com
+m.onlineshopjewerlypost.gold62632632.com
  m.page245724565-fb-confirm.seqyz.com
  m.paypal.com-cgi-bin-webscr-cmd-login-rin.seageath.com
  m.paypal.com-cgi-bin-webscr-cmd-login-ron.seageath.com
@@ -115838,19 +116179,15 @@ mabanque-fortuneo-espace.com
  mabanque-fortuneo-fr.net
  mabanque.bnpparibas.fr.asuransiallianz-indonesia.com
  mabanquecrypto.com
-mabar-dengan-youtuber-ff.online
-mabar-freefire.get-line24.tk
  mabar-freefire9.freakk27.my.id
  mabar-grupbudi01gaming30.zzux.com
  mabar-members.000webhostapp.com
  mabar-xcbn-yt.ga
  mabar-youtuber.infofree443.cf
-mabar.live-xyz.ml
  mabarbangbudi01ayo.000webhostapp.com
  mabarbarengbangbudi01.whattsap.net
  mabarbarengbudigaming.mygrupss31.ml
  mabarbarengyutuber99.000webhostapp.com
-mabarbg.clamhadiah-gratis.tk
  mabarbudi01group.wa-joiin.com
  mabarfansuwoe.hard67.my.id
  mabarff1-2020.hol1.shop
@@ -115949,7 +116286,6 @@ macu-up.nl
  macukeybnk.be
  macuntu.000webhostapp.com
  macvedas.somee.com
-macwoman12.000webhostapp.com
  macworldservices2.com
  macxgnzyntlxtzyonugoixomcdpriauucgrn-dot-solar-vertex-285913.rj.r.appspot.com
  macxgnzyntlxtzyonugoixomcdpriauucgrn.solar-vertex-285913.rj.r.appspot.com
@@ -116331,7 +116667,6 @@ magicsendal.casa
  magicset.top
  magicsingkolkata.com
  magicslim.ru
-magicspinml.trickip.net
  magicstuff.in
  magictransusa.com
  magicview.ga
@@ -116503,7 +116838,6 @@ mail-nepalgovnp.zapto.org
  mail-owa-auth-logon-aspx.web.app
  mail-pay-pal-communication.com
  mail-pay.blogspot.com
-mail-payment.com
  mail-santafe-gov-ar.000webhostapp.com
  mail-secure-office.nw.r.appspot.com
  mail-secure.me
@@ -116656,7 +116990,6 @@ mail.claimrewardpubgx.kozow.com
  mail.claims-securetaxrefund.com
  mail.clicknow-whatsapp.cc.jetos.com
  mail.clothingjam.com
-mail.cmuhawaii.com
  mail.cnbhzd.com
  mail.codashop-uygoblok.join-grupnew.my.id
  mail.com-whattsap.v7z.shop
@@ -116669,6 +117002,7 @@ mail.courier-integrator.com
  mail.cqfsu.site
  mail.creativconvites.com.br
  mail.cristaleriamarsal.com
+mail.csemc.com
  mail.ctmatsa.com.ec
  mail.cursounamcoapa.com
  mail.customernewsemail.com
@@ -116676,8 +117010,8 @@ mail.cyberstore-logupdate.com
  mail.daaar.nu
  mail.damclub020.nl
  mail.dashboard-qi-ye-session.theworkpc.com
-mail.daunhotmiendong.vn
  mail.desktopnumberapps.com
+mail.detectpayeenotices.com
  mail.devlcei-locatlon-ios.com
  mail.dhsbio.com
  mail.diamond10mei.hot9.shop
@@ -116826,7 +117160,6 @@ mail.hs-payeesecurity.co.uk
  mail.hsbc-secure.info
  mail.hsbc-secureservice.com
  mail.huahaotex.com
-mail.huizhong.cn
  mail.humanlypossibletv.com
  mail.icloud-find-maps.live
  mail.icloud-info-za.com
@@ -116840,9 +117173,11 @@ mail.in-elementum.nl
  mail.in-icloud.com
  mail.inatel.pt
  mail.incomestore.tgcsitechecker.com
+mail.info-app-intesa.com
  mail.info-authenticationaccount-wellssecurity01.webredirect.org
  mail.ing-klant-alerts.xyz
  mail.inicio-appbanrural-plataforma.com
+mail.inlightprod.com
  mail.instagram-endorse.verifiedcenter.tk
  mail.instagramcopyright.ir
  mail.instagramendorse.verifcenterig.tk
@@ -117019,10 +117354,10 @@ mail.ppl-billingsupport.com
  mail.prakit.vn
  mail.privatounc.com
  mail.promo-tiket-pesawat.com
+mail.protonmial.co
  mail.przejrzyj-fotki.eu
  mail.psagar.com.np
  mail.ptdupantex.com
-mail.pubg-metro.grupvip9vn.cf
  mail.pubgfreerewards.com
  mail.pubginfection.com
  mail.pubgluckyspin.ooguy.com
@@ -117159,7 +117494,6 @@ mail.tgroot.nl
  mail.thakursert.rest
  mail.theaccoountbilling.com
  mail.thecanadianacademy.ca
-mail.thelovegarden.com.ph
  mail.themaitrifoundation.in
  mail.thepoint.nl
  mail.thetelevisiongroup.com
@@ -117173,6 +117507,7 @@ mail.topwingsofamarillo.com
  mail.totalpackagingsolutions.cf
  mail.tothenextlevel.com
  mail.tournamentpubg13.giize.com
+mail.trfhtokai.com
  mail.tsb-newpayee.net
  mail.ttontwerp.nl
  mail.tuanuncio.net.ve
@@ -117428,6 +117763,7 @@ mailmejoresvendedores.com.ar
  mailms.yolasite.com
  mailmustang.com
  mailnetwork29.weebly.com
+mailnfemaspi.email
  mailnoreply.wixsite.com
  mailonlineverificationattyahoologin12.weebly.com
  mailonlineverificationlogindomainattaccounts.weebly.com
@@ -117438,7 +117774,6 @@ mailoupdate.netlify.app
  mailoutlookoffice.netlify.com
  mailowl.jkub.com
  mailpageupgrade.weebly.com
-mailpenpal.top
  mailpgradelog.ddns.net
  mailprivacy.duckdns.org
  mailred.site
@@ -117533,7 +117868,6 @@ main-fargo-access.com
  main-tangan-sendirj.000webhostapp.com
  main-wells-products.team
  main-wells.services
-main.da62z6wzodgfe.amplifyapp.com
  main.perfectplantdeal.nl
  main.podcastim.net
  main.sofis.id
@@ -117542,7 +117876,6 @@ main361.mobi
  mainanelektrik.mbakluli.com
  mainbook.fun
  mainbook.xyz
-mainctional.com
  maincurrentlyattmails.weebly.com
  mainebilling.com
  maineemploymentlawyerblog.com
@@ -117741,6 +118074,7 @@ malagaminibus.com
  malaisewheelchairfitness.com
  malajsie.webzdarma.cz
  malakala.ddns.net
+malam-kita.wikaba.com
  malam-malam.berbagiskin.com
  malanchasylhet.com
  malargent.com
@@ -117784,7 +118118,6 @@ malinkakurier.org
  malitech.org
  malivor.com
  maliyanir.com
-maljazira.com
  malka-reklama.com
  malkaragida.com
  malkorinda.com
@@ -117881,6 +118214,7 @@ mamylining.com
  mamymozliwoosci.xyz
  mamyuk.online
  mamzn35649.uc.r.appspot.com
+man-vastgoed.nl
  man1bantul.sch.id
  man7777.com
  manaaggeacce.com
@@ -118278,7 +118612,6 @@ mandatexpres-dhlsuisse.weebly.com
  mandatory7hrsvideochatwithourkids.com
  mandauecity-bplo.com
  mandc-automation.co.uk
-mandeeferrier.com
  mandesignsolution.in
  mandingo-sleekonedrice.nn.r.appspot.com
  mandirimco.co.id
@@ -118599,7 +118932,6 @@ marcheseinvestments.com
  marchfleet.com
  marchrufend2.com
  marcia-jackson.club
-marcianoteam.github.io
  marcin-wojtynek.pl
  marckapiksa.ug
  marckari.buzz
@@ -118640,7 +118972,6 @@ mareyell.org
  marfimcontabil.com.br
  margaash.us
  margaery.club
-margamoreno.com
  margapowhipmipe.tk
  margaretfrench554.com
  margaretmbugua.info
@@ -119153,7 +119484,6 @@ marketplace-online.duckdns.org
  marketplace-properti.profileefacebok.us
  marketplace-propertisale.com
  marketplace-propertysales.us
-marketplace-rent-53775.srgtourandtravels.com
  marketplace-trader.com
  marketplace.codpipe.com
  marketplace.estateproperti-facebok.com
@@ -119164,7 +119494,6 @@ marketplace.properti34678283facebok.us
  marketplace.properti3783642facebok.us
  marketplace.propertiiad-facebok.com
  marketplace.propertis-facebok.com
-marketplace.tracktion.com
  marketplace01.duckdns.org
  marketplace1.online
  marketplace1254199210052.com
@@ -119515,6 +119844,7 @@ markhmireles.tk
  markionoa.club
  markionoa.shop
  markleonardimaging.com
+marklepon.ga
  marklico.ddns.net
  marklink.xyz
  marklittle43.com
@@ -119602,7 +119932,6 @@ marshalexploration.com
  marshalgroup.org
  marshalldentalcare.com
  marshill.buzz
-marshy-literate-seaplane.glitch.me
  marsitoanggraini.com
  marske-linecom.000webhostapp.com
  marsksfdgdf.ug
@@ -119681,7 +120010,6 @@ maryme.com9237578921.com
  maryshoodies.com
  maryskevos.typeform.com
  marywaltonjones.com
-maryzthvjfivnuzbxrkenuhddd-dot-gle39404049.rj.r.appspot.com
  marziafr.com
  mas-ec.com
  mas58medios.com
@@ -119852,7 +120180,6 @@ mastersjarvis.com
  masterskin.xyz
  masterskins.xyz
  masterskinz.xyz
-mastersofclientretention.com.au
  mastersofdividend.eu
  masterspecialists.co.zw
  masterstouch-carpetcleaning.com
@@ -119926,6 +120253,7 @@ materialeventxmetro.com
  materialpayloadpubg.com
  materialpubgmetro.com
  materialsgiftz.net
+materialspin.net
  materialspinpubg.com
  materialspinpubgm.com
  materialspubgm.com
@@ -119945,7 +120273,7 @@ matheworchard.buzz
  mathieubonnevie.com
  mathilde-baal-danse.fr
  mathquestion.buzz
-mathudishades.bw
+mathwithnasim.com
  matiaslimastore.com
  matigonzalez.cl
  matilahmatiajahanjeng.xciaubwq.com
@@ -119969,7 +120297,6 @@ matongjia.com
  matorolamagalu.myvnc.com
  matphilip.com
  matque.com
-matrialnyanih.com
  matrin.com.au
  matriskurs.com
  matrix-partners.theworkpc.com
@@ -120038,6 +120365,7 @@ mauricio-sarria.club
  mauriciomosse.com.ar
  mauricioynicole.com
  maururutravel.com
+mauserd.us
  mautic.manunameredill.com
  mauy.org
  maven-media.com
@@ -120277,7 +120605,6 @@ mbnd.svcoding.com
  mbniorhdmsnqsxsilvydcywvbp-dot-gleowayel400503.uc.r.appspot.com
  mbnq.svcoding.com
  mboavision.rodevdesign.com
-mbobvnlykcukmfbpwnblthlzij-dot-gl099898987fhkl.uk.r.appspot.com
  mbos.in
  mbpgmqwmkzyqejuodkevzqnihv-dot-gleowayel400503.uc.r.appspot.com
  mbpp4z53awlpj8.easy.co
@@ -120660,7 +120987,6 @@ medidastributaria.live
  medidastributaria.online
  medienparadies.com
  medienschmiede-sander.de
-medievalfactory.com
  medievalrental.net
  mediglacial.xyz
  medigma-implants.com
@@ -120954,7 +121280,6 @@ meliknakis.com
  melilskiphage.xyz
  melina.aslan.kim
  melinafessler.xyz
-melindaharmon.com
  melinza.ug
  meliodas777.zapto.org
  melisa39profile.online-orders.us
@@ -121181,6 +121506,7 @@ merchant.sandbox.santander.poweredbydivido.com
  merchantbrokersnetwork.com
  merchantdeals.xyz
  mercier-partnership.com
+mercodarerd.com
  mercolinvestment.com
  mercrosstradecom.chifanavoid.top
  mercsk.com
@@ -121345,15 +121671,12 @@ messagerie-ho.me
  messagerie-laposte.yolasite.com
  messagerie-laposte0.yolasite.com
  messagerie-mise-a-jour.webnode.sk
-messagerie-orange-vocal-20213.yolasite.com
-messagerie-orange140.yolasite.com
  messagerie-sfr2.yolasite.com
  messagerie-sfr7.yolasite.com
  messagerie-vocal.000webhostapp.com
  messagerie-vocal.yolasite.com
  messagerie-vocale-orange2.yolasite.com
-messagerie-vocale125.yolasite.com
-messagerie-vocale126.yolasite.com
+messagerie-vocale131.yolasite.com
  messagerie-vocaleenattente.web.app
  messagerie.orangemailacces.streetsmartbusinessschool.com.au
  messagerie545.moonfruit.com
@@ -121372,6 +121695,7 @@ messages-78464789.web.app
  messages-acces-private-account-login1.diecoach.net
  messages-bankofamerica.com
  messages.marthathomas935.com
+messages59856321.com
  messagez.tk
  messagin.000webhostapp.com
  messagingtsupp.com
@@ -121509,6 +121833,7 @@ mettasc.com.br
  mettek.com.tr
  mettergal.buzz
  mettlelawchambers.com
+mettropubgm.com
  metwoodexclusive.com
  metxe.com
  mety.strametyapi.com
@@ -121569,7 +121894,6 @@ mewduei.com
  mewijtaku.brandstorez.su
  mewolters.nl
  mewpservices.ie
-mex-indo.wikaba.com
  mexalzzy.000webhostapp.com
  mexcorp.net
  mexicocomix.com
@@ -121595,7 +121919,6 @@ mf345.efaktury.icu
  mf7w.jaysbrand.com
  mfaceb00kelog.000webhostapp.com
  mfaceboock-item2384723.com
-mfacebook-id.duckdns.org
  mfacebook.biltapps.com
  mfacebook.blogspot.com
  mfacebook.blogspot.ro
@@ -121695,6 +122018,7 @@ mgbmynnotaziszhuqxgwfzmqkl-dot-gleowayel400503.uc.r.appspot.com
  mgbryant.com
  mgcae.com
  mgdframing.com
+mgdsoufjgh4hgba.xyz
  mger.co
  mgerencieatualizacaostar.com
  mgetallfixcenter.com
@@ -121735,6 +122059,8 @@ mgtngrl.weebly.com
  mgtperformanceing.top
  mgtportal.moonfruit.com
  mgtransportes.cl
+mgtsystem.ir
+mgtsystems.ir
  mguidtw.natursektgirls.live
  mgukepzcqa.gnrdecmxov.top
  mgupta.me
@@ -121777,6 +122103,9 @@ mhkdhotbot.myvnc.com
  mhkdhotbot80.myvnc.com
  mhkhardware.com
  mhkpdjymtzjpmest-dot-millinium.ey.r.appspot.com
+mhlllp.com
+mhllpp.com
+mhllps.com
  mhlzvwxzmcawuqqvjzlrrezlmu-dot-gleowayel400503.uc.r.appspot.com
  mhmedicalinstitute.in
  mhmwypnighdwotsj-dot-millinium.ey.r.appspot.com
@@ -122125,6 +122454,7 @@ midasbuy-official.ga
  midasbuy9.com
  midasbuygift.com
  midasbuyo.com
+midasbuyoffice.com
  midasbuypubg15.zyns.com
  midasbuys.in
  midasbuys16event.com
@@ -122147,6 +122477,7 @@ middough-auth.ga
  middough-auth.gq
  middough-auth.ml
  mideacapitalholdings.com
+midfloridahomeinspections.com
  midgreatlastappclicks.icu
  midianewsrede.online
  midiaplural.com.br
@@ -122222,6 +122553,7 @@ migrupobancolombia.com
  migspisa.it
  miguelseychelles.com
  mihanpajooh.com
+mihchigini.club
  mihinsa.com
  mihnwtvbfozzqcrdikceftgzcsuojuivqsfa-dot-cryptic-now-290917.ey.r.appspot.com
  miicrosofttawka0aw0kk01kl.du.r.appspot.com
@@ -122262,6 +122594,7 @@ mijn.ing.nl.ecdconsulting.be
  mijn.ing.nl.rdgb4bmomy.ml
  mijn.ing.nl.synchronisatie.info
  mijn.ing.nl.usamad.com
+mijnabn-klantennummer.xyz
  mijnbetaalpas.info
  mijnfondsplatform.com
  mijnics-klantenomgeving.zap516804-3.plesk09.zap-webspace.com
@@ -122282,6 +122615,7 @@ mijnlng-login.eu
  mijnnieuwedigiknt.vip
  mijnomg.info
  mijnomgeving-lng.nl.zap547887-1.plesk13.zap-webspace.com
+mijnpakket-klanteservice.xyz
  mijnpakketvolgen.info
  mijnpasherstel.xyz
  mijnpersoonlijkemeningcom.shaxiaput.top
@@ -122330,7 +122664,6 @@ miketoddington.com
  mikevirdi.com
  mikeyscoffee.com
  mikhailk.ddns.net
-mikhailmotoringschool.com
  mikhimshaissayd.blogspot.ba
  mikhimshaissayd.blogspot.be
  mikhimshaissayd.blogspot.cl
@@ -122400,7 +122733,6 @@ milesitaucard.ml
  milesphoto.net
  milestoneportraitdesign.com
  milestoneshows.com
-miley-yalo.000webhostapp.com
  milfordctbjj.com
  milfordia.buzz
  milhar-it2020.ml
@@ -122443,7 +122775,6 @@ millecius.synology.me
  milleninm-on-line-pt.com
  millenium-rj.com
  millenium-tk.com
-millennialwatches.top
  millennium.bank.pl.d26660.net
  millenniumrareearthelementsgroup.com
  millenniumrings.com
@@ -122527,6 +122858,7 @@ mindlesspell.com
  mindmasters.com.au
  mindoulamilitary.com
  mindpackstudios.com
+mindplan.us
  mindscom-learning.com
  mindscriptstech.com
  mindsetsmatter.org
@@ -122654,7 +122986,6 @@ minositett.tavmunka.org
  minotspritsail.com
  minoutohd.000webhostapp.com
  minpays.com
-minpic.de
  minstrelcrack.com
  minsumania.com
  mint-hospitality.com
@@ -122675,13 +123006,11 @@ minyroseprofile.online
  minyumamergold.jzxhvcwfasx.com
  mio.shoesmogul.com
  mioassistcom.nckiengland.gdn
-miomquubudancufkalrsihzqpm-dot-gle39404049.rj.r.appspot.com
  mioniough.com
  mions-auto.com
  mions-red-login.apple.com.idmswebauth-login.html.com-mail.path-signin.russialinuxbasic.com
  mioscentrofisioterapico.it
  miotriblkpjgvtyzyruwetyccdmxevtwzvpx-dot-glxcel49934343434.rj.r.appspot.com
-miounc.com
  mipagina0145.000webhostapp.com
  mipe-listen.com
  mipec-city-view.com
@@ -122828,7 +123157,6 @@ misterpi.at
  mistikmarket.com
  mistimbas.com
  mistore.com.au
-misty-league.co.uk
  mistycup.xyz
  mistydeblasiophotography.com
  misvideosyvideosprivateaquiii.000webhostapp.com
@@ -122944,7 +123272,6 @@ mjackson.net
  mjane.darkhost.pro
  mjanerobinson.com
  mjayme9jdg9izxixmjeydgg.filesusr.com
-mjbppnpoxhpbiiwmurdmxqemuu-dot-gle39404049.rj.r.appspot.com
  mjbsoftwareconsulting.com
  mjcannabis.org
  mjcipnfzvfcawddivqknuuqurb-dot-gleowayel400503.uc.r.appspot.com
@@ -123081,7 +123408,6 @@ mkyntxnmegeqgtjl-dot-millinium.ey.r.appspot.com
  mkyw.addroits.com
  mkzlywyrjjribbls-dot-millinium.ey.r.appspot.com
  ml-rms.toms.pe
-ml.spin-lucky919.tk
  ml.warzonedns.com
  ml09903.xyz
  ml143332.xyz
@@ -123092,8 +123418,6 @@ mla3-d4-12s-23.com
  mlacademy.net
  mlakshfee.ml
  mlbb-big-events.mrbonus.com
-mlbb-claim-box76.cf
-mlbb-claim-box76.ga
  mlbb-event1.2waky.com
  mlbb-event8.giize.com
  mlbb-free-skins-halloween.mypop3.net
@@ -123111,13 +123435,12 @@ mlbb-skineventpromo229.serveuser.com
  mlbb-skineventpromo231.serveusers.com
  mlbb-skineventpromo233.serveuser.com
  mlbb-skineventpromo437.wikaba.com
-mlbb.eventgame03.my.id
-mlbb2.eventgame03.my.id
  mlbb41.gq
  mlbbevent.xyz
  mlbbfreediamonds36.000webhostapp.com
  mlbbfreeskinnewupdate.zyns.com
  mlbbkof.pocketmc.net
+mlbbm2skinlimitevent.game-free.gq
  mlbbnewupdatefreeskin.zyns.com
  mlbbskineventpromo08.webredirect.org
  mlbbskineventpromo09.webredirect.org
@@ -123154,14 +123477,12 @@ mlhyjlkswtriuhqo-dot-millinium.ey.r.appspot.com
  mliberb.es
  mlilt-net.online
  mlkgflnlxwebikybevrduunekl-dot-gl099898987fhkl.uk.r.appspot.com
-mllbbcodashopevent.codasshopmlbb2.ml
  mllgdcfpqtggvuvgmouhotfnlpjpjpganznv-dot-cryptic-now-290917.ey.r.appspot.com
  mlljoqyfrjwxqlmqdykzchokbdlfwovbkjtb-dot-cryptic-now-290917.ey.r.appspot.com
  mlm.com.sg
  mlm.gyansearch.com
  mlm.lifecapturevision.com
  mlm724.ir
-mlmlogistics.co.za
  mlmpatent.us
  mlmpreis.com
  mlntmeihpoytvpdy-dot-millinium.ey.r.appspot.com
@@ -123184,7 +123505,6 @@ mlwdkaflzkpqccqdaxjuqlltyexdfcfuzufo-dot-cryptic-now-290917.ey.r.appspot.com
  mlwwf.com
  mlx8.com
  mlxmaivknhthoorwuvyremeccrtjxkzpwrqe-dot-glenxpecial3009493.ey.r.appspot.com
-mlxyuscsajhjsebdgmvsustxgu-dot-gle39404049.rj.r.appspot.com
  mlykommi.info
  mlynarskastezka.cz
  mlzw3i742yoq.talagaremix.com
@@ -123257,7 +123577,6 @@ mmlksteel.ch
  mmlures-shop.com
  mmm-global.gq
  mmm2.aaomg.com
-mmm33.ml
  mmmailupgrade.weebly.com
  mmmasnnssss.ml
  mmmclub.cc
@@ -123265,6 +123584,7 @@ mmmdkjmrcc.duckdns.org
  mmmmonsterpack.info
  mmmnmnmnmn.000webhostapp.com
  mmmp.psdzy.com
+mmms7gh3fcssr53.web.app
  mmmtbsusanna.info
  mmmuchc.xyz
  mmmwllmr.com
@@ -123284,6 +123604,7 @@ mmrckgxmdhqbtecdibuwfumwud-dot-gleowayel400503.uc.r.appspot.com
  mmrihe.xyz
  mmrincs.com
  mmrrrrmmrrr.duckdns.org
+mms-eboite.web.app
  mms-ligne-telephonique.webador.co.uk
  mms-sms0766645356.webnode.sk
  mms-sms0787345435.webnode.sk
@@ -123311,7 +123632,6 @@ mmtkqqktyafjgsecnv.top
  mmtnrypchkrcytpwyxuetugzqmekrwfvyzxh-dot-solar-vertex-285913.rj.r.appspot.com
  mmtpivyozzlzddzvbrynysaqcesqglgpdsvl-dot-glxcel49934343434.rj.r.appspot.com
  mmuair-dot-t6yq5rw.rj.r.appspot.com
-mmudatuqfhwsxvmfuxmiwztavo-dot-gle39404049.rj.r.appspot.com
  mmuell.com
  mmuncqqqlzwmmzuh-dot-millinium.ey.r.appspot.com
  mmuoo.com
@@ -123321,6 +123641,7 @@ mmwebmail-87703.web.app
  mmwidcrxkldwvgfmscibdudqyvotwuinfkrw-dot-offglen.uk.r.appspot.com
  mmxdwnatwrsnmstn-dot-millinium.ey.r.appspot.com
  mmxhswouedaak.com
+mmyasinofficial.online
  mmyijtapqztalhse-dot-millinium.ey.r.appspot.com
  mmyjdqofqwgwelpa-dot-millinium.ey.r.appspot.com
  mmz-servis.by
@@ -123344,6 +123665,7 @@ mnbfdertzuiouztgr56789okl.de
  mnbsw.xyz
  mnbsx.xyz
  mnbtmhtksj.duckdns.org
+mnbvfgthnhtbgvfdcsxa.s3.amazonaws.com
  mncarteam.com
  mncelektronik.com
  mncenters.com
@@ -123352,7 +123674,6 @@ mncveozntdotusgm-dot-millinium.ey.r.appspot.com
  mncygdbijhhcgqtxxhcjrmdodx-dot-gloff849483.uk.r.appspot.com
  mndaytrips.com
  mndghdmdkctubbuxmexitqffah-dot-gleowayel400503.uc.r.appspot.com
-mndychnesqudusisterp.dns.army
  mndytheviejupcafgact.dns.army
  mne.edu.vn
  mneatogie.com
@@ -123456,7 +123777,6 @@ mob.wells.banking.connect-account.com
  mob1legend.my.id
  mob93-auth-wells-support.mobi
  mobadarat.ps
-mobadiamond2021.vip-27.ga
  mobaevents-2020new.lflink.com
  mobaillegendseason18.mrbonus.com
  mobaillegendseason18freeskin.mrbonus.com
@@ -123500,9 +123820,6 @@ mobielbankieren.download
  mobiextend.com
  mobigarde-stockage.fr
  mobigoodscom.shaxiacommittee.top
-mobiiiegendss.ga
-mobiiiegendss.ml
-mobiiiegendss.tk
  mobiilbahis232.com
  mobiile.facebook.com.freefire.foxheaven.co.uk
  mobiklprtolterms.ml
@@ -123568,7 +123885,6 @@ mobile-legendsnovember13.mrbonus.com
  mobile-lgems.alsuemdekkzmd.com
  mobile-login-bofa.com
  mobile-ltau.serveirc.com
-mobile-managepayees.com
  mobile-my3.com
  mobile-myee.com
  mobile-n26.com
@@ -123626,8 +123942,6 @@ mobile.fb.com.marketplace.item.70283649883493.com
  mobile.helpfb2313197.fbhhm.com
  mobile.ifacebock.com
  mobile.illumetechnology.com
-mobile.legends-codashop-event.ga
-mobile.legends-codashop-event.gq
  mobile.lnstagram.com.toufikk.com
  mobile.mfrga3inlakmok.com
  mobile.sccom.cn
@@ -123753,7 +124067,6 @@ mobilelegends-events.com
  mobilelegends-infoskins.com
  mobilelegends.bugmoonton.cf
  mobilelegends.xgame-com.cf
-mobilelegends7727.ga
  mobilelegendsactivity9c.cf
  mobilelegendsactivity9c.gq
  mobilelegendsactivitynew.cf
@@ -123789,10 +124102,10 @@ mobilenetworktestingcom.shaxiaprofile.top
  mobilenotaryofcitruscounty.com
  mobilenoticedpayments.com
  mobileofertasblack.com
-mobileokey-in.com
  mobileora.yolasite.com
  mobilepayee-help.com
  mobilepayeeholdverify.com
+mobilepayeenotices.com
  mobilepresentepravoce.com
  mobilepro-tm.online
  mobilepromoc-ef.info
@@ -123917,7 +124230,6 @@ modeloi7nove.cf
  modelsecurities.com
  modelsofmeerut.com
  modelzub.ml
-modennaautocentro.com.br
  moderato-blow.000webhostapp.com
  modern-autoparts.com
  moderna.house
@@ -123962,7 +124274,6 @@ mods59b3tdl.gmz.cc
  modsecpaststudents.com
  modugonggucom.batwoqistart.top
  modul.silenbg.com
-modularch.hu
  modularhouse.vn
  modulationanalyzercom.nckiconsulting.gdn
  modulazione-aggiornamento-intesasp.com
@@ -124394,6 +124705,7 @@ monzahunt.ru
  moocow.party
  mood-oreoo-15.com
  mood-stitches.pt
+moodclothing.net
  moodstreetpetit.nl
  moodyx3x.ddns.net
  mooglee.com
@@ -124460,6 +124772,7 @@ moratomengineering.com
  moravoseeds.com
  morawe-krueger.de
  morawiak.de
+moraymortgages.co.uk
  morba.cz
  morbidnocturnal.com
  mordecaimackenzie.com
@@ -124490,6 +124803,7 @@ moresque-position.000webhostapp.com
  morethanchili.com
  moretheremin.icu
  moretopshop.com
+morfec03.top
  morfey.myftp.org
  morgan-chasie.securechaseproces.com
  morgan-co-otp.com
@@ -124522,6 +124836,7 @@ moripoly.kr
  morish-stopper.000webhostapp.com
  moritzeis.com
  moriyama-cci.org
+morlisanik07.top
  morlisanwr03.top
  morlo.net
  morning.weeklyherald.co
@@ -124541,6 +124856,7 @@ morrisbrotherssigns.com
  morriscommunitysleep.com
  morrislibraryconsulting.com
  morsailorh.com
+morsed01.top
  morsee1337.beget.tech
  morsengthaithai.com
  morshinnet.ru
@@ -124559,6 +124875,8 @@ mortonbahamascom.nckiparis.gdn
  mortonforks.xyz
  mortyboss.xyz
  moruicul.com
+morurt06.top
+morvvg04.top
  morydi.com
  mosaicchristmas.com
  mosaicdevelopmentgroup.org
@@ -124612,6 +124930,7 @@ motelesapolo.motelnow.cl
  motelfortpierce.com
  motelgachsar.com
  motellunaroja.co
+motelvenuspontevedra.com
  motepio24.mobi
  motevasete2.samennoortoos.com
  motez.net
@@ -124638,7 +124957,6 @@ moto-bike.xyz
  moto-quads.com
  moto1lubricant.com
  motocheck.in
-motoftaoahgfoijzjbtrdvqjgh-dot-glmar9393293232323.uk.r.appspot.com
  motog-plus-8thgeneration-64gb.com
  motog-plus-8thgeneration.com
  motog8-plus-xt2019-2.com
@@ -124796,6 +125114,7 @@ mozillamaintenanceservice.duckdns.org
  mozillaupdater.com
  mozishcuiv-ponzle.dynamic-dns.net
  mozywlnybrwzcttl-dot-millinium.ey.r.appspot.com
+mp-verzoekje.eu
  mp.detoken.net
  mp.webexpertsonline.org
  mp.weixin.mnpyv6.cn
@@ -124837,7 +125156,6 @@ mpmlco.com
  mpmyejy3.firebaseapp.com
  mpn.org.in
  mpnamnbbxeymlkzc-dot-millinium.ey.r.appspot.com
-mpnleiblepeanrjfdlzabmruiy-dot-gl099898987fhkl.uk.r.appspot.com
  mpnutaxcsdbbnaavzt.top
  mpoodsine.com
  mpounta-donuts.gr
@@ -124850,7 +125168,6 @@ mps-gruppo.com
  mps-italy-cartetitolari.ssl443.org
  mps-sicurezza-conto.000webhostapp.com
  mpsgraphicssecure.com
-mpsjdzxpfrlgefsqdzjigfdrzx-dot-gle39404049.rj.r.appspot.com
  mpsmobilecom.shaxiaactive.top
  mpsmobileorg.shaxiaadd.top
  mpsmobileorg.shaxianame.top
@@ -124891,7 +125208,6 @@ mqvccrr.kempongkenyot.info
  mqvcwfkuknxamymr.top
  mqxlltszzlzgeewqqmodyfkzwjtkcwuxrtbs-dot-off94032393204.uk.r.appspot.com
  mqxumfbgqevbbmld-dot-millinium.ey.r.appspot.com
-mqyhnfcuvcddlokpvuvubxgzcn-dot-gle39404049.rj.r.appspot.com
  mqyrbdzzxx.duckdns.org
  mr-ads.ir
  mr-concept.pl
@@ -125117,6 +125433,7 @@ msiytbgxdgpoitntzqcxphgooyltrcnpriev-dot-solar-vertex-285913.rj.r.appspot.com
  msizartech.co.za
  msk-gruz-servis.ru
  msk.turbolider.ru
+mskaters.tk
  mskbs.com
  mskhistory.ru
  mskiicpgiieweptwwmwdugsihzxuodawpheb-dot-gl494903049.wl.r.appspot.com
@@ -125159,6 +125476,7 @@ msowaawsbbwqgpzx-dot-millinium.ey.r.appspot.com
  msp-iledefrance.fr
  msparkgaming.com
  mspivfkyakklvhbz-dot-millinium.ey.r.appspot.com
+mspmacquammen.com
  mspmandal.in
  msqigzc.gmz.cc
  msr.myselectedroad.top
@@ -125283,7 +125601,7 @@ mtvstayingalive.org
  mtw4g-ht1-ge2rbh86rhthy.loan
  mtwiedf.godaddysites.com
  mtwsg.com
-mtxbtbqxwgyevoyeqeegyswsbb-dot-gle39404049.rj.r.appspot.com
+mtzbcfh.bar
  mtzkzruefsbypotrmcekiqrulxazxgajdnbp-dot-gl494903049.wl.r.appspot.com
  mu.alexrealtor.us
  mu.aptem.co.uk
@@ -125420,7 +125738,6 @@ multi-sempre-contigo.site
  multi-trexintegfoodsplc.com
  multicarepayroll.com
  multicasemusic.ru
-multicourtage.com
  multiculturalmission.org.au
  multidecora.cl
  multidestinos.co
@@ -125635,7 +125952,6 @@ muudate.nl
  muusahikeopma.xyz
  muwhs.xyz
  muwiqrwjdclevfjelbfplaeoiwovmetdhypw-dot-cedar-code-289917.nn.r.appspot.com
-muwoughmczhpszelnkddksywto-dot-gle39404049.rj.r.appspot.com
  muwroadyargkffic-dot-millinium.ey.r.appspot.com
  muxicgumqacjrxvqhrecwerojkedvccyrrde-dot-offgl8876899977678.uk.r.appspot.com
  muyuy.deqdaf.cn
@@ -125644,7 +125960,6 @@ muzammelhaq.com
  muzeek.initfusion.com
  muzikeyz.com
  muzimbiti.xigubo.co.mz
-muzk.crewlinkmw.com
  muzpfpytsbncfknylievrvtbkpyhbjeicese-dot-solar-vertex-285913.rj.r.appspot.com
  muztarelakop.com
  mv.efetr65.scxw34.wdw2xz.wr35gr.5657tht.vdv.dwr3.clearpointsupplies.com
@@ -125668,7 +125983,6 @@ mvdrepair.com
  mvengemvenge.com
  mvfair.com
  mvhgjvbn.ug
-mvibtqxgurrssohjbqebvnzckp-dot-gl099898987fhkl.uk.r.appspot.com
  mviesntflxsupdt.com
  mview-jp-chastoreitemwebh-webath-003948102037.cf
  mview-jp-chastoreitemwebh-webath-003948102038.cf
@@ -125734,7 +126048,6 @@ mwgjqtmbaetmcctrkd.top
  mwhdprbqpiarhgbwnoavtjjdlgrjmoowftya-dot-cedar-code-289917.nn.r.appspot.com
  mwhite.ru
  mwjhb.dilshantg.com
-mwjwjispzyemmdsbuwppumsuxh-dot-gle39404049.rj.r.appspot.com
  mwmegjjyamxhlnfk-dot-millinium.ey.r.appspot.com
  mwmwylqwftfufcvi-dot-millinium.ey.r.appspot.com
  mwnb93z.com
@@ -125996,11 +126309,11 @@ my-virgin-media-billing.com
  my-virginmedia-billing-info.com
  my-virginmedia-billing.com
  my-virginmedia-help.com
+my-voda.ga
  my-wallet-platinum.info
  my-wallet-platinum.su
  my-way.style
  my-webhost.eu
-my-websites327.000webhostapp.com
  my-whastapp.tk
  my-whatsapp-xpro.gq
  my-wonderland.com
@@ -126023,7 +126336,6 @@ my.cyon.ch.editinglibri.it
  my.dundee1.unee.me
  my.ee-billingfailed.com
  my.eebill.club
-my.express-mailing.com
  my.hmrc-taxclaim.com
  my.instagram.com.login.page.jmz.ir
  my.jcb.co.jp.365huyu.com
@@ -126046,7 +126358,6 @@ my.jcb.co.jp.lijt.top
  my.jcb.co.jp.mjjxy.top
  my.jcb.co.jp.quanmama.org
  my.jcb.co.jp.qxxyy.com
-my.jcb.co.jp.superunder.buzz
  my.jcb.co.jp.wbin.top
  my.jcb.co.jp.xsltjt.com
  my.jcb.co.jp.yulion.vip
@@ -126265,6 +126576,7 @@ my3log-in-secure.com
  my3log.co.uk
  my3management.com
  my3network-help.company
+my3online.co.uk
  my3pay-update.com
  my3payment.co.uk
  my3protect.co.uk
@@ -126362,7 +126674,9 @@ myagentco.com
  myaihqrnxpvyhyllpsfiippnbtxscmuxmjlw-dot-cryptic-now-290917.ey.r.appspot.com
  myairestaurant.com
  myallergydetective.com
+myallexit.xyz
  myamaiorlojaonline.com
+myamazingdailyjournal.com
  myamazon.club
  myamazonwebservices.aws-verlfy.com
  myamzn-checkpoint589861.mywire.org
@@ -126463,7 +126777,6 @@ mybestsite.xyz
  mybeststore.info
  mybestwp.com
  mybible.000webhostapp.com
-mybigfatlistbuilder.com
  mybill-new3.com
  mybill-o2.co.uk
  mybill-o2.com
@@ -126598,6 +126911,7 @@ mydrivepersonfanb.icu
  mydrunkencupcake.icu
  mydshdasjsdhvx.com
  myeb.ir
+myebookmonthly.xyz
  myee-account-billing.com
  myee-account-support-view-my-ee.000webhostapp.com
  myee-accountbilling.com
@@ -126805,6 +127119,7 @@ mygreenonmymailaccount.weebly.com
  mygridironstuff.com
  mygroke.com
  mygroupwhatsapsexy.mrslove.com
+mygroupwhtspapseexxloverss.lflink.com
  mygrowseeds.com
  myguru.us
  mygwyl.shop
@@ -126868,8 +127183,8 @@ myintromations.club
  myintromationsz.xyz
  myintromationszpoo.xyz
  myinvestvision.com
-myips-ds.ml
  myiptv.ca
+myirs.support
  myj33p.com
  myjainshasan.com
  myjcb.update.co.jp.myjcb-service.top
@@ -126941,6 +127256,7 @@ mymailexp.com
  mymakporo.com
  mymanagessoconssl.outmooksecrue.com
  mymanie3jd-d3f.sfo2.digitaloceanspaces.com
+mymatrimony.info
  mymauimaid.com
  mymdxcuzjruvnsbi-dot-millinium.ey.r.appspot.com
  mymediationcom.shaxiaput.top
@@ -126969,6 +127285,7 @@ mymqdnhutcxvsuhc-dot-millinium.ey.r.appspot.com
  mymsn0.yolasite.com
  mymsno.yolasite.com
  mymy.co.il
+mymy.org.uk
  mynailtechnique.com
  mynaturalwelness.com
  mynatwest-id.com
@@ -127012,7 +127329,6 @@ myoffice.limited
  myoffice366-caster-277711.ue.r.appspot.com
  myofficeeplylp2iq2zfi3cyl23bbt1qn1pedy.s3.us-east-2.amazonaws.com
  myofficeplus.com
-myofficesolution.in
  myofficevoicemailadminportal.weebly.com
  myonedrivefile.myvnc.com
  myonline-ee.co.uk
@@ -127120,7 +127436,6 @@ myprrmkijvwmkykeqbdmhvtkntmcvlcnejhy-dot-gl494903049.wl.r.appspot.com
  mypuppysitter.com
  myqatar.com
  myqpotp.com
-myqurbany.co.uk
  myqzygzcfmybjtgr-dot-millinium.ey.r.appspot.com
  myracc.com
  myradius.eu
@@ -127414,7 +127729,6 @@ mzalldat.com
  mzansipay.com
  mzax.info
  mzbomboniere.it
-mzbqjqpjqgwosvqmrwcyienlrm-dot-gle39404049.rj.r.appspot.com
  mzbsabubfmgyepll-dot-millinium.ey.r.appspot.com
  mzcmvmdhvizsfouqxbpmkejkzb-dot-gloff849483.uk.r.appspot.com
  mzcynaih.shoesmogul.com
@@ -127450,7 +127764,6 @@ mzxbvstjacmxpifcxqpzemozmfadsajuratu-dot-solar-vertex-285913.rj.r.appspot.com
  mzxdpdbxlohqaggjkrrerlwycvqqzistgogh-dot-offgl8876899977678.uk.r.appspot.com
  mzxvwcfzefpihaiklhqnqcazbe-dot-gleowayel400503.uc.r.appspot.com
  mzy48domenico.com
-mzzhxktszzuasyqqxyxavfknzm-dot-gle39404049.rj.r.appspot.com
  mzzpgtscnjvumepzfp.top
  mzzxmwefxtifatdx-dot-millinium.ey.r.appspot.com
  n-5.addroits.com
@@ -127835,8 +128148,6 @@ nakant.com
  nakazatomakann.xyz
  nakedlove.co.uk
  nakhonsawangames.com
-nakiri.ru
-nakisamusicac.com
  nakitrade.com
  nakrutkavk.live
  nakshadekho.com
@@ -127857,7 +128168,6 @@ namapak.com
  namastekarnali.com.np
  namdeinvest.com
  name242215315.000webhostapp.com
-name6.yolasite.com
  nameatine.com
  namedban.com
  namedianot.xyz
@@ -127954,7 +128264,6 @@ nanyang.yfqzdfd.com
  naoclpai.com
  naofiquedeforadessamega.com
  naofiquesemcombaterocorona.com
-naomil.net
  naopbfiplyxpifbi-dot-millinium.ey.r.appspot.com
  naopinchi.cn
  naotraffic.com
@@ -128013,7 +128322,6 @@ naruznaya-saratov.ru
  nas-leader.com
  nas.svk-telecom.ru
  nasabonebolango.com
-nasal-spotted-ambulance.glitch.me
  nascar-info.net
  nascentayur.com
  nasekaxtjrldmyxerhrrjblaytcefhwqybxi-dot-glegen303939423233.ue.r.appspot.com
@@ -128175,6 +128483,7 @@ naturalhealthsystems.us
  naturaljovialeditors--five-nine.repl.co
  naturallifeniagara.com
  naturallycuredepression.com
+naturallylivingketo.com
  naturallythrivingyou.com
  naturalma.es
  naturalmango.icu
@@ -128236,6 +128545,7 @@ natwest-secure.live
  natwest-secureapp.com
  natwest-secureserver.ru
  natwest-security-authorise-user9103910.net
+natwest-verify.com
  natwest.active-payee.co.uk
  natwest.addedpaymentschecks.com
  natwest.cancel-action.com
@@ -128274,6 +128584,7 @@ natwest.personal-online-valid-login.com
  natwest.personal-opts.com
  natwest.personal-reg.com
  natwest.personal-sec.com
+natwest.personal-verify-dev.com
  natwest.personals-account.com
  natwest.personals-login.com
  natwest.personals-member.com
@@ -128483,6 +128794,7 @@ nbpm.svcoding.com
  nbpropiedades.cl
  nbqjzurncbhvngjp-dot-millinium.ey.r.appspot.com
  nbqwhwq9uz.com
+nbr.hms.ge
  nbrkulqbxbhchqmt-dot-millinium.ey.r.appspot.com
  nbrl.com.np
  nbs0.mentriqq.com
@@ -128492,6 +128804,7 @@ nbshe.top
  nbstm.com
  nbtluikmmsqbqmyd-dot-millinium.ey.r.appspot.com
  nbtreeservice.com
+nbtysiort.work
  nbubvtjbvgeowpxhtinfjydrqqpqwwqwyrjp-dot-glxcel49934343434.rj.r.appspot.com
  nbushudfhusf.cf
  nbuy.ga
@@ -128661,6 +128974,7 @@ ne1.apparteworkshop.com
  ne1tflx3-2sign.com
  ne4tflix2-inf0.com
  ne666an.xyz
+ne83qbep.com
  nealhelps.com
  nealhunterhyde.com
  neallaw.ca
@@ -129622,6 +129936,7 @@ neuralmapper.com
  neurocir.cl
  neuroconsciencias.com
  neuroen.de
+neuroenergy.fahadjutt.com
  neurolat.id
  neurolinguistics.xyz
  neurologieregensburgde.nckiphoto.gdn
@@ -129664,7 +129979,6 @@ new-attempted-device.com
  new-attempted-login.com
  new-attempted-login.link
  new-center-fargo.work
-new-connected-device.com
  new-coronavirusmask.com
  new-credit.space
  new-deregistered-device.com
@@ -129683,7 +129997,6 @@ new-eebill.com
  new-evenst-pubg-royalepas13.000webhostapp.com
  new-facebook.de
  new-faceeboook.000webhostapp.com
-new-freefire-com.tk
  new-grupwa.xxuz.com
  new-indycb-dot-phpapp-shshh.df.r.appspot.com
  new-log-facebook.cf
@@ -129814,6 +130127,7 @@ new.updating.assistance.calcustomsdoorrefinishing.com
  new.vipgoma.com
  new.vodakiosk.ru
  new.yeouth.com
+new.zooplanet.it
  new2.aaomg.com
  new2.tcsert.ru
  new2019.mine.nu
@@ -129822,7 +130136,6 @@ new2020groupwhatsapp18.ve99.net
  new3-authorisation.com
  new3-network.com
  new4.pipl.ua
-new5-upd4tes.dagwdwafdhser.com
  newabidgoods.com
  newaccess-288111.ey.r.appspot.com
  newaccountaccess.ddns.net
@@ -129928,6 +130241,7 @@ newerlife.org
  newessayhelp.live
  newevent-freefire27.login-772.cf
  neweventmlbb2020.dynamic-dns.net
+neweventrewards.com
  newevents-mobilelegends.cf
  newevents12.qqpubgmevents.com
  neweventsdarigarenakulgar.claims2.com
@@ -130079,7 +130393,6 @@ newpayee-secured.com
  newpayee-securityvalidation.com
  newpayee-verifyalert.com
  newpayeeadd-secure.com
-newpayeealerts-secure.com
  newpayeecancel.net
  newpayeehalifax.com
  newpayeehelp-halifax.com
@@ -130248,7 +130561,6 @@ newsonic.com
  newsped.eu
  newspinhalloween.com
  newspinpubg.net
-newspinpubg21.ga
  newsrecord.info
  newsreviewdocs.com
  newsspe.com
@@ -130397,7 +130709,10 @@ nfdindfb.net
  nfdre.xyz
  nfe168.com
  nfe98hnnwu98.df.r.appspot.com
+nfedisponivelmaspi.email
+nfegestaomaspi.monster
  nfejezpqhraypysdfynarcebizpgfcjczotm-dot-glegen303939423233.ue.r.appspot.com
+nfemaspimail.club
  nfentz.vipsnapchatsexting.com
  nff-api.aldhub.com
  nffdg43zx.appspot.com
@@ -130406,7 +130721,6 @@ nffiiload04.top
  nffiiload07.top
  nffiiload08.top
  nffiiload09.top
-nfhrdjinyltdttmsykogikhkub-dot-gl099898987fhkl.uk.r.appspot.com
  nfhxlmobskzdeplosbuwxeblsbxgpwgnrito-dot-cedar-code-289917.nn.r.appspot.com
  nfigjekqhmctvufgenzhxenqqoxploqidvjt-dot-glenxpecial3009493.ey.r.appspot.com
  nfiru.xyz
@@ -130439,7 +130753,6 @@ nfx1-acc647.info
  nfxltwwahwapomxlofryrhtfkndeckpcaejp-dot-solar-vertex-285913.rj.r.appspot.com
  nfxsgccopdsyyryexjogisqcjykbatwdostj-dot-solar-vertex-285913.rj.r.appspot.com
  nfzedl.shoesmogul.com
-nfzlfwlmsrecornfuxaossebib-dot-gle39404049.rj.r.appspot.com
  ng-1s.addroits.com
  ng-bank.com
  ng-tech.ru
@@ -130482,7 +130795,6 @@ ngentotinstrihot.zzux.com
  ngentotwabkp.kozow.com
  ngentotwabkp.mywire.org
  ngetdbkepwa.xx.ygto.com
-ngewebokep-janda6.freetcp.com
  ngeweenak.sorehtrss.com
  ngeweyuk.join-wa.net
  ngezen.com
@@ -130631,7 +130943,6 @@ nhs6.azurewebsites.net
  nhsakwfexpagqaxtgwyfmotobuykbrgcetrd-dot-cedar-code-289917.nn.r.appspot.com
  nhsedytmhhoxvnio-dot-millinium.ey.r.appspot.com
  nhsmembershipdatabase.weebly.com
-nhsportal.uk
  nhstudioz.tv
  nhsuh.xyz
  nhsuuioo.cam
@@ -130687,6 +130998,7 @@ ni4738667-3.web19.nitrado.hosting
  nia.psdzy.com
  niaa.org.au
  niaayuningimandari.com
+niagaborong.com
  niagarabeveragesintl.com
  niagaracost.com
  niagaraeventmedia.com
@@ -130755,7 +131067,6 @@ nicole60158993.xyz
  nicoleaeschbachorg.wordpress.com
  nicolecourt.xyz
  nicoledeas.com
-nicoleling.com
  nicolerdixon.com
  nicolesprenger.com
  nicolettasaraceni.servebeer.com
@@ -130880,7 +131191,6 @@ niko.lv
  nikoenoine.in
  nikolajwulff.dk
  nikolausfordbris.xyz
-nikolcontestoriflame1.000webhostapp.com
  nikolei.eu
  nikolovmedia.com
  nikolpashinyanharcer3.000webhostapp.com
@@ -130972,7 +131282,6 @@ niptz.org
  nipunrox.000webhostapp.com
  niqewetoairtzleg-dot-millinium.ey.r.appspot.com
  niqkebhlcphlnutr-dot-millinium.ey.r.appspot.com
-niqybkxwantzjehtpydryzqubm-dot-gle39404049.rj.r.appspot.com
  niralsolutions.com
  nirdhansevaksangh.org
  nireuhzuz.net
@@ -131077,7 +131386,6 @@ njhfdrds.godaddysites.com
  njhost.hopto.org
  njhungry.com
  nji2.byethost24.com
-njjcsqfzckliiuewjgrejgzuna-dot-gle39404049.rj.r.appspot.com
  njjfxgggkqkdlpoy-dot-millinium.ey.r.appspot.com
  njjhwgzcbpvuxqeg-dot-millinium.ey.r.appspot.com
  njjkpmdeoyszxppl-dot-millinium.ey.r.appspot.com
@@ -131121,12 +131429,10 @@ njzbdsdpplnyvhtc-dot-millinium.ey.r.appspot.com
  nk3.8wix.com
  nkanyezikubheka.com
  nkap.global
-nkaqccflpbcoeoigossqcdrvkt-dot-gle39404049.rj.r.appspot.com
  nkausyrsbnmxaqfb-dot-millinium.ey.r.appspot.com
  nkax.svcoding.com
  nkbanks.com
  nkcceuin2udd.talagaremix.com
-nkcnuqtbzpedsnuriomdgglkiq-dot-gle39404049.rj.r.appspot.com
  nkcoupon.com
  nkdctrust.in
  nkddnxdswaifmaomeo.top
@@ -131139,7 +131445,6 @@ nkguxpfcbfsrvrdehmegelkhum-dot-triple-upgrade-293822.rj.r.appspot.com
  nkguxpfcbfsrvrdehmegelkhum.triple-upgrade-293822.rj.r.appspot.com
  nkh.goruli.com
  nkhbop.app.link
-nkhogfatwnqdyjgtbadszvapnk-dot-glmar9393293232323.uk.r.appspot.com
  nkj32.ailacabs.com
  nkjs.shoesmogul.com
  nkl.dogestocks.com
@@ -131352,7 +131657,6 @@ nntjopepqzojktrl-dot-millinium.ey.r.appspot.com
  nntjwqsgnlccasbjxrsirmwejw-dot-owaonk399399393.uk.r.appspot.com
  nntrd.svcoding.com
  nntyxaqbifimjvms-dot-millinium.ey.r.appspot.com
-nnufableaxfhyzryulvhcwbwle-dot-gle39404049.rj.r.appspot.com
  nnumlftifszobppk-dot-millinium.ey.r.appspot.com
  nnwq.ru
  nnxdlp.com
@@ -131450,6 +131754,7 @@ nocontent-algwofjz.velocityhub.com
  nocontent-bbpcytxb.velocityhub.com
  nocontent-ctiezzsv.velocityhub.com
  nocontent-dwpmcmyu.velocityhub.com
+nocontent-fnhqeato.velocityhub.com
  nocontent-giffgiso.velocityhub.com
  nocontent-gqmwtfmh.velocityhub.com
  nocontent-gyuenowf.velocityhub.com
@@ -131516,7 +131821,6 @@ nocopropertyvalues.com
  nocoronavirus.info
  nocturnalbounderby.net
  nocvvshopping.ru
-nocwdynmzliqevsjnwvvoiszjx-dot-gle39404049.rj.r.appspot.com
  noda-8879.cf
  nodedeveloperconferencecom.nckiphoto.gdn
  nodeis-securedmobliesverfed.id-roalsuwepaierm.com
@@ -131533,6 +131837,7 @@ noe-fbv2.ddnslive.com
  noeby.mx
  noeexorcit.com
  noemainteriors.com
+noerebel.com
  noerregaard.mmtest.dk
  noesis.tech
  nofafloors.com
@@ -131697,9 +132002,11 @@ nonspam.hopto.org
  nonstopchampionship.com
  nontnvideoku.000webhostapp.com
  nonton.mobi
+nontonbareng.freefire-biz.ga
  nontonbikep1.jkub.com
  nontonbokep17.jkub.com
  nontongratisxnxx.dns2.us
+nontonjanda.freefire-biz.ga
  nontonporngratisxnxxnovpn.mrslove.com
  nontonporngratisxnxxnovpn1.my03.com
  nontonsampaibasahcrpt.000webhostapp.com
@@ -131829,6 +132136,7 @@ noreply-team.it
  noreply.paypal.com.jajaleen.com
  noreply.securityinstagramm.tk
  noreply2.com
+noreply97.godaddysites.com
  noreplyaccountupdateinfo.com
  noreplychasecare.ooguy.com
  noreplycurentlyattlogin.weebly.com
@@ -131849,6 +132157,7 @@ norikkon.com
  noritakechina.com
  norma43645.xyz
  normacode.com
+normaldiestay.us
  normally-story.xyz
  normankamerusecurepaymentapple-appstore.yagusikoman.com
  normassur.net
@@ -131899,7 +132208,7 @@ northgate.network
  northherovth.buzz
  northindiagroup.com
  northkorisla.co
-northoil-files.online
+northlewishjersey.com
  northportdentures.com
  northquestinvestments.london
  northropmn.buzz
@@ -132127,7 +132436,6 @@ notify-alert.secure01a.chase.com-auth.credit-financebank.com
  notify-alert.secure01a.chase.com-auth.mydailywire.us
  notify-alert.secure01c.chase.com-auth.credit-financebank.com
  notify.webcenter-netflix.com
-notifydetectpayment.com
  notifydevice-alert.com
  notifyfatairge-uservalidateuseronline.com
  notifykcom-052739194.michelademarco.it
@@ -132148,6 +132456,7 @@ notifykcom-915949292.michelademarco.it
  notifykcom-920760466.michelademarco.it
  notifykcom-962107463.michelademarco.it
  notifykcom-967979849.michelademarco.it
+notifymobilealerts.com
  notifymsgs.ey.r.appspot.com
  notifyupdt-informaccessnewdvcid.com
  notifyupdt-savelocaldataaccess.com
@@ -132162,7 +132471,6 @@ notla.ddns.net
  notlficatlonbofa.sytes.net
  notmissingout.com
  notnice.club
-notnot.holzn.org
  notnotnew.invt-me9.gq
  notonmane.tk
  notpaidsz.com
@@ -132229,7 +132537,6 @@ noveamining.com
  novelcoronavirus.cc
  novelcoronavirusnews.xyz
  noveldocs.com
-novelelderlylocation.sdsdsdsd77dsdsd.repl.co
  novelideas.com
  novelindo.xyz
  novellastrave.xyz
@@ -132298,7 +132605,6 @@ nowuseeitplayer.com
  nowxefedefed.com
  nox.landscom.org
  nozaki777.com
-noziha.top
  nozniemus.pnbdwrmmxkie.top
  nozrnxmhowbbcprszmcdjiuqpxptlxnpntqi-dot-glegen303939423233.ue.r.appspot.com
  np1m25u.ambi.cc
@@ -132357,7 +132663,6 @@ nqibfm.rogagot.com
  nqkufpfbnnaiipvj-dot-millinium.ey.r.appspot.com
  nqlaaooroqyqnssw-dot-millinium.ey.r.appspot.com
  nqldezctjvfgzkai-dot-millinium.ey.r.appspot.com
-nqldnnnzqyrqkswjfbrkmqbrpw-dot-gle39404049.rj.r.appspot.com
  nqlpydccajjnfdog-dot-millinium.ey.r.appspot.com
  nqmjmhjguvmmivnysstkgcxnws-dot-gleowayel400503.uc.r.appspot.com
  nqodvrcwkdsaspzg-dot-millinium.ey.r.appspot.com
@@ -132509,7 +132814,6 @@ nseriesgpu.ml
  nserver1-e5ff1.firebaseapp.com
  nsexqmxyemegmzbe-dot-millinium.ey.r.appspot.com
  nsgjtexeytehffltrjttzppppatrbocylcqr-dot-cedar-code-289917.nn.r.appspot.com
-nsgoomqogosjieyabfjqowomgg-dot-gle39404049.rj.r.appspot.com
  nsgvcxzcv.ug
  nsh.svcoding.com
  nsh3gs.xyz
@@ -132540,7 +132844,6 @@ nsnxbkidzoxvxeae-dot-millinium.ey.r.appspot.com
  nsnyecbymqfgkhpfnksubtmgmr-dot-gleowayel400503.uc.r.appspot.com
  nsogbu1.tk
  nsond.000webhostapp.com
-nsooxqcyqbhwczpeyratdwtpxy-dot-gle39404049.rj.r.appspot.com
  nsozai.com
  nsp.biz.ua
  nsp.vipshop.ru
@@ -132860,7 +133163,6 @@ nvdvdgp.com
  nvegqbqcizfljqkq-dot-millinium.ey.r.appspot.com
  nvelj12qyyfi03kqxy.xyz
  nvfuklnxizeidnafxbavelfxlc-dot-gleowayel400503.uc.r.appspot.com
-nvgeeforsegt.ru
  nvgp.com.au
  nvips.eu
  nvits.space
@@ -132890,7 +133192,6 @@ nvwoodwerks.com
  nvwpyymjyohowgkt-dot-millinium.ey.r.appspot.com
  nvxabbpwrlpvwegpiyddqmaapx-dot-gloff849483.uk.r.appspot.com
  nvxgitbsgyxmmkag-dot-millinium.ey.r.appspot.com
-nw-confirm.com
  nw-industries.co.id
  nw-resources.com
  nw-secured.co.uk
@@ -132930,7 +133231,6 @@ nwolb-app.net
  nwolb-online.net
  nwolb-online.services
  nwolb-review-payment.com
-nwolb-verifypayee.com
  nwolb.attempted-payment.com
  nwolb.authpayee.link
  nwolb.com.authorise-payee-5372.info
@@ -132972,7 +133272,6 @@ nwyyrkeevbrbqghwju.top
  nx8s.svcoding.com
  nx9cbqibbbx0aje.web.app
  nxbanjia.cn
-nxbbwmyeglnisnoqhlxdzutwss-dot-gle39404049.rj.r.appspot.com
  nxbdantri.com.vn
  nxbwhfkkkrwecrvp-dot-dbenitonline.ey.r.appspot.com
  nxbyhbrff.rogagot.com
@@ -133061,6 +133360,7 @@ nyifdmacyzechariah.top
  nyjzcfvrcbmcgjzw-dot-millinium.ey.r.appspot.com
  nykfxejyofijbkhz-dot-millinium.ey.r.appspot.com
  nykn.jaysbrand.com
+nym18ltpsyu03hdabh.xyz
  nymassagezone.com
  nymedicalchannel.com
  nymphalid-cranks.000webhostapp.com
@@ -133070,13 +133370,11 @@ nyp86.addroits.com
  nyprwire.com
  nypskxmlemtmchvmrbocjihsuf-dot-gleowayel400503.uc.r.appspot.com
  nypthealing.com
-nyqhwhnlpfvoxdgvuyaghoispc-dot-gl099898987fhkl.uk.r.appspot.com
  nyqzgkrzgrmcynrlnwzvrvqtjyfqhcvonhym-dot-glxcel49934343434.rj.r.appspot.com
  nyqzuhuapseeiowm-dot-millinium.ey.r.appspot.com
  nyrlnrwfbcveugqkoyqplkjxqt-dot-gleowayel400503.uc.r.appspot.com
  nyrwe.addroits.com
  nysdiqoipxusedej-dot-millinium.ey.r.appspot.com
-nysllhnxxgmsqvpqftrretaswo-dot-gle39404049.rj.r.appspot.com
  nysos.se
  nystep.hatakaprokinretshish.com
  nytsa.cn
@@ -133106,7 +133404,6 @@ nzau.xyz
  nzauth.me
  nzaw.drofortho.com
  nzbhtehnlyujypls-dot-millinium.ey.r.appspot.com
-nzbsxnliqotrbjzqswmxgpjtbd-dot-gle39404049.rj.r.appspot.com
  nzby1orv6o.000webhostapp.com
  nzbybike.stage.net.nz
  nzcnmehyvwoopdot-dot-millinium.ey.r.appspot.com
@@ -133172,7 +133469,6 @@ o16yo66rdq91v8q16vaq.today
  o1ps.xyz
  o2-accountauth.com
  o2-accounthelp.com
-o2-accounts-information.com
  o2-accounts.com
  o2-alerts.com
  o2-auth.net
@@ -133197,6 +133493,7 @@ o2-billingpage.com
  o2-billingsecure.com
  o2-billingsupports.com
  o2-billinguk.com
+o2-billingupdatefailure.com
  o2-billsupport.co
  o2-billupdate.com
  o2-change-billing.com
@@ -133222,7 +133519,6 @@ o2-securebilling.com
  o2-secureverify.com
  o2-securityteam.com
  o2-support.net
-o2-uk-resolution.com
  o2-updatebilling.com
  o2-updatebillinginfo.com
  o2-updatebillingvia.com
@@ -133428,7 +133724,6 @@ obckcuomrz.duckdns.org
  obd.cvts.ng
  obdruuguayvttwih-dot-millinium.ey.r.appspot.com
  obdtmghfvzigqbnb-dot-millinium.ey.r.appspot.com
-obec.me
  obecimso.net
  obeellor.xyz
  obeikanprojects.tech
@@ -133438,7 +133733,6 @@ obes.shoesmogul.com
  obgeogjxabsteawcvnllrroema-dot-gleowayel400503.uc.r.appspot.com
  obgynonthepark.com
  obgynresults.com
-obhdoxgetkjwiesxxchgzumdqv-dot-gle39404049.rj.r.appspot.com
  obhoy.com
  obi-bxqxv-----login.ygber.com
  obi-caxcv-----login.ygber.com
@@ -133456,7 +133750,6 @@ obinspirations.com
  obird.ca
  obiwan2021.xyz
  obixpdf.sa7o.com
-object-storage-oo.s3-web.jp-tok.cloud-object-storage.appdomain.cloud
  objectionable-elimi.000webhostapp.com
  objectionsupportform.tk
  objectiontocopyrightlnstagram.com
@@ -133494,11 +133787,15 @@ obrolanology.com
  obscure-headland-14472.herokuapp.com
  obscureallude.com
  obscureip.net
-obscurevolcano.com
  obseques-conseils.com
  obserai.co.jp
  observant-fossil-chopper.glitch.me
  observantdick.org
+observation-expert-ck5992746831259852649901.tk
+observation-expert-ck5992746831259852649902.tk
+observation-expert-ck5992746831259852649903.tk
+observation-expert-ck5992746831259852649904.tk
+observation-expert-ck5992746831259852649905.tk
  observational.pw
  observatoriodagastronomia.com.br
  observatoriodatosabiertosgenero.org
@@ -133533,6 +133830,7 @@ oc-44638740.iptvhdcenter.com
  oc-55831825.iptvhdcenter.com
  oc-61681308.iptvhdcenter.com
  oc-86377098.iptvhdcenter.com
+oc5p5jb3eyyqrvmlqpftgsrflm--www-paypal-com.translate.goog
  ocactcardhelp.xyz
  ocadjndaibjsyeul-dot-millinium.ey.r.appspot.com
  ocajrlmovqbiqqdq-dot-millinium.ey.r.appspot.com
@@ -133540,7 +133838,6 @@ ocallicut.info
  ocampoalbal.net
  ocatklrqrtdjdmva-dot-millinium.ey.r.appspot.com
  ocbec.net
-ocbzfypessmnjukjkzhrmiundx-dot-gle39404049.rj.r.appspot.com
  occidebokomining.net
  occmedconnect.com
  occn-asecna.org
@@ -133564,6 +133861,7 @@ oceanpowerinstitute.com
  oceans-news.com
  oceantires.com
  oceanvibes.com.au
+oceanwaterfree34.xyz
  oceetee-my.sharepoint.com
  ocelliptigo.com
  ocemente.ru
@@ -133578,7 +133876,6 @@ ocharos.com
  ochgpvhrfrbcjdos-dot-millinium.ey.r.appspot.com
  ochibqksfrqctjas-dot-millinium.ey.r.appspot.com
  ochs2001alumni.org
-ocicklmxkgbqdvpzbhdkntsrvk-dot-glmar9393293232323.uk.r.appspot.com
  ocidadaobrasileiro.com
  ocidvbe.com
  ocijkxpgbvoldctj-dot-millinium.ey.r.appspot.com
@@ -133739,7 +134036,6 @@ oefhnymxufpyyozg-dot-millinium.ey.r.appspot.com
  oeglum.net
  oegtxtfdgixxhtmy-dot-millinium.ey.r.appspot.com
  oehovnecikiseqvh-dot-millinium.ey.r.appspot.com
-oehulovqlwmuwlxpealbehdnzp-dot-gle39404049.rj.r.appspot.com
  oehyjsrzvphbgftx-dot-millinium.ey.r.appspot.com
  oeiindkeanc.uoayzwvxms.top
  oeiiwtrfdcyv.singgihpitono.com
@@ -133784,7 +134080,6 @@ of-icc-es-123.du.r.appspot.com
  of357-alternate.app.link
  ofacepraelasok.xyz
  ofam.com.ru
-ofaqfdaybabzfphbdwzvqcpmwz-dot-gle39404049.rj.r.appspot.com
  ofcaidqnvyfutdrhncdgejaovuvxcrvknnxs-dot-glenxpecial3009493.ey.r.appspot.com
  ofcatalin.it
  ofdpsogtdpaljfus-dot-millinium.ey.r.appspot.com
@@ -134198,7 +134493,6 @@ office-wff-administration.com
  office.callav.xyz
  office.cetino.com
  office.com.biaclient.com
-office.com.lang-en.ga
  office.com.office.ha-poc-mcafee-o365.homeaffairsstage2ucepoc.myshn.net
  office.com.office.jconew.mcafeeoct25201814800.myshn.net
  office.com.office.o365-demo.skyhighdemo64.myshn.net
@@ -134288,7 +134582,6 @@ office365privately-owned1rmospe8lumq0c7.azurewebsites.net
  office365recover.com
  office365s.ddns.net
  office365update.duckdns.org
-office365valid.vercel.app
  office365voicemail.serveirc.com
  office365voicemailcovid19.com
  office365voicemailmessagenotification.weebly.com
@@ -134405,7 +134698,6 @@ officialnightingalemovie.com
  officialprimes.duckdns.org
  officialpubgm13.com
  officialpubgmseason16.com
-officialpubgtournament.com
  officialramacherone.chifanaudit.top
  officials.pubgcompany.com
  officialsupportdesk.weebly.com
@@ -134439,24 +134731,15 @@ offroadeventsca.com
  offroadeventsusa.com
  offs-35320638.rochesternutritionist.com
  offs-71620581.rochesternutritionist.com
-offs-fb-09wravpku.cafinforma.it
-offs-fb-1dxqqy7dd.cafinforma.it
-offs-fb-2gzah7qtk1.cafinforma.it
  offs-fb-6akzz20cw1.cafinforma.it
-offs-fb-cduiwarm2.cafinforma.it
-offs-fb-fogdvdq2o6.cafinforma.it
  offs-fb-jlxtr56uisqs.cafinforma.it
-offs-fb-l7iegsl191.cafinforma.it
-offs-fb-lkw8g2ore.cafinforma.it
-offs-fb-qfqateguf.cafinforma.it
-offs-fb-rxblv851sd.cafinforma.it
  offs-fb-shrnnsgu1wj.cafinforma.it
  offs-fb-w3mgz9x47gm.cafinforma.it
-offs-fb-z96wqgbl8.cafinforma.it
  offshore-bankingpro.com
  offshorecitizen.bk-groups.com
  offside2.000webhostapp.com
  offsolo-gbb.tech
+offstore.co
  offteaminvitsppdpddpid0c.an.r.appspot.com
  offthewall.top
  offwhiteoallrightou.today
@@ -134548,8 +134831,6 @@ ogloszenie-kupteraz.in.net
  ogloszenie-nagrod.eu
  ogloszenie24-857362.in.net
  ogmlwuiyhtptuwmz-dot-millinium.ey.r.appspot.com
-ogmspbsnydkdqhbupxztzrqsug-dot-gle39404049.rj.r.appspot.com
-ogmxytmsasmimgjagwtoyppyro-dot-gle39404049.rj.r.appspot.com
  ogo.gl
  ogochi.000webhostapp.com
  ogoimbjqoswbnasp-dot-millinium.ey.r.appspot.com
@@ -134575,7 +134856,6 @@ ogz6d.codesandbox.io
  ogzetmailc.temp.swtest.ru
  ogzfixsde.goruli.com
  ogzmnprftxgvrmxz-dot-millinium.ey.r.appspot.com
-ogznoctrhxgwosmlymzvwzdqci-dot-gle39404049.rj.r.appspot.com
  ogztswyditfpmpavbagokhswrn-dot-gleowayel400503.uc.r.appspot.com
  oh2.live
  ohaalgszsrluosdt-dot-millinium.ey.r.appspot.com
@@ -134591,7 +134871,6 @@ ohccrxmjqttnaxjp-dot-millinium.ey.r.appspot.com
  ohcfajuvrqakrsntystcrsembw-dot-gleowayel400503.uc.r.appspot.com
  ohchij9pai.agency
  ohcisjiidkbpciqb-dot-millinium.ey.r.appspot.com
-ohdevwcowuk.gb.net
  ohdxjjawdkxicvsjhxrhiqxmhf-dot-gleowayel400503.uc.r.appspot.com
  ohe.ie
  ohfebveub.xyz
@@ -134721,7 +135000,6 @@ ojdopffanwstqzusmepnsovikmrcefhtjbjr-dot-glegen303939423233.ue.r.appspot.com
  ojdoweotyrfugnls-dot-millinium.ey.r.appspot.com
  ojdtdoc.goruli.com
  ojejku.5v.pl
-ojfrvdcsgwhrotnuiuvaduyxyw-dot-glmar9393293232323.uk.r.appspot.com
  ojhtewxjfoqajgumuyoaouggmw-dot-gleowayel400503.uc.r.appspot.com
  ojibak123rcketlrude0822.top
  ojibak123rpkotgsply.top
@@ -134744,7 +135022,6 @@ ojosujono.com
  ojoymari.000webhostapp.com
  ojramjazodqxqnng-dot-millinium.ey.r.appspot.com
  ojrdlmplbvrm.kagakuningu.com
-ojrrawacbhhaqczhyudugiaenf-dot-glmar9393293232323.uk.r.appspot.com
  ojruwcztrbprmchv-dot-millinium.ey.r.appspot.com
  ojs.akamigasbalongan.ac.id
  ojs.budimulia.ac.id
@@ -134762,7 +135039,6 @@ ok-bonusesfera.hopto.org
  ok.uananymore.ru
  ok.ygto.com
  ok0009.com
-ok202088.com
  oka-kaikei-okayama.com
  okactprep.com
  okamayasahashi.online
@@ -134808,7 +135084,6 @@ okletsbuy.com
  oklogallem.com
  okmboperation.co.vu
  okmiju.abushuodsfm.top
-okmqdygimkujaxsfvkjllgbkbg-dot-gl099898987fhkl.uk.r.appspot.com
  okmuitomelhor.tk
  okna-43.ru
  okna-pvh-deshevo.ru
@@ -134903,14 +135178,12 @@ old-things.xyz
  old-tosu-9221.verse.jp
  old.777.exoret.com
  old.antenesmenorca.com
-old.chipfc.com
  old.dm.kh.ua
  old.durchgegorene-weine.de
  old.gotyoufloored.com
  old.hostmaster.xn--blockchin-c2d.com
  old.manuengelen.be
  old.mkt.exoret.com
-old.nuft.edu.ua
  old.partiesunlimited.net
  old.pubgvozd.by
  old.shop.xn--kaken-tbb.com
@@ -134974,7 +135247,6 @@ oldschoolrunescape-awards.com
  oldstyle.ro
  oldthemahalo.webgraphity.com
  oldtime.ddns.net
-oldwhiskeybarrels.top
  oldwomenmiss.us-south.cf.appdomain.cloud
  oleegoli.com
  oleeol.info
@@ -135015,7 +135287,6 @@ olive2020.space
  olivedaleproperties.com
  oliveopenpriorities.figueroaads123.repl.co
  olivercorron.cf
-oliverisdeli.com.au
  oliverkremer.net
  oliverodd.com
  olivestyling.com
@@ -135055,7 +135326,6 @@ olpzbexcszkecvjk-dot-millinium.ey.r.appspot.com
  olrfj.yolasite.com
  olrheackwltfeehl-dot-millinium.ey.r.appspot.com
  olrpthononttanoq-dot-millinium.ey.r.appspot.com
-olrratnbcjrijaskjecutneevl-dot-gle39404049.rj.r.appspot.com
  olrsezyhapclljdc-dot-millinium.ey.r.appspot.com
  olssondesignfirm.com
  olt.aletitself.ru
@@ -135090,16 +135360,15 @@ olx-pl.ml
  olx-polland.com
  olx-secure.pl
  olx-y.pl
-olx.ogloszenia.pl.r9s.eu
  olx.pl-safe.oferta-payment.cc
  olx.pl.3ds.website
+olx.pl.oferta-payment.biz
  olx.pl.oferta.kim
  olx.pl.platnosc.info
  olx.ua.obyavlenle.info
  olx.vote
  olxdostawa.com
  olxmobiles.pk
-olxpaysafe.pl
  olxpl.3dsecurity.info
  olxpl.online
  olxpl.youroplata.online
@@ -135113,7 +135382,6 @@ olymtyher.com
  olyqdghdlzfgphmdwvbyukdsfm-dot-poised-bot-306515.uk.r.appspot.com
  olysealants.cf
  olznfeabweamurzw-dot-millinium.ey.r.appspot.com
-om-cars.be
  om-post-63571355.bebayuakademi.edu.my
  om86.ru
  om87pek.senandungmerana.info
@@ -135137,6 +135405,7 @@ ombmcfoowjonkdhlkmwetsndixrddjhkwubm-dot-solar-vertex-285913.rj.r.appspot.com
  ombnvkjzqsjpuohxorwzmarchn-dot-poised-bot-306515.uk.r.appspot.com
  ombuddhasaving.com.np
  omcronenergy.com
+omdc.co.in
  omdqkdoqninubnvk-dot-millinium.ey.r.appspot.com
  omdream.com.br
  ome2j3bw.3utilities.com
@@ -135153,6 +135422,7 @@ omegamarinagroup.com
  omegatravelandtour.com
  omegawiki.dynalias.com
  omelettewhimplev.com
+omelezatava.com
  omelhor-mes-em-variedades-express.com
  omelhor-sempre-aqui-do-seu-lado.com
  omelhorconjuntodatramontinaparavoce.club
@@ -135161,7 +135431,6 @@ omelhorsempreparavoce.com
  omelhorsiteparacomprarcomprecobaixo.club
  omelhorsmartphonedomomento.club
  omentradinginternationalprivateltd.duckdns.org
-omeoww.cn
  omergunes.net
  omeryener.com.tr
  omesdejuunhotodoexclusivo.com
@@ -135409,7 +135678,6 @@ onefarmdesign.com
  onefibre.co.uk
  onefifteen.nl
  oneflextiank.com
-onegonaddown.com
  onegreen.hk
  oneheartwarriors.at
  oneidcode.com
@@ -135602,6 +135870,7 @@ online-compte-securitaire.webnode.com.co
  online-crescent.000webhostapp.com
  online-customer-support.beribucaratelahkucoba.com
  online-dating-safe.com
+online-deregister-payee.com
  online-device-alert.com
  online-device-secure.com
  online-device-secured.com
@@ -135624,7 +135893,6 @@ online-help-uk-centre.com
  online-hm-application.ga
  online-home-job-scheme.djsanjay.in
  online-ib.com
-online-ibancontroleren.info
  online-ibercajadirecto-iniciar.com
  online-ideal-verzoek.icu
  online-inet.de
@@ -136327,7 +136595,6 @@ open-checkid.co
  open-checkjpid.co
  open-css.money
  open-field-outlet.000webhostapp.com
-open-games.tk
  open-roll.com
  open-vcs-gadis.qepxhp.ga
  open-way-view.ga
@@ -136370,7 +136637,6 @@ openrakutan.xyz
  openrakutan01.xyz
  openrkwe.com
  openroadloyalty.com
-openrunicpower.com
  opensaleevent.su
  opensalehit.ru
  openscholarshipcovid19.com
@@ -136409,11 +136675,9 @@ operationnetflix21.info
  operationnetflix22.info
  operationsnetflix.info
  operationwildplaces.com
-operatpey.net
  operatrustnationalbank.com
  operazione-sicura.com
  operosehardworking.com
-opertor24.net
  opesien.xyz
  opesrpwpfovhorgfcvbmzzetch-dot-gleowayel400503.uc.r.appspot.com
  opfaceit.fun
@@ -136433,7 +136697,6 @@ opira.000webhostapp.com
  opisthenarpoontang.com
  opiwjcvomwamcdsz-dot-millinium.ey.r.appspot.com
  opjkk.creatorlink.net
-opjnkdrdqigdpkyaerlzeroaxr-dot-gle39404049.rj.r.appspot.com
  opkali01recvrpge01.my.id
  opkkk.creatorlink.net
  opl-fledslxxzb.iltuoufficiostampa.it
@@ -136495,6 +136758,7 @@ opstalzekeringvergelijkenexpert.nl
  opt01-777-com.preview-domain.com
  opta.net.ua
  optamenwa.ga
+optec-industries.com
  opteckm.my-free.website
  optest0.hot-profile.com
  opthawseholev.com
@@ -136555,6 +136819,7 @@ optionside.com
  optionsmarter.com
  optionsxo.com
  optmrpc.com
+optomex.in
  optslater.ml
  optus-com-au.blogspot.com
  optus.com.au.submit-cloud.services
@@ -136612,7 +136877,6 @@ oqqwurnzkzlzvfhy-dot-millinium.ey.r.appspot.com
  oqrbgtggepsreqbz-dot-millinium.ey.r.appspot.com
  oqrbs.rogagot.com
  oqrnxoufdjwuaomt-dot-millinium.ey.r.appspot.com
-oqskjhpgpczegrzqtsfuvyxcul-dot-gle39404049.rj.r.appspot.com
  oqtvvlsxgqxlhiinydeancejcoikouufkiyf-dot-solar-vertex-285913.rj.r.appspot.com
  oqueeggeaea.com
  oqueistudio.com
@@ -136652,6 +136916,7 @@ orange-0806562145.weebly.com
  orange-alerte.webador.com
  orange-c00800.webnode.com.co
  orange-cadeau1.byethost16.com
+orange-cliente.yolasite.com
  orange-custo.ppr.0pb.org
  orange-fr-orange.weebly.com
  orange-fr-portail-orange-fr-portail-orange-fr-portail.weebly.com
@@ -136674,7 +136939,7 @@ orange-offres.mobile-forfait.optimus.org.rs
  orange-orange.webnode.be
  orange-prelevement.com
  orange-pro6.yolasite.com
-orange-prod3.yolasite.com
+orange-prod2.yolasite.com
  orange-secure.dvrdns.org
  orange-security.cloud.coreoz.com
  orange-support.site.bm
@@ -136688,7 +136953,7 @@ orange.fr.fr-contrats-options.com
  orange.legal
  orange.portail-mobile.digital
  orange12.yolasite.com
-orange12547.yolasite.com
+orange1245.yolasite.com
  orange13.yolasite.com
  orange14.yolasite.com
  orange16.yolasite.com
@@ -136702,7 +136967,6 @@ orange23.yolasite.com
  orange24.yolasite.com
  orange27.yolasite.com
  orange28.yolasite.com
-orange534.yolasite.com
  orangeboitevocale5.wixsite.com
  orangeclientenquete.navettetrans.com
  orangeconsultingin.000webhostapp.com
@@ -136737,11 +137001,11 @@ oraonline-togo.net
  orarwinfo.ru
  orasasaaoskset.tk
  orasudiasu.com
+oratoes.ca
  oratoriostsurukyo.com.br
  oratossigma12.000webhostapp.com
  oratt-71.ml
  orbayunatural.es
-orbeaduana.com
  orbelyx.com
  orbhftvemqtyzoqt-dot-millinium.ey.r.appspot.com
  orbity3.com
@@ -136859,7 +137123,6 @@ orhangazitur.com
  orhhuzgsw.goruli.com
  orialali.com
  oribel.pro
-orico.co.jp.nmxxg.com
  orielliespinoza.com
  oriental-et.com
  orientalrugcleanings.com
@@ -136979,6 +137242,7 @@ ortpstxlbijndwgb-dot-millinium.ey.r.appspot.com
  ortu.ga
  ortvel.com
  oruchestgo.temp.swtest.ru
+orueomuhkvcesqanumyqfgaptv-dot-gl099898987fhkl.uk.r.appspot.com
  orumber.flywheelsites.com
  oruxdqhhy.goruli.com
  orvesimizer.flywheelsites.com
@@ -137009,7 +137273,6 @@ osartetintas.com.br
  osasway-900ed.web.app
  osatowahm.com
  osavczmrjnbtdvli-dot-millinium.ey.r.appspot.com
-osawaynda316f.empretienda.com.ar
  osbaefcwawulcrwtzcohwlhqftdrcmcstxxx-dot-glxcel49934343434.rj.r.appspot.com
  osbb.lviv.ua
  osbios.net
@@ -137132,7 +137395,6 @@ otanityre.in
  otb24com.nckiengland.gdn
  otbrana.com
  otc-manila.com
-otcchluxyfyexoudrkombndybx-dot-gle39404049.rj.r.appspot.com
  otcmrgxgjrzpfgai-dot-millinium.ey.r.appspot.com
  otconline.in
  otcpinxfjoudztti-dot-millinium.ey.r.appspot.com
@@ -137201,6 +137463,7 @@ otplat.com
  otpokehack.ddns.net
  otpsoft.ru
  otra-71.ml
+otroforaneo.com
  otropuerto.com
  otrsnet.zapto.org
  otrykio-71.ml
@@ -137417,7 +137680,6 @@ outlook-srvcaccount.cuppyitaelimermadi.com
  outlook-srvcaccountdevice.grvtjshrbty.com
  outlook-useraccount.rayteller.org
  outlook-web-app-owa.et.r.appspot.com
-outlook-web-app5.yolasite.com
  outlook-webapp-owa0rmicrith146uq--infoaxewa.repl.co
  outlook-webapp-portal.el.r.appspot.com
  outlook.accountcheck.net
@@ -137458,6 +137720,7 @@ outlookdocufile.cloudns.asia
  outlookhelpdesk.activehosted.com
  outlookhelpdeskk.creatorlink.net
  outlookinvoiceviews.securitytactics.com
+outlooklive11.weebly.com
  outlooklogenliveservicerecuperation.ga
  outlookloginverify.yolasite.com
  outlooklp.weebly.com
@@ -137482,7 +137745,6 @@ outlookupdingin.netlify.app
  outlookupdingin.netlify.com
  outlookvoiceapp.web.app
  outlookwebapp.zerockexpress.ml
-outlookwebapp345654.moonfruit.com
  outlookwebapp934.moonfruit.com
  outlookwebapplogin.duckdns.org
  outlookwork.wixsite.com
@@ -137522,6 +137784,7 @@ outsidered.xyz
  outsidernyc.com
  outspotgenti.com
  outspread-pails.000webhostapp.com
+outstanding-careful-coneflower.glitch.me
  outstanding-my3bill.com
  outstandingessay.com
  outthere.net.nz
@@ -137538,6 +137801,7 @@ ouxnkjxhvfagwxpf-dot-millinium.ey.r.appspot.com
  ouyangpyro.com
  ouyjzfltpweqsglxlozaoghcez-dot-gleowayel400503.uc.r.appspot.com
  ouyunq.com
+ouywrqyu.cam
  ouyyus.bgs4.cn
  ouzbfisrhmkfiyut-dot-millinium.ey.r.appspot.com
  ov.psdzy.com
@@ -137612,7 +137876,6 @@ ovhovh2234x.blogspot.com
  oviiqwddhvizixiy-dot-millinium.ey.r.appspot.com
  oviyamfotos.in
  ovjbxxrsxkpmecpegibjgtxjkcelfpaqtrfg-dot-cryptic-now-290917.ey.r.appspot.com
-ovkwbxuphvilnapmocuhfkkjit-dot-gl099898987fhkl.uk.r.appspot.com
  ovmbnlpopgsxhosm-dot-millinium.ey.r.appspot.com
  ovmdjuiafzbhzdic-dot-millinium.ey.r.appspot.com
  ovnmpkrjlytifxyl-dot-millinium.ey.r.appspot.com
@@ -137688,7 +137951,6 @@ owalogonuser9348hs8s.web.app
  owamicrosft79fpf8t5mgcr1z1z7.el.r.appspot.com
  owaoutlook-webmailadmin.moonfruit.com
  owaoutlookwebapp.moonfruit.com
-owaportalcloud.ga
  owarecovermsg.web.app
  owaretrievemsg.web.app
  owas.surveysparrow.com
@@ -137782,6 +138044,7 @@ oxidized-private-song.glitch.me
  oxiger.com.br
  oxiinc.com
  oxivjpgiveqvlaly-dot-millinium.ey.r.appspot.com
+oxlgv19alow03hyuqmm.xyz
  oxnmcxzzsudmzofkeoeblefaar-dot-gleowayel400503.uc.r.appspot.com
  oxnzgvwmsgqoijmnnyzdpzigto-dot-gleowayel400503.uc.r.appspot.com
  oxorobotic.com
@@ -137790,6 +138053,7 @@ oxpar.in
  oxparjpgtixnvoid-dot-millinium.ey.r.appspot.com
  oxqxbbdlbvbghndb-dot-millinium.ey.r.appspot.com
  oxqyvqbwuosbcyzh-dot-glexcel1.ue.r.appspot.com
+oxrzy18gfhz03egxnar.xyz
  oxuhjxehzrukvosa-dot-millinium.ey.r.appspot.com
  oxusgrandservices.com
  oxuzcsdxkflycuaybukbiosoya-dot-gleowayel400503.uc.r.appspot.com
@@ -137834,7 +138098,6 @@ oyostate.gov.ng
  oyplosreyes.com
  oypspfrgbpduzbsy-dot-millinium.ey.r.appspot.com
  oyqasbqjneplzoqn-dot-millinium.ey.r.appspot.com
-oyqlpbjivdfwrekzwplmnlwvlz-dot-gle39404049.rj.r.appspot.com
  oyrblnzahtltylap-dot-millinium.ey.r.appspot.com
  oyrqm.goruli.com
  oys9er.xyz
@@ -137950,7 +138213,7 @@ p0zvb.app.link
  p1.holystarf.com
  p1.lingpao8.com
  p1.seevinleboncoind.com
-p1.servicemeonert.com
+p1.servicenpaiems.com
  p10p.addroits.com
  p1epp1sus.ts.r.appspot.com
  p1xq8.onderhost.com
@@ -138053,7 +138316,6 @@ pa.thejerkparade.com
  pa.transformationartist.info
  pa.trvlmd.net
  pa0s.cloudns.asia
-paaaetryeupaaaael.000webhostapp.com
  paaaretyepaaaaal.000webhostapp.com
  paachpumpiaon.com
  paaqrxufncpyrotdpwkb-dot-gleowyel040493443434989.wl.r.appspot.com
@@ -138227,6 +138489,7 @@ paem7.3812333.com
  paepai.com
  paepailin.com
  paeststaby.com
+paetyruriepaaaal.000webhostapp.com
  paeylokay.com
  pafindo.me
  pafnhsupgwuhctlydzbmftrjbk-dot-triple-upgrade-293822.rj.r.appspot.com
@@ -138273,6 +138536,7 @@ page-business-manager.fb-ads-realtor435673262.com
  page-business-manager.fb-ads-realtor56442626.com
  page-business.facebook.ads64342.com
  page-business.fb-ad365u37e877u2t21.com
+page-center00159.com
  page-cj0kcqjwk.my.id
  page-cj0kcqjwka0.xyz
  page-cj0kcqjwka404.xyz
@@ -138324,10 +138588,9 @@ page-policy.com
  page-realestate-902832673943-aliciasmithh.com
  page-recovery-support.com
  page-review-login.info
-page-rules-fb.org
-page-rules-fbk.com
  page-securiityy.000webhostapp.com
  page-signpoliticy.servebeer.com
+page-support-contact003258.com
  page-support62021.info
  page-unde-review2913.com
  page-under-appeal1192.xyz
@@ -138383,7 +138646,6 @@ page.verification.appleid.account-updates.site
  page.verification.support.account-limited.lajufemotionalhardcore.com
  page.web.qratrade.ml
  page0apple1-idshop1information9.runth-ret16.com
-page1297298.com
  page20recov3ryhelpp.my.id
  page38236-fb-id2937236-manage-business.posting-378273235.com
  page382911019122.adfbsrealtor.com
@@ -138438,7 +138700,6 @@ pages-certificated-valid-invitation-14934802020.tk
  pages-certificated-valid-invitation-14934922020.tk
  pages-certificated-valid-invitation-245242020.tk
  pages-help-identify-certificated-2020.my.id
-pages-protections-and-identity.my.id
  pages-protections-and-identity.notifications-pages-identity.my.id
  pages-reconfirm-active-info-2020.my.id
  pages-security-and-privacy-policy.cf
@@ -138507,7 +138768,6 @@ pahslnc.edu.np
  pahukwgsacrgbfcx-dot-millinium.ey.r.appspot.com
  paic.shoesmogul.com
  paidbigjgbnzxygl-dot-millinium.ey.r.appspot.com
-paiddomainer.com
  paidonbillstoday.com
  paidsevernet1.com
  paidtrees.com
@@ -138558,6 +138818,7 @@ paisakamao.info
  paisefilhossm.com.br
  paivoir.free.fr
  paiypalverify.com
+pajaromalos0s.jimdofree.com
  pajeroknife.club
  pajescure697351.000webhostapp.com
  pajitnov.com
@@ -138802,7 +139063,6 @@ panpanma.top
  panpos.ae
  panproduksiyon.com
  pansionat-line.ru
-panslimiterd.com
  pansphygmograph.xyz
  pantax.com.bd
  pantekkalisakitkepalaku.blogspot.com
@@ -138813,7 +139073,6 @@ panthera-medical.com
  panting-aim.000webhostapp.com
  pantiululalbab.com
  pantofficdse.com
-pantoflepup.com
  pantone-iq.com
  pantorouter.ir
  pantura09.com
@@ -138899,6 +139158,7 @@ paradefilmmmtc.com
  paradesign.us
  paradicepacks.com
  paradigmaitcom.shaxiaauthority.top
+paradis-tranche.fr
  paradisecreationsllc.com
  paradiseguests.com
  paradiselogistics.co.in
@@ -138965,9 +139225,9 @@ parceirolatam.com
  parceiros-americanas.me
  parcel-express-tracking-packages.com
  parcel-id-updates.support
-parceldeliveries.support
  parcelinn.com
  parcelnord.com
+parcels.support
  parceltracking1.com
  parcerldhl.com
  parcnational-lomami.org
@@ -139273,7 +139533,6 @@ pathofexile.host
  pathologie-rosenheim.homepage.t-online.de
  pathypothesis.com
  patiboro.ga
-patience-ils-poussent.fr
  patiencecondition.club
  patinhodomal.duckdns.org
  patio.com.br
@@ -139496,12 +139755,12 @@ paxtul-de.com
  paxturkiye.com
  paxxfull.co
  paxxfull.com
-pay-auth-via.com
  pay-billing.xyz
  pay-ee-account.com
  pay-ee.com
  pay-eebillcheck.com
  pay-epay.net
+pay-fee-royalmail.com
  pay-h3g.services
  pay-info.net
  pay-mobile-ee.com
@@ -139573,6 +139832,7 @@ payadollarandsee.com
  payaer.info
  payagenebiotech.com
  payailfire.000webhostapp.com
+payalandzinal.com
  payamazoon.top
  payameghdir.ir
  payapal-secure.000webhostapp.com
@@ -139632,9 +139892,6 @@ payee-failure.info
  payee-halifax.com
  payee-info-centre.com
  payee-issue-alert.com
-payee-management-help-alert.com
-payee-management-team-alert.com
-payee-notifydetected.com
  payee-online-cancel.com
  payee-online-issue.com
  payee-online-secure.net
@@ -139697,6 +139954,7 @@ payeeadd-hsalert-info.com
  payeealert-deregister.live
  payeealert-security.com
  payeealerts-security.com
+payeealertsinfo.com
  payeebanksafe-help.com
  payeecancel82.com
  payeecancellogin.net
@@ -139711,10 +139969,12 @@ payeeconfirmation-online.link
  payeecontrol.com
  payeed-device.cc
  payeedenialhalifax.com
+payeedetectedalert.com
  payeeguardsafe-help.com
  payeeguide-help.com
  payeehelp-support.com
  payeehelp-update.com
+payeeinfoalerted.com
  payeeinlive.link
  payeelb-disable.com
  payeelinkadd.link
@@ -139723,6 +139983,7 @@ payeemanage-mobile.com
  payeemanage-secure.com
  payeemanage-support.com
  payeenot-requested.net
+payeenoticealerts.com
  payeenoticesalert.com
  payeenotifydetect.com
  payeeonlinehelp-secure.com
@@ -139881,7 +140142,6 @@ paymentauthorisation.com
  paymentbest.club
  paymentcancellation.net
  paymentcards.buzz
-paymentcheck-review.com
  paymenterror-o2.com
  paymenterror20101-netflix.com
  paymentgate-verify.ddns.net
@@ -140201,11 +140461,13 @@ paypal-jkghdfgs.buyermodelun.com
  paypal-jygefpeyundlq.gijuterimun.com
  paypal-l.eu
  paypal-l.serveirc.com
+paypal-limit-ticketid97235.com
  paypal-limit.serveirc.com
  paypal-limitations.com
  paypal-limitations101.com
  paypal-limitazioni.com
  paypal-limited-service-account-terms-cok-deh.giize.com
+paypal-limited-ticketid83385.com
  paypal-limited-uk.com
  paypal-limiteduk.com
  paypal-limitemonth.gleeze.com
@@ -140261,7 +140523,7 @@ paypal-manage.servehalflife.com
  paypal-manage01.ga
  paypal-managedisapointedmajor99.gleeze.com
  paypal-managesverfications.com
-paypal-me-alessandra-martini.com
+paypal-me-cristina-blr.com
  paypal-member.serveirc.com
  paypal-misecure09.cf
  paypal-mmm.ddns.net
@@ -140432,7 +140694,6 @@ paypal-techsupports.com
  paypal-test.projektumfeld.de
  paypal-test.sneakpeek.cc
  paypal-testscama.servebeer.com
-paypal-ticketid452-limit.com
  paypal-to-btc.ga
  paypal-transaction-support.tk
  paypal-uehdjkd.moenzymesr.com
@@ -141692,7 +141953,6 @@ pbndemo2.costapbn.com
  pbntumgryfbikvre-dot-millinium.ey.r.appspot.com
  pbogdydqjvpcenxnsrfftpoalegnsxrumctr-dot-cryptic-now-290917.ey.r.appspot.com
  pbpcbpbgtu.duckdns.org
-pbpqpfwxyhxgwwdmhrbrxgnmyw-dot-glmar9393293232323.uk.r.appspot.com
  pbpxpgzerpavllyraoirxmrzlg-dot-gloff849483.uk.r.appspot.com
  pbqfczpclffydeys-dot-millinium.ey.r.appspot.com
  pbreedemkode.com
@@ -141786,7 +142046,6 @@ pcpin.site
  pcpoints.info
  pcprofessor.com
  pcprohepls.xyz
-pcpuuymotbvwbllviirtazozfb-dot-gle39404049.rj.r.appspot.com
  pcreparaturnet.batwoqiseller.top
  pcrqzamtei.web.app
  pcrsurgeons.com
@@ -141937,6 +142196,7 @@ pearlsjet.us-south.cf.appdomain.cloud
  pearly.com.sg
  pearmain.cn
  peas.dns-cloud.net
+peatheu737-so-net.xyz
  peatix.update-version.download
  peaurega.com
  peaven.000webhostapp.com
@@ -142034,7 +142294,6 @@ pek.com.br
  peka1.ailacabs.com
  pekaopl.com
  pekarkmv.ru
-pekczzyvsuwalzbxfilllgpyvk-dot-gle39404049.rj.r.appspot.com
  pekisvinc.com
  pekontrimulyo.com
  pekp1.svcoding.com
@@ -142091,7 +142350,6 @@ pemberitahuanfb.weebly.com
  pemblockiran-account.facbook.my.id
  pemblokiran-account-23.000webhostapp.com
  pemblokiran-data-facebook.cf
-pemblokiran-facbook.duckdns.org
  pemblokiran-facebook.com
  pemblokiran-fb-security1.cf
  pemblokiran-login-facebook.cf
@@ -142099,7 +142357,6 @@ pemblokiran-login-facebook.ga
  pemblokiran-login-facebook.tk
  pemblokiran-newfb.ga
  pemblokiran-zip.my.id
-pemblokiran.shopdiamond88.gq
  pemblokiran2002.000webhostapp.com
  pemblokiran2020.000webhostapp.com
  pemblokiran21.biz.id
@@ -142115,6 +142372,7 @@ pemblokiranfacebok.gq
  pemblokiranfacebook1.free-ni.ml
  pemblokiranfacebookresmi.pemblokiran-facebok.tk
  pemblokiranfacebookterbaru.rcodest.my.id
+pemblokiranfb-2021.duckdns.org
  pemblokiranfbresmi1.gq
  pemblokiranfbresmi1.tk
  pembrokega.buzz
@@ -142250,13 +142508,11 @@ pepto.ga
  pepxazyengcudysh-dot-millinium.ey.r.appspot.com
  peqg4.svcoding.com
  peqlkecnaggacrfc-dot-millinium.ey.r.appspot.com
-pequenoemprendedor.com
  per-amazonprime.eatuo.com
  perabetgirs.blogspot.com
  peraitml.com
  perambulatory.info
  perations.info
-perawancolmek-bkp9.mydad.info
  perawanhot.hopto.org
  perbigazing.xyz
  perbqnd.myscriptcase.com
@@ -142325,8 +142581,8 @@ performanceacademia.com.br
  performanceactive.com
  performancehaelth.com
  performancevitality.net
+performjustify.com
  performltg.com
-performsupplementsgroup.net
  perfume.pk
  perfumedopens.com
  perfumegallery.com.au
@@ -142356,7 +142612,6 @@ peringatanfb147.webnode.com
  peringatanid96.weebly.com
  peringatanpemblokiran7.weebly.com
  peringatanthnidperingatansecu673.weebly.com
-periodic-tested-stealer.glitch.me
  periodical-cuffs.000webhostapp.com
  periodistasdeportivosmalaga.es
  periohealthidahoreviews.com
@@ -142493,7 +142748,6 @@ personnalite-24hrs.com
  personnalite-mobile.me
  personnalite.link
  personnels.bdm-sa.fr
-persons-lognn.com
  persons.com.ro
  personvirrtusupurrt.atwebpages.com
  persoonlijk-bevestig.info
@@ -142633,7 +142887,6 @@ petwebinarcom.shaxiaaccommodation.top
  peuetnovlxsjfqmo-dot-millinium.ey.r.appspot.com
  peugeot-marketplaceitem602674287269900.website
  peunser.com
-peurih.com
  peviygnxujctuwpw-dot-millinium.ey.r.appspot.com
  pevnajwctsajgwvy-dot-millinium.ey.r.appspot.com
  pevnmbrjzcntfckb-dot-millinium.ey.r.appspot.com
@@ -142645,7 +142898,6 @@ pewwr6njh.000webhostapp.com
  pexene.com
  peyaar.info
  peybal.paycrona.ml
-peyblokady.net
  peyeeer.info
  peylip.co
  peylip.com
@@ -142665,8 +142917,6 @@ pf-d0.addroits.com
  pf0558741122c19-com.preview-domain.com
  pf0j7.svcoding.com
  pf0y7hea.firebaseapp.com
-pfaannualreport.com
-pfabpmttcyjdujfjuemgudhbrg-dot-gle39404049.rj.r.appspot.com
  pfaffmexico.com.mx
  pfajslsfkxwcaeft-dot-millinium.ey.r.appspot.com
  pfannerstil.icu
@@ -142723,7 +142973,6 @@ pftyrylobvsibdqt-dot-millinium.ey.r.appspot.com
  pfuegscsyjysprpsvydiqoekrxvrehmxfzcu-dot-solar-vertex-285913.rj.r.appspot.com
  pfuse.net
  pfyawdhmyvnyglympiggkrpqvslnqzawzatn-dot-cedar-code-289917.nn.r.appspot.com
-pfzezxxzruqvoivqrzhbjtwksi-dot-gle39404049.rj.r.appspot.com
  pg-series-atendimento.joomla.com
  pg17.ailacabs.com
  pg3jy.svcoding.com
@@ -142805,6 +143054,7 @@ phanthuy.online
  phantichbds.net
  phantom-guide-96m0qrndaf.glitch.me
  phantom511.duckdns.org
+phantstore.com
  phaozfuft.xtechspro.com
  phaplysaigonland.com
  pharaohxpmco.com
@@ -143039,7 +143289,6 @@ phrachudadhuj.com
  phrequirement.000webhostapp.com
  phreshphoto.com
  phrunescape.com-de.ru
-phrxcykrvxajuzntdurrdkcjkz-dot-gle39404049.rj.r.appspot.com
  phuchoidaghe.com
  phudieusongma.com
  phuhungcoltd.com
@@ -143172,6 +143421,7 @@ pierremarendet.com
  pierremarmores.com.br
  pierrepike.buzz
  pierret.ml
+piesescuter.eu
  piesetractor.ro
  piesolubni.com
  piestemrhkolnaxr-dot-millinium.ey.r.appspot.com
@@ -143221,8 +143471,11 @@ pilotag.ru
  pilotajes.com
  pilotboom.com
  pilotcargothailand.com
+pilqde02.top
  pilsans.com
+piluui06.top
  pilvyrajenjinrzn-dot-millinium.ey.r.appspot.com
+pilwec03.top
  pilyclix.cl
  pilz.website
  pimayy.cf
@@ -143276,7 +143529,6 @@ pinkbabies.net
  pinkbroadband.in
  pinkexcel.com
  pinkhuefashion.com
-pinkoliveentertainment.com
  pinkpanda.pw
  pinkporno.com
  pinkputin.com.ug
@@ -143574,7 +143826,6 @@ placimexitac.tk
  plagading.edufa.id
  plairyexpressionless.com
  plala.or.jp.rsacourier.com
-plan-o2-monthlypayments.com
  plan-orders.com
  planchaavapor.net
  plancoders.com
@@ -143687,9 +143938,9 @@ platformier.com
  platformsailorv.com
  platformvalidatie.zone
  platformveiligheid.zone
+platigen.com
  platinlojistik.com.tr
  platino.bg
-platinum-restoration.com
  platinum-service.online
  platinumalt.site
  platinumbizleads.com
@@ -143716,7 +143967,6 @@ play-n-learn.net
  play-on-the-edge.com
  play.google.com.jijiutlek.club
  play.google.com.leserdefera.club
-play.mobilelegends.com
  play0357.smmhck35.live
  play11.live
  play2win.buzz
@@ -143752,7 +144002,6 @@ playersmobilelegends.com
  playerspoolevents.com
  playfire.online
  playfirstoftheday.com
-playforwin.live
  playfulage.com
  playground.litmus.online
  playingdoco.play-minigames.com
@@ -143870,7 +144119,6 @@ plc-92681369.hgps.ie
  plc-93001911.hgps.ie
  plc-95530695.hgps.ie
  plc-98898301.hgps.ie
-plcvxqwbylomchnydwqduupume-dot-gle39404049.rj.r.appspot.com
  pldgsbexzhufkmov-dot-millinium.ey.r.appspot.com
  pldtdsll.net
  pldxs.rogagot.com
@@ -143975,7 +144223,6 @@ pllogistix-intl.com
  plm.org.hk
  plmyra.com
  plnue.club
-plnv.top
  plnvbbpszukjieyc-dot-millinium.ey.r.appspot.com
  plocalpeds.com
  plodameg.com
@@ -144176,7 +144423,6 @@ pnuafxlxdknomfob-dot-millinium.ey.r.appspot.com
  pnujygsgbqzwvwnu-dot-millinium.ey.r.appspot.com
  pnumbrero3.ru
  pnvdpstijolkznbsiutbkzfomp-dot-gleowayel400503.uc.r.appspot.com
-pnvkjgbchjtwczggloosbncebo-dot-gle39404049.rj.r.appspot.com
  pnvrljtrovytepya-dot-millinium.ey.r.appspot.com
  pnyvnjmrfncjaeaq-dot-millinium.ey.r.appspot.com
  pnzjkwtwrcvoqest-dot-millinium.ey.r.appspot.com
@@ -144187,7 +144433,6 @@ po.do
  po.ibot.repl.co
  po1mdsacn9pytzqqafcx6spqjx.com
  po4438050.000webhostapp.com
-po90jgfsr79-98768ikvfe68-omi8ij7hy7r.s3.us-east-2.amazonaws.com
  poalim.circles.eco
  poalmskas12d.com
  poaswinal.com
@@ -144235,7 +144480,6 @@ poczxzollsermapt-dot-millinium.ey.r.appspot.com
  podarki-kartin.ru
  podarok399f.000webhostapp.com
  podaxxrwnlcewjkj-dot-millinium.ey.r.appspot.com
-podcast.bolasalju.com
  podcastpopup.com
  podcetrtek-aqualuna.com
  podda2008.000webhostapp.com
@@ -144418,7 +144662,6 @@ polkolonieb4k.pl
  pollarr.top
  pollmeiermassivholzcoin.baerqipress.top
  pollo123sad.000webhostapp.com
-pollyaharrell.com
  pollyestetica.com.br
  pollyilgra098.com
  pollyunnionsree.org
@@ -144646,6 +144889,7 @@ popuribart.com
  popusknifes.work
  popweb.com.br
  poqoniex.com
+poqtrwey.cam
  poqwertal-pdnr3abmu.vercel.app
  porannawiedza.xyz
  porartha.org
@@ -144758,6 +145002,7 @@ portal-microsoft-login.du.r.appspot.com
  portal-minha-web-1itaunet-com.000webhostapp.com
  portal-notify-o3651.rj.r.appspot.com
  portal-officedocdrive.com
+portal-post-die-sendungsstatus.die-swisspost.online
  portal-regularizacao-estilo.com
  portal-stone.ga
  portal-ukgovform.com
@@ -144779,7 +145024,6 @@ portal.colegiodeperiodistasaqp.com
  portal.docdeliveryapp.com
  portal.iranfarsoodeh.ir
  portal.lomboktimurkab.go.id
-portal.macopema.com.br
  portal.meucompromisso.com
  portal.myonlineservicesnow.co
  portal.nfbpc.org
@@ -144818,7 +145062,6 @@ portale-lsp-antifrode-psd2.000webhostapp.com
  portale-siena.com
  portale-unipolsai.com
  portale-web-info.net
-portale-web-mps.com
  portale.titolari.logi.privati.poste.clienti.kanmolifestyle.co.id
  portale.titolari.login.privati.sp.clienti.ayokemon.com
  portale.titolari.poste.it.info.clienti.10002930987.shophavaianas.co.id
@@ -145085,12 +145328,12 @@ posta.godesic.si
  postal-courrier.ath.cx
  postal-ofsofqdomainmail.indusdrills.org
  postal-pjps.com
+postal-update.support
  postal-updates.support
  postal.login-amazon.co.jp.verifykeyjp.com
  postaldelivery.support
  postalemiseajour.com
  postaljobopenings.com
-postalmail.support
  postaonline-ceska-packet.com
  postattmail-signin.weebly.com
  postattyahooupgrade.weebly.com
@@ -145134,6 +145377,7 @@ posteitaliane-sblocco-carte.com
  posteitaliane-sicurezza-psd2online.com
  posteitalianetracking.com
  postemobile.does-it.net
+postennorwaypst.online
  postepay-evolution.com
  postepay.io
  postepay.poste.it.banca.accedi.conto.alumni-ace.org
@@ -145144,7 +145388,6 @@ postfacebook.rigoweb.com.br
  postfinance.in
  postfinance.mm-1.ch
  postgil.com
-posti-fi-fsad.top
  postid-00965453.suakids.com
  postid-01188465.justgreece.org
  postid-01259217.suakids.com
@@ -145276,7 +145519,6 @@ potatocat.net
  potedpuihtkvzosb-dot-glexcel1.ue.r.appspot.com
  potenciadigital.com
  potens.ru
-potent-clean-geology.glitch.me
  potentagents.com
  potf.ga
  poth346952code557825e26jp.xyz
@@ -145341,6 +145583,8 @@ powerexpress.in
  powerfrog.net
  powerful-invited-marscapone.glitch.me
  poweringinfluence.com
+powerlessseriousbrace.adasdfff.repl.co
+powerleter.casa
  powerline-groups.com
  powerlinkaudio.com
  powerlinks.info
@@ -145737,6 +145981,7 @@ practical-dubinsky-3caa8d.netlify.app
  practical-hodgkin-b109a8.netlify.app
  practical-perlman-550e2f.netlify.app
  practical-shockley-f451be.netlify.app
+practical-volhard-e1a3ca.netlify.app
  practicalpeso.com
  practiclick.xyz
  practicum.botfactory.pro
@@ -145934,6 +146179,7 @@ premiumevents.ge
  premiumfreebytes.000webhostapp.com
  premiumgate.ml
  premiuminvestment.net
+premiumjps.biz
  premiumlabourforce.ca
  premiummaintenance.ca
  premiummodapk.com
@@ -146214,13 +146460,11 @@ primeagribusiness.com
  primeamazon.monster
  primeanimate.com
  primeappleid-managesigninvoice.dijalankansajanakal.com
-primecarefertilitycentre.co.ke
  primedeliv.com.br
  primedideo.gq
  primeeast.net
  primeedu-ks.com
  primeengineeringmethods.com
-primeerrorupdates.com
  primefloridavacations.com
  primefms.com
  primehealthbg.com
@@ -146318,7 +146562,6 @@ privacy-fargo-data.com
  privacy-identity-society-secur-recovery.com
  privacy-identity-society-secure-recovery.com
  privacy-microsoft-com.o365.frc.skyfencenet.com
-privacy-notifications-identity-page-and-login-issues.gq
  privacy-policy-advanced-manager-2020.my.id
  privacy-policy-detect-manage-2020.my.id
  privacy-policy-detect-manage.my.id
@@ -146401,7 +146644,6 @@ priveonlinestore.com
  privic76.joomla.com
  privies-trades.000webhostapp.com
  privilege-market.com
-privilegetender.com
  privilegetrading.com
  privnote.io
  privnotes.ru
@@ -146423,7 +146665,6 @@ prize7958.chksrvnewtoday85.live
  prizeavariciousmarketing.estarlingramos.repl.co
  prizecollection.store
  prizepubgv1.com
-prizewel.com
  prizex15.com
  prizexmetro.com
  prj82008dev0720sec20ver004.ue.r.appspot.com
@@ -146503,7 +146744,6 @@ procedureprogressive.club
  proceed48-paypal.com
  proceedcheck.xyz
  proceeseddept.info
-procert.gr
  procesandoseguridadbancolombiasssss-c42fc451.localhost.run
  procesandoseguridadbancolombiavirtual-579a8481.localhost.run
  procesandoseguridadbancolombiavirtual1-0d721041.localhost.run
@@ -146541,6 +146781,7 @@ procialso.xyz
  procidellidespachante.com.br
  procl0ud.xyz
  proclubat.nckiengineering.gdn
+procompatible.casa
  procomputers.co.in
  proconaraguaina.weebly.com
  proconnx.com
@@ -146682,20 +146923,7 @@ profile-helenlarck-6486373774-craiglist.us
  profile-isabel.club
  profile-isabelortega-vazquez.club
  profile-live-fargo.info
-profile-load-0e4793gdij7nh.maletoth.hu
-profile-load-2nkg905l9gro.maletoth.hu
-profile-load-6f30h788wtm.maletoth.hu
-profile-load-8cu27f9anfhmlp.maletoth.hu
-profile-load-8mizym8vjzxhqhf.maletoth.hu
  profile-load-8q5evxrpq8ynb.maletoth.hu
-profile-load-gfgydh08xo4.maletoth.hu
-profile-load-hy799lo669ovo.maletoth.hu
-profile-load-p8jpnx4fb8p9ci.maletoth.hu
-profile-load-rauxd6wtlkj559.maletoth.hu
-profile-load-rs6ik370y3.maletoth.hu
-profile-load-txql5xss9.maletoth.hu
-profile-load-uxa3eens5h9gz.maletoth.hu
-profile-load-yk7m8noyv.maletoth.hu
  profile-login-wells.com
  profile-loozzaa-fabiola.club
  profile-lozafabiola-bonie.club
@@ -146708,6 +146936,7 @@ profile-lozzafabiolla-bonnie.club
  profile-lozzzafabiola-bonnie.club
  profile-marlene-rodriguez.000webhostapp.com
  profile-matilde1986.online
+profile-mkp-listing234524.com
  profile-news-wells.com
  profile-page-realtor-fbk.com
  profile-patriciaelliot9634.link
@@ -146856,8 +147085,6 @@ profitablevacationrentals.com
  profitcall.net
  profitcoach.net
  profitcoins24.com
-profitcommissions.com
-profitsanity.com
  proflines.ga
  proflyone.cyou
  profmaharaja.com
@@ -147072,15 +147299,10 @@ promotion-ample.com
  promotion-faceit.pro
  promotion-item-id571819290552.com
  promotion-page-for-free.000webhostapp.com
-promotion-point-ck78955547895462879541.tk
-promotion-point-ck78955547895462879542.tk
-promotion-point-ck78955547895462879543.tk
-promotion-point-ck78955547895462879544.tk
-promotion-point-ck78955547895462879545.tk
-promotion-point-ck78955547895462879546.tk
-promotion-point-ck78955547895462879547.tk
-promotion-point-ck78955547895462879548.tk
-promotion-point-ck78955547895462879549.tk
+promotion-payment-ck-45670008594652586551.tk
+promotion-payment-ck-45670008594652586552.tk
+promotion-payment-ck-45670008594652586553.tk
+promotion-payment-ck-45670008594652586554.tk
  promotion.boat4.de
  promotions.mbhmedispa.com
  promotionzynovawillzerodacontinuegood.duckdns.org
@@ -147434,7 +147656,6 @@ prv-xnsjoi.shabab.org.sa
  prv-xwxlox.shabab.org.sa
  prvcy01hlpbsnspgesrvce01.my.id
  prvte.duckdns.org
-prvtfijwncwqmonlinrocsphdx-dot-gle39404049.rj.r.appspot.com
  prvybcrsmpwbocyvzagwabzwfm-dot-gleowayel400503.uc.r.appspot.com
  prwssztigrkjofhqssyprtvkvg-dot-gleowayel400503.uc.r.appspot.com
  prx.lagatiteca.com
@@ -147538,7 +147759,6 @@ psl-ecoleinterne.inscription.psl.eu
  psl-recruit.com
  pslauvipwrbzplqs-dot-millinium.ey.r.appspot.com
  pslrn.com.br
-pslrnuvwybvrldjnjlghhnkzbj-dot-gle39404049.rj.r.appspot.com
  pslvoke.com
  psmfznxwcqstmimh-dot-millinium.ey.r.appspot.com
  psmitrovic.com
@@ -147974,11 +148194,10 @@ pubgmobile23.otzo.com
  pubgmobile69.com
  pubgmobilebest16.com
  pubgmobileclaim.net
-pubgmobilecoorporation.com
  pubgmobilecz.com
  pubgmobileeofficial.com
  pubgmobileevent58.freeddns.com
-pubgmobileevnt16.com
+pubgmobileexodus.com
  pubgmobilefreeeuss.cf
  pubgmobilegift.site
  pubgmobilegifte.com
@@ -148015,7 +148234,6 @@ pubgmobileventid.com
  pubgmobileventspin.com
  pubgmobilevip.com
  pubgmobilewinter-s10.000webhostapp.com
-pubgmobilexofficial.com
  pubgmobilexvoting.com
  pubgmobille.online
  pubgmobille.xyz
@@ -148058,7 +148276,6 @@ pubgmxii.vizvaz.com
  pubgmxluckysevent.myvnc.com
  pubgmxmetroexodus.com
  pubgmxz.jkub.com
-pubgmy17.com
  pubgmyace.com
  pubgmyu.com
  pubgnazar.xmidasbuy.com
@@ -148079,6 +148296,7 @@ pubgpmgc2020.com
  pubgpress.com
  pubgprizepool.my03.com
  pubgpro.pw
+pubgpromax.lflink.com
  pubgqreward.loseyourip.com
  pubgrafix.com
  pubgrb.com
@@ -148099,7 +148317,6 @@ pubgroyalepass.com
  pubgrp13.rulepubg.com
  pubgrp13.zzux.com
  pubgrpmax.com
-pubgrunics8.com
  pubgs11.2waky.com
  pubgs11.dnset.com
  pubgs12free.4pu.com
@@ -148116,7 +148333,6 @@ pubgs13spin.com
  pubgs13tournament.jkub.com
  pubgs152025.ml
  pubgs15blackpink.com
-pubgs17.com
  pubgseason13.ddnsfree.com
  pubgseason13.fartit.com
  pubgseason15.com
@@ -148308,7 +148524,6 @@ pukumurumber.000webhostapp.com
  pukuspikis83.000webhostapp.com
  pularvapes.ga
  pulbarlhbossqu.000webhostapp.com
-puldefletat.ru
  puleo.com.au
  puljxlxlzlexuuev-dot-millinium.ey.r.appspot.com
  pulka.pp.ua
@@ -148449,7 +148664,6 @@ purifckd.ug
  purification.ug
  purifiedamericanroyals.com
  purifiq.co.za
-purifireystemwithairakjs.us
  purifymarch.com
  purifymarches.com
  purinex.co.id
@@ -148509,7 +148723,6 @@ pushinginktattoo.net
  pushinglimitscom.nckichat.gdn
  pushkino-motors.ru
  pushkngkser.com
-pushnotification-c0mhyujm0ucn7y.com
  pusht5r.duckdns.org
  pushupsking.com
  pushy-accessible-gatsby.glitch.me
@@ -148618,8 +148831,6 @@ pwcitlgwrokhppsiheikfjvqex-dot-gleowayel400503.uc.r.appspot.com
  pwcneaek.sweetvprice.su
  pwcommercialpaintservices.com.adayglain.com
  pwcrvvrpadzfelhd-dot-glexcel1.ue.r.appspot.com
-pwcs-bnm.ml
-pwcs-in-org.tk
  pwdnyqrbymrsolvg-dot-millinium.ey.r.appspot.com
  pwfqatar.com
  pwghlfgdbosccbojajxdbnoroiywqujcneei-dot-solar-vertex-285913.rj.r.appspot.com
@@ -148656,7 +148867,6 @@ pwscripts.net
  pwsndnbseylvegbm-dot-millinium.ey.r.appspot.com
  pwspark.co.nz.kirainbelum.com
  pwth.awaykart.com
-pwtnwlzheicyfzfknqvxqfewfz-dot-gl099898987fhkl.uk.r.appspot.com
  pwuinwwyqbqyasdfa.ddnsking.com
  pwulfqtnxwwdapxa-dot-millinium.ey.r.appspot.com
  pwwjtnojfxvhnlvp-dot-millinium.ey.r.appspot.com
@@ -148708,7 +148918,6 @@ pxqpiomxxqivgwnkcxietzacvanlfohcdodu-dot-solar-vertex-285913.rj.r.appspot.com
  pxqpiomxxqivgwnkcxietzacvanlfohcdodu.solar-vertex-285913.rj.r.appspot.com
  pxqxsmylwororknd-dot-millinium.ey.r.appspot.com
  pxrey.goruli.com
-pxrnblpajwxjmhjukfkfkrwaww-dot-gle39404049.rj.r.appspot.com
  pxscpwnnqujq.net
  pxsistemas.com
  pxtpfacmqovcwcegexzwsdehcjqulxuukqku-dot-solar-vertex-285913.rj.r.appspot.com
@@ -148766,6 +148975,7 @@ pypl-updates.site
  pypl-webobjects.com
  pypl.services
  pyplrequiredsecure.com
+pyplreset.000webhostapp.com
  pyplservice.serveirc.com
  pyplupdatesaccounts.com
  pyplwebapps-users.com
@@ -148775,7 +148985,6 @@ pypo.xyz
  pyq.dilshantg.com
  pyramide33.pw
  pyramidifms.com
-pyramidtranslate.com
  pyrolytic-hoop.000webhostapp.com
  pyrxltwhsyyesbcp-dot-millinium.ey.r.appspot.com
  pysimeigistuudio.ee
@@ -148829,6 +149038,7 @@ pzvnwtzyaaollnycwphrvayytedawmumsixh-dot-gl494903049.wl.r.appspot.com
  pzvoobjz.shoesmogul.com
  pzvxfkzhzrvgszvaku.top
  pzwameucjmycjhuy-dot-millinium.ey.r.appspot.com
+pzybwxqrrvvkqtvyrtxtsevkdm-dot-gle39404049.rj.r.appspot.com
  pzynfsldtjruixap-dot-millinium.ey.r.appspot.com
  pzzfmfawjaiwvpajlzobzxtrge-dot-gleowayel400503.uc.r.appspot.com
  pzzspbbnidtqdeiy-dot-millinium.ey.r.appspot.com
@@ -148933,6 +149143,7 @@ qadsrchfdspprbpgkaeifiyojt-dot-gleowayel400503.uc.r.appspot.com
  qadtrades.com
  qafagxakbgloahqisahimyahbq-dot-gleowayel400503.uc.r.appspot.com
  qaffh.xyz
+qafjexplzbqiaynrbohvdqycms-dot-gle39404049.rj.r.appspot.com
  qafzaa.com
  qagnnvmlxfsbdjwoedoncbdcpp-dot-gleowayel400503.uc.r.appspot.com
  qaiiam.info
@@ -149025,7 +149236,6 @@ qcfamilylaw.com
  qcfchhunowavdrwl-dot-millinium.ey.r.appspot.com
  qcfhmbmepjgebiquaiaspnedrxkornvcdlgd-dot-glegen303939423233.ue.r.appspot.com
  qcfhu5pu.firebaseapp.com
-qcfwqyljakufacrgexdhlfhvqt-dot-gle39404049.rj.r.appspot.com
  qch6ss8ix0qokrlp.gmz.cc
  qchqrbxkiaeuyiol-dot-millinium.ey.r.appspot.com
  qchxg.mentriqq.com
@@ -149042,10 +149252,8 @@ qcoexxltglpblnwixgfaqvfvee-dot-gleowayel400503.uc.r.appspot.com
  qcqwaabjvggxphdi-dot-millinium.ey.r.appspot.com
  qctyu.tk
  qcwvbysucewkidmi-dot-millinium.ey.r.appspot.com
-qcytvlxqxafzdkazqxpyoilqxi-dot-gle39404049.rj.r.appspot.com
  qcytzahena.topkorder.su
  qcywk28rcywfw02ehij.com
-qczaddgddrssezazuzbjkhwyni-dot-gle39404049.rj.r.appspot.com
  qczwgvmnduzkuzsjvs.top
  qd.china-wl.com
  qd323f23.ru
@@ -149138,7 +149346,6 @@ qer.ae
  qercdhtpphzcfxgmebtrpntagbvkjscqnfze-dot-glegen303939423233.ue.r.appspot.com
  qestmedgroup.icu
  qeswcde.com
-qesyvvvqcppmwlbamhmbzvfmoc-dot-gl099898987fhkl.uk.r.appspot.com
  qetajsougpynhnxoakrmzzw.top
  qetdvdmcbagkgmzymx.top
  qettdg.com
@@ -149153,8 +149360,8 @@ qextwviayzrjbdlt-dot-millinium.ey.r.appspot.com
  qf82.jaysbrand.com
  qfasfzhjcfivlynu-dot-millinium.ey.r.appspot.com
  qfav.goruli.com
+qfbhidoqmgkhepuqvvumomsceu-dot-gl099898987fhkl.uk.r.appspot.com
  qfddhesuenvkgxzm-dot-millinium.ey.r.appspot.com
-qfdojeuowuacylbuelnahfravz-dot-glmar9393293232323.uk.r.appspot.com
  qfdoucpmqgecylcy-dot-millinium.ey.r.appspot.com
  qfgiaolhloirrxvz-dot-millinium.ey.r.appspot.com
  qfgvbhguyvnjtrrer.weebly.com
@@ -149268,6 +149475,7 @@ qiimoqaran.so
  qiisyrwxamqqcwvc-dot-millinium.ey.r.appspot.com
  qijgoaxusvloqfbr-dot-millinium.ey.r.appspot.com
  qijjojkcrotakpwg-dot-millinium.ey.r.appspot.com
+qijla19lsyctq03vgsb.xyz
  qikgen.com.au
  qikplvxzxbwbksfa-dot-millinium.ey.r.appspot.com
  qilamks.com
@@ -149326,7 +149534,6 @@ qjuzz.weblium.site
  qjvqzzehjkhkaczkxr.top
  qjvsymglhuwpuarghdinxhsptq-dot-gleowayel400503.uc.r.appspot.com
  qjwjqjqjqjsjkjqq.com
-qjxdlervdlhjhfwegmlzeflqvv-dot-gle39404049.rj.r.appspot.com
  qjybqnhwkxqveywohzhnclpxbl-dot-gleowayel400503.uc.r.appspot.com
  qjyn.icu
  qjyqn.svapofit.com
@@ -149378,7 +149585,6 @@ qlvuoezucsrlwqjc-dot-millinium.ey.r.appspot.com
  qlwa5zv.ncaz2bbo16sf.signdeficits.com
  qlye163.duckdns.org
  qlyhrmhgrebmzaqx-dot-millinium.ey.r.appspot.com
-qlymwdrkqugrpnxsxpwupxcmch-dot-glmar9393293232323.uk.r.appspot.com
  qlytiaqrtzzrafinwrbuiyfuuhxoitwxngxo-dot-gl494903049.wl.r.appspot.com
  qm.vishou.net
  qm96wl5zvkgu.talagaremix.com
@@ -149501,6 +149707,7 @@ qpdwmo.org
  qpe18-que-assim-seja.com
  qpelunmgbzbvprqt-dot-millinium.ey.r.appspot.com
  qpertu.custovalid.fr
+qpezjienjrvyzyxalfqydzpque-dot-gle39404049.rj.r.appspot.com
  qpfdnoqbyffutxqhqxoxnyrkvgcznzmgjahp-dot-solar-vertex-285913.rj.r.appspot.com
  qpfh.svcoding.com
  qpgbuftbfkfubvpotldircdhqq-dot-gloff849483.uk.r.appspot.com
@@ -149521,7 +149728,6 @@ qpovcnvftmpphmmt-dot-millinium.ey.r.appspot.com
  qpovihijfahelixf-dot-millinium.ey.r.appspot.com
  qppwygao.goruli.com
  qpqq2p0pnn.el.r.appspot.com
-qprnwlqpipojxmnmqdryqcbcgs-dot-gle39404049.rj.r.appspot.com
  qproofpro.com
  qproohh.com
  qprrgorxlrwetransfer.000webhostapp.com
@@ -149568,7 +149774,6 @@ qqmehqhbzcorgwsv-dot-millinium.ey.r.appspot.com
  qqmeise.com
  qqmowceuamazon.monster
  qqnkmnphcjkbrzmz-dot-millinium.ey.r.appspot.com
-qqnntfnkkgyddkuyasekhrgqed-dot-gle39404049.rj.r.appspot.com
  qqowceuamazon.xyz
  qqpsp.codesandbox.io
  qqpubgevents.000webhostapp.com
@@ -149611,7 +149816,6 @@ qrglobalbusiness.com
  qrihojlykgfjgxvo-dot-millinium.ey.r.appspot.com
  qrjpsicjnetkoowp-dot-millinium.ey.r.appspot.com
  qrkkfhykkzwvielw-dot-millinium.ey.r.appspot.com
-qrkvrvbrczcmqkxwnkymequgza-dot-gl099898987fhkl.uk.r.appspot.com
  qrlifjagfigscqos-dot-millinium.ey.r.appspot.com
  qrmgyycyuwaomebn-dot-millinium.ey.r.appspot.com
  qrmn.awaykart.com
@@ -149652,6 +149856,7 @@ qsimrcueo.shoesmogul.com
  qsis4.cn
  qsisdpxkbnadlwkg-dot-millinium.ey.r.appspot.com
  qsiwnyxngdbskmyxakpxdngzlbyolyfbuyvk-dot-solar-vertex-285913.rj.r.appspot.com
+qsklc19fboh03zlewu.xyz
  qskoclspetuyftrqqcmbicxcme-dot-gleowayel400503.uc.r.appspot.com
  qskppfijocouabjxqsqwrascuqckfyimmuss-dot-off94032393204.uk.r.appspot.com
  qskxqpyeihlvksdlleoakfyhblbqnsecxwgn-dot-cedar-code-289917.nn.r.appspot.com
@@ -149753,7 +149958,6 @@ qualitymbparts.buzz
  qualitysecurityny.com
  qualitysource.fr
  qualmetglobalservices.com
-qualpharma.in
  quanchidau.com
  quanganhmobile.net
  quangcaontc.com
@@ -149800,7 +150004,6 @@ quarrington.icu
  quarryrhyming.com
  quarterhausbrewing.com
  quarterly-objective.000webhostapp.com
-quarterlyflusteredkeygen.sfsfffff.repl.co
  quartile-levers.000webhostapp.com
  quartosalacozinhaparavoce.com
  quartosalacozinhavoce.com
@@ -149811,12 +150014,12 @@ quasi.ro
  quasimercantileinsecticidally.site
  quassia.es
  quatanggmt.com
-quatangpubgi-thang3.gq
+quatangpubgi-thang3.cf
+quatangpubgi-thang3.ml
  quatangpubgi-thang3.tk
  quatangthang3-pubgi.cf
  quatangthang3-pubgi.ga
-quatangthang3-pubgi.ml
-quatangthang3-pubgi.tk
+quatangthang3-pubgi.gq
  quatcongnghiepdongnai.vn
  quatercentennial.info
  quatest.sixstarsent.com
@@ -149976,6 +150179,7 @@ quip.onedrivefaxmail.club
  quipertise.com
  quirky-clarke-d15627.netlify.app
  quirky-johnson-c4a60c.netlify.app
+quirky-noether-5c0860.netlify.app
  quirky-noether-cd4453.netlify.app
  quistsolutions.eu
  quitaragora.godaddysites.com
@@ -149986,7 +150190,6 @@ quitenice.co.uk
  quiterenegocieja.com.br
  quitricks.com
  quiwan8.com
-quiwpbwswsj-qnwjiww-nqwkwmw.s3-eu-west-1.amazonaws.com
  quixotic-sol-291317.ts.r.appspot.com
  quixzlytmgdscnjvkwvgjggcouytbuvaummk-dot-solar-vertex-285913.rj.r.appspot.com
  quiz.facebook.com.getbackonyourfeet.sg
@@ -150164,7 +150367,6 @@ qwrsmsxiauzhdzsxos66fq-on.drv.tw
  qwrwitaavjvwryju-dot-millinium.ey.r.appspot.com
  qwry54.duckdns.org
  qwsfugnwvicoxngj-dot-millinium.ey.r.appspot.com
-qwsqppubgntnzriifishjhjkjm-dot-gle39404049.rj.r.appspot.com
  qwstrksqybkgescb-dot-millinium.ey.r.appspot.com
  qwsvjtjkvfcpmzrd-dot-millinium.ey.r.appspot.com
  qwtyu.tk
@@ -150195,7 +150397,6 @@ qxjeqtcjescjzzil-dot-millinium.ey.r.appspot.com
  qxkhzl.goruli.com
  qxloq28vhjko02eiiagg.com
  qxlybveyjdxwvjjx-dot-millinium.ey.r.appspot.com
-qxmkmyhddsusmslkezojacrxax-dot-gle39404049.rj.r.appspot.com
  qxovtyruevnyggtv-dot-millinium.ey.r.appspot.com
  qxphfaengumenwjqsmwmlsqsua-dot-gleowayel400503.uc.r.appspot.com
  qxptjrwykuirkpwvbmjcyewvat-dot-gleowayel400503.uc.r.appspot.com
@@ -150209,7 +150410,6 @@ qxwmfjuxirgbaxxc-dot-millinium.ey.r.appspot.com
  qxwvanmepdfymkjizgctbze.top
  qxwyzcdllm.duckdns.org
  qxwzgyahfvrktkjk-dot-millinium.ey.r.appspot.com
-qxygbyjawntyxgewsdyvzasxri-dot-gle39404049.rj.r.appspot.com
  qy.jandigitalstudios.com
  qy6d1.jaysbrand.com
  qy88vip.com
@@ -150269,7 +150469,6 @@ qzpantnknvwfkojlhhkivgptns-dot-gleowayel400503.uc.r.appspot.com
  qzqxrpviwnpspntioalkwnwgnqhyjabltvnd-dot-cryptic-now-290917.ey.r.appspot.com
  qzrhiiyamzwbhudb-dot-millinium.ey.r.appspot.com
  qzsiezfwoyuonyuomnxjruhwdq-dot-gleowayel400503.uc.r.appspot.com
-qztiqzwqwmvgcivbgkpgxqzspb-dot-gl099898987fhkl.uk.r.appspot.com
  qztjepozgtuactid-dot-millinium.ey.r.appspot.com
  qztldjltjxayutnf-dot-millinium.ey.r.appspot.com
  qzvbjwmsnqplbhws-dot-millinium.ey.r.appspot.com
@@ -150287,7 +150486,6 @@ r-cube-plus5.ml
  r-cube-plus8.ml
  r-day.xyz
  r-dwj.addroits.com
-r-ed.hu
  r-jy.addroits.com
  r-n4b.alnawwar.com
  r-r1.oujevais.com
@@ -150415,6 +150613,7 @@ ra60mv-lumiere-67e6f0.netlify.app
  raacts.in
  raaeu.oput.buzz
  raakesh.co
+raalwyoovpckctcjrohvohcnbx-dot-poised-bot-306515.uk.r.appspot.com
  raamagrofoods.com
  raankntue-cco-j.top
  raankntue-coo-j.top
@@ -150432,6 +150631,7 @@ rabhuixrkhdkswes-dot-millinium.ey.r.appspot.com
  rabihshahine.com
  rabijalees.zapto.org
  rabita.no
+rabo-aanmaning.info
  rabo-aanvraag.info
  rabo-aanvraagprocedure.site
  rabo-aanvraging.com
@@ -150567,6 +150767,7 @@ radaradvies.nl
  radarmacao.com
  radarutama.com
  radarweb.online
+radaryow.it
  radaxes.com
  radcaprawny-24.pl
  raddalmutallaga.com
@@ -150689,6 +150890,7 @@ rahmaaa.xyz
  rahmanbenguigui.com
  rahowxrjyzhzdxzw-dot-millinium.ey.r.appspot.com
  rahsiabisnesaiskrim.com
+rahsjfhs.xyz
  rahtyse.club
  rahudghfpdmspoqnopgyurvzwvatfhcucjce-dot-glxcel49934343434.rj.r.appspot.com
  rahul.dixitaaparrels.com
@@ -150699,13 +150901,13 @@ raidbuilders.net
  raidjkdad.com
  raido-global.ru
  raidrecoveryindia.com
+raieqim.bar
  raiffeisenat.com
  raiffeisenonline.com
  raiffeissenloggin.com
  raifix.com.br
  raifpilingd.com
  raihpulsamu.co.vu
-raiifraizer.site
  raikntuem-coo-jp.top
  railnationcom.nckihouse.gdn
  railroad-guerrilla.dvrlists.com
@@ -150821,10 +151023,12 @@ rakitan.online
  rakiten.co.jp.xixixi.monster
  rakkisushideckbar.com
  rakkutan.xyz
+rakkuteet.rakuteka.shop
  rakntem.co.jp.www-rakuten-co-jp.xyz
  raknten.shop
  raknteu.co.jp.mdnnf.xyz
  raknteun.xyz
+rakntewqn.xyz
  rakntue.co.jp.hjghg.xyz
  rakootatzo.gq
  rakordirutbumn2019.com
@@ -150871,6 +151075,7 @@ rakutanm.xyz
  rakutanz.xyz
  rakutanza.xyz
  rakute.xyz
+rakutejp1.com
  rakutem-account.buzz
  rakutem-account.icu
  rakutem-carde-co.jp
@@ -150995,6 +151200,7 @@ rakuten-co-jp.world
  rakuten-co-jp1.xyz
  rakuten-co-jpasfgdsgsdfhfdhdfjggsdfdssd.email
  rakuten-co-jppm.buzz
+rakuten-co-jppr.buzz
  rakuten-co-jppv.buzz
  rakuten-co.top
  rakuten-co.xyz
@@ -151912,7 +152118,6 @@ rakuten1.raku8.xyz
  rakuten1.rakut2.xyz
  rakuten1.rakut4.xyz
  rakuten1.rakute-cojp1.xyz
-rakuten1.shop
  rakuten1.song12.monster
  rakuten1011.top
  rakuten11.monster
@@ -152331,7 +152536,6 @@ rapidscreening.com.au
  rapidsha.com
  rapidsrc166.com
  rapidsuccesspartners.com
-rapidtekcontrols.in
  rapidwimw.com
  rapidworld53.com
  rapigol.club
@@ -152468,7 +152672,6 @@ ravenpouldyr.com
  ravenproductionsltd.com
  ravenscourtparktennis.co.uk
  ravensnesthomegoods.com
-ravenswoodmedia.co.uk
  ravesolutions.nl
  ravi-fc.com
  raviairtravels.com
@@ -152497,7 +152700,6 @@ rawtastefulr.com
  rax1z.info
  raxdiscount.com
  raxulqkabobnamyxafznuggljc-dot-glmar9393293232323.uk.r.appspot.com
-raxwzcmueemsrxvqnstijzulzk-dot-gle39404049.rj.r.appspot.com
  ray-den.xyz
  ray-kimono.jp
  ray-n-gigs.com
@@ -152809,7 +153011,6 @@ rdacc.org.au
  rdaeaewsviajtfaiifwwmchifiifbuutmcnq-dot-glxcel49934343434.rj.r.appspot.com
  rdamnxngba.monster
  rdanieldigitalco.com
-rdbqvxlywwozvxqeykujqiptdf-dot-gle39404049.rj.r.appspot.com
  rdbxgwsoukgtnpdl-dot-millinium.ey.r.appspot.com
  rdcahgnpagudlkwo-dot-millinium.ey.r.appspot.com
  rdcortinas.com.br
@@ -152905,7 +153106,6 @@ reachziraat.com
  react-ba2roi.stackblitz.io
  react-happy.xyz
  reactione-fastisccinto.net
-reactiva-bcponlineperu.cob-suap.com
  reactiva-peru.zonasegurabetaviaibcp.online
  reactiva-peru.zonasgurabetaviasbcp.live
  reactivabcp.pe-htps.com
@@ -152969,6 +153169,7 @@ read-14953324.bid-digital.com
  read-15241106.bid-digital.com
  read-15648891.bid-digital.com
  read-16342249.bid-digital.com
+read-16409972.ht-egypt.com
  read-17045524.bid-digital.com
  read-17608546.bid-digital.com
  read-17903797.bid-digital.com
@@ -153148,6 +153349,7 @@ reagister-member-nxlesports.000webhostapp.com
  reaj-hosting.com.ve
  reakettem.reakktee.top
  reaknteuc-coo-j.top
+reakuleu.ooo
  real-corp.info
  real-deal.net
  real-estate-6417409-page.me
@@ -153300,7 +153502,6 @@ realmazaganxservices.com
  realme-register.000webhostapp.com
  realme6proreg.000webhostapp.com
  realmeproreg.000webhostapp.com
-realnaturalife.com
  realnetworjismung.club
  realnewseventmlbb03.zyns.com
  realnewseventmlbbb.zyns.com
@@ -153340,6 +153541,7 @@ realtorlynnwilson.com
  realtormanny.com
  realtoronline.website
  realtorpropertyes.com
+realtors-group.com
  realtrek.in
  realty-business.club
  realty-payoffdocs.prestigetissues.com
@@ -153386,7 +153588,6 @@ rebate-service-hmrc.com
  rebate-uk-gov.com
  rebate-uk.com
  rebate-uk1.com
-rebate.ie-revenue.services
  rebate048.com
  rebate064.com
  rebate097.com
@@ -153421,16 +153622,6 @@ rebellows.info
  rebelsspot.com
  rebeltraiteur.com
  rebelunfasten.com
-rebelution-expert-ck3771548791586435298568851.tk
-rebelution-expert-ck3771548791586435298568852.tk
-rebelution-expert-ck3771548791586435298568853.tk
-rebelution-expert-ck3771548791586435298568854.tk
-rebelution-expert-ck3771548791586435298568855.tk
-rebelution-expert-ck3771548791586435298568856.tk
-rebelution-expert-ck3771548791586435298568857.tk
-rebelution-expert-ck3771548791586435298568858.tk
-rebelution-expert-ck3771548791586435298568859.tk
-rebelution-expert-ck3771548791586435298568860.tk
  rebirthnolafilm.learningmatters.tv
  rebisihut.com
  rebladmounad.blogspot.com
@@ -153440,6 +153631,7 @@ rebottlingorg.shuiabring.top
  reboux-tech.de
  rebrandly.com8648253e70.webredirect.org
  rebreaksstonehen.at
+rebreth.flywheelsites.com
  rebuild.ewarehouse.my
  rebuildkerala.info
  rec-lnvoiceq.com
@@ -153507,6 +153699,7 @@ recipe.247computronics.com.np
  recipeacademycom.nckibasketball.gdn
  recipetoday.xyz
  recipharm.xyz
+recipient-authorisation-alert.com
  recipient-delete.com
  recivdissued.com
  recklessdarkreddefragment--five-nine.repl.co
@@ -153598,6 +153791,7 @@ recovery-id.cloudrestricted-dsd.com
  recovery-id.cloudrestricted-ghg.com
  recovery-instagram.loseyourip.com
  recovery-notifications-issue-identity-pages.ga
+recovery-notifications-issue-identity-pages.gq
  recovery-outlook-pathway.herokuapp.com
  recovery-page-security-adss.000webhostapp.com
  recovery-page.my.id
@@ -153673,6 +153867,7 @@ recytechs.cf
  red-cef.com
  red-chilly.xyz
  red-master.com
+red-shapomts-file-reviews-euappdomin-cos-static-web-hosting-362.s3.us-east.cloud-object-storage.appdomain.cloud
  red.al-failakawi.com
  red.hopto.org
  red.razorrenew.com
@@ -153724,7 +153919,6 @@ redeftp.ddns.net
  redelementhealth.com
  redeleteslashinghun.quickwebchecker.com
  redelivery-fee-parcel.com
-redeliveryuk-royal-mail.com
  redemhadiah.eventfreeclaims8.my.id
  redenoticiasmarajo.com
  redensd.com.br
@@ -153974,8 +154168,6 @@ refund-form-vehicle.com
  refund-form216.com
  refund-hmrev-secure-application.com
  refund-myvehicletax-claim.com
-refund-option.co
-refund-rebate.co
  refund-referral.org
  refund-sites.com
  refund-tax-hmgov.com
@@ -154085,6 +154277,7 @@ registering-devices.cc
  registermijnonlineomgeving.noez.me
  registernewcpanel.com
  registernewmemberjoins.ga
+registerpayee-support.com
  registersegvro1bn.club
  registo01produt0ffcerto.com
  registomont24.mobi
@@ -154222,6 +154415,7 @@ reiugy.healthygenez.club
  reiytoys.com
  reizprivateresidence.com
  rejdjcluqcarnwdebjybabfqjifjbmtwrpks-dot-cryptic-now-290917.ey.r.appspot.com
+reject-newpayee-request.com
  rejectionpending.ddns.net
  rejgroups.com
  rejinilla.com
@@ -154280,6 +154474,7 @@ relapsingwagontique.com
  relatedgrouptest.com
  relatepool.com
  relateranches.com
+relationhouseplant.com
  relationship.courses
  relativitypm.com
  relatoriocob.de
@@ -154292,7 +154487,6 @@ relaxed-notice.000webhostapp.com
  relaxed-pike-29ccd7.netlify.app
  relaxed-pike-9dcd69.netlify.app
  relaxed-tesla-4e34cd.netlify.app
-relaxindulge.co.nz
  relaycounsel.xyz
  relaymanagement.info
  relaypro.info
@@ -154349,7 +154543,6 @@ reload.com2l.casa
  reload.com2v.casa
  reload.server12.secure09a.authentication.processnow.listed1.workingnow.lcpdus.com
  reloademailslogs.weebly.com
-reloadprofits.com
  reloadqoutapack.tk
  reloadupgrademail.weebly.com
  relocatekinloch.com
@@ -154647,6 +154840,7 @@ renew-your-billing.saudigenome.net
  renew.lookamazon.xyz
  renew365boionline.com
  renewable-tanks.000webhostapp.com
+renewableroofing.co.uk
  renewablre.work
  renewal-amazonprimembership.com
  renewal-billing.updateukee.com
@@ -154673,6 +154867,7 @@ renimin.mymom.info
  renjianhui.com
  renkl.ga
  renkunte.erketken.top
+renkutan.ooo
  renles-cajamares.com
  renmoflix.com
  rennelautos.zapto.org
@@ -154915,10 +155110,8 @@ reqstorecovarypaqe.000webhostapp.com
  reqtms-xwzvxkyotd.nuxorpr.com
  requation.com
  request-confirmation-profile.support
-request-payee-now.com
  request-payee-removal.com
  request-payee.net
-request-remove-payee.com
  requestednewpayee.net
  requestedpayee-cancellation.com
  requestnet.tk
@@ -155362,7 +155555,6 @@ retergesonbs-sa.umbler.net
  reteropitano.pw
  retesrl.biz
  retfgvybh.serveuser.com
-rethemes.flywheelsites.com
  rethinkacademics.com
  rethinkacademics.net
  rethinkafterschool.net
@@ -155503,7 +155695,6 @@ review-fb-account.com
  review-fb-policy.com
  review-fbactivity.com
  review-files.app.link
-review-flagged-payment.com
  review-form.net
  review-login-2983.info
  review-login-3842.info
@@ -155525,6 +155716,7 @@ review-pages-identify-fb2020.my.id
  review-pages-manager-fb03322020.my.id
  review-payee-9347.info
  review-payeeonline.link
+review-payeerequest.com
  review-paymenthsbc.com
  review-payments.net
  review-paypal.theworkpc.com
@@ -155632,6 +155824,7 @@ revolutionbroadhead.com
  revolutionpropertiesllc.com
  revolutuk.info11.co.uk
  revolvingly.xyz
+revolvingsimplisticlaws--five-nine.repl.co
  revopilte3.club
  revovercortytems.000webhostapp.com
  revrzz.com
@@ -155665,7 +155858,7 @@ rewardsarefunorg.licubooks.gdn
  rewardsecretpubgm8.com
  rewardservicespersonallogin.info
  rewardsff190.000webhostapp.com
-rewardsgetgifts.com
+rewardsgameonline.com
  rewardskinpubg.ooguy.com
  rewardspubgm.giize.com
  rewardspubgskin.gleeze.com
@@ -155698,7 +155891,6 @@ rexstat35.club
  rextaeri.bid
  rextraening.dk
  rey6r.svcoding.com
-reybhmargaupbnkvocyrqlpieo-dot-gl099898987fhkl.uk.r.appspot.com
  reyesrobertsfamily.com
  reyestaxservices.com
  reymo.com
@@ -155775,7 +155967,6 @@ rftg.gmv7.cn
  rftg.lexiaoshan.cn
  rfvtgbyh.fabushdoiqome.top
  rfwfinancial.com
-rfwtdrasudzmsaqgkcqxeumojg-dot-glmar9393293232323.uk.r.appspot.com
  rfxggidmrnxvhjjx-dot-millinium.ey.r.appspot.com
  rfxkzwscnelupczu-dot-millinium.ey.r.appspot.com
  rfxylaufmqautjhevdlxcrchuv-dot-gloff849483.uk.r.appspot.com
@@ -156051,7 +156242,6 @@ rieqktoaxpngjsychlwpxvwklg-dot-gloff00403993445.uk.r.appspot.com
  riesame-normative.000webhostapp.com
  riesberg.biz
  rieseenchs.com
-rievwkajntyxnvbevwkjavneid-dot-glmar9393293232323.uk.r.appspot.com
  rifansahara.com
  rifatenterprise.com
  riffclass.com
@@ -156119,7 +156309,6 @@ riminvest.vn
  rimklh.com
  rimmerpk.com
  rimouskiyardt.com
-rimsdqbdivtkmrymlwslktderw-dot-gle39404049.rj.r.appspot.com
  rinconadarolandovera.com
  rinder.com.ar
  rinettegroutr.buzz
@@ -156259,7 +156448,6 @@ ritytmgatgdtafmt-dot-millinium.ey.r.appspot.com
  ritzboves.co.kr
  ritzmidtownpaducah.com
  riuamtkxtotaxnfw-dot-millinium.ey.r.appspot.com
-riuflumaztvfhdpdllvxurtdes-dot-gle39404049.rj.r.appspot.com
  riunit.lk
  riuytessl.xyz
  riuzstmexadoqcyb-dot-millinium.ey.r.appspot.com
@@ -156277,7 +156465,6 @@ riversidehoanghuy.com
  riversideri.buzz
  riversportokc-dot-t6yq5rw.rj.r.appspot.com
  riverswomencooperative.org
-rivertownrealty.top
  riverviewtaxcpa.com
  riverwalkmb.com
  riverwayretail.info
@@ -156313,7 +156500,6 @@ rjhjhrjhjhr.weebly.com
  rjhumancare.com
  rjkjcgniyqknlobw-dot-millinium.ey.r.appspot.com
  rjkocotwrqryepdn-dot-millinium.ey.r.appspot.com
-rjlhorvkdujiojvqyzwbvjhdkq-dot-gle39404049.rj.r.appspot.com
  rjlitten.com
  rjlpebuihuetnvepwdgrgxmnly-dot-gleowayel400503.uc.r.appspot.com
  rjm.2marketdemo.com
@@ -156331,7 +156517,6 @@ rjujebgmgwsqmsbk-dot-millinium.ey.r.appspot.com
  rjvbtxpdhfxtcztvth.top
  rjwd.jaysbrand.com
  rjxaodkjezdbpufihwcxahhrfw-dot-gleowayel400503.uc.r.appspot.com
-rjxhygxetbfszoksmpbozhlikq-dot-gle39404049.rj.r.appspot.com
  rjxz7.gds.name
  rjyw.awaykart.com
  rk-bc.com
@@ -156341,7 +156526,6 @@ rk940.us-south.cf.appdomain.cloud
  rkajypfnb.goruli.com
  rkaudvbs.goruli.com
  rkb2dpcvykxwe3cckaxhy2sdpq--www-postfinance-ch.translate.goog
-rkbghlktlwymlmxhkcljlflbya-dot-gl099898987fhkl.uk.r.appspot.com
  rkcable.co.in
  rkcsswdbrxptlcil-dot-millinium.ey.r.appspot.com
  rkefjw3423.ddns.net
@@ -156411,9 +156595,7 @@ rlchohanjudicialacademy.com
  rlcportal.reallifechoices.com.au
  rleegreer.com
  rleone45janiya.com
-rlepartners-onedrive.com
  rlepartners-onedrives.com
-rlepartners.org
  rleztbczeafkwaep-dot-millinium.ey.r.appspot.com
  rlgphohj.goruli.com
  rlgrbody.000webhostapp.com
@@ -156440,8 +156622,6 @@ rlwyfokqtszipgngcgeohcwlrlbixaqvckqe-dot-glegen303939423233.ue.r.appspot.com
  rlxdcourixzlipbvwnxpmgrkut-dot-gleowayel400503.uc.r.appspot.com
  rlyrt26rnxw02vqijgs.com
  rlzvpndubgmdahkcliyfyxokumiddykjpmqi-dot-cryptic-now-290917.ey.r.appspot.com
-rm-delivery-uk.com
-rm-redelivery-uk1.com
  rm.facebookus-07423148.cleansol.lk
  rm4w.lawapass.com
  rm56w.jaysbrand.com
@@ -156462,6 +156642,7 @@ rmchospitaluttara.com
  rmcintyre.com
  rmcremodeling.net
  rmdpolymers.com
+rmdwk19obfzrq03ohby.xyz
  rmentregas.com.br
  rmfcombat.co.uk
  rmhkxwhmxatmqkwv-dot-millinium.ey.r.appspot.com
@@ -156567,6 +156748,7 @@ rmv-84731173.detalhesmusical.com.br
  rmv-85274614.detalhesmusical.com.br
  rmv-85384300.detalhesmusical.com.br
  rmv-87080337.detalhesmusical.com.br
+rmv-871838391.adventistgh.org
  rmv-887957336.adventistgh.org
  rmv-89534989.detalhesmusical.com.br
  rmv-899999877.adventistgh.org
@@ -156581,7 +156763,6 @@ rmv-995470242.adventistgh.org
  rmv-wzrqiopa.cmacorp.net
  rmvbv.healthygenez.club
  rmwhrznbgsvreofdgqukmchlef-dot-gleowayel400503.uc.r.appspot.com
-rmwshops.com
  rmxpouy.cn
  rmyapple.com
  rmycevre.com
@@ -156619,7 +156800,6 @@ rnkutaen.buzz
  rnkvsrnnpfyaevrr-dot-millinium.ey.r.appspot.com
  rnkzsljlbbefndbj-dot-millinium.ey.r.appspot.com
  rnlgpkssjstzwwpfgntwwaeodcfvqigqbxla-dot-solar-vertex-285913.rj.r.appspot.com
-rnmasenwodlwyuivbfwzpqsllf-dot-glmar9393293232323.uk.r.appspot.com
  rnnlkllqdmsfuevb-dot-millinium.ey.r.appspot.com
  rnofcectudpebddt-dot-millinium.ey.r.appspot.com
  rnosrati.com
@@ -157081,6 +157261,7 @@ roopakbabu.com
  roorthie.com
  roosteralan.000webhostapp.com
  root-canal.biz
+root-user3.yolasite.com
  root.myetsl.com
  root.nsvmp.eu
  root.pt.yourstudyway.com
@@ -157276,18 +157457,18 @@ roxyonpen.com
  roxyvogue.com.au
  royagold.com
  royai1service.com
-royailmail-pay-parcel-fee.com
  royaiservice1.com
  royal-access.com
  royal-crypto.icu
  royal-empire.fun
  royal-granito.com
  royal-mail-cust-delivery.mgifinc.com
-royal-mail-my-package.com
-royal-mail-postage.com
+royal-mail-delivery-servicesupport.com
+royal-mail-parcel-delivery.com
  royal-mail-shippingfee.com
  royal-mail-uk-delivery.com
-royal-mail.site
+royal-mail-uk-redelivery.com
+royal-mailparcelfees.com
  royal.mail.fee-redelivery.com
  royal888bet.com
  royalagondabeachvillas.com
@@ -157329,31 +157510,36 @@ royalhometouchhotels.com
  royalini.com
  royaljokar.000webhostapp.com
  royalland.com.tr
-royalmail-confirmation.com
+royalmail-approves.com
  royalmail-myshippingfee.com
  royalmail-notice.com
-royalmail-notification.com
+royalmail-onway.com
+royalmail-parcel-access.com
+royalmail-parcel-fee.uk
  royalmail-parceldue.com
-royalmail-parcelpay.com
-royalmail-payfees.com
-royalmail-payonline.com
+royalmail-paying-fee.com
+royalmail-payments-redelivery.com
  royalmail-process.com
+royalmail-processing.com
  royalmail-rescheduled-info.com
+royalmail-rescheduleuk.com
  royalmail-reship-fee.com
+royalmail-schedule.co.uk
+royalmail-sender.com
  royalmail-shipmentfee.com
-royalmail-shippingfee-helpdesk.com
-royalmail-uk-myfee.com
-royalmail-unpaid-fees.co
+royalmail-submit-myfees.com
+royalmail-uk-deliveries.com
+royalmail-undelivered-pending.com
  royalmail-unpaid-payment.com
  royalmail-updatefees.com
-royalmail.attempt-for-package-redelivery.com
-royalmail.co.uk-posted.com
+royalmail-validate.com
+royalmail.co.uk-tracked.com
  royalmail.fee-mail.com
-royalmail.id
-royalmail.redelivery-ref013-attempt.com
+royalmail.login.ref-details-secure1.com
+royalmail.parcel-redelivery-attemp-ref018.com
  royalmaill.top
  royalmailpackagefee-payment.com
-royalmailparcel.attempted-delivery.com
+royalmailparcel.ref16-redelivery.com
  royalmedicpharma.com
  royalmeds.in
  royalmess.art
@@ -157477,7 +157663,6 @@ rq3.svcoding.com
  rq4fh.jaysbrand.com
  rq7t.ru
  rqayjiuyzbskwptr-dot-millinium.ey.r.appspot.com
-rqbkgdzhdmmydqjnaevinoebcr-dot-gle39404049.rj.r.appspot.com
  rqcgnxdjgvsfhsapuvchudkawn-dot-gleowayel400503.uc.r.appspot.com
  rqdaxbrumwemycqn-dot-millinium.ey.r.appspot.com
  rqdnjgsvdyyigbdc-dot-millinium.ey.r.appspot.com
@@ -157727,7 +157912,6 @@ rtijfnbwferju.com
  rtisistemas.com.br
  rtjnmyllezsvtnyl.top
  rtjombpuqjglmmdyj.top
-rtjwianizrsbintaqdcwcuhmgg-dot-gle39404049.rj.r.appspot.com
  rtknyife.fun
  rtkqtnpvdt.top
  rtlurvewscozjguisujfozcmdg-dot-gleowayel400503.uc.r.appspot.com
@@ -157806,7 +157990,6 @@ rubricontrol.com
  ruby9mobile.com
  rubycityvietnam.com
  rubyhacked.myftp.biz
-rubyindjsujhuyghbvxfs73shs.gq
  rucalafchiloe.cl
  rucbsealjhpdirsi-dot-millinium.ey.r.appspot.com
  ruccuzz.dvrlists.com
@@ -157930,6 +158113,8 @@ rules-99811397.roidschemicals.org
  rules-all.web.app
  rules.tr00bleshoot.maximum.tr4cking.mail.co.jp.nopewari.com
  rulesbreaker.000webhostapp.com
+rulesfb-p370525.webport.ca
+rulesfb-w7c7p88m8gyp.webport.ca
  ruletka-stikerovvk.000webhostapp.com
  ruletkavvk.000webhostapp.com
  ruleviolation-verifications.cf
@@ -157960,10 +158145,10 @@ run-for-lutoday2020.com
  run4study.com
  runawaty-71.ga
  runawaysecliptic.top
-runcpowrspin.com
  runda-wygranych.eu
  runderfulthailand.com
  rundll.co.in
+rundownpositiveapplications.sdsdsdsd77dsdsd.repl.co
  runescape-benefits.club
  runescape-benefits.com
  runescape-bonds.com
@@ -158225,7 +158410,6 @@ rvwew-pqerdrinappstoreacc.njfajs.com
  rvwsculpture.com
  rvwx.xyz
  rvxusvoenkhjfrkxwyrp-dot-gleowyel040493443434989.wl.r.appspot.com
-rvycgfbkhjbpxlxmsutahpbqwq-dot-gle39404049.rj.r.appspot.com
  rvyeyeireqmnbdbv-dot-millinium.ey.r.appspot.com
  rvygwrwo.top
  rvyjmsopoxjxyquqsrfldfavku-dot-glowablu03049033.du.r.appspot.com
@@ -158235,6 +158419,7 @@ rvzz.xyz
  rw350.mentriqq.com
  rwa.pixilla.co.th
  rwahetyrexe.gikorip.net
+rwandaupdate.com
  rwbstores.com
  rwbuypower.com
  rwcayutk.tanglescanner.com
@@ -158267,6 +158452,7 @@ rwshd-pdf.org
  rwspmvhz.goruli.com
  rwtepop.online
  rwthbetrgshear.jkub.com
+rwtraining.com
  rwvsacvnjsxamrzt-dot-millinium.ey.r.appspot.com
  rwwsnmnlaunykeyopyehxhemls-dot-gleowayel400503.uc.r.appspot.com
  rwy7.pcgaboma.com
@@ -158288,10 +158474,8 @@ rxlensbuhiomhkdg-dot-millinium.ey.r.appspot.com
  rxmedstores.com
  rxnmcldtxnpydfhjfbtnuubqkm-dot-gleowayel400503.uc.r.appspot.com
  rxobcswccfpxqjossqxmbhricn-dot-gleowayel400503.uc.r.appspot.com
-rxpwtetasancamqlbusefctqlm-dot-gle39404049.rj.r.appspot.com
  rxquickpay.com
  rxraxpvuqwmu.top
-rxsdruqzhrbhdjlsawsskumika-dot-gle39404049.rj.r.appspot.com
  rxsfdsdc.com
  rxsvjvnbwrzrmyex-dot-millinium.ey.r.appspot.com
  rxtwyxwpdaagauiu-dot-millinium.ey.r.appspot.com
@@ -158331,6 +158515,7 @@ rybzp.goruli.com
  rycbradgvedzlxiqhhzrpvukptwvuzhrvvmt-dot-offglen.uk.r.appspot.com
  ryccaslvs.parahcenah.com
  rycecfqomrboyuxk-dot-millinium.ey.r.appspot.com
+rychemllc.com
  rycomputer.com
  rydchile.cl
  rydercompany.com
@@ -158368,7 +158553,6 @@ rynsrw.godaddysites.com
  ryofhmezac.duckdns.org
  ryparorab.tk
  rypdegqoweysiake-dot-millinium.ey.r.appspot.com
-rypfvrldzleyxjsmikzeghtxix-dot-gle39404049.rj.r.appspot.com
  rypzdszqkzzxndqbez.top
  ryrxnguoiqgxpwtrhrmqzgcfrzzprfhywfhh-dot-offgl8876899977678.uk.r.appspot.com
  rysa.neformalforum.online
@@ -158391,6 +158575,7 @@ rywgbolwcvtejovp-dot-millinium.ey.r.appspot.com
  rywiws.goruli.com
  ryxdfbrkctszmvrn-dot-millinium.ey.r.appspot.com
  ryxninamnngwdbzqxpwcpoejdn-dot-gleowayel400503.uc.r.appspot.com
+ryy.knwthrwuz.com
  ryzkiaxipcfpgudq-dot-millinium.ey.r.appspot.com
  ryzkwravcwolrlgauppshqebvgwiblwamsfx-dot-solar-vertex-285913.rj.r.appspot.com
  ryzmhpdmaaxzduqxvpyhnrmpsj-dot-gloff849483.uk.r.appspot.com
@@ -158428,6 +158613,7 @@ rzminc.com
  rzmuxiemowyeemdh-dot-millinium.ey.r.appspot.com
  rznmarket.ru
  rznp4.oujevais.com
+rznpyof.bar
  rzp1y.awaykart.com
  rzpgqpdlcqggdgol-dot-millinium.ey.r.appspot.com
  rzqnxgqehevumqaz-dot-millinium.ey.r.appspot.com
@@ -158438,7 +158624,6 @@ rzsslsxsggpla.com
  rztjocfmmoplnindlpwmzigiyn-dot-gleowayel400503.uc.r.appspot.com
  rzutitcmtrzch.com
  rzwemerson.xyz
-rzwkbvtrdsoywtskvsxaixbvne-dot-gle39404049.rj.r.appspot.com
  rzzujdlolnhomznhluhlpyucsclqosabpfhp-dot-cryptic-now-290917.ey.r.appspot.com
  s-1w6.onderhost.com
  s-30.saytanet.com
@@ -158565,6 +158750,7 @@ s291888.smrtp.ru
  s293488.smrtp.ru
  s299379.smrtp.ru
  s2audio.com.br
+s2db.co.uk
  s2electrical.com
  s2jz.awaykart.com
  s2lol.com
@@ -158908,6 +159094,7 @@ safeguard-my3-billing.co
  safeguard-securepayee.com
  safeguard-youraccount.com
  safeguardbusinessoffice.000webhostapp.com
+safeinfo.cc
  safeintelpro.com
  safekro.com
  safelogmca.000webhostapp.com
@@ -159021,6 +159208,7 @@ saglikgovtr-destek1498tl.com
  sagliklibedenim.com
  saglikramazan20bgb.net
  saglikverileri.com
+sagne.zzux.com
  sagoe-cpa.com
  sagradipieve.it
  sagygvftjbegecwa-dot-millinium.ey.r.appspot.com
@@ -159108,7 +159296,6 @@ sairaku.net
  sairamschool.edu.in
  saiscon-crard.top
  saismiami.com
-saisoftwareinc.com
  saissco.com
  saistuquee.com
  saitamashiyuuta.xyz
@@ -159220,7 +159407,6 @@ salermio.pw
  saleruny.ygto.com
  sales-mail.duckdns.org
  sales.it
-sales.shahityaprakash.com
  sales7.net
  salesbrandsa.com
  saleschampion.co.uk
@@ -159376,6 +159562,7 @@ samcalibration.com
  samchi.co.ke
  samcool.org
  same-same.co.uk
+samecitylinz.myftp.org
  samedaycoronavirustesting.com
  samedayloans.club
  sameera.gq
@@ -159461,7 +159648,6 @@ samyukthanews.in
  san-jose-roofing.com
  san-sing.com.tw
  san4.kl.com.ua
-sanada-manu.co.jp
  sanaia.com
  sanalgram.com
  sanamente.com.py
@@ -159495,6 +159681,7 @@ sandbox.trinket-shell.com
  sandburg.xfinityhelp.com
  sandd.nl
  sandeepkakan.ca
+sandengineer.com
  sanderao.com
  sandert12.blogspot.com
  sandesonpipe.com
@@ -159698,7 +159885,6 @@ santillanaabogadosnet.chifanassociate.top
  santinas.cl
  santinastravenue.buzz
  santinohelpserve.com
-santoantonioenergia.com.br
  santonlineinc.com
  santoshwomencarehospital.com
  santoveli.com
@@ -159794,7 +159980,6 @@ sarcasticchiefmosaic.boswellmichael.repl.co
  sarcoid-evenings.000webhostapp.com
  sardano.xyz
  sardardhambhavnagar.org
-sardarfashions.com
  sardarnetworking.com
  sarderlearning.com
  sardinegecko.com
@@ -159820,6 +160005,7 @@ sarkararchitects.com
  sarkargar.com
  sarkarisuccess.com
  sarkoklamhlpsrvce01.xyz
+sarl-desmarais.fr
  sarl-diouane.com
  sarlessrtaer.com
  sarmvdvkhdvyosfm-dot-millinium.ey.r.appspot.com
@@ -160003,6 +160189,7 @@ saxtec.com
  saxxxsw.xyz
  say1.ru
  sayaliwedsaniruddha.occasionsevent.com
+sayanhilo.com
  sayar.in
  sayduphjoda.susana.info
  saye.xyz
@@ -160036,6 +160223,7 @@ sbb.ch.sunrise-support.net
  sbb20688.mycpanel.rs
  sbbbvzgoqzyxccwnouyfpayebe-dot-gleowayel400503.uc.r.appspot.com
  sbc-inta.000webhostapp.com
+sbc-upgrade.weebly.com
  sbcadminverification.weebly.com
  sbcattbellmee.weebly.com
  sbcattbellverificationofficeadmin.weebly.com
@@ -160050,7 +160238,6 @@ sbcglobal-upgrader.weebly.com
  sbcglobaldesk.weebly.com
  sbcglobalemailupgrade.weebly.com
  sbcgloballoginn.com
-sbcgloballogins.weebly.com
  sbcgloballoginz.com
  sbcglobalmaillogin.weebly.com
  sbcglobalnetmail.weebly.com
@@ -160113,7 +160300,6 @@ sbspvtltd.in
  sbt-locate.000webhostapp.com
  sbtmo.eventcon.org
  sbusinessfgsjxbsy.com
-sbvvhygnbhywmkaseyqlxtrwrz-dot-gle39404049.rj.r.appspot.com
  sbxxs.duckdns.org
  sbysygcu.org
  sbz-h.addroits.com
@@ -160232,6 +160418,7 @@ schebahotel.com
  schedule-royalmail.co.uk
  scheduledpaym-alert.com
  scheduletext.com
+scheesch.de
  scheff.com
  schelliing.com
  schiedelriteventcom.nckiconsulting.gdn
@@ -160319,7 +160506,6 @@ schwabynet.baersevensupply.top
  schwaebischefranken.de
  schwarzesmeerbiz.shaxiarecord.top
  schwarzzelt-funker.de
-schweizer-lieferung.com
  schwimmbaeren.de
  schwj.jaysbrand.com
  schzflnpzeclqgnudlfuobejsmtdgjahdswo-dot-cedar-code-289917.nn.r.appspot.com
@@ -160583,7 +160769,6 @@ scv-scc.com
  scvbmmrad.xyz
  scvnppi.org
  scxer12.ddns.net
-scxpfefpqkpizukjegmyxdjqhp-dot-gle39404049.rj.r.appspot.com
  scxugosports.com
  scxza.top
  scylex.com
@@ -160617,7 +160802,6 @@ sdchverify.blogspot.com
  sdd100.cc
  sddcijidiajd.cf
  sddhfs.ru
-sddivecouncil.com
  sdeat.xyz
  sdec.me
  sdeck.org
@@ -160688,7 +160872,6 @@ sdhzyhsoxofvhkatlieqdkfrqlsmnmhmfaja-dot-solar-vertex-285913.rj.r.appspot.com
  sdilindia.com
  sdj-online.xyz
  sdjhbkjhfeo.top
-sdjhjihgdsdvbljkhvdfxcvbertyuioiuytvmmnnmvxcbkkhjvgcfxfcvjbk.s3-us-west-1.amazonaws.com
  sdjnwfddvyvqpzkwusgunxvjysanvkowmwgf-dot-cedar-code-289917.nn.r.appspot.com
  sdkfhuwiw.com
  sdkkg.com
@@ -161004,6 +161187,7 @@ secur-idchaseworld.serveirc.com
  secur-ppal.xyz
  secur-privacy-europea.com
  secur-provocale-messagerie.web.app
+secur-recovery-standardcommunity-identity-notiification.my.id
  secur-reviewpl.com
  secur01chase.online
  secur01e-chase.com
@@ -161193,6 +161377,7 @@ secure-bofa.serveftp.com
  secure-bofa.serveirc.com
  secure-bofaauth.serveirc.com
  secure-browser.xyz
+secure-cancel-request.com
  secure-care.serveirc.com
  secure-carrierinterac.com
  secure-cdek.ru
@@ -161367,7 +161552,6 @@ secure-lloyd-payee.net
  secure-lloyd.com
  secure-lloyds-device.com
  secure-lloyds-now.com
-secure-llyodbanking-help.com
  secure-lnstagrann.tk
  secure-log.link
  secure-login-3.network
@@ -161440,6 +161624,7 @@ secure-newdevice-cancellation.com
  secure-newdevice-deregister.com
  secure-newonline-payee.com
  secure-newpayee.cc
+secure-noreplyuser.dynamic-dns.net
  secure-notice-account-sign.valhallainfull.com
  secure-notice-app-sign.haggshe.com
  secure-notice-sign-paypal-log.summaryaccount2763.com
@@ -161545,6 +161730,7 @@ secure-registered-device.com
  secure-reminder-endpoint.link
  secure-remove-newpayee.co.uk
  secure-remove-payee.com
+secure-request-cancellation.com
  secure-resolveproblem.com
  secure-restore.me
  secure-review-mypayees.live
@@ -161587,7 +161773,6 @@ secure-tls-auth4.com
  secure-transparency-page-account.000webhostapp.com
  secure-tsb.safety-account.com
  secure-uk-halifax.com
-secure-unauthorised-payment.com
  secure-up-login.com
  secure-update-infoo.com
  secure-update-online-account-information.auth-arturo.com
@@ -161729,6 +161914,7 @@ secure.billing-portal.aumobile-jpapac024.com
  secure.bimlarge.com
  secure.bnz.co.nz.auth.personal-login.nz-bk01.cf
  secure.bnz.co.nz.auth.personal-login.nz-bk01.ml
+secure.caykurrizespor.tk
  secure.cbbnline.co.uk
  secure.chase.com.iosserv4.com
  secure.chaseonlinebanking.online-authentication.online
@@ -162519,6 +162705,7 @@ secure43d-chase.com
  secure44ve-cox.webcindario.com
  secure48paypal.info
  secure4e-webmail-centurylink.000webhostapp.com
+secure4space.link.bossjohnson.com
  secure5-amazon.manage-submit.com
  secure5.idma.appleld.main.imacshop.info
  secure58.webhostinghub.com
@@ -162608,6 +162795,7 @@ securebank-lloyd.com
  securebanking-device-issue.info
  securebanking-deviceauthentication.info
  securebanking-devices.info
+securebanking-lloydbank.com
  securebanking-pairing.info
  securebanking-payees.info
  securebanking.devices-secure.info
@@ -162628,6 +162816,7 @@ securebpreviewyh.online
  securecancel-lloyds.com
  securecancel-payeeuk.com
  securecb01-chase.com
+securecbreview.com
  securecc.ru
  securecgaidapplexy.servecounterstrike.com
  securechase-account.ddns.net
@@ -163009,7 +163198,6 @@ secureob-auth-verify-login-dashboard-true.paymill.xyz
  secureob1chase.serveirc.com
  secureoffice365.redirectme.net
  secureofficenow.kozow.com
-secureolbsants.com
  secureonline-account.com
  secureonline-alerts.com
  secureonline-banking.com
@@ -163060,7 +163248,6 @@ securepayees-hs.com
  securepayees-personal.com
  securepayees-unregistered-devices.com
  securepayees.online
-securepayeeupdate.com
  securepayeeveri.com
  securepayment.click
  securepaymentapp.myftp.org
@@ -163228,6 +163415,7 @@ securie01a.chase.id-login-server.com
  securing-paypal.com
  securingbravoonly.quibee.com.my
  securipass-agricole.ddns.net
+securipass-cr.site44.com
  securipasse-activation.com
  securipayment.com
  securipssactiov.site44.com
@@ -163379,7 +163567,6 @@ security-portal.club
  security-poypol.redirectme.net
  security-process.com
  security-profile-devices.com
-security-protectiondata-fcsc.com
  security-ref019.com
  security-ref585.com
  security-removal-halifax.com
@@ -163388,6 +163575,7 @@ security-removemobile.co.uk
  security-removepayees.com
  security-reply.serveirc.com
  security-restriction.com
+security-review-payment.com
  security-safe.tk
  security-secureaccount.com
  security-service.freeddns.org
@@ -163416,7 +163604,6 @@ security-verification.wetsdzusa.com
  security-verify-activity.com
  security-verify.me
  security-verifydevice.com
-security-verifypayments.com
  security-web-dati.info
  security-wells-fargo-mobile.com
  security-wells-fargo-online.com
@@ -163426,6 +163613,7 @@ security.account.verificaclientelogino.com
  security.anz-falcon.com
  security.apple-lgn.com
  security.check.paypal.co.uk.rlhealthwellness.com
+security.devi-help.me
  security.etbara3.com
  security.fb.update.gyscoal.com
  security.hsbc-cancel-payment.com
@@ -163750,7 +163938,6 @@ sehatmadu.com
  sehgalestates.co.in
  sehitailelerinedestek.com
  sehkhvdvfxkwfjrmovnbzcdmbf-dot-gleowayel400503.uc.r.appspot.com
-sehmwdfgtnjepodlaucnctqxap-dot-gle39404049.rj.r.appspot.com
  sehn.svcoding.com
  sehnguudguo.com
  seicloudservices.com
@@ -164103,6 +164290,7 @@ seowebstatist.xyz
  sepah-login.shop
  separatist-side.000webhostapp.com
  separative-lookout.000webhostapp.com
+separeceati.jimdofree.com
  separohjiwakuterbang.asia
  sepcial-updater.com
  sepcilstat.com
@@ -164206,13 +164394,11 @@ serried-bases.000webhostapp.com
  serrrvicee-loggin-fitraah-02.com
  sertaorifas.com.br
  sertecii.com
-sertek.co.kr
  sertelsiz.com
  sertencee.xyz
  sertificatkey.com
  sertipass.bespoke-hotel.com
  sertyxese.myfreesites.net
-seru.co.za
  serubungrpt.ddnsking.com
  seruiom.me
  seruiom.org
@@ -164508,7 +164694,7 @@ service-chase01a.serveirc.com
  service-client-conditions-mise-a-jour.com
  service-client-connection.net
  service-client-ovh-fr-auth.info
-service-client1.yolasite.com
+service-client2.yolasite.com
  service-clients-mise-a-jour-conditions.com
  service-com.hopto.org
  service-communication9.webnode.be
@@ -164740,6 +164926,7 @@ serviceattyahoo.weebly.com
  serviceattyahoo2020connect.weebly.com
  serviceatusagentpayandpal.000webhostapp.com
  servicebilling-ee.com
+servicebn-jp.cc
  serviceboosterr.com
  servicecasecuripass.ddns.net
  servicecenterid.com
@@ -164748,12 +164935,14 @@ servicechastru.tech
  serviceclient-activationsecurpasse.lamisso.net
  serviceclient-ppl.ddns.net
  serviceclient.site44.com
+serviceclientsonline.com
  servicecom.cloud
  servicecompanyresourch.us
  serviceconnectatt.weebly.com
  serviceconnectinfosclientinternetmail.webnode.sk
  serviceconnexioninternetwebmailinfos.webnode.sk
  servicecustomerstripe1.com
+servicecx-jp.cc
  servicedaccommodation4u.com
  servicedental.chifancall.top
  servicedesecurite.com
@@ -164966,7 +165155,6 @@ servicio-es-bannkia.com
  servicio-face.000webhostapp.com
  serviciobn1websit.com
  serviciocitas.com
-serviciocourrio.moonfruit.com
  serviciocrdigital.com
  serviciodesegur.site
  serviciodigitacr.online
@@ -165117,6 +165305,7 @@ setiaindo.com
  setimag.com
  setingfb330.webnode.com
  setingspageconfirm762-com.preview-domain.com
+setippcdugjldowhcgbvbwlhup-dot-gle39404049.rj.r.appspot.com
  setmyapple.com
  setmyappstore.com
  setngs.000webhostapp.com
@@ -165321,6 +165510,8 @@ sexphotos1080.000webhostapp.com
  sexphotos1084.000webhostapp.com
  sexphotos1094.000webhostapp.com
  sexpoetry.za.net
+sexpornmenewvidiohub.ourhobby.com
+sexpornmenewvidiox.ourhobby.com
  sexprivat.0pk.ru
  sexshop-vsochi.ru
  sexshop.neagoeandrei.com
@@ -165456,7 +165647,6 @@ sfer.strametyapi.com
  sfergu.ddns.net
  sfetybsiness-page.my.id
  sfexpress000.ddns.net
-sffywtbtcphnpreuywafpcyawj-dot-gle39404049.rj.r.appspot.com
  sfg.9qyy5.cn
  sfg.o9zay.cn
  sfghfsfjskdjkdfbvndcnfjskaklwrrfw.ydns.eu
@@ -165530,7 +165720,6 @@ sg3c.addroits.com
  sg771.kwikfunnels.com
  sg96.awaykart.com
  sgaaalife.com.koalapropelas.com
-sgaircon.com.sg
  sgauhd.ga
  sgb3p.svcoding.com
  sgbapple8393938supportsistemshop.ssfdgfyrisuzu-9.com
@@ -165578,7 +165767,6 @@ sgm0c.alnawwar.com
  sgmoneycollections.com
  sgmslw3ac.verify-accountdkas.informationskdws2s.gastipiss1.com
  sgmueaepir.duckdns.org
-sgmwdgtddoqaclebhizhssxkyv-dot-glmar9393293232323.uk.r.appspot.com
  sgnaturn.com
  sgndr.online
  sgnestle.com.graphi-art.com
@@ -165626,7 +165814,6 @@ sh.xhoao.com
  sh001.bigrock.tempwebhost.net
  sh001.whb.tempwebhost.net
  sh002.bigrock.tempwebhost.net
-sh004.whb.tempwebhost.listing.wantsbro.com
  sh005.bigrock.tempwebhost.net
  sh007.whb.tempwebhost.net
  sh1000816.had.su
@@ -165680,6 +165867,7 @@ shadedefender.top
  shadenfn.com
  shadensbagsfqz6nh.com
  shadetreetechnology.com
+shadhin190.com
  shadhinbangla.net
  shadifirst.com
  shadihomayooni.com
@@ -165876,7 +166064,7 @@ sharefiletooutlook.cloudns.asia
  sharefoundation.in
  sharegdie.firewall-gateway.net
  sharegroup.info
-sharegroup.whatsapp-biz.ml
+shareholds.com
  shareinpectonfile.com
  sharemydiskcom.nckiconsulting.gdn
  sharepiiont.xyz
@@ -165914,7 +166102,6 @@ shareponlt.weebly.com
  sharepooint-store-yu.s3-web.jp-tok.cloud-object-storage.appdomain.cloud
  sharepooint-store.s3-web.jp-tok.cloud-object-storage.appdomain.cloud
  sharesend.club
-sharesharepoint.s3-web.jp-tok.cloud-object-storage.appdomain.cloud
  sharesmell.com
  sharespins.club
  sharespins3k.club
@@ -166273,7 +166460,6 @@ shjxwyyxgs.002.sh.cn
  shjzqlqcohwwhvqjxamm-dot-gleowyel040493443434989.wl.r.appspot.com
  shjzshop.com
  shkh2gsedopq44q5zs4dpf.creativetutors.com
-shkzsucomfangtitkxnegxszmq-dot-gle39404049.rj.r.appspot.com
  shlerlashu.com
  shleta.com
  shlud.com
@@ -166557,7 +166743,6 @@ shr-0746734.direct-share.com
  shr-9466488.direct-share.com
  shrabon.xyz
  shramatably.info
-shrapnelneptunium.com
  shrbqy.com
  shredmax.in
  shreeagaramschool.com
@@ -166592,6 +166777,7 @@ shriganeshchemical.com
  shrihariindia.in
  shrilldamagedrange--five-nine.repl.co
  shrinavkarsevasansthan.com
+shrinikunjabiharitrust.org.in
  shriramenterprisesonline.com
  shrisarvhitkari.com
  shriswaminarayanmission.org
@@ -166621,7 +166807,6 @@ shrwsjgyyxgs.002.sh.cn
  shsddqyxgs.002.sh.cn
  shshgjwlyxgs.002.sh.cn
  shsjcbsbyxgs.002.sh.cn
-shsjskks-swnsjskswk-snsjsk.s3-eu-west-1.amazonaws.com
  shskwyglyxgs.002.sh.cn
  shslgssbyxgs.002.sh.cn
  shsqjdcjsypxyxgs.002.sh.cn
@@ -166719,7 +166904,6 @@ siamtravelmart.com
  siamzime.com
  siana-sa.com
  sianet.xyz
-siang.gratissbundle290.cf
  sianishop.tk
  siap-gakkumsulawesi.com
  siapasy.ddns.net
@@ -166735,10 +166919,12 @@ sibefire.000webhostapp.com
  siberiankatalog.com
  sibgigant-promo.ru
  sibintehcom.ru
+siblingrivalrybakingco.ca
  siblingsfoodcreations.in
  sibmkmtmxtbuugrdyeojlzcvbg-dot-gloff849483.uk.r.appspot.com
  sic-bank.com
  sica-ltd.com
+siccarcargo.com
  sicdam.biogenicherb.com
  sicfms.com
  sicher-id-check-423232323.xyz
@@ -166775,7 +166961,6 @@ sicurezza-accessi.com
  sicurezza-antifrode-intesasp.000webhostapp.com
  sicurezza-apk.com
  sicurezza-app-web.com
-sicurezza-app.net
  sicurezza-appisp.info
  sicurezza-banca-psd3.duckdns.org
  sicurezza-bancobpm.com
@@ -166843,7 +167028,6 @@ sidore.com.ua
  sidralmalaki.com
  sie-tec.com
  siebuo.com
-siecinfo.net
  sieck-kuehlsysteme.de
  siedemstarint.com
  siegertorg.shaxiaassessment.top
@@ -167110,7 +167294,6 @@ signin.amazon.comstatus.confirm.erneabste.com
  signin.appleid.apple.payment-center.confirmation-logins.com
  signin.appleld-apple.accountslockeds.page.beaheh.com
  signin.appleld-apple.myaccount.page.bhnehe.com
-signin.asomiqs.bar
  signin.attempt.awscloud-self.com
  signin.automobilepartsfactory.com
  signin.aws.amazon.com.services.restoreafricahealth.org
@@ -167657,7 +167840,6 @@ silver-rocket.com.au
  silver-teknik.com
  silverado-marketplaceitem1566082653556583.website
  silverbinary.com
-silverbrothers.com.ua
  silvercityms.buzz
  silvercoregroup.com
  silvercreekmountain.com
@@ -167755,7 +167937,6 @@ simplebsolutions.co.uk
  simplecuisine.000webhostapp.com
  simplegrupwa.000webhostapp.com
  simplehome.ca
-simplemailtransferprotocol.us
  simplemakemoneyonline.com
  simplemars.fun
  simplemirror.ga
@@ -168064,6 +168245,7 @@ site.sjc.co.ke
  site.smprna77home01.xyz
  site.sysnetconseil.com
  site1.com.br
+site237s.blogspot.com
  site2appleidrecoverycentre.duckdns.org
  site9423623.92.webydo.com
  site9423773.92.webydo.com
@@ -168198,7 +168380,6 @@ sjhoops.com
  sjhsk.app.link
  sjhy123.com
  sjkd.duckdns.org
-sjlzdymfvvbcdjofuvlobnjqwr-dot-gle39404049.rj.r.appspot.com
  sjmp.co.in
  sjnykoghcx.duckdns.org
  sjomfpyj.goruli.com
@@ -168298,7 +168479,6 @@ skin-giveway.000webhostapp.com
  skin-gunevo.event-game.my.id
  skin-mobilelegends-gratis.ml
  skin-secrets.gr
-skin.moonton-free-skin-com.cf
  skin24shop.com
  skinalex.fun
  skinall.4free9.com
@@ -168497,7 +168677,6 @@ sky.pbds.at
  sky0530.com
  skybluedesign.in
  skybluinternational.com
-skybourneinternational.com
  skycitydelivery.com
  skydefenceacademying.top
  skydeliverycompany.com
@@ -168509,7 +168688,6 @@ skyeconsultoria.com.br
  skyeranet.com
  skyfinancial.in
  skyflle.com
-skyflyfares.com
  skyfree9324.ddns.net
  skyfxpro.net
  skygroup.company
@@ -168620,6 +168798,7 @@ slgtldrxmjzzqrsxwjwwmcinfe-dot-gleowayel400503.uc.r.appspot.com
  slhgbls001.top
  slhgbls004.top
  slhrqty.ddns.net
+sli-netflix.com
  sliazmlsjna.top
  slicekitchen.com
  slicerbox.com
@@ -168679,6 +168858,7 @@ slmconduct.dk
  slmdressage.com
  slmotomotiv.com
  slmparty.000webhostapp.com
+slmtv.com
  slndgroup.com
  slnginaccntonntflixmovies.com
  slngln-eboy-usr.de
@@ -168727,7 +168907,6 @@ sls-34w-mlw.com
  sls-sec-auth7.com
  slsdfljlgk.tk
  slservicebd.com
-slsfzswtyqtjiuibtgbxbieyzu-dot-glmar9393293232323.uk.r.appspot.com
  slsmiamihydecom.shaxiaact.top
  sltgx.goruli.com
  sltorg.ru
@@ -168766,7 +168945,6 @@ sma.naturealtree.com
  sma2pangkep.sch.id
  sma45dsa12.yemfgzz.best
  smackboxing.ie
-smackwear.ie
  smacznaprznyta.com
  smagiau.lt
  smaki9801.com
@@ -169668,6 +169846,7 @@ snackology.me
  snaer.cn
  snagabitcoin.com
  snahcat.000webhostapp.com
+snakeqrip.us
  snaky-fence.000webhostapp.com
  snap-ontech.com
  snapbit53.com
@@ -170004,6 +170183,7 @@ socialstatistics.zapto.org
  socialwebsystems.com
  sociedadalikante.com
  societae.com
+societe-generalle.com
  societebeaute.com
  societegenerale-secure.com
  societing-online-bnk.com
@@ -170131,6 +170311,7 @@ sogemadgestion.com
  soggerfpt.com
  soggyjampackedbrackets.olivercaba.repl.co
  soggyparchedspreadsheets--five-nine.repl.co
+soggysparsefan--five-nine.repl.co
  sogiitx.org
  sogive.net
  sohailmujffar.000webhostapp.com
@@ -170310,7 +170491,6 @@ solutionerr.com
  solutionexpatcom.licusales.gdn
  solutionhelp.weebly.com
  solutionixinc.com
-solutionsb.be
  solutionscapitals.com
  solutionschiro.net
  solutionsenredwebsit.com
@@ -170327,7 +170507,6 @@ solvents.ru
  solvestp.com
  solvit.services
  solx.duckdns.org
-solyanayakomnata.ru
  som2020.zapto.org
  soma.sezibwa.com
  somadress.com
@@ -170690,7 +170869,6 @@ southyang-jp.top
  soutiennetflix0511.info
  soutsholesails.com
  souurtyo.work
-souvenirs.ng
  souvenirsplace.com
  sov-gcridcen.tk
  sov.lv
@@ -170761,6 +170939,7 @@ space4ad.com
  space4promotions.com
  spaceandform.com
  spacebeyond.space
+spacecamp.in
  spacecitysisters.org
  spaceclub.gq
  spacecreations.co
@@ -170810,6 +170989,7 @@ spanflattop.co.za
  spanishlanguageguide.com
  spanishspryslope--five-nine.repl.co
  spanishwithmireia.com
+spappstest.com
  sparanta.net
  sparc-mac.com
  spardanos.com
@@ -170900,7 +171080,6 @@ spawps.tk
  spaxful.com
  spay-information.serveirc.com
  spayments-paxful.com
-spayu.co.in
  spaziomicron.it
  spaziozero.org
  spb-sexhome.ru
@@ -170947,7 +171126,6 @@ specialistups.com
  specializationzs.xyz
  speciallife.com.br
  specialnetorg.weebly.com
-specialnotice.securityamazonwith.icu
  specialpayservicesnotify.info
  specialsedu.com
  specialsessionwithsharer.com
@@ -170959,7 +171137,6 @@ specieswhisper.com
  specimentruck.com
  specjs.com
  speckauto.com
-specnota.com
  specoat.mu
  spectaglobal.com
  spectatorial-foreca.000webhostapp.com
@@ -171091,7 +171268,6 @@ spinehealthpune.com
  spinenruepfun.tk
  spinerpubg.com
  spinetrac.ru
-spineventmlbb3.ml
  spinfrees14.com
  spinheal.ru
  spinkseagle.com.au
@@ -171146,7 +171322,6 @@ spinx-collects16.com
  spinx.giize.com
  spinx.onpubg.com
  spinx.tencenters.com
-spinxcatsquad.com
  spiny-plume-nitrogen.glitch.me
  spinzpubg.com
  spipererck.com
@@ -171168,7 +171343,7 @@ spitefulpristinerectangle--five-nine.repl.co
  spitex60plus.ch
  spititourism.com
  spix.com.my
-spjmpgijzwbqywfndsypsauwey-dot-gle39404049.rj.r.appspot.com
+spjmschool.edu.np
  spk-authserv.xyz
  spk-filliale-direkt.xyz
  spk-finanzgruppe-de-home-portalredirect.ru
@@ -171287,7 +171462,6 @@ spotify-suberr0r.com
  spotify.rajeducon.com
  spotify.sso-billinginfo.co.uk
  spotify.update-billing.sctrlgin.com
-spotify.verified.payment.authentic-documents.com
  spotifyizlenme.0fees.us
  spotifyno.beget.tech
  spotifyregalo.000webhostapp.com
@@ -171364,7 +171538,6 @@ spsbarrelservice.com
  spschool.tk
  spsshomeworkhelp.com
  sptconstruction.co.za
-sptweohnsonkiqrdzejcenxpjo-dot-gl099898987fhkl.uk.r.appspot.com
  spunkyhealthylife.com
  spunkyiopkslookup.ddns.net
  spunkyvids.com
@@ -171433,6 +171606,7 @@ sqqwer.ru
  sqrcaresponsorline.com
  sqreply1.net
  sqreply1.org
+sqribblee.us
  sqrresrvce.org
  sqrtey.com
  sqrure-mee.com
@@ -171486,6 +171660,7 @@ squarecbv4.com
  squareccl1.com
  squareccl3.com
  squarecovid91.com
+squaredashboardoffical.live
  squaredconer0.com
  squaredep3.com
  squareeeup.myftp.biz
@@ -171634,6 +171809,7 @@ srcs987acc001.icu
  srcsrvdownloads.s3.amazonaws.com
  srdcconsulting.com
  srdeveloperltd.com
+sreculogislanding.wixsite.com
  sredamoney.com
  sredssdsd.com
  sreeindia.com
@@ -171689,7 +171865,6 @@ sriutamahub.com
  srivedamaharshiastrologicalcenter.com
  srivenkateshwarainfratech.com
  srivenkateswarainfratech.com
-sriygxkuzycxkmbyoqxcmgcsdn-dot-gle39404049.rj.r.appspot.com
  srj-muelles.com.mx
  srj.co.nz
  srjeohob.goruli.com
@@ -171714,6 +171889,7 @@ srsshodhsansthan.org
  srstbdzxlbwmvcydwakqvtvnov-dot-gloff849483.uk.r.appspot.com
  srsvalid.cudraz.com
  srt45yugdga.000webhostapp.com
+srt652g.icu
  srtipe-acc.com
  sruedlqzbdeglfvgmebwhsgfqz-dot-gleowayel400503.uc.r.appspot.com
  srushtiinstitutemncl.com
@@ -171912,11 +172088,11 @@ sshskindnessproject.ca
  ssicontabil.com
  ssiinstitute.com
  ssilenteyeh.000webhostapp.com
-ssilqtevekbkhbvtfufmoiuaar-dot-gle39404049.rj.r.appspot.com
  ssiprocessinghouse.com
  ssjex.jaysbrand.com
  sskfbd.com
  sskirt.com
+ssl-allegrro.net
  ssl-anpoqzylag-home.club
  ssl-chase.com
  ssl-cr-2w3.com
@@ -172036,7 +172212,6 @@ sstcovid-19.com
  sstday.jkub.com
  ssteaamconmunlty.net.ru
  ssteamtradderoffer.xyz
-ssteqmwzshvuuajqhgomlesvlr-dot-gle39404049.rj.r.appspot.com
  sstil.pp.ua
  ssttaaddannddw3.co.za
  ssttripe.com
@@ -172183,9 +172358,9 @@ stamentstoreprime8326373953appleidap.duckdns.org
  stametcurug.com
  stamfordvt.buzz
  stampagrafica.es
+stampasegnaletica.com
  stampduty.sampleplan-vim.club
  stampile-sibiu.ro
-stancepodiatry.co
  standard.sglobal-service.com
  standardchartered.com.kz
  standardcolours.com
@@ -172248,6 +172423,7 @@ starkov115.cz
  starktrailsuite.xyz
  starlas.ga
  starlet-hotels.com
+starlightsavick.com
  starlingintlbnk.com
  starlit-strobes.000webhostapp.com
  starllingbank.co.uk
@@ -172395,12 +172571,14 @@ stats.sitelemon.com
  statsarts.com
  statsdev.com
  statsdot.eu
+statsic.com
  statsklinnksqureup.com
  statsline.bar
  statslink.casa
  statsrc.cool
  statsres.com
  statsrichwork.com
+statssale.com
  statssen.com
  statsseotraff.xyz
  statssound.com
@@ -172466,7 +172644,6 @@ stdynbnbnewagedevxaz.dns.army
  stdypycsslwinnerscot.dns.army
  stdyrmtcntlenverpibf.dns.army
  stdyrmtcntlenverpsfd.dns.army
-stdyrusschine2ganmax.dns.army
  stdyshgshgnationstgh.dns.army
  stdyunitedfrkesokoriorimistreetsmsttyr.ydns.eu
  steaamcommunity.xyz
@@ -173005,7 +173182,6 @@ sthi.ga
  sthlmtjejer.net
  sthmzx.com
  stholidays.com.np
-sthqncsdidugbpykytaycffowt-dot-gl099898987fhkl.uk.r.appspot.com
  sti-metal.com
  sticerspack2020.000webhostapp.com
  sticersvkcom.000webhostapp.com
@@ -173114,7 +173290,6 @@ stnygcw.com
  stnyrytdxqayugcdkm.top
  stoaconsultores.es
  stoargegoogleapis09.ntooitivedigita.repl.co
-stobhnydsetgwoimatfsurvcsx-dot-gle39404049.rj.r.appspot.com
  stochile.com
  stock-binary.com
  stock-crypto.com
@@ -173286,7 +173461,6 @@ storieshotel.com.tr
  storiesofrita.net
  storiesunlimitedorg.shaxiabeauty.top
  storiesunlimitedorg.shuiacast.top
-storitellah.co
  storkdamned04.com
  storm-friendly-property.glitch.me
  storm.kllk.tk
@@ -173432,6 +173606,8 @@ stringchoices.ml
  stringher.com.br
  stringjollux.com
  stringy-tourniquet.000webhostapp.com
+stripepayinc.com
+stripepayment-info.com
  stripewoks.com
  stripkser.com
  striprinicsiatuali.xyz
@@ -173439,7 +173615,6 @@ strisdhxljcoeizvgqagdfvdjp-dot-gleowayel400503.uc.r.appspot.com
  striversrowatl.com
  strlihxbozbemvvfvbhyndcftc-dot-gleowayel400503.uc.r.appspot.com
  strlpessecur.com
-strmanaheurgre.com
  strmessaging1.com
  strmessaging1.net
  stroamsmetnettworking.000webhostapp.com
@@ -173567,6 +173742,7 @@ studyfleet.net
  studymidwifery.com
  studymojo.000webhostapp.com
  studyshine.in
+studysnap.in
  studytours.cl
  studytravel.gr
  stuffed-71.gq
@@ -173658,7 +173834,6 @@ subacidulous-heart.000webhostapp.com
  subaerial-irons.000webhostapp.com
  subagan.com
  subaru-conf-ru-verification-login.g4seq.net
-subasta.cearca.org
  subatomic-itinerary.000webhostapp.com
  subatours.com
  subbieapps.com
@@ -174054,7 +174229,6 @@ sudentas.com
  sudetztend.com
  sudexpert.tj
  sudinsolite.com
-sudkeuceihlmaxsnblrlwhhuil-dot-gl099898987fhkl.uk.r.appspot.com
  sudmedexpert.ru
  sudmotoservices.fr
  sudqeffpv.goruli.com
@@ -174126,6 +174300,7 @@ suitsforseniors.com
  suivi-post-ch.info
  suivi-secure-pcs.fr
  suivis-packets-ag-diepost-ch.com
+suivre-le-colis-dhl.me
  sujalappliances.co.in
  sujet-du-bac.com
  sukababysite.000webhostapp.com
@@ -174146,13 +174321,18 @@ sukienfreefireee.000webhostapp.com
  sukienfreefirevn2.xyz
  sukienmanhhung.com
  sukienpubgi-thang3.cf
+sukienpubgl-thang3.cf
+sukienpubgl-thang3.ml
  sukienpubgl-thang3.tk
+sukienpubgll-thang3.cf
+sukienpubgll-thang3.ml
  sukienpubgll-thang3.tk
  sukiensinhnhatfreefire9.000webhostapp.com
  sukienthang3-pubgl.cf
  sukienthang3-pubgl.gq
  sukienthang3-pubgl.ml
  sukienthang3-pubgll.ga
+sukienthang3-pubgll.ml
  sukienthang3-pubgll.tk
  sukientrianfreefire.top
  sukita.info
@@ -174337,11 +174517,11 @@ sunidisp.com.tw
  sunildhiman.com
  sunilkhairnar.com
  sunincloud.000webhostapp.com
+sunioddy.com
  sunjuan.winmail01.cn
  sunkara.me
  sunla.winmail01.cn
  sunlightoverseas.com
-sunmarkholidays.com
  sunmeter.eu
  sunmo.winmail01.cn
  sunmotors-recycle.com
@@ -174358,6 +174538,7 @@ sunpo-tech.com
  sunqu.winmail01.cn
  sunridgerealty.com
  sunrise89.com
+sunriseclarify.com
  sunriseeds.com
  sunriselondon.co.uk
  sunrisesocialtrust.com
@@ -174438,7 +174619,6 @@ super-reinforcement.000webhostapp.com
  super-vote.ru
  super4ksmart.myddns.me
  superajedrez.com
-superavailable.buzz
  superazor.biz
  superbactivewear.com
  superbahis555.blogspot.com
@@ -174523,6 +174703,7 @@ superproll.de
  superpromocoesdaquarentena.ml
  superprosperousy.info
  superquest.info
+superroof.buzz
  supersalesandbargains.com.au
  superscheduler.com
  superschoolstore.com
@@ -174530,6 +174711,7 @@ superscientificsuppliers.com
  superscript-hitch.000webhostapp.com
  supersecurity.net
  supersellerfl.com
+supersilo.buzz
  superson-com.ml
  superstarrr.hk
  superstartart.xyz
@@ -174724,7 +174906,6 @@ support-center3.com
  support-center5.com
  support-centre-uk.info
  support-chase03.serveirc.com
-support-confirm-newdevice.com
  support-confirm-newtransfers.com
  support-contact010022.com
  support-customer-amazonlogin.securessl.honzy.net
@@ -174802,7 +174983,7 @@ support-profile.com
  support-ref765.com
  support-ref81.com
  support-reference9165.com
-support-register-newdevice.com
+support-registerpayee.com
  support-replyalertspchase-login.ml.cazare-sarmizegetusa.ro
  support-s10.cloudaccess.host
  support-secure-card.com
@@ -174832,12 +175013,13 @@ support-verif.myvnc.com
  support-verification.adkwirsgnioreugark.club
  support-verification.dynamic-dns.net
  support-verified-badge.com
+support-verify-mydevice.com
+support-verify-mydevices.com
  support-verify-mypayments.com
+support-verify-newtransfers.com
  support-verify-wells.com
-support-verifypayment.com
  support-vervangnet.info
  support-vervication-paypalcare.gleeze.com
-support-violations.ml
  support-virginmedia.com
  support-vpass-smbc-card.com
  support-wells-apps.com
@@ -174850,7 +175032,6 @@ support-you.in.net
  support.account-id.golaughtussermanage.com
  support.account-updates.servicescompanycenters.casa
  support.account.verification.servicekimpet.pet
-support.al7oora.com
  support.ama-zj.com
  support.amaqueusa.com
  support.amazje.com
@@ -175065,6 +175246,7 @@ supportlinebank.com
  supportlivecentre.com
  supportlogs.co.vu
  supportmail.webservis.ru
+supportmediateam.com
  supportmethoer00.com
  supportmevoteme.000webhostapp.com
  supportmy-3billing.com
@@ -175214,7 +175396,6 @@ surel-verifikasi.m-fb-coom.ga
  surematvxz.tk
  sureshnaturopathy.in
  surespark.org.uk
-suresstdybonestrands.dns.army
  surewaytoheaven.org
  surf-sail.com
  surf-seen-giant.glitch.me
@@ -175361,7 +175542,11 @@ suspended-auth.com
  suspended-crops.000webhostapp.com
  suspended-wellsfargo-access-fraud-detected.ml
  suspension-aws.com
+suspfacebookcom-14796405.nightaway.ca
+suspfacebookcom-21591113.nightaway.ca
  suspfacebookcom-25623011.nightaway.ca
+suspfacebookcom-81448794.nightaway.ca
+suspfacebookcom-89956782.nightaway.ca
  suspgercvrysrvce01.my.id
  suspicious-activity-paypal.vrfd-arz-sppt4.com
  suspicious-austin-cd8033.netlify.app
@@ -175510,7 +175695,6 @@ sw4sa.dkasd.repl.co
  sw6jshf91sdqg.duckdns.org
  sw76.onderhost.com
  swa.cfmfahe.cn
-swabalambaodisha.com
  swadaa.org
  swadeshipix.com
  swadesidukan.in
@@ -175774,6 +175958,7 @@ sxsp.mentriqq.com
  sxsss.xyz
  sxsts.xyz
  sxtuaxfonmhsfrzzbkrktvyajudlmpetoepx-dot-solar-vertex-285913.rj.r.appspot.com
+sxu18ppjk03ebhxaj.xyz
  sxvhe.xyz
  sxwdjamrqk.duckdns.org
  sxxxxx111x.blogspot.com
@@ -175866,7 +176051,6 @@ synthesisdv.com
  synthsuchellba.ml
  synxdeveloper.com
  syokmelaram.com
-syonekur.dominiotemporario.com
  syootwlrywqfebgijddvvfsbcqinfczsivsu-dot-solar-vertex-285913.rj.r.appspot.com
  syphiloid-class.000webhostapp.com
  sypin.gr
@@ -175877,7 +176061,6 @@ sypwefxkclaxwwoaktrxxviipc-dot-gleowayel400503.uc.r.appspot.com
  syr.edu.frbe.be
  syracusecoffee.com
  syrfex-eg.com
-syria-expo.com
  syriagaleri.com
  syrianevi.com
  syriashopping.com
@@ -175970,7 +176153,6 @@ sytstech.com
  syttuttziabgqbrstegxwslmyqkddzhwqbdh-dot-solar-vertex-285913.rj.r.appspot.com
  syuhmehjcsnoldxevtzmfohlmn-dot-gloff00403993445.uk.r.appspot.com
  syurtsyurt.com
-syvqtyjsbsdzharvpimqdtmjwt-dot-gl099898987fhkl.uk.r.appspot.com
  syvroses.com
  sywhpcxmxhurildirjok.com
  syworkroom.com
@@ -176053,7 +176235,6 @@ szrlgvlmfsbdqloiisjucpfmkt-dot-gleowayel400503.uc.r.appspot.com
  szscdz.000webhostapp.com
  szsdbg.com
  szsett.cn
-szsohghuqjzgyweaaeipphvwie-dot-gle39404049.rj.r.appspot.com
  szspd.cn
  szstwo.com
  sztbm.jaysbrand.com
@@ -176287,6 +176468,7 @@ tadbeerad.ae
  taddepol.edu.hk
  tadikadladybirds.xyz
  tadoo.ca
+tadriib.com
  tadtobadof.ga
  taduwrddrlyabqqf-dot-glass-effect-294320.ew.r.appspot.com
  tadvqyhfvbmfctmvpc.top
@@ -176298,7 +176480,6 @@ taekvondo.com
  taekwondocorrientes.org
  taekwondospring.com
  taeldesktop.000webhostapp.com
-taelidzcbqrfnjoebbqszsjugj-dot-gle39404049.rj.r.appspot.com
  taemofbxjiedrcvjxcjjvteqkp-dot-gleowayel400503.uc.r.appspot.com
  taengball.co
  taevzhary.goruli.com
@@ -176545,6 +176726,7 @@ tamara43645.xyz
  tamaradidenko.com
  tamarauquadruplicates.com
  tamat-812.ml
+tambolin.adv.br
  tameeraljanoob.com
  tamer.gq
  tamericans-melhorando.com
@@ -176605,6 +176787,7 @@ tangentoutfitters.com
  tangerlnehelpy123.com
  tangerroi072.bounceme.net
  tanghuo8.com
+tangible-buttercup-page.glitch.me
  tangismalam.com
  tanglewoodmotorcarfestival.maainc.com
  tangocheats.site
@@ -176756,7 +176939,6 @@ tasgra.com
  tasgroupconsulting.com
  tashamland.us
  tashivietnam.com
-tasimetric-wounds.000webhostapp.com
  taskhost.xyz
  taskhosts.hopto.org
  taskhostw.netxi.in
@@ -177059,6 +177241,7 @@ tchdata0dues.com
  tcipinkbeaches.com
  tcir.topkorder.su
  tciynlrmvqbyhptuivkjdopugl-dot-gloff849483.uk.r.appspot.com
+tcjm18emih03jpjt.xyz
  tcjsl.com
  tckanrmgqtruminqphfapfpjbiqlyewwaumx-dot-cedar-code-289917.nn.r.appspot.com
  tclalled.com
@@ -177134,7 +177317,6 @@ tdjkywbvetwdzcxesvsrgskbgb-dot-gleowayel400503.uc.r.appspot.com
  tdkaraecxxchbekimwysobzgat-dot-gleowayel400503.uc.r.appspot.com
  tdlcoxip8cvtjjwt.cene.cc
  tdlpxcodsiusdwe.azurewebsites.net
-tdnpaxrmnlanpqdkmeedlrbgmi-dot-gle39404049.rj.r.appspot.com
  tdonline-clientauth.com
  tdonrojdhkqmpszdqlpiguvppefnqgkuqbzi-dot-solar-vertex-285913.rj.r.appspot.com
  tdox.host
@@ -177167,6 +177349,7 @@ teachiefs.xyz
  teachingfactory.smk10smg.sch.id
  teachingmathsforunderstanding.co.za
  teachscout.de
+teacjhingnewgeneratorjhds.us
  teacobranca.com.br
  teadeousclyde.com
  teaetal.com
@@ -177273,6 +177456,7 @@ tech-choice-intl.com
  tech-in.com.pl
  tech-might.com
  tech-sol.co.in
+tech-waves.com
  tech.mbsrv.net
  tech.webdemobd.com
  tech.zimbrsupport.xyz
@@ -177306,6 +177490,7 @@ techdirectbh.com
  techdole.com
  techecn.com
  techelearn.in
+techfela.win
  techfonet.com
  techforboomers.com
  techfreakonline.com
@@ -177660,7 +177845,6 @@ telltaleswriting.com
  telltheworld.shop
  telluriumvarex.net
  tellusvillas.com
-telmed.cl
  telmobilitydata.com
  telomedic.com
  telorjambans.com
@@ -177777,7 +177961,6 @@ tencentgames.pubgmx.com
  tencentgetfreenow.com
  tencenthelp.com
  tencentmansion.com
-tencentmobilevip.com
  tencentofficialeu.com
  tencentpoll.com
  tencentsuprise.otzo.com
@@ -178081,7 +178264,6 @@ test.shaostoul.com
  test.shop.xn--blockchin-c2d.com
  test.sportechd.com
  test.staging.xn--kaken-tbb.com
-test.studecademy.com
  test.stylevesti.ru
  test.synergyglobal.one
  test.taphoare.com
@@ -178235,7 +178417,6 @@ teuhidi.com
  teumpeun.id
  tevel7.pw
  tevel8.pw
-tevhdjqisswccqnwloigxrephe-dot-gle39404049.rj.r.appspot.com
  tevorro.com
  tevtenitengpumpit.com
  tevwnzqyzjagixvefyclzbnrtv-dot-gleowayel400503.uc.r.appspot.com
@@ -178336,7 +178517,6 @@ tfww.xyz
  tfxk.oujevais.com
  tfxw.com.cn
  tfyguxcvbn.weebly.com
-tfyxjzraztydtcoxsacafuompt-dot-gle39404049.rj.r.appspot.com
  tfzmwrqxbpkcwbzxpbugvcrutj-dot-gleowayel400503.uc.r.appspot.com
  tfzqimglchglazxirzhqhfrawpwankmvxerq-dot-solar-vertex-285913.rj.r.appspot.com
  tg-h.ru
@@ -178386,7 +178566,6 @@ tgvglieyrppqfivflzwqvhbdae-dot-gleowayel400503.uc.r.appspot.com
  tgvuahcnargmeysbaaznefqtygmydnmqwgeo-dot-off94032393204.uk.r.appspot.com
  tgwblvlof.quickyad.com
  tgwrg.com
-tgybfmorfizzkebrwkrkwturgu-dot-glmar9393293232323.uk.r.appspot.com
  tgysghg.homonyos.cn
  th-construction-services.com
  th-maler.dk
@@ -178448,6 +178627,7 @@ thanhnien.vietnannnet.com
  thanhphotrithuc.com
  thanhtungtanluoc.com
  thanhviet.com.vn
+thanisiri.com
  thankful-impartial-verse.glitch.me
  thankfulelementarycomputers.estarlingramos.repl.co
  thankscorona.com
@@ -178488,7 +178668,6 @@ thcsminhduc.edu.vn
  thdatt.weebly.com
  thdnxvhdptjwexcwqgwwvoxmeu-dot-gleowayel400503.uc.r.appspot.com
  thdyprivatecloudshareandfileprotectgent.duckdns.org
-thdyworkfinerainball.dns.army
  the-bacot-parah.000webhostapp.com
  the-bankofamerica.com
  the-bombay-summit.000webhostapp.com
@@ -178499,6 +178678,7 @@ the-don187.publicvm.com
  the-expatexperts.icu
  the-gamer-zone.000webhostapp.com
  the-gordons.net
+the-health-and-safety-executive.encr84646623.docusign.phsarpos.com
  the-instagramhlp.0fees.us
  the-kyliejenner-collection.000webhostapp.com
  the-lobby.org
@@ -178619,6 +178799,7 @@ theboutiqe.com
  thebranddir.com
  thebreaktime.in
  thebrewdudes.com
+thebrooksreunion.com
  thebrownblessings.com
  thebrownbutterblog.com
  thebuckaroo.net
@@ -178731,7 +178912,6 @@ theebeautyspot.co.uk
  theecellgim.in
  theedenmagazine.com
  theefaxcentral.com
-theegerco.com
  theeggdonor.com
  theelectronics4u.com
  theellipsestory.com
@@ -178819,7 +178999,6 @@ thegreatlike09353.000webhostapp.com
  thegreatlike098774.000webhostapp.com
  thegreatwayofthelawwheel.org
  thegreencorner.com.sv
-thegreenstamp.com
  thegriefstrickenbrainanditsbrokenlove.com
  thegrillguystexas.com
  thegrindstore.com
@@ -179003,6 +179182,7 @@ themetalofficemeals.com.pl
  themetechmount.net
  themexoneonline.me
  themgcc.com
+themichoacanfile.com
  themicrotonalpiano.com
  themindset.org.ng
  theministrycollective.com
@@ -179018,6 +179198,7 @@ themulchmanva.com
  themunday.com
  themustardcorporationcom.nckiwebhosting.gdn
  themyorx.com
+thenaturehero.com
  thenaturehouse.ie
  thenblus.com
  thencg-view.com
@@ -179141,6 +179322,7 @@ therattgang.com
  therealabd.ca
  therealactifity.xyz
  therealmarkmearin.com
+therealmcqueen.com
  therealmormon.com
  therealstephaniemurphy.com
  therealtycircle.com
@@ -179227,7 +179409,6 @@ theskul.com
  theslidebolt.com
  thesmackleague.com
  thesmileyfacekillers.com
-thesmokeycarter.co.uk
  thesnapprint.com
  thesoccermoms.co
  thesocialtaco.com
@@ -179470,6 +179651,7 @@ thoublimmanis.xyz
  thoucamixers.xyz
  thoughteggplant.com
  thoughtfulfunctionalpostscript--five-nine.repl.co
+thoughtfulwiryinstances.omarbaez.repl.co
  thoughtscombined.com
  thoughtstopaper.com
  thoughtwax.com
@@ -179716,7 +179898,6 @@ threebillingupdate.co.uk
  threebillingupdates.co.uk
  threebills.co
  threebillupdate.secure333.co.uk
-threebillverify.com
  threebrothersmoving.net
  threeconfirm.co.uk
  threecontract.co.uk
@@ -179991,6 +180172,7 @@ tijtojnewktqxyowdovsdrrnvthwmicessux-dot-glxcel49934343434.rj.r.appspot.com
  tik.info.pl
  tik.stronnet.pl
  tikae.000webhostapp.com
+tikama.work
  tikaspot.com
  tikboo.com
  tiketwin.org
@@ -180094,7 +180276,6 @@ timeline-vyqyysutq.mstransport.ae
  timeline-wkozyixtj.mstransport.ae
  timeline-wqnvpqtkt.mstransport.ae
  timeline-yiospfyye.mstransport.ae
-timelinegifts.com
  timelineinfotech.com
  timelinelimitless.000webhostapp.com
  timelinemaintenance.ae
@@ -180406,13 +180587,11 @@ tlextreme.com
  tlftdaduzy.duckdns.org
  tlg.40eb.com
  tlgramsenfb-com.preview-domain.com
-tlgxwxfomckvevlqlkkvhvcbij-dot-gle39404049.rj.r.appspot.com
  tlhblogs.com
  tlidigital.net
  tljytfffdycgymhoqnegqlnuas-dot-gleowayel400503.uc.r.appspot.com
  tlkshow.com
  tll.optmob-tyieerscej.film2moviez.ir
-tllxebvisylrklwfziaeqvzoyg-dot-gl099898987fhkl.uk.r.appspot.com
  tlmi.co.id
  tlook-off365-signin.el.r.appspot.com
  tlpclient.site
@@ -180445,7 +180624,6 @@ tmaopzaa.web.app
  tmarkets.com
  tmassets.com.bd
  tmastie.com
-tmc.streamstudio2.co.uk
  tmc.tsukemoto.co.jp
  tmc4d.awaykart.com
  tmcaa526j4.firebaseapp.com
@@ -180458,7 +180636,6 @@ tmdggjzhachlwpbpnhlggruzhecsaxfxbunx-dot-glenxpecial3009493.ey.r.appspot.com
  tmdkckaymkbxdarbxp.top
  tmdl.pro
  tme7dmhjnzhmjeswyvpe.us-south.cf.appdomain.cloud
-tmedfavfwrudfzvcaxfcxyaecp-dot-gl099898987fhkl.uk.r.appspot.com
  tmeu.ir
  tmf.gk-yug23.ru
  tmfoodland.com
@@ -180487,7 +180664,6 @@ tmsc.miukuai.com
  tmsneurohealth.net
  tmt-moldova.com
  tmu.goruli.com
-tmxigmomwymprntqciqgzaxiqm-dot-gl099898987fhkl.uk.r.appspot.com
  tmybriyqlioozswlqxtrkgtxlk-dot-gleowayel400503.uc.r.appspot.com
  tmynetflix.com
  tn34.mentriqq.com
@@ -180649,7 +180825,6 @@ tokarconstruction.icu
  token-desbloqueio.com
  token-mobile30hs.ddns.net
  tokendigital-bn1multired.com
-tokendigital.registroseguro1bn-corn-pe.xyz
  tokendigital.registrosmvltired.xyz
  tokendigital.zonasegvraperu1bn.com
  tokendigitalbnsegura.com
@@ -180726,6 +180901,7 @@ tommyleetattoo.com
  tommymcconnell.com
  tommymousert.com
  tomnredah.gq
+tomobil.online
  tomod.net
  tomoiyuma.com
  tomovies.a5zhukao.com
@@ -181061,6 +181237,7 @@ toros-consulting.com
  torpgreenapt.buzz
  torphybridge.buzz
  torpideggplantr.com
+torpoa.cn
  torpstreets.buzz
  torradestoqueagosto.ml
  torratorradejulho.com
@@ -181230,7 +181407,6 @@ tpey.rogagot.com
  tpfhzzpnkvmmupwvhamzxtawoq-dot-gleowayel400503.uc.r.appspot.com
  tphkgfcaqpjjmtrxedczpdeksgjvbhobudzm-dot-solar-vertex-285913.rj.r.appspot.com
  tpioverseas.com
-tpjrffutedquhoyizbstzvdpob-dot-gle39404049.rj.r.appspot.com
  tpke.hu
  tpkklahat.id
  tpm-77.com
@@ -181265,6 +181441,7 @@ tqfaojtify.web.app
  tqg.studio
  tqhfqn.goruli.com
  tqiwjdhmqylrbvbkyakerojkwy-dot-gleowayel400503.uc.r.appspot.com
+tqjipkqbkbdhrgftzjnwpyajyc-dot-poised-bot-306515.uk.r.appspot.com
  tqlrjevn.goruli.com
  tqlxid.rogagot.com
  tqnpjfacebookcomm-12253063.pawsaccesories.com
@@ -181344,7 +181521,6 @@ trackable-editor.000webhostapp.com
  trackandshop.pk
  trackcdek.ru
  trackcode-dillevry.com
-trackdigital.co
  tracke.4onlinedating.com
  trackebay.review-center.uk
  tracker-visitors.com
@@ -181354,7 +181530,6 @@ trackerspro.com
  tracking-cdek.ru
  tracking-globalservices.mikkellkhan.com
  tracking-parcel.free-h.net
-tracking-royalmail.com
  tracking-ups.scsce.com.au
  tracking.dinos.vn
  tracking.mellyrenny.com
@@ -181627,7 +181802,6 @@ transportesmakool.com
  transportesparedes.com
  transportesprimedobra.com.br
  transportesprisma.com
-transportesrajju.com
  transportesycementoshidalgo.es
  transportmada.com
  transporty24.net
@@ -181729,6 +181903,7 @@ trbetasusgiris.blogspot.com
  trbetasusgirisimiz.blogspot.com
  trbwrtgbret.ac.ug
  trc.gov.np
+trcaidu.bar
  trck-bet.carerjourney.com
  trck121-er.benzodiazapines.com
  trcky.publishingdot.com
@@ -181775,7 +181950,6 @@ treeoflifelancaster.org
  treeservicekalamazoo.net
  treesguru.com
  treex.info
-treezor.io.foto-as.ro
  trefiart.com.br
  tregdsryterger.rf.gd
  treggings.info
@@ -182088,7 +182262,6 @@ troystory.net
  troyva.buzz
  troyzehj68013.mpeblog.com
  trp0q.jaysbrand.com
-trplo.dumb1.com
  trq-erth.commissionlock.com
  trquqvl.shoesmogul.com
  trr20200413211524171.domtemporario.com.br
@@ -182288,12 +182461,10 @@ tsb-online.payee-add-online.com
  tsb-security-issue.com
  tsb.new-loginattempt.com
  tsb.page
-tsb.personal-banking-authorise.com
  tsb.uk-secure-deregisterdevice.com
  tsbfraud.com
  tsbmanagepayee.com
  tsbqgpsuez.duckdns.org
-tsbrnmfftuyqpbmdnxnglbevvh-dot-gle39404049.rj.r.appspot.com
  tsbrw.xyz
  tsccoop.baerseventhere.top
  tscherning.dk.mayfieldpropertymgmt.com
@@ -182306,7 +182477,6 @@ tsdesignstudio.net
  tsdlnter.com
  tsdychinese2onlyywalkaloneinlifev28lad.duckdns.org
  tsdytoprethreemovers.dns.army
-tsdytopretwoanimavin.dns.army
  tsecityurkhub.pw
  tsegs.duckdns.org
  tsepkteggvzmqytczvxfargpncpcozebzomj-dot-cryptic-now-290917.ey.r.appspot.com
@@ -182338,7 +182508,6 @@ tslserver.duckdns.org
  tsm-soldering.co.kr
  tsm.25u.com
  tsmjsnrbzkjalqssxquoukrxgn-dot-gloff849483.uk.r.appspot.com
-tsmlhocvzaojxvmgeptkwvdcwj-dot-gle39404049.rj.r.appspot.com
  tsmlive.nl
  tsnqovlcbfvyyjwumzwlmyorvuljlimorrrb-dot-cryptic-now-290917.ey.r.appspot.com
  tsoft.co.in
@@ -182368,7 +182537,6 @@ tstsgroup.com
  tsuchii.com
  tsukasagiku.com
  tsuzuki.co.id
-tsvfbhudbcesyyuqucsquhkihl-dot-gle39404049.rj.r.appspot.com
  tsvictoria.cz
  tsvsykrfretejccjxwxfnvnmdylgsniiaxvs-dot-gl494903049.wl.r.appspot.com
  tsxes.xyz
@@ -182381,7 +182549,6 @@ tt-gram.ru
  tt-uber.com
  tt-yahoomail-com.weebly.com
  tt.8wix.com
-tt22.monster
  tt2r4.mentriqq.com
  tt5v.cn
  tt666tytyt.000webhostapp.com
@@ -182624,6 +182791,7 @@ turismodeemociones.com
  turismosantillanacom.shaxianame.top
  turistejo.pt
  turisti.al
+turkairlonomelette.space
  turkcaparbariatrics.com
  turkcellsuperonline-gnynet-osm1.com
  turkeycruise.net
@@ -182668,6 +182836,7 @@ turpialexpress.com
  turpwo.co.uk
  turquoise-ritzy-gasosaurus.glitch.me
  turretglobal.com
+turrita.it
  tursaf.org.tr
  turshjbyghdbyui.com
  turtalya.com.tr
@@ -182793,7 +182962,6 @@ tvoi-kredity.net
  tvoriteli.co.uk
  tvosxdfmkciqxvpwvbbnnrjifawkhznzifyx-dot-offgl8876899977678.uk.r.appspot.com
  tvosxdfmkciqxvpwvbbnnrjifawkhznzifyx.offgl8876899977678.uk.r.appspot.com
-tvotiltil.cl
  tvpdchbtpiexbwiikyybmdyqucfmrngixnxb-dot-glxcel49934343434.rj.r.appspot.com
  tvpinformacje1.eu
  tvpinformacyjnie1.eu
@@ -182839,7 +183007,6 @@ twenzsh.club
  twenzsh.me
  twer5jkvvzez.ambi.cc
  twerkingbeauties.com
-twfgadfuverwzhwigymnewsuyn-dot-gle39404049.rj.r.appspot.com
  twgsoftwash.com
  twi.hangtech.xyz
  twiceastallb.com
@@ -182998,7 +183165,6 @@ ty.choingay.net
  ty364tsdsaf.appspot.com
  ty45eadszxz.appspot.com
  ty5.svcoding.com
-tyacvhyxtjfhqtauvubhjpriwv-dot-gle39404049.rj.r.appspot.com
  tyaicflcvsjkxggtwvecdklkkz-dot-gleowayel400503.uc.r.appspot.com
  tyaniexrt.com
  tyarter.link
@@ -183043,7 +183209,6 @@ tyloumangonfairs.com
  tyowfh.com
  typal-hate.000webhostapp.com
  type-dcument-request.mypi.co
-type.konfirmasii-peemblokiran.ga
  type.officeseries.xyz
  type.setamazon.cyou
  typeacc-canceled.servehttp.com
@@ -183102,9 +183267,7 @@ tz005.com
  tz3c3.weblium.site
  tz7m.jaysbrand.com
  tzakitngmat.com
-tzaqleoribhqzfyqirsxnbsbvj-dot-gle39404049.rj.r.appspot.com
  tzdcoacuniwqijfttlruraqvbloudaswzljz-dot-cryptic-now-290917.ey.r.appspot.com
-tzdspkmulrzxwmhkxdnyhrldsu-dot-glmar9393293232323.uk.r.appspot.com
  tzecoz.serviceorder.su
  tzf.goruli.com
  tzfjmk.cn
@@ -183179,6 +183342,7 @@ u1212044.cp.regruhosting.ru
  u1214871.cp.regruhosting.ru
  u12793796.ct.sendgrid.net
  u12905888.ct.sendgrid.net
+u1326751.cp.regruhosting.ru
  u13271998.ct.sendgrid.net
  u13322224.ct.sendgrid.net
  u13829329.ct.sendgrid.net
@@ -183273,7 +183437,6 @@ uagdztech.org
  uagritech.com
  uaisoftware.com.br
  uaixsuam.web.app
-uajttelworuzltgqjlzbmzdgvz-dot-gle39404049.rj.r.appspot.com
  ualocal787.org
  ualocal853.org
  ualsi.test3d0.it
@@ -183443,6 +183606,7 @@ ucmpen.com
  ucmpun.com
  ucnfeekokuyezppgwlxrdyumhiewdvszojtp-dot-glxcel49934343434.rj.r.appspot.com
  ucniok9.com
+ucnox.com
  ucnzotxlrehrsqtmnkvkncbqjettqxyfjriu-dot-cedar-code-289917.nn.r.appspot.com
  ucostina.temp.swtest.ru
  ucp.chatwhasapp.gxxnxxetznow0.boxuc13.com
@@ -183482,7 +183646,6 @@ ucznddpqsdyzjxpuzuuuwnhuxoqednzudusq-dot-glegen303939423233.ue.r.appspot.com
  udana-pomoc.eu
  udavckuzbdqsmfmnph.top
  udaysolopiano.com
-udblckwjqirgfbruqaudnojakv-dot-gle39404049.rj.r.appspot.com
  udbroker.com
  udc.ac.in
  udcbwcelidjczqijppsnjppxvt-dot-gleowayel400503.uc.r.appspot.com
@@ -183504,7 +183667,6 @@ udokumentowanie.eu
  udomaincom.dynamic-dns.net
  udon.com.br
  uds-updates.weebly.com
-udsceohdtgjpscfbfredkosckm-dot-gl099898987fhkl.uk.r.appspot.com
  udtjhernandezonline.com
  udugsmgmotqqqpxswebkhpmcdipvhoyftqab-dot-cryptic-now-290917.ey.r.appspot.com
  uduogbako.gq
@@ -183559,11 +183721,9 @@ ueyjme.ueyjme.adventureredundancyes.com
  uezhgshz.dermals.org
  uf0jh.cene.cc
  ufa888.com
-ufawdkfayjeqiwqwjelxzrcxeo-dot-gl099898987fhkl.uk.r.appspot.com
  ufc.co.id
  ufcscyszdpsjkqhbxw.top
  ufctaekwondo.com
-ufdimmaglpdoywiwlcjshwlsdq-dot-gle39404049.rj.r.appspot.com
  ufest.id
  uffsfydddf.com
  uffydddftv.com
@@ -183581,7 +183741,6 @@ ufogmbhinfo.shaxiaact.top
  ufohomnggphlqjnb-dot-glexcel1.ue.r.appspot.com
  ufonrpg.info
  ufowqolfazirgujjxefocbhlqa-dot-gleowayel400503.uc.r.appspot.com
-ufsrjvcqzrouqwwiveazohvvan-dot-gle39404049.rj.r.appspot.com
  uftetxgzqjpettwhswrnihdmyg-dot-gleowayel400503.uc.r.appspot.com
  ufungamano.org
  ufxqwrfysmpxaqkf.top
@@ -183640,7 +183799,6 @@ uhfgkztmeaszoupkzoidkpadpc-dot-gleowayel400503.uc.r.appspot.com
  uhfzjfablnxcdbmohpmgraxuhnvgqfedfiqv-dot-glxcel49934343434.rj.r.appspot.com
  uhgvlqvxuvvcumr.compluterte.com
  uhhg.45ii5w.cn
-uhhugmpdbaecgfzhjbxqcjkdjr-dot-gle39404049.rj.r.appspot.com
  uhj.metisonline.se
  uhjcejbfnhkisvwbwzezyvsqsp-dot-gleowayel400503.uc.r.appspot.com
  uhlpndlteicsqwyxeccqhimeemgpcmbmhurx-dot-solar-vertex-285913.rj.r.appspot.com
@@ -183677,6 +183835,7 @@ uinventer.com
  uiodghpro.com
  uiodghshop.com
  uioopprt.cam
+uiorepty.cam
  uipack.com
  uiqxqhapbkfftiwqjveidnyvqccmgakltbyp-dot-gl494903049.wl.r.appspot.com
  uirnssewi.com
@@ -183764,6 +183923,7 @@ uk-prime-subscription.adminit.com.au
  uk-rebates-gov.com
  uk-ref111287.com
  uk-refunds-tax.com
+uk-royal-mail-service.com
  uk-securecentre.com
  uk-tax-hmrc.com
  uk-taxitloseit.com
@@ -183914,7 +184074,6 @@ ukrestrictionpaypal.com
  ukreturnform.com
  ukrhockey.info
  ukronet.ru
-ukroyalmail-trackparcel.com
  ukrteatr.odessa.ua
  uksa.in
  uksecure-mypayee.com
@@ -183952,7 +184111,6 @@ ulaanbaatar.club
  ulamaeislam.com
  ulanhu.com
  ulashopping.gq
-ulbnndlqqhloudajofhgwteqeh-dot-gle39404049.rj.r.appspot.com
  ulcyqoojwsipaltcvxwknvsrlnqzdnnmhkkk-dot-cedar-code-289917.nn.r.appspot.com
  uldkh.weblium.site
  ule-login.account.login.dropbox.com.secure-auth0-relogin.paper.ppsecure-user.mailcommute.com
@@ -183961,6 +184119,7 @@ ulfhorror.com
  ulfurunny.com
  ulgbsikeuluhnkpaypal.filosililia.com
  ulianaradko.hopto.org
+ulikconstruction.my
  uliomons.wwwaz1-ss35.a2hosted.com
  ulirlkidticawuickgyjmjiqkt-dot-gleowayel400503.uc.r.appspot.com
  ulizo.gikorip.net
@@ -184169,6 +184328,7 @@ uncommoncbd.com
  uncompelled-shears.000webhostapp.com
  unconciliatory-grip.000webhostapp.com
  unconfessed-seam.000webhostapp.com
+unconfirmedpayee-lloydplcs.com
  unconfused-dam.000webhostapp.com
  unconscientious-ret.000webhostapp.com
  unconsoled-waxes.000webhostapp.com
@@ -184215,6 +184375,7 @@ underuseunjustly.co.kr
  underwrld.casa
  underwrought-hub.000webhostapp.com
  undesmaro1937.blogspot.co.uk
+undetectable.us
  undetectedcheat.com
  undiaem.com
  undianpointblank.com
@@ -184420,7 +184581,6 @@ uniquewv.com
  unireconfrimes12.cf
  unis.link
  unisarasedialitybi.xyz
-unisoftcc.com
  unisonsouthayr.org.uk
  unisurprise.com
  unisvvap.live
@@ -184497,6 +184657,7 @@ universidadeprevisivel.com
  university.makerites.com
  university786.000webhostapp.com
  universityofwashingtonpreviewonline.officedeskportal.xyz
+universitypubg.ezua.com
  universnature.free.fr
  universocientifico.com.br
  universoeup.com
@@ -184855,7 +185016,6 @@ uocxejmdkf.duckdns.org
  uofnelincoln-my.sharepoint.com
  uofnpress.ch
  uoimall.ddns.net
-uoitkilztxeaeicunjzwhthpfv-dot-gl099898987fhkl.uk.r.appspot.com
  uolmalli.ddns.net
  uomioin.com
  uooleunfljlaguriuhbswnsvhx-dot-gleowayel400503.uc.r.appspot.com
@@ -184886,6 +185046,7 @@ upatonline.com
  upay.africa
  upbeat-feynman-0c5a10.netlify.com
  upbeat-kalam-2d873c.netlify.app
+upbfhnvk.com
  upbraiding-recapitu.000webhostapp.com
  upbzivot.com
  upcarpets.com
@@ -185272,7 +185433,6 @@ updates.cn.com
  updates.eeinfo.net
  updates.gtaprovince.ru
  updatescheck.com
-updateseason17.com
  updatesecurity.ooguy.com
  updatesecurityamazn.com
  updatesecurityapp.servebeer.com
@@ -185628,6 +185788,7 @@ urlsverified.uk
  urlvoice41.moonfruit.com
  urlzs.com
  urmasiimariiuniri.ro
+urmigroup.in
  urnupiyorcgpknthoyandzdsld-dot-gleowayel400503.uc.r.appspot.com
  urog.co.uk
  urogyn-workshops.com
@@ -185637,7 +185798,6 @@ urquilam.com.ar
  ursreklam.com
  ursulamalls.cf
  urteste.com
-urtkjcxhpjdxmoanxiveejsffu-dot-gle39404049.rj.r.appspot.com
  urtnzxmanfpqywbzmg.top
  urtoothfairy.com
  urtut.ru
@@ -185704,7 +185864,6 @@ us.ucbintl.top
  us02web.zoom.us.coremailxt5mainjsp.com
  us1-netflix.com
  us2westamazonses.servebeer.com
-us992home92.page.link
  usa-chase.com
  usa-gov-bidopps.us
  usa-govt-bids.us
@@ -185746,6 +185905,7 @@ usamashakeel.com
  usapaypal.logpl.com
  usaphotocopyservice.com
  usapubliclibraryjp.chifanavoid.top
+usarealsestate.com
  usarmybase1.us
  usarmyvacations.info
  usasearchmarketing.com
@@ -185843,7 +186003,6 @@ user-amazon.ls9.xyz
  user-amazon.lx1.top
  user-amazon.oh1.top
  user-amazon.oi7.top
-user-amazon.p1o.top
  user-amazon.p9t.xyz
  user-amazon.pl4.xyz
  user-amazon.r1a.top
@@ -186058,7 +186217,6 @@ users-login.ml
  users.atw.hu.46b7944523172043.d99q.cn
  users.atw.hu.ef099dc7d3a470eb.d99q.cn
  users.limited
-users.on.net
  users.qlictonline.nl
  users48-paypal.com
  usersecurity-ref0153.com
@@ -186069,6 +186227,7 @@ userssecuresaccounts.com
  userst.000webhostapp.com
  usersupdatesallaccounts.com
  usersvalidation.weebly.com
+uservipsapass.com
  uservipsvpass.com
  userwebivery.live
  userweblogin.com
@@ -186112,7 +186271,6 @@ usid-94821.mixh.jp
  usid-98541.mixh.jp
  usid-99821.mixh.jp
  usid.link
-usifkziihxxttmiwqokencuenp-dot-gle39404049.rj.r.appspot.com
  usigpross.com
  usiiihtttu.duckdns.org
  usinadefilmes.com.br
@@ -186153,10 +186311,10 @@ usonlineclass.com
  uspaycexnjp.com
  usperemoga.flywheelsites.com
  uspeshnybusiness.ru
-usps.co.com
  usps.reg.secure2.quebecsanstabac.ca
  uspsdelvery-001-site1.atempurl.com
  uspstracking.delivery
+uspstracking.express
  uspsworldwide.com
  usqazt.cn
  usr-d892441e6392cbd3aaf41015.000webhostapp.com
@@ -186242,6 +186400,7 @@ utenti.live
  utenza-psd2-intesa.000webhostapp.com
  utf-16.ovh
  utffunds.com
+utfnln2rckj6vhcxnm2kwuinvi--www-paypal-com.translate.goog
  uths.avantgardeservices.in
  utiladm.com
  utilisation.000webhostapp.com
@@ -186260,7 +186419,6 @@ utjytirbbcfzqcwofbafywujld-dot-gleowayel400503.uc.r.appspot.com
  utk-ks.org
  utkallive.com
  utkin.space
-utkrwcqslzvzxhxtotckowbimo-dot-gl099898987fhkl.uk.r.appspot.com
  utkzlqbmnic2mvh0lbmxpulm5lzcvflw.com
  utl.dermals.org
  utlapomer.com
@@ -186289,9 +186447,7 @@ utransilvania.ro
  uttarakhandghoomo.com
  uttarakhandvarta.com
  utting.org
-utuumrukxkkjbwoejwspqecmvi-dot-gle39404049.rj.r.appspot.com
  utvjhkpvbuaivuthtadpwaoxiy-dot-gleowayel400503.uc.r.appspot.com
-utwlpwxfnabfszhuhrscqdelxe-dot-glmar9393293232323.uk.r.appspot.com
  utyr.gearhostpreview.com
  utzjdwntawovgzbtazjnmlhazeplpzrgjbvr-dot-offgl8876899977678.uk.r.appspot.com
  uu.blackboard.unee.me
@@ -186316,7 +186472,6 @@ uuu.liunian.mobi
  uuud540.cn
  uuuiquiuroff.du.r.appspot.com
  uuviettravel.net
-uuwogiijzgidlarqorlrfkxicl-dot-gle39404049.rj.r.appspot.com
  uuwoieictrkpzbipznwwcouxtyuyffomvdfo-dot-gl494903049.wl.r.appspot.com
  uuww3o.al1av.com
  uuww55pp.al1av.com
@@ -186371,7 +186526,6 @@ uwcfoovm.goruli.com
  uwcontectpunt.us
  uwcwireless.com
  uwcztbtfdghxyfqigshwsnexiextinounwid-dot-gl494903049.wl.r.appspot.com
-uwdcfctkzdafnbkdvtvcmpqdnd-dot-gle39404049.rj.r.appspot.com
  uwe-doherr.de
  uwebi.xyz
  uweigendommen-nu.info
@@ -186383,7 +186537,6 @@ uwhfdsndcjdn.ml
  uwhfdsndcjdn.tk
  uwiomawio.com
  uwj2q.online
-uwkxfdxkmqydzaoqppokvguvew-dot-gle39404049.rj.r.appspot.com
  uwml.shoesmogul.com
  uwncvkvklmpkvnuzilioonxbvoggzcawpkfi-dot-cedar-code-289917.nn.r.appspot.com
  uwoeid01.forumz.info
@@ -186497,7 +186650,6 @@ uzyjujlndeqaadqlpzrewzcqyykpmylyrddg-dot-gl494903049.wl.r.appspot.com
  v-0-v.cn
  v-amazon.top
  v-chek.in
-v-dcorp.com
  v-film.com
  v-foodsal.com
  v-gamez.com
@@ -186506,6 +186658,7 @@ v-inloggenkartlazer.host
  v-kpass.000webhostapp.com
  v-project.000webhostapp.com
  v-stab.com
+v-tech.com.pk
  v-upd.co.uk
  v.dyamm.com
  v00ic.heiluq.com
@@ -186589,7 +186742,6 @@ vacompany.co.za
  vacomsystems.com
  vacontd.com
  vacxv.000webhostapp.com
-vacyegfvoanduufyiabljqukvr-dot-gle39404049.rj.r.appspot.com
  vad12mhpfp03vyfl.xyz
  vadapt.com
  vaddesobhanadri.com
@@ -186830,7 +186982,6 @@ vaner.com.sg
  vanessa971profile.online.photos966611-item.com
  vanexchange.online
  vanezas.com
-vanglzuawcothhvwuzndneishd-dot-gle39404049.rj.r.appspot.com
  vanguarddentalgroup.com
  vanguardunite.org
  vanhaeften.eu
@@ -186896,6 +187047,7 @@ vapm.in
  vapnhwubzibotvqjftkdavscci-dot-gleowayel400503.uc.r.appspot.com
  vaporizershusht.com
  vapormaxsingapores.com
+vapourblastingnyc.com
  varacollect.com
  varahi.org
  varaminity.com
@@ -187087,7 +187239,6 @@ vcf45df.com
  vcfh4wsdxxc.appspot.com
  vcfyf.kpzsom.cn
  vchosting.ddns.net
-vcirxilfedrmlwnffzgotjqcxz-dot-gle39404049.rj.r.appspot.com
  vclmemos.surge.sh
  vclmmsorg.yolasite.com
  vcloud.exchangevoiceapps.ga
@@ -187249,7 +187400,6 @@ veiligheid-beheer.info
  veiligheid-sturen.eu
  veiligheid.herstelplan.info
  veiligheids-update-index.de
-veiligthuis.net
  veinsart.com
  veiok.topkorder.su
  veirteudd7.xyz
@@ -187372,7 +187522,6 @@ venisonpython.com
  venisons.com
  venitronics.com
  venividivici.host
-venixotechnologies.com
  venkindead.zone
  venmao.ga
  venmo--security.com
@@ -187509,7 +187658,6 @@ verfiy-users.com
  verfiy-your-information.com
  verfiy.mobile.ref-id193.work
  verfshoponlinecom.chifanavoid.top
-verfssn.org
  verfy-my-device.com
  verfybaddges-supports.ml
  verfyme.creatorlink.net
@@ -187919,7 +188067,6 @@ verifikasiaccount02.weebly.com
  verifikasiakun-fb7.webnode.com
  verifikasiakun21.weebly.com
  verifikasiakun72.webnode.com
-verifikasiakunanda.nizerx55.ml
  verifikasidatafacebook.x-diamond77.my.id
  verifikasifb20.webnode.com
  verifikasihh-pemblockiraan.cf
@@ -188060,13 +188207,12 @@ verify-myacc02a.serveftp.com
  verify-myaccount083.serveirc.com
  verify-myee-account.com
  verify-myeeaccount.com
-verify-mynew-devices.com
  verify-mypayment.com
  verify-mypp.com
+verify-mysantan-app.com
  verify-myservices.servehalflife.com
  verify-mythree.info
  verify-mythree.xyz
-verify-nckel.com
  verify-necessary-wells.network
  verify-netflix-bill.com
  verify-new-device.com
@@ -188074,10 +188220,8 @@ verify-new-payee.com
  verify-newdevice.cc
  verify-newdevice.com
  verify-newdevices.com
-verify-newpayees-support.com
  verify-notice-wells.network
  verify-notice.network
-verify-nwolb.com
  verify-o2-billing.com
  verify-offce.com
  verify-officilal.tftpd.net
@@ -188158,7 +188302,6 @@ verify.chase.billing.info.ektaxconsultants.com
  verify.chase.billing.info.igualdad.cl
  verify.ddns.net
  verify.eemylogin.com
-verify.fb-confirm01.com
  verify.fb.unilorite.com
  verify.hmrctax-regain.com
  verify.login-3.com
@@ -188420,9 +188563,10 @@ veritificartbcpmovil-peru.cola-ge.com
  veritress.info
  veritynova.com
  veritype166.com
-verivikasi-pemblokiran-fb4.gq
  verivikasi-pemblokiran-fb5.cf
-verivikasi-pemblokiran-fb5.tk
+verivikasi-pemblokiran-fb5.gq
+verivikasi-pemblokiran-fb8.ml
+verivikasi-reall.se.ke
  verivikasi.fego-xfb.cf
  verixon.co.uk
  verizon-3support.com
@@ -188445,7 +188589,6 @@ verizontripleoffers.com
  verizonwesttransition.com
  verizonwirelessltd.com
  verizonwireoffers.com
-verkinae34.com
  verlfication-apple.ddnsking.com
  verlfiymatch.com
  verlflcations-accesd.com
@@ -188570,6 +188713,7 @@ vesrzxs.000webhostapp.com
  vesselomar.com
  vestacrest.buzz
  vestaxmusic.com
+vestbins.gq
  vestcheasy.com
  vestea.jp
  vesteccles.com
@@ -188577,7 +188721,6 @@ vestibulecovers.club
  vestibulecovers.com
  vestibulecovert.com
  vestjyskbnk-dk-159.000webhostapp.com
-vet-chien.com
  vet-equin.fr
  vet-growth.com
  vetapharma.fr
@@ -188629,7 +188772,6 @@ vezba.radiovoda.com
  vf.jandigitalstudios.com
  vfbnedrf44.duckdns.org
  vfca.co
-vfcfthrlctfjyzvwpnpwozlwas-dot-gle39404049.rj.r.appspot.com
  vfd892.com
  vfduzopmpyibfahyqidyjucgnj-dot-gloff849483.uk.r.appspot.com
  vfestas.com
@@ -188920,7 +189062,6 @@ video-ld.ru
  video-webcam.site
  video-x-libya.000webhostapp.com
  video.emadras.ir
-video.enexusgroup.com.au
  video.getwisdom.com
  video.messenger-beta.to
  video.news.naver.45227975.cafenaver.xyz
@@ -189013,6 +189154,7 @@ videosforyouforme.000webhostapp.com
  videosiocom.batwoqisep.top
  videoskick.com
  videosmaiscs.xyz
+videosmk-colmek3.freetcp.com
  videosmundonice.xyz
  videosnicewomen.xyz
  videosnicewomen2.xyz
@@ -189028,7 +189170,6 @@ videoswebcammsn.free.fr
  videosxx.ga
  videoterbaruaku.site
  videoterkini.xyz
-videoviral.gamescome.net
  videoviral.wikaba.com
  videoviral778.site
  videoviralaku.site
@@ -189053,6 +189194,7 @@ vidio-dewasa-jepang-www.000webhostapp.com
  vidio-sex-18plus.000webhostapp.com
  vidio-sexy-bokep-indo-www.000webhostapp.com
  vidio-viral19.wikaba.com
+vidiobokep-janda2.otzo.com
  vidiobokep14.my03.com
  vidiobokep2.dns05.com
  vidiobokepanaksmp.000webhostapp.com
@@ -189095,7 +189237,6 @@ vierccom.shaxiaanti.top
  viesserin.xyz
  viestatnorfali.cf
  vietducbio.com
-vietentours.com
  vietexmedia.de
  vietjetair.cf
  vietlawconsultancy.com
@@ -189153,9 +189294,9 @@ view72paypal.com
  viewadobeeviteinvitation.000webhostapp.com
  viewall.eu
  viewandmanage.top
-viewbackwebsolutions.mavencube.com
  viewbytext.com
  viewfbapp.com
+viewfileverzekering.000webhostapp.com
  viewform.invoice760.dnsabr.com
  viewforview.com
  viewgr.com
@@ -189473,7 +189614,6 @@ viralbokep-miripnagita.zyns.com
  viralbokepindo.myinfoo.tk
  viralcc.com
  viralchat2.claim654.com
-viralcolmek-bokep12.mydad.info
  viralcwekbali.000webhostapp.com
  viralesfb.xyz
  viralgishel.2waky.com
@@ -189488,12 +189628,12 @@ viralllbaru2020.000webhostapp.com
  viralsex929383.000webhostapp.com
  viralterbaru2020.com
  viraltrendingfb.000webhostapp.com
-viralvideo-girang1.otzo.com
  viralvideo-ph.duckdns.org
  viralvideoperampokan.000webhostapp.com
  viralwhatsapp-dewasagroup.joins-wagrup10.tk
  viralwhatsappsgrup.zzux.com
  viralzingz.com
+viramasta.com
  virat24news.com
  viratmobiletools.com
  virbelgdivir.000webhostapp.com
@@ -189637,6 +189777,7 @@ visa.com-che-9899760304.wikyzone.com
  visa.com-mobi-0236578329.islahomeibiza.com
  visa.com-mobi-1527798468.islahomeibiza.com
  visa.org.ua
+visadpsgiftcard.com
  visagepk.com
  visahome-prismamediosdepago.picotflb.org
  visahouses.com
@@ -189660,6 +189801,7 @@ vishwasanket.com
  visiativ-industry.fr
  visibilityhub.com
  visiblecapital.xyz
+visiblend.com
  visicosm53.com
  visidom53.com
  visietest.nl
@@ -190104,7 +190246,6 @@ vlojr.pw
  vlpc.goruli.com
  vlsecityurtxa.pw
  vltkmienphi.net
-vlttszmawuqrffeudikastnyee-dot-gle39404049.rj.r.appspot.com
  vlvdigital.com
  vlwiwfifjheeriufoudzakfdksjpnoyhzumi-dot-solar-vertex-285913.rj.r.appspot.com
  vlwvzyoe314fra997w.top
@@ -190150,6 +190291,7 @@ vmeyineidiixeqbdnudvememud-dot-gloff849483.uk.r.appspot.com
  vmfturbinas.com
  vmgtyhlsxde45rye6345ryku8oplyu7iokr56fdsgrwsews.2waky.com
  vmhc.net
+vmi221587.contaboserver.net
  vmi402482.contaboserver.net
  vmi458350.contaboserver.net
  vmindus.com
@@ -190166,10 +190308,8 @@ vmoremlm.com
  vmorescam.com
  vmphotograph.com
  vmpzdsbnztmycvmztp.top
-vmqxhagmyleckhrooraulycbne-dot-gl099898987fhkl.uk.r.appspot.com
  vmracing507.com
  vmrbuildcon.com
-vms.prep.co.in
  vmsecityurevz.pw
  vmsecuritysolutions.com
  vmwares.ca
@@ -190202,9 +190342,9 @@ vngwpvmylwvonmcagcwhjvmkwolnacmwxoqr-dot-solar-vertex-285913.rj.r.appspot.com
  vnhmcrs.com
  vnhomes.vn
  vniel.co.kr
-vnijmhackbbcfkyjmthqklzpqp-dot-glmar9393293232323.uk.r.appspot.com
  vnitservice.com
  vnjsascfa.com
+vnjt.top
  vnko.creatorlink.net
  vnlacoste.com
  vnlf.4buyuklergazete.com
@@ -190522,7 +190662,6 @@ votre-boitevocale-fixe.web.app
  votre-compte-desjardins.online
  votre-contactorange-sms.web.app
  votre-facture.com
-votre-messagerie-vocale-orange25.yolasite.com
  votre-servicevocale.web.app
  votre-smsvocale-telephone.web.app
  votre-telfixe-appelorange.web.app
@@ -190656,6 +190795,7 @@ vqatqjymmmforc.top
  vqbvmfp.daylibrush.com
  vqdqjohnewyfyuoezfvcqlrfwt-dot-gloff849483.uk.r.appspot.com
  vqfimuzfrlasrpuswzzblolqcc-dot-gleowayel400503.uc.r.appspot.com
+vql19wjin03yamf.xyz
  vqldevvbbuapbawybidvwtsotu-dot-gleowayel400503.uc.r.appspot.com
  vqntrolopokowi.ga
  vqpr.com
@@ -190732,6 +190872,7 @@ vsbwacjzeyzblzzswmfhkmiindoghxurdymi-dot-offgl8876899977678.uk.r.appspot.com
  vsd-netflix.com
  vsdz21wasz.appspot.com
  vsecityurafzc.pw
+vsfyhrterfvsd.net
  vshjgqxfozjijowuvhmkdunxzsyovllihcci-dot-glenxpecial3009493.ey.r.appspot.com
  vshks.com
  vshopbuy.com
@@ -190739,7 +190880,6 @@ vshwcpqhky.duckdns.org
  vsijfwuppgfonjisykbnyfcraw-dot-gloff849483.uk.r.appspot.com
  vsmmnec.com
  vsmms0.yolasite.com
-vsmpbomxmtuaqzlculrtbswrmw-dot-gle39404049.rj.r.appspot.com
  vsmsorg.weebly.com
  vsnou432.top
  vsochi-park-hotel.ru
@@ -190750,7 +190890,6 @@ vspc.org
  vspirelab.com
  vsplegals.com
  vspmscop.org
-vsrmjdzemzeivfptncxsrxemiy-dot-gle39404049.rj.r.appspot.com
  vsstle.edu.rs
  vst3.com
  vstamptitle.club
@@ -190760,7 +190899,6 @@ vstress.pw
  vstsample.com
  vsv.co.in
  vswczrdartjcyuhx-dot-millinium.ey.r.appspot.com
-vswkpqkwvqpsnmijfiqgtktnbm-dot-glmar9393293232323.uk.r.appspot.com
  vsxgmkapcfskpxpqjzinwaomgx-dot-gloff849483.uk.r.appspot.com
  vsxxs18.000webhostapp.com
  vszcza.000webhostapp.com
@@ -190929,9 +191067,7 @@ vvww1royallbank.com
  vvwwbcpzonasegurabeta.com
  vvwwrolox.com
  vvyucgyyeqwjzynkyevd.top
-vvyxzrmbaupeaamlidkxnaiuol-dot-gle39404049.rj.r.appspot.com
  vw.perlqw.net
-vwallet.top
  vwapxkqgtgwjmefq.top
  vware.duckdns.org
  vwassessoria.superwebmaster.com.br
@@ -190972,16 +191108,13 @@ vxabybupvu.duckdns.org
  vxcznbvbzcxn.servecounterstrike.com
  vxgdft.shoesmogul.com
  vxgqejudtcxyhwxz.top
-vxhkuihraoyiiqyojoxrdpldxu-dot-gl099898987fhkl.uk.r.appspot.com
  vxikjexwwnoaggkxewrbmxemxygzufubcrmq-dot-glegen303939423233.ue.r.appspot.com
-vxjpwwmjvpvxagcivcatiakuei-dot-gle39404049.rj.r.appspot.com
  vxneczocizlbnxvflbzmtucxun-dot-gleowayel400503.uc.r.appspot.com
  vxojeldzonjlqzrfeolxpatjiilduxvphnyz-dot-solar-vertex-285913.rj.r.appspot.com
  vxptecwkptoevzzv-dot-millinium.ey.r.appspot.com
  vxqghurwhvineepy.oragondesignstudio.com
  vxqkhzourygtzxanxalrjnsjjxelxzxgzcme-dot-solar-vertex-285913.rj.r.appspot.com
  vxser.com
-vxshhayetbwpvmcchgvsibiluz-dot-gle39404049.rj.r.appspot.com
  vxssarhqelaonaedtbnpwlduqrxkywgswjta-dot-glegen303939423233.ue.r.appspot.com
  vxswqefit.com
  vxtu6vhwwzf1hf1.theholywhore.com
@@ -191007,7 +191140,7 @@ vyofdfejd.goruli.com
  vyojkgvwxephfjevkevcqjnslyjwfbveakfj-dot-offglen.uk.r.appspot.com
  vyrlksauqzrsvnlflbrhteudgjxjeqvfashn-dot-glenxpecial3009493.ey.r.appspot.com
  vyroba-plotov-bran.sk
-vyrogypsy.ml
+vyrogypsy.cf
  vyrtfcadclhbjfeqwnpcptpwzwkyxtyhxdfh-dot-cedar-code-289917.nn.r.appspot.com
  vysix.nl
  vysokepole.eu
@@ -191209,6 +191342,7 @@ wa-youtuber-freefire.tk
  wa.event-indo.com
  wa.userka.com
  wa10.trickip.net
+wa111524gfsws735.web.app
  wa18-xx.000webhostapp.com
  wa18-xxux.000webhostapp.com
  wa18-zxz.000webhostapp.com
@@ -191228,6 +191362,7 @@ wa7xck5d3vnk.talagaremix.com
  waaaa1.duckdns.org
  waagenstammcom.shaxiapussy.top
  waahasapsange.mrbonus.com
+waajasq.bar
  waallyoutuberff.grupwhatsapp-freefireplayers2.cf
  waam-ci.com
  waapos.com
@@ -191252,7 +191387,6 @@ wacstderypasgzlrlosjmxpgeslxigbvshkh-dot-solar-vertex-285913.rj.r.appspot.com
  wacyifcndadrucfpfbguyixfksqnesrewddu-dot-glegen303939423233.ue.r.appspot.com
  wadadsadada.email
  waddbilmoltschemartrop.tk
-wade-co.com
  wade-es.com
  wademancom.000webhostapp.com
  wadetsmith.selfip.com
@@ -191289,14 +191423,12 @@ wagroup-invited111.2waky.com
  wagroup18.h3d.shop
  wagroup18.site-hadiah.com
  wagroup18.theworkpc.com
-wagroupasikasikbikinpanasbngt.frees6.com
  wagroupindo.000webhostapp.com
  wagroupinvite-bokep.000webhostapp.com
  wagroupinvite-bokep9.000webhostapp.com
  wagroupjoin.h3d.shop
  wagroupjoin.h6d.shop
  wagroupjointomygroup2020.000webhostapp.com
-wagroupwagrouphootsko.frees9.com
  wagrub-indo.pricee.gq
  wagrub651.wa-sex.com
  wagrubbkp671.nett13.ml
@@ -191614,6 +191746,7 @@ waseda-investment.jp
  wasemoren.net
  wasesibomi.info
  wash.caferelax.spb.ru
+washalgulfchemicals.com.sa
  washawaydesctrucion.com
  washcolsc.com
  washingtonlibraries.top
@@ -191648,7 +191781,6 @@ watch-kredit.ru
  watchcorona.com
  watchdogdns.duckdns.org
  watchdoughrefbikin.ml
-watcherinsrisuk.000webhostapp.com
  watcheslovetop.top
  watchesofswitzerland.eu
  watchespower.com
@@ -191713,7 +191845,6 @@ watsjoker.tukphpgl.com
  watsupptoday.com
  watsx.xyz
  wattacatch.com
-wattkinselectrical.com.au
  wattpadsecure.000webhostapp.com
  wauchlesenecanhun.quickwebchecker.com
  wauconia.com
@@ -191739,7 +191870,6 @@ wavidhot52.gq
  wavidhot85.cf
  wavidhot85.ga
  wavidhot85.ml
-waviral.holzn.org
  waviral2020.mrslove.com
  wavywayest.ga
  wavzs.biz
@@ -191983,7 +192113,6 @@ wduqjwzzygmcazglzwwlkjkoew-dot-gleowayel400503.uc.r.appspot.com
  wdvophtlgtexrvnyibslhivhfrowdvjuudpi-dot-solar-vertex-285913.rj.r.appspot.com
  wdwaqas.com
  wdwesaictuzmlimjwgyigblrmpyyfsfcwzoj-dot-solar-vertex-285913.rj.r.appspot.com
-wdwjuegjrtxfvfkqfleuolzkjg-dot-glmar9393293232323.uk.r.appspot.com
  wdwusa.org
  wdxz.riabest.com
  we-review.com
@@ -192021,7 +192150,6 @@ wealthcreationhomes.co.nz
  wealthoughout.info
  wealthplanadv.com
  wealthprez.com
-wealthvisionary.com
  wealthweldone.com
  wealthwelldone.net
  wealthytiffany.com
@@ -192200,6 +192328,7 @@ web-whatsappsex186.wikaba.com
  web0016-mail.co
  web0aruportal0config.theworkpc.com
  web1-bbva-es.net
+web1-cpn.biz.net.id
  web1crafting.com
  web1zonasegvrabnonlinedat.club
  web2-bb-com-br.duckdns.org
@@ -192537,6 +192666,7 @@ webmail.freehealthstudy.icu
  webmail.gift14.kozow.com
  webmail.gjared.com
  webmail.harmonypads.top
+webmail.hautot-communication.fr
  webmail.hmrc-gov-uk.com
  webmail.home-verify-netfllx-com.gleeze.com
  webmail.hydropneuengg.com
@@ -192598,7 +192728,6 @@ webmail.servicio-banco-es-identificador.com
  webmail.servidorseguroweb.gq
  webmail.silkflowerexperts.icu
  webmail.simplesubtraction.xyz
-webmail.simvoly.com
  webmail.sistemaamazonasenergia.com
  webmail.sokorri.com
  webmail.spcbrasil.adm.br
@@ -192611,6 +192740,7 @@ webmail.utaxeurope.com
  webmail.verifiys-aacounts-cardss-noticeaamzonss-user-id17.ooguy.com
  webmail.verifiys-aacounts-cardss-noticeaamzonss-user-id26.ooguy.com
  webmail.verifymythree-update.com
+webmail.vochtplekken.be
  webmail.web-jandwsales.club
  webmail.www-icscards.xyz
  webmail.xn--cdk-1ra.com
@@ -192943,10 +193073,8 @@ weiterbildungsparkcom.licumexico.gdn
  weixin.lefu.co
  weixin.vishou.net
  wejdzmy-masowo.eu
-wejgj234jg234.com
  wejhwhz29.asfsanh.com
  wekcopsn.top
-wekwonamfxqucbpaazieheuvva-dot-gle39404049.rj.r.appspot.com
  welasyia.com
  welawultrading.com
  welb1da48a82hp.com
@@ -193052,6 +193180,7 @@ wells-fargo-user.team
  wells-fargo-verify-acc.work
  wells-fargo-verify-personal-info.work
  wells-fargo-verify.network
+wells-fargo.myftp.biz
  wells-fargobankonline.com
  wells-information.duckdns.org
  wells-login-notice-access.network
@@ -193185,7 +193314,6 @@ welshstructures.com
  weltheimat.com
  weltho.com
  welwrdpharmaceuticals.com
-welyadzkzynmifvwfoijegzimg-dot-gle39404049.rj.r.appspot.com
  wemai.000webhostapp.com
  wemail-hotmail-1.com.ng
  wemakeboxes.com
@@ -193225,7 +193353,6 @@ wentuomachinery.com
  wenusemeee.com
  wenzhou.06wi.com
  weorder-xrs.000webhostapp.com
-weospojfwuqtrsdzfwtnodypjo-dot-gle39404049.rj.r.appspot.com
  weowx.com
  weplayaem.com
  weplaygiven.com
@@ -193353,7 +193480,6 @@ westend-us.com
  westend-zoo.de
  westerm-global.com
  westermannmodulhauscom.shaxiarecord.top
-western-lofty-limburger.glitch.me
  western.ge
  westernautoweb.duckdns.org
  westernbee.com
@@ -193584,7 +193710,6 @@ wghigap003.xyz
  wghigap004.top
  wginfotechnology.com
  wgiyw.brandstorey.su
-wgjflohpzqymtbuyiifinfphqh-dot-gl099898987fhkl.uk.r.appspot.com
  wgkenny.com
  wgktsvbifwbbsmkvudtzfpvhxo-dot-gloff849483.uk.r.appspot.com
  wgmfcohtpdgzgfwfmqgyopveugmlwrobhucp-dot-cedar-code-289917.nn.r.appspot.com
@@ -193646,6 +193771,7 @@ whastapp18plus.v-25.com
  whastappbokeppcokke.000webhostapp.com
  whastxgroupp.tk
  what-appinvited01.2waky.com
+whataap-viralss-j0in.2waky.com
  whataapp-bogel-join-invite18.2waky.com
  whataapp-invit-group18-reby1.2waky.com
  whataapp-invite-groupsx18.2waky.com
@@ -193754,8 +193880,6 @@ whatsapberbagi.ffitem6.cf
  whatsapbokep.dns04.com
  whatsapbokep.getzs20.tk
  whatsapbokep.kce89.cf
-whatsapevosmr05regi.truego00.ml
-whatsapevosregimr05.deweo33.cf
  whatsapgroup.dns1.us
  whatsapgroup.fartit.com
  whatsapgroup.my.to
@@ -193956,6 +194080,7 @@ whatsapp-invite-grubboghel.2waky.com
  whatsapp-invite-joinkuy-groups3sy.2waky.com
  whatsapp-invite-lordpoi18.2waky.com
  whatsapp-invite.freefirehadiah12.ml
+whatsapp-invite.info665.gq
  whatsapp-invite.lflink.com
  whatsapp-invite11.mc-srv.com
  whatsapp-invite2.jetos.com
@@ -193990,8 +194115,6 @@ whatsapp-joingrub.mcalias.com
  whatsapp-joingrupbokepjepang.holl88.com
  whatsapp-joingrupnew18.wa-bokep7.cf
  whatsapp-joinngrupinvite.ocry.com
-whatsapp-joinnow.duckdns.org
-whatsapp-joinxx.get-line23.cf
  whatsapp-khususdewasa18plus.viral-xxx.ga
  whatsapp-linkinvit-group18sex.2waky.com
  whatsapp-lordpoi-dewasa18.2waky.com
@@ -194018,6 +194141,7 @@ whatsapp-xgrup.wikaba.com
  whatsapp-youtubers.25u.com
  whatsapp.bkp-grup.bkp-wa18.ml
  whatsapp.bkp.croot-18.tk
+whatsapp.blazagency.com
  whatsapp.bokep0016.ga
  whatsapp.bokep091615.ml
  whatsapp.brazil7.my.id
@@ -194032,6 +194156,7 @@ whatsapp.grup18-invit.my.id
  whatsapp.grup18.vvipx77.ga
  whatsapp.hols20.cf
  whatsapp.hot1.shop
+whatsapp.hotviip19.gq
  whatsapp.hy5.ooguy.com
  whatsapp.join-grup.porn.2020-2021.net
  whatsapp.joinx-grup.tk
@@ -194086,6 +194211,7 @@ whatsapp27.25u.com
  whatsapp29.lflink.com
  whatsapp30.duckdns.org
  whatsapp36.tk
+whatsapp389.duckdns.org
  whatsapp4.25u.com
  whatsapp40.lflink.com
  whatsapp49.lflink.com
@@ -194136,7 +194262,7 @@ whatsappchats.claim654.com
  whatsappchatt.pointdns3.xyz
  whatsappchatt18.qhigh.com
  whatsappchatts.ygto.com
-whatsappclientgrup.gq
+whatsappcimbrut-munis.dqhv.cf
  whatsappdansohbet.xyz
  whatsappdewasa-group1.myl8.tk
  whatsappdewasa1.tk
@@ -194166,7 +194292,6 @@ whatsappgroup19.linkk.ml
  whatsappgroup20.ddns.net
  whatsappgroupbokep.dynamic-dns.net
  whatsappgroupchatjoin8382.squirly.info
-whatsappgroupff.zzux.com
  whatsappgroupinvite.ml
  whatsappgroupinvite95.ga
  whatsappgroupinvithot17.jetos.com
@@ -194192,7 +194317,6 @@ whatsappgrpup2020.myvnc.com
  whatsappgrub-mabarfreefire-budi01gaming.zzux.com
  whatsappgrub.25u.com
  whatsappgrub.asia
-whatsappgrub.guied255.ga
  whatsappgrub.hol8.me
  whatsappgrub.xxx-bokep.tk
  whatsappgrub0.kalem-2.my.id
@@ -194223,10 +194347,8 @@ whatsappgrupbudi.com
  whatsappgrupbudi01gaming.serveusers.com
  whatsappgruphot2020.dynamic-dns.net
  whatsappgrupinvitation.otzo.com
-whatsappgrupinvite.grup-wa-join.cf
  whatsappgrupinvite20.ml
  whatsappgrupjoin18plus.sexidude.com
-whatsappgrupnew.ga
  whatsappgrupnew.xyz
  whatsappgrupnew18.holl01.ml
  whatsappgrupnew2020.tk
@@ -194278,14 +194400,12 @@ whatsappjoingrupbok3p.user11.gq
  whatsappjoinhot.tk
  whatsappjoins.4dq.com
  whatsappjoinss.4dq.com
-whatsappku.joinwhat1app.cf
  whatsapplendir.4pu.com
  whatsapplinkchat.my.id
  whatsappm782.pkus88.net
  whatsappmabar-grup220.tk
  whatsappmensagenserecados.blogspot.com
  whatsappmessenger-free.diamondff15.tk
-whatsappml.gq
  whatsappnetbokepdewasaindo.tk
  whatsappnew-wa1.ga
  whatsappnew-wa1.gq
@@ -194344,6 +194464,7 @@ whatsapps.serveirc.com
  whatsapps.srv51.com
  whatsapps.zxix7.com
  whatsapps18grup.srv51.com
+whatsapps407.duckdns.org
  whatsappsangean.25u.com
  whatsappsbokep2020.krip-krip.tk
  whatsappsenderpro.com
@@ -194378,8 +194499,6 @@ whatsappskh2wje76ahja.ddns.info
  whatsappss-xxxx.tk
  whatsappss.serveirc.com
  whatsapptbk77.blogspot.com
-whatsappupydesah.truego00.tk
-whatsappupytiktok.truego00.ml
  whatsappvc.com
  whatsappviral.vvipv.ml
  whatsappviral18.ezua.com
@@ -194784,7 +194903,6 @@ wildcard.azph.monster
  wildcard.bnrc.bz
  wildcard.bylockgercegi.com
  wildcard.c3ul.ru
-wildcard.cafinforma.it
  wildcard.cchos.network
  wildcard.cleanshoes.com.do
  wildcard.cleansol.lk
@@ -194821,8 +194939,6 @@ wildcard.laracatesworld.com
  wildcard.laylamebel.az
  wildcard.locationbureau.com
  wildcard.m7md1.sa
-wildcard.maletoth.com
-wildcard.maletoth.hu
  wildcard.mansurtech.com
  wildcard.mezcalunion.com
  wildcard.mls-d2-f4-sdd.com
@@ -195009,7 +195125,6 @@ winchesterremodelingmd.com
  wincoins.be
  wincon20.in
  wincon32.in.net
-wincontestaddidas.000webhostapp.com
  wind.windmilldrops.com
  winday18.com
  windays15.com
@@ -195024,6 +195139,7 @@ windjammermuseumcom.shaxiacenter.top
  windlyco.shuiadrink.top
  windmarkco.com
  windmaskwde.ru
+windocyte.com
  window32.in.net
  window64.in.net
  windowbear.com
@@ -195200,7 +195316,6 @@ wiretube.com.br
  wirex-app.co
  wirex-gb.co
  wirfir.com
-wirliebenwebseiten.de
  wirmacheninfo.shaxiaproduct.top
  wirodrgpltyrmbyqovncyhesph-dot-gleowayel400503.uc.r.appspot.com
  wirpflegennet.chifanavoid.top
@@ -195239,6 +195354,7 @@ wishupongifts.com
  wishzon.com
  wiskundebijles.nu
  wissyner.com
+wit19refyn03rokplj.xyz
  wital-logistics.de
  witapen.xyz
  witatury.nl
@@ -195306,7 +195422,6 @@ wjamtecadwbgsgpztp.top
  wjanrokttshhwusdoozgfohuhhhzjfesicpg-dot-cryptic-now-290917.ey.r.appspot.com
  wjbnvpsaayhquxfned.top
  wjcctf.com
-wjgligxuvufpwyxafasccaitvk-dot-gle39404049.rj.r.appspot.com
  wjglvuezaaclvnrcjophktnununjqjiwweiq-dot-glenxpecial3009493.ey.r.appspot.com
  wjjjvzdwfmrygldq-dot-glexcel1.ue.r.appspot.com
  wjjprlmbqubxvngkkdtajewppg-dot-gleowayel400503.uc.r.appspot.com
@@ -195319,7 +195434,6 @@ wjmkswezxkwkpdumqrr.top
  wjoll.goruli.com
  wjpoqildgliuupsrqdyhubadmpwglsdygllo-dot-solar-vertex-285913.rj.r.appspot.com
  wjskdijiajskaksman.com
-wjthgnlryrjblbgrzxnjhwaftr-dot-gle39404049.rj.r.appspot.com
  wjuuccjziytohqcgggejaybbzv-dot-poised-bot-306515.uk.r.appspot.com
  wjw47.alnawwar.com
  wjwstypeuuracaqcwh.top
@@ -195335,7 +195449,6 @@ wkfgpxz.vipsnapchatsexting.com
  wkgeocxcqzfldbgqqnqcoigibl-dot-gleowayel400503.uc.r.appspot.com
  wkhwrouyks.duckdns.org
  wkibufrfv.goruli.com
-wkildgajztekgkqfhswlveupon-dot-gle39404049.rj.r.appspot.com
  wkjq.mentriqq.com
  wkkjf.com
  wklatt.cbyla.com
@@ -195364,7 +195477,6 @@ wkvgxpnsyzmlknjnaeupwabmyffnvobbpcaj-dot-solar-vertex-285913.rj.r.appspot.com
  wkwhwnet.ru
  wkyctcrhfnzredywza.top
  wkye.xyz
-wkzhgs.com
  wl.psdzy.com
  wl2694.com.br
  wlafhqy.sovereignty2020.com
@@ -195613,7 +195725,6 @@ womwx.net
  wonand.co.kr
  wonder-tonic.com
  wonderfish-recipe2.com
-wonderful-just-anise.glitch.me
  wonderful-payne-0df6cd.netlify.app
  wonderful.gr
  wonderfulaffectionateelectricity.estarlingramos.repl.co
@@ -195631,7 +195742,7 @@ wonderstore.it
  wonderstream.tv
  wonderwaterbeads.com
  wonderwomans.net
-woningnet-betaalverzoek.tk
+woning-ideal-omgeving.tk
  woningontruimenarnhem.nl
  woningontruimingarnhem.eu
  woningontruiminglimburg.nl
@@ -195691,6 +195802,7 @@ word-login.ga
  word-mlbbfreeskinch.tk
  word-onlineoffice365sharepointdocreview.com
  word-onlineoffice365sharepointdocview.com
+word-skinfreenew.cf
  wordbasis.com
  wordbridgetranslation.com
  wordbyletter.com
@@ -195706,7 +195818,6 @@ wordpress.com.na
  wordpress.dev.zhishiq.com
  wordpress.eastbayhub.com
  wordpress.madwirebuild.com
-wordpress.mavencube.com
  wordpress.motionmill.be
  wordpress.paraline.com.vn
  wordpress.paypal.com-informationaccounts.com
@@ -195912,7 +196023,6 @@ wp-vinaseco-dev.vicoders.com
  wp.10x00.com
  wp.6645478.top
  wp.99vip.com.cn
-wp.accsv.org
  wp.argofax.com
  wp.corelooknung.com
  wp.dcsakuk.co.in
@@ -195941,7 +196051,6 @@ wp07.jaysbrand.com
  wp1.cbykmedia.com
  wpbgwcfafxqgaktudrjqhcldzl-dot-gleowayel400503.uc.r.appspot.com
  wpbkw.com
-wpbqcmwqrtrbwzyzoxndhenija-dot-gle39404049.rj.r.appspot.com
  wpca.nicedayjp.com
  wpcccricket.co.za
  wpconnect.org
@@ -196040,7 +196149,6 @@ wrathful-committee.aerobaticapp.com
  wratourd.com
  wrcca.net
  wrcmwyjxmqegvlzjuudsadqwlr-dot-gleowayel400503.uc.r.appspot.com
-wrcp.cf
  wrdwljaepftxdjvpryzanhzsrf-dot-poised-bot-306515.uk.r.appspot.com
  wrefinsivey.xyz
  wrestyeildsfarms.com
@@ -196066,7 +196174,6 @@ writingfromling.live
  writinginstrument.co.uk
  writingpup.com
  writions.xyz
-writtendeer.com
  wriuzjxasbgdzfzlcgbbgfvycylsloylvzyw-dot-cedar-code-289917.nn.r.appspot.com
  wrjctzbnvbbzsbmnynnmzocloj-dot-gleowayel400503.uc.r.appspot.com
  wrk44.ddns.net
@@ -196080,7 +196187,6 @@ wrong-headed-caps.000webhostapp.com
  wroq.tanglescanner.com
  wrotraifax.biz
  wrought-paper.000webhostapp.com
-wrpmwkhleerbbefoyvhebuyvwu-dot-gle39404049.rj.r.appspot.com
  wrqww.xyz
  wrqy.goruli.com
  wrric.ml
@@ -196103,7 +196209,6 @@ ws-ebavisapia01-dll.ir
  ws.stivenfernando.com
  ws3lfkm.com
  ws6q.gazengel.com
-ws6zntebgp646q9w6m0x4z3m.shop
  wsadministrateurxvocalebe.yolasite.com
  wsads.weebly.com
  wsdfghjkjhgfcv.duckdns.org
@@ -196139,7 +196244,6 @@ wsqy.vipsnapchatsexting.com
  wsrjobrzcgocayyonyaatdpojzbbrwpkcdif-dot-cedar-code-289917.nn.r.appspot.com
  wss.autotradingservices.com
  wssa-ceeflivves.bounceme.net
-wssilwnbxtaeblnvdupknmtdfj-dot-gle39404049.rj.r.appspot.com
  wsspaq.com
  wssports.msolsales3.com
  wstatt.weebly.com
@@ -196250,7 +196354,6 @@ wulansbd.000webhostapp.com
  wulggyrplodnhcirrxejkwxawg-dot-gleowayel400503.uc.r.appspot.com
  wulierji.com
  wulumuqi.06rl.com
-wumpbgaqtapodsuuelkjywducs-dot-gle39404049.rj.r.appspot.com
  wunder-heute.tv
  wundergrau.com
  wunnuinnwuilm.com
@@ -196433,6 +196536,7 @@ ww38.us.mobilesitescan.com
  ww38.xieziet.do22.co
  ww3chase.request.id.system.online.covi19.app
  ww3chase.request.id.system.online.redirect.jpservice.co
+ww3verification-mtb.serveftp.com
  ww4.indiabay.xyz
  ww5k.mentriqq.com
  ww6.000webhostapp.com
@@ -196458,6 +196562,7 @@ wwedttztfrrqjdmrgzhtenzupn-dot-gleowayel400503.uc.r.appspot.com
  wwedvm.appspot.com
  wwets.xyz
  wwetw.xyz
+wwgmvivi66axpoxgejsjc4p5oy-adwhj77lcyoafdy-www-paypal-com.translate.goog
  wwhm55.com
  wwildeard.genovesevanderhoof.com
  wwiwesbgax.duckdns.org
@@ -196595,7 +196700,6 @@ www-customer-login-wells-fargo.mobi
  www-customerloginpage-verifyidentity.ibijossieng.com
  www-cwbank.com
  www-degelyehuda-org-il.filesusr.com
-www-drive-view.000webhostapp.com
  www-ebanking-ing.com
  www-ecimer-formgirisleri-gov-tr.com
  www-ecimer-iadebasvurusu2020-gov-tr.com
@@ -196935,6 +197039,7 @@ wxhkdcxdhjv.biz
  wxhuaweijx.com
  wxj8.mandaforenon.ru
  wxjjbqeenpljftwwtgqhubklhjtsyygwkelf-dot-cedar-code-289917.nn.r.appspot.com
+wxjlhvhvudtcdxprjeabeaclva-dot-poised-bot-306515.uk.r.appspot.com
  wxjnp.top
  wxm3q.awaykart.com
  wxnxnkcgsvztyqnjmduu.top
@@ -196969,6 +197074,7 @@ wyf003.cn
  wyfq6afhiuu54lj.e8273.pro
  wygeneruj-kody.net
  wygrywajglosem.com.pl
+wyhfi19vkwt03hcrle.xyz
  wyjbanunphazxfmhbnhvyltnydktpsexlanz-dot-offgl8876899977678.uk.r.appspot.com
  wyjqcljpkpeolnxtlsckneqwdwpldyawuite-dot-gl494903049.wl.r.appspot.com
  wyjyb.cn
@@ -197002,6 +197108,7 @@ wyt6.addroits.com
  wytypuj-wyborce.eu
  wytypuj-wynik.eu
  wyuchabsxz.duckdns.org
+wyus3yvus3yijytmlclsplmqs4-adwhj77lcyoafdy-www-paypal-com.translate.goog
  wyvernpartnersoffice365box.com
  wyvspqpm.dermals.org
  wywc.svcoding.com
@@ -197160,7 +197267,6 @@ xaelvz.qewoahzkz.pqtimakzds.com
  xaergtcrc.club
  xaergtcrc.win
  xafkmlvqga.com
-xagenaforum.it
  xagmpkueqiesigtjqtrqorwqupuohchliahu-dot-offgl8876899977678.uk.r.appspot.com
  xagqwqhbnkfaebnuonmuppbgie-dot-gleowayel400503.uc.r.appspot.com
  xahoihayvietnam.xyz
@@ -197193,7 +197299,6 @@ xatauthentverificationauth-incoming-paypal-payment-xgbmd30bm.cf
  xatauthentverificationauth-incoming-paypal-payment-xgbmd32bm.cf
  xautd.goruli.com
  xauthentics.com
-xav22ieremarcy.000webhostapp.com
  xaviermartinez.keoskohosting.com
  xaviermor.ru
  xavieronassis.com
@@ -197625,7 +197730,6 @@ xj0n.svcoding.com
  xjackzhao.com
  xjbgmmiforqckzoexiqqlyjksu-dot-gleowayel400503.uc.r.appspot.com
  xjfopklicpxfdtllnxsiztlsbwjmoawqmrzz-dot-gl494903049.wl.r.appspot.com
-xjgdyzizvitimenfednwtncfer-dot-gle39404049.rj.r.appspot.com
  xjgyedu.cn
  xjjtpzkubombfunnyaeqwyzzbtkqggkzyzgt-dot-solar-vertex-285913.rj.r.appspot.com
  xjkglsjk.gq
@@ -197686,14 +197790,12 @@ xljzexeavrhkcdobtqgvxboprugdqdfihbam-dot-cedar-code-289917.nn.r.appspot.com
  xllzbqvpzwzvkbkshkotyxpdnh-dot-gloff849483.uk.r.appspot.com
  xlnciwvyeimeabhsviyzjyiwxy-dot-gloff849483.uk.r.appspot.com
  xlpxmvjoqgrvlsnqatkikrylhfdllachelec-dot-cedar-code-289917.nn.r.appspot.com
-xlqkqlphwtbnwapcaciscaneak-dot-gle39404049.rj.r.appspot.com
  xlsinvoices.sytes.net
  xltc-dta.be
  xltdwn4788hfj87298eyh.mattsenior1.repl.co
  xltyu.com
  xluck.giize.com
  xlucky.giize.com
-xluhxprbptacoutciwgabkjvkh-dot-gle39404049.rj.r.appspot.com
  xlurhkzuriodhnjxzpbxrmbxus-dot-gleowayel400503.uc.r.appspot.com
  xluvzhzwrgocpqo-dot-charming-sky-2700.appspot.com
  xlvddbpswohcbwxcostm.com
@@ -197717,7 +197819,6 @@ xmaksvwq.wze.io
  xmarketplace.store
  xmasgifts.000webhostapp.com
  xmbf.addroits.com
-xmbfwgttekizbbbywesuirrcox-dot-gle39404049.rj.r.appspot.com
  xmbrlrpemv.duckdns.org
  xmecn.com
  xmg.tanglescanner.com
@@ -197729,12 +197830,11 @@ xml-servappleferivasm.redirectappaktivitas.cf
  xml-servmanageapplelogs.servmeriauahan.com
  xmlsvdiwlymaniminceggelgjg-dot-gleowayel400503.uc.r.appspot.com
  xmnjy.csb.app
+xmobile24hra.com
  xmode.duckdns.org
  xmodmodrainbow.000webhostapp.com
  xmodthsmyssearyecbgzkeggmc-dot-gleowayel400503.uc.r.appspot.com
-xmotbdbywfhqeemdkfgzzanfhn-dot-gle39404049.rj.r.appspot.com
  xmovcrahffjwfglwaxbzhejkzdjpmbwdceqo-dot-cedar-code-289917.nn.r.appspot.com
-xmozgcyazxycoemhpmxeqhxzxg-dot-gle39404049.rj.r.appspot.com
  xmp3.mentriqq.com
  xmpzi.icu
  xmr-eu.dwarfpool.com
@@ -197824,16 +197924,19 @@ xn--72c1aoa8a9c8a4b8fqd.com
  xn--72ca5bpb8fxat5bgq6lpe.com
  xn--72ca8ce9ah4dwbp9a8jnd.com
  xn--7ca5b0s.tk
+xn--80a6ag1ams.xn--p1ai
  xn--80aa0cb0jqb.emozionipiscine.it
  xn--80aaaajabpuldc2bzaugr7a5k.xn--p1ai
  xn--80aaadcoea8c2cdx4jpb.xn--p1ai
  xn--80aacbmgyemxi2a.xn--p1ai
+xn--80aacud6e2ayg.xn--p1ai
  xn--80aaewcawie.xn--p1ai
  xn--80aafa3blnbekq.xn--p1acf
  xn--80aafuec2bqq9b9f.049.xn--p1acf
  xn--80aajiaapeyhqdbo9bk.xn--p1acf
  xn--80aanufcfzcs6l.xn--p1ai
  xn--80abh2c1ckhe1a.xn--p1ai
+xn--80abl2dqd.xn--p1ai
  xn--80abnk0a8a0ga.xn--p1ai
  xn--80aceg5a5a4c9b0a.xn--p1ai
  xn--80aclgl2d2co.xn--p1ai
@@ -197879,6 +197982,7 @@ xn--altnoran-vkb.com.tr
  xn--articulosparacumpleaos-3ec.cl
  xn--avyfedera-yubm.org
  xn--b1ad7aelmkj3e.xn--p1ai
+xn--b1adjbt5ghx.xn--p1ai
  xn--b1advorh2a4b2b.xn--p1ai
  xn--b1agpzh0e.xn--80adxhks
  xn--b1alaggrfb0ah6h.xn--p1ai
@@ -197922,6 +198026,7 @@ xn--c1amsccx.xn--p1ai
  xn--c1apuako2bg.xn--p1ai
  xn--c1aqdgn3a2ckd.xn--p1ai
  xn--c1ard1ad.xn--p1ai
+xn--c1awhcp6a2ak.xn--p1ai
  xn--c3ca7brwp8cb5a8bdr7kqe.com
  xn--celegeninaat-dnc.com
  xn--cinfcccmug-rbbebb.azurewebsites.net
@@ -197929,6 +198034,7 @@ xn--claimtxrebate-8db.com
  xn--clinicatraa-beb.com
  xn--cloud-9nc.com
  xn--covid19-gncelsalgnvakalar-nwc35l.com
+xn--d1aaqawqa.xn--p1ai
  xn--d1aawbax3g.xn--p1ai
  xn--d1ac2ccyl.xn--p1ai
  xn--d1acsp4atv.xn--p1ai
@@ -197945,6 +198051,7 @@ xn--davivienda-portl-tmb.com
  xn--e-devlet-aidatiadeportal-ewd.com
  xn--e-devletslemleriniz-n5c.com
  xn--e-faktygwat-25b.pl
+xn--e1aaec6crva7f.xn--p1ai
  xn--e1aamfhejncjl.xn--p1ai
  xn--e1aceh5b.xn--p1acf
  xn--e1adigbdjz5k.xn--p1ai
@@ -197983,6 +198090,7 @@ xn--h1adnap0d2b.xn--p1ai
  xn--hlfx-login-h4ac8m.com
  xn--hravfall-9za.com
  xn--hypoverensbank-7lb.de
+xn--i1ajhvd.xn--p1ai
  xn--iconiqcaptal-0fb.com
  xn--id-zb4axila5esc1e1f9bvhzd4a6fe.sehvcnx.com
  xn--insagram-tj0d.com
@@ -198110,6 +198218,7 @@ xn--treor-kib.com
  xn--trkiyesalk-9db14bzh.com
  xn--trtkatkpay-3ubd.com
  xn--trzor-d6b.com
+xn--tt-xia.com
  xn--u9j9emat0m6jk52w6lo7nkt8c.amazon.co.jp.accamzh.com
  xn--u9j9emat0m6jk52w6lo7nkt8c.amazon.co.jp.marketazluticky.com
  xn--u9jt73g5sae97fe1v5rm.xyz
@@ -198347,7 +198456,6 @@ xrbcsbzpeiewszakholmmyamjomkqnsmlklr-dot-cryptic-now-290917.ey.r.appspot.com
  xrbcsbzpeiewszakholmmyamjomkqnsmlklr.cryptic-now-290917.ey.r.appspot.com
  xrbmyixwavtarwsrzsmozrooilgcnwcgvqns-dot-solar-vertex-285913.rj.r.appspot.com
  xrfzblpkdrroduacswbtlqixyvwpeowyljpp-dot-cryptic-now-290917.ey.r.appspot.com
-xrgfyvukjbjmltptygybvfpddo-dot-gle39404049.rj.r.appspot.com
  xrgwxmb.goruli.com
  xrhgstukqmnnaea.top
  xristiana.com
@@ -198375,6 +198483,7 @@ xrtymowbzminrxtdgjjbfsdloessbxjsuhox-dot-cryptic-now-290917.ey.r.appspot.com
  xrubbahcqdsmnypfvfkqvdhyffxaoowytjup-dot-off94032393204.uk.r.appspot.com
  xrunicpower.com
  xrwecucplkqiwsmlkzkwnkdapq-dot-gloff00403993445.uk.r.appspot.com
+xryrt.com
  xs1nz.svcoding.com
  xs6bd.awaykart.com
  xsafxtwedsrtfcveajafpdtenvbuoauxoxfw-dot-gl494903049.wl.r.appspot.com
@@ -198401,12 +198510,12 @@ xsjshort.appserviceus.com
  xskinzbag.pro
  xsleekrak.myvnc.com
  xsnonline.us
+xsoic.com
  xsolarinfo.baersevensuper.top
  xspin.giize.com
  xspin.s13claim.com
  xspin16.com
  xspins.tencenters.com
-xsportalauthaccess.web.app
  xsqd.awaykart.com
  xsqwdjutimcdzmzfokgugnbgsd-dot-glmar9393293232323.uk.r.appspot.com
  xsr.hamhonar.com
@@ -198427,7 +198536,6 @@ xsykrbnunndjoosuhknkekfultiiyghnwjax-dot-glegen303939423233.ue.r.appspot.com
  xsykrygakonbt.com
  xt.boxerleads.dog
  xtbesqwkbpfonahxjfbtfsnwvphghdcxnhzu-dot-cedar-code-289917.nn.r.appspot.com
-xtbpdvuilvlptfjwrglbwcunzc-dot-gle39404049.rj.r.appspot.com
  xtchawd.goruli.com
  xtcovdswgnfjgeknwkoohkuyzd-dot-gleowayel400503.uc.r.appspot.com
  xtdskggjsrzingnkglmjkesnjw-dot-gloff00403993445.uk.r.appspot.com
@@ -198559,7 +198667,6 @@ xwskhyxyumzkoiipshphzjcxzczyicjomanx-dot-glenxpecial3009493.ey.r.appspot.com
  xwtm.cn
  xwwvzdwfhwsffzfl-dot-rekk-293211.ew.r.appspot.com
  xwxn7.jaysbrand.com
-xwxnqjrhapossodvtazfvbjosi-dot-gle39404049.rj.r.appspot.com
  xwy71rsfiqr6-24mtehiin.vercel.app
  xwz1.ru
  xx-2020.com
@@ -198604,7 +198711,6 @@ xxlrestaurantcom.shaxiapussy.top
  xxlxali.ddns.net
  xxmffzkzxxjrsjzpcdbptccxiy-dot-gleowayel400503.uc.r.appspot.com
  xxnx-anaksmpviral.mrbonus.com
-xxnx-com.tk
  xxo3ewbj83zfeqk3jlw1.us-south.cf.appdomain.cloud
  xxooyx.com
  xxpbcruqq.goruli.com
@@ -198660,9 +198766,9 @@ xyjyutmjibcadcoaxduaejukzmoorokgxomo-dot-glxcel49934343434.rj.r.appspot.com
  xykwmsawwlcxwlwzisxcgwxtgkyrbqiclppq-dot-solar-vertex-285913.rj.r.appspot.com
  xyloid-foot.000webhostapp.com
  xylontoken.com
-xymkzgrsufxerojaiinpeanbaq-dot-gle39404049.rj.r.appspot.com
  xymlhxg.com
  xymscvrvmvpkkbpgteeecnsaad-dot-poised-bot-306515.uk.r.appspot.com
+xypcpuygsmfagjbvgihgujdhne-dot-glmar9393293232323.uk.r.appspot.com
  xyqdilpsjemfhzztrrvplssqsymxkhpctnoc-dot-solar-vertex-285913.rj.r.appspot.com
  xyrmbb.jaysbrand.com
  xyshbk.com
@@ -198784,6 +198890,7 @@ y5mart.com
  y5n2.awaykart.com
  y5y-a.jaysbrand.com
  y6-d3.onderhost.com
+y66suqwv.cc
  y6c2.svcoding.com
  y6c7n.ailacabs.com
  y6cg.jaysbrand.com
@@ -198886,6 +198993,7 @@ yahoo-security-center.weebly.com
  yahoo-sign-in-att.weebly.com
  yahoo-staysafe.weebly.com
  yahoo-updt.weebly.com
+yahoo-verfication.weebly.com
  yahoo-verificationprocess-link.weebly.com
  yahoo.4sgroupbd.com
  yahoo.autheticathor.com
@@ -198904,6 +199012,7 @@ yahoo2312.weebly.com
  yahoo34.yolasite.com
  yahoo38.yolasite.com
  yahoo674.weebly.com
+yahoo895.webnode.com
  yahooaccessonline.weebly.com
  yahooaccount.authenticationonlinever.com.d.wbsprt.com
  yahooaccountdetais.weebly.com
@@ -199193,9 +199302,6 @@ yatrerem.com
  yatresipsa.webcindario.com
  yattaloguot.godaddysites.com
  yatuafricanhairbraiding.com
-yaumoxlmewhplwqfpjtlahakgu-dot-gle39404049.rj.r.appspot.com
-yauohwijrqefqyiywrxzejtqcw-dot-gl099898987fhkl.uk.r.appspot.com
-yauyatvbqcscfkfhbpjatczjdf-dot-gl099898987fhkl.uk.r.appspot.com
  yavaranenarmak.com
  yavuztuncil.ya.funpic.de
  yawaquiriporimaluiosnma.ml
@@ -199224,7 +199330,6 @@ ybffjhusg.cfbozh.cn
  ybhhkw.ph
  ybhkdy.cf
  ybhr.or.id
-ybicvwmtmnagcheyzthqblnsuk-dot-gle39404049.rj.r.appspot.com
  ybjsrkhfiptupxwhoufbumxqsp-dot-gleowayel400503.uc.r.appspot.com
  ybjy.addroits.com
  ybkthhgjsvborguoihgd.club
@@ -199260,7 +199365,6 @@ ycjlqlkbrgcfjpvcpdevmeubvmgvloejjozw-dot-gl494903049.wl.r.appspot.com
  yckswwhrqjhrssqchsz.top
  yclasdy.cf
  yclydq.com
-ycmnrofybpeevyjahdxtrdoosy-dot-gle39404049.rj.r.appspot.com
  ycoffee.vn
  ycom.com.my
  ycpxckvguyqyluqpzqmrrbpiwt-dot-gleowayel400503.uc.r.appspot.com
@@ -199273,7 +199377,6 @@ ycteanrisxlavvslepovkmrndkxopbobetpt-dot-solar-vertex-285913.rj.r.appspot.com
  yctiumq-dot-t6w5q4p9o7i3.uc.r.appspot.com
  ycugccldaidstjfxwvvypylygvdwqgrwptza-dot-cryptic-now-290917.ey.r.appspot.com
  ycuyou456.com
-ycvmokwjdhpenaxzeopeqjpbhw-dot-glmar9393293232323.uk.r.appspot.com
  ycvsvoyam1co.talagaremix.com
  ycx1.addroits.com
  ycyh368.com
@@ -199385,6 +199488,7 @@ yellowling.com.br
  yellowpagesautos.000webhostapp.com
  yellowpageshessencom.nckifitness.gdn
  yeloconsulting.com
+yelowinc.com
  yelpeggplantz.com
  yelzhingtours.com.bt
  yemtdfwznzpyiwogkzlqpfsblnprejdmbljv-dot-glegen303939423233.ue.r.appspot.com
@@ -199450,7 +199554,6 @@ yeutrz.live
  yevtuswkpncpoikldcjqrpwrahbellnhpytw-dot-glenxpecial3009493.ey.r.appspot.com
  yewj.awaykart.com
  yeyu.gq
-yezvjyinfyqucmuifwtuacudlm-dot-gl099898987fhkl.uk.r.appspot.com
  yf.jjconcreteseattle.com
  yfcfvcqmtscdupoomdve-dot-gleowyel040493443434989.wl.r.appspot.com
  yfcmanbetx.com
@@ -199502,7 +199605,6 @@ ygmdrmwvgzqpxhbnlgrgswbvyc-dot-gleowayel400503.uc.r.appspot.com
  ygpryd.com
  ygraphx.com
  ygrj.org
-ygrruzvxawwohiokawjkkchaxv-dot-gle39404049.rj.r.appspot.com
  ygsd.yolasite.com
  ygsddl1.cf
  ygsddl1.ga
@@ -199511,7 +199613,6 @@ ygsddl1.ml
  ygsddl1.tk
  ygtfyafxcvqimwuobetnaqbujc-dot-gloff849483.uk.r.appspot.com
  ygunoiunommiurynfuup.com
-ygvshhhpdlapaxmbsbphpihgqz-dot-gle39404049.rj.r.appspot.com
  ygycquxa.goruli.com
  ygyftyftytftf.weebly.com
  ygyoglszcr.buzz
@@ -199533,6 +199634,7 @@ yhhsa.bwcwqs.cn
  yhinet.shaxiacatalog.top
  yhka.mentriqq.com
  yhkaeelriujjukaliqebeomtlc-dot-gleowayel400503.uc.r.appspot.com
+yhkmtkgtfhktk.webstriple.com
  yhnawsxz.fairfieldconstruction.net
  yhnjfec.com
  yhoxa.gikorip.net
@@ -199654,7 +199756,6 @@ ykd.goruli.com
  ykdqbrsxgk.top
  ykjzmhthjblmrdakyzolfkputryvivfvwwak-dot-glenxpecial3009493.ey.r.appspot.com
  ykkgkgyugykkygkg.xyz
-ykmabar.event08-com.cf
  ykpl.shoesmogul.com
  ykpunetdy.cf
  ykqpn.goruli.com
@@ -199728,7 +199829,6 @@ ymzgufxntuxuscgxjz.top
  yn0m8p9u.firebaseapp.com
  yn2e.awaykart.com
  yn8eh.addroits.com
-ynakhizmjleccmfeoxsygmfeki-dot-gle39404049.rj.r.appspot.com
  ynarliahel.xyz
  ynblaccount.com
  ynbm.awaykart.com
@@ -199740,10 +199840,8 @@ ynhzhxqhojhreutnjvwrieytlf-dot-gleowayel400503.uc.r.appspot.com
  ynjipjxfoxcsetboisfpkuqrwc-dot-gleowayel400503.uc.r.appspot.com
  ynkapsigabhuljkrgjwfehdzlqhtjqbatgyj-dot-solar-vertex-285913.rj.r.appspot.com
  ynl.co.il
-ynlcbshuseksyfhioxptravohi-dot-gle39404049.rj.r.appspot.com
  ynlyshop.com
  ynmq.shoesmogul.com
-ynopecann.com
  ynopyxyzdy.cf
  ynowiowjovnjhqllfaucatirsr-dot-gleowayel400503.uc.r.appspot.com
  ynpfp.csb.app
@@ -199824,7 +199922,6 @@ yolotravelz.com
  yolticaxcan.com
  yomahakaion.com
  yomahakertionel.com
-yomall.hk
  yomasukbro.bkp18-whatsappp-com.ga
  yomesumo-betasegvra1bnonline.xyz
  yomesumobnmultired.club
@@ -199897,6 +199994,7 @@ yougeniusads.com
  yougetwhatyouplayedfor.com
  youghe-dod.web.app
  youhavebeennjratted.ddnsking.com
+youjiapua.com
  youkahama.com.au
  youkezl.com
  youknownow.ru
@@ -200098,7 +200196,6 @@ yp.dcyazilim.com
  yp.hnggzyjy.cn
  yp89ip8pd7pq.webappxclot.club
  ypaaisonxogpaspnivrvrhkljbolrovvqdlf-dot-solar-vertex-285913.rj.r.appspot.com
-ypacddweinnxkfueadlmnriqvg-dot-gle39404049.rj.r.appspot.com
  ypanetwork.com
  ypbszztrewmdmueanihxfaj.top
  ypdkbdjyms.top
@@ -200115,6 +200212,7 @@ ypjuzdxoktnnnfbrzkmiixfmmq-dot-gleowayel400503.uc.r.appspot.com
  ypjzbinvuwanaivzufsasoeubyglpsustzwr-dot-gl494903049.wl.r.appspot.com
  ypko-55.gq
  ypl0207.theworkpc.com
+ypl345.info
  ypma.mentriqq.com
  ypndhapidslcszsxrhjbcuyfaxkugrgcfnxj-dot-glegen303939423233.ue.r.appspot.com
  yppaydvxnvcfxbshnmadtsscuv-dot-gleowayel400503.uc.r.appspot.com
@@ -200125,7 +200223,6 @@ ypsmko.com
  ypuyrhztjjqwayvg.top
  ypvcbuvewrvtkjrysceanmhvud-dot-gleowayel400503.uc.r.appspot.com
  ypw1.dilshantg.com
-ypyztdoebuckpwjimctswtrbtv-dot-gl099898987fhkl.uk.r.appspot.com
  yq32.jaysbrand.com
  yq964.addroits.com
  yqdfbqchxv.top
@@ -200260,6 +200357,7 @@ ytuongviet.com.vn
  yturdsgfdfg.com
  ytwea.xyz
  ytwhe.xyz
+ytwyyuoo.work
  yty.topkorder.su
  ytytdywlwy.ga
  ytytufe.gikorip.net
@@ -200330,7 +200428,6 @@ yuliarachma.id
  yulin.yfqzdfd.com
  yulin1.06rl.com
  yulitours.com
-yullkztrdcksaltuomquqwjjbd-dot-gl099898987fhkl.uk.r.appspot.com
  yulongciahua.com
  yulp.cn
  yulswwulbecqzakideuqbosacs-dot-gleowayel400503.uc.r.appspot.com
@@ -200371,7 +200468,6 @@ yuomzoxvwaykxvcxrabxdpiiwjxgnykuqtyi-dot-offglen.uk.r.appspot.com
  yuoofxheusqiircduckjwvsrklsisbdodqru-dot-solar-vertex-285913.rj.r.appspot.com
  yuoofxheusqiircduckjwvsrklsisbdodqru.solar-vertex-285913.rj.r.appspot.com
  yuorchance.com
-yuoshxnumidqzigyvuznddzyrk-dot-gle39404049.rj.r.appspot.com
  yuqqw.com
  yuquyuju.com
  yuqygihyyeqiiacigshxbrygnv-dot-gleowayel400503.uc.r.appspot.com
@@ -200437,7 +200533,6 @@ yweax.xyz
  ywgiu10zmnwcx03vpnyp.com
  ywhlprko.vipsnapchatsexting.com
  ywicqlvfvxlzujbbfaypzmykkvdgsdazamvd-dot-cryptic-now-290917.ey.r.appspot.com
-ywijlmymbrprnvbnbemomngjyn-dot-glmar9393293232323.uk.r.appspot.com
  ywinternational.vip
  ywmchdlufidkttjljpkixfvscy-dot-triple-upgrade-293822.rj.r.appspot.com
  ywmkieijnkvtscrovaimfinupt-dot-gleowayel400503.uc.r.appspot.com
@@ -200482,11 +200577,9 @@ yxshengda.com
  yxsmrbsc.goruli.com
  yxto.shoesmogul.com
  yxwwjjwjjw.duckdns.org
-yxxnublgupjyzgertmsbzfvxqs-dot-gle39404049.rj.r.appspot.com
  yxxzzt.com
  yxzc9.svcoding.com
  yxzwuv8sdx9aysrhh.ambi.cc
-yxzyjhcvjvlxsqjhswzgsnxdwe-dot-gle39404049.rj.r.appspot.com
  yy-x.mentriqq.com
  yy13041.moonfruit.com
  yy29398899.com
@@ -200503,7 +200596,6 @@ yyevw.gulfhirings.com
  yyfyyyutyjuemndaad.top
  yygavcvmpvpznofvfgvitznnvv-dot-gloff849483.uk.r.appspot.com
  yygelbbkauxnbcqliovy-dot-level-elevator-279110.nw.r.appspot.com
-yygsujfvmcywbwkrnxfvoflrdq-dot-glmar9393293232323.uk.r.appspot.com
  yygvdaewuhjbhrbfbujipuqtzqbidqqbjzad-dot-off94032393204.uk.r.appspot.com
  yyhbnhg.com
  yyhbnhg2.com
@@ -200539,6 +200631,7 @@ yz.r2dd.com
  yz7okxof-b839zpolc.vercel.app
  yzaqmnso.goruli.com
  yzbek.co.ug
+yzczvwjwyebrmrlgopbibszdzx-dot-poised-bot-306515.uk.r.appspot.com
  yzda6.dilshantg.com
  yzdpharmacy.com
  yzf-r250.co.cc
@@ -200557,7 +200650,6 @@ yztvvwwmgqsvwwtf.top
  yzunited.com
  yzuxiwovi.gikorip.net
  yzv2zrg9.attwebspace.com
-yzvazqpfknslwsolkgqzfyoqku-dot-gl099898987fhkl.uk.r.appspot.com
  yzvjnhbvidsqdqeiqkydirpnodbbeqsextjh-dot-glegen303939423233.ue.r.appspot.com
  yzwlw.com
  yzxjgr.com
@@ -200624,7 +200716,6 @@ z4ynr.6ed2d-12d62x3e84ef6b85q37v8d34h202e01c.rfasyamuah.com
  z4ynr.6ed2d-12d62x3e84ef6b85q37v8d34h202e01czp0k.icaljavu.com
  z4z2q.ailacabs.com
  z50fa.awaykart.com
-z542movsqr7pbgb36p6khjgy5e-adwhj77lcyoafdy-translate.translate.goog
  z5799.com
  z59cti0d.cc
  z5aokm.cn
@@ -200861,7 +200952,6 @@ zapooi.cf
  zappingtv76.000webhostapp.com
  zapps.in
  zapslskk.tk
-zaqhwhhcjezincuntrohonnwiu-dot-gl099898987fhkl.uk.r.appspot.com
  zaqta-71.tk
  zaqwsxcde.sportsontheweb.net
  zara-shops.ru
@@ -200882,6 +200972,7 @@ zarmgratiz.com
  zarmuzik.com
  zarnaftdiar.ir
  zarnoosh.ca
+zarobitoknadomu.ru
  zaroosha.in
  zarouter1.000webhostapp.com
  zarpaashfashion.com
@@ -200908,7 +200999,6 @@ zaunbaucom.shaxiaoh.top
  zauthdcca0160ad6aqqu.ap-northeast-2.elasticbeanstalk.com
  zavaana.com
  zavb8cuhji.web.app
-zavfofgyuxicwtuzvokbemhpuj-dot-gle39404049.rj.r.appspot.com
  zavgroup.net
  zavjese-net.omolje.com
  zavjsfbqrwflxrwtgciyvfeufc-dot-gleowayel400503.uc.r.appspot.com
@@ -200979,6 +201069,7 @@ zctnw.rogagot.com
  zcuvildnfuapjyeckqlklqnidcvylsuzvubd-dot-glxcel49934343434.rj.r.appspot.com
  zcxe37adonis.top
  zcxqmiirzm.duckdns.org
+zczczczczxcxz.jimdofree.com
  zcztnuquijrpanmjqrdyzziksnxupqgjujqg-dot-solar-vertex-285913.rj.r.appspot.com
  zd1.addroits.com
  zd4b.lonlyfafner.ru
@@ -201010,7 +201101,6 @@ zdne.rogagot.com
  zdnw.addroits.com
  zdojxulontlabuiorjdseswowlgweszmadki-dot-solar-vertex-285913.rj.r.appspot.com
  zdone.site
-zdoydqgvkgsjizrojkyjroprzb-dot-gle39404049.rj.r.appspot.com
  zdpgliwice.pl
  zdq-p.svcoding.com
  zdravahrana.host
@@ -201101,10 +201191,12 @@ zemlakstation.buzz
  zemolding.com
  zempaqes-alerts3.ga
  zempaqes-nottif2.ga
+zemraxmie.cloudaccess.host
  zems-skins.ml
  zen-clarke-60eae9.netlify.app
  zen-indonesia.com
  zen-kalam-c40101.netlify.app
+zen-rosalind-ccfd2a.netlify.app
  zen-wilson-5f6257.netlify.app
  zenaddevis.com
  zenben.site
@@ -201257,20 +201349,17 @@ zgbbtsvtjpedgaegau.top
  zgc.com.cn
  zgdiyydgmmkcsuzlyfehzhajvjhsldwhyjpr-dot-solar-vertex-285913.rj.r.appspot.com
  zgeuurpkqztwuusjpt.top
-zgfydgjsmbsjhoevoazgjgfmxb-dot-gl099898987fhkl.uk.r.appspot.com
  zghshmw.com
  zgipsucwlpdyhxiwrbwopkprrizlgmhwpozs-dot-cryptic-now-290917.ey.r.appspot.com
  zgitjmdwsusnfvvkbszimllvys-dot-gleowayel400503.uc.r.appspot.com
  zgjyzqctoatax.serveirc.com
  zglobalschool.top
  zglsfcw.cn
-zgnlxjajfcceoldmkrboamhzli-dot-glmar9393293232323.uk.r.appspot.com
  zgodhtmwaqvwksvvhowzisrxahizmuarfsyk-dot-gl494903049.wl.r.appspot.com
  zgodnezenskebg.000webhostapp.com
  zgpyly.com
  zgq.gucac.com
  zgsqedu.com
-zgswcndcsnsexhcqncvwzevboe-dot-gle39404049.rj.r.appspot.com
  zgsyojyliuzywsjigkpohquyonvjrgukwdpw-dot-glenxpecial3009493.ey.r.appspot.com
  zgtaiji.com
  zgum52f88v3xf57682.com
@@ -201315,7 +201404,6 @@ zhaozewei.top
  zhasoral.kz
  zhaw-ch.yolasite.com
  zhba2.com
-zhbqionotmprqtefeaawgeoara-dot-glmar9393293232323.uk.r.appspot.com
  zhcbao.com
  zhcy.jaysbrand.com
  zhd5.addroits.com
@@ -201347,7 +201435,6 @@ zhipyauyadbwormclsfhsbybqcbtdqpvpmve-dot-offgl8876899977678.uk.r.appspot.com
  zhitvoxpscjsqxsnyaxygpatpq-dot-gleowayel400503.uc.r.appspot.com
  zhixiaoruanjian.org
  zhiyoutou.com
-zhjlnoykuclbuhjitnzjtomgri-dot-gl099898987fhkl.uk.r.appspot.com
  zhjxvsasfxnjqtavpv.top
  zhk4yj5cgeahdjs8-npjovljtn.vercel.app
  zhktevngggnamcpezckw.top
@@ -201445,7 +201532,6 @@ zillow-photographers.club
  zillowhousesale.marketplacesfbk.us
  zim99.com
  zimahenergy.com
-zimailboxupgrade.com
  zimaproperties.com
  zimb66580.uc.r.appspot.com
  zimberdolbares.com
@@ -201473,6 +201559,7 @@ zimbrar.000webhostapp.com
  zimbrastellcofilersd.com
  zimbrchim.com
  zimbrstemupgrdenie405.jdevcloud.com
+zimbrute.ml
  zimcon.de
  zimeks.com.mk
  zimgovbr.creatorlink.net
@@ -201526,7 +201613,6 @@ ziraatileevdekal.com
  zirkondental.chifancall.top
  zirkz.com
  zirnvis.ir
-zirrkpvqrfueturartbyxtabxx-dot-gle39404049.rj.r.appspot.com
  zirvekonutlari.com
  zirvetel.com
  zisapet.com.br
@@ -201601,7 +201687,6 @@ zkrxplzuy.vipsnapchatsexting.com
  zkutjtqxzdybpqmlnfozyvsuesnkbmlyiayb-dot-cedar-code-289917.nn.r.appspot.com
  zkwbdfyqxzsfm7d.e8273.pro
  zkwjxdkjmfcvodfychoeaweacspomxsnzhsv-dot-cryptic-now-290917.ey.r.appspot.com
-zkxymgyspiejxmrnutsiyzjzis-dot-glmar9393293232323.uk.r.appspot.com
  zkzhmxekl.xyz
  zlab.me
  zlatanibile.ddns.net
@@ -201619,7 +201704,6 @@ zlobekczarkowo.pl
  zlolz.info
  zlshop-card.com
  zltw15tzezi03nbmru.xyz
-zlucrjcxgfvuddmuwvtlbwgamp-dot-gle39404049.rj.r.appspot.com
  zlxsgg.com
  zlynmtymqhcoxhpbdjzcukyneisngsofwczb-dot-cryptic-now-290917.ey.r.appspot.com
  zlyqhzosjfqouknoawbnwhsncekylslxcgra-dot-solar-vertex-285913.rj.r.appspot.com
@@ -202035,6 +202119,7 @@ zoom-corp.gkmaskim.ru
  zoom-emergency.myftp.org
  zoom-machinery.com
  zoom.cloudconventions2020.com
+zoom.crowdm.it
  zoom.gkmaskim.ru
  zoom.jo
  zooma.shop
@@ -202142,7 +202227,6 @@ zqmdm.com
  zqmjsfds.goruli.com
  zqmltfqisiiwcoeqkeendxurrffzcfdjacfl-dot-gl494903049.wl.r.appspot.com
  zqmojrmvajkewwphsuggmtahfchxlayqwqzs-dot-spyexc3093493.ey.r.appspot.com
-zqnxdiiykxymoyjqamxjhmvufp-dot-gle39404049.rj.r.appspot.com
  zqptmrujxlruiatyqylexbfdmnwtvsuallik-dot-solar-vertex-285913.rj.r.appspot.com
  zqsafnww.goruli.com
  zquareup.net
@@ -202193,7 +202277,6 @@ zsffwxhewwpgrmfknt.top
  zsfxjnslingshvjzbwnrjrwcdn-dot-gleowayel400503.uc.r.appspot.com
  zshpeqeqnzstahjqrftvqxeowl-dot-gleowayel400503.uc.r.appspot.com
  zsinstrument.com
-zsiquheewuzauxilxmfbomwsgp-dot-gle39404049.rj.r.appspot.com
  zsmeupntwjelvulcdynfqidjlcdppqvlaiwq-dot-cedar-code-289917.nn.r.appspot.com
  zsmsbcn.com
  zso-mannheim.de
@@ -202230,7 +202313,6 @@ zthowmuz.sovereignty2020.com
  ztivzwqktoduguye-dot-glexcel1.ue.r.appspot.com
  ztjujzcnckgaeyegedixvjysjpqatcbxqlhh-dot-glenxpecial3009493.ey.r.appspot.com
  ztkphfueca.duckdns.org
-ztngoxezhansgaaxqsedvqwshh-dot-gle39404049.rj.r.appspot.com
  ztqy168.com
  ztruivmwttjatlgwkbnqnzjzik-dot-gleowayel400503.uc.r.appspot.com
  zts0d.mentriqq.com
@@ -202265,7 +202347,6 @@ zunyi.06rl.com
  zunyi.yfqzdfd.com
  zuqhljkoxitzqqesgkcmdgjduf-dot-triple-upgrade-293822.rj.r.appspot.com
  zuqhljkoxitzqqesgkcmdgjduf.triple-upgrade-293822.rj.r.appspot.com
-zuqmmtrjjflsrnapdrloczhzvs-dot-gle39404049.rj.r.appspot.com
  zurawiewynajem.pl
  zurfluh.net
  zuriadelfines.com
@@ -202274,7 +202355,6 @@ zurichswissonlinebank.ne-n.com
  zurieh.com
  zustellungfehlgeschlagen-adresseandern-posteswiss.com
  zut-educate.com
-zutnefmsssmuanxutzeyvaydno-dot-gle39404049.rj.r.appspot.com
  zutwholesale.com
  zutxrmhwyskebjivwofs.ru
  zuurqeaon.handipants.com
@@ -202324,11 +202404,9 @@ zwfcnxcgcacgfujcuy.top
  zwfxiieabnecjkgkbmebcnsykfeqdennpaaw-dot-glegen303939423233.ue.r.appspot.com
  zwgweb.000webhostapp.com
  zwinglian-goggles.000webhostapp.com
-zwnsyntowjpkhnkxxuydcdrxnx-dot-gle39404049.rj.r.appspot.com
  zwset.xyz
  zwvkmkzmpkfyqkbdteyi-dot-gleowyel040493443434989.wl.r.appspot.com
  zwwvndt.rogagot.com
-zwxtesesxmmwyhmludavrldzdn-dot-gle39404049.rj.r.appspot.com
  zwycieska-nota.eu
  zwz597p4z3ll8jx.gmz.cc
  zx-7.com
@@ -202339,6 +202417,7 @@ zxateutitrewe.com
  zxbqrhkjfiwiflgjufjlkdmcji-dot-gleowayel400503.uc.r.appspot.com
  zxc03.codesandbox.io
  zxc123.cc
+zxc20.top
  zxc2018zxc2018.linkpc.net
  zxc301.com
  zxc696.ga
@@ -202370,6 +202449,7 @@ zxqyrzwapp.cqhc.net
  zxr-e.jaysbrand.com
  zxr.poststudioprojects.net
  zxr.ranjeevmahtani.com
+zxrjholuwhevaqcoozsvncyekk-dot-gl099898987fhkl.uk.r.appspot.com
  zxsdr.s3-us-west-1.amazonaws.com
  zxses.xyz
  zxsfetvydxucfnxntty.top
@@ -202397,8 +202477,8 @@ zydxbzkyy.com
  zye4b.codesandbox.io
  zyf0510.com
  zyfhqtlxqnqiggluxkabtuebkwjzfzukcaor-dot-cryptic-now-290917.ey.r.appspot.com
-zyggmdulzjyqdnywrpoipilkuq-dot-gle39404049.rj.r.appspot.com
  zygk.com
+zyhc818.com
  zyhdp.mentriqq.com
  zyjc7xpiuno.gmz.cc
  zyjyyy.com
@@ -202448,7 +202528,6 @@ zzhalm.goruli.com
  zzhare12345.hopto.org
  zzhhc.cn
  zzi.bellevilledc.com
-zzimbbramail.000webhostapp.com
  zzjph.com
  zzkj0898.com
  zzlong.xyz
diff --git a/blacklists/malware/urls b/blacklists/malware/urls

index c83913ec42de510376339bdf0981f7c907464752..4f65d06ce6d19d83ff7a29b6f0a8033e46277114 100644 (file)
--- a/blacklists/malware/urls
+++ b/blacklists/malware/urls
@@ -1,185 +1,86 @@
  0i.is/7Tr9
  0i.is/CpAq
  0i.is/IqWc
-107.173.246.2/knab
-117.222.173.5/+-O+/tmp/netgear;sh+netgear&curpath=/&currentsetting.htm=1
  123formbuilder.com/form-5559915/microsoft-team
  123formbuilder.com/form-5580797
-13.89.52.160/banks/Tangerine
-13.89.52.160/banks/Tangerine/
-13.89.52.160/banks/Tangerine/pin.php
-13.89.52.160/banks/Tangerine/questions.html
-14.46.25.17/.i
-171.96.192.200/.i
-174.61.3.149/.i
-177.231.42.9/.i
-178.175.120.102/+-O+/tmp/netgear;sh+netgear&curpath=/&currentsetting.htm=1
-182.16.26.236/ap/signin
-182.53.197.62/centaur-docs/23
-185.215.113.77/oxchjdfgbnv.exe
-185.248.140.132/x01/arm
-185.248.140.132/x01/arm5
-185.248.140.132/x01/arm6
-185.248.140.132/x01/arm7
-185.248.140.132/x01/mips
-185.248.140.132/x01/mpsl
-185.248.140.132/x01/ppc
-185.248.140.132/x01/x86
-185.82.219.219/44273,5055075232.dat
-185.82.219.219/44273.4360444444.dat
-185.82.219.219/44273.5317763889.dat
-185.82.219.220/44273.474240625.dat
-185.82.219.80/44272.8138383102.dat
-188.127.231.55/44273.4360444444.dat
-19.dbstrony.pl/huo67v.zip
-191.232.186.145/itaucard
+143.198.75.54/bins/jew.arm
+143.198.75.54/bins/jew.arm5
+143.198.75.54/bins/jew.arm6
+143.198.75.54/bins/jew.arm7
+143.198.75.54/bins/jew.m68k
+143.198.75.54/bins/jew.mips
+143.198.75.54/bins/jew.mpsl
+143.198.75.54/bins/jew.ppc
+143.198.75.54/bins/jew.sh4
+143.198.75.54/bins/jew.x86
+173.56.119.108/.i
+1chanel.tv-tovar.in.ua/APPLE%20_%20PAYPAL%20CRYPTO.zip
+1chanel.tv-tovar.in.ua/accounts.digitalfed.zip
+1chanel.tv-tovar.in.ua/login.alibaba-com.zip
+1chanel.tv-tovar.in.ua/no.zip
+1chanel.tv-tovar.in.ua/secure-dis.zip
  1drv.ms/xs/s
-1eao07fbddc646.wixsite.com/monsite
-206.189.62.83/bins/jew.arm
-206.189.62.83/bins/jew.arm5
-206.189.62.83/bins/jew.arm6
-206.189.62.83/bins/jew.arm7
-206.189.62.83/bins/jew.m68k
-206.189.62.83/bins/jew.mips
-206.189.62.83/bins/jew.mpsl
-206.189.62.83/bins/jew.ppc
-206.189.62.83/bins/jew.sh4
-206.189.62.83/bins/jew.spc
-206.189.62.83/bins/jew.x86
-23.100.79.8/banks/Desjardins/
-23.100.79.8/banks/Tangerine
-23.100.79.8/banks/Tangerine/
-23.100.79.8/banks/Tangerine/pin.php
-23.100.79.8/banks/Tangerine/questions.html
-24.11.141.134/.i
-27.205.178.110/.i
-27.41.10.16/+-O+/tmp/netgear;sh+netgear&curpath=/&currentsetting.htm=1
-3.126.91.122/may/saber-08.exe
-3.126.91.122/may/saber-09.exe
-3.126.91.122/may/saber.exe
-3.15.13.74/accc44dbe92eaeda25199180e6301e2a/
-3wgfhggujm.s3-us-west-2.amazonaws.com/vcvxdsdsretyyuhhcf
-3wgfhggujm.s3-us-west-2.amazonaws.com/vcvxdsdsretyyuhhcf/sause.html
-45.140.146.208/44273.474240625.dat
-5.39.217.221/https/vbc.exe
-51.75.191.234/SBIDIOT/arm
-51.75.191.234/SBIDIOT/arm6
-51.75.191.234/SBIDIOT/m68k
-51.75.191.234/SBIDIOT/mips
-51.75.191.234/SBIDIOT/ppc
-51.75.191.234/SBIDIOT/root
-51.75.191.234/SBIDIOT/rtk
-51.75.191.234/SBIDIOT/sh4
-51.75.191.234/SBIDIOT/x86
-51.75.191.234/SBIDIOT/zte
-51.75.191.234/sh
-52-173-206-22.cprapid.com/wellsfrgoo
-52-173-206-22.cprapid.com/wellsfrgoo/a.html
-52.171.193.33/banks/BMO/
-52.171.222.203/banks/BMO
-52.171.222.203/banks/Desjardins/
-52.171.222.203/banks/Tangerine
-52.171.222.203/banks/Tangerine/
-52.171.222.203/banks/Tangerine/pin.php
-52.171.222.203/banks/Tangerine/questions.html
-58.115.162.92/.i
-67.3.169.223/.i
-79.22.176.145/.i
-7college.du.ac.bd/2result/assets/js/morris/2011018151/new/
-9hkhfgfkhgjg.s3-sa-east-1.amazonaws.com/cfgdfgdgfhghk
-9hkhfgfkhgjg.s3-sa-east-1.amazonaws.com/cfgdfgdgfhghk/sause.html
-a2otech.org/o1/main
-a2otech.org/o1/main/index1.php
-a81ahome.org/.UPD/countdown
-a81ahome.org/.UPD/countdown/index.php
+2.0netflix.com.it-it-sospeso.org/v3/ID-36252242
+2.0netflix.com.it-it-sospeso.org/v3/ID-36252242/index.html
+2.219.84.111/.i
+2834321.mediaspace.kaltura.com/user
+2834321.mediaspace.kaltura.com/user/login
+5.39.217.221/htdocs/vbc.exe
+59.127.90.51/.i
  abre.ai/as0p
  abre.ai/bLoA
  abre.ai/caixacx
  abre.ai/seguranca-app
-accesoclientesservices.com/b/acceso-clientes/
-account.prologin.net/android/pdf/fonts/ae_fonts_2.0
-account.prologin.net/android/pdf/fonts/ae_fonts_2.0/html.php
-accounts-byagricole.3utilities.com/agricolsecu
-accounts-byagricole.3utilities.com/agricolsecu/login/region.php
-accountupdate.support/O2/Login/index
-accurateskate.com/office
-accurateskate.com/office/index.php
-acumecsg.com/quform/emails/autoreply/admin
-acumecsg.com/quform/emails/autoreply/admin/DHL.htm
-adeptmassages.com/7685/Mnana/onedrive365
-admin.hostpoint.ch-customer-shop.buy43-dc9d1fbd.abogadodedecasoscriminales.com/VEJQWWp6UTVjbWt3QXZCS21EOXRKQT09/
-admissionword.com/iksss/upload
-admissionword.com/iksss/upload/index.php
-agilityhurdles.net/Finance/tang
-agilityhurdles.net/Finance/tang/charter.php
-agilityhurdles.net/Finance/tang/gouv.html
-agilityhurdles.net/Finance/tang/index1.html
-agilityhurdles.net/Finance/tang/information.html
-agilityhurdles.net/Finance/tang/myaccount.wellsfargo.com.php
-agilityhurdles.net/Finance/tang/recovery-answer.html
-agilityhurdles.net/Finance/tang/step.php
-agilityhurdles.net/Finance/tang/verif.php
-aiency.mx/Priv7/Priv8
-aiency.mx/Priv7/Priv8/index.html
-allianc.eu/abo/col
+aeglorytrans.live/red
+aeglorytrans.live/red/login/aW1jbGVvZEBkYWlyeS1mYXJtLmNvbS5oaw==
+aeglorytrans.live/red/login/cmFkaGEucEBpbi5hYmIuY29t
+aeglorytrans.live/red/login/verify.php
  allowcopy.com/open
  allowcopy.com/open/
-alsupllc.com/pur/Adobe/
  alturl.com/tdhf4
-amazon-update-account.awmoazzyu.net/ap
-amazon-update-account.awmoazzyu.net/ap/signin.php
-amoueon.bbaahh.cn/pc
-amoueon.bbaahh.cn/pc/Amazonsignin1.php
+ammri1.ga/w3-0794/Chxrx-128463/
  ams3.digitaloceanspaces.com/ams1
  ams3.digitaloceanspaces.com/ams1/click.html
  ams3.digitaloceanspaces.com/newvm
  ams3.digitaloceanspaces.com/newvm/index.html
+ams3.digitaloceanspaces.com/sbv3e3e333eeeeee
+ams3.digitaloceanspaces.com/sbv3e3e333eeeeee/index.html
+ams3.digitaloceanspaces.com/vvcsd111111111nnsss
+ams3.digitaloceanspaces.com/vvcsd111111111nnsss/index.html
+anarosha.ltd/template/adupte
+anarosha.ltd/template/adupte/index.html
  angelfire.com/games/gamez3
  angelfire.com/games/gamez3/facebook.htm
  anon.to/H2jGQ0
  anon.to/uRnAyx
-aomaomsndn.com/mazon/0002c
-aomaomsndn.com/mazon/2fcaf
-aomaomsndn.com/mazon/5123f/homepage
-aomaomsndn.com/mazon/8b6b5/homepage
-aomaomsndn.com/mazon/amazon
-aomaomsndn.com/mazon/amazon/homepage
-api.renercom.mx/js/bower_components/moment/locale/class.lib.php
-apple-supports.cn/zc
-arendairemont.ru/admin
-arendairemont.ru/admin/infodata.php
-arpaguestfarm.co.za/apple
-asfgerardmer.fr/media/login/
-asgtfvdfs1.ml/indo2/
-atozhomeappliance.com/tx/home/
-atozhomeappliance.com/tx/home/gnindm=/
-atozhomeappliance.com/tx/home/ji5zmy=
-atozhomeappliance.com/tx/home/ji5zmy=/
-atozhomeappliance.com/tx/home/myaccount
-atozhomeappliance.com/tx/home/myaccount/
-atozhomeappliance.com/tx/home/myaccount/access.php
-atozhomeappliance.com/tx/home/myaccount/billing.php
-atozhomeappliance.com/tx/home/myaccount/uploads
-atozhomeappliance.com/tx/home/myaccount/uploads/index.php
-atozhomeappliance.com/tx/home/myaccount/vbv.php
-avlondehradun.com/emd/
-backend.syno.vn/bt/global/Global2021
-backend.syno.vn/bt/global/Global2021/index.html
-banque-postale.help-fr.org/bpostale/files
-banque-postale.help-fr.org/bpostale/files/login/login.php
-barneyaaya.com/hafo
-beatyamerican.com/excel/m/scan.exe
-beaufortscacupuncture.com/ele/Priv8/Priv8
-beaufortscacupuncture.com/ele/Priv8/Priv8/index.html
-beelohimauctioneers.co.za/aid/
-beelohimauctioneers.co.za/cails/
-beingagilist.com/js/Priv8/Priv8
-betaaldeverzoek.live/baro/baro1/baro2
-biggsglobal.com/Trident/core.inc.php
-bikerentaljaisalmer.com/img/attraction
-bikerentaljaisalmer.com/img/attraction/i.php
-billetterie.angers-sco.dspsport.com/Dsp/web/site/packages/Payment
-billetterie.angers-sco.dspsport.com/Dsp/web/site/packages/Payment/info3Dsecure.htm
+antisdrucciolo.it/agricole/
+antisdrucciolo.it/agricole/2mjfjmty=
+antisdrucciolo.it/agricole/2mjfjmty=/cc.html
+antisdrucciolo.it/agricole/2mjfjmty=/code1.html
+antisdrucciolo.it/agricole/2mjfjmty=/code2.html
+antisdrucciolo.it/agricole/2mjfjmty=/codeemail.html
+antisdrucciolo.it/agricole/2mjfjmty=/login.php
+antisdrucciolo.it/agricole/hmgfizdk=
+antisdrucciolo.it/agricole/hmgfizdk=/
+antisdrucciolo.it/agricole/hmgfizdk=/cc.html
+antisdrucciolo.it/agricole/hmgfizdk=/code1.html
+antisdrucciolo.it/agricole/hmgfizdk=/code2.html
+antisdrucciolo.it/agricole/hmgfizdk=/codeemail.html
+antisdrucciolo.it/agricole/hmgfizdk=/login.php
+appare-izumiotsu.com/tax
+appare-izumiotsu.com/tax/
+appare-izumiotsu.com/tax/aboutus.php
+appare-izumiotsu.com/tax/services.php
+arigo.ng/.well-known/tracking-ch
+arigo.ng/.well-known/tracking-ch/login/index.php
+atiasado.co.il/cp/css/fa/css
+atiasado.co.il/cp/css/fa/css/xkkPwwNz.php
+auid-wallet.com/conect.auone.jp
+auid-wallet.com/conect.auone.jp/login.php
+bassas.co.za/file
+bazhinov.com/sya/gavan
+bazhinov.com/sya/gavan/wp-includes/Text/Diff/OwQTaXsb.php
+bereneli.com.br/bereneli/I1d42b7h6df80gh71/
  biolinky.co/legendarycontract
  biolinky.co/luckyxspin
  biolinky.co/tencentmetro
@@ -260,6 +161,7 @@ bit.do/fKRpG
  bit.do/fKZdP
  bit.do/fKuC3
  bit.do/fLg8m
+bit.do/fPJiS
  bit.do/fdrfg
  bit.do/fnNcm
  bit.do/fndxn
@@ -375,9 +277,9 @@ bit.ly/3aS6b36
  bit.ly/3aiQ9yX
  bit.ly/3b8sOAs
  bit.ly/3bSgkin
+bit.ly/3bVCsbL
  bit.ly/3bhoSgj
  bit.ly/3bjrj1Q
-bit.ly/3cDYGOE
  bit.ly/3cGXQiP
  bit.ly/3cOrSAx
  bit.ly/3cmuxSb
@@ -392,7 +294,6 @@ bit.ly/3dz5vzQ
  bit.ly/3e0ja3l
  bit.ly/3e1gqUl
  bit.ly/3eKdpZc
-bit.ly/3eRuClk
  bit.ly/3eoKad8
  bit.ly/3et0kmh
  bit.ly/3fCvze2
@@ -427,14 +328,16 @@ bit.ly/3kmcdfJ
  bit.ly/3koQf49
  bit.ly/3l15oRs
  bit.ly/3ldEgPt
-bit.ly/3lqgJvK
  bit.ly/3lsusld
  bit.ly/3lvHSNF
  bit.ly/3m0AIRm
  bit.ly/3m4oE1w
  bit.ly/3nhYaK7
  bit.ly/3pvPGRe
-bit.ly/3qVq4wA
+bit.ly/3qZmQrS/
+bit.ly/3qZrGFF
+bit.ly/3r1oPMl
+bit.ly/3vDDH7c
  bit.ly/Actualiza-ViaBcp
  bit.ly/Atualizar-SMS-iToken
  bit.ly/BCP_Validar
@@ -466,62 +369,17 @@ bitly.com/3kXAhXj
  bitly.com/3oFHKMQ
  bitly.com/3p4HWWh
  bitly.com/PAYPAL-LOGIN-IL
-blueflamemarketing.us/OH2/GG8
-blueoceanoutdoors.co/wi
-blueoceanoutdoors.co/wi/index.html
-bothpierre.com/oWa
-bothpierre.com/oWa/index.php
-bpay-netbank.com/www.my.commbank.com.au/netbank/Logon
-bpay-netbank.com/www.my.commbank.com.au/netbank/Logon/Logon.php
-brainstormaccumulation.com/u1
-brainstormaccumulation.com/u2
-bricksforchicks.co.nz/1/final365TRL/
-businesszen.trade/mike/holmberg
-byoskar.com.tr/azc/Priv8/Priv8
-c.oooooooooo.ga/o/cpu32.exe
-c.oooooooooo.ga/o/cpu64.exe
-c00.us/nrzsz
+cablelooting.com/cn/log/https/mail/quota/upgrade/25GB/
  cakeurl.com/sw3zY
-camionerosantiago.com.ar/hfkfhkf
-camlife.in/AMAZ
-cancel-request-payee.com/lloyds
-cancel-request-payee.com/lloyds/Login.php
+capacitiveswitching.com.au/bbbbbbbbb
  capesandbox.com/file/sample/2582/8729e52104ec08ca7002b217c42c3ec12262badbb3f11faaab1829eba505c3cb
-capilart.com.br/site/assets/js/us/delta.com
-capilart.com.br/site/assets/js/us/delta.com/index.php
-capturecrusade.com/ux
-caregiversblessings.com/Ryan/Cowan/
-casercaloo.ga/steinbeck
-cashonyourmobile.net.au/promedllc/
-cbdlegaleitalia.com/ebtco/15cdb7b9498fc13
-cbdlegaleitalia.com/ebtco/15cdb7b9498fc13/login.php
-cciiglobal.org/css/Wetransfer/
-ccpaia.com/js/
-cenbicx.com/pok/Americas.Apps
-certifyunauthorizedpayee.com/lloyds
-certifyunauthorizedpayee.com/lloyds/Login.php
-cewsqer.com/mazon/amazon/
-chicksinfo.com/vc
-chicksinfo.com/vc/login2.html
-clashdare.com/jjhbjbj/hvhhju/plutn/
-classified.webc.in/redirect/negwtod/mail%40example.com
-codecraftdm.com/xis/Priv8/Priv8
-codecraftdm.com/xis/Priv8/Priv8/index.html
-colonlean.com/LUNO_2021/
-contentfiles.cc/onedrive/599Xr56Fre30pQ243V9074Mj7Sw90juDDerXz3497566
-copyrightinfringement-form.com/support/help
-copyrightinfringement-form.com/support/help/
-copyrightinfringement-form.com/support/lnstagram
-copyrightinfringement-form.com/support/lnstagram/
+cashlandbuyer.cash/premier_five_wta/xchan_owa
+cashlandbuyer.cash/premier_five_wta/xchan_owa/index.php
  cort.as/-FgvH
-coupon.trabolgan.com/oue
-coupon.trabolgan.com/oue/mime.php
  cpbild.co/c6d466d
-craigslist-posting0171407.com/update.craigslist.org
-craigslist-posting0171407.com/update.craigslist.org/
-creditswissbanking.com/ibank/login/
-culture-philippeville.be/img
-culture-philippeville.be/img/r5tgghhrtdtedsdfggrrrffdtftyt545yfdfghyg6ugfghjhfygfghjityutifghjhktiuy89tr89utjyuyjjuyhjtuyhgjtthmnbhjgyr5ee5543.php
+crossingscatter.com/./CN/ali1/ali
+crossingscatter.com/./CN/ali1/ali/login.php
+culture-philippeville.be/vendor
  cutt.ly/QiCMqtb
  cutt.ly/SsyhHnk
  cutt.ly/SyhM3BP
@@ -531,40 +389,25 @@ cutt.ly/WgAU6fN
  cutt.ly/_BCP
  cutt.ly/actualizarbcp
  cutt.ly/ldTGuAB
+cutt.ly/lxqRu2l
+cutt.ly/qxqVZTI
  cutt.ly/tsqb6ai
  cutt.ly/vsqbVMI
  cutt.us/9WNKq
  cutt.us/X41CC
  cutt.us/rHqRx
-cyber-aa.com/index_html/At&t
-cyber-aa.com/index_html/At&t/
-cyber-aa.com/index_html/At&t/index2.html
  cyw.pe.kr/images/baba/Alibaba.com/Alibaba.com/Alibaba.co.uk/35c2f42de3a745af1c74bd8fc03250ad
-d.ttr3p.com/kr.bin
-davesalomon.com/office365/
-ded3531.inmotionhosting.com/~bettafitcomau/wpadmin/dhl/source
-ded3531.inmotionhosting.com/~bettafitcomau/wpadmin/dhl/source/index.php
-deepearthmovers.com/deep/style/excs/countdown
-deepearthmovers.com/deep/style/excs/countdown/en.php
-deltagrouptravel.com/Secure/
-demo.theinspium.com/wizartz/demo
-demo.theinspium.com/wizartz/demo/wp-content/languages/html.php
-dfeujess.com/nobody
-dhlmaytrackingseiwss.app/dhl-tracking/
-dhlmaytrackingseiwss.app/dhl-tracking/F004f19441
-dhlmaytrackingseiwss.app/dhl-tracking/F004f19441/55933014f.php
+derechohr.com/images/ID/b53a4204647b7cb11ba82d5ab40cffd2
+derechohr.com/images/ID/b53a4204647b7cb11ba82d5ab40cffd2/Suspend.php
  digitalkom.com/mobibah
  digitalkom.com/mobibah/wp-includes/sodium_compat/namespaced/Core/ByaOBP86i.php
-distrial.ec/bm/
-distributie-pakket.me/bnp
-distributie-pakket.me/ing
-distributie-pakket.me/ing/index.php
-distributie-pakket.me/knab
-distributie-pakket.me/rb1/r1
-distributie-pakket.me/sns
+diplomaticroute.com/chase-login/home
+diplomaticroute.com/chase-login/home/index.php
+disponivelisems.westus2.cloudapp.azure.com/jmk64hg.zip
+divineresort.com/fxxx/
  dlvr.it/RXVbg3
-dobbelsteenelektro.nl/hyen
-dobbelsteenelektro.nl/hyen/Index.html
+dnp-cdm.com/telekom
+dnp-cdm.com/telekom/login.html
  docs.google.com/forms/d/1cftY9nPkgtssMgHl5uc070iUbDW-vRpa7sBpQQYOSCk/viewform
  docs.google.com/forms/d/1ubfTadXuGDGvTvNscAY0_f78KUm17eHjm5vf2Ltz6Hs/viewform
  docs.google.com/forms/d/e/1FAIpQLScF68Z9GTY6VGd_OJVtROggMC5gl95AoNcW27gHvVatJQfp4Q/viewform
@@ -609,56 +452,24 @@ docs.google.com/forms/d/e/1FAIpQLSfgVWY26SZ_Aumb4Tj52fkdiZr979r97zbXoy45CT7ojbzU
  docs.google.com/forms/d/e/1FAIpQLSflOWOdPVSHQxAOf0Yu5HMfUUbV1VQp2ddfltTkAYApDSsUyg/viewform
  docs.google.com/forms/d/e/1FAIpQLSflxxuI_0dV49fhRtRiIo5E1uN2RBMGgMLQI-6qGDZVNV-ZVQ/viewform
  docs.google.com/forms/d/e/1FAIpQLSfw3glHBuhrFSF4kTOw1sa_BSsYr9NBQF4RhDYAv_g6xXgPoA/viewform
-donoroo.com/blockchain/block
-donoroo.com/blockchain/block/
-donoroo.com/blockchain/block/verify.html
-dony.org.uk/p9bdd5o.tar
-dopediscount.com/sooie/
-dosiovini.shop/dz/caixa/particular/home/
-dqeyesun.com/6TbNzKNsPYYrDBP/pdZ4sy2r51NwDhB-2/
-dreamannonces.com/Finance/mobilesco/
+drhankdelivered.com/mock/medical
  drive.google.com/uc
  dropbox.com/l/AABy5Irzd_ji2DuiO-i5z8ZZ70_ZRnRBTLQ
  dropbox.com/l/AADF6y5O_I_uxzPM7EarhSzPUoBxa9VQXQ0
-dwire.it/FB-19MNBA12361JNA
-dwire.it/FB-19MNBA12361JNA/profile.html
  dwnlds.co/ab3f360
-ebyaiqydnqcvyzlq-dot-junta-sompara.ue.r.appspot.com/#abuse
-ec2-18-184-28-26.eu-central-1.compute.amazonaws.com/atualizacao/home/03/device/
-eduwirednews.com/Naomi/insight/
-ejectfleet.net/gkddl/gjkl/
-eliturbrasil.com.br/ayt
-enomeannaonly1.cf/627a67df02802a62a4bacee045de4bc3
-enomeannaonly1.cf/627a67df02802a62a4bacee045de4bc3/indexx.php
-enomeannaonly1.cf/627a67df02802a62a4bacee045de4bc3/indexxx.php
-enomeannaonly1.cf/627a67df02802a62a4bacee045de4bc3/office.php
-enomeannaonly1.cf/e26a75dcda0d63e8a6317aab1e8cd0e8
-enomeannaonly1.cf/e26a75dcda0d63e8a6317aab1e8cd0e8/indexx.php
-enomeannaonly1.cf/e26a75dcda0d63e8a6317aab1e8cd0e8/indexxx.php
-enomeannaonly1.cf/e26a75dcda0d63e8a6317aab1e8cd0e8/office.php
-enomeannaonly1.cf/eff65ddad5fce36477cc520db76c3af9
-enomeannaonly1.cf/eff65ddad5fce36477cc520db76c3af9/indexx.php
-enomeannaonly1.cf/eff65ddad5fce36477cc520db76c3af9/indexxx.php
-enomeannaonly1.cf/eff65ddad5fce36477cc520db76c3af9/office.php
-eowynblader.com/intuitsolution/quickbooks/
-equitymoat.in/./SFExpress/
-estudiorbt.com/proposaldocs
-estudiorbt.com/proposaldocs/8abweo7jmg4vercn6o5dbwn2.php
-eurex.ps/bomx/4IM6UdbDirEU0hR.exe
-eurex.ps/bomx/abman.exe
-eurex.ps/english/okl/xckex.exe
+e-iones-mail-supports-germany.glitch.me/#support
+erp.hrex.pk/passport
+erp.hrex.pk/passport/index.html
  evernote.com/shard/s349/client/snv
-exchangema.com/mazon/amazon/
-ezvhkjqm4updkpxe.filesusr.com/html
-ezvhkjqm4updkpxe.filesusr.com/html/f20a22_f28bbd0e83e4293d4d64a235a3c1ed44.html
  f002.backblazeb2.com/file/OfI7IwvBL496004dc/XCUIHB4e0a12IJlO
  f002.backblazeb2.com/file/OfI7IwvBL496004dc/XCUIHB4e0a12IJlO/FDCB19C64EB0416B12EC0B49F.html
-faceebookevents.atwebpages.com/groups/3539744339377670/photo/fbid=154347239181679/
-fafireead.com.br/ava_old_mix/grade/tests/behat/lib.service.php
-fanhuntersagency.com/jasmyu
-fanhuntersagency.com/jasmyu/index.php
-faustinoclemente.pt/images/revo-slider/images/core.cache.php
-files.jivosite.com/file-transfer/1621967/2021-03-16/55ec600e4e6500e080c5.doc
+f4cboook-la-lognla-facbook-es-2ks421xpj.filesusr.com/html
+f4cboook-la-lognla-facbook-es-2ks421xpj.filesusr.com/html/e36689_a4e3ccf1f3ef2ca97c9742b5995e7468.html
+f4cboook-lognla-facbook-es-gc8zwhvw6m.filesusr.com/html
+f4cboook-lognla-facbook-es-gc8zwhvw6m.filesusr.com/html/e36689_e76ad8ff12abe98da4fc25893ae10bbb.html
+fevanalytics.com/Vf0392e48b108ch0h/
+fevanalytics.com/Yh481hhf3gh07ec92/
+fevanalytics.com/Z4h7b4b42g48g5fd3/
  firebasestorage.googleapis.com/v0/b/access439984393434430fd4c34f4.appspot.com/o
  firebasestorage.googleapis.com/v0/b/access439984393434430fd4c34f4.appspot.com/o/index.html
  firebasestorage.googleapis.com/v0/b/apps-00303000300mic.appspot.com/o
@@ -816,7 +627,6 @@ firebasestorage.googleapis.com/v0/b/woodtoday-ae8d3.appspot.com/o
  firebasestorage.googleapis.com/v0/b/woodtoday-ae8d3.appspot.com/o/index.html
  firebasestorage.googleapis.com/v0/b/workse-d507e.appspot.com/o
  firebasestorage.googleapis.com/v0/b/workse-d507e.appspot.com/o/mananayoindex.html
-flatwaredawn.com/uc/
  form.elementform.com/0a4b86bcfd8d414b9fbce0329020508d45549925
  form.jotform.com/201644738915057
  form.jotform.com/202268964605057/
@@ -838,20 +648,9 @@ forms.gle/h2gpkwfqYEURyZfBA
  forms.gle/jW5MRytPVSRpRSWx7/
  forms.gle/su3QLmquExCofMcX7
  forms.gle/uGjm1KN5rRTUdArS6
-forms.gle/xN9keoPsNDywPiNN6
  fra1.digitaloceanspaces.com/zooms
  fra1.digitaloceanspaces.com/zooms/zoom.html
-frill-flax-vicuna.glitch.me/#abuse
-frontsider.com/att
-frontsider.com/att/index.php
-fuullciau.com/purpsose/mazon/3c59d
-fuullciau.com/purpsose/mazon/3c59d/homepage
-fuullciau.com/purpsose/mazon/amazon
-fuullciau.com/purpsose/mazon/amazon/homepage
  gamerlaunch.com/community/users/blog/4908663/1794789
-garagedoorai.com/cfg
-gencanning.com/xt/office-RD117
-get.your.package.global.iboisoes.com/F004f19441/
  gg.gg/ElPeruPrimero
  gg.gg/auto_atendimento
  gg.gg/fwi76
@@ -862,35 +661,13 @@ gg.gg/jgwhv
  gg.gg/lng51
  gg.gg/lnzh7
  gg.gg/ls61b
-ghazipro.com/zoom/True/
-gingerthaidallas.com/cito/chase/chase/
-gingerthaidallas.com/cito/chase/chase/verification-email.php
-gingerthaidallas.com/inc/ibxolb/ibxolb/login/index-html
-gingerthaidallas.com/inc/ibxolb/ibxolb/login/index-html/login/
-gingerthaidallas.com/inc/ibxolb/ibxolb/login/index-html/login/email.php
-gofuturett.com.au/shade99/365_auth
-gofuturett.com.au/shade99/365_auth/office.php
-goldengaragedoor.com/yy/oauth
-goldengaragedoor.com/yy/oauth/ooo.html
-goodideatravel.com/onedrive
-graindesable.eliatroneduchante.com/mosi9tchitan/baba/_/home/gmxxx/
-hackgoapp.com/moddjifly/
-healingfrequencymedicine.com/temp/
-help-copyrights-lnstagram.com/contact/63627639972184122
-helps-uber.com/trips/
-home-post-die-sendungsstatus.company-bonuscard.com/post
-home-post-die-sendungsstatus.company-bonuscard.com/post/access.php
-home-post-die-sendungsstatus.support-bonuscard.com/post
-home-post-die-sendungsstatus.support-bonuscard.com/post/access.php
-home-post-die-sendungsstatus.tracking-diepost.com/post
-home-post-die-sendungsstatus.tracking-diepost.com/post/access.php
-home-post-die-sendungsstatus.trackingdietpost.com/post
-home-post-die-sendungsstatus.trackingdietpost.com/post/access.php
-homs.cl/Officesm
-homs.cl/Officesm/login.php
-hotelnirvanapalace.com/ooe
-houmangallery.ir/diid/linkedIn.com/linkedIn.com
-houmangallery.ir/diid/linkedIn.com/linkedIn.com/login.php
+girlsforyourdesires.com/SFexpress/SFExpress
+girlsforyourdesires.com/SFexpress/SFExpress/index.php
+go.swipez.in/2w2t/
+gracechu.net/doll
+hankookbeautyshop.com/access/
+hsbc.referred-authorisation.com/payees/reg
+hsbc.referred-authorisation.com/payees/spe
  ht.ly/10IO30qSAAi
  ht.ly/1Yzh30r1i6R
  ht.ly/2Wh830qSzga
@@ -927,31 +704,29 @@ ht.ly/l9fA30r4pBd
  ht.ly/qI3n30qYyFp
  ht.ly/qnpl30rixrr
  ht.ly/taRE30qyd7z
-ht.ly/vn0N30rAWm7
  ht.ly/zBcg30qCsiy
  htl.li/XVTs30qzpMo
  htl.li/fjhC30pZk72
  htl.li/kL5q30q5utK
-hwoodburnmed.com/manuel/login/amxsb3JlbnNAaGFlbW9uZXRpY3MuY29t
-ia801802.us.archive.org/19/items/startup_20210219/Startup.txt
-iacoi-law.work/OneDrive/98fee8105cbc1b5ff224ff1890e4683e
-iacoi-law.work/OneDrive/98fee8105cbc1b5ff224ff1890e4683e/index1.php
-ib2-security.com/att/
-ib2-security.com/att/classic
-ib2-security.com/att/classic/index.php
-idealhostel.com.np/office365/
-identityalert-newpayees.com/LLOYDS
-identityalert-newpayees.com/LLOYDS/Login.php
-ighelpbusinessnew.com/3x
-ighelpbusinessnew.com/3x/home.php
-igovafrica.com/a/
-img.maplejournal.co.in/im/2249282/ed29ac22750f92c39cbde8d8e0555230c64c637c9ebb76f984c363e2265c93a3.jpg
-inf0rm4tions-update-j73h7f4s.melalakanee16.net/RetailInternetLogin2
-instaweargift.com/de-amazon/
-inti-tray.com/az/Priv8/Priv8
-inti-tray.com/az/Priv8/Priv8/index.html
-ioiuqer-71.ml/webmail%20login%20account
-iones-es-spupport.glitch.me/#abuse
+igricekonzole.com/main/
+iisoko.com/banks/directing/atbonline
+iisoko.com/banks/directing/atbonline/index.html
+iisoko.com/banks/directing/cibc
+iisoko.com/banks/directing/cibc/index.html
+iisoko.com/banks/directing/royalbank
+iisoko.com/banks/directing/royalbank/index.html
+iisoko.com/banks/directing/simplii
+iisoko.com/banks/directing/simplii/index.html
+iisoko.com/banks/directing/tangerine
+iisoko.com/banks/directing/tangerine/index.html
+illliiilllilll.wpengine.com/banks/Simplii
+illliiilllilll.wpengine.com/banks/Tangerine
+illliiilllilll.wpengine.com/banks/Tangerine/pin.php
+illliiilllilll.wpengine.com/banks/Tangerine/questions.html
+imagesbyrainy.com/ninos/flis/87zrazsazr4a9raz/
+imasmari105.filesusr.com/html
+imasmari105.filesusr.com/html/e04f4e_f28bbd0e83e4293d4d64a235a3c1ed44.html
+inr.pl/pub/scib/Absa%20Online%20-%20PROFILE.htm
  iplogger.org/2KmWW5
  is.gd/CB9Ipo
  is.gd/ING1ES
@@ -969,50 +744,27 @@ is.gd/uae_girls_number
  is.gd/wRd7yK
  is.gd/youappweb
  is.gd/zrYBJr
-islafrancine.com/c/acrobat/
  islam-guide.com/cgi-bin/goto.cgi
-itaucartaoes.com/cart%C3%A3oes
-itaucartaoes.com/cart%C3%A3oes/inicio.html
  j.mp/2BUqTCt
  j.mp/2ZZtIeM
  j.mp/39oczg7
  j.mp/3asgxFT
-jksfoodsandflavours.in/az/Priv8/Priv8
-jksfoodsandflavours.in/az/Priv8/Priv8/index.html
-johntoursperu.com.pe/dhl/source
-johntoursperu.com.pe/dhl/source/index.php
-k3grjkgrfjk.ga/New1
-k5yhekrfhkl.ga/New2
-kandkattorneylaws.com/DON/DO/DON/DO/1drvme
-kandkattorneylaws.com/DON/DO/DON/DO/1drvme/
-kandkattorneylaws.com/DON/DO/DON/DO/1drvme/verification.php
-kandkattorneylaws.com/DON/DO/DON/DO/1drvme/verificationAttempt.php
-kathleenmxpeake.com/Robert%20Arens/mazon/8572c/homepage
-kimraewon.cn/signim/
-kinya.byethost7.com/panda
-kinya.byethost7.com/panda/ss.html
-ko0.us/pChart/2030/
-kora-homes.com.au/doc-file/Drive/
-kreativekustomdesignz.com/ska
-kreativekustomdesignz.com/ska/index.php
-kreativekustomdesignz.com/ska/verification.php
-kukudoo.com/spider
+jp-myau.com/connect.auoneid
+jp-myau.com/connect.auoneid/
+jp-myau.com/connect.auoneid/login.php
+kbmovers.co.za/host/latest-onedrive
+kbmovers.co.za/host/latest-onedrive/
+kiesesypumpiones.com/css/webmail-op.jp/webmail-op.jp/
+kiesesypumpiones.com/css/webmail-op.jp/webmail-op.jp/check/
+kilts.fr/opg/
+kulindatraining.co.uk/23af4b45f1e166141a790d1a3126e77a/
  kutt.it/3MdFZz
-kutt.it/ADrnTf
  kutt.it/GZ0Eo1
-kutt.it/Kl1aKC
  kutt.it/nZEaRO/
-lamareisen.com/Secure/
  landpage.co/a8eb4190-031d-11eb-ad8f-f2646ce6f5c7
  landpage.co/f171b772-03ff-11eb-b136-be6044770142
-laudypauty.com/ff385e998383b6f800/35_296418_2480255/2110_3233548_2898981_19/371862514
-lawnchairwebbingusa.gb.net/vbnm/
-ldksfhsdklvh.ga/New5
-lejtglwerjt.ga/New2
-lexnotes.com.ng/onee365664545
-lexnotes.com.ng/onee365664545/logon.php
-li.cmu.ac.th/ho/agricole/6e0ae4533b78dc4
-li.cmu.ac.th/ho/agricole/6e0ae4533b78dc4/region.php
+lemnis.ro/mfm
+lifeway.ngo/fff/Telekom.confirmed/
  linktr.ee/Blkg7
  linktr.ee/FREESKINSLEGENDARY
  linktr.ee/PUBG.MOBILE.SEASON.15
@@ -1028,76 +780,28 @@ linktr.ee/amemuito
  linktr.ee/pubglukyspinevent.com
  litelink.at/Cartao_Carrefour
  litelink.at/cartaoatacadao2020
-lkwhfaskhls.ga/New3
+livrais-colisemo-express.net/chawars
  lnk.news/2rovk
  lnkd.in/dC_EFvE
-lnstagramagency.com/appeal/bluebadge/89254272114/wastedvedat
-login-membershipaccountsupport.aggmony.org/30ba105754346aaf47509089d2287f2a
-login-membershipaccountsupport.aggmony.org/30ba105754346aaf47509089d2287f2a/knhmWSOc40J4X3DJCeXJ3v1oVrLP.php
-lostpromises.com/PO/INV/
-luluandthebean.com/chase-login/
-luluandthebean.com/chase-login/home
-luluandthebean.com/chase-login/home/
-lupromocoes.com/7879577849275/59547
-lupromocoes.com/7879577849275/59547/product.php
-madens.com.pl/8963/
-mail.accountupdate.support/O2/Login/index
-mail.detectpayeenotices.com/lloyds
-mail.detectpayeenotices.com/lloyds/Login.php
-mail.inlightprod.com/wordpress
-mail.inlightprod.com/wordpress/wp-admin/js/il/il-xppl
-mail.itaucartaoes.com/cart%C3%A3oes
-mail.itaucartaoes.com/cart%C3%A3oes/inicio.html
-mail.payeealertsinfo.com/lloyds
-mail.payeealertsinfo.com/lloyds/Login.php
-mail.rwandaupdate.com/intesa.sanpaolo.it
-mail.secure-cancel-request.com/lloyds
-mail.secure-cancel-request.com/lloyds/Login.php
-mailapplications.wixsite.com/connexion-mail/
-mainstreamwebsites.com/manager/prepaid.bankofamerica.com/prepaid.bankofamerica.com/eddcard/Verify/image/home/myaccount/uploads/
+mail.victotech.com/ddd/DHLL
+mail.victotech.com/ddd/DHLL/u.php
  mapage.noos.fr/~jeanmarie.regall/7546t5.exe
-masonsdemand.com/LUNO_2021
-maxjz.com/1
-maxjz.com/1/pagepage.html
-mechlloyd.com/bin/Package/DHL/Account/Informaions/b299aa7d50eab40bff0cb7f44d76acf1
-mechlloyd.com/bin/Package/DHL/Account/Informaions/b299aa7d50eab40bff0cb7f44d76acf1/
-mechlloyd.com/bin/Package/DHL/Account/Informaions/b299aa7d50eab40bff0cb7f44d76acf1/cvv.html
-mechlloyd.com/bin/Package/DHL/Account/Informaions/b299aa7d50eab40bff0cb7f44d76acf1/info.html
+marketing.jffalcom.com.br/DHL/dhl/dhl/dhl/dhl/
+mayorimport.com.ve/oprofiledo
+mayorimport.com.ve/oprofiledo/i0afx5l4d1eu8u3j956yz2xo.php
  mediafire.com/file/yn8dnlx4znw0qwy/AppTrailers.9.1.10amt.exe
-meusabor.com.br/b/login/
-mkuyadelk.com/amas/mazon/dd7a1/homepage
-mobilepayeenotices.com/lloyds
-mobilepayeenotices.com/lloyds/Login.php
-moodclothing.net/eFolder/0ffline/933/
-motelvenuspontevedra.com/accounts/
-msceoconnections.com/account
-msceoconnections.com/account/login
-mybuildcam.com/view/archive/files209/Log%20in%20_%20WeTransfer.php
-mybuildcam.com/view/profiles/standard/xls.doc/retiovcx-excel2
-mybuildcam.com/view/profiles/standard/xls.doc/retiovcx-excel2/index.php
-mydsn.net/clinicals/nuevoemt/186.12.108.16148345/agregar/telefono/contacto
-mydsn.net/clinicals/nuevoemt/186.12.108.16148345/agregar/telefono/contacto/LogonOperacionServlet.html
-mydsn.net/clinicals/nuevoemt/186.12.108.16148345/agregar/telefono/contacto/operacion-exitosa.html
-mydsn.net/clinicals/nuevoemt/186.12.108.16148345/agregar/telefono/contacto/telefono.html
-n0tificat1ons-verifed.montanasenaterace.com/RetailInternetLogin2/
-naturallylivingketo.com/header/2/
-naturallylivingketo.com/header/3/
-nbs.vizzhost.com/fils/cfsm.txt
-nbs.vizzhost.com/fils/melo.txt
-nemesiaacademy.in/boce/sone/
-neronet-library.com/idbids/YWpvcmdlQHNodmVuZXJneS5jb20=
-neronet-library.com/ouijknhj
-neronet-library.com/ouijknhj/verify.php
+moderncioplaybook.com/xx
+moderncioplaybook.com/xx/index.html
+morgage-genius.com/grace/
+nbs.vizzhost.com/a/cfsm.txt
+nbsnoticias.com.mx/prim
  net.geo.opera.com/opera/stable/windows
  net.geo.opera.com/opera/stable/windows/
-neuroenergy.fahadjutt.com/tfhcxlrzk.tar
  news-ontime.com/Nov.1/Shark-Tank-Diet8.0/Keto-Lean.html
  news-ontime.com/Nov.1/Shark-Tank-Diet8.0/Keto-Pure-ss.html
  news-ontime.com/Nov.1/Shark-Tank-Diet8.0/Slim-X-Genie-Keto.html
-niagaborong.com/link/OV4/bWFpbEBleGFtcGxlLmNvbQ==
-northcountyluxuryrealestate.com/Lunosaisd/LUNO_2021/
-notifiyedexpress.com/landing/form/7d469fe8-ad09-496d-92e9-efb68779bf4b
-notifymobilealerts.com/lloyds
+newyork-gritty.com/BusiPropopsal/xx%202
+newyork-gritty.com/BusiPropopsal/xx%202/index.html
  objectstorage.eu-amsterdam-1.oraclecloud.com/n/axvzq6ccdhre/b/covna/o
  objectstorage.eu-amsterdam-1.oraclecloud.com/n/axvzq6ccdhre/b/covna/o/covhome.html
  objectstorage.uk-london-1.oraclecloud.com/n/lr4txdosnm2q/b/voipshare/o
@@ -1121,45 +825,16 @@ objectstorage.us-phoenix-1.oraclecloud.com/n/axxhgwgjih8t/b/voicenote/o/117-Crl.
  objectstorage.us-phoenix-1.oraclecloud.com/n/axy0ck15gxtn/b/outcall/o/11-Crl.html
  objectstorage.us-sanjose-1.oraclecloud.com/n/axcdfbfimho2/b/bucket-20200807Voicemessagesreviewportal-0627/o
  objectstorage.us-sanjose-1.oraclecloud.com/n/axcdfbfimho2/b/bucket-20200807Voicemessagesreviewportal-0627/o/index.html
-oceancurrentsllc.com/zsjhfsh/
-olx-accepted.com/order
+ofstlaxcala.gob.mx/mail
+ofstlaxcala.gob.mx/mail/correo.php
+olxpl.bank-payment.com/cash57008877
+ombb.omarwebdesign.com/wordpress/inc
+ombb.omarwebdesign.com/wordpress/inc/redir.html
  onedrive.live.com/download
-online-rbb.bg.secured8487477466637hd.mr-dj.com.au/bg
-online-rbb.bg.secured8487477466637hd.mr-dj.com.au/bg/login
-onlinehalifax-account.com/Halifax
-onlinehalifax-account.com/Halifax/Login.php
-onstone.sg/login/Chase-online-Banking/01dfe9c8605d8b93c8870484a505867a
-onstone.sg/login/Chase-online-Banking/01dfe9c8605d8b93c8870484a505867a/
-onstone.sg/login/Chase-online-Banking/01dfe9c8605d8b93c8870484a505867a/index1.php
-onstone.sg/login/Chase-online-Banking/2759e0906ba8d3e6bf60d62791535aea
-onstone.sg/login/Chase-online-Banking/2759e0906ba8d3e6bf60d62791535aea/index1.php
-onstone.sg/login/Chase-online-Banking/3f61a7c4f2f74be3325a18c5919a9604
-onstone.sg/login/Chase-online-Banking/3f61a7c4f2f74be3325a18c5919a9604/index1.php
-onstone.sg/login/Chase-online-Banking/56ac4c3a3898f103e471ac097d9dfec4
-onstone.sg/login/Chase-online-Banking/56ac4c3a3898f103e471ac097d9dfec4/
-onstone.sg/login/Chase-online-Banking/56ac4c3a3898f103e471ac097d9dfec4/index1.php
-onstone.sg/login/Chase-online-Banking/79281547b8ed5674f92ecccd456485aa
-onstone.sg/login/Chase-online-Banking/79281547b8ed5674f92ecccd456485aa/index1.php
-onstone.sg/login/Chase-online-Banking/8fa02632d4be511fa280fc5c08f61cc2
-onstone.sg/login/Chase-online-Banking/8fa02632d4be511fa280fc5c08f61cc2/
-onstone.sg/login/Chase-online-Banking/8fa02632d4be511fa280fc5c08f61cc2/index1.php
-onstone.sg/login/Chase-online-Banking/d71fa22c57f2f6f9cad4ce0187d3c65b
-onstone.sg/login/Chase-online-Banking/d71fa22c57f2f6f9cad4ce0187d3c65b/
-onstone.sg/login/Chase-online-Banking/d71fa22c57f2f6f9cad4ce0187d3c65b/index1.php
-onstone.sg/login/Chase-online-Banking/e7af037e640a31ae8a18277371bf7e35
-onstone.sg/login/Chase-online-Banking/e7af037e640a31ae8a18277371bf7e35/
-onstone.sg/login/Chase-online-Banking/e7af037e640a31ae8a18277371bf7e35/index1.php
-onstone.sg/login/Chase-online-Banking/e9215d610b7da583cd155c1ad5bec422
-onstone.sg/login/Chase-online-Banking/e9215d610b7da583cd155c1ad5bec422/
-onstone.sg/login/Chase-online-Banking/e9215d610b7da583cd155c1ad5bec422/index1.php
-opan.byethost22.com/haya
-opan.byethost22.com/haya/ss.html
-optec-industries.com/themes/Keybank/Keybank
-optec-industries.com/themes/Keybank/Keybank/login.php
-optec-industries.com/themes/Keybank/Keybank/security.php
-optec-industries.com/themes/Keybank/Keybank/validate.php
-oratoes.ca/mailusaa/usaa2/
-orbitmalang.co.id/.a/qiye2
+oqwablplz57iz265oyzc3hh3au-adwhj77lcyoafdy-www-paypal-com.translate.goog/authflow/password-recovery/
+os5aa.com/excel/Excelfv/files
+os5aa.com/excel/Excelfv/files/index2.php
+os5aa.com/sxv/china/
  ow.ly/3IRf30qF4Kw
  ow.ly/BD9i50AVlOV
  ow.ly/BgVO30qE9fg
@@ -1174,85 +849,57 @@ ow.ly/tEjO30qJvOw
  ow.ly/yxK730qUYLl
  padlet-uploads.storage.googleapis.com/610964646/d0a82b340ac6b4eb2fed334399fe2e84
  padlet-uploads.storage.googleapis.com/610964646/d0a82b340ac6b4eb2fed334399fe2e84/palad.html
-pagestampcrab.com/William
-pagestampcrab.com/William/
-pagestampcrab.com/William/en-e.php
-pagestampcrab.com/William/en.php
-pagestampcrab.com/William/log.php
-pairyapp.com/owafile
-panichealthmedical.com/ells
-panichealthmedical.com/wh/11ef0/
-panichealthmedical.com/wh/8425d
-panichealthmedical.com/wh/8ed1c
-parjanyaa.com/xhtm/Priv8/Priv8/
  pastebin.com/raw/DawJ5x7m
  pastebin.com/raw/Yt0EUBML
  pastebin.com/raw/yqVSvLVQ
-pay16-olx.pl/track
-pay18-olx.pl/track
-payalandzinal.com/nk/mnm
-payeealertsinfo.com/lloyds
-payeealertsinfo.com/lloyds/
-payeealertsinfo.com/lloyds/Login.php
-payeedetectedalert.com/lloyds
-payeedetectedalert.com/lloyds/Login.php
-payeenoticealerts.com/lloyds
-payeenoticealerts.com/lloyds/Login.php
-paymentmobilealerts.com/lloyds
-paymentmobilealerts.com/lloyds/Login.php
-paypal.me.holdpaystatic.shop/connexion
-piesescuter.eu/webservice/track/DHL-EXPRESS/my-shopping-cart.php
-platigen.com/wordpress
-platigen.com/wordpress/wp-content/themes/commbank-RD218/
-plfcdubai.com/parcel/dhl/dhl/dhl/dhl/
-portal.myonlineservicesonline.com/bonus
-portal.myonlineservicesonline.com/bonus/access.php
-posmddlc.com/stopl3029-kjhg
-post.schweizer-lieferung.digital/CH/idp/portal-delivery&service/-/manage/
-postal-update.support/RoyalMail
-postal-update.support/RoyalMail/
-postal-update.support/RoyalMail/loading.php
-postal-update.support/RoyalMail/secure.php
-postal-update.support/RoyalMail/user.php
-postal-update.support/RoyalMail/verifylogin.php
-pprcaintl.com/020
-primeseguridad.com.ar/.well-known/link/
-priyadarshinigroupengg.com/clark/chinalxx
-priyadarshinigroupengg.com/clark/chinalxx/index.php
-prodiadministrasibisnis.fisip.ulm.ac.id/pre/25GB
-prodiadministrasibisnis.fisip.ulm.ac.id/pre/25GB/index.php
-pumpfitness.org/sf/sf/
-puppypeddler.com/aw/Priv8/Priv8
-puppypeddler.com/aw/Priv8/Priv8/index.html
-purposemadefurniture.com/.start123
-quatangpubgi-thang3.cf/fb
-racalpumpion.com/Secure
-ras-tracking.com/rasbersama/dist/js/pages/Office365
+paypal-opladen.be/en
+paypal-opladen.be/en/login
+paypal-opladen.be/en/tickets
+paz-group.com/next/office
+pilisklima.hu/Z4h7b4b42g48g5fd3/
+postdie-sendungsstatus.misconfused.org/post
+postdie-sendungsstatus.misconfused.org/post/access.php
+pragmakratos.com/usus/onedrive365/loginout-2.php
+prepaid-boaverify.serveirc.com/Anonymous/prepaid.bankofamerica.com/prepaid.bankofamerica.com/prepaid.bankofamerica.com/eddcard/Verify
+prepaid-boaverify.serveirc.com/Anonymous/prepaid.bankofamerica.com/prepaid.bankofamerica.com/prepaid.bankofamerica.com/eddcard/Verify/
+prepaid-boaverify.serveirc.com/Anonymous/prepaid.bankofamerica.com/prepaid.bankofamerica.com/prepaid.bankofamerica.com/eddcard/Verify/billing.html
+prepaid-boaverify.serveirc.com/Anonymous/prepaid.bankofamerica.com/prepaid.bankofamerica.com/prepaid.bankofamerica.com/eddcard/Verify/card.html
+prepaid-boaverify.serveirc.com/Anonymous/prepaid.bankofamerica.com/prepaid.bankofamerica.com/prepaid.bankofamerica.com/eddcard/Verify/email.html
+prepaid-boaverify.serveirc.com/Anonymous/prepaid.bankofamerica.com/prepaid.bankofamerica.com/prepaid.bankofamerica.com/eddcard/Verify/email2.html
+presupuestosolar.com/blog
+presupuestosolar.com/blog/wp-content/plugins/wordpress-importer/parsers/PHReNDkONn7SAH.php
+primeseguridad.com.ar/css/link/
+psd2-portale-intesa.com/cdbk0yrrleuqfae/
+qps.ru/VSptZ/
+qps.ru/mpLlb
+qycn114.com/Z4h7b4b42g48g5fd3/
  rb.gy/05vruj
  rb.gy/0dxzro
-rb.gy/4kef4w
  rb.gy/ajgrnt
  rb.gy/aqr3sk/
  rb.gy/aqwj7l
-rb.gy/cceiu9
  rb.gy/fihzov
+rb.gy/gekur9
  rb.gy/hobteq/
  rb.gy/ia1oft
  rb.gy/iifoiu
-rb.gy/jykzjy
  rb.gy/kn27px/
  rb.gy/lflert
  rb.gy/ludoy0
  rb.gy/n5ozim
-rb.gy/nl1vsc
+rb.gy/qchjmt
  rb.gy/rqkrxe
  rb.gy/rrl1ll
  rb.gy/rtlomb
+rb.gy/s0ig8w
  rb.gy/vnwszq
  rb.gy/xalpmw
  rb.gy/y5c8aa
  rb.gy/yrzlzc
  rcl.ink/PD6
+readsee.thedisneylover.com/KEN7XX7Y0P9/wemail_al.html
+readsee.thedisneylover.com/KEN7XX7Y0P9/wemail_al.html/
+readsee.thedisneylover.com/KEN7XX7Y0P9/wemail_al.html/error.php
  rebrand.ly/000ATT
  rebrand.ly/0gn930f/
  rebrand.ly/0kc6ihu
@@ -1322,21 +969,15 @@ rebrand.ly/yngvu65
  rebrand.ly/zikqv8f
  rebrand.ly/zitln6v
  rebrand.ly/zshyr3j
-reidooleoanalia.com.br/wwm/public_html/webmail/webmail
-reidooleoanalia.com.br/wwm/public_html/webmail/webmail/index.php
-request-cancel-payment.com/lloyds
-request-cancel-payment.com/lloyds/Login.php
+register.tii.qa/metrobank/METRO/METRO/
  reurl.cc/1xRr1Y
  reurl.cc/WL16RO
  reurl.cc/bRkoqE
  reurl.cc/gvjOLp
  reurl.cc/oLeEQj
-review-payeerequest.com/hsbc/spe
-rharecruiters-vreviews.crituvsevmre.com/rha/clients/recruit20098/b37
-rohanapparels.com/holr/dols/
-royalclient-message.com/45190/onlinebanking/cgi-bin/rbaccess
-royalclient-message.com/45190/onlinebanking/cgi-bin/rbaccess/rbcgi3m013fc9.html
-royalmail.parcel-redelivery-attemp-ref018.com/track-your-item.php
+richmondboyschoir.org/mend/excelzz
+richmondboyschoir.org/mend/excelzz/bizmail.php
+rovinjsport.com/authwells
  rplg.co/2-nfc-click
  rplg.co/28aec060
  rplg.co/522f6060
@@ -1350,6 +991,8 @@ rplg.co/ec360820
  rplg.co/ing-contact
  rplg.co/mijn-ing-sca
  rplg.co/web-ve
+rubeeworks.com/sites/default/files/cache/track-CH9514901185421/track-CH9514901185421
+rubeeworks.com/sites/default/files/cache/track-CH9514901185421/track-CH9514901185421/info.html
  run.plnkr.co/plunks/9E5KHqjstsW9Vgnh/
  run.plnkr.co/plunks/9WEVAZo1Tl8SBXHb
  run.plnkr.co/plunks/9WEVAZo1Tl8SBXHb/index.html
@@ -1362,9 +1005,6 @@ run.plnkr.co/plunks/kSN3sbIK3XzLgWhJ
  run.plnkr.co/plunks/mJtflmcpgaozX5SG/
  run.plnkr.co/plunks/rdIzYroZhd0vp7u2/
  run.plnkr.co/plunks/t4cM7cIQAWnjlM9d/
-ruthtaylor.me.uk/cdcgov/audio
-ruthtaylor.me.uk/cdcgov/audio/a292f51c74509dcf0e102bbf4ff5095f.php
-rwandaupdate.com/intesa.sanpaolo.it
  s.free.fr/4cyNYE3X
  s.free.fr/6yRyvaaV
  s.free.fr/92rsZcB4
@@ -1404,8 +1044,6 @@ s.id/u0e9d
  s.id/uDQqs
  s.id/uGGf1
  s.id/versleuteling
-s.id/y-mdU
-s.id/yXxDq
  s3-ap-northeast-1.amazonaws.com/cxrequirement.sharepointeseugwpjlmahxedgkqsbjlzfgsn
  s3-ap-northeast-1.amazonaws.com/cxrequirement.sharepointeseugwpjlmahxedgkqsbjlzfgsn/index.html
  s3-ap-southeast-1.amazonaws.com/xuip
@@ -1448,54 +1086,23 @@ s3.us-east-2.amazonaws.com/www.microsoft.com.v83
  s3.us-east-2.amazonaws.com/www.microsoft.com.v83/inAAi33.html
  s3.us-east-2.amazonaws.com/www1.microsoft.com.st
  s3.us-east-2.amazonaws.com/www1.microsoft.com.st/inAAi33.html
-s7.jchost07.pl/~arkasklep/support/sapo
-samecitylinz.myftp.org/0mslmef/
-samisae-travel.co.jp/tax
-samisae-travel.co.jp/tax/aboutus.php
-samisae-travel.co.jp/tax/home.php
-samisae-travel.co.jp/tax/services.php
-schoolville.net/1
-schoolville.net/1/2.php
-schoolville.net/1/page2.html
-schweiz.post-delivery.net/login-returnUrlsoporteplataformaidentidadapiv1connectauthorizecallback-client
-schweiz.post-delivery.net/login-returnUrlsoporteplataformaidentidadapiv1connectauthorizecallback-client/postch.php
+sainathhospital.com/media/tinymce/plugins/moxiemanager/classes/Core
  scienceasia.org/1987.13.n4/FGBFGTHRTT54ER3467UTRDSVFR3465
  scienceasia.org/1987.13.n4/FGBFGTHRTT54ER3467UTRDSVFR3465/mag.html
-sectionstorage.com/xtem/
-secure-accountrestoration03.ddns.us/link
-secure-accountrestoration03.ddns.us/link/
-secure-cancel-request.com/lloyds
-secure-cancel-request.com/lloyds/Login.php
-secure-paypal.3d3dseccz.com/redirect-new.php
-secure-request-cancellation.com/halifax
-sendandripleyhistorysociety.co.uk/d/acrobat
-sendandripleyhistorysociety.co.uk/d/acrobat/view.php
  sendspace.com/pro/dl/45rnsw
-sendspace.com/pro/dl/q05z91
+service-dienstleistung.com/knab
  sfo2.digitaloceanspaces.com/spacezoomincemeetingcloud
  sfo2.digitaloceanspaces.com/spacezoomincemeetingcloud/AAwsodhdYTTYSHyuey.html
-sgp1.digitaloceanspaces.com/khgfdget4r65t
-sgp1.digitaloceanspaces.com/khgfdget4r65t/dp4nuture.html
  share.hsforms.com/1HWBy9E8zQ5CPqHe5EI6IGA3245i
  share.hsforms.com/1OWoQghkBQDO-dfBLtGExeQ4g63f
-shareholds.com/aus
-shareholds.com/aus/login
-sharepointonline896.hopto.org/Home/
-sharonkoren.com/.well-known/pa/
  short.pe/q00Sa
  shorturl.at/oIJP1
  shorturl.at/rRTX4
-shrinikunjabiharitrust.org.in/ofs/wgbground
-siblingrivalrybakingco.ca/J/1/uu8hM/
  sites.google.com/view/embedded-fi/home
+skylineproperties.co.tz/sun/NEWDHL/DHL_
  slack-redir.net/link
-slmtv.com/tfbgl/44251782425463000000.dat
-smart2host.com/45454
-smart2host.com/45454/next.php
-smbc--card.ml/wap
-smbc--card.ml/wap/index.html
-snackcommerce.com/Ds/crypt
-snackcommerce.com/Ds/crypt/error.php
+snakedoctorspirits.com/Iinkedln.net
+snakedoctorspirits.com/Iinkedln.net/LinkedIn.html
  snip.ly/03elb0
  snip.ly/3b3y76
  snip.ly/7u961z
@@ -1525,22 +1132,19 @@ snip.ly/www.netflix.com-Login-secure
  snip.ly/www.netflix.com-Login-secure/
  snip.ly/www.netflix.com-costumer-login/
  snip.ly/www.netflix.com-signIn-account/
-societe-particulies.com/moncompte/sg/
+solucionesortopedicas.mx/lite101/Excel/page/
  soo.gd/BSmq
  soo.gd/T0F1
  soo.gd/kxVY
  soo.gd/l6Rg
  soo.gd/y3rR
-sorinuri.com/labanquepostale.fr/moncompte/708f6
-spappstest.com/img/portfolio/countdown
-sreculogislanding.wixsite.com/my-site
+ssplsoft.com/bcc/ExcelSecuredfile/ExcelSecuredfile
+ssplsoft.com/bcc/ExcelSecuredfile/ExcelSecuredfile/login.php
+ssplsoft.com/bcc/ExcelSecuredfile/ExcelSecuredfile/page.php
  st6.ning.com/topology/rest/1.0/file/get/8122054091/
-staemcommunitey.com/tradeoffer/newpartner/1119870164/token/192bozqc/
-starlightsavick.com/doc/
-stats.trackingde.com/dev/public/downloads/lsemails
-stats.trackingde.com/dev/public/downloads/lsemails/html.php
-statsic.com/header.jpg
-statssale.com/header.jpg
+stdyalgreenkelvesken.dns.army/receipat/winlog.exe
+stdykungsb2talentwej.dns.army/kung2doc/winlog.exe
+stdyrmtcntlfarmtrypo.dns.army/documenrt/winlog.exe
  stor.ee/4kTV
  storage.googleapis.com/0ffice/ajo2
  storage.googleapis.com/0ffice/ajo2/voicemail.html
@@ -2009,24 +1613,8 @@ storage.googleapis.com/ym-windows/windows.htm
  storage.googleapis.com/zhieurgfieuhfhre
  storage.googleapis.com/zhieurgfieuhfhre/hoif.htm
  storage.ning.com/topology/rest/1.0/file/get/8122054091/
-stripepayment-info.com/sdvvl
-stripepayment-info.com/sdvvl/2step-auth.php
-stripepayment-info.com/sdvvl/login.php
-stripepayment-info.com/sdvvl/profile.php
-stripepayment-info.com/sdvvl/verify.php
-stripepayment-support.com/trhddl
-stripepayment-support.com/trhddl/
-stripepayment-support.com/trhddl/2step-auth.php
-stripepayment-support.com/trhddl/login.php
-stripepayment-support.com/trhddl/profile.php
-stripepayment-support.com/trhddl/verify.php
-structureui.com/assets/css/prism/cd/rbk/unblock_verification/customer_center/customer-IDPP00C643/signin
-structureui.com/assets/css/prism/cd/rbk/unblock_verification/customer_center/customer-IDPP00C643/signin/signin.php
-studysnap.in/.cov/
-sudentsoftheworld.com/cd/spider/
-sukienpubgll-thang3.cf/fb
-sukienpubgll-thang3.ml/fb
-sunriseclarify.com/access/usaa/
+supportaccount-membershiprenew.sagemodee.com/ae5e3ce40e0404a45ecacaaf05e5f735
+supportaccount-membershiprenew.sagemodee.com/ae5e3ce40e0404a45ecacaaf05e5f735/knhmWSOc40J4X3DJCeXJ3v1oVrLP.php
  surveygizmo.com/s3/5635022/AT-T/
  surveygizmo.com/s3/5655517/at-t
  surveygizmo.com/s3/5679924/AT-T-Login/
@@ -2041,15 +1629,6 @@ surveygizmo.com/s3/5799006/Sbcglobal
  surveygizmo.com/s3/5966390/AT-T-Mail
  surveygizmo.com/s3/5989878/Sign-in-to-continue
  surveyheart.com/form/5e23c40fb533f62621f5252d
-swissidnow.com/idp/03/login&app/portal-delivery&service/klp&targetURL/-/manage/
-sydneyestimators.com.au/Cagri/Cagri/z0n51-ca/092c527c53fb5ca
-sydneyestimators.com.au/Cagri/Cagri/z0n51-ca/092c527c53fb5ca/region.php
-sydneyestimators.com.au/Cagri/Cagri/z0n51-ca/7dde330b53180d9
-sydneyestimators.com.au/Cagri/Cagri/z0n51-ca/7dde330b53180d9/region.php
-sydneyestimators.com.au/Cagri/Cagri/z0n51-ca/97805a059069647
-sydneyestimators.com.au/Cagri/Cagri/z0n51-ca/97805a059069647/region.php
-sydneyestimators.com.au/Cagri/Cagri/z0n51-ca/e1b0c83a730f800
-sydneyestimators.com.au/Cagri/Cagri/z0n51-ca/e1b0c83a730f800/region.php
  t.cn/A6LxgDxg
  t.co/0Y8DHT78dD
  t.co/2XX7ZSQTqN
@@ -2067,26 +1646,11 @@ t.co/m6Fz3ChX91
  t.co/mCmzxZ8cyT
  t.co/mSKJH9xhZW
  t.ly/4HEr
-tecflex.com.br/old/abertura/class.lib.php
-teniscet.cl/zim/Priv8/Priv8
-teniscet.cl/zim/Priv8/Priv8/index.html
-thebrooksreunion.com/IDsecure/2f9c9ebb71d52c3d12b94b4ee342591f
-thebrooksreunion.com/IDsecure/2f9c9ebb71d52c3d12b94b4ee342591f/assets/includes
-thebrooksreunion.com/IDsecure/2f9c9ebb71d52c3d12b94b4ee342591f/assets/includes/login.php
-thebrooksreunion.com/IDsecure/2f9c9ebb71d52c3d12b94b4ee342591f/redirect.php
-thebrooksreunion.com/IDsecure/9b695bd11630e9eb40a2de5915933273
-thebrooksreunion.com/IDsecure/9b695bd11630e9eb40a2de5915933273/redirect.php
-theemotionalintellect.com/life/
-thehardshipgift.com/sf/fr-amazon-path
-thepeasantguide.com/web/sun
-thepeasantguide.com/web/sun/cd.php
-thoroughcoaching.com/public/images/testimonial/Adpadpsecurity/adp/
-thoroughcoaching.com/public/images/testimonial/adpsecure/adp/
+teamtelstraaust.sells-it.net/Au/
  tiny.cc/3cutsz
  tiny.cc/6mihnz
  tiny.cc/nlf03y
  tiny.cc/qhdskz
-tinyurl.com/2c2tkwm6/
  tinyurl.com/AtualizacaoCaixaCovid-19
  tinyurl.com/PdfInforSave
  tinyurl.com/r9am6h3
@@ -2123,13 +1687,12 @@ tny.sh/santrest
  tny.sh/share-myfile
  tny.sh/wBXwb4M
  tny.sh/z1iOyHK
-top-b2p-net.com/Swisscom/edb3185b19f5c441badb31aad3cb284b/
+top3petproducts.in/Chub.exe
+toprestdymastertwoix.dns.army/receipmt/svchost.exe
  tr.im/AlertaslBCP
  translate.sogoucdn.com/pcvtsnapshotorigin
-tripayan.com/office/goodpage/goodpage/
  u.nu/2744a
  u.nu/42qil
-u.nu/7y4wh
  u.nu/dvh6r
  u.nu/si426
  u.nu/sxhx2
@@ -2146,9 +1709,11 @@ u.to/ab0RGQ
  u.to/eAnBGQ
  u.to/iwFOGg
  u.to/x9AVFg
+u1297235.cp.regruhosting.ru/bredinfos.online/mad/CorrectBred/__bre/
+u1326645.cp.regruhosting.ru/account
+u1326645.cp.regruhosting.ru/account/login.php
  ucarecdn.com/2a7b935a-1c7f-46e2-a05a-094adb8108a6/myflycodes.exe
-ulikconstruction.my/parcel/dhl/dhl/dhl/dhl/
-unconfirmedpayee-lloydplcs.com/admin
+umbrellaclubla.com/8sf7f57sf687a68sf68dg78d88sf6f7fsfg3dg24gd235dg7hh87hd6g6d6fh7h6fh/Log%20in%20_%20WeTransfer.php
  uqr.to/icvk
  uqr.to/k5ga
  urlz.fr/aE9L
@@ -2192,42 +1757,38 @@ urlz.fr/ei4L
  urlz.fr/eiGH
  urlz.fr/ejHy
  urlz.fr/ekkz
-urmigroup.in/cnm/spapis/
-uservipsapass.com/signim
-uservipsapass.com/signin
-usps.help/redelivery-request/9514901185421/
-usps.work/Redelivery-Request/9514901185421/
-usps.work/Redelivery-Request/9514901185421/usa/
-utentedati.net/info
+usps.ceo/redelivery-request/9514901185421/usa/
+uvulin.com/logs/mbt/cmd-login=61cf5eb82326358e590acc8503fc7194
+uvulin.com/logs/mbt/cmd-login=61cf5eb82326358e590acc8503fc7194/data.php
+uvulin.com/logs/mbt/cmd-login=61cf5eb82326358e590acc8503fc7194/domain.php
+uvulin.com/logs/mbt/cmd-login=61cf5eb82326358e590acc8503fc7194/index.php
+uvulin.com/logs/mbt/cmd-login=61cf5eb82326358e590acc8503fc7194/login.php
+uvulin.com/logs/mbt/cmd-login=98c84ca2a22bef681997849fd13d8927
+uvulin.com/logs/mbt/cmd-login=98c84ca2a22bef681997849fd13d8927/data.php
+uvulin.com/logs/mbt/cmd-login=98c84ca2a22bef681997849fd13d8927/domain.php
+uvulin.com/logs/mbt/cmd-login=98c84ca2a22bef681997849fd13d8927/index.php
+uvulin.com/logs/mbt/cmd-login=98c84ca2a22bef681997849fd13d8927/login.php
  v.gd/eoauYu
  v.ht/7pzM
-vapourblastingnyc.com/new/daum
-vapourblastingnyc.com/new/daum/index.html
-view-icloud-id-lnfo.live/3/20-69
-vonbarron.com/kevin/Koder/
-vyrogypsy.cf/chemical/chapel/quest/
+verifica-sicurezza-dati-online.com/pesbp080jwd3a7h
+vertuindiamobile.com/d1d5a0a3e6/obline-GOV/gov/
+victotech.com/ddd/DHLL
+victotech.com/ddd/DHLL/u.php
+vietnamimages.vn/G70935c13e314c679/
+villela.org/tudo/particuliers/acceder-a-mes-comptes/cre-dit/agr-i/cole/acces-cr/402af442d27a8e12a82ee756b28d2d47
+villela.org/tudo/particuliers/acceder-a-mes-comptes/cre-dit/agr-i/cole/acces-cr/402af442d27a8e12a82ee756b28d2d47/card.php
+villela.org/tudo/particuliers/acceder-a-mes-comptes/cre-dit/agr-i/cole/acces-cr/402af442d27a8e12a82ee756b28d2d47/log.php
+villela.org/tudo/particuliers/acceder-a-mes-comptes/cre-dit/agr-i/cole/acces-cr/402af442d27a8e12a82ee756b28d2d47/mail.php
+villela.org/tudo/particuliers/acceder-a-mes-comptes/cre-dit/agr-i/cole/acces-cr/402af442d27a8e12a82ee756b28d2d47/mail2.php
+villela.org/tudo/particuliers/acceder-a-mes-comptes/cre-dit/agr-i/cole/acces-cr/402af442d27a8e12a82ee756b28d2d47/otp.php
+villela.org/tudo/particuliers/acceder-a-mes-comptes/cre-dit/agr-i/cole/acces-cr/402af442d27a8e12a82ee756b28d2d47/sms.php
  wa.me/260979441405
-webfamily.com.br/findcred.com.br/.well-known/acme-challenge/simple-infomation-contacte
-webmail.hautot-communication.fr/exchweb/bin/auth/owalogon.asp
-webmail.marininter.9services.com/exchweb/bin/auth/owalogon.asp
-westconsumernews.com/www/message.globalsource.com
-westconsumernews.com/www/message.globalsource.com/index.php
-whatsapp.blazagency.com/2a25aeb938002e10829c5d76c098e8eb
-whatsapp.blazagency.com/2a25aeb938002e10829c5d76c098e8eb/billing.html
-whatsapp.blazagency.com/71d11f8cdb38ac17a911f524a01521d2
-whatsapp.blazagency.com/71d11f8cdb38ac17a911f524a01521d2/billing.html
-windocyte.com/eur
-windocyte.com/eur/login
-woning-verzoek.ml/ing
-woning-verzoek.ml/rabo
-wyus3yvus3yijytmlclsplmqs4-adwhj77lcyoafdy-www-paypal-com.translate.goog/us/home
-xiaofangzhongkong.com/twitter_/p2h5555
-xmobile24hra.com/Inicio
-yaqoobi.org/smd.rchn
-yaqoobi.org/smd.rchn/profile.php
-yelowinc.com/umn/spapis/
-yhfdossary.com/link
-zimbrute.ml/zinc/session/reps/
-zinxino.com/ph/ftt/ssu
-zinxino.com/ph/ftt/ssu/singledrv.php
+webmail.gaianets.com/~connectw/verifiled
+webmail.gaianets.com/~connectw/verifiled/login.php
+webmail.ssecurenet.com/yt
+webmail.ssecurenet.com/yt/login.php
+xj150.cn/signim/
+xj150.cn/signin/
+yamiitsolutions.com/chase
+yamiitsolutions.com/chase/firstlog.php
  zonehmirrors.org/defaced/2019/09/11/magazinepromo.net/magazinepromo.net/
author	Travis CI User <travis@example.org>
	Sat, 20 Mar 2021 04:32:06 +0000 (04:32 +0000)
committer	Travis CI User <travis@example.org>
	Sat, 20 Mar 2021 04:32:06 +0000 (04:32 +0000)
README.md		patch \| blob \| blame \| history
blacklists/README		patch \| blob \| blame \| history
blacklists/adult/domains		patch \| blob \| blame \| history
blacklists/adult/urls		patch \| blob \| blame \| history
blacklists/malware/domains		patch \| blob \| blame \| history
blacklists/malware/urls		patch \| blob \| blame \| history