Automatic blacklist update

author Travis CI User <travis@example.org>

Wed, 17 Feb 2021 04:15:38 +0000 (04:15 +0000)

committer Travis CI User <travis@example.org>

Wed, 17 Feb 2021 04:15:38 +0000 (04:15 +0000)
author Travis CI User <travis@example.org>
Wed, 17 Feb 2021 04:15:38 +0000 (04:15 +0000)
committer Travis CI User <travis@example.org>
Wed, 17 Feb 2021 04:15:38 +0000 (04:15 +0000)
diff --git a/README.md b/README.md

index 2d484e544aec7c0bba47e4b15046bdde9d5525b1..88372b7c4173cb756c169dfa5714b5322e8c1b09 100644 (file)
--- a/README.md
+++ b/README.md
@@ -6,7 +6,7 @@ __Note__: this repository is only intended to mirror lists, to modify/update the
  ## Lists
  | Name | Size | Description |
  |:-----|:-----|:------------|
-| [adult](blacklists/adult) | 2916502 | Some adult site from erotic to hard pornography |
+| [adult](blacklists/adult) | 2916817 | Some adult site from erotic to hard pornography |
  | [agressif](blacklists/agressif) | 384 | Some aggressive sites |
  | [arjel](blacklists/arjel) | 69 | ARJEL which is a french certification authority for gambling sites |
  | [associations_religieuses](blacklists/associations_religieuses) | 1 | religious_association |
@@ -39,7 +39,7 @@ __Note__: this repository is only intended to mirror lists, to modify/update the
  | [jobsearch](blacklists/jobsearch) | 386 | Site to looking for job |
  | [lingerie](blacklists/lingerie) | 83 | Sites for lingerie |
  | [liste_bu](blacklists/liste_bu) | 2881 | A french list for educational sites. VERY locally oriented. may help libraries |
-| [malware](blacklists/malware) | 289654 | Any website which deliver malware |
+| [malware](blacklists/malware) | 288322 | Any website which deliver malware |
  | [manga](blacklists/manga) | 779 | Any website related to manga, and cartoons |
  | [marketingware](blacklists/marketingware) | 28 | Very special marketing sites |
  | [mixed_adult](blacklists/mixed_adult) | 152 | Websites which contains adult sections unstructured |
diff --git a/blacklists/README b/blacklists/README

index 682afa50fa5aecef9d33ccef5ec8e6abbb5997cb..e558430a5b54e1fad8a02508f1b4a6fc951d3879 100644 (file)
--- a/blacklists/README
+++ b/blacklists/README
@@ -41,7 +41,7 @@ adult.tar.gz          is a list of adult sites. They are based on
                                          Symon Aked
                                          Todd Sieland-Peterson
  
-Last version Monday 15 February 2021 with 2844291 domains and 72211 urls : 12300 Kb.
+Last version Tuesday 16 February 2021 with 2844493 domains and 72324 urls : 12304 Kb.
                         
  
  OTHER :
diff --git a/blacklists/adult/domains b/blacklists/adult/domains

index b3bb4e6eff7832b610007cdef7cf9c86db4b8477..52470c141c7fa473e6e3f3832bde864d099a3ee9 100644 (file)
--- a/blacklists/adult/domains
+++ b/blacklists/adult/domains
@@ -15985,6 +15985,7 @@
  175.8.41.237
  175.8.61.45
  17551.agoxa.com
+17553.blogspot.com
  1758681625.rsc.cdn77.org
  176.107.183.52
  176.111.60.55
@@ -70568,6 +70569,7 @@
  24hnonstop.com
  24homeporn.com
  24horassex.com
+24hotsexy.blogspot.com
  24hour-transsexualphonesex.com
  24hour.dk
  24hourgirlfriends.com
@@ -134194,6 +134196,7 @@ a-a-teens-dildosex.da.ru
  a-a1absoluteperfect10.com
  a-a5a5.000webhostapp.com
  a-ab.com
+a-acompanhantes-travestis.blogspot.com
  a-adult-costumes.com
  a-adult-porn.blogspot.ae
  a-adult-porn.blogspot.al
@@ -137211,6 +137214,7 @@ aardigsletterig.startspot.nl
  aardon.de
  aarenmathis.tumblr.com
  aarens.com
+aaretha1144.blogspot.com
  aarhusbabes.dk
  aarielle.com
  aarin.blogspot.ae
@@ -151195,6 +151199,7 @@ adakah123kontolanjim.000webhostapp.com
  adalbertobrito.weebly.com
  adaletbagdu.com
  adalimmigrations.com
+adalin18.info
  adaliska.com
  adalogtqlwfnyqio-dot-millinium.ey.r.appspot.com
  adalus.tumblr.com
@@ -165143,6 +165148,7 @@ adult-poopy-diaper.blogspot.tw
  adult-poopy-diaper.blogspot.ug
  adult-porn-blog.com
  adult-porn-blogs.co.uk
+adult-porn-clip.blogspot.com
  adult-porn-directory.org
  adult-porn-dvd.com
  adult-porn-film-clips.com
@@ -168332,6 +168338,7 @@ adult-web-site.net
  adult-web-solutions.num-1.com
  adult-web-templates.com
  adult-web.co.uk
+adult-web.com
  adult-web.net
  adult-webcam-asian-girls.tumblr.com
  adult-webcam-chat-secret.yoy-search.com
@@ -182067,6 +182074,7 @@ adultpicture.blogspot.tw
  adultpicture.blogspot.ug
  adultpictures.co.uk
  adultpictures.com
+adultpicturexxxdildoedild.blogspot.com
  adultpicworld.com
  adultpicxxx.com
  adultpig.com
@@ -195014,6 +195022,7 @@ aftermidnightstore.com
  afternoonsex.com
  afternoontube.com
  aftero.temp.swtest.ru
+afterrape.com
  afterschoolsex.com
  aftersex-o-gram.tumblr.com
  aftershutter.tumblr.com
@@ -203132,6 +203141,7 @@ akhcuceimkljohd.blogspot.tw
  akhcuceimkljohd.blogspot.ug
  akhen.xyz
  akhenza.com
+akhialamgirmudefakes.blogspot.com
  akhilajay.com
  akhilautismfoundation.org
  akhilkumar.mywebdesigner.co.in
@@ -207019,6 +207029,7 @@ alecjmjovarxe.blogspot.tw
  alecjmjovarxe.blogspot.ug
  alecleu.tumblr.com
  alectra.com
+alectransy.tumblr.com
  alectraplaygrounds.blogspot.ae
  alectraplaygrounds.blogspot.al
  alectraplaygrounds.blogspot.am
@@ -254877,6 +254888,7 @@ amatuervids.blogspot.ug
  amatuervids.net
  amatuerwebcams.com
  amatuerwebcams.net
+amatuerwifevideos.blogspot.com
  amatuerwifey.tumblr.com
  amatuerwives.net
  amatueurporn.com
@@ -266056,6 +266068,7 @@ amp.localxh3.com
  amp.pornahikayeleri.com
  amp.xhamster10.com
  amp.xhamster15.com
+amp.xhamster31.com
  amp.xhamster7.desi
  amp69.com
  ampafrica.com
@@ -266799,6 +266812,7 @@ amwltd.com
  amwstg.efserver.net
  amx.com.br
  amx2.com
+amxorion.com
  amxricxnasrepro.com
  amxsupporrt.com
  amxvideo.com
@@ -276822,6 +276836,7 @@ analvidz.net
  analvillage.com
  analviolated.com
  analviolated.net
+analvirgin.blogspot.com
  analvirgins.tumblr.com
  analvirgins.us
  analvixen.tumblr.com
@@ -295296,6 +295311,7 @@ annomxz.aomvxzwc.jdslxz.52shuangfushui.com
  annonay.my-dictionary.eu
  annonce-bdsm.com
  annonce-coquine.fr
+annonce-coquines.blogspot.com
  annonce-cougar-sans-inscription.blogspot.ae
  annonce-cougar-sans-inscription.blogspot.al
  annonce-cougar-sans-inscription.blogspot.am
@@ -299263,6 +299279,7 @@ antiaging-by.beautifulveganskin.com
  antiaginghealthbenefits.com
  antianime.pitas.com
  antianton1981.tumblr.com
+antiboise-optique.fr
  antibot-pw.com
  anticcolonial.cf
  antichavez.ven.nu
@@ -307004,6 +307021,7 @@ approachingstorm.blogspot.sn
  approachingstorm.blogspot.tw
  approachingstorm.blogspot.ug
  approche-du-sexe.kouzin.com
+appropriategayboy.blogspot.com
  appropriately-inappropriate.tumblr.com
  appropriatelyselfish.com
  appropriateneeds.tumblr.com
@@ -310438,6 +310456,7 @@ ardonis.nl
  ardorasia.com
  ardorinterior.tumblr.com
  ardorist.tumblr.com
+ardorotica.com
  ardorx.com
  ardoryshow.com
  ardos.com.br
@@ -327287,6 +327306,7 @@ asian-ladies.com
  asian-ladyboy-blog-deactivated2.tumblr.com
  asian-ladyboy-blog.tumblr.com
  asian-ladyboy-links.com
+asian-ladyboy-porn.blogspot.com
  asian-ladyboy.biz
  asian-ladyboy.fblogs.com
  asian-ladyboy.net
@@ -340116,6 +340136,7 @@ asiloalpago.it
  asiluxury.com
  asimaprima.com
  asimglobaltraders.com
+asimina.ro
  asimo.de
  asimplegirl.net
  asimpleslavewrites.blogspot.ae
@@ -348106,6 +348127,7 @@ asucker4ahotman.tumblr.com
  asuckmybabyplease.tumblr.com
  asudavetiye.com
  asue-dot-work-document.appspot.com
+asufo6342008.blogspot.com
  asuka1984.tumblr.com
  asuldrews.xyz
  asuna-securiter.hmsw.eu
@@ -349653,6 +349675,7 @@ athis-mons-pouffiasse.blogspot.sn
  athis-mons-pouffiasse.blogspot.tw
  athis-mons-pouffiasse.blogspot.ug
  athleet92.tumblr.com
+athlete-female-nude.blogspot.com
  athletecentral.tumblr.com
  athletes-naked.blogspot.ae
  athletes-naked.blogspot.al
@@ -363978,6 +364001,7 @@ ayannaotykyqy.blogspot.sk
  ayannaotykyqy.blogspot.sn
  ayannaotykyqy.blogspot.tw
  ayannaotykyqy.blogspot.ug
+ayannaviospu.blogspot.com
  ayanneachterhaarlivecam.blogspot.ae
  ayanneachterhaarlivecam.blogspot.al
  ayanneachterhaarlivecam.blogspot.am
@@ -365986,6 +366010,7 @@ b36fd433d0f62fa7c753263db51708e5-dot-dbenitonline.ey.r.appspot.com
  b3auty_qu33n.livejournal.com
  b3c78078.ngrok.io
  b3cc381d.com
+b3d33s3m.tumblr.com
  b3dsadoadkspadancindvpsdvdsv5r4168j78jdtk74s53dsd283j0f32mcomec.buzz
  b3hindtheveil.tumblr.com
  b3kt.qiuvienr.com
@@ -376906,6 +376931,7 @@ bad1dimagines.tumblr.com
  badabadabingo.com
  badabasket.materialszone.com
  badabima.com
+badabingmaddison.blogspot.com
  badabingphonesex.com
  badabingstrip.com
  badabingstrip.tumblr.com
@@ -383445,6 +383471,7 @@ balidiscovery.com
  baliescorts.net
  baliessentialproperties.com
  balifornia-dreaming.tumblr.com
+balifreesex.blogspot.com
  balimeilitravel.com
  baliplantation.com
  balirichtuban.com
@@ -389619,6 +389646,7 @@ bankelizabethnaked.blogspot.sk
  bankelizabethnaked.blogspot.sn
  bankelizabethnaked.blogspot.tw
  bankelizabethnaked.blogspot.ug
+bankelizabethst.blogspot.com
  bankers.home.ro
  bankert-gemert-bakel-sexcontact.startspot.nl
  bankey.net
@@ -400702,6 +400730,7 @@ bbwsexhookup.com
  bbwsexhost.com
  bbwsexhot.com
  bbwsexhub.com
+bbwsexlife.tumblr.com
  bbwsexmov.com
  bbwsexmovie.com
  bbwsexmovies.com
@@ -410910,6 +410939,7 @@ beastysexlinks.com
  beastystart.com
  beastythumbs.com
  beastyvideos.com
+beastzone.club
  beastzoo.org
  beasy32.tumblr.com
  beasybd.com
@@ -421213,6 +421243,7 @@ belgiangays.tumblr.com
  belgianhairylovergay.tumblr.com
  belgianmodel.be
  belgianmodel.nl
+belgianmusiconline.be
  belgianpornaddict.tumblr.com
  belgiansex.sucks.nl
  belgie-escort-profielen.startspot.nl
@@ -448185,6 +448216,7 @@ bhamdemo.com
  bhamfistboy.tumblr.com
  bhamfistby.tumblr.com
  bhampanty.tumblr.com
+bhamspanking.blogspot.com
  bhandaraexpress.com
  bhaneef.tumblr.com
  bhanu.vetgat.com
@@ -464934,6 +464966,7 @@ bigmommaslittleboy.tumblr.com
  bigmommytube.com
  bigmomsporn.com
  bigmomtube.com
+bigmomvideo.com
  bigmonsterboobs.com
  bigmonstercock.tumblr.com
  bigmonstercockgifs.tumblr.com
@@ -465728,6 +465761,7 @@ bignaturaltitsrk.blogspot.sk
  bignaturaltitsrk.blogspot.sn
  bignaturaltitsrk.blogspot.tw
  bignaturaltitsrk.blogspot.ug
+bignaturaltitsteenwebcams.blogspot.com
  bignaturaltitties.net
  bignazicock.tumblr.com
  bignblonde.com
@@ -470859,6 +470893,7 @@ bikini-beauty.blogspot.sk
  bikini-beauty.blogspot.sn
  bikini-beauty.blogspot.tw
  bikini-beauty.blogspot.ug
+bikini-bikini-vid.blogspot.com
  bikini-bikini-xxx.tumblr.com
  bikini-bilder.de
  bikini-bitches.com
@@ -488603,6 +488638,7 @@ blackgirlssexvideo.net
  blackgirlssexvideos.com
  blackgirlsthatneedmoney.com
  blackgirlsvevo.tumblr.com
+blackgirlswantsex.tumblr.com
  blackgirlswhitecocks.com
  blackgirlswhiteguys.tumblr.com
  blackgirlswholovewhitecock.tumblr.com
@@ -503270,6 +503306,7 @@ blonde4phonesex.com
  blonde_teen_shaved_pussy.bzs.es
  blondeamazon.com
  blondeambition.com
+blondeanaldrilling.blogspot.com
  blondeanalsex.com
  blondeandboobs.tumblr.com
  blondeandbusty.com
@@ -518971,6 +519008,7 @@ bondage-transvestite.tumblr.com
  bondage-tube.org
  bondage-tubes.com
  bondage-video-clips.com
+bondage-video.blogspot.com
  bondage-video.com
  bondage-video.tinusi.com
  bondage-videos-1741.blogspot.ae
@@ -530818,6 +530856,7 @@ bornslave.blogspot.tw
  bornslave.blogspot.ug
  bornslave.tumblr.com
  bornthisgayyy.tumblr.com
+borntobeabitch.com
  borntobebound.com
  borntobebreed.tumblr.com
  borntobegay.com
@@ -550249,6 +550288,7 @@ brendingo.tumblr.com
  brenditasissy.tumblr.com
  brendon.tv
  brendonboyduriesexualfrustration.tumblr.com
+breneaksolesthecanon.blogspot.com
  brennaksanpey.blogspot.ae
  brennaksanpey.blogspot.al
  brennaksanpey.blogspot.am
@@ -554775,6 +554815,7 @@ britney-sex-tape-video.blogspot.tw
  britney-sex-tape-video.blogspot.ug
  britney-sex.com
  britney-sex.de
+britney-spear-in-porn.blogspot.com
  britney-spears-comics.com
  britney-spears-naked-pics5900.blogspot.ae
  britney-spears-naked-pics5900.blogspot.al
@@ -562215,6 +562256,7 @@ brutalgirls.net
  brutalgirlz.com
  brutalhardcore.com
  brutalhost.com
+brutalicecaesao.blogspot.com
  brutalinsertions.net
  brutalinvasion.com
  brutalism.com
@@ -562272,6 +562314,7 @@ brutalsexmovies.name
  brutalsexpics.com
  brutalshemales.net
  brutalshow.com
+brutalsluts.com
  brutalspanking.com
  brutalspankings.com
  brutalteens.com
@@ -607623,6 +607666,7 @@ capatectfr.nckifrance.gdn
  capbvs.org
  capcanli.com
  capcella.com
+capcocksr.blogspot.com
  capcomkorea.com
  capdagde.startkabel.nl
  capdagdedating.com
@@ -639935,6 +639979,7 @@ celebritynudecentury.blogspot.sn
  celebritynudecentury.blogspot.tw
  celebritynudecentury.blogspot.ug
  celebritynudeclips.net
+celebritynudefake.blogspot.com
  celebritynudegif.tumblr.com
  celebritynudeking.com
  celebritynudemovie.com
@@ -675534,6 +675579,7 @@ chinesekisses.com
  chineselive.com
  chineselivesex.com
  chineselovelinks.com
+chinesemalaysiancpl.blogspot.com
  chinesemilf.com
  chinesemilf1.tumblr.com
  chinesen.com
@@ -691041,6 +691087,7 @@ claudia-telefonsex-live.de
  claudia.blogs.fr
  claudia.com.au
  claudia4you.com
+claudiabites.blogspot.com
  claudiablackphoto.blogspot.ae
  claudiablackphoto.blogspot.al
  claudiablackphoto.blogspot.am
@@ -725043,6 +725090,7 @@ constaredgf.com
  constefellations.tumblr.com
  constellationtube.com
  consteructasur.gq
+constitstecl.blogspot.com
  constitulation.com
  constitutionalaz.tumblr.com
  constitutionclass.tumblr.com
@@ -742015,6 +742063,7 @@ cporn.net
  cporn.org
  cporn.xyz
  cpornfree.com
+cpornographietrannyu.blogspot.com
  cporns.com
  cpourgolri.fr
  cpourlavie.over-blog.com
@@ -747903,6 +747952,7 @@ creampiesurprise.com
  creampiesworld.com
  creampieteen.com
  creampieteen.net
+creampieteenmassage.blogspot.com
  creampieteens.com
  creampieteensporn.com
  creampiethai.com
@@ -752731,6 +752781,7 @@ crossfitcsg.com
  crossfitheimdall.com
  crossfitlouvre.fr
  crossfitpassofundo.com.br
+crossgay.blogspot.com
  crossgay.tumblr.com
  crosshemale.tumblr.com
  crossingblackcat15.tumblr.com
@@ -765961,6 +766012,7 @@ cummander.com
  cummasseater-deactivated2015032.tumblr.com
  cummasseater.tumblr.com
  cummatmeh.tumblr.com
+cummaturesex.com
  cummaturetube.com
  cummbunny.tumblr.com
  cummcumblr.tumblr.com
@@ -767316,6 +767368,7 @@ cumsexvideos.com
  cumsg.com
  cumsh0ts-cumsh0ts-cumsh0ts.tumblr.com
  cumshaker.tumblr.com
+cumshed.tumblr.com
  cumshitpig.tumblr.com
  cumshoot.com
  cumshoot.net
@@ -769005,6 +769058,7 @@ cumslut-heaven.tumblr.com
  cumslut-kirsten.tumblr.com
  cumslut-vegan.tumblr.com
  cumslut.com
+cumslut.me
  cumslut.webjump.com
  cumslut100.tumblr.com
  cumslut123.tumblr.com
@@ -776350,6 +776404,7 @@ cuteypies.com
  cuteypsilon.com.ru
  cutginger.tumblr.com
  cutguy87.tumblr.com
+cuthbertelishafake.blogspot.com
  cuthbertelishafoto.blogspot.ae
  cuthbertelishafoto.blogspot.al
  cuthbertelishafoto.blogspot.am
@@ -781576,6 +781631,7 @@ d0c321.com
  d0e53b69c5b17e14b098c28c56d0e98c0c7c5.net
  d0ff1d6e7b3a288b592bf0a59f54e712.webredirect.org
  d0g.de
+d0g.dog
  d0i3s43.bluretz.info
  d0lphin1337.xyz
  d0mb.addroits.com
@@ -800768,6 +800824,7 @@ darwinwwculcf.blogspot.tw
  darwinwwculcf.blogspot.ug
  darxx.tumblr.com
  daryalisa.tumblr.com
+darylcarmel3439.blogspot.com
  darylffrigtzh.blogspot.ae
  darylffrigtzh.blogspot.al
  darylffrigtzh.blogspot.am
@@ -855461,6 +855518,7 @@ disney--porn--pic.blogspot.ug
  disney-anime.com
  disney-cartoons.com
  disney-hentai.psl.lt
+disney-land-porn.blogspot.com
  disney-lostgirl.tumblr.com
  disney-porn-blog.com
  disney-porn-cartoon.com
@@ -863515,6 +863573,7 @@ dom13kus.tumblr.com
  dom1964.tumblr.com
  dom2949.tumblr.com
  dom2photo.ru
+dom2sait.ru
  dom4both.tumblr.com
  dom4femsissy.tumblr.com
  dom4jocks.tumblr.com
@@ -873405,6 +873464,7 @@ downblouse.com
  downblouse.it
  downblouse.over-blog.com
  downblouse.us
+downblouse.wtf
  downblouseamateur.com
  downblousebabes2.tumblr.com
  downblouseblog.com
@@ -873651,6 +873711,7 @@ download-free-paris-hilton-video.blogspot.tw
  download-free-paris-hilton-video.blogspot.ug
  download-free-porn-movie.org
  download-free-porn-movies.co.uk
+download-free-porn.adultsites.club
  download-free-porn.tumblr.com
  download-free-sex-movie.org
  download-free-sex-movies.com
@@ -880132,6 +880193,7 @@ drewandpepe.blogspot.sk
  drewandpepe.blogspot.sn
  drewandpepe.blogspot.tw
  drewandpepe.blogspot.ug
+drewbarrymorebreast.blogspot.com
  drewbarrymoreonline.net
  drewblydoo.tumblr.com
  drewbottoms.tumblr.com
@@ -895803,6 +895865,7 @@ easylives.com
  easylove.fr
  easylover6.tumblr.com
  easyman.tumblr.com
+easyman0815.blogspot.com
  easymatures.com
  easymaturewomen.com
  easymec.com
@@ -901160,6 +901223,7 @@ ebuffer.com
  ebulo.pw
  ebumamu.com
  ebun.275mb.com
+ebureg7072008.blogspot.com
  ebureherly.com
  ebusinessexpo.nl
  ebutx.com
@@ -923684,6 +923748,7 @@ emily-addison.net
  emily-alyssa-kate.tumblr.com
  emily-fuckdoll.tumblr.com
  emily-model.com
+emily-proctor-pem-blog.tumblr.com
  emily-sweet-pic.blogspot.ae
  emily-sweet-pic.blogspot.al
  emily-sweet-pic.blogspot.am
@@ -927980,6 +928045,7 @@ emz-international.com
  emzaluvbaby.tumblr.com
  en-8yil-cekilisim.com
  en-account-user-locked.gleeze.com
+en-amp.erkiss.club
  en-appleid.com
  en-appleid.servehalflife.com
  en-appleld-page-login-feedback.wokmfqqz.com
@@ -960123,6 +960189,7 @@ escorte.free.fr
  escorte75.free.fr
  escorteam.com
  escorteboy.free.fr
+escortecom.tumblr.com
  escortedames.be
  escortedelux.com
  escortee-homme.blogspot.ae
@@ -960972,6 +961039,7 @@ escortparis-nicollemiller.com
  escortparis.canalblog.com
  escortpariscanne.canalblog.com
  escortparisgirl.com
+escortparisgirls.com
  escortparislyon.canalblog.com
  escortpictures.com
  escortplanet.maakjestart.nl
@@ -962952,6 +963020,7 @@ espace-mobile-compte.webnode.com.co
  espace-plaisir.com
  espace-plaisir.fr
  espace-porno-sexe.com
+espace-reliance-ressources.fr
  espace-rencontre.com
  espace-serviceclint.cf
  espace-sexe.com
@@ -965694,6 +965763,7 @@ estheruxlungf.blogspot.ug
  esthesis.tumblr.com
  estheticnude.tumblr.com
  esthetics.co.kr
+esthetique-conception-blog.blogspot.com
  esthetisexe.ifrance.com
  esthetisexe.multimania.com
  esticboig.com
@@ -1001381,6 +1001451,7 @@ fandomsandbroadway.tumblr.com
  fandomsandcountriesinthetardis.tumblr.com
  fandomsandfeminism.tumblr.com
  fandomshatewomen.tumblr.com
+fandomsmuttt.tumblr.com
  fandomsohard.tumblr.com
  fandomwhoreex.tumblr.com
  fandor.org
@@ -1019361,6 +1019432,7 @@ femalesubmissive.com
  femalesuperiority.com
  femalesupremacy.com
  femalesupremacycaptions.tumblr.com
+femalesupremacyqueens.blogspot.com
  femalesupreme.tumblr.com
  femaletatoos.com
  femaleteacher.phpbbx.de
@@ -1021753,6 +1021825,7 @@ femdomgroup.com
  femdomgroup.tumblr.com
  femdomhard.com
  femdomhardcore.com
+femdomhd.org
  femdomhentai.net
  femdomhost.com
  femdomhotwife-cuckoldpussyboy.tumblr.com
@@ -1031764,6 +1031837,7 @@ fetishfashioncanada.com
  fetishfashionvictim.tumblr.com
  fetishfavorites.tumblr.com
  fetishfeetures.com
+fetishfemale.blogspot.com
  fetishfemale.com
  fetishfemales.tumblr.com
  fetishfemdom.com
@@ -1033643,6 +1033717,7 @@ fetishtime.tumblr.com
  fetishtimes.com
  fetishtip.net
  fetishtips.nl
+fetishtoenakedlatinasxxxin.blogspot.com
  fetishtonight.com
  fetishtool.com
  fetishtoon.com
@@ -1038708,6 +1038783,7 @@ filmdecul.fr
  filmdecul.tv
  filmdeporno.net
  filmdesexe.canalblog.com
+filmdesexelaplage.blogspot.com
  filmdewasanovpn0183.2waky.com
  filmdewasanovpn074.qhigh.com
  filmdewasanovpn075.zyns.com
@@ -1046881,6 +1046957,7 @@ fistingbrazil.tumblr.com
  fistingcamgirls.com
  fistingcapetown.tumblr.com
  fistingcast.com
+fistingcentral.blogspot.com
  fistingcentral.com
  fistingcinema.com
  fistingclub.pl
@@ -1068583,6 +1068660,7 @@ fr.url.org
  fr.watchcheapprice.com
  fr.wikaba.com
  fr.xtratubexxx.com
+fr.xvix.eu
  fr.xwidetube.com
  fr0001.unblog.fr
  fr0002.unblog.fr
@@ -1074352,6 +1074430,7 @@ free-anal-sex.cx
  free-anal-sex.net
  free-anal-sex.org
  free-anal-sex.ws
+free-anal-video.blogspot.com
  free-anal-vids.net
  free-analsex-pics.com
  free-analsex-s.com
@@ -1083125,6 +1083204,7 @@ free-pictures-sexy-babes.com
  free-pictures-sexy-links.bds0d.com
  free-pictures.net
  free-pill.com
+free-piss-drinking6060.blogspot.com
  free-piss-drinking6482.blogspot.ae
  free-piss-drinking6482.blogspot.al
  free-piss-drinking6482.blogspot.am
@@ -1087645,6 +1087725,7 @@ free-sex-photo.org
  free-sex-photoes.com
  free-sex-photos-pics.com
  free-sex-photos-porn-pics.com
+free-sex-photos-pornstar-pics.tumblr.com
  free-sex-photos-xxx.com
  free-sex-photos.alpol.com
  free-sex-photos.co.uk
@@ -1101628,6 +1101709,7 @@ freelady.host.sk
  freeladyboy.net
  freeladyboygalleries.com
  freeladyboypics.net
+freeladyboypictures.com
  freeladyboypornpics.com
  freeladyboysexpics.com
  freeladyboyshdtube.com
@@ -1127985,6 +1128067,7 @@ fuckinglikeagentleman.tumblr.com
  fuckinglikebunnies.tumblr.com
  fuckinglink.com
  fuckinglinks.info
+fuckinglittlewhores.tumblr.com
  fuckinglive.com
  fuckinglivesex.com
  fuckinglolita.com
@@ -1141259,6 +1141342,7 @@ fut91ga.com
  futa-and-hentaii.tumblr.com
  futa-and-shemale.tumblr.com
  futa-apples.tumblr.com
+futa-caption.tumblr.com
  futa-chaser.tumblr.com
  futa-fucka.tumblr.com
  futa-futa-futa.tumblr.com
@@ -1177698,6 +1177782,7 @@ gaymz-homofield.tumblr.com
  gayn8v.tumblr.com
  gaynakatherinescully.tumblr.com
  gaynakedguys.com
+gaynakedhairymen.blogspot.com
  gaynakedmansly.tumblr.com
  gaynakedmen.com
  gaynakednudist.tumblr.com
@@ -1207285,6 +1207370,7 @@ girlkissgirl.tumblr.com
  girlkissingporn.com
  girlknewyork.tumblr.com
  girlksenia.tumblr.com
+girll-blonde-escorte.blogspot.com
  girll.en.wanadoo.es
  girllemmetellyou.tumblr.com
  girllesb.tumblr.com
@@ -1212284,6 +1212370,7 @@ girlsformatures.com
  girlsformen.com
  girlsformyspace.com
  girlsforoldmen.com
+girlsforonlinesexdating.tumblr.com
  girlsforphone.com
  girlsforsex.com
  girlsforsex.net
@@ -1221487,6 +1221574,7 @@ gloryholeuk.com
  gloryholeupdate.com
  gloryholevideos.com
  gloryholevidz.com
+gloryholevoyeurstube.tumblr.com
  gloryholewhores-deactivated2014.tumblr.com
  gloryholewhores.com
  gloryholewhores.tumblr.com
@@ -1261776,6 +1261864,7 @@ handsomeguys.com
  handsomeguysdaily.tumblr.com
  handsomelyhung.tumblr.com
  handsomemenonly.tumblr.com
+handsomenakedhunks.blogspot.com
  handsomesexydaddies.tumblr.com
  handsomeshyguy.tumblr.com
  handsometoulousain.tumblr.com
@@ -1267344,6 +1267433,7 @@ hardcore-porno-webcam.de
  hardcore-porno-xxx.com
  hardcore-porno.at
  hardcore-porno.be
+hardcore-porno.blogspot.com
  hardcore-porno.ch
  hardcore-porno.dd.vu
  hardcore-porno.de.gg
@@ -1311342,6 +1311432,7 @@ home-made-amateur.blogspot.tw
  home-made-amateur.blogspot.ug
  home-made-gay-videos.com
  home-made-nude-pics-submits.tumblr.com
+home-made-porn-came-insid-pussy.blogspot.com
  home-made-porn-movies.com
  home-made-porn.net
  home-made-sex-tapes.hi5.com
@@ -1375905,6 +1375996,7 @@ hotz3skinnyz3ass.blogspot.sk
  hotz3skinnyz3ass.blogspot.sn
  hotz3skinnyz3ass.blogspot.tw
  hotz3skinnyz3ass.blogspot.ug
+hotz4asianz4teacher.blogspot.com
  hotzephyer.tumblr.com
  hotzeshowerzesex.blogspot.ae
  hotzeshowerzesex.blogspot.al
@@ -1390684,6 +1390776,7 @@ i-sexualdesire.tumblr.com
  i-sexvideos.de
  i-sexweb.de
  i-sexy-redhead.tumblr.com
+i-sexyboobs-love.tumblr.com
  i-share-my-girlfriend.tumblr.com
  i-shemale.com
  i-shot-myself.tumblr.com
@@ -1409726,6 +1409819,7 @@ indian-sex.org
  indian-sex.ws
  indian-sex1.com
  indian-sexpictures.com
+indian-sexy-girlz.blogspot.com
  indian-sexy.tumblr.com
  indian-stories.com
  indian-teen.net
@@ -1438030,6 +1438124,7 @@ ixxxnxx.com
  ixxxphotos.com
  ixxxplorer.com
  ixxxsi.com
+ixxxteen.com
  ixxxtube.co
  ixxxtube8.com
  ixxxvideos.com
@@ -1452568,6 +1452663,7 @@ javtop.fun
  javtopx.com
  javtreasure.com
  javtube.com
+javtubesex.com
  javtv.org
  javuncen.me
  javuncensoredstreaming.blogspot.ae
@@ -1465921,6 +1466017,7 @@ jimcest.tumblr.com
  jimcock33.tumblr.com
  jimcub71.tumblr.com
  jimdad12.tumblr.com
+jimdad2013.blogspot.com
  jimdiamond.tumblr.com
  jimdilylis.tumblr.com
  jimdsblog.tumblr.com
@@ -1481625,6 +1481722,7 @@ julianbrand.de
  julianguzmanabril.com
  julianis.site
  julianisback.tumblr.com
+julianmakesmydickhard.tumblr.com
  juliannetv.tumblr.com
  julianrioscockworship.tumblr.com
  julians-house-of-cock.tumblr.com
@@ -1494413,6 +1494511,7 @@ kastley.co.uk
  kastoy-71.gq
  kastrend.com
  kasturiengineering.in
+kasumi-hardcoree.blogspot.com
  kasumi.joueb.com
  kasumik.com
  kasurleather.com
@@ -1499355,6 +1499454,7 @@ kaylakupcakes.com
  kaylalamphere.tumblr.com
  kaylalords.com
  kaylalouise.com
+kaylani-lei-star.blogspot.com
  kaylanilei.com
  kaylanilei.net
  kaylannicolexxx.com
@@ -1536338,6 +1536438,7 @@ ladyboysasian.blogspot.sn
  ladyboysasian.blogspot.tw
  ladyboysasian.blogspot.ug
  ladyboysasian.tumblr.com
+ladyboysbareback.blogspot.com
  ladyboyscartoons.com
  ladyboysclips.com
  ladyboysclub.com
@@ -1560687,6 +1560788,7 @@ lepremierdrivingschool.com.au
  leprinceofsins.tumblr.com
  leprinceovsins.tumblr.com
  leprivee.es
+leprosys.info
  lepsiporno.cz
  leptionaas.com
  leptitbouillon.be
@@ -1584097,6 +1584199,7 @@ likeknickers.tumblr.com
  likelady.tumblr.com
  likeland.net
  likelegs.com
+likelymanufacfo.blogspot.com
  likelytransient.tumblr.com
  likemarsnsfw.tumblr.com
  likematureporn.com
@@ -1592799,6 +1592902,7 @@ little-gabrielle.tumblr.com
  little-gay-boys.tumblr.com
  little-gay-cupcake.tumblr.com
  little-ginger-bush.tumblr.com
+little-girl-come-here.tumblr.com
  little-girl-koneko.tumblr.com
  little-girl-leash.tumblr.com
  little-girl-loves-her-little-boy.tumblr.com
@@ -1606366,6 +1606470,7 @@ lixmysole.tumblr.com
  lixu69.tumblr.com
  lixzmaz.gq
  liya2002.com
+liyaaburivolybu.blogspot.com
  liybn.ga
  liyjc.com
  liyuemachinery.com
@@ -1640658,6 +1640763,7 @@ magseal.com
  magsinc.com
  magsredrocket.tumblr.com
  magsteve.tumblr.com
+magsxxx.blogspot.com
  magungappsstore.manximanzsu.com
  magusenergia.com.br
  magushose.tumblr.com
@@ -1647411,6 +1647517,7 @@ maleimage.co.uk
  maleinbondage.com
  maleindress.com
  maleinferiority.tumblr.com
+maleinspiration2.blogspot.com
  maleinstructor.tumblr.com
  maleintrigue.com
  malejaduff.com
@@ -1672151,6 +1672258,7 @@ mature-glamour.net
  mature-glory-hole.com
  mature-gloryhole.com
  mature-grannies-min.tumblr.com
+mature-granny-cougar-sex.blogspot.com
  mature-granny-milf.over-blog.com
  mature-granny-milf.tumblr.com
  mature-granny-porn-nude-older-women-xxx-sex-pictures.com
@@ -1674542,6 +1674650,7 @@ mature-underwear.com
  mature-vagina.com
  mature-video-porn.com
  mature-video.com
+mature-videos-d.tumblr.com
  mature-videos-tube.com
  mature-videos.com
  mature-videos.net
@@ -1676841,6 +1676950,7 @@ matureorgiesnow.com
  matureorgy.net
  matureoutdoorsex.com
  matureover30.net
+matureoxbustyoxredhead.blogspot.com
  maturep.com
  maturep.infogami.com
  maturepalace.com
@@ -1683951,6 +1684061,7 @@ mckennittfamily.com
  mckenzeemileshdvideos.tumblr.com
  mckenzie-lee.net
  mckenzie.com.br
+mckenziealex.blogspot.com
  mckenziebelle.com
  mckenziegroves.buzz
  mckenzieleeblog.com
@@ -1687996,6 +1688107,7 @@ meett11.webs.com
  meetthaigirls.com
  meettheghost.tumblr.com
  meettheharrells.com
+meetthehumpers.blogspot.com
  meetup4sex.com
  meetusforsex.com
  meetvisio.net
@@ -1711571,6 +1711683,7 @@ milf-gangbang-bisexuals-orgy-2013.blogspot.sk
  milf-gangbang-bisexuals-orgy-2013.blogspot.sn
  milf-gangbang-bisexuals-orgy-2013.blogspot.tw
  milf-gangbang-bisexuals-orgy-2013.blogspot.ug
+milf-gangbang-masturbation-orgy-2013.blogspot.com
  milf-gangbang-voyeur-webcam-2013.blogspot.ae
  milf-gangbang-voyeur-webcam-2013.blogspot.al
  milf-gangbang-voyeur-webcam-2013.blogspot.am
@@ -1774267,6 +1774380,7 @@ myeroticdiary.blogspot.tw
  myeroticdiary.blogspot.ug
  myeroticdump.tumblr.com
  myeroticfrenchtouch.tumblr.com
+myeroticfun.blogspot.com
  myeroticlifestyle.tumblr.com
  myeroticlingerie.blogspot.ae
  myeroticlingerie.blogspot.al
@@ -1786271,6 +1786385,7 @@ mystraightfriend.tumblr.com
  mystraightpornscout.com
  mystrangekinks.tumblr.com
  mystrangeshit.tumblr.com
+mystrangetfs.blogspot.com
  mystrapfantasy.tumblr.com
  mystraponobsession.tumblr.com
  mystraponporn.tumblr.com
@@ -1787600,6 +1787715,7 @@ mywomanslegs.tumblr.com
  mywomenoftheworld.tumblr.com
  mywomenpeeing.com
  mywonderfullykinkymind.tumblr.com
+mywoodenshoes.tumblr.com
  mywoods.by
  mywordes.com
  myworldatt.weebly.com
@@ -1803222,6 +1803338,7 @@ nastymaturewomen.pbhst.com
  nastymenalways.tumblr.com
  nastymfinbmore76.tumblr.com
  nastymichelle.tumblr.com
+nastymichellecocksucker.blogspot.com
  nastymikefetish.unblog.fr
  nastymilf.xyz
  nastymilf4you.blogspot.ae
@@ -1805235,6 +1805352,7 @@ nation-of-nudes.tumblr.com
  nation-x.com
  nation.wide-payeeverify.com
  nation.widepayee-supports.com
+nationaed.blogspot.com
  national-escorts.co.uk
  national-pornographic.com
  national-pornography.com
@@ -1815325,6 +1815443,7 @@ necocheasol.blogspot.tw
  necocheasol.blogspot.ug
  necoleserotictouch.com
  necomiare.temp.swtest.ru
+neconvert.tumblr.com
  necpng.com
  necqlmeemdddxihy-dot-millinium.ey.r.appspot.com
  necro.us
@@ -1817336,6 +1817455,7 @@ nemasterblog.tumblr.com
  nembhard.tumblr.com
  nembutalpeacefuldeath.com
  nemcosolar.com.au
+nemedianhot-pants.blogspot.com
  nemelyu871.info
  nemesis2.co.uk
  nemesis423.ddns.net
@@ -1837950,6 +1838070,7 @@ no-motherfucka-up-in-here.tumblr.com
  no-name-club.adr.com.ua
  no-name-jane-pornstar.tumblr.com
  no-no-oh-no.tumblr.com
+no-nude-teen.blogspot.com
  no-panties-girl.tumblr.com
  no-panties.com
  no-pants-on.tumblr.com
@@ -1849697,6 +1849818,7 @@ nude-babes.redpufik.ru
  nude-barely-legal-girls.com
  nude-bbw-pics.com
  nude-bbw.com
+nude-beach-babes.blogspot.com
  nude-beach-babes.tumblr.com
  nude-beach-fucking.com
  nude-beach-girls.com
@@ -1854679,6 +1854801,7 @@ nudeblowjobvideos.com
  nudeboatbateaunu.tumblr.com
  nudebodyboy.tumblr.com
  nudebodybuilders.net
+nudebodybuildingclitring.blogspot.com
  nudebodypositive.tumblr.com
  nudebodypublic.blogspot.ae
  nudebodypublic.blogspot.al
@@ -1861152,6 +1861275,7 @@ nudesexyfuckingwet.tumblr.com
  nudesexygalleries.tumblr.com
  nudesexygirls.com
  nudesexygirls.net
+nudesexyladies.tumblr.com
  nudesexyladiespictures.blogspot.ae
  nudesexyladiespictures.blogspot.al
  nudesexyladiespictures.blogspot.am
@@ -1872319,6 +1872443,7 @@ oedipussywrecks.tumblr.com
  oedipuswreckz.tumblr.com
  oeffentlich-erniedrigt.com
  oeffentlicherniedrigt.com
+oeffentlichnackt.blogspot.com
  oeffne.de
  oefhnymxufpyyozg-dot-millinium.ey.r.appspot.com
  oeglum.net
@@ -1876445,6 +1876570,7 @@ olciiakx.tumblr.com
  olcoltyfpiamgrsfhjmnaqnjpa-dot-gloff849483.uk.r.appspot.com
  olcyfuonpczqemow-dot-millinium.ey.r.appspot.com
  olczyk-sex.com
+old-abandoned-building.blogspot.com
  old-adult-dating.blogspot.ae
  old-adult-dating.blogspot.al
  old-adult-dating.blogspot.am
@@ -1883225,6 +1883351,7 @@ one2one.com
  one2onechat.be
  one2sex.nl
  one2sexy.tumblr.com
+one3onelords.blogspot.com
  one44.net
  one4beauty.tumblr.com
  one4sex.de
@@ -1887879,6 +1888006,7 @@ only-playmates.blogspot.sk
  only-playmates.blogspot.sn
  only-playmates.blogspot.tw
  only-playmates.blogspot.ug
+only-pokemon-porn.blogspot.com
  only-porn-links.com
  only-porn-models-here-xxx.tumblr.com
  only-porn-passwords.com
@@ -1900880,6 +1901008,7 @@ ourdirtypanties.com
  ourdirtypleasure.com
  ourdirtysecret1.tumblr.com
  ourdonnagirl.tumblr.com
+oureroticescape.tumblr.com
  oureroticplaytime.tumblr.com
  oureroticsanctuary.tumblr.com
  ourfamilyfun.tumblr.com
@@ -1913162,6 +1913291,7 @@ panthersnake.blogspot.sn
  panthersnake.blogspot.tw
  panthersnake.blogspot.ug
  panthydefi.canalblog.com
+pantie-bulge.blogspot.com
  pantie-cum.xprv.com
  pantie-fan101.tumblr.com
  pantie-fetish-freak.tumblr.com
@@ -1916288,6 +1916418,7 @@ pantypoopinglove.tumblr.com
  pantypoopingstories-blog.tumblr.com
  pantypoopingstories.tumblr.com
  pantypooplover.tumblr.com
+pantypooplover112.tumblr.com
  pantypops.com
  pantyporn.com
  pantypornblog.com
@@ -1963632,6 +1963763,7 @@ pinkmonkeystl.tumblr.com
  pinkmotel.com
  pinkmoviepost.com
  pinkmovies.nl
+pinkmovies.xyz
  pinkmovs.com
  pinkmystery.com
  pinknavi.com
@@ -1964103,6 +1964235,7 @@ pinkylicious.com
  pinkylovers.hi-y.net
  pinkyoung.com
  pinkypeckers.com
+pinkypeggy.com
  pinkypercy.tumblr.com
  pinkypics.com
  pinkypinkpinklove.tumblr.com
@@ -1971872,6 +1972005,7 @@ planestripper.tumblr.com
  planet-black.com
  planet-charme.fr
  planet-cybersex.nl
+planet-earth-dvddgubpelelp.blogspot.com
  planet-ecchi.tumblr.com
  planet-erotica.tumblr.com
  planet-escort.com
@@ -1985012,6 +1985146,7 @@ popcornsex.com
  popcornzone.best
  popcporn.com
  popcrunch.com
+popculturecantina.blogspot.com
  popculturepundit.blogspot.ae
  popculturepundit.blogspot.al
  popculturepundit.blogspot.am
@@ -2008104,6 +2008239,7 @@ porn18.biz
  porn18.co
  porn18.com
  porn18.net
+porn180.me
  porn183.blogspot.ae
  porn183.blogspot.al
  porn183.blogspot.am
@@ -2009976,6 +2010112,7 @@ pornaction.de
  pornaction.net
  pornaction18.com
  pornactions.com
+pornactive.blogspot.com
  pornactor.com
  pornactors.com
  pornactors.tumblr.com
@@ -2020221,6 +2020358,7 @@ pornivore.blogspot.sn
  pornivore.blogspot.tw
  pornivore.blogspot.ug
  pornivore.com
+porniwank.com
  pornix.fr
  pornix.net
  pornixo.com
@@ -2050411,6 +2050549,7 @@ pornrealm.org
  pornrealms.com
  pornrealstars.com
  pornrealteen.com
+pornreaper.blogspot.com
  pornreaper.com
  pornreaper.net
  pornrebates.com
@@ -2051167,6 +2051306,7 @@ pornsec.net
  pornsecret.net
  pornsecrets.com
  pornsecrets.org
+pornsecretstogreatsex.blogspot.com
  pornsect.com
  pornsection.com
  pornsector.com
@@ -2054900,6 +2055040,7 @@ pornstargalerymaid.blogspot.sk
  pornstargalerymaid.blogspot.sn
  pornstargalerymaid.blogspot.tw
  pornstargalerymaid.blogspot.ug
+pornstargalerymaturewomen.blogspot.com
  pornstargalerymilf.blogspot.ae
  pornstargalerymilf.blogspot.al
  pornstargalerymilf.blogspot.am
@@ -2085051,6 +2085192,7 @@ ptnostalgia.com
  ptoffroad.com
  ptojpfmafbpirloi-dot-millinium.ey.r.appspot.com
  ptoons.net
+ptorrents.com
  ptosexwpndhpzzuawnkotrbvby-dot-gleowayel400503.uc.r.appspot.com
  ptotanntolep.ga
  ptownex.tumblr.com
@@ -2089511,6 +2089653,7 @@ puppyeyesonmasterscock.tumblr.com
  puppyfatteens.com
  puppyfemboy123.tumblr.com
  puppyfoxbbw.tumblr.com
+puppygirl035.tumblr.com
  puppygirll.tumblr.com
  puppygirlsnplaythings.tumblr.com
  puppylesbiansblr.tumblr.com
@@ -2092133,6 +2092276,7 @@ pussy-galore831.tumblr.com
  pussy-gaylover.tumblr.com
  pussy-gifs.tumblr.com
  pussy-grool.tumblr.com
+pussy-hair2952.blogspot.com
  pussy-hair6861.blogspot.ae
  pussy-hair6861.blogspot.al
  pussy-hair6861.blogspot.am
@@ -2104464,6 +2104608,7 @@ queenraqui.com
  queenraynarvaezjr.tumblr.com
  queens-club777.com
  queens-escort.de
+queens-of-kink.blogspot.com
  queens-of-porn.com
  queens-of-porn.de
  queens-of-sex.com
@@ -2121271,6 +2121416,7 @@ real-whores-wives.tumblr.com
  real-whores.tumblr.com
  real-wife-nude-pics.tumblr.com
  real-wife-stories69.tumblr.com
+real-wife.blogspot.com
  real-wives-naked.com
  real-wives-only.tumblr.com
  real-wives.net
@@ -2129125,6 +2129271,7 @@ redditgonewild.tumblr.com
  redditgonewildgirlsgettingnaked.tumblr.com
  redditlurker.com
  redditorporn.com
+redditpornx-blog.tumblr.com
  redditripper.tumblr.com
  reddman02.tumblr.com
  reddmodx.blogspot.ae
@@ -2142661,6 +2142808,7 @@ retro-porn-thumbs.com
  retro-porn-tour.com
  retro-porn-tube.com
  retro-porn-tube.net
+retro-porn-xud.blogspot.com
  retro-porn.com
  retro-porno-x.tumblr.com
  retro-porno.de.ms
@@ -2166954,6 +2167102,7 @@ s0htr.codesandbox.io
  s0n.ru
  s0n1c.ru
  s0pg.onderhost.com
+s0rryym0m.tumblr.com
  s0s9p0pspuser.df.r.appspot.com
  s0sexy69.skyblog.com
  s0yyweans02ytdkltawai0wmaoaeach1ohyc5wo.icu
@@ -2168787,6 +2168936,7 @@ sac-dhaka.com
  sac-italine.tk
  sac-itau.com
  sac-johnson.tumblr.com
+sac-observer.blogspot.com
  sac-serv.com
  sac.atendimento-mobile.com
  sac.cliente-itau.online
@@ -2224090,6 +2224240,7 @@ sex-pill.net
  sex-pinnwand.com
  sex-pinups.com
  sex-pissing.com
+sex-pistol.blogspot.com
  sex-pistol.net
  sex-pistols.co.uk
  sex-pistols.e-mp3s.eu
@@ -2244518,6 +2244669,7 @@ sexdatingvlaamslimburg.startspot.nl
  sexdatingvlaanderen.com
  sexdatingvoorjou.nl
  sexdatingwebsite.nl
+sexdatingwithguys.tumblr.com
  sexdatingworld.com
  sexdatingworld.de
  sexdatingworld.nl
@@ -2259657,6 +2259809,7 @@ sexhemel.nl
  sexhen-tai.goodparkloan.com
  sexhen-tai.nudsale.com
  sexhengst.nl
+sexhenta.net
  sexhentai.canalblog.com
  sexhentai.com
  sexhentai.free.fr
@@ -2271023,6 +2271176,7 @@ sexnostop.free.fr
  sexnostress.com
  sexnostrings.co.uk
  sexnota.com
+sexnotax.blogspot.com
  sexnote.com
  sexnotebook.blogspot.ae
  sexnotebook.blogspot.al
@@ -2282080,6 +2282234,7 @@ sexpicsandgifs1.tumblr.com
  sexpicsandmore.com
  sexpicsandmovies.com
  sexpicsandvids.com
+sexpicsarchiveuwaifs.blogspot.com
  sexpicsarea.com
  sexpicsbox.com
  sexpicscenter.com
@@ -2282148,6 +2282303,7 @@ sexpict.com
  sexpict.net
  sexpict.ru
  sexpictgallery.com
+sexpictintheworlds.blogspot.com
  sexpicts.com
  sexpictu.es.co.uk
  sexpictuers.com
@@ -2290029,6 +2290185,7 @@ sexstories4u.com
  sexstoriesandpics-deactivated20.tumblr.com
  sexstoriesandpornlinks.com
  sexstoriesarchive.net
+sexstoriesbag.wordpress.com
  sexstoriesblog.tumblr.com
  sexstoriesbyemail.com
  sexstoriesclub.com
@@ -2301455,6 +2301612,7 @@ sexvideosfree.blogspot.sk
  sexvideosfree.blogspot.sn
  sexvideosfree.blogspot.tw
  sexvideosfree.blogspot.ug
+sexvideosfree.cc
  sexvideosfree.net
  sexvideosfreedownloads.blogspot.ae
  sexvideosfreedownloads.blogspot.al
@@ -2369817,6 +2369975,7 @@ shaved-pussy.com
  shaved-pussy.de
  shaved-pussy.net
  shaved-pussy55-blog.tumblr.com
+shaved-sex.blogspot.com
  shaved-teen-pussy.blogspot.ae
  shaved-teen-pussy.blogspot.al
  shaved-teen-pussy.blogspot.am
@@ -2372477,6 +2372636,7 @@ shemale-beauty.blogspot.tw
  shemale-beauty.blogspot.ug
  shemale-beauty.com
  shemale-blog.com
+shemale-bondage.blogspot.com
  shemale-boobs.tumblr.com
  shemale-bookmarks.com
  shemale-boys-sheboy.axxs.de
@@ -2376323,6 +2376483,7 @@ shemaledb.com
  shemaledb.net
  shemaledelights.tumblr.com
  shemaledeluxe.com
+shemaledeluxes.blogspot.com
  shemaledevils.tumblr.com
  shemaledick.org
  shemaledicked.com
@@ -2377968,6 +2378129,7 @@ shemaleporncomics.com
  shemaleporncomics.net
  shemaleporncum.com
  shemaleporndir.com
+shemaleporndot.com
  shemaleporndrop.com
  shemaleporndvds.com
  shemaleporner.com
@@ -2380877,6 +2381039,7 @@ shewashe.blogspot.sn
  shewashe.blogspot.tw
  shewashe.blogspot.ug
  shewenttojarreds.tumblr.com
+shewhomakestherules.blogspot.com
  shewhomustbeobeyed.com
  shewillalwaysbealifelongtragedy.tumblr.com
  shewillfuckyou.com
@@ -2395819,6 +2395982,7 @@ sissyaudioporn.tumblr.com
  sissybabygirl35.tumblr.com
  sissybabymegan.tumblr.com
  sissybabyneedsaname.tumblr.com
+sissybabysarah.blogspot.com
  sissybabyslavelaura.tumblr.com
  sissybabysusie.tumblr.com
  sissybackforblack.tumblr.com
@@ -2398354,6 +2398518,7 @@ sissyneedsablackdaddy.tumblr.com
  sissyneedsbbcdaddy.tumblr.com
  sissyneedsbigblackrewster.tumblr.com
  sissyneilina.tumblr.com
+sissynequissimus.tumblr.com
  sissynessy.tumblr.com
  sissynicci.tumblr.com
  sissynicole814.tumblr.com
@@ -2419658,6 +2419823,7 @@ smutindia.com
  smutindia.net
  smutinside.com
  smutinterracial.com
+smutisforthedirtyminded.blogspot.com
  smutisp.com
  smutjoy.com
  smutjpegs.com
@@ -2424418,6 +2424584,7 @@ soft-is-sexy.tumblr.com
  soft-kittie.tumblr.com
  soft-n-easy.tumblr.com
  soft-obzor.net
+soft-porn-dvd.blogspot.com
  soft-porn-galleries.com
  soft-porn-nudes.com
  soft-porn-pics.com
@@ -2481383,6 +2481550,7 @@ sundarbonit.com
  sunday.com.ua
  sunday907.tumblr.com
  sundaymonday107.live
+sundaynightsexshow.blogspot.com
  sundayporn.com
  sundayporno.com
  sundaysex.com
@@ -2491021,6 +2491189,7 @@ suzukiball.xyz
  suzukibh.com
  suzukicibubur.com
  suzukistallion.com
+suzumiwilder.blogspot.com
  suzy.nl
  suzybimbo69.tumblr.com
  suzyboobies.com
@@ -2496173,6 +2496342,7 @@ sweetteens.free.fr
  sweetteenscene.com
  sweetteensex.net
  sweetteensex.tumblr.com
+sweetteenslicking.blogspot.com
  sweetteensporn.com
  sweetteenstube.com
  sweetteentease.blogspot.ae
@@ -2518577,6 +2518747,7 @@ teen-factory.com
  teen-feeder.tumblr.com
  teen-feet-and-tiny-toes.tumblr.com
  teen-feet-nudes.tumblr.com
+teen-feet7308.blogspot.com
  teen-femdom-love.tumblr.com
  teen-fetish-sex-pictures.com
  teen-ficken.tumblr.com
@@ -2552973,6 +2553144,7 @@ the-mature-porn.com
  the-maturesex.com
  the-maybesomeday-girl.tumblr.com
  the-meat-market.tumblr.com
+the-melanin-cuckcake.tumblr.com
  the-mezo.tumblr.com
  the-middle-aged-whore.tumblr.com
  the-middle-finger-blog.tumblr.com
@@ -2556087,6 +2556259,7 @@ theallstarporngirls.com
  thealluringbeadboutique.com
  thealluringdiamondmine.tumblr.com
  theallwam.com
+thealmightyepiccouple.blogspot.com
  thealmightygodrods.tumblr.com
  thealmost-lesbian.tumblr.com
  thealmostbi.tumblr.com
@@ -2606268,6 +2606441,7 @@ tokyotempo96.blogspot.ug
  tokyothumbs.com
  tokyotoes.com
  tokyotopless.com
+tokyotoplesseroticphotofreepictu.blogspot.com
  tokyotosho.info
  tokyototty.com
  tokyotube.tumblr.com
@@ -2611150,6 +2611324,7 @@ top5khampha.com
  top5porn.com
  top5pornsites.com
  top5rencontres-fr.com
+top5sitederencontre.fr
  top6-sites-rencontre.com
  top6.com
  top66.com
@@ -2622391,6 +2622566,7 @@ tranny-sex.ipupdater.com
  tranny-sex.ws
  tranny-sexmovie.com
  tranny-sextasy.tumblr.com
+tranny-sextrans.blogspot.com
  tranny-shemale-gay.tumblr.com
  tranny-shemale-sex.biz
  tranny-shemalefilms.startspot.nl
@@ -2622656,6 +2622832,7 @@ tranny-trans-escort.blogspot.sk
  tranny-trans-escort.blogspot.sn
  tranny-trans-escort.blogspot.tw
  tranny-trans-escort.blogspot.ug
+tranny-trans-sexuel.blogspot.com
  tranny-trick.blogspot.ae
  tranny-trick.blogspot.al
  tranny-trick.blogspot.am
@@ -2622938,6 +2623115,7 @@ tranny.linkoverzicht.be
  tranny.nexuswebs.net
  tranny.nl
  tranny.one
+tranny.plus
  tranny.scriptmania.com
  tranny.startspot.nl
  tranny.uwstart.nl
@@ -2640305,6 +2640483,7 @@ tsescort-mariana-gros-seins120g-paris.blogspot.sn
  tsescort-mariana-gros-seins120g-paris.blogspot.tw
  tsescort-mariana-gros-seins120g-paris.blogspot.ug
  tsescort.co.uk
+tsescorts.blogspot.com
  tsescorts.com
  tsesmee.tumblr.com
  tsesso.com
@@ -2644656,6 +2644835,7 @@ tufcwcpqtljhpmxedelz-dot-gleowyel040493443434989.wl.r.appspot.com
  tuffguy.net
  tuffguyz.homestead.com
  tuffi3.tumblr.com
+tuffsnuff.blogspot.com
  tuffstuff22.tumblr.com
  tuffstuffleather.com
  tuflii.tumblr.com
@@ -2653847,6 +2654027,7 @@ tysontylerxxx.tumblr.com
  tysoumi84.tumblr.com
  tytovore.tumblr.com
  tytoxu37.soup.io
+tytporn.com
  tytporno.com
  tytporno.net
  tytsex.net
@@ -2656405,6 +2656586,7 @@ ukfilthygirlx.tumblr.com
  ukfilthymilfwife4u.tumblr.com
  ukfis.pl
  ukflashers.co
+ukfootmistress.tumblr.com
  ukfreesex.com
  ukfreesexchat.com
  ukfucking.com
@@ -2684339,6 +2684521,7 @@ very-hairy-women.tumblr.com
  very-hardcore-sex.com
  very-highend.com
  very-horny-girl.tumblr.com
+very-hot-and-tasty.blogspot.com
  very-hot-chicks.com
  very-hot-moms.tumblr.com
  very-hot-sex69.tumblr.com
@@ -2717905,6 +2718088,7 @@ voyeur-secrets.com
  voyeur-seite.com
  voyeur-sex-24.de
  voyeur-sex-amateur.com
+voyeur-sex-cam.blogspot.com
  voyeur-sex-cam.com
  voyeur-sex-cams.com
  voyeur-sex-fair.de
@@ -2731105,6 +2731289,7 @@ web-cam-chaudasse.blogspot.sn
  web-cam-chaudasse.blogspot.tw
  web-cam-chaudasse.blogspot.ug
  web-cam-directory.com
+web-cam-erotiche.blogspot.com
  web-cam-girl-live.blogspot.ae
  web-cam-girl-live.blogspot.al
  web-cam-girl-live.blogspot.am
@@ -2738711,6 +2738896,7 @@ webcams-sexe.com
  webcams-sexe.net
  webcams-sexe.ze.cx
  webcams-sexo.com
+webcams-sexy.blogspot.com
  webcams-sexy.com
  webcams-show-girls.atspace.com
  webcams-strip.com
@@ -2747922,6 +2748108,7 @@ wesexandorgywithme.tumblr.com
  wesexpo.com.tw
  wesexs.com
  wesexu.com
+wesexygirlsboobs.tumblr.com
  wesexyou.com
  wesfargoo.com
  wesgb.com
@@ -2749050,6 +2749237,7 @@ wetformommy.tumblr.com
  wetforsex.com
  wetforsexxx.tumblr.com
  wetfoto.com
+wetfreegayporn.com
  wetfreepornclips.com
  wetfreepussy.com
  wetfreesex.com
@@ -2766550,6 +2766738,7 @@ womenandmeneroticmuch.tumblr.com
  womenandsex.com
  womenanimalsex.net
  womenarebarbies.tumblr.com
+womenarebitchesandbastards.blogspot.com
  womenarechildren.tumblr.com
  womenarefucktoys.tumblr.com
  womenaregorgeous.tumblr.com
@@ -2767407,6 +2767596,7 @@ womensexxxxcumshotscolleges.blogspot.tw
  womensexxxxcumshotscolleges.blogspot.ug
  womensexy.canalblog.com
  womensexy.com
+womensexyandbadgirl2016.blogspot.com
  womensharingcocksandcum.tumblr.com
  womenshealth-sexualhealth-orgasm.com
  womenshealth.about.com
@@ -2768358,6 +2768548,7 @@ wonderful-photos.com
  wonderful-porn.com
  wonderful-sexland.tumblr.com
  wonderful.gr
+wonderfulandmarvelous.tumblr.com
  wonderfulbabes.net
  wonderfulboobs.com
  wonderfulbrandss.com
@@ -2778687,6 +2778878,7 @@ x-boxx.com
  x-boy.net
  x-business.com
  x-cam-girls-overzicht.startspot.nl
+x-cam-gratuite-mobile.blogspot.com
  x-cam-gratuite.blogspot.ae
  x-cam-gratuite.blogspot.al
  x-cam-gratuite.blogspot.am
@@ -2780681,6 +2780873,7 @@ xanadudigital.com
  xanaduloverblog.tumblr.com
  xanal-sex.com
  xanaldy.tumblr.com
+xanaliana.blogspot.com
  xanalporn.com
  xanalsex.com
  xanalvids.com
@@ -2782377,6 +2782570,7 @@ xduporno.org
  xdux.net
  xdvdcenter.free.fr
  xdvdz.com
+xdvideosmp4.site
  xdwasexwhatsapp.zzux.com
  xdxdlol.tk
  xdxnecohyohiivuxnepcduylmtrhmbgbsxco-dot-cryptic-now-290917.ey.r.appspot.com
@@ -2794239,6 +2794433,7 @@ xvideoporn.blogspot.tw
  xvideoporn.blogspot.ug
  xvideoporn.pro
  xvideoporno.com
+xvideoporno.name
  xvideoporno.nelweb.it
  xvideoporno.org
  xvideoporno.tv
@@ -2798951,6 +2799146,7 @@ xxx-hardcore-porno-sex.com
  xxx-hardcore-porno.com
  xxx-hardcore-porno.net
  xxx-hardcore-pornos.com
+xxx-hardcore-sex-cookie.blogspot.com
  xxx-hardcore-sex-livechat.co.uk
  xxx-hardcore-sex-movies.com
  xxx-hardcore-sex-pics-exclamation.com
@@ -2804285,6 +2804481,7 @@ xxxbestamature.com
  xxxbestblowjobxxx.tumblr.com
  xxxbestfree.com
  xxxbestnsfwgifsxxx.tumblr.com
+xxxbestporn.blogspot.com
  xxxbestporn.com
  xxxbestpornxxx.com
  xxxbestsex.net
@@ -2805392,6 +2805589,7 @@ xxxdates.com
  xxxdates.nl
  xxxdating.com
  xxxdating.nl
+xxxdating100free.blogspot.com
  xxxdatingblog.com
  xxxdatinggroup.com
  xxxdatingnederland.nl
@@ -2844289,3 +2844487,7 @@ xxx
  porn
  sex
  adult
+xxx
+porn
+sex
+adult
diff --git a/blacklists/adult/urls b/blacklists/adult/urls

index 196c01106a0d656db1c848dae5073a9285927d32..35ea7523fb2f9da059b9bd3d8a86c667e64781b3 100644 (file)
--- a/blacklists/adult/urls
+++ b/blacklists/adult/urls
@@ -1877,6 +1877,7 @@
  2ememain.be/l/vetements-femmes/q/fetish
  2ememain.be/l/vetements-femmes/q/panty
  2ememain.be/q/fetish/f/comme-neuf
+2ex.me/movies/panties
  2flashgames.com/photo/cecile_de_france
  2flashgames.com/photo/david_boreanaz
  2flashgames.com/photo/hannah_graaf
@@ -2597,7 +2598,6 @@
  9reyes.net/videos-y-o-peliculas-porno/
  9rules.com/relationships/notes/2323
  9w2kmf.blogspot.com/2014/03
-a-acompanhantes-travestis.blogspot.com/2020/03
  a-box-o-jills.tumblr.com/post/115966272095/onegirlinalltheworld-im-one-of-the-worst
  a-bruisedheart.tumblr.com/post/35966356293/perverse-lesbian-girls-follow-me-perverse
  a-cute.net/gasp
@@ -2655,7 +2655,6 @@ aardvarkmusicschool.com/seinsxwebcamxxx
  aardvarkmusicschool.com/sodomiexwebcamxxx
  aardvarkmusicschool.com/video-porno
  aardvarkmusicschool.com/videoxwebcamxxx
-aaretha1144.blogspot.com/2009/03
  aarock1.tumblr.com/post/119494485160/grandkinglesbi-depthroat-gangbang-teens-sex
  aarosco.tumblr.com/post/132013022446/gorgeous-natural-and-confident-d
  aarvig.com/wallpaper
@@ -2974,7 +2973,6 @@ ad.howstuffworks.com/RealMedia/ads/adstream_lx.ads/computer.howstuffworks.com
  ad.howstuffworks.com/RealMedia/ads/adstream_lx.ads/videos.howstuffworks.com
  ad.it.doubleclick.net/jump/www.dreamsonweb.net/sex
  adafo.com/Image+lesbienes
-adalin18.info/female-fake-taxi-nympho-blonde-swaps-studs-cock-for-cash-3465
  adalt.wml.su/free/shemales
  adaltmac.com/vd
  adaltnik.com/sex1
@@ -3130,7 +3128,6 @@ adult-frei.blogspot.com/2010
  adult-gay-clips.blogspot.com/search/label
  adult-gay-porn-xrrx.blogspot.com/2008
  adult-planet.org/cassidey-and-maitresse-madeline-get-off-the-dick-a-lesbian-bdsm-fantasy
-adult-porn-clip.blogspot.com/2008
  adult-toile-fabric.blogspot.com/2010/12
  adult-top-list.com/asian-exxxtasy
  adult-university.searchmole.co.uk/search
@@ -3161,7 +3158,6 @@ adultnode.com/search/hashtag/impregnate
  adultnode.com/search/hashtag/sadomaso
  adultphotosandchat.blogspot.com/2013/06
  adultpicsvideos.net/hun
-adultpicturexxxdildoedild.blogspot.com/2009/08
  adultplus18-deactivated20150915.tumblr.com/post/129158451714/beautiful-gay-twink-in-his-room-private-brief
  adultrealitykings.blogspot.com/2018/12
  adultrealitykings.blogspot.com/2019/02
@@ -3428,6 +3424,7 @@ alainsex.tumblr.com/post/143500332397/altobagoo-tendre-mon-q-
  alaireinc.com/wwwboard
  alamak.fsn.net/heidi
  alamoudilaw.com/asian-xxx-porn-hermaphrodites
+alan540.tumblr.com/following
  alanabimaker.tumblr.com/following/page/4
  alaska.net/~foneslut
  albatrosit.iitalia.com/archives
@@ -4224,7 +4221,6 @@ analoliz.blogvis.com/2009/01/09/ass-mature-naked-tit-woman
  analpark.tumblr.com/likes
  analsex-freenakedness.blogspot.com/2007
  analsexvideos.pro/play-4504-lusty-eastern-beauty-alexa-nicole-is-doing-her-best-to-satisfy-her
-analvirgin.blogspot.com/2004
  analyse.jubii.dk/surveys
  analysebrassens.com/?page=texte&id=201&%23
  analysiswebsite.com/analysis/ballerinabondagefairies.tumblr.com
@@ -4635,6 +4631,7 @@ anis7z.unblog.fr/2014/07/10/bisex-party-vol-26-the-pick-of-the-bi-lot-the-hottes
  anis7z.unblog.fr/2014/07/10/hentai-dirty-laundry-mega
  anishsood.weblogs.us/archives/81
  anitabora.com/blog/2004/08/24/in-which-madhu-extracts-his-pound-of-flesh
+anjajosefsen.blogspot.com/2012/12
  anjfantasies.tumblr.com/post/136369888254/wanted-to-fuck-her-pussy-longer-but-that-tight
  anjfantasies.tumblr.com/post/136607982614/anjfantasies-wanted-to-fuck-her-pussy-longer
  ankaisa.net/blog/
@@ -4715,6 +4712,7 @@ annonz.com/c/escort+girl+occasionel
  annonz.com/rss/annonces_massages.xml
  annoo.fr/annuaire-gratuit.php
  annouchka.fr/ebay-cest-culotte
+annoyingbearnacho.tumblr.com/post/171375025430/recent-big-tits-porn-videos-tgpdog
  annoyinglydecafinatedcoffee.tumblr.com/post/122488179334/texts5sos-suck-off-oral-fellation
  annu-jeux-gratuit.cquoi.net/Jeux_coquin/jeux_regles
  annuaire-1st.com/video-sexe
@@ -4939,6 +4937,7 @@ anywhereli.info/codi-milo-pic/
  anyxxx.me/find
  anyxxx.me/video/31301072
  anyxxx.me/video/34878370
+anyxxx.me/video/41179400
  anyxxx.me/video/46228753
  anyxxx.me/video/46883188
  anyxxx.me/video/47417257
@@ -5642,6 +5641,7 @@ asianfaces.co.uk/faces
  asianfaggotboy.tumblr.com/post
  asianfanfics.com/story/view/810517/13/danger-hardcore--wild-you--bangtan-taehyung
  asianfix.tumblr.com/post/101360081732/cute-asians-share-a-dick-get-your-fix-for-more
+asianfucker.blogspot.com/2005
  asiangirl2015.tumblr.com/post/108732218992/jin-namjoon-smut-part-3
  asiangirl2015.tumblr.com/post/109483220947/can-you-do-a-smut-about-bts-v-catching-you
  asianholenet.blogspot.com/2009/02
@@ -5728,6 +5728,7 @@ ass-krazy.tumblr.com/post/105616366201/jillian-janson-bangbros
  ass-krazy.tumblr.com/post/111996817003
  ass-krazy.tumblr.com/post/114960623465/kelsi-monroe-bangbros
  ass-overdose.tumblr.com/archive
+ass-worship-suh.blogspot.com/2009/11
  ass.myfreeamateur.net/cartoon-hard-core-fucking-giant-rod-and-ejaculate-culottes
  assanaltrainer.tumblr.com/post/166447187772/tits-pics-russian-anal-xxx-porno
  assanaltrainer.tumblr.com/post/166447335652/hot-xxx-alicia-fanny-key-fuck-pussy
@@ -5842,7 +5843,6 @@ atheistadam.com/infidel-a-womans-degradation-a-novel-of-erotic-domination-bondag
  atheistadam.com/infidel-a-womans-degradation-a-novel-of-erotic-domination-bondage-and-bdsm-9
  athenaagency.com/ladies
  atheos.cx/tk
-athlete-female-nude.blogspot.com/2012
  athletespornxxx-blog.tumblr.com/post/129182635109/buy-wonderwoman-teen-halloween-porn-videos
  athletespornxxx-blog.tumblr.com/post/129320244049/teen-unwed-womens-huge-white-videos-teen
  athletespornxxx-blog.tumblr.com/post/129320341299/ctv-news-virgin-sex-pics-photos-white-videos
@@ -5963,6 +5963,7 @@ aurahealinghands.webs.com/apps/blog/entries/show
  aurelie-touchard.blogemploi.com/cv/le_cv/Excel/repartition_clientele_camping.xls
  aus.ch/ctyri
  aushomo.tumblr.com/post/86484607727/afgayboy-yummy
+aussiecumgiver.tumblr.com/following/page/14
  aussieguy4u2c.tumblr.com/post/147139690660/badyoungbrotha-kingsofwhitepussy-jdubjsw
  aussiesamateurs.tumblr.com/post/111536844564/hill8786-blowjob-shaved-hornywife-wetpussy
  austin.craigslist.org/m4m
@@ -6046,6 +6047,7 @@ avondescent.com.au/node/582
  avonudtcummins.blogspot.com/2013/06
  avrguide.com/ping-pong-at90s8535
  avsdemo.com/video/269
+avstreamingddl.blogspot.com/2011
  avstreamingddl.blogspot.com/2011/07
  avstreamingddl.blogspot.fr/2011/07
  avstreamingddl.blogspot.fr/2011/08
@@ -6092,7 +6094,6 @@ axwound.co.uk/sophie3739
  axxximage.com/2015-xxx-25-lisa-ann-nude-photos-hardcore-sex-pics-naked-images
  ayahtiri.blogspot.com/2019/06
  ayambokep.blogspot.com/2019/05
-ayannaviospu.blogspot.com/2020
  ayanohanna.exblog.jp/1875577
  ayfnet.net/londik
  ayillustrations.tumblr.com/post/133158260625/drawings-from-my-porn-of-the-dead-book-avalible
@@ -6136,6 +6137,7 @@ azstarnet.com/~buster
  azsunset.com/~jskk
  aztide.tumblr.com/post/137770189848/sexxxyjess-mywickedwierdalterego
  azur-access.com/amazonia-s.htm
+azuralondon.blogspot.com/2012
  azurephenix.tumblr.com/post/112248879100/serendipityslave-sexy-chastity-pussy-giggles
  azx734024.canalblog.com/archives/2012/06
  b-cat.net/adult
@@ -6200,6 +6202,7 @@ babeszone.dk/news.php
  babetko.sk/user/view_page.php
  babewalker.com/category/ask-babe
  babgindonesia.blogspot.com/2019
+babgjepang.blogspot.com/2019
  babi-xo.imeem.com/music/nT3IZqps/i_wanna_fuck_you_dirty
  babki.no.sapo.pt/voyeur
  babki.zyns.com/mature
@@ -6341,6 +6344,7 @@ baluart.net/videos/categoria/topless
  baluart.net/videos/categoria/traseros
  baluart.net/videos/categoria/upskirt
  baluart.net/videos/categoria/webcam
+bambamjoker.tumblr.com/post/188220266127/sexy
  bambili.com/cgi-local/top100
  bambooputters.com/images/tmp/564
  banakulakverin-boicegirl.blogspot.com/2017/06
@@ -6371,6 +6375,7 @@ bangtan-in-bed.tumblr.com/post/113108044837/can-i-request-a-gangbang-smut-of-all
  bangtanboyssmutbts.tumblr.com/post/628333696593903616/cyber-sex-m
  bangtaniejungkookie.tumblr.com/post/164208841541/when-you-catch-him-masturbating-with-your-panties
  bangtaniejungkookie.tumblr.com/post/167654585776/hi-could-you-do-a-yoongi-smut-where-he-is-your
+bangtaniejungkookie.tumblr.com/post/168390994941/bts-reaction-impregnation-kink
  bangtanofarmys.tumblr.com/post/162443072276/days-of-the-week-thursday-smut
  bangtantaegi.tumblr.com/post/628812515148742656/bts-reaction-giving-him-a-blowjob-while-hes-on
  bannedbids.tumblr.com/post/32764181518/bannedbids-gay-fetish-auctions
@@ -6544,6 +6549,7 @@ barnesbabee.tumblr.com/post/618506136732172288/like-a-pornstar-cs
  barnorama.com/beautiful-busty-girls-13
  barnorama.com/hot-busty-girls
  barnorama.com/random-busty-girls-3
+barnsleyhealthcarefederation.co.uk/2019/12/26/how-to-see-sexy-girls-on-live-adult-web-cam-sites
  baronmagdalene.tumblr.com/post/49638095006/porn-sex-69-gif-clitoris-and-pussy-stimulation
  barrie.kijiji.ca/c-personals-casual-encounters-Looking-for-female-exhibitionists-W0QQAdIdZ96801800
  bart666.com/index.php/projects/movie-rating-quiz/
@@ -6631,6 +6637,7 @@ bbs.ws/bbs.php?bbs=Jill
  bbsbord.unblog.fr/2014/07/10/18-years-hot-indian-fucking-girl-fucking-with-boyfriend-in-several-positions
  bbsxml.tumblr.com/following/page/138
  bbsxml.tumblr.com/following/page/2
+bbugilcewek.blogspot.com/2019/06
  bbugilsange.blogspot.com/2019
  bbw-chubby.tumblr.com/post/133811535028/big-beautiful-womans-naked-on-their-webcams-join
  bbw-curvy.tumblr.com/post/108972445478/chubbybabes-meet-hottest-curvy-women-on-this
@@ -6738,6 +6745,7 @@ beatease.tumblr.com/post/626216529/fuckyeahsinglemomma-creamy-panties-i-3-this
  beatifulgirlsinmylife.tumblr.com/post/148133838205
  beatmycakes.tumblr.com/post/9589735360/sexyclipstv-hot-blonde-in-sexy-white-lingerie
  beatranny.tumblr.com/post/117686291211/his-cock-is-working-her-pussy-fillig-it
+beau-bones.tumblr.com/post/631127285143076864/the-most-comprehensive-nsfw-ask-around
  beauaguon.tumblr.com/post/114440190685/daddythefetish-beauaguon-very-cute-i-like
  beaute-femme.org/blog-femme/leighton-meester-411
  beaute-femme.org/blog-femme/lingerie-tendances-printemps-ete-2010-605
@@ -7109,6 +7117,7 @@ bft.nu/exit_trafik/
  bfullsex.blogspot.com/2019
  bg.wordpress.com/tag/centerfold
  bgbain.fr/dansksex-6ac92
+bgirlsphoto.blogspot.com/2019
  bgp.he.net/dns/sexswap2000.com
  bhabhi-sex.com/25-xxx-kelly-divine-free-porn-pics-nude-sexy-hot-photos
  bhmais.com.br/nudez/
@@ -7183,6 +7192,7 @@ bigbruno.com/celebrities/tiffanytaylor.html
  bigcloset-tg-fiction-search-engine-swicki.eurekster.com/femdom
  bigdeeps.com/video1306265/horny_amateur_strip_show
  bigdictoy15.tumblr.com/following
+biged76.tumblr.com/following
  bigempire.com/filthy/
  bigeuromelons.com/gal
  bigeye.com/sexeducation
@@ -7209,12 +7219,9 @@ biglistofwebsites.com/list-top-websites-like-jualobatkuatsex.com
  biglnk.com/Ac0
  bigloannot.theatrepeople.net/2007/05/13/shemale-sex-videos-tranny-manga-transgender-stories-on-tranny
  bigmac0109.tumblr.com/post/97904893352/bbwhoes-bombastic-butt-sexy-bbw-abused-hard
-bigmomvideo.com/fr/g/nympho-870/1
-bigmomvideo.com/fr/videos71470/agreeable-trio-fornication
  bigmouse.com/~teen
  bigmovies.dynup.net/download
  bigmunky-com.spadesquiz.com/fond_ecran/
-bignaturaltitsteenwebcams.blogspot.com/2020
  bignbeefydick.tumblr.com/post/40861555582/big-n-beefy-shooting-a-huge-load-fucking-hot
  bigniggajones.tumblr.com/post/122090829512/sexy-celeb-fakes-god-i-fucking-love-lisa-ann
  bigoo.ws/Glitters/doll
@@ -7298,6 +7305,7 @@ bioxit.com/sexy-et-charme
  bipolar-sunshine-says-bite-me.tumblr.com/post/108253704396
  bipolar-sunshine-says-bite-me.tumblr.com/post/109999450481/analcult-brunette-getting-fucked-by-a-thick-cock
  biqle.life/video
+biqle.me/play/20040/canadian-nympho-nikki-benz-gets-pounded-by-a-big-hard-cock
  bird-of-paradise.eu/je-cherche-couple-gay-irapuato
  birds-have-teeth.tumblr.com/post/611828705957986304/can-i-get-some-thirst-midoriya-being-edged-by-a
  birds-have-teeth.tumblr.com/post/613539486486462464/i-just-wanna-praise-and-dirty-izuku-and-watch-him
@@ -7492,6 +7500,7 @@ blackedjackforfun.tumblr.com/page/2
  blackgirlsinlove.com/post
  blackglovesfan.tumblr.com/post/126947192508/mistress-anli-booty-close-up-from-my-leather
  blackguys.tumblr.com/post/109134692162/bigger-boys-xxx-massive-cock-videos-once
+blacklovernaked2.blogspot.com/2012
  blackmack1977.tumblr.com/post/120095321827
  blackmandlatinf.tumblr.com/post/128332337868/my-wife-is-freaky-and-enjoys-licking-my-ass
  blackmenrevenge.tumblr.com/post
@@ -7500,6 +7509,7 @@ blacknoir01.tumblr.com/post/133907441110/destroywhiteboys-nigger-cocks-cant-be
  blackorder.com/modules/forum/
  blackownedwhitesissy.tumblr.com/post/108993181870/fuck-my-mouth-harder-daddy-i-wont-resist
  blackpeak.eu/hanne3671
+blackpoetrypmrapedtwice.blogspot.com/2011/01
  blackpottery.cn/qy
  blacks-obsession.tumblr.com/post/134720942364/gangbang-orgy-interracial-black-fantasy-bbc
  blacksideofrainbow.tumblr.com/post/120902759436/dominatrice-cruelle-pisse-moi-sur-ma-bite-de
@@ -9031,6 +9041,7 @@ bobbyb69me.tumblr.com/post/106394124360/hardgangbang-extreme-gangbang-sex
  bobbywmitchell.tumblr.com/post/100951627810/perfection-my-favorite-xxx-pic-of-my-boy-troy
  bobbywmitchell.tumblr.com/post/102248248990/my-boy-troy-fucking-a-extremely-hot-muscle-bear
  bobespicturexxx.blogspot.com/2020/10
+bobhammer62.tumblr.com/following/page/2
  bobinger.com/sx
  bobisuki.blogspot.com/2015/09
  bobjams.tumblr.com/post/60567223065/jenna-jameson-pov-fuck
@@ -9226,6 +9237,7 @@ bonbudget.com/thesaurus/videos
  boncap.com/Photo/Photographes/Professionnels/Charme
  bond.net/~shaman/dream
  bondage-sex182009.blogspot.com/2009/01
+bondage-stories-977.blogspot.com/2007/11
  bondageforthebigman.blogspot.com/2011
  bondagelesbian.blogspot.com/2008
  bondagelesbian.blogspot.com/2009
@@ -9479,6 +9491,7 @@ boston.craigslist.org/nos/tlg
  bothhandsknickers.tumblr.com/post/134532959888/dress-hint-tease-beaver-peek-panties
  bothhandsknickers.tumblr.com/post/142140343558
  botona88.blog.co.uk/2013/06/28/amy-fisher-sex-video-anne-baxter-nip-slip-myrick-has-16174094
+bottom8688.tumblr.com/following/page/6
  bottombearking.tumblr.com/post/120630005054/gaymarioxxx-follow-me-write-me-for-more-pics
  bottomboi19.tumblr.com/following/page/2
  botw.org/new/Adult/
@@ -9491,6 +9504,7 @@ bougn.at/5p9
  boulderhighsoccer.com/coaches
  bouletcorp.com/2007/12/11/fuck-peter-pan/
  boulogne-billancourt.wannonce.com/rencontres-adultes-85/
+bouncing-bubble-booty-valkyrie.tumblr.com/post/185000120219/blakes-offer-girl-ver
  bound-princess.tumblr.com/post/124005535216/panties-bdsm-slave-nipple-sexy
  bound2bsassy.tumblr.com/post/49408085266
  boundandblacked.tumblr.com/post/127506826717/stretch-it-out-interracial-bondage
@@ -9541,6 +9555,7 @@ boy-couple-fuck-teen.blogspot.com/2009/04
  boy.net/amber6692
  boy12689.tumblr.com/post
  boycluborganization-blog.tumblr.com/post/117080244279/sammy-case-gay-porn-star
+boycluborganization-blog.tumblr.com/post/117081127044/stark-naked-gay-bear-galleries
  boycluborganization-blog.tumblr.com/post/117210338969/gay-bareback-gay
  boycluborganization.tumblr.com/post/117081232689/tgp-gay-johan-paulik
  boycluborganization.tumblr.com/post/117082563334/videos-hot-boyfriend-masturbates-views
@@ -9631,6 +9646,7 @@ boysmoviesgay-blog.tumblr.com/post/118237683319/gay-uncircunsized-penis-pictures
  boysmoviesgay-blog.tumblr.com/post/118237703664/gay-cbt-videos
  boysmoviesgay-blog.tumblr.com/post/118238017944/filmati-porno-gratis-homo
  boysmoviesgay-blog.tumblr.com/post/118239620044/stud-movies-gay
+boysmoviesgay-blog.tumblr.com/post/118240932814/boy-men-porn-free-video-clips
  boyssexvideos-blog.tumblr.com/post/142319646388/homo-wrestling-group
  boyssexvideos-blog.tumblr.com/post/142319812098/gay-blowjob-secure-up-pictures
  boyssexvideos-blog.tumblr.com/post/142320002303/homo-asian-gangbang
@@ -9760,7 +9776,6 @@ breitbart.com/london/2015/12/12/girls-as-young-as-12-made-available-for-sex-with
  breitbart.com/london/2016/01/08/nude-female-cologne-protest-we-are-not-fair-game-even-when-we-are-naked
  breitenbush.com/gallery
  breitling-orbiter.ch/cd/charme
-breneaksolesthecanon.blogspot.com/2017/08
  brenhinesblog.tumblr.com/post/119706676261/my-breast-cum-video-cumshot-tit-pearlneckless
  bresil.org/images/stories/ambassade-documents/le-bresil/economie/le-bresil-economie-conjoncture-balance.xls
  bresil.org/images/stories/ambassade-documents/le-bresil/symboles-nationaux/le-bresil-hino-nacional-letra-vb.doc
@@ -9883,7 +9898,6 @@ brussel.backpage.com/en-be/Domination/maitresse-uro-scato-bdsm-100-0483040650/31
  brussels.craigslist.org/m4m
  brussels.fr.craigslist.org/cas
  brutalanal.net/fr/search/dXBza2lydHMgY3Vt/popular
-brutalicecaesao.blogspot.com/2008/10
  brutally-brian.tumblr.com/post/147983620995
  brutalplace.com/avs/gays/cls/afl/index.htm
  brutalsex.clicdev.com/f/?CDCookie=brutalsex&
@@ -9993,6 +10007,7 @@ bugthrust.com/hp/3
  bugthrust.com/hp/6
  buhuchetaudit.ru/packsmegacp/amateur
  buhuchetaudit.ru/packsmegacp/busty
+buhuchetaudit.ru/packsmegacp/shemale
  buitengewoonconcept.nl/story
  bukisa.com/videos/178657_how-to-masturbate-as-a-woman
  bukkake-gang-bang.de/de/
@@ -10564,7 +10579,6 @@ caosfn.tumblr.com/post/130752804417/gifxxx-sex-exhibitionist-masturbate-blowjob
  capatv.com/2015/12/fuck-le-systeme-la-nouvelle-serie-incarnee-de-leffet-papillon/
  capcampus.com/lingerie-feminine-118
  capcampus.com/mode/mode-et-marques/lingerie-feminine
-capcocksr.blogspot.com/2008
  capetown.gumtree.co.za/c-Friends-Dating-casual-relationships-girls-seeking-guys-LUSTY-GIRL-W0QQAdIdZ74000085
  capetown.gumtree.co.za/c-Friends-Dating-casual-relationships-guys-seeking-girls-Any-exhibitionists-W0QQAdIdZ178912875
  capetown.gumtree.co.za/c-Friends-Dating-casual-relationships-guys-seeking-girls-Exhibitionist-W0QQAdIdZ78039681
@@ -10951,7 +10965,6 @@ celebritynetworth.com/view/m/0gbx0mk
  celebritynudeblog.tumblr.com/post/152235585942/maggie-q-maggieq-maggie-q-naked-weapon-2
  celebritynudeblog.tumblr.com/post/152235596027/maggie-q-maggieq-maggie-q-nude-in-naked
  celebritynudeblog.tumblr.com/post/152235603702/maggie-q-maggieq-maggie-q-nude-in-naked
-celebritynudefake.blogspot.com/2011
  celebritypictures.duble.com/pictures-photos-pics/K
  celebritypictures.duble.com/pictures/K
  celebritypokerparty.com/poker-challenged-celebrities
@@ -11256,6 +11269,7 @@ charlzford1.tumblr.com/post/98111493343/adults-at-play-her-hard-little-nipples-p
  charmemasculin.tumblr.com/post/15698454214/reblog-if-youre-gay-lesbian-bisexual-trans
  charminglady.fr/type/4071/chaussures-fetish
  charro316.tumblr.com/following
+chaseross.tumblr.com/post/103101576476/tw-genitals-sex-toys-butt-masturbation
  chaseunion.com/documents/urethra/sndsess/
  chasingmechasingyou.blogspot.com/2015/03
  chasseurdefrance.com/reglementation/documents/Questionnaire_examen_theorique_2006.xls
@@ -12125,7 +12139,6 @@ chinanakedorgfreexxxpornm.blogspot.com/2009
  chine-nouvelle.com/chine/sexy
  chineng.com/magic
  chinesefreewebs.com/awotezoviw
-chinesemalaysiancpl.blogspot.com/2010/05
  chinesexxxvideo.com/tag/dream
  chistesybromas.com/news.php
  chistesychistes-fr.diviertete.biz/blagues-sur-les-femmes-blagues-cochonnes
@@ -12515,7 +12528,6 @@ claudewhite46.blogspot.com/2019
  claudewhite46.blogspot.com/2020/04
  claudewhite46.blogspot.com/2020/06
  claudia-schiffer-mom.over-blog.com/top
-claudiabites.blogspot.com/2012/01
  claytonagnv543.tumblr.com/post/618990620848029696/5-killer-quora-answers-on-thumbzilla
  clcv.org/htm/document/lettre_num-surtaxe.doc
  clearblogs.com/sexegratuit
@@ -12641,6 +12653,7 @@ closeupcoitus.tumblr.com/aatumview
  closeupheaven3.tumblr.com/post/108587953497/nudeathleticbabes-hairy-pussy-fur-pubic
  clothes-on-off.tumblr.com/post/103453882692/nude-amateurs-clothes-on-off
  clothesfreecouples.tumblr.com/post/36961501418/saggy-boobs-nice-penis-and-shaved-pussy
+cloudgirldexxx.blogspot.com/2013
  cloudspnp.tumblr.com/post/136043810248/need-my-dick-suck-which-cock-sucker-can-dick-it
  clover.h555.net/u/mickey/FNyRCAzwof51xKdaJXh0
  clover.h555.net/u/overdrive/JZt3j54RpYeiTwyfso0S
@@ -13481,7 +13494,6 @@ cp24.com/news/three-charged-after-13-year-old-girl-coerced-into-sex-trade-1.2667
  cp6465.tumblr.com/post/62589285074/mature-fuck-sluts-milfs-matures-and
  cpc.x86.fr/threads/146-Vous-regardez-quoi-comme-anime-Sans-lolita-ni-petite-culotte/page277
  cpl4bimalefun.tumblr.com/post/115560833965/sucking-his-cock-to-get-him-good-and-hard-and-then
-cpornographietrannyu.blogspot.com/2010
  cpressley92.tumblr.com/post/175135840600/cuckold-on-blonde
  cpressley92.tumblr.com/post/175289254655/spunk-in-food
  cps.gov.uk/legal/d_to_g/extreme_pornography/
@@ -13594,7 +13606,6 @@ creampie-tube-shemale-2013.blogspot.com/2018/03
  creampieboyfriends.org/sexe-adult-site-de-rencontres-libertin-gratuit-la-villedieu-l
  creampiesformothersadaughters.tumblr.com/post/112546338467/free-random-nude-sex-webcam-chat-1-2-3-4-5-6-7-8-9
  creampiesthings2.tumblr.com/post/625976952869830656/female-masturbation
-creampieteenmassage.blogspot.com/2019
  creapoemes.com/poeme/erotique/12867
  creapoemes.com/poeme/erotique/1549
  creapoemes.com/poeme/erotique/21733
@@ -13725,8 +13736,6 @@ crossfitzone.ca/in-pornography-butts-by-oral-that
  crossfitzone.ca/nerves-fetishist-their-exhibitionism-gay-male-sex-videos-if
  crossfitzone.ca/sex-them-nubile-gianna-michaels-porn-upon
  crossfitzone.ca/teenage-lesbian-porn-mimics-during-contains
-crossgay.blogspot.com/2012
-crossgay.blogspot.com/2013/02
  crosspinkys.tumblr.com/post/157385457430
  crossroadscollege.edu/images/Partners/img_old/2159224/01546
  crossroadscollege.edu/images/Partners/img_old/2159224/16323
@@ -14227,6 +14236,7 @@ cyberpass.net/~udk
  cyberquebec.ca/gourmande
  cyberrat.tumblr.com/post/91038352282/sorry-to-bother-you-but-could-you-post-your-prompts
  cybersex-chat-city.com/browse-interests/tag
+cybersexchatcity.com/browse-interests
  cybersolidaires.org/prostitution/
  cybersolidaires.typepad.com/direct/forum_xxx
  cyberspc.mb.ca/~mknight/images2
@@ -14379,6 +14389,7 @@ daddysongayporn-blog.tumblr.com/post/138513888040/sumo-gay-wrestler
  daddysongayporn-blog.tumblr.com/post/138514076060/doctor-three-gay-xxx-gay-gay-dicks
  daddysongayporn-blog.tumblr.com/post/138514491915/the-pleasant-house-dude-file-twink-male-video
  daddysongayporn-blog.tumblr.com/post/138514994605/falcon-twink-porn-star-list-gang-bang-twink
+daddysongayporn-blog.tumblr.com/post/138515186860/michigan-boys-know-how-know-how-piping-hot
  daddysongayporn-blog.tumblr.com/post/138515623275/gays-tee-video-porno-sora-aoi-boy-videos-pic
  daddysongayporn-blog.tumblr.com/post/138575515860/homosexuals-and-gay-asses-gay-ass-twink-movie
  daddysongayporn-blog.tumblr.com/post/138575735595/vintage-gay-loops-william-higgins-william
@@ -17332,6 +17343,7 @@ danishfamily.com/circle-of-incest
  danjohnston.org/2006/rap-music-and-our-society
  danlac.com/store/farm
  danleal.tumblr.com/post/28036206281/immoral-productions-presents-nympho-week
+danleal.tumblr.com/post/40692306530/united-nations-of-sucking-fucking
  danleal.tumblr.com/post/42709933043/cock-craving-cuties
  danmature.xyz/see/ATK/46/2511
  danmeth.com/post/119457060107/the-sexy-new-social-app-for-bearded-guys
@@ -17374,6 +17386,7 @@ darkerdeeperdepths.tumblr.com/post/146730957705/ironbox3-monkeyslavegirl-isodome
  darkitude.com/blog/
  darklydeliciousdesires.tumblr.com/post/118610185189/sex-for-sale-dave-navarro-original-character-one
  darklydeliciousdesires.tumblr.com/post/145781120374/a-cut-above-the-rest-shannon-letooriginal
+darklydeliciousdesires.tumblr.com/post/154344132514/best-birthday-ever-a-shannon-letotessaoriginal/amp
  darklydeliciousdesires.tumblr.com/post/615318175590072320/glow-a-henry-cavillreader-one-shot-story
  darkmulti.tumblr.com/post/612252704192036864/incubus-and-sadistsan-warning-heavy-smut
  darkmulti.tumblr.com/post/612890455981654016/hell-hole-incubusseonghwa-and-san-x-fem
@@ -17647,6 +17660,7 @@ debeste.nl/adultbanners
  debestegids.be/startpagina/pictures/sex
  debilo.chbn.ru/sperm
  debiutext.eu/gay
+debiutext.eu/other
  debloogies.net/voy
  deborahsong.tumblr.com/post/94073337063/ready-for-class
  debourgondischebrouwerij.be/too
@@ -18696,6 +18710,7 @@ dft.ba/-aA0q
  dgmag.it/mobile/con-ios-9-liphone-ti-ricorda-quando-hai-fatto-sesso-111071
  dgroovy.tumblr.com/post/115387591261/reblog-if-you-masturbate-while-on-tumblr
  dgtianqi.cn/Guestbook/BIG5/list.asp
+dguna-oral-sex-lessons.blogspot.com/2015
  dgy1954.tumblr.com/page/3
  dhaget.tumblr.com/post/127030518412/adultplus18-gay-boys-big-dick-fellation
  dhaimyo.tumblr.com/post/131920466315/xlkyng10-assbootytitsboobs-oh-my-damn
@@ -19002,6 +19017,7 @@ dijon.kijiji.fr/c-Rencontres-Homme-cherche-homme-un-mec-poilu-W0QQAdIdZ25919854
  dijon.kijiji.fr/c-Rencontres-Rencontre-occasionnelle-Homme-cherche-homme-un-mec-poilu-W0QQAdIdZ25919854
  dikkemaatjes.nl/wordpress/
  dildo-generator.com/3d-printed-custom-toys/
+dildo-porn.blogspot.com/2005
  dildosformen.blogspot.com/p
  dildowife.tumblr.com/post
  dilerhost.com/traffic
@@ -20005,6 +20021,7 @@ dogpile.com/info.dogpl.toolbar/search/web/lasbien+twins+site:cfmnd.info&adultfil
  dogpile.com/info.dogpl/search/web/fotos%2bsesso
  dogporntube.site/fr/vagina/best/1
  dogsexzoo.fun/en/deepthroat/best/1
+dogsexzoo.fun/en/mature/best/1
  dogsexzoo.fun/en/videos/bondage-and-bestiality-sex-with-dog
  dogsexzoo.fun/en/videos/foursome-bestiality-action-with-mutt
  dogsexzoo.fun/fr/asian/best/1
@@ -20013,6 +20030,7 @@ dogsexzoo.fun/fr/bestiality/best/1
  dogsexzoo.fun/fr/sluts/best
  dogsexzoo.fun/orgy/best/1
  dogsexzoo.fun/search/beastiality/best/1
+dogsexzoo.fun/tag/zoophilia/best
  dogshit.net/xxx
  dohomemadeporn.com/gl/aXQtMTk0LTE5Ng
  dohomemadeporn.com/gl/aXQtMTk0LTI2Mw
@@ -20336,7 +20354,6 @@ dressedandnot.tumblr.com/post/136022175432/onoffslutsdressed-undressed-before-an
  dresslikestarz.com/tag/gossip-girl-fashion
  drew.corrupt.net/bp
  drew.corrupt.net/lp
-drewbarrymorebreast.blogspot.com/2008
  drgama.com/sex
  drgrein.trix.net/Downloads/Fotos%20Mulheres
  drharryfisch.com/male-masturbation
@@ -20359,6 +20376,7 @@ driversmutbucket.tumblr.com/post/619442875835514880/can-i-request-ekinky-610-and
  driversmutbucket.tumblr.com/post/621321201034362880/could-you-please-do-another-ffm-threesome-i-dont
  driversmutbucket.tumblr.com/post/622023268929617920/hi-can-i-request-your-ass-is-going-to-be-seven
  driversmutbucket.tumblr.com/post/630915487572819968/hi-okay-so-i-have-a-request-i-recently-got-my
+drkkaiser.tumblr.com/post/181147314379/being-a-tiny-dickd-cocksucker
  drlauraberman.com/great-sex
  drlauraberman.com/sexual-health/sexual-desire/male-orgasm-facts
  drlauraberman.com/sexual-health/sexual-dysfunction/tips-to-help-stop-premature-ejaculation
@@ -20639,7 +20657,9 @@ dudleyq.com/en/adult-sex-sites
  duesseldom.tumblr.com/following
  dujamaisvu.com/fr
  duke.edu/~jyp
+duker42.tumblr.com/post/188332872850/same-request-she-is-half-naked-on-the-desk/amp
  duker42.tumblr.com/post/188627244750/kinktober-2019-october-27th
+duker42.tumblr.com/post/189415429920/kinktober-2019
  dukevalais.tumblr.com/post/104906047382/gaybatard-treillis-vegasjazz-oh-fuck
  dumb-asians.tumblr.com/post/105946476869/your-only-concern-should-be-pleasing-my-cock
  dumb.com/pictures
@@ -21168,6 +21188,7 @@ econjobrumors.com/topic/check-out-this-ucla-chick-racist-ever/page/3
  econoline71.tumblr.com/post/132295463864/z4kcumncock-cum-wow-mmmm
  economist.com/news/leaders/21666614-free-pornography-ever-more-plentiful-online-right-response-involves-better-sex
  ecorapter.tumblr.com/following
+ecorapter.tumblr.com/likes
  ecostar.biz/007/rb/01
  ecranlarge.com/films/news/932198-50-nuances-de-grey-jamie-dornan-bondage-et-cravate-sur-la-nouvelle-affiche
  ecranlarge.com/films/news/949717-xxx-3-vin-diesel-invite-les-actrices-de-vampire-diaries-et-orange-is-the-new-black
@@ -21667,6 +21688,7 @@ emma-watson.name/emma-watson-nude-a-dream-to-realize
  emmanuel.com.site.voila.fr/index.jhtml
  emmanuelle.buzznet.com/user/
  emmanuellerichard.com/Articles/ArticleScanBIS/Articlesscan/
+emmawatsonxxx.blogspot.com/2016
  emmypics.tumblr.com/post/105541810864/prettybabexxx-teen-porn-teen-sex-xxx-free
  emo-corner.com/emo-girls-pictures
  emotioner.com/socialparadise/fra
@@ -21699,7 +21721,6 @@ emulsie.blogspot.com/2019
  emustar.com/telecharger/telechargement_blagues
  emwritesfootball.tumblr.com/post/619313082435616768/ass-obsession-jesse-lingard
  emwritesfootball.tumblr.com/post/625327597819133952/threesomes-2-6-marcus-rashford-and-benjamin
-en-amp.erkiss.club/search/testicles
  en-la-penumbra.blogspot.com/2013
  en-navelstories.blogspot.com/2015/06
  en.alisaverner.com/gallery/erotic
@@ -22126,6 +22147,7 @@ erosisntpleasure.tumblr.com/post/47505034565/just-beautiful
  erosisntpleasure.tumblr.com/post/60324505000
  erosmind.tumblr.com/post
  erossa.com/banner
+erostocom.tumblr.com/following/page/2
  erot.org/menu
  erotic-beauty.over-blog.com/2015/10
  erotica-romance-ebooks.com/romance-and-erotic-ebooks
@@ -22133,15 +22155,18 @@ erotica-romance-ebooks.com/sommer-marsden
  erotica.actifforum.com/groupcp.forum
  eroticartgayblogs-blog.tumblr.com/post/123680813040/blog-masturbation-gay
  eroticartgayblogs-blog.tumblr.com/post/123680852395/homosexual-hung-cop
+eroticartgayblogs-blog.tumblr.com/post/123683366845/books-with-gay-males
  eroticartgayblogs-blog.tumblr.com/post/123765373290/homo-dragon-blowjobs
  eroticartgayblogs-blog.tumblr.com/post/123766984810/public-boys-sex-pic
  eroticartgayblogs-blog.tumblr.com/post/123845947230/gay-twink-ejaculation-gay
  eroticartgayblogs-blog.tumblr.com/post/123934067910/menvsboys-mature-meat
  eroticfilmincludingblackpussyp.blogspot.com/2009
  eroticismhooterscalendar.blogspot.com/2009
+eroticspacegirls.blogspot.com/2013/03
  erotik-web.via.t-online.de/schneefickchen
  erotik.infostore.org/info
  erotikossindiasmos.blogspot.com/2011
+erotikstoriesspanken.blogspot.com/2017
  erotikwebmaster.org/verlinkung
  erotiq4me.tumblr.com/post/138638817049/girlhavetoys-teen-masturbates-with-a-bed
  erotique.site.voila.fr/videoxxx
@@ -22198,6 +22223,7 @@ esclavemaitres.tumblr.com/post/133008216221/alphabet-de-lesclave
  escort-brussels.com/big-boobs-escorts
  escort-cyprus.blogspot.com/2019/12
  escort-galleries.com/wiki/softcore
+escort-in-netherlands.blogspot.com/2019/04
  escort-italia.org/adult-friend-finder
  escort-malta.blogspot.com/2019/04
  escort-transbellebrunaenfranceparis.blogspot.com/2014
@@ -22364,7 +22390,6 @@ estella.com/bf2004/legal/
  esterel.net/voila
  estetik-ameliyat.org/2006/12/15/burun-estetigi
  estetikabdsm.blogspot.com/2010
-esthetique-conception-blog.blogspot.com/2013
  estia.com/adult
  estore.surfnetcorp.com/store/UnlimitedBondage
  estrela-pleasures.blogspot.com/2019
@@ -23283,6 +23308,7 @@ faithbookjr.ning.com/profiles/blogs/6270731:BlogPost
  fajnecipki.pl/darmowe_filmy_erotyczne
  fajnecipki.pl/szukajporno
  fake-smile.org/cb
+fake-taxi.blogspot.com/2015
  fake.kir.jp/images/m
  fakeplastictits.tumblr.com/post/41772839153/striptease-bar-hot-sexy-young-naked-teen-with
  fakeposters.com/posters/fuck/
@@ -24782,6 +24808,7 @@ film.unblog.fr/2007/04/19/sexe-manga-videos-photos-gay-porno-foutre-sexe-transex
  film.unblog.fr/2007/04/20/petit-cul-videos-jolie-fille-porno-fellations-sexe-photo-de-pipe-fellation
  film.unblog.fr/2007/04/21/sexe-black-videos-belle-femme-porno-galerie-photo-femme-sexe-sperme-sexe-gratuit
  film.unblog.fr/2007/04/25/blonde-suce-petites-culottes-porno-gratuit-gang-bang
+filmamateur.top/video/3627/brunette-aux-film-amateur-x-gros-seins-et-chatte-ras
  filmaster.pl/tag/erotyczny/
  filmchest.com/film-chest/search-public-domain-films/filmlibrary/adult/Blonde-in-Bondage
  filmdeculte.com/culculte
@@ -24953,7 +24980,6 @@ firsttoknow.com/trans-womans-butt/
  fishscreensavers.net/wallpapers
  fist.porscheonline.com/puppy/homebrew
  fistfelt.tumblr.com/post/56353319024/asexuality-and-bondage
-fistingcentral.blogspot.com/2013
  fistingpornflicks.com/video/8333/young-girls-hard-anal-fisting
  fistprive.blogspot.com/2013
  fistybobmaster.tumblr.com/post/148536761021/thebpster-girliepoo-panty-pooping-teen-1
@@ -26033,6 +26059,7 @@ foxxytime.tumblr.com/post/138316866312/dongconsumer-artist-warmbodies-submitted
  foxxytime.tumblr.com/post/138384590492/scdk-nsfw-kyna-presenting-bunny-butt-smut-of
  foxxytime.tumblr.com/post/138385275756/chalodillo-requests-from-yesterdays-stream
  foxxytime.tumblr.com/post/99381396307/some-cute-adorable-adult-femboys-for-my-kitty
+foxykatniss123.tumblr.com/post/627583319721263104/tanjiro-gives-off-big-dick-energy-and-hed-be
  fozuhi29.blog.co.uk/2013/06/28/christa-miller-sex-video-jennifer-aniston-sex-tape-beatifies-the-16175492
  fozuhi29.blog.co.uk/2013/06/29/anne-heywood-fakes-miranda-cosgrove-topless-miranda-cosgrove-nude-picasso-16181071
  fozuhi29.blog.co.uk/2013/06/29/bonnie-bedelia-sex-maryse-ouellet-sex-tape-maryse-ouellet-nude-16181012
@@ -26691,6 +26718,7 @@ fravis777.tumblr.com/post/124809977815/postyournudewife-wifes-hairy-pussy-and-as
  fravis777.tumblr.com/post/125779492705/missexhibitionist-international-no-panty-day
  frboard.com/clip-xxx
  frboard.com/hd-bluray-xxx
+freakblows.blogspot.com/2011/12
  freakinthesheetzz.tumblr.com/post/137789503564
  freakinthesheetzz.tumblr.com/post/138087824152
  freakinthesheetzz.tumblr.com/post/138150525712
@@ -26786,7 +26814,6 @@ free-pics.wz.cz/b
  free-porn-pic-older-mature.blogspot.com/2004/08
  free-porn-video-porn-star.blogspot.com/2009/10
  free-porn-videos-sidvrd.blogspot.com/2020
-free-sex-photos-pornstar-pics.tumblr.com/post/617720534315188224/brittany-shaes-free-load-my-mouth-blowjob-porn-gallery
  free-si.hinet.hr/xxxsite/gallerys
  free-streaming-video-cumshots.the-science-lab.com/live
  free-streaming.org/free
@@ -27014,6 +27041,7 @@ freeflight.cockpit.be/samael
  freeflights.net/le69
  freeflights.net/libertinage
  freefootsexindianactress.blogspot.com/2009
+freeforallmrpron.blogspot.com/2011/12
  freefotolog.net/sexo__lindo
  freefullsex.blogspot.com/2011
  freefun.cz/online-hry-zdarma/eroticke
@@ -27065,6 +27093,7 @@ freeindianporn.mobi/trends/3d
  freeindianporn.mobi/trends/anal
  freeindianporn.mobi/trends/ass
  freeindianporn.mobi/trends/big
+freeindianporn.mobi/trends/centerfold
  freeindianporn.mobi/trends/cyber
  freeindianporn.mobi/trends/double
  freeindianporn.mobi/trends/group
@@ -27073,7 +27102,6 @@ freeindianporn.mobi/trends/pre-cum
  freeindianporn.mobi/trends/shemale
  freeindianporn.mobi/trends/softcore
  freejabber.com/femmemature1
-freeladyboypictures.com/categories/mature
  freelivepsychic.com/free_live_psychic
  freelivepsychic.com/psychic_reading_free
  freelivepsychicreading.com/live_psychics
@@ -27193,6 +27221,7 @@ freepicstogo.net/kali1
  freepicstogo.net/tara1
  freepornanimelesbians.blogspot.com/2016/11
  freepornforum.blogspot.com/2008/04
+freepornocentraletc.blogspot.com/2010
  freepornotubes.net/sl/searches/alley-bagget-hard-blowjob
  freepornsgirlspictures.blogspot.com/2013/01
  freepornstarpicturefreeeroti.blogspot.com/2009
@@ -27248,6 +27277,7 @@ freeteenpornvideos-blog.tumblr.com/post/123416599015/spanking-young-bandi
  freeteenpornvideos-blog.tumblr.com/post/123416748260/brazilian-teenager-blowjob
  freeteenpornvideos-blog.tumblr.com/post/123503673860/shaved-teenybopper-stripping
  freeteenpornvideos-blog.tumblr.com/post/123504324470/lady-pussy-feet
+freeteenpornvideos-blog.tumblr.com/post/123504759375/raven-virgin-titan-xxx
  freeteenpornvideos-blog.tumblr.com/post/123506537050/chubby-studentgirl-pics-and-videos
  freeteenpornvideos-blog.tumblr.com/post/123507681245/lesbo-adolescent-sex-lesbian-galleries
  freeteenpornvideos-blog.tumblr.com/post/123508162895/teenager-sexrussian-orgies
@@ -27328,6 +27358,7 @@ freewebx.com/adult/suckshy
  freewebz.com/shanersportfolio
  freeworldgroup.com/games
  freexxnx.pro/movies/x-rated-big-tits-girl-pussy-slap
+freexxxmovie.red/xxxresult
  freexxxpasswords247.blogspot.com/2020/01
  freeyellow.com/classifieds
  freeyellow.com/members/hifashions
@@ -27438,6 +27469,7 @@ frizou.org/perenoel
  frodon.20six.fr/frodon/art/102664899
  froggywithfries.tumblr.com/post/134648543896/sucking-penetration-erection-cock-thats
  froggywithfries.tumblr.com/post/137312481516/sucking-prostitution-exhibitionism-cum
+frolxoxegroqubo.blogspot.com/2011
  fromtop2bttm.blogspot.com/2013
  fromtop2bttm.blogspot.fr/2013
  fromworldsawaay.tumblr.com/post/136949675851/are-we-a-heterosexual-high-school-couple-yet
@@ -27543,6 +27575,7 @@ fulltimewebmaster.com/ftwm/
  fulltubexxx.pro/categories/110
  fullvictory.com/psd/./839
  fullvideos.net/teensexgame
+fumettisesso.blogspot.com/2017
  fun-hits.de/premiumbutton
  fun-one.de/kategorie/babes
  fun-room.com/blocks/relog.swf
@@ -28026,6 +28059,7 @@ galerie-des-marques.com/top/
  galerie-des-marques.com/xml
  galerie.umowieni.pl/1
  galiya-craft.blogspot.com/2012
+galleries-upskirt.blogspot.com/2005
  galleries.dinosentertainment.com/asia
  galleries.dinosentertainment.com/candy
  galleries.dinosentertainment.com/desire
@@ -28242,6 +28276,7 @@ gayathleticguy34.tumblr.com/post/617237045019082752/muscular-top-throatfucking-c
  gaybeachaction.tumblr.com/post/157097647039/hot-gay-sex-chat-httpxxxcamboyscom
  gaybedfantasy21.tumblr.com/post/173846747421/you-have-nowhere-to-run-bitch-report-handjob-gay
  gaybedfantasy21.tumblr.com/post/173847446041/a-fair-of-lust-big-cock-cums-large-fr-live-sex
+gaybondagemale.com/video/11253/sunnyleone-sunny-leone-in-sensuous-striptease
  gaybondagemale.com/video/17370/blessed-motherfucker-smashes-gorgeous-woman-in-the-forest
  gayboycash.com/2257.txt
  gayboymale78.tumblr.com/post/612789454601601024/doctor-twinks-and-boy-full-toulouse-go-and-get
@@ -28294,6 +28329,7 @@ gayfuckingboys-blog.tumblr.com/post/137988207487/fuck-fags-gay-men-boy-gallery-s
  gayfuckingboys-blog.tumblr.com/post/137988535572/big-queer-cock-penetration-cum-video-oral-sex
  gayfuckingboys-blog.tumblr.com/post/137988783302/twink-tickle-torture-video
  gayfuckingboys-blog.tumblr.com/post/138055115657/gay-au-naturel-men-blog
+gayfuckingboys-blog.tumblr.com/post/138055381172/black-gay-pee-white-boy-black-gay
  gayfuckingboys-blog.tumblr.com/post/138055401367/crazy-gay-fuckfest-college-jocks-sucking-gay
  gayfuckingboys-blog.tumblr.com/post/138056138977/sex-hd-sinful-gay-teens-who-gay-gay-teens
  gayfuckingboys-blog.tumblr.com/post/138056424802/chavos-gay-fotos-gratis
@@ -28356,6 +28392,7 @@ gayfuckingboys-blog.tumblr.com/post/138312173227/photos-gratuites-de-bite-gay
  gayfuckingboys-blog.tumblr.com/post/138312431567/blond-homosexual-male-penis-pics-oral-sex
  gayfuckingboys-blog.tumblr.com/post/138312575547/teen-cocks-gay-porn-boys-kissing-hardcore-sex
  gayfuckingboys-blog.tumblr.com/post/138313200962/denver-co-gay-strip-clubs-first-time-oral-sex
+gayfuckingboys-blog.tumblr.com/post/138313247412/gay-dragon-cockcom-oral-sex-black-man-black
  gayfuckingboys-blog.tumblr.com/post/138313622612/homo-and-homosexual-anti-violence-project-big
  gayfuckingboys-blog.tumblr.com/post/138313642667/gay-boys-small-yung-nude-asian-boy-media-video
  gayfuckingboys-blog.tumblr.com/post/138313868612/rape-gay-orgy-gay
@@ -28369,6 +28406,7 @@ gayfuckingboys-blog.tumblr.com/post/138375549172/gay-x-men-pics-men-pics-suck-co
  gayfuckingboys-blog.tumblr.com/post/138375645452/hot-blonde-gay-hunk
  gayfuckingboys-blog.tumblr.com/post/138375732282/gay-94-exhib-sucking-dick-anal-sex-gay
  gayfuckingboys-blog.tumblr.com/post/138375889622/daniel-radcliffe-having-boy-sex-de-gay-boy
+gayfuckingboys-blog.tumblr.com/post/138375921332/enola-gay-groupe-gay-group-gay-photos-enola
  gayfuckingboys-blog.tumblr.com/post/138376273252/black-guy-round-ass-oral-sex-black-man
  gayfuckingboys-blog.tumblr.com/post/138376434732/twink-teens-porn-free-movies
  gayfuckingboys-blog.tumblr.com/post/138376634582/erotic-gay-xxx-stories-erotic-gay-oral-sex
@@ -28378,6 +28416,7 @@ gayfuckingboys-blog.tumblr.com/post/138377680222/gay-dvd-thai-bath-house-guys-ge
  gayfuckingboys-blog.tumblr.com/post/138377799557/original-gay-movie-suck-each-gay-movie-gay
  gayfuckingboys-blog.tumblr.com/post/138377911512/blogger-closes-gay-blogs-meet
  gayfuckingboys-blog.tumblr.com/post/138377927532/at-liberty-gay-porn-gay-cinema-music-hall
+gayfuckingboys-blog.tumblr.com/post/138378141982/uncut-dick-live-guys
  gayfuckingboys-blog.tumblr.com/post/138378360227/detroit-fuck-city-27-gay-porn-twinks-gay
  gayfuckingboys-blog.tumblr.com/post/138378552972/fetish-free-homo
  gayfuckingboys-blog.tumblr.com/post/138378619277/free-gay-teen-videos-xxx
@@ -28408,7 +28447,6 @@ gaymenpornclassy.tumblr.com/post/132571105977/free-boys-teenage-erotic-stories-b
  gaymusclenudist55.tumblr.com/post/190665317866/muscular-hunks-wrestling-in-foursome-ronks-join-to
  gaynakedhairy53.tumblr.com/post/620808161589362689/handsome-hairy-gay-enjoys-nice-session-crane-hill
  gaynakedhairy53.tumblr.com/post/622659355255422977/hung-hairy-dude-petting-a-twink-eckert-get-them
-gaynakedhairymen.blogspot.com/2016/05
  gaynakedphotos86.tumblr.com/post/632558844054257665/best-men-at-pylon-run-2018-reutlingen-get
  gaynakedphotos86.tumblr.com/post/632563888208150528/ebony-wrestling-dude-cocksucked-by-group-ohlman
  gaynirvana.com/free
@@ -28662,6 +28700,7 @@ georgettabettis.unblog.fr/2013/10/12/understanding-vital-factors-for-creampie-po
  georgiahancock29.tumblr.com/post/118007424106/flaming-clitoris-but-guys-this-fucked-me-up-so
  georgianamerica.com/forum
  gerarddesuresnes.com/topic/2741-photosbonasses
+gerianna2923helme66.tumblr.com/post/36847925505/hentai-parody-official-porn-edition-famous
  germandream.org/teensinjeans/
  germangayboyfuck-blog.tumblr.com/page/2
  germangayboyfuck-blog.tumblr.com/post/119145585909/sexy-homosexual-amateurs
@@ -29021,7 +29060,6 @@ girlhealth.org/our_bodies/teen_pregnancy
  girlhotpic.com/jeune-fille-avec-une-chatte-poilue-se-masturbe-et-mouille-wallpaper
  girlhunter.blogvis.com/2009/01/08/free-hardcore-xxx-movie-clip
  girlhunter.blogvis.com/2009/01/08/free-lesbian-sample-sex-video
-girll-blonde-escorte.blogspot.com/2011
  girlpower.it/sex
  girls-emo.com/tag/sex-emo-girl
  girls-girls-inweb.com/1223744
@@ -30134,6 +30172,7 @@ groups.yahoo.com/phrase/sylvia-saint-movies
  groupsex-bbw-2013.blogspot.com/2014
  groupsex-blonde-sex-2013.blogspot.com/2015/01
  groupsex-movies.com/en/gang-category
+groupsex-movies.com/en/hosted/iq726a607e7d78707d1b181e492d20
  groupsex-outdoor-porn-2013.blogspot.com/2014
  groupsex4k.com/upskirt
  groupsharcore.com/lola/pics/15
@@ -30690,7 +30729,6 @@ hands-o-gold.tumblr.com/post/73531268364/shortvideos-mature-women-handjob-ejacul
  handsoftime.com/13
  handsoftime.com/anime
  handsomedogs.com/post/137717292037/thordog-pit-bull-terrier-dalmatian-mix-adult
-handsomenakedhunks.blogspot.com/2018
  handy.dynip.com/pennypussy
  handyarchive.com/Desktop/Screensavers
  handyarchive.com/free/blondes-stripshow
@@ -30750,7 +30788,6 @@ hardbaregays-blog.tumblr.com/post/157963223554/encasement-in-fishnet-bondage-soc
  hardboycockus.tumblr.com/post/130441142933/gay-hunk-in-drag-big-dick-uncut-cock-anal-sex
  hardcore-blonde-sex-2013.blogspot.com/2015
  hardcore-fucking.blogspot.com/2005
-hardcore-porno.blogspot.com/2005
  hardcore-titten.com/pornno-maroc-video-de-q-champagne-lesbian-facesitting-rencontre-femme-sexy-pensol
  hardcore-vids.net/4
  hardcorebimbosfuckingvideos.tumblr.com/post/169111940983/fappqueens-analamateursex-f-a-p-q-u-e-e
@@ -30851,6 +30888,8 @@ hdvideosporn.net/porn/alley-baggett-pussy
  hdvideosporn.net/porn/bdsm-gangbang-sasha-grey
  hdvideosporn.net/porn/close-up-intercourse
  hdvideosporn.net/porn/cocksucker-babe-sativa-rose-anal-creampie-sex
+hdvideosporn.net/porn/devils-film-snuff-gangbang-bbc
+hdvideosporn.net/porn/forced-rape-close-up
  hdvideosporn.net/porn/hustler-tv-sex
  hdvideosporn.net/porn/lickin-pussy-by-dick
  hdvideosporn.net/porn/necrophilia-video
@@ -31171,6 +31210,7 @@ heretik.net/music/stream%20redir/Beuns%20live%20Hardfloor.ram
  heretik.net/music/stream%20redir/Krs%20mix%20hardtekno.ram
  heretik.net/music/stream%20redir/Limka%20mix%20Hardtekno.ram
  heretube.com/most-popular
+herhighnessthequeen.tumblr.com/post/164178662855/real-life-hoe-tips
  herin2ism.in2ism.com/HER
  herlifeofsex.blogspot.com/2010/08
  hermes.spaceports.com/~poepzooi/film.html
@@ -31565,6 +31605,7 @@ holepleasures-blog.tumblr.com/post/143035071458/ass-sex-lesbain-or-gay
  holepleasures-blog.tumblr.com/post/143035086963/local-guy-sex-personals-find
  holepleasures-blog.tumblr.com/post/143035166408/allyson-paflas-gay-homosexual-marriage
  holepleasures-blog.tumblr.com/post/143035332873/jeff-gay-creampie
+holepleasures-blog.tumblr.com/post/143035348383/queer-masterbation-techniques-for-men
  holepleasures-blog.tumblr.com/post/143035556533/youporn-download-gay-porno
  holepleasures-blog.tumblr.com/post/143035571568/examines-anti-queer-violence
  holepleasures-blog.tumblr.com/post/143035664798/gay-ageing-handjob
@@ -32618,6 +32659,7 @@ homomenporn-blog.tumblr.com/post/133304984245/gay-xxx-movies-unconfined
  homomenporn-blog.tumblr.com/post/133305651565/twink-porn-bareback-rape-free
  homomenporn-blog.tumblr.com/post/133308325755/gayvideo-free-gay-porn-compilation
  homomenporn-blog.tumblr.com/post/133625322850/boy-latin-men-photos/amp
+homomenporn-blog.tumblr.com/post/133626883040/gaunt-calvous-twink
  homomenporn.tumblr.com/page/2
  homorazzi.com/article/masturbation-gay-guy-about-porn-lube-website-frequency
  homorazzi.com/article/rihanna-te-amo-lesbian-bondage-laetitia-casta-supermodel-music-video-gay
@@ -32845,6 +32887,7 @@ hotdesiclips.com/video/sunny-leone-making-69-position-with-husband-for-cumshot
  hotdesimovs.com/movies
  hotdogsforallmeals-deactivated2.tumblr.com/post/9242379133/ocelotjimwi-damn-gayporn-gay-porn-hung
  hotdot38.tumblr.com/post/117381345643/girls-who-love-masturbation-girls-who-love-to
+hotelescortservices.com/air-hostess-escorts-in-jaipur
  hotelmaco.spar.ge/melida3544
  hotelsiar.com/a-up-they-prostitute-patrons-adult-webcam-chat-of/
  hotelysia18.com/fsm/06
@@ -32899,6 +32942,7 @@ hotmax.pl/sexi_bitch166
  hotmax.pl/shemale_monika
  hotmax.pl/shemale_warsaw
  hotmodelvideos.piczo.com/?cr=5&rfm=y
+hotmommysonya.blogspot.com/2008/09
  hotmoms247.tumblr.com/post/128781256465/fuck-a-horny-milf-tonight-httpbitly1kivvdi
  hotmovies.linux-dude.com/download
  hotmoviesforher.blogspot.com/2007/08
@@ -32938,6 +32982,7 @@ hotvidsnguys.tumblr.com/post/25720458734/hot-fucking-threesome-so-much-cumswappi
  hotvidsnguys.tumblr.com/post/39042501512/brian-gets-fucked-large-cum-shots-from-both-the
  hotwhispering.tumblr.com/post/7497267060/masturbation-monday-morning-workout
  hotwife82.tumblr.com/post/138191883428/reblog-if-you-would-love-to-suck-my-wifes-tits
+hotwifecaps.com/search/public
  hotwifecpl4fun.tumblr.com/post/71515792964/amateur-porn-star-blonde-gets-black-cock-stuffed
  hotwifedc.tumblr.com/post/145960645236/novaswingers-hot-as-fuck-is-right-holy-shit
  hotwifedfw1.tumblr.com/post
@@ -33314,9 +33359,11 @@ iamlost.com/features/films_fuckmymonkey
  iamlost.com/features/fuckingpeas
  iamlost.com/features/pornking
  iamlost.com/features/robotporn
+iamsissylexi.tumblr.com/following
  iamthewolfofmetal.tumblr.com/post/153362971849/basically-i-want-me-breeder-girls-to-go-through
  iamtom.multiply.com/journal/item/29
  ianag.com/arcade/
+iand23.tumblr.com/following/page/4
  iaqi.com/entertainment
  ibadteencamxfan.tumblr.com/post/160668962637/nude-teen-cam-girls
  ibag.com/brandys
@@ -33333,6 +33380,7 @@ ibelgique.ifrance.com/pilou-pilette
  ibelgique.ifrance.com/sm2002/
  iberomedia.net/sexotecaonline
  ibgmails.blogspot.com/2019/12
+ibgmails.blogspot.com/2020/04
  ibgmails.blogspot.com/2020/08
  ibgmails.blogspot.com/2020/09
  ibgmails.blogspot.com/2020/10
@@ -34703,6 +34751,7 @@ iloveyourbitch.tumblr.com/page/3
  ilrosso.com/images
  ilsawolfss.tumblr.com/post/85635578444/dominatrixwhore-i-am-a-fucking-fetish-dominatrix
  ilsgcash.com/iloveschoolgirls
+iluvnarry.tumblr.com/post/54206122112/preference-82-threesome-with-a-girl-liam
  ilventodellaresistenza.blogspot.com/2012/07
  ilvnylnft.tumblr.com/following/page/2
  im9.eu/album/join-ass-porn-ftv-gorgeous-adult-solo-hot-petite
@@ -35170,6 +35219,7 @@ inarticulate-sour.tumblr.com/likes
  inbedwithyou.com/videosales/
  inblogs.net/swingers-alt-sex-blog
  incdb.org/ponysex-free-sex-animal-movies-tiersex-horsesex-ebony
+incesteporno.me/fr/search/U2hlbWFsZQ/popular
  incesteporno.me/fr/search/YnJ1dGFsIHJhcGUgZGVhdGggdmlvbGVudCBhc3N1YWx0IHJvdWlnaCBzbnVmZg/popular/1
  incesteporno.me/fr/search/Z3Jhbm55IHRocmVlc29tZQ/popular/1
  incestlover30.tumblr.com/post/95196024798/nude-shoutouts-my-ejaculation-video-enjoy
@@ -35997,7 +36047,6 @@ ixpres.com/hackula/porn
  ixxjayi.tumblr.com/post/110112572637/bigdick-riding-boyfriends
  ixxxgay.com/tag/bisexual-masturbation
  ixxxmovs.com/category/8e237e607a7d7d6c691e1e19
-ixxxteen.com/fr/xxxsearch
  izaya--orihara.tumblr.com/post/22723192362/give-me-a-fetish-and-ill-tell-you-how-i
  iziblog.net/users/videoamatrice
  iziblog.net/users/xamat
@@ -36155,6 +36204,7 @@ jasongood.net/365/2012/05/from-breasts-to-boobs-and-back-again
  jatahbokep.blogspot.com/2019/06
  jaunfr.iquebec.com/archives
  jav-dvd-download.blogspot.com/2011/12
+jav18star.blogspot.com/2016/05
  java.m6world.com/michelle1515
  javagames.com.ru/buyxanax
  javanet.com/~mrwrite
@@ -36643,7 +36693,10 @@ joshpeckofficial.com/post/127901362103/i-am-great-at-multitasking-i-am-both-cute
  joshrocket.net/g
  joshslater.tumblr.com/likes
  joshuaellerbe61-blog.tumblr.com/free-blonde-blowjobs-videos
+joshuaellerbe61-blog.tumblr.com/you-tube-hot-sex-video
  josporn.com/videos/3349-blonde-with-big-milkings-and-group-sex-brunette
+jotaros-massive-tiddies.tumblr.com/post/190456316589/would-you-mind-doing-a-smut-request-for-the-circle
+jotaros-massive-tiddies.tumblr.com/post/190586926449/my-love-i-need-to-cry-laugh-my-ass-off-and-be
  jotaros-massive-tiddies.tumblr.com/post/624801938774605824/josephs-hot-and-horny-phone-call-joseph
  jotleaf.com/mishasexual/mishas-left-titty
  jotleaf.com/slut-hutt.tumblr.com
@@ -36830,6 +36883,7 @@ jurisexpert.net/blogs/
  jus22blr.tumblr.com/post/53427049028/http-big-horny-pussy-gif-tumblr-com
  jusdunet.com/sexe-adultes-uniquement/galeries-dimages
  just-a-girly-guy.tumblr.com/post/138879456372/im-a-sissy-bisexual-diaper-and-chastity-bitch
+just-a-sissy.tumblr.com/following
  just-bin-things.tumblr.com/post/186996759286/pegging-degration-oral-both-receiving
  just-feminist-stuff.tumblr.com/post/82629226695/poilue
  just-young.com/members
@@ -37144,7 +37198,6 @@ kasinkojicg2.tumblr.com/post/202450092/bdsm-blush-bondage-catheter-censored-clit
  kasitodo.com/komomola
  kaskusxxx.blogspot.com/2012/01
  kasmohuxxx-blog.tumblr.com/post/51626664430/a-stalking-xxxperience-starring-amazing-aura
-kasumi-hardcoree.blogspot.com/2011
  kat-is-a-cross-dresser.tumblr.com/following
  kat.ph/search/amatuer
  kat.ph/search/bdsm
@@ -37378,6 +37431,7 @@ kingpub.com/dorm/pics2/christy
  kingpub.com/dorm/pics2/hope
  kingpub.com/dorm/pics2/stacey
  kingragnar22.tumblr.com/following/page/2
+kingrudy52.tumblr.com/following/page/21
  kingshark340.tumblr.com/post/110715322606/lonelyblkmn43-alliwantispussy-tru-freak
  kingsnake.com/donpatterson
  kingsnake.com/saherpsociety/beautypageant
@@ -37875,6 +37929,7 @@ kpop---smut.tumblr.com/post/185775969773/special-delivery-m
  kpop-dungeon.tumblr.com/post/620130557986324480/at-your-mercy-sadisteunwoodongmin-x
  kpop-dungeon.tumblr.com/post/625728871948582912/dolly-sadistjungkook-x-you
  kpop-dungeon.tumblr.com/post/625910594858582016/ooooh-minho-panty-kink-pleaaaase
+kpopanimeluvwriter.tumblr.com/post/169080855030/sinful-desires
  kpopholicbobbylove.tumblr.com/following
  kpopwishes.tumblr.com/post/165694326236/youre-mine-subaek-smut
  krak.com.ar/adultos-erotico/
@@ -37997,6 +38052,7 @@ kwalayteng.blogspot.com/2019
  kwbrowse.com/pages
  kwic.com/~rbilton/palace
  kwikie.tumblr.com/post/102889662338/sexxxualdesires-no-bra-day
+kwint77.tumblr.com/page/2
  kwmap.com/pages
  ky-nsfws-sanders-sides.tumblr.com/post/189170180322/kinktober-22-masturbation-everyone-fucking/amp
  kyelewis.info/go/guestbook
@@ -38102,7 +38158,6 @@ lady-claire-bdsm-lesbian-nude-sports.blogspot.com/2012/04
  lady-gaga-nipple-long-hairy-pussy.blogspot.com/2012/01
  lady-gaga-nipple-long-hairy-pussy.blogspot.com/2012/04
  ladyboyloversinc.tumblr.com/post/143123881734/live-shemale-chat-httpxxxtrannycamscom
-ladyboysbareback.blogspot.com/2012
  ladycheeky.wordpress.com/2012/08/29
  ladycrappo.com/post/111692848841/facets-its-hard-to-paint-straight-lines-on
  ladycrappo.com/post/132686858226/regal-as-fuck
@@ -38325,6 +38380,7 @@ lavishavenue.com/collect/girls/
  lavishedinjimin.tumblr.com/post/181976309912/bts-reaction-first-time-seeing-you-in-a-lingerie
  lavishedinjimin.tumblr.com/post/186583764147/bts-reaction-getting-caught-having-sex-by
  lavishedinjimin.tumblr.com/post/188315991277/could-i-request-where-rms-been-teasing-you-all
+lavishedinjimin.tumblr.com/post/612998682600751104/imagine-jungkook-fucking-you-hard-in-his-bed-while
  lavishedinjimin.tumblr.com/post/620519646863441920/ddlg-yn-gives-jk-a-blowjob-while-hes-on-the
  lavishedinjimin.tumblr.com/post/622856838700007424/face-sitting-demon-jk-with-horns-like-a-steering
  lavishedinjimin.tumblr.com/post/624316205412564992/overstimulation-and-clit-torture-with-jk-maybe
@@ -38611,7 +38667,6 @@ lepost.fr/tag/masturbation
  lepost.fr/tag/sexy
  leprikan.tumblr.com/post/110790673071/nudeathleticbabes-threesome-fuck-orgy-porn
  leprincesskitten.tumblr.com/post
-leprosys.info/amateur
  lerenardmalin.com/video
  les-blogues.com/podiom
  les-cheriz.tumblr.com/post/110881176153/xxx-mature-sluts-horny-mature-sluts-live-on-free
@@ -38652,6 +38707,7 @@ lesbiansportsvideos.com/index.html
  lesbiennes-coquines.net/1
  lesblogueuses.blog.parents.fr/2007/02/15/comment-reagir-face-a-la-violence
  lesbovrouven.com/jereviensgenevieve/
+lesbranches78.blogspot.com/2015
  lesbrary.com/2015/11/
  lesbrascasses.fr-bb.com/Partie-Privee-entre-manchots-c5/Vos-meilleurs-moments-f12
  lescalator.tribalix.com/archives/2004/03/26/ceci-est-un-post-normal-sur-mon-existence
@@ -38690,6 +38746,7 @@ lessaintescheries.be/tout-est-une-question-de-point-de-vue
  lessthanthreebaileyjay.tumblr.com/following/page/2
  lestatthecupcakeprince.tumblr.com/post/101561324416/a-guide-to-kinks-fetishes-and-fantasies-tw
  lesvideosdecul.com/tag/amateur
+lesvideosdecul.com/tag/face-sitting
  let-explicit.tumblr.com/post/111313066467/prettygayboys-similar-posts-here-snapchat-me
  let-me-surrender.tumblr.com/post/128908529581/brutal-whore-degrader-ride-my-fucking-dick
  let-me-watch-you.tumblr.com/post/73295324234/him-about-to-fuck-hers-perfect-pussy-us
@@ -39469,6 +39526,7 @@ loose-weight.weight-loss-central.org/related:weight-loss.weight-loss-central.org
  loose-weight.weight-loss-central.org/weight-
  loose-weight.weight-loss-central.org/weight-training-
  loose-weight.weight-loss-central.org/weight-watchers-
+lope026.blogspot.com/2020
  lopgji.blogspot.com/2009
  lopgji.blogspot.com/2011
  loquemegustaynomegusta.blogspot.com/2018/04
@@ -39729,6 +39787,7 @@ lovetransit.com/couple/comment-rendre-fou-homme-au-lit
  lovetravellife.com/a-guide-to-the-japanese-sex-industry/
  loveyummy.exblog.jp/666949
  lovezoo.org/members
+loving-the-1d-boys.tumblr.com/post/52334438952/hate-that-i-want-you-pt-iii
  lovingpeople.net/lovingdating
  lovingthesissies.tumblr.com/post/132446996211/duckladyboy-trans-tranny-blowjob-self-sucking
  lovingyou.com/content/sex
@@ -40351,7 +40410,6 @@ magnifind.net/XML/http%253A%252F%252Fwww.sexe-x69.com%252Fxxx%252F
  magnumdad.tumblr.com/post/82904864500/mister-shemale-nipple-clamps-feel-so-damn
  magrossesse.com/article/la-fellation
  magshoppe.com/coolpussies
-magsxxx.blogspot.com/2012/03
  maguiredescribes.ga/12641-adult-tgp-sex-gratuit
  maguly47.soup.io/post/355558672
  maguly47.soup.io/post/356879901
@@ -40445,6 +40503,7 @@ malehotnessguys.tumblr.com/post/116779712500/xxx-boy-black-dick-cumshots
  malehotnessguys.tumblr.com/post/116780600890/gallery-twinks-gay
  malehotnessguys.tumblr.com/post/116780935640/hombres-superdotados-guy
  malehotnessguys.tumblr.com/post/116782553295/gay-porn-galleries-free-teen
+malehotnessguys.tumblr.com/post/116782747545/gay-anal-cum-sex
  malehotnessguys.tumblr.com/post/116782890720/nude-free-twink-teens
  malehotnessguys.tumblr.com/post/116868740235/hairy-gay-bear-fuck
  malehotnessguys.tumblr.com/post/116868893085/gay-hot-men-naked-sexy
@@ -40574,6 +40633,7 @@ manhattan.backpage.com/FemaleEscorts/sexy-girl-next-door-kinky-playmate-nude-mas
  manhattandigest.com/2013/04/05/sex-ed-increasing-volume-of-ejaculation-with-orgasm-is-it-possible
  manhelper.com/dating_sex/5_signs_that_tell_shes_horny
  manhost.com/spunkys/
+maniaentertain.blogspot.com/2020
  maniatv.com/video/Hollywood-Minute-3-Granny-Panties-07-16-07
  manila.backpage.com/Datelines/busty-sexy-katherine
  manilabeta.userland.com/sandbox/discuss
@@ -40864,12 +40924,10 @@ mattymacc.tumblr.com/post/131897572470/hotgaymales-getting-nude-outside-and-some
  maturbationation.tumblr.com/post/119679871374/sensual-sexxx-fckinglikerabbits-i-swear-this
  mature-bot.com/hq/posing
  mature-fuck-young-chubby-pussy-mastur.blogspot.com/2011/10
-mature-granny-cougar-sex.blogspot.com/2009
  mature-pic-post8883.blogspot.com/2003/06
  mature-stockings-hax-blog.tumblr.com/post/12376174411/leading-news-about-stockings-mature
  mature-stockings-hax-blog.tumblr.com/post/12385320149/stockings-mature-latest-news
  mature-upskirts.blogspot.com/2005
-mature-videos-d.tumblr.com/post/104587064136/mature-videos-rss/amp
  mature.dyndns.org/mature
  maturebubble.com/gallery/hot-and-horny-mom
  maturecams.com/landing/templates
@@ -40877,7 +40935,6 @@ maturefishka.org/index.php
  maturelover69.tumblr.com/post/99259347855/bbwgothcumsex-anal-closeup-here-is-the-free-hq
  maturemenoftvandfilms.tumblr.com/post/613103958908682240/featuring-actor-hugh-bonneville-back-in-2012-i
  maturen2.tumblr.com/post/109361226998/beachbatorfucker-cocksucker-sucking-me-during
-matureoxbustyoxredhead.blogspot.com/2009
  maturesoverfifty.blogspot.com/2012/06
  maturestunners.tumblr.com/post/71954909801/hotmaturepic-babes-lingerie-erotic-pics
  maturewhisper.tumblr.com/post/9206624262/lingerie-milf-handjob-ejaculation
@@ -41277,7 +41334,6 @@ meetic.orange.fr/signup
  meetmeup.de/animexchange/exchange
  meetpeopleonline.biz/?rid=573083
  meetpeopleonline.name/?rid=948014
-meetthehumpers.blogspot.com/2011
  meetup.com/embed/largest/adultent
  meetup.com/lasloveshack
  meetup.com/san-diego-bisexual-women
@@ -41434,6 +41490,7 @@ melbourne.gumtree.com.au/c-Friends-Dating-casual-relationships-guys-seeking-girl
  melinamason-deactivated20130619.tumblr.com/post/11815621376/shower-sex-with-clubcarmenxxx-so-steamy-3
  melis.com/orgetorix/francis
  melis2.com/the-bondage-breaker-interactive-workbook
+melissa-joan-hart.blogspot.com/2011
  melissa21017.tumblr.com/post/133432384063/milf-melissa
  melissalincoln.org/melissalincoln
  mellange.upf.es/portal_memberdata/portraits/mkesselman
@@ -42841,7 +42898,6 @@ mila-nice.tumblr.com/post/143892532721
  milam.net/~pa12
  milano.mentelocale.it/30615-sesso-a-milano-locali-hot-lap-dance-striptease-e-club-prive
  mildlyrelevantthoughts.com/2010/03/michael-steeles-lesbian-sex-bondage-fetish
-milf-gangbang-masturbation-orgy-2013.blogspot.com/2014
  milfhunter.cz/video/15497/jynx-maze-hardcore-foot-fetish-daily-the-1-foot-fetish-site-on-the-internet
  milflatinacama.blogspot.com/2020/04
  milfophilia.tumblr.com/post/95268335394/mature-ladies-extreme
@@ -44156,9 +44212,11 @@ moviesxxxporn-blog.tumblr.com/page/2
  moviesxxxporn-blog.tumblr.com/post/127035469584/frlust-av-titeln-old-schoolgirl
  moviesxxxporn-blog.tumblr.com/post/127038871199/download-video-adolescent
  moviesxxxporn-blog.tumblr.com/post/127196767359/cutie-porn-tube-relax
+moviesxxxporn-blog.tumblr.com/post/127198243539/average-american-teenage-spends
  moviesxxxporn-blog.tumblr.com/post/127200038349/pussy-naked-lovely-studentgirl
  moviesxxxporn-blog.tumblr.com/post/127200255524/byoung-girl-asks
  moviesxxxporn-blog.tumblr.com/post/127274969184/underweight-virgin-girls-live-well-nhs
+moviesxxxporn-blog.tumblr.com/post/127278089874/se-youthful-sex
  moviesxxxporn-blog.tumblr.com/post/127278232304/questioned-whether-teenage
  movieteensex-blog.tumblr.com/page/2
  movieteensex-blog.tumblr.com/page/3
@@ -44250,6 +44308,7 @@ mrgetyasome.tumblr.com/post/40916765843/striptease-bar-holy-masturbation-anal-fu
  mrgoldsdearie.tumblr.com/post/173365624826/show-us-how-hard-you-can-fuck-yourself
  mrhelmethead.com/teenpuss
  mrhut.nl/pornomatie
+mrishmael.blogspot.com/2013
  mrishmael.blogspot.com/2015/07
  mrjlovestoplay.tumblr.com/post/126757324885/nudeathleticbabes-fuck-fellation-lingerie
  mrkite.wizardtech.net/newposts
@@ -45239,7 +45298,6 @@ mysticalsharkvoidpurse.tumblr.com/following
  mysticdaddies.tumblr.com/post/154917245907/rfavsaeransex-toys-favorite-positions-obvi
  mysticfurry.tumblr.com/post/125964388004/sexy-females
  mysticmessenger-fic.tumblr.com/post/152054822107/how-they-punish-mc-spanking-orgasm-denial-ect
-mystrangetfs.blogspot.com/2018
  mystyle.com/mystyle/photos
  mysubdiary.tumblr.com/post/127103655774/newsubgirl
  mysubmissivelife.blogspot.com/2016
@@ -45767,6 +45825,7 @@ naughty12275.tumblr.com/following/page/14
  naughtyandnicelingerie.com/product/lux-fetish-couples-roleplay-adult-novelty-perfect-penetration-bedroom-toy-kit
  naughtyb69.tumblr.com/post/107008775290/xxxselfshotsxxxlove-mature-tube-porn-xxx-milf
  naughtyboyscorner.tumblr.com/post/106354032801/speedy
+naughtydiapergirls.blogspot.com/2010/11
  naughtydinner.tumblr.com/post/130942778659/ada-sanchez-mia-khalifapart-1
  naughtyflavours.tumblr.com/post/37372294955
  naughtyjulie.tumblr.com/post/103716207911/a-little-ass-fingering-in-the-hotel-lobby-is-good
@@ -45786,6 +45845,7 @@ naughtyteengirlsme-blog.tumblr.com/post/125472964490/names-of-girl-men-in-east-m
  naughtyteengirlsme-blog.tumblr.com/post/125474139365/amature-lovely-blogs
  naughtyteengirlsme-blog.tumblr.com/post/125474180555/young-bbw-free-porn
  naughtyteengirlsme-blog.tumblr.com/post/125474359975/cyber-sex-youngest-chatroom
+naughtyteengirlsme-blog.tumblr.com/post/125474378625/lovely-birth-rate-declined
  naughtyteengirlsme-blog.tumblr.com/post/125474436750/lady-babe-sucking
  naughtyteengirlsme-blog.tumblr.com/post/125474513540/topless-maiden-russian-photos
  naughtyteengirlsme-blog.tumblr.com/post/125474552625/teens-short-shorts-pictures
@@ -46107,6 +46167,7 @@ new-prod.com/www/cttc
  new-tranny-videos.com/category_with_shemales
  new-xxxmovies.com/fr
  new-xxxmovies.com/niche/iq726a607e7a7f70731d19
+new-xxxmovies.com/tag-xxx/busen
  new-xxxmovies.com/tag-xxx/hidden
  new-xxxmovies.com/tag-xxx/nymphomaniac
  new-xxxmovies.com/xxx-girl
@@ -46474,7 +46535,6 @@ no-bug.com/dossiers/erotisme
  no-bug.net/dossiers/erotisme
  no-matter-what-bh.tumblr.com/post/116416983638/list-of-possibly-sexual-forms-of-intimacy
  no-more-cream.tumblr.com/post/152757166938/spin-the-bottle
-no-nude-teen.blogspot.com/2006
  no-problem.com.pl/jpg_00
  no-problem.com.pl/jpg_1
  no-problem.com.pl/jpg_2
@@ -46874,7 +46934,6 @@ nude-porn-stars.blogspot.com/2005
  nude-scuba-diving.searchmole.co.uk/search
  nude-sky-diving.searchmole.co.uk/search
  nudebeaches.spicycities.com/babes
-nudebodybuildingclitring.blogspot.com/2009
  nudebrazilianwomanprivacy.blogspot.com/2009
  nudefemalebodybuildersli.blogspot.com/2009
  nudefemalescelebrities.blogspot.com/2014/04
@@ -47209,6 +47268,7 @@ okmagazine.com/photos/lindsay-lohan-naked-photos-instagram-nude-pictures
  okmagazine.com/photos/top-beach-bodies-of-2015-check-out-the-best-boobs-and-butts
  okonet.com.pl/~dora
  okoninjah.tumblr.com/post/159106146976/i-like-eating-pussy-i-like-fucking-i-love-it-in
+oktyabyr.tumblr.com/following
  olapcouncil.org/amatuer_incest
  olapcouncil.org/bondage_rape
  olapcouncil.org/gangbang_rape
@@ -47335,6 +47395,7 @@ onamission.com/Adult/Image_Galleries
  onashortleash.tumblr.com/post/132676490248/collared-sluts-on-the-leash-xpost-from
  onashortleash.tumblr.com/post/132676504413/collared-sluts-not-too-secure-but-she-wont
  onceuponacollar.tumblr.com/masterlist
+onceuponaman.blogspot.com/2009/09
  onceuponatimeinthenight.tumblr.com/post/92042246474/bdsmbondage-lesbian-dominatrix-is-turned-her
  ond.vein.hu/~buba/girls
  ondinedlove.tumblr.com/post/103231975221/quand-jy-mets-les-doigts
@@ -47345,8 +47406,6 @@ one-thirty-seven.net/xxx
  one.revver.com/find/keywords/breast
  one.revver.com/find/keywords/upskirt
  one2onewebcam.com/fr/
-one3onelords.blogspot.com/2012
-one3onelords.blogspot.com/2014
  oneatlanticevents.com/blowjob-iwlmsvill
  onebigworld.co.uk/ukdirectory/n/adult-business/1p19
  oneby2.blogspot.com/2011
@@ -48246,7 +48305,6 @@ pansehange.blogspot.com/2008
  pansexy.com/blog/post/84
  panstudio.com/celebritystop
  panther7777.tumblr.com/post/157738905579/tightpussygrip-amazing-pound-that-pussy
-pantie-bulge.blogspot.com/2012
  pantiesteasekitten.tumblr.com/post
  pantin.wannonce.com/rencontres-adultes-85/
  pants-off-boys.tumblr.com/post/134792920975
@@ -48618,6 +48676,7 @@ paraguayy.com/paraguay-paraguay/paginas-para-adultos/
  paraguayy.com/paraguay-paraguay/servicios-sexuales/
  paraguayy.com/paraguay-paraguay/venta-videos-fotos-adultos/
  paraiso-brasileira.blogspot.com/2014/06
+paraiso-brasileira.blogspot.com/2014/07
  paranoia.com/~kevintx
  paranoia.com/~nudeclub
  paranoyia.dnsalias.com/nudecelebs
@@ -48800,6 +48859,7 @@ paris.vivastreet.fr/annonces-rencontre-lesbienne
  paris.web66.com/euni
  parisbabe-00.tumblr.com/post/137224299166/lesbians-run-the-world-download-her-meet-girls
  parisfree.com/sexe
+parishiltonsexyactresssinger.blogspot.com/2017
  parishiltonus.com/parishiltonpictures
  parken.cusoon.dk/hanna5032
  parklivekit.blogs.oceancity.com/2007/12/29/free-lesbian-sex-city-kayesilk-initiation-jazmine
@@ -48908,6 +48968,7 @@ pawsit.com/17106
  pay-popup.com/celeb
  pay.darkmedia.it/loading/it
  paydates.tumblr.com/post/60992631492/wannabeyourfuckpig-busty-bbw-prostitute
+payetapolice.tumblr.com/page/3
  payetoncouple.tumblr.com/./les-actrices-
  payetoncouple.tumblr.com/post
  paymasterfreehost.com/404
@@ -49003,6 +49064,7 @@ peacefence.com/nude
  peachdvd.com/cart/peach_girl2
  pearhub.tumblr.com/tagged/bbw
  pearhub.tumblr.com/tagged/booty
+pearlnecklacegifs.blogspot.com/2014/09
  pearlswhipsvodkaandcum.tumblr.com/post/24538924866/sexpornxxx-lisa-ann-love-hard-sex-in-the
  pearltrees.com/myoo/erotyka/id4250117
  pearltrees.com/only.jo/erotisme-artistique/id9447769
@@ -50242,6 +50304,7 @@ pink-undies.net/rachel
  pink.pl/fr/
  pink7.net/cosmo
  pinkdistrict.winterrider.com/babe
+pinkhoerose.tumblr.com/post/160054490360/how-do-i-give-a-guy-a-good-blowjob-that-will-suck
  pinkhoerose.tumblr.com/post/160054490360/how-do-i-give-a-guy-a-good-blowjob-that-will-suck/amp
  pinkisthenewblog.com/2012-04-30/sofia-vergara-bares-her-boobies-in-mexican-gq-magazine
  pinkisthenewblog.com/2013-04-18/omfg-this-girls-e-mailrant-to-her-sorority-sisters-needs-to-go-viral-immediately
@@ -50439,7 +50502,6 @@ planculpontivy.com/baise
  plancultoulouse.com/plan-cul
  planculvoyage.fr/2015/02/10/comment-faire-une-sodomie/
  planculvoyage.fr/2018/08
-planet-earth-dvddgubpelelp.blogspot.com/2008
  planet-interkom.de/erosex/
  planet.nl/sex
  planeta.clix.pt/celebx/
@@ -50714,7 +50776,6 @@ popara.mk/2012/erotika
  popcornmachine7157.unblog.fr/2013/08/26/ladyboy-xxx-x-rated-asian-shemale-porn
  popcrush.com/justin-bieber-butts
  popcrush.com/ya-books-gay-lesbian-queer-sexuality-lgbt
-popculturecantina.blogspot.com/2021
  popdirt.com/jenna-jameson-britney-spears-wanted-me-for-lesbian-sex
  popdust.com/2014/06/26/bronies-photos-videos-documentary-my-little-pony-adult-fans-conventions
  popdust.com/2014/08/01/porn-facts-adult-industry-pay-men-women-impact-sex-dangers
@@ -50814,11 +50875,11 @@ porn.6996.us/post/69770934785/more-nude-girls-models-picture-at-girlsgonudecom
  porn.goshow.tv/en
  porn.goshow.tv/fr/sex-films/255221/striptease-erotique-en-lingerie-sexy
  porn.tools/porn/drtuber-deep-throat-fucking-and-moaning
-porn180.me/video/2492
  porn5k.me/video/sex-in-the-whorehouse
  porn720p.xyz/video/kinky-teen-slut-christy-mack-softcore-video-clip
  porn720p.xyz/video/milf-whore-in-softcore-porn
  porn720p.xyz/video/pov-blowjob-porn-with-dani-daniels
+porn8.tube/gallery/8319901
  porn800.me/tags/family-sex-fun
  pornaddictedfemale.tumblr.com/addict
  pornaga.com/page/anna-
@@ -50882,6 +50943,7 @@ pornkickass.blogspot.com/2018
  pornlolhd.com/video/1152338/couple-amateur-fellation-et-sexe-sous-la-douche
  pornlove98.blogspot.com/2017
  pornlust.eu/tag
+pornmafiaxxx.blogspot.com/2015
  pornmaniac.tv/fr/tag
  pornmaster.cc/hd/1/amrecan-sex-xxxxxxx/sex-swing-rimming-for-horny-lesbians
  pornmaster.cc/hd/12398/https-adultpic-top-slides-12-andee-daaunty-ra-xxxdoog/tunisian-sex-13375913
@@ -50921,6 +50983,7 @@ pornofrancais.org/mature-chez-le-gyneco-grave-sodomisee-et-couverte-de-sperme-da
  pornofrancais.org/petite-blonde-francaise-a-la-chatte-rasee-et-sodomisee-dans-1-gangbang-avec-papy
  pornogif.xyz/category/anal-sex-gif
  pornogratuitici.com/fr/video/1426482545436936229
+pornogratuitici.com/fr/video/2705852732667493586
  pornogratuitici.com/fr/video/2705852733276830952
  pornohefte.blogspot.com/2014
  pornohefte.blogspot.com/2015
@@ -50945,6 +51008,7 @@ pornoxo.pro/find/dani-daniels-porn-star
  pornoxo.pro/find/gianna-michaels-cuckold/2
  pornoxxxfilms.com/fr
  pornpic89.blogspot.com/2019/07
+pornpics.click/fr/xxxcats/blow-job-gallery
  pornpics9.com/pics/flowery-fornication/9768
  pornprofessional.tumblr.com/post/132713681276/adult-sex
  pornquake.com/fr/babe/amber-q
@@ -50960,6 +51024,7 @@ pornsmobile.blogspot.com/2021
  pornstar-frenzy.tumblr.com/frenzy
  pornstargaleryamateur.blogspot.com/2013/05
  pornstargalerygangbang.blogspot.com/2012/03
+pornstargalerymassage.blogspot.com/2012/07
  pornstargalerymassage.blogspot.com/2013/07
  pornstarpornfreethumbfr.blogspot.com/2009
  pornstarsdigest.com/asian-pornstar-mila-jade
@@ -50992,6 +51057,7 @@ porntiime.blogspot.com/p
  porntube-alonalon.blogspot.com/2011/02
  porntube-alonalon.blogspot.com/2011/04
  porntube-alonalon.blogspot.com/2011/08
+porntube.city/video22338
  porntubex.org/fx/sasha-grey-scat-rape
  pornushka.blogsome.com/2009/01/12/adult-sex-free-porn-clips
  pornushka.blogsome.com/2009/01/12/big-dick-sex-videos-samples-online
@@ -51936,7 +52002,6 @@ puslicker28.tumblr.com/post/111804483393/upskirts-candid-amateur
  puss.pw/420Penny
  pusscumshot.com/analcumshot
  pusscumshot.com/cumshot
-pussy-hair2952.blogspot.com/1999
  pussy-sms.de/pages
  pussyebeauty.blogspot.com/2012
  pussyfree-whiteboi-4-life.tumblr.com/./black69cock69milf
@@ -51951,10 +52016,12 @@ pussyspace.net/vid-1527820-hot_babe_kelly_divine_threesome_or_group_nikki_sexx_n
  pussyspace.net/vid-2149223-blonde-mistress-sore-big-butt-taking-care-rimjob-by-sugar-daddy
  pussyspace.net/vid-283162-skinny_teen_pixies_public_flashing_and_outdoor_exhibitionism_of_brunette_goth
  pussyspace.net/vid-2908288-mia-khalifa-hot-cum-shot-compilation-add-her-snapchat-hotmarypierce
+pussyspace.net/vid-2960464-asshole-licking-lovers-sophie-dee-and-lisa-ann-dual-orgasms
  pussyview.net/res/mpeg-redpimentnet-fetish-reference-sexecom-salope-arabenet-usa
  pussyview.net/res/slut-takes-piss-bath-at-perverse-watersports-orgy
  pussyview.net/res/softcore-kissing-lesbian-girl-on-nipple-sucking-fingering-scissoring-pussy-licking
  putaria-da-alta.tumblr.com/post/123684045195/iwanttobeafirefly-kinggoochgifs-exxxtra
+putas-in-suffering.tumblr.com/post/190592270187/ez-reyes-nsfw-alphabet
  putas.jconserv.net/index.php
  putas.latestsantiviruses.com/sexo2
  putasmuyputas.blogspot.com/2012
@@ -53074,6 +53141,7 @@ redbled.com/bdms-bondage-pornstars
  redbled.com/best-nsfw-sub-reddits/amp
  redbled.com/hottest-deepthroat-pornstars
  redbled.com/top-10-asian-pornstars-still-active-2017
+redbled.com/top-10-blowjobs-pornstars
  redbled.com/upskirt-pussy-pics-gifs
  redbookmag.com/archive/love-sex/positions-toys-techniques
  redbookmag.com/love-sex
@@ -54585,7 +54653,6 @@ retenews24.it/vuoi-sesso-veloce-ecco-lapp-che-te-lo-fa-fare-ma-chi-non-si-presen
  retiredjesus.tumblr.com/post/102472537252/when-ur-taking-a-test-and-u-know-ur-fucked
  retirednavyman.tumblr.com/post/118144787843/thaunderground-weed-wine-and-women-i-an
  retomilo.iquebec.com/folder
-retro-porn-xud.blogspot.com/2009
  retro1211.tumblr.com/following
  retrogamecity.forumactif.org/t441-adult-hentai-anime-adult-hentai-cartoon
  retroloops.blogspot.com/2012/04
@@ -54772,6 +54839,7 @@ risparmic.org/porno
  risquerenee.inter.net/videos
  risquevids4you.net/morgan
  rissabryn.tumblr.com/post/92176536238/such-a-good-little-kitten-kittenmichael-smut
+ritalin-use-adults.blogspot.com/2010
  ritaroberts56.tumblr.com/post/61591095672/blogged-by-rita-slutty-mature-women
  ritaroberts56.tumblr.com/post/61597949884/blogged-by-rita-slutty-mature-women
  ritaroberts56.tumblr.com/post/97204131747/blogged-by-rita-slutty-mature-women
@@ -54922,6 +54990,7 @@ roguesalley.com/blondes
  roguesalley.com/lesbians
  roguesalley.com/peekaboo
  roguesalley.com/pornstars
+roguestjames.tumblr.com/post/126317097793/nasty-girl-by-killakadafi191
  rohanslouvre.tumblr.com/post/126079739096/fetish-johnny
  rohini326.blogspot.com/2020/06
  rohrstock.net/Bizarr
@@ -55165,6 +55234,7 @@ rubbercanuck.blogspot.com/2014/06
  rubberdocs.tumblr.com/post/103974844480/gayperverts-on-your-fucking-knees-and-lick
  rubberdom.blogspot.com/2015
  rubberdom.blogspot.com/2016
+rubbersuccubus.tumblr.com/following
  ruben76.ifrance.com/gros-sein
  ruben76.ifrance.com/gros-sexe
  ruben76.ifrance.com/jeune-chatte
@@ -55367,7 +55437,6 @@ sabotaged.net/revelations/sincity/sonovabitch
  sabriel-otp.tumblr.com/post/94888613384/panty-kink-parties
  sabrina-nellie.tumblr.com/post/133344438088/lickgold-who-has-a-fetish-for-buying-me-things
  sabroelarsen.org/natalie5158
-sac-observer.blogspot.com/2010
  sachatte.com/2020
  sachem.cc/dreamteenz
  sachert.de/img/2016/01/07/prostitute-alley-2/
@@ -55676,6 +55745,7 @@ sasuitchi.tumblr.com/post/85637972698/bdsmafterthoughts-open-to-me
  sat.net/~zimmer/xxxpics
  satanosphere.com/story/2007/2/8/131226/0020
  satin-knights.com/swingers
+satin7.tumblr.com/following
  satinlingerielust.tumblr.com/post/132064544439/brunette-girl-masturbating-on-webcam-redtube
  satinpantie.tumblr.com/post/78200650819/quelle-coquine
  satinpantie.tumblr.com/post/78348002850/au-top-cette-petite-culotte
@@ -55792,6 +55862,7 @@ school-movies.com/116-school
  schooladultporn-blog.tumblr.com/post/134559700772/how-to-plan-a-teen-party-teen-nasty-free-butt
  schooladultporn-blog.tumblr.com/post/134559823787/free-teens-girls-in-lingerie-pictures-maid
  schooladultporn-blog.tumblr.com/post/134561812397/new-adolescent-girl-bedding-fuck-stars
+schooladultporn-blog.tumblr.com/post/134562673822/photosfree-porn-hardcore-youngs-panties-free
  schooladultporn-blog.tumblr.com/post/134623419307/tight-glamour-ass-bent-over-nude-young-anal
  schooladultporn-blog.tumblr.com/post/134703610322/free-glamour-sex-pics-cam-white-teen-bus-suck
  schooladultporn-blog.tumblr.com/post/134703851547/goltic-maiden-porn-pic-beautiful-picture
@@ -56105,6 +56176,7 @@ sehcap.org/Sex-Parties-Mots-De-Valeur-5/Public-Sex-Club-De-Striptease-Offre-Une-
  seifukulove.com/buruburu
  seins.unblog.fr/2007/03/22/gros-seins-enormes-petits-beaux-xxx-nus
  seins.unblog.fr/2007/04/18/porno-films-extrait-gros-seins-sexe-video-porno-gratuit-amateur-hard
+sekolahporn.blogspot.com/2019
  seks-filmy.za.darmo.biz/whore-in-one-nicole-ray-fucked-outdoor
  seks-show.pl/gangbang/amateur-slutwife-bareback-creampie-gangbang
  seks-show.pl/nastolatki/hot-amateur-chick-porn-with-anal-scenes-scene
@@ -56175,6 +56247,7 @@ selinaws.blogspot.com/2005
  selingkuhseks.blogspot.com/2019
  sell.com/c/18/5/adult-erotic
  sell.com/c/18/adult-erotic
+sellercentral.amazon.com/gp/help/external/G200339940
  sellercentre.ebay.co.uk/adults-only-policy
  sellmeyourpantys.tumblr.com/post/133222104939/london-pussy-kayleigh-p-black-hustler-lingerie
  sem-group.net///neworleansallamericangirls.com
@@ -56368,6 +56441,7 @@ sexdongyungsang.com/sex
  sexdongyungsang.com/tprtm
  sexdreamsdepot.com/ntblove65843
  sexe-adulte.blogspot.com/2012/10
+sexe-grosseins.com/actrice-porno/gianna-michaels
  sexe-hot-in-life.skyblog.com/includenbcomment.js
  sexe-lady.skyblog.com/includenbcomment.js
  sexe.wearableimages.com/bondagexsexe-gratuitx
@@ -56396,7 +56470,6 @@ sexguidepros.blogspot.com/2018/02
  sexguidepros.blogspot.com/2019/02
  sexgutsandrocknroll.tumblr.com/post/621032439311220736/can-i-get-freddy-x-so-who-has-an-oral-fetish
  sexhdtubee.com/video-porno
-sexhenta.net/category/games
  sexhomecm.blogspot.com/2018/10
  sexhotwifeswinger.tumblr.com/post
  sexhouse21.net/sex-pics-free-free-adult-
@@ -56413,7 +56486,7 @@ sexkittenuk.tumblr.com/page/6
  sexlovedatingtips.blogspot.com/p
  sexlust.blogspot.com/2012/10
  sexmorgane.com/enter2/index.php?url_ref=
-sexnotax.blogspot.com/2013/09
+sexodi.com/video/bmkzqk4z
  sexolandia123.tumblr.com/post/135443962683/gen3tuckin-jackieseroticlesbiandream
  sexomir.com/video/f2h5068812w
  sexonwebmarchbareswhich.blogspot.com/2009
@@ -56422,9 +56495,7 @@ sexotanga.com/xxx/
  sexoybdsmrelatos.blogspot.com/2012/04
  sexoymascositassensuales.tumblr.com/post/65499116918/very-hot-female-orgasm-free-porn-videos
  sexpertdiaries.tumblr.com/post/190401838731/dear-teenagers-and-young-adults-becoming-sexually
-sexpicsarchiveuwaifs.blogspot.com/2020/12
  sexpicsteenporn-blog.tumblr.com/page/3
-sexpictintheworlds.blogspot.com/2006/06
  sexpo.com.sg/onlinestore
  sexpornmbokneanco-xxx.blogspot.com/2010
  sexpornx.com/casting-interracial-sexy-ebony-beauty-pleases-him-with-his-boobies-2
@@ -56435,12 +56506,14 @@ sexpornx.com/indian-adult-cartoon-penthouse-tv-hd1-16
  sexpornx.com/indian-handjob-adult-penthouse-tv-hd1-17
  sexpornx.com/latina-world-adult-playboy-naughty-dorm-girls-get-crazy-2
  sexportal.com.ua/en
+sexprivatenakedjewishwomana.blogspot.com/2009
  sexprivatenakedjewishwomana.blogspot.com/2009/08
  sexshop-midt.dk/shop/default.asp
  sexshop-midt.dk/shop/frontpage.html
  sexshop.wirtua.net/PartnerDefault.asp?PartnerID=33
  sexshopwyspa.pl/magento
  sexsiledyiranvideo.blogspot.com/2013
+sexstoree.blogspot.com/2015/12
  sexstories-banglachoti.tumblr.com/post/156005870732/asianamateur-girl-nude-slutty-asianamateur-dirty
  sexstories.stok33.ru/filme-porno/tag/bisexual-incest
  sext-shots.pixub.com/post/115353215251/submit-sextshots
@@ -56511,6 +56584,7 @@ sexyabsolue.com/lingerie-sexy
  sexyabsolue.com/sex-toys
  sexyactor.blogspot.com/2009
  sexyasouhait.com/dirty-whore-swallowed-eight-cumshots
+sexybondage47.tumblr.com/following
  sexycharito.blogspot.com/2010/05
  sexyedithtaylor.blogspot.com/2020/12
  sexyeyez.com/video/cepten-porno-izle
@@ -56547,6 +56621,7 @@ sexymasseusebabegivingclientblowjob.blogspot.com/2012/09
  sexymasseusebabegivingclientblowjob.blogspot.com/2012/12
  sexymatureguys.tumblr.com/post/130237041194/free-pictures-trailer-video-twink-men-fucking-ass
  sexymichel2013.tumblr.com/post/68482080186/click-here-for-more-hot-adult-images-click-here
+sexymilfinmaidoutfit.blogspot.com/2017/05
  sexymodel160bikerchickstripca.blogspot.com/2009/08
  sexymonokinis.com/enter2/index.php?url_ref=
  sexynakedgirlss.blogspot.com/2011/02
@@ -56556,6 +56631,7 @@ sexyniunie.pl/anal-ksvyxjjwd
  sexyoungmilfs-blog1.tumblr.com/post/125716859474/travel-tour-groups-for-cutie-people
  sexyoungmilfs-blog1.tumblr.com/post/125800969384/mature-taboo-teen-lesbian-ms-warren/amp
  sexyoungmilfs-blog1.tumblr.com/post/125801949464/cest-young-previrgin-sex-porn-orgasm-lesbian
+sexyoungmilfs-blog1.tumblr.com/post/125886524764/nuse-studentgirl-girls-in-shower
  sexypam47.tumblr.com/post/147441728881/amateurgirlzz-more-of-this-popular-slut-wife
  sexypartygirlblondes.blogspot.com/2008
  sexypartygirlblondes.blogspot.com/2012/10
@@ -56624,6 +56700,7 @@ sglawl.tumblr.com/likes
  sgtkink.tumblr.com/post/109046543446/sexy
  sgxiaomeimei.tumblr.com/post/132213154637/sexy-or-xxx-snapchat-accounts
  shack.bianca.com/shack
+shado-raven.tumblr.com/post/186673034446/colour-me-with-your-love
  shadolight.com/sexualzen/blog.html
  shadow746.tumblr.com/following
  shadowdragon960.tumblr.com/post/117144855569/hentai-ass-only-you-love-hentai-butts-then
@@ -56713,7 +56790,6 @@ shellylicious.com/X/b6shellycam
  shelooksamazing.tumblr.com/post/108488907579/highuponsex-i-have-a-fetish-for-boobies-3
  shelovesthebbc.tumblr.com/post/32936247964/sexy-ass-blonde-bitch-suckin-black-dick-follow
  shelovesthedick-deactivated2015.tumblr.com/post/128275415721/degradingwhitewhoresnsluts-hammer-that-fucking
-shemale-bondage.blogspot.com/2005/02
  shemale-celebrity-porn-2013.blogspot.com/2014
  shemale-fucking.info/fr/latex-cutie-loves-a-big-boner-to-quickie-8333
  shemale-orgy-swingers-2013.blogspot.com/2014/12
@@ -56727,17 +56803,20 @@ shemale.pornvids.fr/video/5rgmz_femboy-avec-grosse-
  shemale.pornvids.fr/video/6ajDq_velue-joue-avec-un-
  shemale.pornvids.fr/video/7bqO4_face-sitting-tgirl-cumshot
  shemale.pornvids.fr/video/AZPMz_femboy-salope-serr
+shemale.pornvids.fr/video/B3Gp3_adolescent-femboy-en-petite-culotte-donne-une-bonne-fellation-et-une-branlette
  shemale.pornvids.fr/video/B3qM0_tgirl-baise-salopes-chatte
  shemale.pornvids.fr/video/DewXq_gay-crossdresser-donne-une-tr
  shemale.pornvids.fr/video/KmblA_amateur-femboy-tirant-la-transition-bite
  shemale.pornvids.fr/video/Q9g9M_lubriques-tgirl-jessy-duba
  shemale.pornvids.fr/video/Qaobg_tchad-diamant-dans-she-male-pervers-03-sc
+shemale.pornvids.fr/video/YrXx6_melina-
  shemale.pornvids.fr/video/Yx68B_de-beaux-cheveux-courts-femboy-d
  shemale.pornvids.fr/video/Z6BXe_totalement-poilu-ladyboy-devient-profonde-anal-bais
  shemale.pornvids.fr/video/aLPYb_exotique-femboy-d
  shemale.pornvids.fr/video/aeqgB_lait-hung-showgirl-gluant-ladyboygold
  shemale.pornvids.fr/video/kdraW_transexuelle-punk-dernier-dani-daniels-punit-son-esclave-de-sexe-tgirl-eva-lin
  shemale.pornvids.fr/video/kjreR_sexy-trans-chaude-babe-victoria-montrer-sa-bite
+shemale.pornvids.fr/video/lb4aM_ts-dernier-dani-daniels-baise-un-couple-h
  shemale.pornvids.fr/video/mz4jE_luna-pi
  shemale.pornvids.fr/video/pEpGp_femboy-salope-minables-ladyboygold
  shemale.pornvids.fr/video/r1ann_mignon-tgirl-obtient-rimjob
@@ -56746,10 +56825,8 @@ shemale.pornvids.fr/video/z64Q1_rada-en-penthouse-piquer-play-ladyboygold
  shemaleassporno.blogspot.com/2015/06
  shemalecam.com/landing/templates
  shemalecenter.blogspot.com/2011
-shemaledeluxes.blogspot.com/2012/03
  shemalefuckingsex.tumblr.com/post/151812397934/lanita-hot-sizzling-hot-gangbang-sex-perfect
  shemalepayperv.blogspot.com/2019/06
-shemaleporndot.com/fr
  shemaletube24.com/categories_of_tranny
  shepenis.tumblr.com/post/123756756456/hookup-with-a-shemale-tonight
  sherbrooke.kijiji.ca/c-rencontres-aventures-Transexuel-recherche-W0QQAdIdZ100860616
@@ -56773,7 +56850,6 @@ sherv.net/adult
  shesaidhesaidscoop.tumblr.com/bestofthesex
  shesgothreelegs.tumblr.com/post/46284705768/he-face-says-i-want-to-suck-your-cock
  shewantschasity.tumblr.com/post/53811245473/afro-orgasm-strip-masturbate-cum-sleep-xxx
-shewhomakestherules.blogspot.com/2011
  shhexycorin.co.uk/2006
  shi-howler.tumblr.com/post/139764272661/xxxblitzwingxxx-cumfilledfurry1-sethuchia
  shibarihowto.com/post/138681143759/japanese-bondage-fetish-ero-
@@ -57290,7 +57366,6 @@ sissybabemichelle.tumblr.com/post/141311368431/iamarealsissy-iamasissyyahoocom-t
  sissybabepr.tumblr.com/post
  sissybabycaity.tumblr.com/post/100458884840/whitehotpegging-pegged-butts-boys-fucked
  sissybabycaity.tumblr.com/post/93635201450/femboilove-femboy-in-sexy-lingerie
-sissybabysarah.blogspot.com/2016
  sissybbstephanie36.tumblr.com/post/186236465864
  sissyboy267.tumblr.com/following/page/4
  sissybrainwash.tumblr.com/post/147106009534/sluttycocksuckr-you-love-being-fucked-by-a-real
@@ -57466,6 +57541,7 @@ sizegeneticspeniextender.com/how-to-make-your-dick-bigger
  sizor.com/swimware
  sizvideos.com/post/131024700660/im-bisexual-but-im-not-full-video
  sj743.tumblr.com/following/page/14
+sj743.tumblr.com/following/page/170
  sjharvey.com/sites/
  sjmmdk.tumblr.com/page/3
  sk-inks.tumblr.com/post/181547756401/requests-are-open
@@ -57883,6 +57959,7 @@ slaveexchangenola.tumblr.com/following
  slavegirlscentral.tumblr.com/post/156646983487/slave-sluts-sucking-cock
  slavelina.tumblr.com/post/81362012772/rapesluts-two-pathetic-cunts-making-out-with-a
  slaveormaster.tumblr.com/post/38963487739
+slaveradionetwork.blogspot.com/p
  slaves25.tumblr.com/post/47412972132/ukbdsm-cumshot-on-ballgag-bdsm-amateur
  slaves25.tumblr.com/post/47827956025/ukbdsm-teen-submissive-bdsm-amateur-bondage
  slaves25.tumblr.com/post/49963599600/ukbdsm-submissive-sucking-cock-bdsm-amateur
@@ -57946,6 +58023,7 @@ slutsyes.com/fr/we-found-it
  slutty-ebony.tumblr.com/post
  slutty-moms.tumblr.com/post/143697967553
  sluttypublic-deactivated2016012.tumblr.com/post/132175006980/fuck-me-till-the-end
+sluttysan.tumblr.com/post/187230292196/ateez-trying-mutual-masturbation-with-you
  sluttysissybabymary.tumblr.com/following
  sluttyten-ficrecs.tumblr.com/post/182497611029/its-your-birthdaytaeyong-jaehyun-x-reader
  sluttyten-ficrecs.tumblr.com/post/183070101370/nct-reaction-watching-you-masturbate
@@ -58013,6 +58091,7 @@ smg-zwlj.net.cn/clipart_gratuit_metier
  smg-zwlj.net.cn/matter_belle_fesse
  smg-zwlj.net.cn/sex_granny_old
  smile-4eva.blogspot.com/2019
+smile-4eva.blogspot.com/2020/02
  smile-4eva.blogspot.com/2020/05
  smileandactnice.com/life
  smileandactnice.com/sex
@@ -58274,6 +58353,7 @@ somelikeitdirty.tumblr.com/post/5592731865/fuck-look-the-size-of-his-cock
  somemenarejustinferior.tumblr.com/post/98590458567/bonermakers-good-cocksucking-bitch-a-true
  someminismutfactory.tumblr.com/post/187496454613/vecnawrites-attentiondefislut-dirty-a-z
  someonecalledmefamous.tumblr.com/post/48660175994/mu5icliz-germansam-tokyosluts-sleeping-is
+somestuff999.blogspot.com/2014
  somethingawful.com/hentai
  sometimeshorny.tumblr.com/post/2874520832/coldnightshotsex-very-deep
  sometimesviolenceistheanswer.tumblr.com/post/117891309651/he-eats-her-pussy-as-she-plays-with-her-huge-tits
@@ -58455,6 +58535,7 @@ speedomuscle.tumblr.com/post/17324885619/speedo-blowjob
  speedos7.tumblr.com/post/110279029482/couple-of-sexy-guys-showing-off-two-different
  speedsurf.to/Chloe-Jones
  speedy-orange-pc-shortcuts-2013.blogspot.com/2017
+speedychopslover.blogspot.com/2019/08
  speedyfiles.org/grab/alexus
  speedyfiles.org/grab/erotyka
  speedyfiles.org/grab/kelly
@@ -58471,6 +58552,7 @@ spermgang.com/it
  spermshunter.com/galls/monsterofjizz04
  sphcaptions.tumblr.com/post/69446040823/tiny-dick-cums
  spheremetisse.com/couple/sexe
+spi-ventures.com/journal/2015/09/16/panty-poop-scat
  spi-ventures.com/journal/2016/01/04/zoo-sex-bestiality
  spiceisle.com/nordpat
  spices.nl.com/spices
@@ -59247,6 +59329,7 @@ studysaysteenage-blog-blog.tumblr.com/post/125125787521/free-schoolgirl-boys-fis
  studysaysteenage-blog-blog.tumblr.com/post/125125827871/teeny-titans-video-video-porn
  studysaysteenage-blog-blog.tumblr.com/post/125125953891/rimba-virgin-lingerie
  studysaysteenage-blog-blog.tumblr.com/post/125125974671/young-girls-spread-eagle
+studysaysteenage-blog-blog.tumblr.com/post/125126061076/studentgirl-curly-hair-style
  studysaysteenage-blog-blog.tumblr.com/post/125126102611/schoolgirl-fisting-virgin
  stuff.com/beachpatrol
  stuffedpanties.tumblr.com/page/75
@@ -59369,6 +59452,7 @@ successnetworks.org/images/film-porn
  successnetworks.org/images/licks-ass
  successnetworks.org/includes/doors
  succu6us.tumblr.com/post/182269754416/werewolfbakugou-x-humanmatereader-smut-him
+succu6us.tumblr.com/post/613052449189724160/reasons-i-need-a-strap-on
  suceboulesucebite.tumblr.com/post/133054085832/rimming-boys-horny-gays-anus-licking-live-on
  sucer.sexe-histoires.com/sexe
  suceuse-demoniaque.com/blondes
@@ -59486,7 +59570,6 @@ sumparo.biz/1/index.html
  sumundelplacer.blogspot.com/2017
  sumundelplacer.blogspot.com/p
  sundance.tv/blog/2010/01/australia-bans-small-breasts-ejaculation-from-adult-entertainment
-sundaynightsexshow.blogspot.com/2009
  sunfishclass.org/newyork/archives/1999
  sunflotus.tumblr.com/post/103403142273/presenting-my-to-do-list-aka-dont-read-if-you
  sunflower.com/~rlhume
@@ -60018,6 +60101,7 @@ takachan.net/love
  takaschu.com/sm
  take-me-im-all-yours.tumblr.com/post/44071130604/http-firstsexvirgin-tumblr-com
  take40.com/news/14905/jordin-sparks-not-a-slut
+takeachanceff.tumblr.com/post/149134715221/nasty-girl-by-killakadafi191
  takebucks.com/eng/resources
  takeeveryinch73.tumblr.com/post/133008750581/lovelycraftysexystudent-free-webcam-shows-ass
  takeherforceher.tumblr.com/post/127692271290/fuckingbrutalextreme-cry-me-a-river-slut
@@ -61654,6 +61738,7 @@ the-broad-side.com/questioning-rihanna-isnt-slut-shaming
  the-dark-craving.tumblr.com/following
  the-extreme-naturals.info/en6
  the-fans.com/adult
+the-great-porn.blogspot.com/2015
  the-hollow-prince.tumblr.com/post/117037223118/ive-been-injected-with-false-hope-so-many-fucking
  the-inspired-lesbian.com/post/121346454828/dont-lead-people-on-like-its-not-fucking-hard
  the-jeuxflash.com/j/voir-une-pute-enculer-un-mec
@@ -62190,6 +62275,8 @@ thenasties321.tumblr.com/post/152114224068/xtinarose12-fuck-this-made-me-cum-so-
  thenaturistclub.it/clubprivenaturista/tag/sesso-sadomaso-milano
  thenaughtylitteboysroom.tumblr.com/post/106750615029/im-so-horny-i-need-to-have-some-sex
  thenewbisexual.blogspot.com/2010
+thenewbisexual.blogspot.com/2012/12
+thenewbisexual.blogspot.com/2013
  thenewgay.net/category/ideas/sex
  thenippleproject.com/gallery
  thenudistprincess.tumblr.com/post
@@ -62492,6 +62579,8 @@ thisizgame.ning.com/profiles/blogs/amatuer-photos-hedonism-3157
  thisizgame.ning.com/profiles/blogs/amatuer-russian-teens-4229
  thisizgame.ning.com/profiles/blogs/arkansas-amatuer-girls-4226
  thisizgame.ning.com/profiles/blogs/voyeur-amatuer-video-9551
+thislilpornomine.blogspot.com/2007
+thislilpornomine.blogspot.com/2007/09
  thislilpornomine.blogspot.com/2009/11
  thisnext.com/item/04AB7969
  thisnext.com/item/077CBA79
@@ -63160,6 +63249,7 @@ tikibears.tumblr.com/post/137516134310/httpworldsbestgayporncom20150605sexy-hair
  tikkunmedical.com/partner-pregnancy-gianna-michaels-porn-sexual-the
  tikkunmedical.com/sadism-bbw-sex-movies-to-invention-styling-criteria-protruding/
  tikkunmedical.com/surface-softcore-sex-milf-humans-is
+tilatequilapregnant.blogspot.com/2013/06
  tim47802.tumblr.com/post/105601611832/nudemilfspornpics-free-milf-sex-nude-milfs
  timberbay912.tumblr.com/post/118887752017/2015-pervfetishboy-cum-in-rubber
  timbres.tonsite.biz/sexyannonce
@@ -63301,6 +63391,7 @@ tisu.doxit.com/matthew2709
  titfarmpics.com/gall/693
  titfarmpics.com/gall/694
  titfarmpics.com/gall/695
+titflesh.blogspot.com/2010
  titfuckdolls.tumblr.com/./analingus-only-hottest-masturbati
  titfuckdolls.tumblr.com/post/134554048412/analingus-only-hottest-masturbation-webcam
  titi-chan-s-forum.heavenforum.org/t3792-moxie-girlz
@@ -63666,6 +63757,7 @@ top-news.fr/the-pussycat-dolls-photos-sexy
  top-news.fr/virginie-ledoyen-nue-les-photos-sexy
  top-online-store.co.uk/sexyloveshop
  top-php.nuxit.net/sexe
+top-pornvideos.com/catalog/aXAtOTI1LTU4OQ
  top-pornvideos.com/catalog/aXAtOTI1LTgxMg
  top-serv.biz/baby-beauties
  top-serv.biz/castle-portal
@@ -63764,6 +63856,7 @@ topiccraze.com/t/Exhibitionists
  topiccraze.com/t/Gay-Exhibitionists
  topiccraze.com/t/Upskirt-Babes
  topics.latimes.com/entertainment/people
+topindianxxxvideo.com/en/video/1892856894494653170
  topito.com/shopping/petite-culotte-chat-jeux-de-mots-crados-interdits
  topito.com/top-8-des-pires-anecdotes-sexuelles
  topito.com/top-avantages-etre-petite-fuck-yeah
@@ -64360,7 +64453,6 @@ tranniesmovies.net/new-shemale-student-surprises-friend-with-a-fucking
  tranniesmovies.net/shemale-sea-fucking
  tranniesmovies.net/three-on-one-alleyway-shemale-gangbang-surprise
  tranny-gifs.tumblr.com/post/123717474214/click-here-now-for-real-shemales-performing-live
-tranny-sextrans.blogspot.com/2013/10
  trannyfuckingsex.tumblr.com/post/159776362105/girlboy-part-2-finger-oral-lee
  trannyfuckingsex.tumblr.com/post/159849390895/a-sandy-surprise-4k-secret-download-tit-cum
  trannyfuckingsex.tumblr.com/post/159849747565/gangbang
@@ -64628,7 +64720,6 @@ ts9.images.live.com/videos/thumbnail.aspx
  tsbmag.com/2010/06/08/how-to-ejaculate-like-a-porn-star/
  tsdominatrix.blogspot.com/2017/11
  tse-tse.it/la-top-milf-wifey-e-le-sue-mega-tettone/
-tsescorts.blogspot.com/2017
  tsfandl.tumblr.com/post/142122025534
  tshirtwatch.com/blog/2006/05/18/adriana-lima-a-sexy-virgin-in-a-t-shirt
  tshunter97.tumblr.com/following
@@ -64736,7 +64827,6 @@ tudobusca.com/tudosexo/
  tudoquecdzinhagosta.blogspot.com/2017/09
  tudoquecdzinhagosta.blogspot.com/2017/10
  tudoquecdzinhagosta.blogspot.com/p
-tuffsnuff.blogspot.com/2013
  tugasapo.com/category/adultos/
  tugasapo.com/category/pt/pt-adultos/
  tugjobs0.com/blogs
@@ -65442,6 +65532,7 @@ twinkfilmsfree.tumblr.com/post/116670421766/queer-big-penis-pistures
  twinkfilmsfree.tumblr.com/post/116671171291/cock-unencumbered-teenaged-stark-naked-boys
  twinkfilmsfree.tumblr.com/post/116671238621/gay-fat-booty-anus-fucking
  twinkfilmsfree.tumblr.com/post/116671308526/cummy-bears-gallery
+twinkfilmsfree.tumblr.com/post/116671997426/chocolate-gay-cocks
  twinkfilmsfree.tumblr.com/post/116671997426/chocolate-gay-cocks/amp
  twinkgaysuperman.tumblr.com/post/131124554856/san-jose-marines-runaway-filipino-gay-big-dick
  twinkgaysuperman.tumblr.com/post/131186911796/queer-kiddy-boy-lol-pre-xxx-gay-night-gay-tgp
@@ -65764,6 +65855,7 @@ ultraraven62.tumblr.com/post/141988149030/maestrofilosofo-nude-sexy-hot
  ultrasparky.org/poseablethumbs
  ultratwistedbubble.com/post/136197978479/bbygirlzara-waiting-for-daddy
  ultraz.dk/news.php
+umbreonbox.tumblr.com/following/page/3
  umnet.com/download-screensaver/106450-Jennifer_Emerson_024
  umnet.com/download-screensaver/106553-Jennifer_Emerson_014
  umnet.com/download-screensaver/106608-Jennifer_Emerson_029
@@ -66217,6 +66309,7 @@ uselectionatlas.org/FORUM/GALLERY/thumbs/2
  useme5533.tumblr.com/following
  usemytramp.com/fhg/mgfv/107
  usemytramp.com/fhg/mgfv/108
+usename1000.tumblr.com/following
  usenet.com.pl/grupy-dyskusyjne/grupy-binarne/erotyka/
  user.online.be/narcane
  user.online.be/~sk001064
@@ -66442,6 +66535,7 @@ ustream.tv/channel/blowjob-babes-hard-oral-sex-videos-775066
  ustream.tv/channel/gangbang-hardcore-party-dirty
  ustream.tv/search/channel/tag/masturbate
  ustrendy.com/nude-lace-lolita-corset-cherry-applique-ruffled-boned-animal
+ustwofun.tumblr.com/following/page/17
  usuarios.fotolog.cl/r/u/rubiasymorenas/
  usuarios.fotolog.cl/s/e/sexysofia/
  usuarios.iponet.es/budfox/t
@@ -66569,6 +66663,7 @@ valkyrieofsmut.tumblr.com/post/185908167500/love-recorded-14
  valkyrieofsmut.tumblr.com/post/186056458369/steves-birthday-blow-job/amp
  valkyrieshaunt.com/valkyrie
  valleypop.com/category/Celebrity-News/who-should-we-blame-for-taylor-momsens-upskirt-shots-jail-bait
+vallon-blanc.eu/jeune-pute-lesbienne-jeune-fille-sexy-nue-beurette-tube-sexemodel-chartres-fran
  valontanooo.tumblr.com/post
  valpallove.tumblr.com/post/10208221390/nipple-clitoris-penis-tongue-piercings-are
  valser.es/~redpixel/ford
@@ -66875,6 +66970,9 @@ video-buzz.fr/voyeur-culotte-supermarche
  video-camera-cachee-porno.blogspot.com/2018
  video-cats.com/alexus-winston
  video-dingo.com/videos/coquines
+video-gratuit-de-sex.blogspot.com/2013
+video-gratuit-de-sex.blogspot.com/2013/08
+video-gratuit-de-sex.blogspot.com/2013/09
  video-izvrat.com/Porno_Sexe.cfm
  video-kachat-xxx-2013.blogspot.com/2014
  video-paketi.blogspot.com/2008
@@ -67101,6 +67199,7 @@ videosdefilms.unblog.fr/series-11/prison-break
  videosdesexe.wordpress.com/2008/05
  videosexchaud.com/videos/dtxzzkxby
  videosexchaud.com/videos/guecwstvq
+videosexchaud.com/videos/hestnccbm
  videosexchaud.com/videos/isfczniok
  videosexo.info/PinkBits
  videosgratisxxxjay.blogspot.com/2016/02
@@ -67242,6 +67341,7 @@ vineroulette.com/tag/cumshot
  vineroulette.com/v/Boobs-vineafaterdark-breasts-jiggle-softcore-porn-adult-nipple-tits-bigboobs-boobies-hYn0qr1OPHq
  vintagemagazinecompany.co.uk/en/127-adult-magazines
  vintagepornfreefuckfestthekinky.blogspot.com/2009
+vintagexxxclips.com/clip
  vintagexxxclips.com/free-clips/8781720
  vinylpushers.myquest.fr/category/mardi-pervers-2
  violatedrot.com/analblast/
@@ -67314,6 +67414,7 @@ visioclub.com/home.asp?
  vision.net.au/~jcurran
  visiondevined.blogspot.com/2010/07
  visiondevined.blogspot.com/2010/09
+visiondevined.blogspot.com/2011
  visiontiny.com/kara07
  visiontiny.com/visiotinyxxxa159
  visiontiny.com/visiotinyxxxa160
@@ -68044,6 +68145,7 @@ watsuthat.org/big-ass
  watsuthat.org/video-files
  wattpad.com/11007912-the-kissing-booth-larry-smut
  wattpad.com/11445095-bromance-smut-one-direction-wait-for-me-larry
+wattpad.com/145480698-band-one-shots-black-lolita-gared-dirge-and-chris
  wattpad.com/14738313-1d-dirty-smut-boyxboy-zianourry
  wattpad.com/18685161-larry-stylinson-one-shots-contains-smut-my-little
  wattpad.com/190941574-camren-smut-here
@@ -69080,7 +69182,6 @@ webcampirates.com/brunettefir3-nude-kinky-strip-show-live-2015-07-20-203048/
  webcampirates.com/lunaxgrey-erotic-adult-striptease-kinky-chat-2015-06-13-183027
  webcampirates.com/tinglebelle-kinky-strip-show-erotic-shaved-2015-09-07-100027
  webcampirates.com/tygrysica96-adult-cute-porn-shaved-kinky-2015-07-21-000047
-webcams-sexy.blogspot.com/2011
  webcams.servemp3.com/free
  webcamsrecorded.com/kawaiiibabiii-explicit-kinky-xxx-adult-shaved-2015-07-23-003102
  webcamsrecorded.com/kendall_janner-silly-shaved-strip-show-xxx-2015-08-12-140125/
@@ -69804,7 +69905,6 @@ wet-tshirt-pud.tumblr.com/post/18378397596/hot-news-about-wet-tshirt-video
  wet-tshirt-pud.tumblr.com/post/18418469963/current-news-about-wet-tshirt
  wet-tshirt-pud.tumblr.com/post/18438900504/latest-news-about-wet-tshirt
  wet-videos.com/internal/3
-wetfreegayporn.com/category/194
  wetgussets.tumblr.com/post/77059653925/absolute-heaven-right-there-hot-pussy-and-panties
  wetpaint.com/gene-simmons-child-pornography-raid-1434707
  wetpaint.com/joffreys-sadistic-sex-scene-did-game-of-thrones-finally-go-too-far-702428
@@ -71025,6 +71125,7 @@ xexafy74.soup.io/post/356272030
  xexerotic.tumblr.com/page/2
  xfastsearch.com/calendari
  xfemaledom.com/fr/30573-seductive-amateur-femdom-facesitting-piss-squirt-at-mouth-very-seductive-video
+xfemaledom.com/fr/tag/13352-shaved-pussy
  xfetishvideos.tumblr.com/post/35477478468/amateur-girl-ready-to-try-anal-sex
  xfilezr.tumblr.com/post/110067983602/mature-blonde-fucked-in-the-toilet
  xfilm.blog2blog.nl/10167/sexuele
@@ -71072,6 +71173,7 @@ xin9le.blogspot.com/2019/11
  xin9le.blogspot.com/2020/03
  xindex.net/x/freshteens
  xinha.python-hosting.com/ticket/570
+xkanekitoukax.tumblr.com/post/166189694474/first-oneshottouken-fic
  xkingjason.tumblr.com/post/137246871874/saviourxxx
  xkox-kmqh.org.cn/belle_fesse_faire_amour
  xkox-kmqh.org.cn/clip_partouze_amateur
@@ -71173,6 +71275,7 @@ xnxxs.mobi/q-getting-ass-fucked-3gp-video-4311717
  xnxxs.mobi/thumbnum-orgy-group-fuck-in-club-linkfull-ht
  xnxxsexmovie.com/sex-movies
  xnxxv.mobi/videos/celebs-upskirt-pussy-download
+xnxxxplayer.info/erotique-tv-sexy-lily-lane-dick-drilled-live-by-erick-john-his-big-cock-15435420
  xo4.ch/omea
  xojane.co.uk/sex
  xojane.com/clothes/lingerie-for-big-boobs
@@ -71283,8 +71386,10 @@ xvideos.wapka.cc/video296930
  xvideos.wapka.cc/video30235061
  xvideos.wapka.cc/video32946141
  xvideos.wapka.cc/video35915421
+xvideos.wapka.cc/video36054165/playgirl_se_fait_sucer_par_une_fille_mature_pendant_un_plan_a_trois
  xvideos.wapka.cc/video36835417
  xvideos.wapka.cc/video38406365/cutie_gives_great_blowjob_before_feeling_penis_in_wet_twat
+xvideos.wapka.cc/video38789519
  xvideos.wapka.cc/video46089709
  xvideos.wapka.cc/video48505639
  xvideos.wapka.cc/video52597413
@@ -71379,6 +71484,7 @@ xxxlivehd.com/it/xxx-video/amateur/2-or-more-far-eastern-toys
  xxxmilftube.top/category/blowjob
  xxxmoviefreepiercedclitstop.blogspot.com/2009
  xxxpicbd.blogspot.com/p
+xxxpicstory.com/big-boobs
  xxxpornvideos.cam/fr/panties
  xxxpretty.com/category
  xxxsexe91xxx.tumblr.com/post/107232040780/sluty-anal-wife-dpdoug-timea-bella
@@ -71399,6 +71505,7 @@ xxxvideo.space/searchresults
  xxxvideostrue.com/fr/query/real
  xxxvideou.blogspot.com/2019
  xxxvideou.blogspot.com/2020
+xxxvippics.com/party
  xxxvoyeur.pro/video-view
  xxxwomansexpichornywifefreenud.blogspot.com/2009/08
  xxxxjenniferdu76xxxx.skyrock.mobi/related_blogs
@@ -71609,6 +71716,7 @@ youforgotpoland.com/top/upskirt.com
  youforgotpoland.com/top/upskirts.com
  yougoggle.com/categories/47/Sexy
  yougotnojams73.tumblr.com/post/189409971926/bts-reactions-the-boys-watch-you-guys-have-sex
+youjizz.guru/search
  youjizz.miami/de/cats/xxx-foursome-movies
  youjizz.team/results
  youlingerie.tumblr.com/shop-now
@@ -71657,6 +71765,7 @@ youngsexhot.com/in-18yo-category/Sexy
  youngsexylife-blog.tumblr.com/post/127348724317/when-collegegirl-babes-get-naked
  youngsexylife-blog.tumblr.com/post/127349781187/studentgirl-adult-clothes-xxx
  youngsexylife-blog.tumblr.com/post/127598498042/nude-young-xxx-youthful-nude-girls
+youngsexylife-blog.tumblr.com/post/127599325717/models-pre-puberty-youthful-models
  youngsexylife-blog.tumblr.com/post/127668456542/cars-eddie-meduza-virgin-girls
  youngsexylife-blog.tumblr.com/post/127670593182/several-virgin-departments/amp
  youngsexylife-blog.tumblr.com/post/127671405737/meth-adolescent-sex
@@ -71963,6 +72072,7 @@ zenliving72.tumblr.com/following
  zenn.nl/18.htm
  zenn.nl/k1
  zepelion.com/webnet
+zepierre.tumblr.com/page/2
  zepixel.com/photo/femmes
  zeppelin-after-dark.tumblr.com/post/20208346761/penthouse-b
  zepti.com/live
@@ -72113,6 +72223,7 @@ zoophiliablog.tumblr.com/post/119826356332/kjc1015-dog-cock-knot-fucking
  zoopoint.blogspot.com/2012
  zoopornzoo.cyou/fr/anal/best
  zoopornzoo.cyou/fr/videos/crazy-zoophile-fingering-horse-asshole
+zoopornzoo.cyou/fr/videos/subby-animal-and-pregnant-sex-goddess
  zoosk.com/d/dating_fr/36
  zoosk.com/d/dating_fr/43
  zootoday.com/girls
@@ -72162,6 +72273,7 @@ ztube.org/artofzoo-deepthroat-rape-victoria-deluxe-cunt
  ztube.org/artoofzoo-zoofilia-with-zooofart-dog
  ztube.org/asian-licking-dog-anal-in-animal-sex
  ztube.org/lady-k9-ariel-porno-next-door-private
+ztube.org/pervert-slut-lina-in-extreme-scat-fetish
  ztube.org/pervert-slut-zoophilia-anal-dogporn
  ztube.org/tag/blonde
  ztube.org/tag/zoofilia
@@ -72186,6 +72298,7 @@ zup.pe/b/k7zz
  zup.pe/b/k8y5
  zurich.fr.craigslist.ch/cas
  zurichinvestmentsltd.com/2257/
+zuvids.blogspot.com/2018
  zuzaa.com/gallery
  zv-magazine.be/sfw
  zv-magazine.be/user
diff --git a/blacklists/malware/domains b/blacklists/malware/domains

index 1d846017ac368769564911352ded75b40596e65f..c95819473c43b54efcd0952b2b2ae4b8b129b1d8 100644 (file)
--- a/blacklists/malware/domains
+++ b/blacklists/malware/domains
@@ -6,6 +6,7 @@
  0.15.0.1
  0.15.0.2
  0.15.6.5
+0.16.3.1
  0.17.0.1
  0.19.0.1
  0.2.0.11
@@ -32,7 +33,6 @@
  0001safeworld0002.000webhostapp.com
  000201nets.cloudaccess.host
  000359.xyz
-0007.name
  000asmr.com
  000dmobilt9034.com
  000l34e.wcomhost.com
@@ -152,7 +152,6 @@
  02-update.billing912.com
  02-update.billing95.com
  02.bill.ref-117.com
-02.data-process01.com
  02.my-payments.org
  02.service-unpaid-bill.com
  02.smsinformativo.com
@@ -324,6 +323,7 @@
  0931tangfc.com
  094-365.net
  095-365.net
+0950950667014063.eu-gb.cf.appdomain.cloud
  095267195954465-dot-crafty-shade-294422.uk.r.appspot.com
  096-365.net
  097-365.net
@@ -344,6 +344,7 @@
  0abf6601f8c4736595886ee34c48fa0ca5bd8a2a.info
  0ac30efc848232e89d3fb1ead15ed.cyou
  0acrew.crccoleccionables.com
+0ad8b925.ithemeshosting.com.php73-39.lan3-1.websitetestlink.com
  0af51c7ae60e29da0418dda2b47ef98e45d03479.info
  0ath-payment.com
  0auth.secure-icloud.appleid.mentoring.pe
@@ -485,7 +486,6 @@
  1.0.133.89
  1.0.136.111
  1.0.138.22
-1.0.144.176
  1.0.149.38
  1.0.152.97
  1.0.156.61
@@ -498,38 +498,39 @@
  1.0.183.25
  1.0.185.82
  1.0.209.46
+1.0.209.99
  1.0.210.218
  1.0.210.249
  1.0.211.250
  1.0.212.191
  1.0.212.192
  1.0.212.37
-1.0.212.63
  1.0.213.203
  1.0.213.215
  1.0.213.40
  1.0.213.87
  1.0.214.58
  1.0.215.180
+1.0.218.240
  1.0.220.242
+1.0.221.4
  1.0.228.75
  1.0.232.183
  1.0.235.35
-1.0.249.48
  1.0.251.190
  1.1.129.166
-1.1.135.52
  1.1.162.182
+1.1.165.153
  1.1.166.178
  1.1.174.9
  1.1.175.69
-1.1.195.23
+1.1.200.231
  1.1.224.137
  1.1.224.208
+1.1.226.253
  1.1.233.240
-1.1.234.79
  1.1.243.160
-1.10.139.145
+1.1.245.90
  1.10.140.43
  1.10.141.220
  1.10.141.58
@@ -550,14 +551,13 @@
  1.10.188.140
  1.10.188.202
  1.10.188.52
+1.10.188.78
  1.10.188.93
  1.10.189.107
-1.10.189.126
  1.10.189.133
  1.10.189.156
  1.10.189.84
  1.10.228.75
-1.10.237.2
  1.10.246.179
  1.11.201.18
  1.119.131.102
@@ -567,23 +567,23 @@
  1.119.195.58
  1.122.234.70
  1.122.64.110
-1.129.28.214
+1.129.111.30
+1.129.111.68
  1.129.30.16
-1.136.110.148
-1.15.127.23
+1.15.102.234
  1.159.22.75
-1.160.122.63
  1.160.125.194
  1.160.130.123
  1.160.136.162
+1.160.67.105
  1.163.5.196
+1.163.8.42
  1.164.146.198
  1.164.97.194
  1.165.101.189
  1.165.103.62
  1.165.181.69
  1.165.182.50
-1.168.76.2
  1.170.183.146
  1.170.231.106
  1.171.195.111
@@ -591,12 +591,16 @@
  1.172.105.154
  1.172.110.191
  1.172.172.206
+1.172.54.56
  1.172.99.148
  1.173.68.80
+1.174.100.159
  1.174.198.18
+1.174.97.201
  1.175.139.9
  1.175.45.212
  1.175.78.213
+1.175.82.66
  1.179.130.201
  1.179.137.10
  1.179.144.181
@@ -618,24 +622,22 @@
  1.179.246.244
  1.180.211.138
  1.180.211.139
-1.180.217.139
  1.180.246.82
-1.186.181.250
  1.186.225.86
  1.186.242.12
  1.186.248.136
-1.186.248.30
  1.186.40.157
  1.186.40.177
  1.186.40.2
  1.186.40.9
-1.186.45.236
  1.186.57.146
  1.186.57.150
  1.186.60.25
  1.186.63.133
+1.187.80.190
  1.189.26.108
  1.193.160.164
+1.193.163.195
  1.196.152.217
  1.198.72.233
  1.2.169.101
@@ -644,6 +646,7 @@
  1.2.169.81
  1.2.171.136
  1.2.180.214
+1.2.187.63
  1.2.195.180
  1.2.195.187
  1.2.195.211
@@ -657,22 +660,25 @@
  1.2.205.246
  1.2.207.119
  1.2.207.246
-1.2.228.110
  1.2.229.34
  1.20.100.111
  1.20.100.133
  1.20.100.227
  1.20.100.45
  1.20.101.103
+1.20.101.114
  1.20.101.149
  1.20.101.221
+1.20.101.24
  1.20.101.62
+1.20.102.102
  1.20.102.228
  1.20.102.68
  1.20.103.196
  1.20.103.248
  1.20.137.82
  1.20.143.23
+1.20.156.220
  1.20.169.206
  1.20.178.145
  1.20.180.229
@@ -685,10 +691,8 @@
  1.20.207.231
  1.20.207.233
  1.20.211.138
-1.20.217.221
  1.20.217.78
  1.20.220.79
-1.20.221.73
  1.20.227.220
  1.20.227.66
  1.20.96.156
@@ -707,11 +711,11 @@
  1.20.99.89
  1.202.76.226
  1.202.77.210
+1.202.78.32
  1.202.78.35
  1.203.103.3
-1.204.58.192
  1.204.62.56
-1.207.198.90
+1.204.68.107
  1.212.157.115
  1.212.181.131
  1.214.156.164
@@ -720,10 +724,9 @@
  1.214.245.27
  1.214.89.69
  1.215.122.108
+1.215.138.43
  1.215.162.195
  1.217.24.139
-1.219.54.22
-1.22.232.216
  1.220.145.45
  1.220.185.149
  1.220.89.178
@@ -734,7 +737,6 @@
  1.222.176.232
  1.222.178.27
  1.222.198.69
-1.222.44.52
  1.223.248.99
  1.224.2.208
  1.224.37.98
@@ -746,9 +748,7 @@
  1.227.57.126
  1.229.165.34
  1.229.224.78
-1.229.83.194
  1.23.183.197
-1.230.190.251
  1.230.213.123
  1.232.247.3
  1.233.163.193
@@ -760,11 +760,15 @@
  1.234.58.166
  1.234.58.194
  1.234.58.215
+1.234.58.216
  1.234.58.227
  1.234.58.236
  1.234.58.241
  1.234.58.252
  1.235.192.218
+1.236.28.42
+1.241.213.191
+1.244.201.139
  1.245.4.163
  1.245.61.144
  1.246.222.105
@@ -786,6 +790,7 @@
  1.246.222.237
  1.246.222.245
  1.246.222.249
+1.246.222.25
  1.246.222.36
  1.246.222.38
  1.246.222.4
@@ -845,7 +850,9 @@
  1.246.80.41
  1.248.252.176
  1.251.239.18
+1.254.145.92
  1.254.152.220
+1.254.250.52
  1.255.226.37
  1.30.215.144
  1.31.128.57
@@ -854,13 +861,19 @@
  1.34.136.15
  1.36.210.62
  1.36.221.170
+1.36.52.242
  1.36.88.200
  1.38.136.255
+1.38.156.151
+1.38.156.225
+1.38.156.240
  1.38.156.243
  1.38.236.132
-1.38.52.9
+1.38.52.65
  1.39.77.104
+1.4.157.34
  1.4.157.35
+1.4.158.177
  1.4.160.43
  1.4.166.202
  1.4.184.0
@@ -869,19 +882,19 @@
  1.4.198.198
  1.4.198.230
  1.4.198.234
+1.4.198.32
  1.4.198.4
  1.4.198.48
  1.4.198.81
  1.4.198.83
+1.4.198.90
  1.4.248.130
  1.4.249.197
-1.4.249.63
  1.4.249.89
  1.4.250.221
  1.4.251.245
  1.42.201.180
  1.46.6.74
-1.46.69.17
  1.47.201.129
  1.47.7.36
  1.4buyuklergazete.com
@@ -891,41 +904,36 @@
  1.53.137.220
  1.53.137.84
  1.53.137.92
-1.53.25.132
-1.53.3.226
-1.54.155.184
+1.54.107.223
  1.54.193.178
  1.54.193.251
  1.55.0.97
-1.55.118.33
  1.55.165.141
  1.55.215.30
  1.55.223.95
  1.55.241.4
-1.55.251.223
-1.55.41.65
  1.55.51.64
  1.56.207.130
  1.58.13.96
-1.58.167.244
  1.6.135.164
  1.6.182.218
-1.6.247.167
  1.62.89.184
  1.63.226.147
  1.64.36.243
-1.65.178.22
+1.65.133.208
+1.65.135.102
+1.65.174.5
+1.65.193.156
+1.65.205.236
  1.69.242.43
  1.69.243.225bin.sh
-1.70.65.56
  1.71.143.177
  1.80.151.160
  1.80.164.27
  1.80.165.130
  1.80.227.159
-1.83.100.214
-1.83.163.192
  1.85.0.98
+1.85.2.119
  1.85.52.250
  1.9.104.155
  1.9.111.145
@@ -949,12 +957,13 @@
  10.4buyuklergazete.com
  100-365.net
  100-diamond.000webhostapp.com
-100.0.220.63
+100.0.15.8
  100.1.149.223
+100.1.169.63
  100.10.11.17
  100.10.9.70
-100.11.101.157
  100.11.117.164
+100.11.185.15
  100.111.231.2.static.cdnserver.in
  100.14.59.165
  100.14.66.94
@@ -966,7 +975,6 @@
  100.2.182.206
  100.2.182.31
  100.2.202.125
-100.2.243.233
  100.24.216.83
  100.24.35.155
  100.25.185.145
@@ -974,7 +982,7 @@
  100.25.60.57
  100.26.143.89
  100.26.180.70
-100.26.203.197
+100.26.249.16
  100.27.42.241
  100.27.42.242
  100.27.42.243
@@ -982,7 +990,9 @@
  100.3.129.148
  100.32.29.134
  100.34.17.227
+100.34.229.26
  100.35.47.77
+100.36.134.236
  100.36.184.223
  100.36.19.244
  100.36.76.248
@@ -1006,7 +1016,6 @@
  100.43.85.20
  100.6.23.40
  100.6.81.194
-100.7.116.12
  100.7.3.44
  100.7.3.45
  100.8.21.205
@@ -1039,6 +1048,7 @@
  101.0.34.150
  101.0.34.189
  101.0.34.255
+101.0.34.49
  101.0.34.67
  101.0.34.87
  101.0.41.232
@@ -1050,7 +1060,6 @@
  101.0.49.76
  101.0.54.102
  101.0.54.11
-101.0.54.128
  101.0.54.163
  101.0.54.167
  101.0.54.171
@@ -1067,12 +1076,16 @@
  101.100.177.165
  101.101.209.80
  101.108.115.176
-101.108.122.70
  101.108.126.60
-101.108.127.5
+101.108.128.11
+101.108.130.65
+101.108.131.144
  101.108.134.96
+101.108.135.186
+101.108.143.95
  101.108.145.106
  101.108.155.80
+101.108.160.69
  101.108.176.139
  101.108.177.43
  101.108.177.88
@@ -1080,14 +1093,12 @@
  101.108.184.222
  101.108.186.1
  101.108.187.224
-101.108.187.88
  101.108.188.19
  101.108.19.126
  101.108.191.159
  101.108.192.173
  101.108.192.90
  101.108.193.55
-101.108.194.143
  101.108.194.183
  101.108.194.98
  101.108.197.179
@@ -1095,35 +1106,31 @@
  101.108.199.151
  101.108.199.164
  101.108.229.193
-101.108.250.242
  101.108.32.208
  101.108.61.104
  101.108.66.247
-101.108.73.112
+101.108.80.19
  101.108.91.200
  101.108.93.171
  101.108.93.201
-101.108.93.73
-101.109.10.185
-101.109.102.95
+101.108.93.213
  101.109.108.21
-101.109.11.9
  101.109.111.111
  101.109.122.91
  101.109.141.80
-101.109.142.37
  101.109.143.71
  101.109.149.13
  101.109.15.196
-101.109.164.223
  101.109.165.39
+101.109.172.229
  101.109.176.152
-101.109.176.169
  101.109.176.188
  101.109.176.237
  101.109.177.14
  101.109.184.193
  101.109.193.198
+101.109.239.140
+101.109.24.65
  101.109.245.200
  101.109.247.136
  101.109.251.42
@@ -1144,44 +1151,46 @@
  101.109.83.194
  101.112.160.71
  101.116.110.70
+101.127.132.241
  101.127.232.199
  101.132.149.193
  101.132.153.114
  101.132.182.76
-101.132.193.232
  101.132.33.79
  101.132.39.115
  101.132.39.85
  101.132.43.162
  101.132.72.117
-101.133.164.220
  101.133.226.119
  101.133.235.161
-101.136.16.57
-101.137.114.108
+101.133.235.75
  101.16.98.170
  101.162.83.233
  101.165.169.151
  101.166.192.3
  101.173.40.161
+101.174.156.240
  101.178.223.39
  101.187.123.101
  101.188.55.183
-101.188.95.84
-101.190.180.72
  101.191.174.148
  101.198.186.254
+101.2.191.95
  101.20.136.171
  101.20.236.27
  101.20.244.126
  101.20.35.78
+101.20.55.203
+101.200.124.44
+101.200.127.75
+101.200.137.78
  101.200.143.50
  101.200.151.38
  101.200.160.24
-101.200.228.130
+101.200.234.71
  101.200.40.4
  101.200.56.138
-101.200.57.240
+101.201.105.77
  101.201.62.45
  101.203.174.175
  101.205.120.102
@@ -1196,6 +1205,7 @@
  101.227.251.235
  101.227.34.23
  101.227.5.66
+101.227.82.60
  101.230.248.162
  101.230.248.163
  101.230.248.164
@@ -1207,6 +1217,7 @@
  101.231.146.36
  101.231.96.174
  101.236.60.31
+101.25.101.42
  101.25.112.240
  101.25.117.141
  101.251.197.238
@@ -1216,7 +1227,7 @@
  101.251.219.243
  101.254.136.130
  101.254.159.218
-101.254.233.194
+101.255.103.201
  101.255.116.61
  101.255.117.2
  101.255.118.146
@@ -1229,19 +1240,21 @@
  101.255.140.101
  101.255.40.18
  101.255.52.210
+101.255.54.188
  101.255.55.10
  101.255.56.134
+101.255.56.42
  101.255.62.202
  101.255.63.10
  101.255.63.22
  101.255.66.147
+101.255.72.171
  101.255.75.46
  101.255.79.18
  101.255.79.249
  101.255.81.91
  101.255.9.104
  101.255.93.22
-101.255.94.130
  101.26.88.95
  101.28.35.166
  101.28.93.184
@@ -1266,7 +1279,6 @@
  101.32.179.54
  101.32.181.140
  101.32.181.50
-101.32.182.55
  101.32.183.189
  101.32.187.45
  101.32.188.89
@@ -1364,10 +1376,13 @@
  101.36.179.145
  101.37.118.54
  101.37.161.61
+101.37.31.237
  101.37.33.19
  101.4.136.34
  101.50.1.11
  101.50.1.2
+101.50.102.108
+101.50.121.26
  101.50.83.28
  101.50.92.11
  101.51.104.122
@@ -1379,7 +1394,6 @@
  101.51.121.203
  101.51.121.29
  101.51.121.35
-101.51.13.147
  101.51.141.106
  101.51.141.11
  101.51.141.118
@@ -1391,18 +1405,21 @@
  101.51.144.75
  101.51.149.44
  101.51.16.87
+101.51.168.176
+101.51.182.125
  101.51.19.31
  101.51.196.179
  101.51.238.104
  101.51.240.65
  101.51.241.203
  101.51.244.22
-101.51.36.161
  101.51.37.115
+101.51.39.233
  101.51.43.143
  101.51.66.23
-101.53.228.85
+101.6.102.48
  101.6.64.76
+101.6.98.91
  101.64.116.52
  101.64.117.49
  101.64.156.58
@@ -1411,22 +1428,26 @@
  101.65.128.150
  101.65.160.13
  101.65.161.220
+101.65.81.114
  101.66.80.23
  101.67.215.7
  101.67.241.95
  101.67.243.158
+101.68.78.194
+101.68.82.186
  101.69.200.162
  101.69.240.94
+101.69.244.37
  101.70.15.84
  101.71.3.53
  101.71.51.192
  101.72.33.145
  101.73.145.214
  101.78.15.54
+101.78.3.29
  101.78.9.237
  101.79.167.114
  101.79.5.58
-101.83.37.5
  101.86.162.5
  101.89.110.1
  101.89.116.39
@@ -1437,6 +1458,7 @@
  101.89.218.176
  101.89.219.59
  101.91.178.122
+101.93.107.120
  101.95.162.58
  101.96.113.50
  101.98.149.170
@@ -1444,7 +1466,6 @@
  101.98.32.57
  101.99.14.54
  101.99.20.59
-101.99.36.37
  101.99.52.174
  101.99.77.62
  101.99.90.116
@@ -1467,19 +1488,18 @@
  101gowrie.com
  101jo.com
  101login-screens.weebly.com
+102.101.139.12
  102.101.192.26
-102.116.17.9
+102.116.99.148
  102.118.202.113
-102.123.77.54
  102.129.175.128
+102.129.175.155
  102.129.199.110
  102.129.199.111
  102.129.199.70
  102.129.199.83
  102.129.249.232
-102.129.249.32
  102.129.36.189
-102.129.48.134
  102.130.114.164
  102.130.119.99
  102.130.120.91
@@ -1491,14 +1511,16 @@
  102.134.180.75
  102.135.132.121
  102.137.241.7
-102.140.225.214
  102.140.228.251
-102.140.4.14
  102.141.121.13
  102.141.197.17
+102.152.58.97
+102.157.51.201
  102.164.108.43
+102.164.12.113
  102.164.210.100
  102.164.248.235
+102.164.5.177
  102.164.61.237
  102.165.52.62
  102.165.54.27
@@ -1508,7 +1530,6 @@
  102.176.160.107
  102.176.160.109
  102.176.160.70
-102.176.160.82
  102.176.160.84
  102.176.161.114
  102.176.162.24
@@ -1519,7 +1540,6 @@
  102.176.189.7
  102.176.197.253
  102.176.221.68
-102.176.59.91
  102.176.94.141
  102.177.105.34
  102.177.141.1
@@ -1534,15 +1554,12 @@
  102.182.204.96
  102.223.73.172
  102.223.73.187
-102.223.75.159
  102.223.75.177
  102.23.221.1
  102.23.242.15
  102.244.120.10
-102.252.64.6
-102.252.64.71
-102.252.64.88
  102.36.164.141
+102.37.10.45
  102.37.101.212
  102.37.13.183
  102.37.42.197
@@ -1553,30 +1570,26 @@
  102.38.50.62
  102.38.50.65
  102.39.192.156
+102.39.217.248
  102.39.67.51
+102.40.230.139
  102.45.138.94
  102.53.4.42
-102.64.122.81
  102.64.33.150
-102.65.114.89
  102.65.189.156
  102.65.22.84
  102.65.89.16
-102.66.3.164
  102.67.19.132
  102.67.68.1
  102.67.73.1
  102.67.74.1
-102.68.110.193
  102.68.134.14
  102.68.17.108
  102.68.17.156
  102.68.17.8
  102.68.17.96
  102.69.163.144
-102.70.49.113
-102.70.49.119
-102.89.3.141
+102.77.108.158
  102020yahoo.weebly.com
  1022408.had.su
  1024-36963.el-alt.com
@@ -1592,11 +1605,14 @@
  103.10.133.41
  103.10.133.81
  103.10.157.9
+103.10.169.212
  103.10.191.116
  103.10.210.17
  103.10.228.221
  103.10.23.161
  103.10.3.104
+103.10.52.249
+103.10.53.170
  103.10.53.174
  103.10.53.70
  103.10.54.17
@@ -1606,11 +1622,11 @@
  103.10.63.234
  103.10.81.172
  103.10.87.54
-103.100.137.40
  103.100.159.182
  103.100.159.186
  103.100.159.204
  103.100.188.51
+103.100.208.30
  103.100.208.50
  103.100.209.118
  103.100.209.152
@@ -1619,32 +1635,32 @@
  103.100.210.101
  103.100.210.198
  103.100.210.207
-103.100.211.77
+103.100.210.231
+103.100.233.5
  103.100.4.8
  103.100.83.253
-103.100.96.174
  103.101.161.33
  103.101.162.209
-103.101.171.1
  103.101.174.145
  103.101.233.13
  103.102.101.43
+103.102.117.78
  103.102.14.185
  103.102.141.56
  103.102.141.61
  103.102.142.184
  103.102.145.34
  103.102.205.38
+103.103.143.54
  103.103.212.222
+103.103.212.25
  103.103.52.40
+103.103.52.5
  103.103.71.8
-103.103.92.131
  103.104.124.33
  103.104.132.2
  103.104.133.178
  103.104.17.18
-103.104.213.118
-103.104.213.154
  103.104.227.154
  103.104.61.102
  103.105.130.136
@@ -1670,15 +1686,17 @@
  103.105.40.161
  103.105.40.70
  103.105.67.146
+103.105.69.58
  103.105.70.9
+103.106.101.79
  103.106.112.11
+103.106.114.134
  103.106.158.252
  103.106.192.245
  103.106.20.212
  103.106.219.131
  103.106.219.209
  103.106.219.222
-103.106.219.79
  103.106.242.206
  103.106.250.25
  103.106.28.78
@@ -1712,7 +1730,6 @@
  103.106.35.41
  103.106.35.9
  103.106.65.243
-103.107.113.22
  103.107.160.169
  103.107.161.54
  103.107.17.205
@@ -1736,11 +1753,13 @@
  103.107.92.1
  103.107.92.105
  103.107.92.110
+103.107.92.113
  103.107.92.117
  103.107.92.121
  103.107.92.129
  103.107.92.133
  103.107.92.137
+103.107.92.153
  103.107.92.161
  103.107.92.165
  103.107.92.169
@@ -1783,19 +1802,18 @@
  103.107.94.89
  103.107.95.9
  103.108.128.178
+103.108.146.74
  103.108.228.42
  103.108.58.212
  103.108.59.162
  103.108.75.153
  103.108.87.133
  103.108.87.161
-103.108.91.160
  103.108.98.1
  103.109.0.20
  103.109.0.242
  103.109.0.46
  103.109.101.216
-103.109.109.98
  103.109.15.141
  103.109.15.196
  103.109.152.210
@@ -1825,7 +1843,6 @@
  103.109.57.233
  103.109.57.237
  103.109.57.249
-103.109.57.254
  103.109.57.42
  103.109.58.1
  103.109.58.110
@@ -1847,11 +1864,10 @@
  103.109.59.77
  103.109.59.81
  103.109.95.98
-103.11.106.69
  103.11.106.70
-103.11.23.0
  103.11.67.169
  103.11.80.108
+103.11.82.82
  103.110.109.17
  103.110.109.2
  103.110.109.33
@@ -1866,9 +1882,9 @@
  103.110.126.111
  103.110.160.198
  103.110.162.210
-103.110.36.196
-103.110.49.223
+103.110.48.84
  103.110.59.3
+103.110.6.118
  103.110.84.196
  103.110.88.218
  103.110.89.148
@@ -1894,12 +1910,14 @@
  103.112.177.246
  103.112.204.190
  103.112.212.133
+103.112.212.189
+103.112.212.190
  103.112.212.30
-103.112.213.237
  103.112.244.249
  103.112.253.214
  103.112.254.43
  103.112.29.124
+103.112.55.242
  103.112.60.33
  103.112.60.5
  103.112.60.50
@@ -1916,7 +1934,6 @@
  103.112.63.121
  103.112.63.33
  103.112.86.174
-103.113.102.166
  103.113.104.176
  103.113.104.225
  103.113.104.43
@@ -1943,8 +1960,6 @@
  103.114.104.62
  103.114.105.83
  103.114.106.11
-103.114.107.128
-103.114.107.149
  103.114.211.69
  103.114.221.16
  103.114.61.150
@@ -1960,11 +1975,13 @@
  103.114.98.233
  103.115.116.17
  103.115.119.17
+103.115.119.20
  103.115.119.226
  103.115.119.250
  103.115.119.254
  103.115.14.1
  103.115.252.129
+103.115.252.17
  103.115.252.26
  103.115.252.30
  103.115.254.6
@@ -1976,7 +1993,6 @@
  103.115.255.145
  103.115.255.193
  103.115.255.209
-103.115.255.212
  103.115.255.65
  103.115.255.73
  103.115.255.86
@@ -1984,17 +2000,16 @@
  103.115.255.93
  103.115.44.238
  103.116.104.95
-103.116.173.242
+103.116.12.91
+103.116.200.12
  103.116.203.244
  103.116.47.92
-103.116.58.186
  103.117.108.106
  103.117.108.154
  103.117.108.247
  103.117.108.30
  103.117.146.210
  103.117.146.98
-103.117.152.229
  103.117.156.44
  103.117.195.120
  103.117.229.26
@@ -2027,7 +2042,6 @@
  103.12.161.196
  103.12.161.38
  103.12.177.34
-103.12.198.86
  103.12.198.94
  103.12.246.10
  103.12.246.101
@@ -2056,18 +2070,13 @@
  103.120.135.144
  103.120.135.33
  103.120.168.3
-103.120.173.102
-103.120.176.57
  103.120.189.141
-103.120.201.2
  103.120.208.229
  103.120.223.27
  103.120.226.170
  103.120.37.66
  103.120.6.39
-103.121.175.50
  103.121.197.82
-103.121.213.65
  103.121.215.208
  103.121.215.211
  103.121.224.11
@@ -2089,18 +2098,19 @@
  103.123.170.190
  103.123.170.67
  103.123.229.106
-103.123.231.202
  103.123.235.40
-103.123.246.130
  103.123.246.66
  103.123.25.80
+103.123.36.246
  103.123.64.19
  103.123.65.186
+103.123.66.114
+103.124.104.118
+103.124.106.203
  103.124.136.77
  103.124.147.22
  103.124.175.139
  103.124.199.34
-103.124.83.14
  103.124.94.169
  103.124.95.136
  103.124.95.223
@@ -2109,17 +2119,17 @@
  103.125.128.45
  103.125.128.46
  103.125.130.84
+103.125.130.94
  103.125.170.22
-103.125.176.2
  103.125.189.140
  103.125.189.52
  103.125.191.106
  103.125.191.123
  103.125.191.136
  103.125.191.233
-103.125.191.4
  103.125.191.78
  103.125.218.107
+103.125.218.111
  103.125.26.82
  103.125.28.147
  103.125.43.12
@@ -2128,10 +2138,10 @@
  103.126.100.13
  103.126.100.18
  103.126.100.31
+103.126.102.25
  103.126.102.5
  103.127.185.133
  103.127.206.109
-103.127.35.50
  103.127.41.103
  103.127.57.162
  103.127.76.172
@@ -2140,6 +2150,7 @@
  103.129.194.1
  103.129.195.48
  103.129.197.185
+103.129.220.138
  103.129.221.55
  103.129.222.171
  103.129.222.181
@@ -2163,14 +2174,18 @@
  103.131.104.52
  103.131.104.63
  103.131.168.133
-103.131.214.243
  103.131.80.2
+103.133.107.172
+103.133.107.38
  103.133.109.40
  103.133.109.41
  103.133.223.122
+103.133.242.92
  103.133.37.77
+103.133.56.147
  103.133.56.68
  103.133.82.125
+103.134.135.167
  103.134.177.163
  103.134.18.209
  103.134.200.26
@@ -2179,10 +2194,6 @@
  103.134.203.26
  103.134.208.2
  103.134.24.253
-103.134.240.99
-103.134.248.58
-103.134.249.14
-103.134.249.58
  103.134.25.80
  103.134.255.103
  103.134.255.110
@@ -2198,9 +2209,9 @@
  103.135.216.194
  103.135.225.164
  103.135.227.74
-103.135.33.74
  103.135.38.92
  103.135.39.19
+103.135.7.246
  103.136.40.128
  103.136.40.17
  103.136.40.18
@@ -2209,6 +2220,7 @@
  103.136.40.93
  103.136.42.230
  103.136.42.241
+103.136.83.155
  103.137.124.10
  103.137.124.12
  103.137.124.15
@@ -2227,19 +2239,19 @@
  103.138.30.114
  103.138.4.20
  103.138.4.224
-103.138.47.3
+103.138.5.105
  103.138.5.135
  103.138.5.26
  103.138.5.43
  103.138.53.201
  103.138.69.197
-103.138.8.155
  103.139.120.231
  103.139.163.210
  103.139.163.219
  103.139.190.35
  103.139.196.68
  103.14.198.18
+103.14.20.225
  103.14.235.26
  103.14.235.70
  103.14.244.190
@@ -2258,13 +2270,10 @@
  103.14.38.186
  103.14.38.188
  103.14.45.98
-103.140.104.211
-103.140.104.212
  103.140.126.142
  103.140.127.65
  103.140.189.167
  103.140.238.246
-103.140.31.159
  103.140.82.1
  103.140.83.101
  103.140.83.109
@@ -2282,7 +2291,6 @@
  103.140.83.93
  103.140.83.94
  103.141.108.142
-103.141.108.161
  103.141.108.185
  103.141.116.210
  103.141.138.118
@@ -2294,7 +2302,7 @@
  103.141.235.170
  103.141.3.120
  103.141.52.234
-103.141.90.23
+103.141.70.167
  103.142.111.146
  103.142.164.37
  103.142.164.38
@@ -2317,7 +2325,6 @@
  103.142.98.84
  103.143.167.38
  103.143.193.226
-103.143.196.98
  103.143.20.82
  103.143.20.84
  103.143.20.86
@@ -2346,7 +2353,6 @@
  103.143.235.37
  103.143.235.45
  103.143.77.102
-103.143.77.105
  103.143.77.124
  103.143.77.130
  103.143.77.156
@@ -2372,17 +2378,17 @@
  103.144.147.210
  103.144.18.35
  103.144.180.2
+103.144.180.22
  103.144.213.13
  103.145.12.11
  103.145.12.91
-103.145.13.60
  103.145.22.49
  103.145.252.23
  103.145.252.72
  103.145.253.208
+103.145.254.221
  103.145.255.142
  103.145.255.25
-103.145.59.11
  103.145.67.246
  103.146.100.130
  103.146.110.22
@@ -2390,19 +2396,19 @@
  103.146.176.124
  103.146.202.150
  103.146.221.125
-103.146.224.178
  103.146.3.58
  103.147.10.222
  103.147.119.3
  103.147.13.62
-103.147.192.126
+103.147.142.236
+103.147.185.48
  103.147.245.36
  103.147.3.153
  103.147.3.32
  103.147.4.49
  103.147.4.55
-103.147.5.67
  103.147.5.89
+103.148.129.246
  103.148.195.11
  103.148.195.18
  103.148.195.20
@@ -2423,17 +2429,16 @@
  103.148.94.254
  103.149.12.183
  103.149.12.29
-103.149.158.48
  103.149.159.33
  103.149.159.73
+103.149.162.84
  103.149.170.15
  103.149.201.204
  103.149.203.55
  103.149.248.57
  103.149.27.65
-103.149.53.230
  103.15.140.140
-103.15.140.142
+103.15.140.177
  103.15.226.14
  103.15.242.210
  103.15.242.212
@@ -2455,28 +2460,26 @@
  103.150.68.124
  103.151.124.247
  103.151.124.96
+103.151.157.24
  103.151.176.21
  103.151.182.6
-103.151.189.71
  103.151.43.38
-103.152.101.135
  103.152.117.222
  103.152.118.244
+103.152.134.166
  103.152.158.40
  103.152.158.60
  103.152.181.45
  103.152.221.178
  103.152.242.19
-103.152.242.51
  103.152.40.154
  103.152.5.2
  103.152.5.70
  103.152.5.80
  103.152.79.161
-103.153.104.131
-103.153.167.38
  103.153.183.18
-103.153.38.244
+103.153.37.96
+103.153.61.156
  103.153.64.238
  103.153.77.147
  103.153.92.137
@@ -2484,9 +2487,11 @@
  103.154.160.58
  103.154.54.176
  103.154.9.66
+103.154.9.67
  103.154.9.68
  103.154.9.69
  103.155.162.184
+103.155.162.191
  103.155.162.218
  103.155.162.233
  103.155.166.250
@@ -2494,18 +2499,17 @@
  103.156.145.143
  103.156.90.4
  103.156.90.78
-103.156.90.8
  103.156.91.203
  103.156.93.150
  103.157.116.199
  103.157.186.163
  103.157.220.197
-103.157.225.48
  103.157.25.2
  103.157.25.3
  103.157.25.4
  103.157.25.5
  103.157.96.135
+103.158.174.25
  103.16.115.18
  103.16.128.63
  103.16.128.72
@@ -2524,18 +2528,18 @@
  103.16.25.6
  103.16.60.146
  103.16.63.125
-103.160.103.174
  103.17.117.40
  103.17.117.43
-103.17.236.93
+103.17.236.94
+103.17.244.126
  103.17.48.12
  103.17.49.2
  103.18.117.10
  103.18.117.109
+103.18.14.0
  103.18.179.196
  103.18.179.212
  103.18.77.46
-103.19.142.192
  103.19.229.150
  103.19.250.52
  103.19.252.130
@@ -2564,14 +2568,16 @@
  103.194.242.158
  103.194.242.254
  103.194.242.78
-103.194.243.212
  103.194.251.42
+103.195.141.227
  103.195.205.109
  103.195.7.25
  103.195.7.97
  103.195.90.115
  103.195.90.7
+103.196.11.38
  103.196.233.199
+103.196.235.122
  103.196.53.209
  103.197.134.18
  103.197.134.22
@@ -2586,10 +2592,8 @@
  103.197.48.98
  103.197.75.1
  103.197.93.2
-103.198.173.147
  103.198.192.14
  103.199.110.42
-103.199.114.115
  103.199.155.198
  103.199.155.26
  103.199.156.121
@@ -2636,8 +2640,8 @@
  103.199.16.50
  103.199.160.50
  103.199.18.37
+103.199.182.129
  103.199.19.134
-103.199.19.179
  103.199.84.42
  103.199.97.129
  103.199.97.161
@@ -2645,21 +2649,23 @@
  103.199.97.33
  103.199.97.5
  103.199.97.9
+103.2.135.10
+103.2.181.70
  103.20.166.167
  103.20.188.94
  103.20.189.126
  103.20.191.242
-103.20.3.78
+103.20.3.36
  103.20.33.185
  103.20.34.169
  103.200.116.12
-103.200.134.159
  103.200.135.226
  103.200.135.228
  103.200.135.229
  103.200.135.230
  103.200.22.126
  103.200.37.31
+103.200.38.68
  103.200.40.194
  103.200.95.82
  103.200.97.70
@@ -2669,6 +2675,7 @@
  103.204.110.144
  103.204.111.137
  103.204.111.184
+103.204.163.52
  103.204.166.206
  103.204.52.66
  103.204.54.50
@@ -2686,13 +2693,11 @@
  103.205.130.202
  103.205.130.206
  103.205.130.209
+103.205.130.213
  103.205.130.214
  103.205.130.216
  103.205.130.218
-103.205.130.22
  103.205.130.220
-103.205.130.225
-103.205.130.226
  103.205.130.228
  103.205.130.231
  103.205.130.232
@@ -2700,6 +2705,7 @@
  103.205.130.236
  103.205.130.241
  103.205.130.243
+103.205.130.244
  103.205.130.246
  103.205.130.25
  103.205.130.250
@@ -2711,11 +2717,12 @@
  103.205.130.36
  103.205.130.38
  103.205.130.41
-103.205.130.43
+103.205.130.42
  103.205.130.46
  103.205.130.48
  103.205.130.5
  103.205.130.51
+103.205.130.53
  103.205.130.59
  103.205.130.60
  103.205.130.62
@@ -2734,8 +2741,6 @@
  103.205.134.180
  103.205.134.218
  103.205.177.229
-103.205.179.249
-103.205.180.177
  103.205.182.142
  103.205.243.67
  103.205.5.158
@@ -2749,6 +2754,7 @@
  103.206.128.137
  103.206.130.201
  103.206.131.213
+103.206.208.135
  103.206.209.238
  103.206.225.84
  103.206.227.22
@@ -2758,11 +2764,13 @@
  103.206.254.170
  103.206.254.242
  103.206.9.152
+103.206.96.210
  103.207.0.193
  103.207.11.10
  103.207.11.6
+103.207.11.9
  103.207.156.207
-103.207.36.223
+103.207.36.56
  103.207.37.133
  103.207.37.184
  103.207.37.189
@@ -2796,7 +2804,6 @@
  103.209.65.12
  103.209.68.197
  103.209.81.219
-103.209.88.41
  103.209.89.66
  103.21.142.12
  103.21.150.184
@@ -2808,7 +2815,6 @@
  103.21.183.248
  103.21.239.106
  103.21.40.35
-103.21.48.82
  103.21.53.11
  103.21.58.156
  103.210.120.40
@@ -2817,7 +2823,7 @@
  103.210.22.124
  103.210.236.229
  103.210.237.13
-103.210.28.54
+103.210.28.50
  103.210.29.113
  103.210.29.193
  103.210.29.212
@@ -2901,6 +2907,7 @@
  103.212.223.155
  103.212.223.161
  103.212.225.238
+103.212.43.88
  103.212.69.171
  103.212.92.193
  103.212.92.201
@@ -2921,13 +2928,11 @@
  103.212.93.253
  103.212.93.254
  103.212.94.253
+103.213.116.178
  103.213.240.29
  103.213.245.102
-103.213.245.169
  103.213.248.45
-103.213.249.26
  103.213.96.15
-103.214.100.102
  103.214.146.12
  103.214.191.253
  103.214.219.49
@@ -2938,6 +2943,8 @@
  103.214.55.34
  103.214.55.6
  103.214.6.199
+103.214.60.251
+103.214.61.102
  103.214.61.113
  103.214.61.41
  103.214.65.230
@@ -2946,7 +2953,6 @@
  103.215.148.17
  103.215.148.25
  103.215.148.4
-103.215.164.74
  103.215.177.211
  103.215.177.231
  103.215.236.2
@@ -2954,8 +2960,8 @@
  103.215.81.107
  103.215.81.74
  103.215.82.17
+103.216.140.219
  103.216.147.49
-103.216.162.208
  103.216.169.253
  103.216.216.250
  103.216.218.207
@@ -2981,10 +2987,8 @@
  103.217.121.14
  103.217.121.140
  103.217.121.145
-103.217.121.158
  103.217.121.169
  103.217.121.173
-103.217.121.181
  103.217.121.185
  103.217.121.191
  103.217.121.201
@@ -3026,16 +3030,15 @@
  103.217.213.129
  103.217.213.145
  103.217.217.25
+103.217.92.166
  103.218.109.62
  103.218.134.144
-103.218.163.253
  103.218.2.188
  103.218.240.75
  103.218.26.169
  103.219.112.178
  103.219.112.48
  103.219.112.63
-103.219.147.2
  103.219.147.34
  103.219.187.55
  103.219.187.56
@@ -3043,8 +3046,8 @@
  103.219.212.87
  103.219.41.107
  103.22.144.67
+103.22.248.59
  103.22.251.45
-103.220.157.30
  103.220.204.101
  103.220.205.212
  103.220.206.110
@@ -3060,6 +3063,7 @@
  103.220.6.250
  103.220.6.254
  103.220.7.13
+103.221.220.138
  103.221.221.190
  103.221.222.30
  103.221.232.125
@@ -3069,10 +3073,11 @@
  103.221.232.175
  103.221.232.203
  103.221.232.231
+103.221.232.237
  103.221.232.36
  103.221.232.63
+103.221.235.114
  103.221.235.235
-103.221.235.28
  103.221.252.38
  103.221.252.46
  103.221.253.145
@@ -3090,6 +3095,7 @@
  103.223.12.139
  103.223.12.156
  103.223.12.183
+103.223.15.94
  103.224.101.46
  103.224.118.79
  103.224.185.16
@@ -3097,7 +3103,6 @@
  103.224.185.4
  103.224.185.48
  103.224.195.41
-103.224.245.4
  103.224.250.94
  103.224.33.35
  103.224.48.38
@@ -3111,7 +3116,7 @@
  103.224.83.71
  103.224.83.91
  103.225.103.5
-103.225.138.122
+103.225.174.30
  103.225.206.22
  103.225.22.118
  103.225.228.1
@@ -3152,17 +3157,16 @@
  103.226.248.225
  103.226.249.187
  103.226.250.169
+103.226.250.242
  103.226.250.28
  103.226.250.79
  103.226.51.80
-103.227.118.129
  103.227.145.6
  103.227.147.142
  103.227.176.23
  103.227.254.59
  103.227.255.43
  103.227.36.48
-103.227.37.87
  103.228.1.170
  103.228.112.110
  103.228.117.105
@@ -3183,7 +3187,6 @@
  103.229.200.125
  103.229.45.170
  103.229.73.17
-103.229.82.194
  103.229.84.117
  103.229.85.205
  103.229.85.22
@@ -3206,15 +3209,11 @@
  103.23.102.245
  103.23.119.56
  103.23.119.57
-103.23.125.171
  103.23.125.173
-103.23.125.67
  103.23.126.84
-103.23.127.46
-103.23.127.52
  103.23.154.184
  103.23.21.127
-103.230.153.227
+103.230.104.24
  103.230.155.154
  103.230.155.243
  103.230.216.132
@@ -3248,15 +3247,17 @@
  103.232.66.154
  103.232.66.162
  103.232.66.166
+103.232.66.97
  103.233.0.121
  103.233.0.18
  103.233.0.37
  103.233.103.233
  103.233.103.237
  103.233.103.241
+103.233.118.163
  103.233.118.226
  103.233.122.12
-103.233.123.166
+103.233.123.202
  103.233.146.1
  103.233.152.140
  103.233.152.179
@@ -3267,12 +3268,11 @@
  103.233.154.19
  103.233.198.156
  103.233.2.162
-103.233.2.191
-103.233.5.24
  103.233.80.154
  103.233.80.25
  103.233.80.26
  103.233.89.214
+103.234.100.3
  103.234.137.130
  103.234.139.86
  103.234.220.195
@@ -3281,6 +3281,7 @@
  103.234.254.164
  103.235.1.224
  103.235.164.110
+103.235.170.162
  103.235.170.195
  103.235.198.102
  103.235.198.60
@@ -3307,12 +3308,14 @@
  103.236.161.56
  103.236.161.8
  103.236.162.206
+103.236.201.239
  103.236.201.88
  103.236.253.28
  103.237.144.150
  103.237.145.182
  103.237.146.56
  103.237.147.16
+103.237.37.106
  103.237.56.16
  103.238.14.242
  103.238.203.168
@@ -3320,33 +3323,30 @@
  103.238.225.129
  103.238.226.160
  103.238.227.56
-103.238.228.3
  103.238.231.60
+103.238.68.117
  103.238.69.144
  103.238.69.169
  103.238.75.235
  103.239.147.129
  103.239.19.142
  103.239.252.234
+103.239.253.0
  103.239.253.161
  103.239.254.114
  103.239.254.70
  103.239.255.170
  103.239.54.243
  103.239.55.73
-103.24.126.179
  103.24.179.18
  103.24.230.86
  103.240.100.106
  103.240.100.214
-103.240.102.39
  103.240.160.21
  103.240.161.101
  103.240.161.108
  103.240.168.138
-103.240.193.40
  103.240.206.196
-103.240.236.17
  103.240.245.16
  103.240.250.169
  103.240.33.113
@@ -3372,6 +3372,7 @@
  103.241.141.234
  103.241.178.10
  103.241.204.225
+103.241.205.1
  103.241.227.100
  103.241.227.105
  103.241.227.106
@@ -3394,13 +3395,13 @@
  103.242.132.33
  103.242.14.68
  103.242.14.8
+103.242.15.37
  103.242.166.5
  103.242.180.248
  103.242.3.134
  103.242.45.68
  103.242.56.122
  103.242.66.56
-103.243.113.42
  103.243.115.230
  103.243.129.15
  103.243.131.231
@@ -3416,16 +3417,17 @@
  103.243.25.92
  103.243.27.175
  103.243.27.23
+103.243.44.238
  103.243.46.6
  103.243.81.252
  103.243.82.198
  103.243.82.234
  103.244.108.160
  103.244.111.196
-103.244.177.250
-103.244.177.82
+103.244.176.154
  103.244.205.146
  103.244.206.74
+103.244.242.191
  103.244.4.66
  103.245.153.70
  103.245.181.2
@@ -3442,15 +3444,13 @@
  103.246.1.218
  103.246.1.220
  103.246.1.222
-103.246.106.118
  103.246.240.26
  103.246.240.30
  103.246.245.253
  103.247.13.129
  103.247.13.45
-103.247.151.74
+103.247.151.83
  103.247.162.218
-103.247.196.81
  103.247.216.17
  103.247.217.162
  103.247.218.43
@@ -3466,32 +3466,34 @@
  103.248.33.51
  103.248.85.244
  103.249.100.244
+103.249.148.27
  103.249.155.109
  103.249.155.137
  103.249.155.141
+103.249.155.145
  103.249.155.149
  103.249.155.169
  103.249.155.177
-103.249.155.185
  103.249.155.197
  103.249.155.245
  103.249.155.97
-103.249.250.183
  103.249.28.142
  103.249.28.195
  103.249.28.87
  103.249.31.189
  103.249.37.159
-103.249.77.2
  103.249.98.139
  103.25.0.202
  103.25.120.138
  103.25.121.153
  103.25.122.41
  103.25.130.114
+103.25.170.65
  103.25.21.34
  103.25.3.82
+103.25.36.194
  103.25.45.38
+103.25.85.24
  103.250.148.82
  103.250.152.30
  103.250.153.203
@@ -3506,9 +3508,9 @@
  103.250.166.4
  103.250.167.226
  103.250.184.59
+103.250.186.167
  103.250.68.10
  103.250.68.66
-103.250.69.233
  103.250.69.94
  103.250.71.33
  103.251.176.22
@@ -3543,8 +3545,8 @@
  103.251.222.9
  103.251.223.13
  103.251.225.10
+103.251.225.13
  103.251.225.16
-103.251.225.18
  103.251.57.23
  103.251.83.14
  103.252.117.100
@@ -3553,10 +3555,10 @@
  103.252.168.75
  103.252.17.146
  103.252.35.170
-103.252.35.81
  103.253.113.54
  103.253.14.43
  103.253.145.133
+103.253.146.25
  103.253.146.44
  103.253.146.56
  103.253.154.155
@@ -3576,6 +3578,7 @@
  103.254.198.67
  103.254.207.197
  103.254.56.114
+103.254.58.217
  103.254.94.190
  103.254.94.91
  103.255.123.128
@@ -3590,16 +3593,17 @@
  103.26.136.173
  103.26.213.117
  103.26.40.145
-103.26.85.13
  103.27.108.113
  103.27.109.164
  103.27.109.166
  103.27.202.58
  103.27.236.10
+103.27.239.185
  103.27.239.216
  103.27.4.161
  103.27.61.222
  103.27.79.136
+103.27.79.150
  103.27.79.185
  103.28.112.2
  103.28.112.205
@@ -3665,6 +3669,7 @@
  103.35.111.101
  103.35.111.102
  103.35.168.14
+103.35.168.175
  103.35.171.178
  103.35.74.74
  103.36.10.5
@@ -3682,6 +3687,7 @@
  103.36.124.158
  103.36.125.162
  103.36.126.14
+103.36.18.246
  103.36.35.135
  103.36.48.103
  103.36.48.110
@@ -3690,7 +3696,6 @@
  103.37.205.47
  103.37.82.38
  103.38.102.182
-103.38.18.169
  103.38.24.46
  103.38.25.130
  103.38.25.138
@@ -3714,6 +3719,7 @@
  103.39.212.96
  103.39.213.170
  103.39.235.166
+103.39.236.213
  103.39.246.210
  103.39.29.101
  103.4.146.220
@@ -3721,10 +3727,11 @@
  103.4.164.205
  103.4.217.138
  103.4.217.139
-103.4.217.180
  103.4.233.93
+103.4.92.226
  103.4.94.178
  103.40.116.68
+103.40.132.10
  103.40.160.194
  103.40.162.37
  103.40.172.173
@@ -3757,10 +3764,12 @@
  103.41.206.133
  103.41.206.180
  103.41.212.186
+103.41.25.131
  103.41.25.33
  103.41.28.70
-103.41.28.98
  103.41.29.134
+103.41.37.102
+103.41.38.16
  103.41.66.179
  103.41.66.250
  103.41.96.94
@@ -3774,7 +3783,6 @@
  103.42.254.108
  103.42.254.194
  103.42.56.50
-103.42.87.23
  103.43.129.227
  103.43.151.46
  103.43.16.146
@@ -3794,7 +3802,9 @@
  103.44.15.193
  103.44.18.233
  103.44.18.248
+103.44.240.204
  103.44.242.22
+103.44.245.18
  103.44.246.33
  103.44.248.252
  103.44.249.136
@@ -3811,10 +3821,11 @@
  103.45.103.80
  103.45.105.120
  103.45.108.130
+103.45.111.35
  103.45.116.183
  103.45.118.124
  103.45.118.92
-103.45.120.144
+103.45.128.242
  103.45.174.196
  103.45.177.224
  103.45.177.31
@@ -3823,30 +3834,31 @@
  103.45.183.223
  103.45.184.120
  103.45.184.234
-103.45.186.74
  103.45.189.165
  103.45.190.6
  103.45.251.8
+103.45.65.60
  103.46.128.41
  103.46.128.43
  103.46.210.134
  103.46.234.129
  103.46.239.133
+103.46.239.25
  103.47.104.226
+103.47.104.227
  103.47.104.239
  103.47.104.247
  103.47.104.249
  103.47.104.250
  103.47.14.246
  103.47.217.109
+103.47.217.114
  103.47.217.177
-103.47.217.2
  103.47.217.85
  103.47.218.76
  103.47.219.162
  103.47.219.49
  103.47.219.84
-103.47.66.154
  103.47.92.33
  103.47.93.113
  103.47.93.193
@@ -3869,6 +3881,8 @@
  103.48.192.48
  103.48.193.7
  103.48.25.195
+103.48.68.142
+103.49.200.50
  103.49.28.58
  103.49.28.64
  103.49.53.129
@@ -3887,15 +3901,16 @@
  103.50.170.37
  103.50.170.41
  103.50.170.49
-103.50.170.65
  103.50.170.69
  103.50.170.73
+103.50.170.75
  103.50.170.81
  103.50.170.9
  103.50.170.97
  103.50.171.9
  103.50.205.186
  103.50.81.198
+103.51.103.3
  103.51.12.206
  103.51.12.32
  103.51.145.196
@@ -3938,7 +3953,6 @@
  103.53.231.144
  103.53.27.1
  103.53.76.82
-103.53.77.234
  103.54.101.28
  103.54.148.26
  103.54.148.50
@@ -3956,6 +3970,8 @@
  103.54.36.59
  103.54.95.70
  103.55.144.243
+103.55.146.160
+103.55.146.161
  103.55.24.37
  103.55.36.28
  103.55.38.220
@@ -3976,6 +3992,7 @@
  103.57.192.138
  103.57.201.91
  103.57.220.28
+103.57.222.212
  103.57.222.230
  103.57.70.231
  103.57.70.248
@@ -4004,7 +4021,6 @@
  103.57.83.224
  103.57.84.121
  103.57.85.244
-103.58.152.61
  103.58.16.106
  103.58.16.254
  103.58.17.246
@@ -4021,7 +4037,6 @@
  103.59.200.58
  103.59.203.141
  103.59.203.157
-103.59.203.161
  103.59.203.249
  103.59.38.130
  103.6.104.104
@@ -4042,7 +4057,6 @@
  103.60.212.113
  103.60.212.146
  103.60.214.18
-103.60.215.56
  103.61.101.11
  103.61.113.167
  103.61.198.114
@@ -4050,9 +4064,9 @@
  103.61.198.234
  103.62.141.133
  103.62.144.152
-103.62.152.108
+103.62.232.234
  103.62.232.26
-103.62.48.10
+103.62.239.70
  103.63.108.25
  103.63.158.153
  103.63.2.148
@@ -4068,16 +4082,13 @@
  103.66.177.189
  103.66.178.43
  103.66.212.75
-103.66.218.10
  103.66.218.121
  103.66.218.13
  103.66.218.14
-103.66.218.167
  103.66.218.170
  103.66.218.171
-103.66.218.173
+103.66.218.191
  103.66.218.32
-103.66.218.52
  103.66.232.1
  103.66.232.201
  103.66.232.5
@@ -4093,13 +4104,11 @@
  103.66.69.74
  103.66.79.104
  103.66.79.148
-103.66.79.195
+103.66.79.18
  103.67.16.6
  103.67.17.1
  103.67.235.10
-103.67.235.104
  103.67.235.8
-103.67.236.191
  103.68.0.188
  103.68.1.194
  103.68.1.46
@@ -4108,6 +4117,7 @@
  103.68.35.166
  103.68.54.66
  103.69.118.77
+103.69.120.140
  103.69.121.211
  103.69.121.218
  103.69.124.247
@@ -4126,11 +4136,8 @@
  103.69.216.134
  103.69.216.138
  103.69.220.11
-103.69.224.209
  103.69.224.57
-103.69.9.63
  103.7.112.121
-103.7.248.214
  103.70.128.23
  103.70.130.26
  103.70.140.194
@@ -4140,7 +4147,6 @@
  103.70.145.211
  103.70.146.106
  103.70.153.131
-103.70.199.193
  103.70.204.1
  103.70.204.194
  103.70.204.201
@@ -4155,16 +4161,19 @@
  103.70.77.18
  103.71.21.10
  103.71.252.18
-103.71.79.205
+103.71.46.139
  103.72.144.228
  103.72.172.20
  103.72.223.56
  103.72.4.148
+103.72.72.133
  103.73.102.130
+103.73.152.137
  103.73.152.24bin.sh
+103.73.160.137
  103.73.161.123
  103.73.162.156
-103.73.166.13
+103.73.182.215
  103.73.183.15
  103.73.183.23
  103.73.183.4
@@ -4183,12 +4192,14 @@
  103.74.120.101
  103.74.120.89
  103.74.120.90
+103.74.121.173
  103.74.138.229
  103.74.227.130
  103.74.227.177
  103.74.244.244
  103.74.245.117
-103.74.245.162
+103.74.245.90
+103.74.246.238
  103.74.54.192
  103.74.70.142
  103.74.70.97
@@ -4224,7 +4235,6 @@
  103.76.172.230
  103.76.175.130
  103.76.175.88
-103.76.186.41
  103.76.188.129
  103.76.188.13
  103.76.188.161
@@ -4254,7 +4264,6 @@
  103.76.252.6
  103.76.253.150
  103.76.253.156
-103.76.80.202
  103.76.82.250
  103.76.85.149
  103.77.138.50
@@ -4277,15 +4286,16 @@
  103.78.151.117
  103.78.16.194
  103.78.164.201
+103.78.18.59
  103.78.180.127
-103.78.180.221
+103.78.180.80
  103.78.20.193
+103.78.20.205
  103.78.210.205
  103.78.213.226
  103.78.213.73
  103.78.219.237
  103.78.23.26
-103.78.252.38
  103.78.254.82
  103.78.27.34
  103.78.27.36
@@ -4304,10 +4314,8 @@
  103.78.38.34
  103.78.52.130
  103.78.53.206
-103.78.73.92
  103.79.117.5
  103.79.141.148
-103.79.141.158
  103.79.169.129
  103.79.169.137
  103.79.169.145
@@ -4319,16 +4327,18 @@
  103.79.74.26
  103.79.74.3
  103.79.90.72
+103.79.96.181
  103.8.115.27
  103.8.119.166
  103.8.119.17
  103.8.12.100
  103.8.195.34
  103.8.27.10
+103.8.27.33
  103.8.27.34
-103.8.27.77
  103.8.59.1
  103.8.59.9
+103.80.111.77
  103.80.142.117
  103.80.210.80
  103.80.25.18
@@ -4336,7 +4346,6 @@
  103.80.38.83
  103.80.51.61
  103.80.61.79
-103.80.64.186
  103.80.70.254
  103.80.83.161
  103.81.100.250
@@ -4351,9 +4360,8 @@
  103.81.117.225
  103.81.119.225
  103.81.153.133
+103.81.169.186
  103.81.170.160
-103.81.38.181
-103.81.77.15
  103.82.11.209
  103.82.11.233
  103.82.11.237
@@ -4362,6 +4370,7 @@
  103.82.145.111
  103.82.146.154
  103.82.15.105
+103.82.151.197
  103.82.208.121
  103.82.233.2
  103.82.241.2
@@ -4378,10 +4387,9 @@
  103.83.109.228
  103.83.110.21
  103.83.116.122
-103.83.116.202
+103.83.116.154
  103.83.116.75
-103.83.118.10
-103.83.129.170
+103.83.147.59
  103.83.156.112
  103.83.156.113
  103.83.156.138
@@ -4415,12 +4423,10 @@
  103.84.240.228
  103.84.240.232
  103.84.37.142
-103.84.37.146
  103.84.39.100
  103.84.39.102
  103.84.39.92
  103.84.39.98
-103.84.4.80
  103.84.63.5
  103.84.7.68
  103.84.84.250
@@ -4432,12 +4438,13 @@
  103.85.16.126
  103.85.162.26
  103.85.171.154
-103.85.21.162
+103.85.232.146
  103.85.4.19
  103.85.63.66
  103.85.67.114
  103.85.67.169
  103.85.67.94
+103.85.8.89
  103.85.85.136
  103.86.1.17
  103.86.1.2
@@ -4447,6 +4454,7 @@
  103.86.1.34
  103.86.1.41
  103.86.1.9
+103.86.132.250
  103.86.135.42
  103.86.135.62
  103.86.153.82
@@ -4460,6 +4468,8 @@
  103.86.180.10
  103.86.187.244
  103.86.19.74
+103.86.194.174
+103.86.194.182
  103.86.195.186
  103.86.195.190
  103.86.200.47
@@ -4467,6 +4477,7 @@
  103.86.49.11
  103.86.49.187
  103.86.50.211
+103.86.53.31
  103.86.70.222
  103.86.86.71
  103.87.160.177
@@ -4474,12 +4485,16 @@
  103.87.168.239
  103.87.168.30
  103.87.169.180
+103.87.169.231
  103.87.170.103
  103.87.170.105
  103.87.170.114
  103.87.170.117
+103.87.170.2
+103.87.170.68
  103.87.170.93
  103.87.171.162
+103.87.171.223
  103.87.171.241
  103.87.171.251
  103.87.174.54
@@ -4492,14 +4507,13 @@
  103.87.236.114
  103.87.236.150
  103.87.236.46
-103.87.238.24
  103.87.24.204
  103.87.25.106
  103.87.25.193
  103.87.251.146
-103.87.26.101
  103.87.26.125
  103.87.26.81
+103.87.27.122
  103.87.31.169
  103.87.48.1
  103.87.48.45
@@ -4519,6 +4533,7 @@
  103.89.176.74
  103.89.235.98
  103.89.252.123
+103.89.252.130
  103.89.254.138
  103.89.88.39
  103.89.90.208
@@ -4527,7 +4542,6 @@
  103.9.113.90
  103.9.114.118
  103.9.114.194
-103.9.114.230
  103.9.124.210
  103.9.134.114
  103.9.174.70
@@ -4536,18 +4550,16 @@
  103.9.227.210
  103.9.79.132
  103.90.145.196
+103.90.190.54
  103.90.200.226
  103.90.203.152
  103.90.220.97
-103.90.228.100
  103.90.248.43
  103.90.74.242
  103.91.128.182
  103.91.130.1
  103.91.130.110
-103.91.141.141
  103.91.17.136
-103.91.17.147
  103.91.210.187
  103.91.244.102
  103.91.244.50
@@ -4557,17 +4569,19 @@
  103.91.245.13bin.sh
  103.91.245.14
  103.91.245.19
+103.91.245.23
  103.91.245.27
  103.91.245.27bin.sh
-103.91.245.28
  103.91.245.3
  103.91.245.3bin.sh
  103.91.245.45
  103.91.245.47
-103.91.245.49
  103.91.245.5
  103.91.245.54
  103.91.245.62
+103.91.67.146
+103.91.76.73
+103.91.76.78
  103.91.82.163
  103.91.90.221
  103.92.101.178
@@ -4582,12 +4596,10 @@
  103.92.213.41
  103.92.214.1
  103.92.214.17
-103.92.225.46
  103.92.225.95
  103.92.25.90
  103.92.25.95
  103.92.26.252
-103.93.104.112
  103.93.136.8
  103.93.17.149
  103.93.17.231
@@ -4601,14 +4613,14 @@
  103.94.138.98
  103.94.16.129
  103.94.18.13
-103.94.192.114
+103.94.192.60
  103.94.2.110
  103.94.6.18
  103.94.6.69
  103.94.7.250
  103.94.7.254
+103.94.7.43
  103.95.123.28
-103.95.234.202
  103.95.40.18
  103.95.40.20
  103.95.48.73
@@ -4620,16 +4632,23 @@
  103.95.98.179
  103.95.98.90
  103.95.99.229
+103.96.18.241
+103.96.18.242
+103.96.18.243
+103.96.18.244
+103.96.18.245
+103.96.18.246
+103.96.18.247
  103.96.220.115
-103.96.237.238
-103.96.237.245
  103.96.3.46
  103.96.51.233
  103.96.73.160
  103.96.73.208
  103.96.96.114
+103.97.124.200
  103.97.124.53
  103.97.125.174
+103.97.136.114
  103.97.162.97
  103.97.164.98
  103.97.179.141
@@ -4657,7 +4676,6 @@
  103.99.170.220
  103.99.176.32
  103.99.177.247
-103.99.2.105
  103.99.207.151
  103.99.207.238
  103.99.244.70
@@ -4671,6 +4689,7 @@
  104.1.55.171
  104.12.66.70
  104.128.48.202
+104.128.66.183
  104.128.92.120
  104.128.92.28
  104.128.93.238
@@ -4683,11 +4702,13 @@
  104.129.194.243
  104.129.196.126
  104.129.196.178
+104.129.24.114
  104.129.255.119
  104.129.255.60
  104.129.255.7
  104.129.255.92
-104.129.3.203
+104.129.30.169
+104.129.4.186
  104.129.40.123
  104.129.40.158
  104.129.40.162
@@ -4727,7 +4748,6 @@
  104.131.0.47
  104.131.1.142
  104.131.1.89
-104.131.10.124
  104.131.101.240
  104.131.102.169
  104.131.103.225
@@ -4786,6 +4806,7 @@
  104.131.175.91
  104.131.176.180
  104.131.178.207
+104.131.18.212
  104.131.180.54
  104.131.181.4
  104.131.184.60
@@ -4827,7 +4848,6 @@
  104.131.4.232
  104.131.40.125
  104.131.40.97
-104.131.41.16
  104.131.41.185
  104.131.41.46
  104.131.44.150
@@ -4837,6 +4857,7 @@
  104.131.46.166
  104.131.48.26
  104.131.55.236
+104.131.57.95
  104.131.58.110
  104.131.58.132
  104.131.58.179
@@ -4887,7 +4908,7 @@
  104.131.93.254
  104.131.97.219
  104.131.98.30
-104.137.3.153
+104.138.216.212
  104.139.74.25
  104.140.103.41
  104.140.114.103
@@ -4903,29 +4924,30 @@
  104.140.245.66
  104.140.83.173
  104.143.14.92
-104.143.2.195
  104.144.103.56
-104.144.109.125
  104.144.110.144
+104.144.112.114
+104.144.112.120
  104.144.112.121
+104.144.112.122
+104.144.112.188
  104.144.112.190
  104.144.112.197
  104.144.112.222
-104.144.112.97
  104.144.116.218
  104.144.116.228
-104.144.125.133
-104.144.125.36
  104.144.155.228
  104.144.159.193
-104.144.163.198
+104.144.163.238
  104.144.171.147
  104.144.171.157
  104.144.171.71
  104.144.171.76
+104.144.172.98
+104.144.177.172
  104.144.18.168
-104.144.180.108
  104.144.185.18
+104.144.185.8
  104.144.187.14
  104.144.191.18
  104.144.191.230
@@ -4937,25 +4959,28 @@
  104.144.208.141
  104.144.209.34
  104.144.210.116
-104.144.210.138
+104.144.210.166
  104.144.210.185
  104.144.210.244
-104.144.210.254
  104.144.213.102
+104.144.213.103
  104.144.22.142
-104.144.22.201
+104.144.22.149
  104.144.22.209
+104.144.22.220
+104.144.22.227
  104.144.22.243
+104.144.22.248
+104.144.22.250
  104.144.220.20
+104.144.220.8
  104.144.236.48
  104.144.241.107
  104.144.242.122
-104.144.254.26
-104.144.28.130
+104.144.249.125
  104.144.28.133
  104.144.28.155
  104.144.28.161
-104.144.28.167
  104.144.28.182
  104.144.28.185
  104.144.45.167
@@ -5023,10 +5048,12 @@
  104.145.236.51
  104.145.236.52
  104.145.236.57
+104.145.76.130
  104.148.114.139
  104.148.124.120
  104.148.57.2
  104.148.64.26
+104.149.130.198
  104.149.134.118
  104.149.134.218
  104.149.135.110
@@ -5046,13 +5073,16 @@
  104.152.52.34
  104.152.52.36
  104.152.52.38
-104.152.59.9
+104.152.57.140
+104.152.59.121
+104.152.59.192
  104.153.101.197
  104.153.102.152
  104.153.103.134
  104.154.147.52
  104.154.156.5
  104.154.158.198
+104.154.168.84
  104.154.203.62
  104.154.236.234
  104.154.237.177
@@ -5085,6 +5115,7 @@
  104.155.225.130
  104.155.227.128
  104.155.71.104
+104.156.225.108
  104.156.227.60
  104.156.227.84
  104.156.230.231
@@ -5097,8 +5128,6 @@
  104.156.251.193
  104.156.59.29
  104.157.144.246
-104.160.1.163
-104.160.11.93
  104.160.11.94
  104.160.11.95
  104.160.14.116
@@ -5120,11 +5149,10 @@
  104.160.17.109
  104.160.17.113
  104.160.17.147
+104.160.17.197
  104.160.17.212
  104.160.17.217
-104.160.17.25
  104.160.17.4
-104.160.17.48
  104.160.185.227
  104.160.41.247
  104.160.42.222
@@ -5162,7 +5190,6 @@
  104.168.173.244
  104.168.173.248
  104.168.176.160
-104.168.176.84
  104.168.195.213
  104.168.198.194
  104.168.198.235
@@ -5184,13 +5211,16 @@
  104.168.44.166
  104.168.51.132
  104.168.51.140
+104.168.51.157
  104.168.52.171
+104.168.56.155
  104.168.65.222
  104.168.75.197
  104.168.86.228
  104.168.90.122
  104.168.94.130
  104.168.96.168
+104.168.99.112
  104.168.99.168
  104.168.99.220
  104.169.91.254
@@ -5202,9 +5232,7 @@
  104.173.222.17
  104.174.61.206
  104.175.168.148
-104.175.38.25
  104.175.99.243
-104.177.119.82
  104.178.67.198
  104.182.129.38
  104.183.217.130
@@ -5213,7 +5241,6 @@
  104.192.0.18
  104.192.0.226
  104.192.1.94
-104.192.102.10
  104.192.103.3
  104.192.103.78
  104.192.108.19
@@ -5352,6 +5379,7 @@
  104.200.25.118
  104.200.29.181
  104.200.31.213
+104.200.40.123
  104.200.67.112
  104.200.67.146
  104.200.67.159
@@ -5360,33 +5388,23 @@
  104.200.78.166
  104.205.70.35
  104.206.119.131
-104.206.119.133
  104.206.119.148
-104.206.119.152
  104.206.119.180
-104.206.119.217
  104.206.128.14
-104.206.128.22
  104.206.128.30
-104.206.128.50
  104.206.128.6
  104.206.128.62
-104.206.173.100
  104.206.173.103
-104.206.173.104
  104.206.173.105
  104.206.173.116
  104.206.173.117
-104.206.173.118
-104.206.173.119
-104.206.173.97
-104.206.173.98
+104.206.173.85
  104.206.173.99
  104.206.203.164
+104.206.203.20
  104.206.203.241
  104.206.252.71
  104.206.96.58
-104.206.98.126
  104.207.129.179
  104.207.130.24
  104.207.140.218
@@ -5422,7 +5440,7 @@
  104.211.49.188
  104.211.77.169
  104.211.8.210
-104.211.88.209
+104.214.138.117
  104.214.51.93
  104.214.59.120
  104.215.124.156
@@ -5430,7 +5448,6 @@
  104.215.15.95
  104.215.152.162
  104.215.19.167
-104.215.198.141
  104.215.255.55
  104.215.49.64
  104.215.5.88
@@ -5443,7 +5460,7 @@
  104.219.250.36
  104.219.251.30
  104.220.88.125
-104.221.133.194
+104.222.127.122
  104.222.96.61
  104.223.114.36
  104.223.123.98
@@ -5497,13 +5514,13 @@
  104.225.233.10
  104.225.236.41
  104.225.251.29
-104.227.101.72
-104.227.106.185
  104.227.112.142
  104.227.112.189
  104.227.112.240
  104.227.121.159
  104.227.121.222
+104.227.124.187
+104.227.124.220
  104.227.124.222
  104.227.13.112
  104.227.146.27
@@ -5512,15 +5529,13 @@
  104.227.168.130
  104.227.169.9
  104.227.17.145
+104.227.172.102
  104.227.175.34
  104.227.187.166
  104.227.190.219
-104.227.194.94
  104.227.20.21
  104.227.20.6
-104.227.204.85
  104.227.208.249
-104.227.209.53
  104.227.210.111
  104.227.253.67
  104.227.255.104
@@ -5528,13 +5543,10 @@
  104.227.4.203
  104.227.4.206
  104.227.4.219
-104.227.4.232
+104.227.4.236
  104.227.49.246
  104.227.64.101
  104.227.72.153
-104.227.76.54
-104.227.77.133
-104.227.77.176
  104.227.77.177
  104.227.77.183
  104.227.77.185
@@ -5543,6 +5555,7 @@
  104.227.91.243
  104.227.92.130
  104.230.217.102
+104.231.176.188
  104.232.103.226
  104.233.101.96
  104.233.106.158
@@ -5569,6 +5582,7 @@
  104.236.118.20
  104.236.118.6
  104.236.121.248
+104.236.122.193
  104.236.122.214
  104.236.122.229
  104.236.124.45
@@ -5615,6 +5629,7 @@
  104.236.200.181
  104.236.201.168
  104.236.203.25
+104.236.203.29
  104.236.205.123
  104.236.207.1
  104.236.207.117
@@ -5674,14 +5689,17 @@
  104.236.31.115
  104.236.35.132
  104.236.35.211
+104.236.36.110
  104.236.38.57
  104.236.39.38
  104.236.4.161
  104.236.40.85
+104.236.41.119
  104.236.43.154
  104.236.43.172
  104.236.43.56
  104.236.44.34
+104.236.45.171
  104.236.46.212
  104.236.48.174
  104.236.48.178
@@ -5695,10 +5713,12 @@
  104.236.52.227
  104.236.52.94
  104.236.54.196
+104.236.58.164
  104.236.59.151
  104.236.6.235
  104.236.61.188
  104.236.62.50
+104.236.63.99
  104.236.65.234
  104.236.69.31
  104.236.7.135
@@ -5733,6 +5753,7 @@
  104.237.143.106
  104.237.144.63
  104.237.144.74
+104.237.145.130
  104.237.149.194
  104.237.152.236
  104.237.154.77
@@ -5743,19 +5764,23 @@
  104.237.218.72
  104.237.226.120
  104.237.232.152
+104.237.234.97
  104.237.252.12
+104.237.252.73
  104.237.255.248
  104.237.255.254
-104.238.100.248
+104.237.48.101
+104.237.48.103
+104.237.48.105
+104.237.48.107
+104.237.48.111
  104.238.111.150
  104.238.111.218
-104.238.118.228
  104.238.128.197
  104.238.129.228
  104.238.131.42
  104.238.133.128
  104.238.133.16
-104.238.137.148
  104.238.144.225
  104.238.144.35
  104.238.144.62
@@ -5785,9 +5810,7 @@
  104.238.220.24
  104.238.223.126
  104.238.235.186
-104.238.39.24
  104.238.44.103
-104.238.73.149
  104.238.80.237
  104.238.81.186
  104.238.83.242
@@ -5799,7 +5822,6 @@
  104.239.173.237
  104.239.175.211
  104.239.229.181
-104.239.240.79
  104.243.129.210
  104.243.129.94
  104.243.16.125
@@ -5810,7 +5832,6 @@
  104.243.31.81
  104.243.44.219
  104.244.117.234
-104.244.158.127
  104.244.72.104
  104.244.72.115
  104.244.72.152
@@ -5865,6 +5886,7 @@
  104.244.78.67
  104.244.79.121
  104.244.79.123
+104.244.79.131
  104.244.79.154
  104.244.79.187
  104.244.79.196
@@ -5872,7 +5894,6 @@
  104.244.79.43
  104.245.125.251
  104.245.144.227
-104.245.204.80
  104.245.228.65
  104.245.41.139
  104.245.42.120
@@ -5906,6 +5927,7 @@
  104.248.131.11
  104.248.131.181
  104.248.133.143
+104.248.133.33
  104.248.133.62
  104.248.134.130
  104.248.136.155
@@ -5926,7 +5948,6 @@
  104.248.147.78
  104.248.148.129
  104.248.149.130
-104.248.149.132
  104.248.149.241
  104.248.150.157
  104.248.151.229
@@ -5936,21 +5957,20 @@
  104.248.158.95
  104.248.159.69
  104.248.16.27
+104.248.160.192
  104.248.163.35
  104.248.165.25
  104.248.17.39
  104.248.170.169
  104.248.172.121
  104.248.172.241
-104.248.175.39
  104.248.176.46
  104.248.181.156
  104.248.182.98
  104.248.183.73
-104.248.185.163
  104.248.186.168
+104.248.186.42
  104.248.19.228
-104.248.190.52
  104.248.191.247
  104.248.192.182
  104.248.192.227
@@ -5959,7 +5979,6 @@
  104.248.194.130
  104.248.194.212
  104.248.195.228
-104.248.195.42
  104.248.195.7
  104.248.196.130
  104.248.196.198
@@ -6039,13 +6058,10 @@
  104.248.251.228
  104.248.251.85
  104.248.26.124
-104.248.27.245
-104.248.29.6
  104.248.30.146
  104.248.30.202
  104.248.30.211
  104.248.31.138
-104.248.31.168
  104.248.31.229
  104.248.33.254
  104.248.34.142
@@ -6081,8 +6097,8 @@
  104.248.50.207
  104.248.52.119
  104.248.52.225
+104.248.53.246
  104.248.53.72
-104.248.55.220
  104.248.57.27
  104.248.59.156
  104.248.59.7
@@ -6105,14 +6121,9 @@
  104.248.75.224
  104.248.76.28
  104.248.79.138
-104.248.86.130
  104.248.88.112
  104.248.90.212
-104.248.90.255
  104.248.90.45
-104.249.27.109
-104.249.27.172
-104.249.27.214
  104.250.102.143
  104.250.102.145
  104.250.102.146
@@ -6131,6 +6142,7 @@
  104.250.151.123
  104.250.163.23
  104.250.178.21
+104.250.178.34
  104.250.34.179
  104.250.97.101
  104.250.97.102
@@ -6176,6 +6188,7 @@
  104.32.29.186
  104.32.43.13
  104.35.13.161
+104.35.168.182
  104.37.104.44
  104.37.187.23
  104.37.212.5
@@ -6229,11 +6242,11 @@
  104.7.1.180
  104.7.1.181
  104.7.1.182
+104.7.141.172
  104.9.168.115
  104.9.30.99
  1041469-dot-n-e-w-me-ss-age-po-rt-al.wl.r.appspot.com
  104722155613106546.002.sh.cn
-105.0.7.101
  105.101.86.13
  105.101.91.129
  105.103.160.197
@@ -6243,23 +6256,21 @@
  105.112.1.166
  105.112.10.244
  105.112.156.24
+105.112.32.237
  105.112.91.234
-105.112.95.194
  105.154.151.250
  105.154.191.59
  105.155.159.11
  105.156.227.11
+105.158.209.140
  105.158.91.157
-105.158.91.63
  105.159.149.193
-105.159.194.58
-105.16.115.200
+105.159.51.247
  105.160.6.13
  105.160.96.235
-105.163.0.93
  105.163.1.173
-105.163.160.215
  105.163.21.18
+105.163.53.220
  105.174.38.250
  105.185.154.174
  105.186.131.232
@@ -6272,15 +6283,14 @@
  105.209.40.114
  105.21.40.54
  105.212.56.107
-105.213.97.143
  105.213.97.157
+105.213.98.201
  105.225.36.51
  105.226.188.16
-105.226.22.73
+105.228.119.225
  105.229.22.206
  105.233.34.9
  105.235.106.59
-105.235.130.76
  105.235.197.150
  105.235.197.162
  105.235.201.234
@@ -6288,6 +6298,7 @@
  105.235.201.86
  105.235.205.250
  105.235.205.90
+105.235.71.162
  105.236.93.198
  105.244.32.65
  105.247.101.41
@@ -6298,6 +6309,7 @@
  105.247.28.74
  105.255.222.42
  105.27.116.46
+105.27.116.98
  105.27.143.190
  105.27.152.206
  105.27.155.182
@@ -6307,11 +6319,11 @@
  105.29.67.20
  105.29.95.34
  105.30.250.108
-105.66.5.209
  105.66.5.253
-105.67.11.10
+105.71.149.88
  105.73.83.18
  105.96.11.65
+105.96.13.17
  105.96.3.198
  1051a2e8-48cf-4f98-988c-b1aa7ec7e290.htmlcomponentservice.com
  1052068-dot-n-e-w-me-ss-age-po-rt-al.wl.r.appspot.com
@@ -6325,7 +6337,9 @@
  106.104.148.208
  106.104.151.142
  106.104.162.15
+106.104.172.178
  106.104.193.155
+106.104.34.193
  106.109.112.zoom-lab.com
  106.110.104.29
  106.110.105.60
@@ -6342,12 +6356,14 @@
  106.110.164.246
  106.110.167.130
  106.110.196.80
+106.110.198.118
+106.110.198.76
  106.110.203.244
  106.110.206.21
-106.110.214.128
  106.110.214.186
+106.110.214.217
  106.110.214.37
-106.110.218.31
+106.110.218.156
  106.110.219.88
  106.110.69.24
  106.110.71.236
@@ -6369,6 +6385,8 @@
  106.111.55.123
  106.111.85.197
  106.116.17.91
+106.116.200.178
+106.117.235.202
  106.12.10.54
  106.12.102.202
  106.12.102.210
@@ -6383,6 +6401,7 @@
  106.12.112.236
  106.12.112.4
  106.12.112.49
+106.12.113.111
  106.12.113.155
  106.12.113.204
  106.12.113.223
@@ -6394,12 +6413,9 @@
  106.12.118.184
  106.12.118.54
  106.12.119.242
-106.12.127.253
  106.12.128.48
  106.12.129.242
-106.12.130.224
  106.12.130.83
-106.12.131.102
  106.12.134.102
  106.12.134.106
  106.12.134.187
@@ -6410,7 +6426,6 @@
  106.12.140.211
  106.12.141.142
  106.12.141.71
-106.12.143.85
  106.12.144.189
  106.12.148.68
  106.12.152.28
@@ -6434,12 +6449,11 @@
  106.12.186.155
  106.12.186.56
  106.12.194.154
+106.12.195.70
  106.12.199.117
  106.12.199.30
-106.12.2.221
  106.12.200.176
  106.12.200.225
-106.12.200.239
  106.12.201.95
  106.12.202.119
  106.12.202.180
@@ -6469,7 +6483,6 @@
  106.12.30.57
  106.12.31.186
  106.12.31.207
-106.12.36.142
  106.12.38.109
  106.12.4.114
  106.12.46.26
@@ -6488,10 +6501,13 @@
  106.123.60.134
  106.124.129.115
  106.124.130.114
+106.124.131.194
  106.124.131.214
  106.124.131.70
  106.124.132.105
  106.124.135.232
+106.124.136.103
+106.124.136.227
  106.124.137.103
  106.124.137.130
  106.124.139.161
@@ -6506,23 +6522,21 @@
  106.124.205.42
  106.125.139.76
  106.13.1.239
-106.13.10.242
  106.13.100.103
  106.13.102.197
  106.13.103.158
  106.13.103.29
  106.13.104.41
  106.13.105.97
-106.13.112.45
  106.13.112.83
  106.13.113.172
+106.13.115.229
  106.13.115.28
  106.13.116.30
-106.13.119.163
  106.13.12.199
+106.13.120.112
  106.13.123.29
  106.13.123.73
-106.13.124.215
  106.13.125.248
  106.13.126.15
  106.13.128.71
@@ -6535,17 +6549,19 @@
  106.13.136.240
  106.13.137.195
  106.13.139.79
-106.13.140.138
  106.13.140.154
  106.13.142.161
  106.13.142.93
  106.13.144.207
  106.13.146.93
+106.13.147.33
  106.13.147.89
  106.13.148.97
  106.13.16.113
+106.13.163.88
  106.13.168.180
  106.13.17.16
+106.13.171.106
  106.13.174.171
  106.13.18.86
  106.13.180.85
@@ -6555,20 +6571,18 @@
  106.13.19.92
  106.13.195.32
  106.13.196.51
-106.13.197.35
  106.13.198.68
  106.13.20.31
-106.13.202.191
  106.13.203.240
  106.13.203.62
  106.13.205.239
+106.13.206.111
  106.13.206.183
  106.13.207.205
  106.13.207.219
  106.13.208.101
  106.13.208.37
  106.13.21.128
-106.13.210.166
  106.13.212.162
  106.13.215.215
  106.13.215.219
@@ -6604,11 +6618,9 @@
  106.13.35.99
  106.13.36.215
  106.13.37.118
-106.13.37.202
  106.13.40.23
  106.13.42.140
  106.13.42.95
-106.13.46.123
  106.13.46.235
  106.13.47.10
  106.13.47.205
@@ -6634,6 +6646,7 @@
  106.13.74.61
  106.13.75.187
  106.13.76.146
+106.13.78.198
  106.13.78.210
  106.13.78.235
  106.13.79.113
@@ -6650,7 +6663,6 @@
  106.13.9.153
  106.13.9.244
  106.13.90.60
-106.13.93.60
  106.13.93.92
  106.13.94.193
  106.13.94.96
@@ -6661,17 +6673,15 @@
  106.14.1.209
  106.14.138.13
  106.14.166.74
-106.14.185.99
  106.14.188.79
-106.14.211.77
  106.14.224.228
  106.14.241.0
  106.15.178.16
+106.15.180.75
  106.15.197.185
  106.15.249.27
  106.15.35.211
  106.163.158.127
-106.168.239.111
  106.184.2.16
  106.184.2.18
  106.184.3.122
@@ -6694,25 +6704,25 @@
  106.187.49.249
  106.187.51.204
  106.187.99.130
-106.193.14.187
  106.195.123.57
  106.2.207.106
  106.2.45.18
-106.200.254.167
  106.200.39.132
+106.201.220.10
  106.201.243.101
-106.205.166.215
-106.205.63.234
  106.207.166.27
+106.208.172.71
  106.208.181.131
-106.210.211.33
-106.212.255.150
+106.211.75.23
  106.214.92.229
+106.215.66.21
+106.217.132.238
  106.225.135.120
  106.240.131.5
  106.240.86.211
  106.240.89.60
  106.241.190.58
+106.241.33.158
  106.241.54.211
  106.242.20.219
  106.242.35.34
@@ -6726,6 +6736,7 @@
  106.245.197.234
  106.245.95.116
  106.246.244.122
+106.247.210.55
  106.247.232.252
  106.247.237.179
  106.248.143.195
@@ -6744,10 +6755,11 @@
  106.38.158.131
  106.38.205.205
  106.38.58.138
+106.38.82.242
  106.39.63.53
  106.46.169.193
  106.5.224.183
-106.51.0.218
+106.5.225.38
  106.51.114.44
  106.51.136.202
  106.51.164.41
@@ -6757,6 +6769,7 @@
  106.51.255.21
  106.51.3.214
  106.51.63.3
+106.51.72.126
  106.51.72.221
  106.51.73.204
  106.51.76.223
@@ -6767,7 +6780,6 @@
  106.51.85.16
  106.51.85.93
  106.51.86.27
-106.51.87.141
  106.52.105.158
  106.52.105.178
  106.52.106.170
@@ -6795,7 +6807,6 @@
  106.52.135.88
  106.52.139.223
  106.52.140.195
-106.52.141.169
  106.52.141.222
  106.52.141.36
  106.52.141.46
@@ -6804,16 +6815,15 @@
  106.52.15.196
  106.52.150.93
  106.52.152.16
+106.52.152.168
  106.52.152.237
  106.52.152.75
  106.52.162.140
  106.52.166.154
-106.52.166.245
  106.52.167.107
  106.52.178.166
  106.52.181.236
  106.52.181.73
-106.52.182.247
  106.52.196.163
  106.52.197.126
  106.52.198.174
@@ -6825,12 +6835,12 @@
  106.52.209.36
  106.52.209.98
  106.52.210.175
+106.52.210.60
  106.52.214.183
  106.52.22.230
  106.52.222.11
  106.52.231.38
  106.52.231.46
-106.52.236.23
  106.52.239.66
  106.52.240.169
  106.52.244.46
@@ -6848,6 +6858,8 @@
  106.52.37.129
  106.52.38.242
  106.52.39.75
+106.52.43.214
+106.52.51.73
  106.52.52.114
  106.52.52.52
  106.52.53.206
@@ -6872,6 +6884,7 @@
  106.52.9.154
  106.52.93.106
  106.52.96.107
+106.52.96.247
  106.52.98.89
  106.53.103.194
  106.53.104.212
@@ -6898,10 +6911,10 @@
  106.53.148.41
  106.53.148.9
  106.53.181.242
+106.53.19.38
  106.53.192.15
  106.53.192.246
  106.53.2.215
-106.53.2.93
  106.53.201.239
  106.53.207.227
  106.53.210.12
@@ -6909,6 +6922,7 @@
  106.53.219.165
  106.53.219.247
  106.53.220.198
+106.53.220.55
  106.53.222.24
  106.53.226.224
  106.53.227.104
@@ -6937,6 +6951,7 @@
  106.53.254.85
  106.53.26.197
  106.53.31.34
+106.53.40.211
  106.53.40.79
  106.53.5.85
  106.53.52.232
@@ -6947,6 +6962,7 @@
  106.53.63.248
  106.53.8.180
  106.53.81.17
+106.53.82.107
  106.53.85.18
  106.53.88.144
  106.53.9.163
@@ -6959,6 +6975,7 @@
  106.54.1.58
  106.54.101.141
  106.54.104.8
+106.54.108.8
  106.54.111.75
  106.54.112.173
  106.54.121.24
@@ -6968,6 +6985,7 @@
  106.54.140.165
  106.54.144.22
  106.54.149.118
+106.54.163.204
  106.54.166.168
  106.54.167.68
  106.54.17.221
@@ -6991,6 +7009,7 @@
  106.54.253.9
  106.54.33.142
  106.54.35.42
+106.54.48.208
  106.54.48.241
  106.54.57.113
  106.54.57.203
@@ -7035,7 +7054,7 @@
  106.55.150.24
  106.55.151.103
  106.55.155.167
-106.55.159.141
+106.55.156.198
  106.55.160.91
  106.55.161.191
  106.55.162.110
@@ -7046,6 +7065,7 @@
  106.55.170.47
  106.55.18.86
  106.55.21.141
+106.55.235.89
  106.55.236.107
  106.55.236.71
  106.55.240.190
@@ -7059,6 +7079,7 @@
  106.55.249.5
  106.55.253.247
  106.55.26.195
+106.55.30.229
  106.55.31.210
  106.55.34.241
  106.55.35.111
@@ -7083,13 +7104,8 @@
  106.58.215.201
  106.66.3.226
  106.66.36.49
-106.67.107.228
-106.67.66.64
-106.67.80.235
-106.67.98.185
  106.68.158.60
  106.69.245.72
-106.7.124.146
  106.72.36.96
  106.72.39.130
  106.74.220.28
@@ -7140,13 +7156,14 @@
  106.75.211.173
  106.75.211.208
  106.75.211.48
+106.75.212.75
  106.75.214.198
  106.75.214.72
-106.75.215.151
  106.75.218.71
  106.75.224.132
  106.75.230.208
  106.75.230.69
+106.75.230.83
  106.75.232.123
  106.75.233.199
  106.75.236.116
@@ -7170,6 +7187,7 @@
  106.75.31.135
  106.75.34.226
  106.75.45.180
+106.75.48.174
  106.75.50.173
  106.75.55.46
  106.75.57.20
@@ -7187,6 +7205,7 @@
  106.75.9.141
  106.75.91.171
  106.75.92.94
+106.75.97.129
  106.75.98.193
  106.75.99.14
  106.8.149.164
@@ -7213,6 +7232,7 @@
  106.8.212.91
  106.8.212.95
  106.8.213.112
+106.8.213.131
  106.8.213.159
  106.8.213.168
  106.8.213.205
@@ -7230,6 +7250,7 @@
  106.8.215.39
  106.8.215.4
  106.8.215.71
+106.8.215.97
  106.8.216.114
  106.8.216.126
  106.8.216.152
@@ -7239,6 +7260,7 @@
  106.8.217.122
  106.8.217.142
  106.8.217.151
+106.8.217.185
  106.8.217.186
  106.8.217.219
  106.8.217.66
@@ -7288,7 +7310,6 @@
  106.8.222.21
  106.8.222.213
  106.8.222.22
-106.8.222.230
  106.8.222.234
  106.8.222.246
  106.8.222.38
@@ -7307,14 +7328,11 @@
  106b.com
  107.0.135.4
  107.0.200.227
-107.10.73.181
  107.11.115.68
-107.11.177.126
  107.13.140.129
  107.13.141.32
  107.13.176.58
  107.131.21.243
-107.131.52.114
  107.132.88.42
  107.143.185.86
  107.143.246.110
@@ -7323,7 +7341,6 @@
  107.147.249.75
  107.15.154.173
  107.15.249.177
-107.150.11.30
  107.150.2.29
  107.150.2.35
  107.150.23.199
@@ -7338,6 +7355,9 @@
  107.150.64.115
  107.150.64.241
  107.150.70.105
+107.150.70.128
+107.150.70.62
+107.150.84.140
  107.150.84.28
  107.150.89.121
  107.150.89.124
@@ -7351,50 +7371,44 @@
  107.152.139.212
  107.152.139.226
  107.152.139.238
+107.152.149.177
+107.152.149.45
+107.152.151.33
  107.152.151.34
  107.152.151.35
  107.152.151.41
-107.152.151.6
-107.152.151.60
  107.152.151.75
  107.152.157.8
  107.152.171.165
  107.152.173.116
  107.152.173.92
-107.152.174.124
  107.152.174.127
  107.152.177.47
  107.152.189.190
  107.152.196.168
  107.152.201.20
+107.152.201.22
  107.152.203.58
  107.152.208.102
-107.152.210.10
  107.152.210.26
  107.152.210.96
+107.152.214.75
  107.152.229.1
  107.152.229.13
  107.152.234.20
  107.152.239.118
-107.152.239.189
  107.152.239.28
-107.152.239.43
-107.152.239.61
-107.152.239.62
  107.152.241.92
  107.152.243.131
  107.152.243.153
  107.152.243.228
  107.152.243.249
  107.152.243.81
-107.152.246.144
  107.152.246.243
-107.152.246.43
  107.152.246.44
  107.152.247.150
  107.152.247.215
  107.152.247.224
-107.152.247.227
  107.152.247.230
  107.152.247.233
  107.152.247.240
@@ -7408,6 +7422,7 @@
  107.152.255.190
  107.152.255.242
  107.152.255.250
+107.152.32.80
  107.155.132.187
  107.155.160.204
  107.155.162.15
@@ -7422,6 +7437,7 @@
  107.158.154.88
  107.158.154.94
  107.158.154.99
+107.158.202.118
  107.158.202.140
  107.158.202.20
  107.158.202.220
@@ -7431,28 +7447,22 @@
  107.158.202.40
  107.158.202.85
  107.158.32.196
-107.158.32.207
-107.158.8.120
-107.158.8.150
-107.158.8.169
  107.158.8.185
-107.158.8.48
  107.158.8.49
  107.158.8.88
  107.158.8.99
  107.158.85.208
  107.158.9.116
-107.158.9.121
  107.158.9.135
  107.158.9.252
  107.158.9.29
+107.158.9.43
  107.158.92.240
-107.158.92.49
+107.158.93.125
  107.158.93.179
-107.158.93.208
-107.158.93.32
  107.158.93.69
  107.159.93.103
+107.160.101.243
  107.160.167.130
  107.160.249.14
  107.160.249.6
@@ -7488,6 +7498,7 @@
  107.170.134.125
  107.170.135.29
  107.170.14.209
+107.170.144.113
  107.170.160.61
  107.170.162.155
  107.170.164.211
@@ -7549,7 +7560,6 @@
  107.170.76.170
  107.170.77.69
  107.170.8.24
-107.170.86.182
  107.170.9.195
  107.170.96.6
  107.170.99.119
@@ -7558,16 +7568,16 @@
  107.172.104.9
  107.172.122.102
  107.172.13.68
+107.172.131.187
  107.172.131.190
  107.172.131.201
-107.172.131.221
  107.172.132.201
  107.172.139.206
  107.172.140.127
  107.172.142.122
  107.172.146.201
+107.172.148.128
  107.172.148.148
-107.172.148.155
  107.172.148.166
  107.172.148.174
  107.172.150.21
@@ -7575,7 +7585,6 @@
  107.172.151.208
  107.172.153.169
  107.172.155.242
-107.172.155.245
  107.172.156.119
  107.172.156.153
  107.172.157.125
@@ -7592,68 +7601,68 @@
  107.172.224.186
  107.172.227.161
  107.172.227.175
+107.172.227.195
+107.172.227.214
  107.172.227.90
+107.172.228.172
+107.172.228.173
  107.172.228.72
  107.172.228.78
-107.172.229.121
  107.172.229.57
  107.172.229.58
  107.172.229.80
  107.172.238.104
  107.172.238.87
-107.172.246.171
+107.172.248.144
  107.172.248.168
  107.172.29.108
  107.172.3.146
-107.172.30.12
-107.172.30.21
  107.172.30.68
+107.172.31.110
  107.172.39.131
  107.172.39.27
  107.172.43.152
+107.172.43.242
  107.172.45.160
  107.172.49.120
  107.172.5.116
  107.172.52.71
-107.172.54.207
  107.172.57.73
  107.172.59.249
-107.172.63.239
  107.172.64.151
  107.172.65.227
  107.172.66.244
-107.172.67.133
  107.172.67.170
-107.172.67.242
  107.172.68.209
-107.172.68.75
  107.172.69.10
+107.172.80.104
  107.172.80.127
-107.172.80.203
  107.172.80.244
-107.172.82.134
  107.172.88.254
  107.172.89.15
  107.172.89.165
  107.172.89.253
  107.172.94.133
-107.172.99.58
  107.173.122.10
-107.173.137.132
+107.173.122.158
+107.173.129.112
  107.173.137.253
  107.173.141.130
  107.173.146.196
  107.173.147.216
  107.173.149.104
+107.173.166.43
  107.173.176.100
  107.173.176.172
+107.173.178.141
+107.173.178.145
  107.173.179.155
  107.173.179.158
+107.173.19.31
  107.173.191.55
  107.173.192.56
  107.173.194.241
  107.173.201.244
-107.173.201.252
  107.173.201.254
  107.173.201.87
  107.173.204.16
@@ -7661,14 +7670,16 @@
  107.173.209.241
  107.173.213.43
  107.173.219.103
+107.173.219.2
  107.173.219.51
  107.173.222.153
+107.173.230.217
+107.173.230.218
  107.173.230.220
+107.173.230.246
  107.173.233.12
  107.173.233.120
  107.173.241.253
-107.173.248.102
-107.173.248.113
  107.173.248.115
  107.173.248.151
  107.173.248.32
@@ -7679,8 +7690,10 @@
  107.173.28.34
  107.173.28.37
  107.173.34.130
+107.173.4.163
  107.173.48.253
  107.173.49.10
+107.173.50.200
  107.173.50.213
  107.173.50.214
  107.173.51.246
@@ -7699,25 +7712,22 @@
  107.174.13.220
  107.174.133.119
  107.174.14.152
+107.174.142.107
  107.174.144.155
-107.174.144.197
  107.174.149.226
  107.174.149.88
  107.174.150.57
-107.174.17.108
  107.174.204.224
  107.174.205.28
  107.174.206.110
-107.174.206.147
  107.174.224.153
  107.174.233.248
  107.174.239.226
-107.174.239.237
  107.174.24.12
  107.174.240.42
  107.174.244.102
  107.174.245.119
-107.174.249.70
+107.174.245.4
  107.174.251.167
  107.174.255.62
  107.174.26.181
@@ -7727,21 +7737,22 @@
  107.174.38.178
  107.174.39.102
  107.174.39.118
+107.174.39.68
+107.174.53.58
  107.174.54.76
  107.174.67.166
-107.174.68.54
  107.174.9.128
  107.175.0.13
  107.175.0.51
  107.175.1.177
  107.175.113.101
+107.175.13.22
  107.175.13.35
  107.175.13.95
  107.175.146.203
  107.175.150.73
  107.175.150.83
  107.175.151.74
-107.175.153.209
  107.175.153.212
  107.175.153.222
  107.175.158.105
@@ -7756,8 +7767,8 @@
  107.175.197.150
  107.175.197.164
  107.175.224.133
+107.175.224.137
  107.175.224.188
-107.175.232.240
  107.175.236.254
  107.175.32.75
  107.175.32.89
@@ -7773,6 +7784,7 @@
  107.175.38.101
  107.175.38.29
  107.175.38.35
+107.175.39.25
  107.175.39.6
  107.175.44.89
  107.175.61.32
@@ -7782,7 +7794,6 @@
  107.175.64.188
  107.175.65.251
  107.175.67.189
-107.175.67.38
  107.175.68.249
  107.175.69.166
  107.175.75.147
@@ -7797,17 +7808,18 @@
  107.175.93.87
  107.175.94.166
  107.175.94.18
+107.175.95.122
  107.178.186.119
  107.178.6.30
  107.178.75.114
-107.178.75.61
-107.178.9.186
  107.178.91.53
  107.178.98.66
  107.179.95.6
  107.179.96.11
  107.180.100.223
  107.180.100.224
+107.180.103.185
+107.180.104.71
  107.180.106.60
  107.180.108.32
  107.180.108.7
@@ -7816,6 +7828,8 @@
  107.180.120.61
  107.180.121.26
  107.180.122.10
+107.180.227.163
+107.180.236.234
  107.180.239.203
  107.180.44.78
  107.180.72.207
@@ -7827,6 +7841,7 @@
  107.180.88.189
  107.180.95.70
  107.181.112.15
+107.181.161.85
  107.181.174.175
  107.181.175.112
  107.181.187.132
@@ -7851,7 +7866,7 @@
  107.182.23.139
  107.182.23.162
  107.182.25.146
-107.184.105.75
+107.184.39.199
  107.186.120.130
  107.189.10.119
  107.189.10.143
@@ -7898,9 +7913,9 @@
  107.191.116.103
  107.191.125.124
  107.191.33.83
-107.191.43.246
  107.191.45.65
  107.191.49.16
+107.191.50.50
  107.191.51.136
  107.191.61.187
  107.191.63.217
@@ -7925,12 +7940,10 @@
  107.21.192.118
  107.21.196.112
  107.21.225.222
-107.21.229.205
  107.21.77.7
  107.213.167.156
  107.22.127.222
  107.22.132.160
-107.22.156.98
  107.22.162.155
  107.22.163.11
  107.22.251.207
@@ -7939,12 +7952,12 @@
  107.220.199.71
  107.221.96.202
  107.222.10.97
-107.222.60.213
  107.223.161.13
  107.23.116.84
  107.23.14.203
  107.23.189.203
  107.23.196.188
+107.23.209.100
  107.23.214.232
  107.23.240.0
  107.23.37.43
@@ -8054,25 +8067,16 @@
  108.160.138.55
  108.160.141.213
  108.160.193.48
-108.161.128.118
-108.161.128.22
-108.161.128.64
-108.161.129.118
  108.161.129.14
-108.161.131.10
  108.161.133.130
  108.161.134.112
-108.162.176.121
-108.162.219.224
-108.162.219.74
  108.162.229.35
-108.162.229.92
  108.162.245.119
  108.162.245.83
  108.162.246.36
  108.162.246.54
-108.162.28.6
  108.163.250.106
+108.165.192.107
  108.166.194.71
  108.166.202.103
  108.166.85.126
@@ -8080,7 +8084,6 @@
  108.167.163.100
  108.167.189.16
  108.167.2.254
-108.167.23.229
  108.168.125.57
  108.168.131.106
  108.168.247.250
@@ -8118,29 +8121,31 @@
  108.179.219.114
  108.179.54.171
  108.18.131.20
-108.185.173.255
+108.180.158.56
+108.185.148.114
  108.186.6.161
  108.186.6.193
  108.19.140.2
  108.190.109.107
  108.190.190.48
+108.190.201.37
  108.191.2.72
  108.195.234.233
  108.20.175.197
  108.20.186.210
  108.20.207.31
-108.200.255.200
  108.201.55.226
  108.202.87.39
+108.215.252.149
  108.222.149.83
+108.225.195.53
  108.228.10.182
+108.232.112.66
  108.234.193.106
  108.247.173.170
  108.248.87.92
-108.250.76.109
  108.26.60.38
  108.27.23.160
-108.28.192.230
  108.29.164.150
  108.29.164.250
  108.29.77.74
@@ -8149,10 +8154,10 @@
  108.36.253.227
  108.4.207.148
  108.4.213.39
+108.41.106.29
  108.41.2.202
  108.46.207.204
  108.48.169.20
-108.48.189.178
  108.5.127.251
  108.51.103.79
  108.51.195.30
@@ -8207,6 +8212,7 @@
  108.61.86.34
  108.61.87.179
  108.61.89.137
+108.62.12.152
  108.62.21.154
  108.62.56.0
  108.62.56.1
@@ -10256,20 +10262,18 @@
  108.62.63.97
  108.62.63.98
  108.62.63.99
-108.62.70.109
  108.62.70.118
  108.62.70.32
  108.62.70.82
  108.62.82.189
  108.62.96.36
  108.67.148.87
-108.7.219.25
  108.70.4.231
  108.72.209.30
  108.78.162.234
  108.81.157.69
-108.88.155.135
  108.9.195.212
+108.95.85.69
  1080london.com
  1080wallpapers.xyz
  1081-https.com
@@ -10277,7 +10281,6 @@
  108bpo.com.br
  108studija.lt
  109-365.net
-109.10.165.189
  109.101.137.162
  109.101.139.106
  109.101.196.50
@@ -10285,7 +10288,6 @@
  109.102.228.130
  109.102.254.170
  109.103.241.242
-109.103.29.94
  109.104.164.105
  109.104.17.112
  109.104.212.25
@@ -10296,27 +10298,27 @@
  109.105.205.229
  109.105.205.230
  109.105.205.232
+109.105.242.112
  109.106.139.225
  109.106.236.5
  109.107.241.98
+109.108.136.103
  109.108.87.136
  109.108.88.156
  109.11.193.220
  109.110.73.106
  109.110.81.90
-109.111.129.51
  109.111.130.133
  109.111.142.116
  109.111.237.38
  109.115.225.250
-109.115.62.166
  109.116.245.80
  109.116.41.238
  109.116.7.179
  109.116.7.240
  109.117.250.76
  109.117.53.230
-109.12.26.252
+109.117.79.73
  109.12.99.127
  109.120.141.160
  109.120.141.220
@@ -10339,17 +10341,14 @@
  109.127.53.114
  109.134.162.71
  109.134.232.81
-109.134.89.132
-109.146.45.192
+109.145.147.89
  109.146.61.204
+109.148.127.199
  109.148.140.120
  109.149.177.137
-109.151.40.214
  109.154.150.149
-109.156.149.124
-109.157.42.23
  109.158.56.60
-109.160.13.127
+109.160.20.131
  109.160.20.203
  109.160.41.101
  109.160.41.102
@@ -10363,13 +10362,12 @@
  109.160.97.49
  109.161.94.251
  109.162.127.246
+109.163.142.193
  109.163.234.5
  109.164.105.107
  109.164.113.55
  109.164.231.240
-109.165.0.176
  109.165.118.223
-109.165.18.66
  109.166.213.12
  109.166.89.91
  109.167.132.201
@@ -10381,7 +10379,6 @@
  109.167.231.99
  109.167.249.41
  109.167.38.1
-109.168.248.12
  109.168.253.41
  109.169.20.168
  109.169.29.30
@@ -10393,16 +10390,15 @@
  109.169.73.23
  109.169.74.123
  109.170.96.18
-109.170.96.26
  109.170.97.146
  109.171.39.18
+109.172.222.222
  109.172.57.250
-109.172.57.64
-109.173.144.26
  109.173.179.239
  109.173.207.145
  109.173.235.134
  109.173.41.95
+109.173.87.173
  109.173.96.209
  109.174.19.134
  109.175.10.239
@@ -10413,8 +10409,8 @@
  109.183.189.238
  109.183.251.77
  109.184.231.85
-109.184.238.254
  109.184.255.148
+109.184.44.128
  109.185.141.61
  109.185.174.84
  109.185.180.87
@@ -10432,10 +10428,13 @@
  109.191.157.213
  109.191.169.189
  109.191.203.153
+109.191.59.20
+109.192.219.158
  109.192.75.21
  109.193.134.138
  109.193.202.33
  109.193.211.227
+109.193.235.70
  109.194.17.181
  109.194.174.78
  109.194.175.108
@@ -10443,6 +10442,7 @@
  109.194.244.248
  109.194.27.222
  109.195.102.200
+109.195.112.209
  109.195.118.221
  109.195.147.206
  109.195.177.136
@@ -10450,7 +10450,6 @@
  109.195.194.79
  109.195.215.210
  109.195.38.201
-109.196.148.102
  109.196.172.197
  109.196.69.67
  109.196.82.214
@@ -10459,7 +10458,6 @@
  109.198.191.22
  109.199.133.161
  109.199.241.148
-109.199.251.2
  109.200.132.161
  109.200.156.102
  109.200.156.2
@@ -10480,15 +10478,16 @@
  109.202.79.28
  109.205.115.234
  109.205.145.157
+109.205.145.251
  109.206.168.240
-109.206.97.58
  109.207.102.183
+109.207.121.248
  109.207.166.224
-109.207.166.232
+109.207.178.155
  109.207.193.46
  109.207.46.111
+109.207.77.27
  109.207.79.248
-109.208.65.14
  109.21.2.47
  109.210.97.157
  109.215.254.226
@@ -10507,15 +10506,17 @@
  109.224.55.10
  109.224.55.6
  109.224.6.140
-109.226.193.45
+109.225.42.238
  109.226.213.125
  109.226.220.93
+109.227.115.209
  109.227.199.25
  109.227.23.180
  109.227.249.194
  109.227.5.66
  109.227.63.3
  109.228.12.92
+109.228.134.237
  109.228.168.80
  109.228.21.246
  109.228.50.121
@@ -10539,7 +10540,6 @@
  109.231.194.188
  109.232.106.236
  109.232.109.58
-109.232.54.119
  109.233.212.105
  109.234.161.21
  109.234.161.25
@@ -10555,7 +10555,6 @@
  109.235.69.120
  109.235.7.228
  109.236.105.40
-109.236.213.1
  109.236.52.80
  109.236.81.124
  109.236.81.138
@@ -10567,19 +10566,12 @@
  109.236.90.117
  109.236.90.209
  109.236.91.15
-109.237.101.10
-109.237.101.14
  109.237.101.16
-109.237.101.18
-109.237.101.19
-109.237.101.2
  109.237.101.21
  109.237.101.4
  109.237.101.45
  109.237.101.47
  109.237.101.59
-109.237.101.6
-109.237.101.8
  109.237.140.8
  109.237.147.213
  109.237.214.77
@@ -10588,9 +10580,12 @@
  109.237.92.138
  109.237.96.101
  109.237.96.102
+109.237.96.104
+109.237.96.107
  109.237.96.169
  109.237.96.174
  109.237.96.177
+109.237.96.195
  109.237.96.196
  109.237.96.197
  109.237.96.199
@@ -10605,29 +10600,30 @@
  109.237.96.212
  109.237.96.213
  109.237.96.214
+109.237.96.215
  109.237.96.216
+109.237.96.218
+109.237.96.219
  109.237.96.220
  109.237.96.221
+109.237.96.222
+109.237.96.223
+109.237.96.224
  109.237.96.225
  109.237.96.230
  109.237.96.58
-109.237.96.59
  109.237.96.60
  109.237.96.61
-109.237.96.62
  109.237.96.63
-109.237.96.64
  109.237.96.65
  109.237.96.66
  109.237.96.68
  109.237.96.69
-109.237.96.70
  109.237.96.71
  109.237.96.72
  109.237.96.73
  109.237.96.74
  109.237.96.76
-109.237.96.77
  109.237.96.89
  109.238.11.95
  109.238.208.130
@@ -10641,15 +10637,14 @@
  109.238.223.67
  109.238.229.233
  109.238.230.42
+109.238.32.42
  109.238.46.186
  109.239.211.17
-109.239.242.202
  109.24.144.155
  109.241.164.89
  109.241.203.171
  109.244.102.28
  109.244.102.7
-109.244.103.136
  109.244.35.48
  109.244.97.210
  109.244.99.20
@@ -10660,39 +10655,35 @@
  109.245.239.125
  109.245.241.89
  109.245.242.105
-109.245.95.210
  109.247.106.144
-109.247.217.24
  109.248.11.121
-109.248.12.81
  109.248.129.241
  109.248.14.178
-109.248.14.33
  109.248.14.90
  109.248.142.240
-109.248.144.10
+109.248.142.99
  109.248.147.150
  109.248.148.57
  109.248.149.95
  109.248.149.96
  109.248.166.102
  109.248.175.26
-109.248.176.238
  109.248.200.191
  109.248.205.252
  109.248.206.13
  109.248.62.207
  109.248.9.32
  109.250.138.137
-109.250.229.39
-109.250.229.70
+109.250.143.80
+109.250.229.131
+109.250.250.93
  109.251.252.123
-109.251.55.235
  109.251.68.112
  109.251.76.229
  109.252.122.64
-109.252.123.156
+109.252.228.158
  109.252.255.162
+109.252.87.13
  109.254.6.40
  109.255.152.153
  109.31.234.155
@@ -10704,14 +10695,9 @@
  109.61.112.53
  109.61.14.0
  109.61.2.166
-109.63.165.102
-109.64.169.125
  109.64.229.66
  109.64.231.189
  109.65.109.209
-109.66.58.147
-109.67.61.6
-109.67.74.141
  109.68.189.22
  109.68.212.165
  109.69.0.69
@@ -10719,6 +10705,7 @@
  109.69.10.116
  109.69.108.235
  109.69.161.131
+109.69.66.105
  109.69.67.17
  109.69.75.5
  109.7.44.186
@@ -10783,6 +10770,7 @@
  109.74.143.45
  109.74.144.130
  109.74.194.190
+109.74.198.185
  109.74.206.146
  109.74.5.95
  109.74.51.83
@@ -10795,11 +10783,11 @@
  109.75.36.93
  109.75.43.17
  109.75.45.34
-109.80.118.68
  109.80.128.210
+109.81.210.204
+109.86.114.238
  109.86.121.118
  109.86.134.93
-109.86.182.203
  109.86.187.241
  109.86.190.92
  109.86.198.220
@@ -10808,7 +10796,6 @@
  109.86.219.4
  109.86.225.146
  109.86.226.133
-109.86.240.57
  109.86.244.225
  109.86.71.186
  109.87.11.192
@@ -10818,12 +10805,10 @@
  109.87.166.145
  109.87.183.226
  109.87.190.238
-109.87.2.207
  109.87.206.44
-109.87.40.23
-109.87.55.67
  109.87.78.144
  109.9.175.65
+109.9.51.15
  109.90.104.232
  109.90.2.66
  109.92.131.90
@@ -10837,10 +10822,11 @@
  109.92.222.102
  109.92.222.170
  109.92.29.236
+109.92.78.136
+109.93.16.49
  109.94.115.108
  109.94.182.128
  109.94.182.9
-109.94.208.180
  109.95.123.150
  109.95.150.102
  109.95.151.108
@@ -10886,6 +10872,7 @@
  11.evahesse.com
  110.10.178.22
  110.10.178.251
+110.10.178.51
  110.10.179.64
  110.10.179.65
  110.10.58.38
@@ -10896,6 +10883,8 @@
  110.136.105.45
  110.136.129.228
  110.136.207.150
+110.136.218.99
+110.136.219.23
  110.136.241.180
  110.136.247.104
  110.136.75.17
@@ -10903,21 +10892,21 @@
  110.137.77.128
  110.137.89.11
  110.138.148.5
-110.138.150.69
  110.138.192.61
-110.138.203.90
+110.138.70.150
  110.138.99.121
  110.139.128.232
  110.139.203.64
  110.139.206.102
  110.139.24.72
+110.139.26.186
  110.139.50.111
+110.140.157.96
  110.141.212.12
  110.141.221.58
  110.142.161.90
  110.142.236.207
  110.143.198.245
-110.143.43.131
  110.143.84.202
  110.145.101.66
  110.145.11.73
@@ -10940,19 +10929,19 @@
  110.156.65.88
  110.157.217.111
  110.157.28.43
-110.16.94.34
  110.16.95.6
  110.164.101.129
  110.164.86.203
  110.164.91.50
  110.165.19.77
+110.166.87.119
  110.167.30.50
-110.168.170.20
+110.168.175.200
  110.168.175.86
-110.169.128.238
  110.169.129.105
  110.169.137.213
  110.169.32.135
+110.169.32.16
  110.169.70.204
  110.17.115.225
  110.17.41.183
@@ -10963,20 +10952,17 @@
  110.170.254.50
  110.170.37.194
  110.170.65.146
-110.171.110.120
  110.171.133.227
  110.171.154.126
  110.171.172.67
  110.171.184.34
  110.171.226.67
-110.171.28.17
  110.172.160.42
  110.172.162.216
  110.172.162.249
  110.172.166.161
  110.172.174.249
  110.172.180.180
-110.172.191.142
  110.173.58.162
  110.173.59.42
  110.174.109.237
@@ -10994,7 +10980,6 @@
  110.179.5.188
  110.179.5.65
  110.179.50.161
-110.18.187.188
  110.18.194.20
  110.18.194.204
  110.18.194.228
@@ -11002,7 +10987,7 @@
  110.18.194.236
  110.18.61.218
  110.182.107.42
-110.182.119.128
+110.182.115.97
  110.182.62.68
  110.182.63.203
  110.183.108.189
@@ -11014,19 +10999,15 @@
  110.188.23.57
  110.191.212.190
  110.191.237.202
-110.225.93.86
  110.226.72.220
  110.227.110.41
  110.227.118.199
-110.227.232.30
  110.228.196.199
  110.228.219.153
  110.228.91.170
  110.232.249.205
  110.232.249.211
  110.232.252.145
-110.232.252.242
-110.232.66.162
  110.232.74.55
  110.232.76.39
  110.232.76.94
@@ -11034,6 +11015,7 @@
  110.232.82.177
  110.232.82.229
  110.232.83.117
+110.232.87.13
  110.232.87.3
  110.235.249.162
  110.235.250.71
@@ -11043,7 +11025,6 @@
  110.243.21.44
  110.244.97.221
  110.247.16.64
-110.247.255.166
  110.251.10.18
  110.251.132.10
  110.251.236.10
@@ -11068,32 +11049,32 @@
  110.36.228.157
  110.36.234.146
  110.36.235.122
+110.36.237.10
  110.36.238.138
-110.36.238.158
+110.36.58.26
  110.37.204.106
  110.37.216.118
  110.37.224.243
+110.37.225.117
  110.37.226.83
  110.37.227.139
-110.38.3.130
+110.39.134.154
  110.39.160.132
  110.39.160.38
  110.39.162.2
  110.39.174.58
-110.39.8.26
  110.4.27.27
  110.4.45.150
  110.42.10.141
  110.43.241.63
  110.43.242.102
+110.43.34.170
  110.43.42.91
  110.43.49.112
  110.43.52.158
  110.43.52.211
  110.43.52.246
-110.44.113.187
  110.44.117.26
-110.44.122.214
  110.44.123.116
  110.44.124.220
  110.44.126.149
@@ -11109,20 +11090,24 @@
  110.47.218.84
  110.49.101.58
  110.49.11.50
+110.49.125.109
  110.49.127.85
  110.49.127.88
  110.49.167.189
  110.49.47.242
-110.5.101.210
  110.5.102.238
  110.50.84.162
  110.50.84.231
+110.50.84.248
  110.50.85.162
  110.52.208.141
  110.53.182.126
  110.54.126.94
  110.54.134.223
+110.54.148.20
+110.54.159.101
  110.54.176.58
+110.54.245.202
  110.54.250.13
  110.55.117.248
  110.72.251.22
@@ -11143,16 +11128,14 @@
  110.74.222.71
  110.76.128.50
  110.76.128.53
-110.76.129.106
  110.76.155.145
  110.77.132.217
-110.77.135.112
  110.77.135.131
  110.77.135.70
  110.77.137.213
  110.77.145.159
+110.77.146.101
  110.77.149.227
-110.77.149.76
  110.77.159.132
  110.77.159.149
  110.77.159.60
@@ -11160,25 +11143,22 @@
  110.77.171.241
  110.77.171.84
  110.77.173.178
-110.77.180.55
  110.77.184.210
  110.77.184.239
+110.77.184.58
  110.77.184.65
  110.77.185.71
  110.77.189.93
  110.77.196.24
  110.77.197.75
  110.77.207.109
-110.77.217.149
  110.77.217.163
  110.77.217.177
-110.77.217.66
  110.77.217.7
  110.77.226.221
  110.77.232.174
  110.77.232.219
  110.77.232.29
-110.77.232.65
  110.77.232.84
  110.77.235.197
  110.77.236.112
@@ -11187,21 +11167,24 @@
  110.77.236.54
  110.77.240.101
  110.77.240.174
+110.77.242.128
+110.77.242.15
  110.77.242.165
  110.77.246.119
  110.77.246.126
  110.77.250.185
  110.78.137.118
-110.78.138.195
+110.78.138.113
  110.78.141.246
  110.78.145.195
  110.78.145.2
+110.78.145.66
+110.78.146.137
  110.78.146.177
  110.78.146.4
  110.78.146.99
  110.78.147.191
  110.78.147.197
-110.78.147.236
  110.78.147.48
  110.78.148.143
  110.78.148.221
@@ -11209,14 +11192,15 @@
  110.78.148.3
  110.78.148.99
  110.78.149.14
+110.78.149.160
  110.78.149.167
  110.78.149.197
  110.78.149.201
-110.78.149.221
  110.78.149.80
  110.78.149.9
  110.78.151.2
  110.78.151.234
+110.78.151.83
  110.78.152.118
  110.78.152.119
  110.78.152.12
@@ -11234,19 +11218,20 @@
  110.78.158.221
  110.78.164.188
  110.78.164.234
+110.78.168.11
  110.78.168.123
  110.78.168.167
  110.78.168.217
+110.78.178.128
  110.78.178.134
+110.78.178.212
  110.78.179.212
  110.78.179.54
  110.78.186.105
  110.78.186.142
-110.78.186.172
  110.78.186.183
  110.78.186.227
  110.78.186.238
-110.78.186.245
  110.78.186.248
  110.78.186.37
  110.78.186.58
@@ -11255,19 +11240,21 @@
  110.78.20.62
  110.78.208.28
  110.78.81.162
+110.8.42.222
  110.8.67.146
  110.8.71.166
  110.8.84.231
  110.82.9.54
-110.85.98.191
+110.84.145.67
  110.85.99.220
-110.86.179.127
-110.86.182.27
  110.88.160.179
  110.88.160.233
  110.89.40.75
-110.90.220.2
-110.90.220.64
+110.9.134.4
+110.90.221.196
+110.90.221.203
+110.90.221.47
+110.90.223.216
  110.93.13.182
  110.93.13.190
  110.93.13.33
@@ -11276,9 +11263,7 @@
  110.93.214.34
  110.93.214.37
  110.93.226.50
-110.93.227.133
  110.93.246.222
-110.93.82.22
  110.93.87.254
  111.0.123.73
  111.0.124.232
@@ -11302,14 +11287,16 @@
  111.118.96.2
  111.119.178.175
  111.119.187.22
+111.119.187.61
  111.119.187.63
  111.119.210.10
  111.119.233.65
  111.119.245.114
  111.12.52.219
  111.120.16.2
+111.121.104.130
  111.121.107.221
-111.122.228.38
+111.122.63.122
  111.123.64.229
  111.125.143.143
  111.125.70.22
@@ -11318,11 +11305,12 @@
  111.125.88.188
  111.126.77.173
  111.13.102.171
-111.13.102.195
+111.13.61.115
  111.132.5.132
  111.132.7.174
  111.14.221.8
  111.16.78.232
+111.160.180.18
  111.160.204.110
  111.160.226.178
  111.160.253.22
@@ -11331,39 +11319,30 @@
  111.161.74.100
  111.161.74.106
  111.161.74.113
-111.161.74.117
  111.161.74.118
  111.161.74.125
  111.162.45.145
  111.163.10.202
  111.163.75.91
-111.164.34.225
+111.165.167.237
  111.165.242.26
  111.165.73.6
  111.165.9.204
  111.166.194.142
  111.167.160.161
-111.167.207.8
  111.17.201.197
-111.170.201.10
  111.170.85.31
-111.170.86.72
-111.172.180.77
  111.172.38.82
  111.173.222.173
  111.175.186.150
  111.176.46.94
-111.177.192.106
-111.177.192.114
-111.177.192.122
-111.177.192.131
-111.177.192.36
-111.177.192.46
+111.177.192.129
+111.177.192.31
+111.177.192.43
+111.177.192.85
  111.177.22.112
-111.177.22.4
  111.177.22.5
  111.177.32.171
-111.178.109.96
  111.182.136.18
  111.182.237.131
  111.185.126.96
@@ -11376,9 +11355,7 @@
  111.198.33.54
  111.198.48.204
  111.199.73.138
-111.20.171.234
  111.200.216.72
-111.200.48.228
  111.200.54.67
  111.203.201.176
  111.204.176.209
@@ -11389,11 +11366,9 @@
  111.207.49.186
  111.207.92.209
  111.21.255.3
+111.21.72.18
  111.21.99.227
-111.220.71.156
  111.223.3.83
-111.224.32.162
-111.225.153.34
  111.225.45.95
  111.229.1.180
  111.229.113.64
@@ -11452,6 +11427,7 @@
  111.229.221.142
  111.229.229.16
  111.229.234.57
+111.229.235.119
  111.229.236.96
  111.229.237.226
  111.229.237.32
@@ -11480,6 +11456,7 @@
  111.229.72.226
  111.229.73.244
  111.229.75.135
+111.229.75.27
  111.229.78.120
  111.229.79.118
  111.229.82.6
@@ -11519,6 +11496,7 @@
  111.230.221.203
  111.230.228.235
  111.230.229.231
+111.230.23.171
  111.230.23.206
  111.230.231.196
  111.230.233.68
@@ -11534,15 +11512,15 @@
  111.230.92.241
  111.231.103.64
  111.231.108.204
-111.231.110.149
  111.231.115.43
  111.231.116.149
  111.231.119.188
  111.231.119.203
  111.231.119.93
-111.231.132.135
+111.231.120.22
  111.231.134.110
  111.231.135.160
+111.231.137.83
  111.231.140.184
  111.231.164.168
  111.231.18.208
@@ -11561,7 +11539,6 @@
  111.231.224.188
  111.231.226.216
  111.231.228.239
-111.231.241.102
  111.231.241.201
  111.231.33.135
  111.231.52.108
@@ -11573,33 +11550,39 @@
  111.231.68.153
  111.231.71.235
  111.231.71.53
-111.231.75.5
  111.231.75.83
  111.231.76.214
  111.231.77.115
  111.231.79.227
  111.231.87.204
  111.231.88.39
+111.231.89.140
  111.231.9.225
  111.231.93.35
  111.235.65.211
+111.239.187.176
+111.239.191.227
  111.241.26.3
+111.241.58.78
  111.243.90.102
  111.246.44.92
  111.248.205.130
-111.249.1.192
  111.249.16.83
  111.250.133.37
  111.250.133.6
+111.250.19.153
  111.250.20.122
  111.251.220.162
  111.251.31.2
  111.252.155.184
  111.254.161.78
+111.254.38.81
  111.255.37.224
  111.26.206.113
  111.30.107.154
+111.30.114.22
  111.31cf4fdae.com
+111.33.179.2
  111.38.10.161
  111.38.103.114
  111.38.103.114bin.sh
@@ -11617,6 +11600,7 @@
  111.38.123.136
  111.38.123.15
  111.38.123.171
+111.38.123.184
  111.38.123.197
  111.38.123.200
  111.38.123.23
@@ -11670,6 +11654,7 @@
  111.42.67.31
  111.42.67.92
  111.42.89.137
+111.43.10.128
  111.43.223.100
  111.43.223.120
  111.43.223.121
@@ -11694,7 +11679,8 @@
  111.50.76.3
  111.53.13.253
  111.57.0.90
-111.61.122.78
+111.59.126.37
+111.59.45.19
  111.61.98.37
  111.63.25.98
  111.67.12.221
@@ -11703,7 +11689,6 @@
  111.67.194.36
  111.67.194.41
  111.67.194.94
-111.67.195.119
  111.67.195.77
  111.67.196.155
  111.67.197.198
@@ -11736,8 +11721,8 @@
  111.67.206.31
  111.67.207.202
  111.67.207.218
+111.67.63.49
  111.67.74.242
-111.67.77.193
  111.67.92.66
  111.68.101.236
  111.68.102.20
@@ -11753,16 +11738,17 @@
  111.68.97.205
  111.68.98.152
  111.68.99.216
-111.72.162.21
  111.73.45.204
-111.73.98.17
  111.74.11.82
  111.75.149.221
  111.76.126.109
  111.77.234.108
  111.77.250.65
+111.79.225.123
  111.79.45.186
  111.8.57.61
+111.85.15.238
+111.85.15.97
  111.85.96.173
  111.88.121.224
  111.88.249.25
@@ -11770,6 +11756,7 @@
  111.88.69.60
  111.89.221.74
  111.90.138.208
+111.90.140.132
  111.90.140.179
  111.90.140.207
  111.90.140.46
@@ -11790,7 +11777,6 @@
  111.90.149.233
  111.90.149.244
  111.90.149.250
-111.90.149.90
  111.90.150.108
  111.90.150.48
  111.90.150.64
@@ -11802,8 +11788,10 @@
  111.90.159.120
  111.90.177.130
  111.90.187.94
+111.90.190.52
  111.92.104.58
  111.92.164.238
+111.92.164.242
  111.92.164.245
  111.92.164.246
  111.92.164.251
@@ -11811,11 +11799,13 @@
  111.92.240.134
  111.92.52.171
  111.92.61.220
+111.92.63.194
  111.92.80.105
  111.92.80.119
  111.92.80.157
  111.92.80.168
  111.92.80.175
+111.92.80.182
  111.92.80.2
  111.92.80.22
  111.92.80.241
@@ -11840,24 +11830,19 @@
  111.93.121.26
  111.93.145.146
  111.93.169.90
-111.93.195.30
  111.93.2.220
  111.93.200.50
  111.93.214.67
-111.93.233.107
  111.93.235.74
  111.93.24.98
  111.93.30.66
  111.93.38.226
  111.93.71.219
-111.94.130.128
  111.94.180.174
  111.94.6.216
-111.94.87.87
  111.95.108.234
  111.95.141.34
  111.95.203.73
-111.95.71.233
  111.zc6555.com
  111.zc8333.com
  111361112586123.002.sh.cn
@@ -11870,32 +11855,38 @@
  112.104.27.94
  112.105.249.56
  112.109.198.106
-112.109.20.238
-112.111.0.245
  112.111.119.237
  112.111.162.117
  112.111.162.131
  112.112.7.202
  112.116.155.205
  112.116.48.159
+112.118.140.225
+112.118.153.215
+112.118.77.164
+112.119.139.71
  112.119.173.16
+112.119.200.90
  112.119.201.97
  112.121.164.154
+112.121.223.254
  112.122.5.6
  112.122.58.155
  112.122.58.205
+112.122.62.83
  112.122.63.102
  112.123.109.120
  112.123.109.145
  112.123.109.162
  112.123.109.196
-112.123.180.234
  112.123.187.171
  112.123.61.18
  112.123.62.14
  112.123.62.154
  112.124.50.80
  112.125.89.61
+112.126.100.252
+112.126.65.144
  112.126.65.178
  112.132.0.7
  112.132.129.158
@@ -11910,16 +11901,18 @@
  112.133.219.171
  112.133.222.151
  112.133.237.10
+112.133.237.55
+112.133.246.81
  112.133.251.171
  112.133.26.29
  112.134.139.240
-112.134.141.116
-112.134.143.136
  112.134.156.36
+112.134.69.117
  112.134.70.134
+112.134.70.163
  112.135.229.203
+112.135.240.245
  112.135.3.80
-112.137.132.89
  112.137.164.101
  112.14.158.86
  112.14.47.6
@@ -11927,15 +11920,15 @@
  112.140.185.101
  112.141.135.77
  112.146.109.225
+112.15.193.22
  112.15.71.219
  112.15.71.71
  112.15.9.22
+112.157.236.47
  112.158.127.39
-112.16.160.46
  112.16.211.200
  112.160.228.146bin.sh
  112.160.238.138
-112.161.15.208
  112.161.211.65
  112.162.112.56
  112.162.153.65bin.sh
@@ -11949,9 +11942,11 @@
  112.164.225.19bin.sh
  112.164.242.29
  112.164.25.228
+112.164.99.211
  112.165.0.158
  112.165.209.225
  112.165.209.227
+112.165.234.170
  112.165.75.57
  112.166.104.14
  112.166.133.216
@@ -11988,14 +11983,19 @@
  112.17.89.155
  112.17.94.217
  112.170.59.191
+112.171.75.146
  112.172.135.239
  112.172.173.99
+112.172.187.162
+112.172.69.156
  112.175.137.20
  112.175.184.36
  112.175.232.169
  112.175.92.67
  112.18.69.127
+112.185.8.186
  112.186.17.231
+112.186.6.192
  112.186.78.13
  112.187.27.85
  112.187.6.59
@@ -12003,31 +12003,33 @@
  112.19.94.19
  112.192.159.136
  112.192.159.4
-112.195.151.160
  112.196.117.137
+112.196.132.91
  112.196.16.50
  112.196.163.10
-112.196.163.154
  112.196.2.206
  112.196.26.202
  112.196.43.202
+112.196.50.178
+112.196.52.74
  112.196.54.35
  112.196.74.82
-112.196.74.85
  112.196.76.140
-112.197.225.74
+112.197.0.125
  112.198.103.183
  112.198.27.40
  112.198.64.19
  112.198.77.219
+112.199.112.18
  112.199.118.195
-112.199.139.136
  112.199.65.114
  112.199.65.118
  112.199.76.44
  112.199.98.42
+112.20.189.144
  112.200.201.164
  112.201.176.54
+112.201.221.173
  112.201.91.20
  112.202.160.210
  112.202.39.210
@@ -12037,7 +12039,6 @@
  112.204.183.90
  112.205.10.148
  112.205.132.16
-112.206.152.253
  112.206.64.137
  112.206.85.168
  112.207.220.102
@@ -12048,6 +12049,7 @@
  112.21.191.10
  112.21.191.244
  112.210.59.106
+112.211.0.14
  112.211.85.172
  112.213.124.220
  112.213.179.18
@@ -12060,7 +12062,6 @@
  112.213.98.9
  112.214.127.42
  112.214.127.42bin.sh
-112.215.113.10
  112.215.113.11
  112.216.153.186
  112.216.226.146
@@ -12080,6 +12081,7 @@
  112.218.66.90
  112.218.73.138
  112.219.201.124
+112.220.102.162
  112.220.151.204
  112.220.238.3
  112.221.4.3
@@ -12095,7 +12097,6 @@
  112.225.52.145
  112.225.57.154
  112.225.73.162
-112.225.83.69
  112.225.87.22
  112.226.116.82bin.sh
  112.226.122.28
@@ -12123,6 +12124,8 @@
  112.228.178.129
  112.228.229.83
  112.229.186.88
+112.229.199.112
+112.231.216.141
  112.232.89.49
  112.233.100.32
  112.233.61.230bin.sh
@@ -12131,7 +12134,6 @@
  112.233.90.58
  112.234.110.178
  112.234.155.171
-112.234.16.252
  112.234.194.23
  112.234.198.115
  112.234.218.202
@@ -12176,13 +12178,16 @@
  112.238.63.223
  112.239.115.195
  112.239.138.200
+112.239.20.124
  112.240.145.121
  112.240.173.23
  112.240.176.49
  112.240.179.162
  112.240.180.145
  112.240.181.243
+112.240.181.5
  112.240.182.30
+112.240.230.75
  112.242.1.245bin.sh
  112.242.119.70bin.sh
  112.242.129.242
@@ -12211,16 +12216,12 @@
  112.246.162.94
  112.246.185.65
  112.246.23.135
-112.246.242.149
  112.246.42.101
  112.247.158.19
-112.247.163.241
  112.247.174.45
-112.247.184.40
  112.247.191.75bin.sh
  112.247.215.212
  112.247.251.223
-112.247.46.47
  112.247.59.124
  112.247.80.24
  112.247.80.248
@@ -12230,12 +12231,12 @@
  112.248.112.139
  112.248.115.154
  112.248.115.180
-112.248.12.171
+112.248.12.227
+112.248.12.95
  112.248.125.144
  112.248.13.152
-112.248.13.169
  112.248.13.204
-112.248.13.45
+112.248.13.46
  112.248.169.138bin.sh
  112.248.176.75
  112.248.184.99
@@ -12247,13 +12248,12 @@
  112.248.47.171
  112.248.61.64
  112.248.68.131
-112.248.8.114
  112.248.85.54
  112.249.112.124
  112.249.114.118
  112.249.117.35
+112.249.162.247
  112.249.187.129
-112.249.207.154
  112.249.207.89
  112.249.232.220
  112.249.239.249
@@ -12271,19 +12271,20 @@
  112.250.102.173
  112.250.187.128
  112.250.34.253
+112.250.57.99
  112.251.16.53
  112.251.18.0
  112.251.218.91
  112.251.220.204
  112.251.42.183
  112.252.13.202
-112.252.192.124
+112.252.194.216
  112.252.199.225
  112.252.213.72
  112.252.221.244
  112.252.228.4
-112.252.231.117
-112.252.238.207
+112.252.229.96
+112.252.230.33
  112.252.249.245
  112.252.74.188
  112.252.97.36
@@ -12291,7 +12292,6 @@
  112.254.133.141
  112.254.177.210
  112.254.180.220
-112.254.194.112
  112.254.201.248
  112.254.45.156
  112.254.68.30
@@ -12309,12 +12309,11 @@
  112.255.8.235
  112.255.83.242
  112.255.92.233
+112.26.101.249
  112.26.113.106
  112.26.160.67
-112.26.169.108
  112.26.44.112
  112.26.44.65
-112.26.7.145
  112.27.115.8
  112.27.121.163
  112.27.121.163bin.sh
@@ -12393,9 +12392,7 @@
  112.27.126.243
  112.27.127.155
  112.27.127.155bin.sh
-112.27.128.13
  112.27.141.90
-112.27.202.63
  112.27.232.189
  112.27.250.128
  112.27.250.128bin.sh
@@ -12426,7 +12423,7 @@
  112.28.98.69
  112.28.98.70
  112.29.149.198
-112.29.149.237
+112.29.74.129
  112.30.1.119
  112.30.1.133
  112.30.1.139
@@ -12527,6 +12524,7 @@
  112.30.4.52
  112.30.4.53bin.sh
  112.30.4.57
+112.30.4.60
  112.30.4.61
  112.30.4.68
  112.30.4.68bin.sh
@@ -12539,28 +12537,35 @@
  112.30.4.90
  112.30.4.90bin.sh
  112.30.97.184
+112.30.98.129
  112.31.0.118
  112.31.176.16
  112.31.211.135
  112.31.240.239
+112.31.240.45
  112.31.56.247
  112.31.65.24
  112.31.87.98
+112.33.113.165
  112.33.13.124
  112.33.16.34
+112.33.254.28
  112.33.47.36
  112.33.50.31
  112.33.55.51
  112.35.30.107
  112.35.79.100
+112.4.114.151
  112.4.79.70
  112.44.120.97
  112.44.95.132
  112.47.3.53
  112.47.64.139
+112.49.241.115
  112.5.112.230
  112.51.249.235
  112.51.254.134
+112.53.198.180
  112.53.227.57
  112.53.227.57bin.sh
  112.53.227.65
@@ -12572,15 +12577,13 @@
  112.6.9.8
  112.64.32.118
  112.64.33.38
-112.64.52.64
  112.64.52.87
  112.64.67.35
  112.64.67.36
  112.64.67.37
+112.65.125.190
  112.65.63.62
-112.66.255.196
  112.67.174.71
-112.67.177.243
  112.67.252.27
  112.72.133.118
  112.72.137.94
@@ -12595,9 +12598,8 @@
  112.72.195.47
  112.72.231.35
  112.72.245.132
-112.74.30.95
-112.74.43.100
  112.74.44.120
+112.74.76.83
  112.78.0.37
  112.78.1.134
  112.78.1.240
@@ -12620,8 +12622,8 @@
  112.78.161.42
  112.78.162.111
  112.78.162.131
-112.78.162.177
  112.78.162.195
+112.78.163.67
  112.78.164.209
  112.78.164.227
  112.78.164.61
@@ -12634,7 +12636,6 @@
  112.78.167.195
  112.78.167.33
  112.78.167.71
-112.78.169.98
  112.78.170.27
  112.78.186.110
  112.78.188.194
@@ -12647,14 +12648,15 @@
  112.78.44.229
  112.78.8.133
  112.79.134.194
+112.80.154.56
  112.80.238.37
-112.80.39.166
+112.80.25.77
  112.81.210.122
  112.81.24.144
  112.81.43.83
+112.81.64.159
  112.82.142.161
  112.82.146.51
-112.82.172.4
  112.82.18.255
  112.82.198.79
  112.82.218.4
@@ -12664,7 +12666,6 @@
  112.84.21.184
  112.84.95.83
  112.85.42.143
-112.85.42.17
  112.85.42.72
  112.85.42.74
  112.86.132.95
@@ -12675,9 +12676,8 @@
  112.86.65.70
  112.87.136.109
  112.87.139.58
-112.87.250.147
  112.90.145.103
-112.90.196.242
+112.91.108.187
  112.91.109.103
  112.91.135.184
  112.91.145.58
@@ -12690,12 +12690,12 @@
  112.94.97.1
  112.94.97.106
  112.94.97.40
-112.94.98.118
  112.94.98.54
  112.94.99.252
  112.94.99.4
  112.94.99.67
  112.95.135.77
+112.95.22.42
  112.95.225.158
  112.95.70.109
  112.98.126.100
@@ -12706,55 +12706,55 @@
  113-365.net
  113.10.154.11
  113.10.158.220
-113.100.209.184
-113.100.209.211
-113.100.209.76
+113.102.129.40
+113.102.131.59
  113.102.35.217
  113.103.57.113
+113.104.217.196
  113.104.227.177
-113.104.249.248
+113.105.174.4
  113.105.191.5
  113.105.247.21
  113.106.111.50
-113.107.169.197
+113.106.9.248
  113.107.201.131
  113.107.244.124
-113.108.116.214
  113.108.195.242
+113.108.88.121
  113.108.88.78
  113.11.110.46
  113.11.20.23
  113.11.252.97
  113.11.254.216
  113.11.255.24
+113.11.39.110
  113.11.64.62
-113.110.193.134
-113.110.245.36
+113.110.192.86
+113.110.244.254
  113.111.229.93
  113.113.81.174
-113.116.121.168
-113.116.155.225
-113.116.171.161
+113.116.10.155
+113.116.130.186
+113.116.177.18
+113.116.226.107
  113.116.226.147
-113.118.123.170
-113.118.204.241
+113.116.49.129
+113.116.89.181
+113.118.12.135
+113.118.15.160
+113.118.192.86
+113.118.194.130
  113.118.206.61
-113.118.248.48
-113.118.249.110
+113.118.4.190
  113.118.84.53
  113.12.64.58
  113.120.33.35
-113.120.62.206
-113.121.241.129
-113.121.241.254
-113.121.242.65
-113.121.242.69
-113.121.243.250
+113.121.241.195
+113.121.243.142
  113.121.243.37
+113.122.134.35
  113.125.21.66
-113.125.64.158
  113.128.15.170
-113.128.179.86
  113.128.246.50
  113.130.126.154
  113.130.126.2
@@ -12762,30 +12762,29 @@
  113.133.170.196
  113.133.176.204
  113.133.224.68
-113.133.229.143
  113.134.211.242
  113.134.211.28
  113.134.240.218
  113.137.102.122
-113.137.103.243
  113.14.236.173
-113.140.48.198
+113.140.11.6
  113.140.48.82
  113.140.80.174
  113.141.165.235
  113.141.66.255
+113.141.70.199
  113.142.58.155
  113.15.205.127
  113.160.105.74
  113.160.130.116
-113.160.131.53
  113.160.142.10
  113.160.142.68
-113.160.152.23
  113.160.166.49
  113.160.188.21
+113.160.205.10
  113.160.206.37
-113.160.208.255
+113.160.210.115
+113.160.210.54
  113.160.218.111
  113.160.219.210
  113.160.234.147
@@ -12805,12 +12804,13 @@
  113.161.148.81
  113.161.149.126
  113.161.151.170
+113.161.161.242
  113.161.186.101
  113.161.207.105
  113.161.207.99
-113.161.210.190
  113.161.220.242
  113.161.237.248
+113.161.238.99
  113.161.24.63
  113.161.37.216
  113.161.52.89
@@ -12818,40 +12818,42 @@
  113.161.58.249
  113.161.58.60
  113.161.62.31
+113.161.62.81
  113.161.68.146
  113.161.70.172
-113.161.72.129
  113.161.78.86
+113.161.88.235
+113.161.89.78
  113.161.92.91
  113.162.101.73
-113.162.178.21
-113.162.220.29
+113.162.156.76
  113.162.232.255
  113.163.157.250
  113.163.200.47
+113.163.222.82
  113.164.79.127
  113.164.79.177
+113.164.94.156
+113.165.167.108
  113.165.167.17
  113.168.106.126
  113.168.209.247
  113.169.22.4
-113.170.221.199
-113.172.189.147
+113.170.128.242
  113.172.216.199
-113.172.240.150
  113.172.242.137
+113.172.27.205
  113.173.1.14
  113.173.150.128
  113.173.179.219
-113.173.180.175
+113.173.189.2
  113.173.191.219
  113.173.198.91
  113.173.253.138
  113.173.26.216
-113.174.170.156
  113.174.42.98
-113.175.251.206
  113.175.30.164
+113.175.47.248
  113.176.195.145
  113.176.231.150
  113.176.88.10
@@ -12861,36 +12863,34 @@
  113.177.27.217
  113.178.51.148
  113.178.72.115
-113.179.178.166
  113.180.103.252
  113.180.121.188
-113.180.159.163
-113.180.230.226
  113.181.23.207
  113.181.26.60
-113.182.109.15
-113.183.114.134
-113.184.133.153
+113.181.45.12
+113.181.65.123
  113.185.0.13
  113.185.19.134
-113.186.31.119
+113.190.114.176
  113.190.181.117
  113.190.227.2
-113.190.252.217
  113.190.254.165
  113.190.254.245
+113.190.254.74
  113.190.40.199
+113.190.42.153
  113.190.60.112
+113.190.97.230
  113.191.219.206
  113.193.240.109
  113.193.3.223
  113.194.129.139
+113.194.133.139
  113.194.137.48
-113.195.160.158
  113.195.165.192
  113.195.207.146
+113.199.197.102
  113.200.105.23
-113.200.150.55
  113.200.156.180
  113.200.58.178
  113.200.60.74
@@ -13416,49 +13416,44 @@
  113.212.70.97
  113.212.70.98
  113.212.70.99
-113.212.90.111
+113.212.87.131
+113.214.28.246
  113.215.163.135
  113.215.181.54
  113.219.200.7
  113.219.210.140
  113.219.217.244
-113.22.4.10
  113.221.13.204
  113.221.50.64
-113.224.14.213
+113.224.241.155
  113.225.12.165
  113.226.142.202
  113.227.42.149bin.sh
  113.229.81.108
  113.23.144.50
-113.230.95.99
+113.23.54.185
  113.231.200.55
+113.231.40.102
  113.231.40.54
-113.231.42.10
  113.231.42.36
+113.231.42.88
  113.231.47.139
-113.231.47.43
+113.231.47.176
  113.232.230.205
+113.233.118.233
  113.233.130.111
-113.234.228.177
  113.234.231.172
-113.237.196.204
-113.237.235.189
-113.237.235.213
+113.237.235.150
  113.237.236.174
-113.237.236.236
-113.237.236.246
-113.237.237.195
+113.237.248.47
  113.237.249.107
-113.237.249.216
  113.237.250.161
-113.237.250.56
-113.237.251.79
+113.237.250.231
  113.237.253.190
  113.237.254.241
-113.237.255.91
  113.238.142.208
  113.239.200.242
+113.239.84.41
  113.240.184.183
  113.240.186.132
  113.240.238.170
@@ -13470,15 +13465,26 @@
  113.247.250.238
  113.248.192.30
  113.251.220.49
+113.252.118.143
+113.252.160.242
  113.252.222.73
+113.253.213.30
+113.253.218.13
+113.253.3.29
  113.254.178.224
+113.254.25.193
+113.254.75.64
+113.255.104.146
+113.255.105.201
+113.255.114.244
+113.255.13.231
+113.255.40.184
  113.255.76.24
  113.28.243.105
  113.30.141.46
  113.30.66.24
  113.30.66.5
  113.31.102.234
-113.31.102.6
  113.31.102.8
  113.31.104.160
  113.31.104.176
@@ -13515,6 +13521,7 @@
  113.31.152.52
  113.31.152.60
  113.31.153.157
+113.4.78.121
  113.4.79.101
  113.41.194.235
  113.52.122.6
@@ -13522,9 +13529,8 @@
  113.53.119.76
  113.53.121.31
  113.53.144.49
-113.53.145.22
+113.53.155.144
  113.53.185.133
-113.53.194.24
  113.53.20.184
  113.53.200.76
  113.53.230.200
@@ -13532,26 +13538,28 @@
  113.53.232.201
  113.53.238.195
  113.53.247.221
+113.53.253.45
  113.53.255.222
  113.53.29.163
  113.53.29.218
  113.53.29.228
  113.53.29.88
-113.53.3.74
+113.53.3.120
  113.53.37.249
+113.53.40.174
  113.53.42.4
  113.53.53.155
  113.53.57.141
  113.53.61.235
  113.53.75.156
  113.53.82.157
+113.53.82.92
  113.53.83.210
  113.53.83.212
  113.53.91.12
  113.53.91.214
  113.53.94.235
  113.56.126.248
-113.57.109.73
  113.57.153.83
  113.57.170.50
  113.57.252.72
@@ -13562,57 +13570,58 @@
  113.59.156.244
  113.59.164.135
  113.59.165.19
-113.59.209.8
-113.59.217.145
+113.59.166.194
  113.59.224.170
  113.60.147.166
  113.60.202.175
  113.60.202.178
+113.61.227.146
  113.61.66.94
  113.64.248.239
  113.64.97.132
  113.65.110.41
  113.65.209.21
  113.65.21.108
-113.65.228.252
+113.65.229.223
  113.65.232.21
-113.65.232.65
+113.65.232.249
+113.66.124.197
  113.66.32.242
  113.66.33.125
-113.66.34.144
-113.67.99.83
+113.66.36.214
  113.68.142.196
+113.68.187.114
  113.69.131.38
  113.71.155.219
  113.72.121.177
-113.72.204.200
  113.74.26.114
  113.78.64.129
-113.79.15.111
+113.79.161.7
  113.8.207.221
-113.81.114.75
-113.81.46.140
  113.83.12.103
-113.87.180.246
  113.87.195.88
+113.87.2.175
+113.87.224.130
  113.87.227.173
+113.87.227.62
  113.88.102.225
-113.88.211.235
+113.88.108.255
+113.88.155.115
+113.88.232.146
  113.88.240.17
  113.88.37.133
  113.89.236.46
  113.89.246.247
-113.89.247.12
  113.89.35.2
+113.89.35.243
+113.89.41.247
  113.89.53.70
-113.89.86.85
  113.9.233.14
  113.90.177.134
  113.90.185.243
  113.90.245.165
  113.90.245.173
  113.90.35.2
-113.92.223.86
  113.93.108.248
  113.93.108.5
  113.93.224.20
@@ -13630,17 +13639,31 @@
  1139.31cf4fdae.com
  114-results-realestate-properties-in-your-city.estate
  114.100.116.101
-114.100.116.253
+114.100.116.162
+114.100.116.19
  114.100.117.10
+114.100.117.39
+114.100.117.76
+114.101.246.142
+114.101.246.52
+114.101.246.60
  114.101.247.198
  114.101.247.209
  114.102.180.99
  114.103.136.172
  114.103.136.235
+114.103.136.94
+114.103.137.199
  114.103.137.26
  114.103.137.50
+114.103.137.59
  114.104.189.119
+114.107.52.119
  114.107.53.102
+114.107.53.132
+114.107.53.79
+114.107.54.114
+114.107.54.30
  114.108.130.135
  114.108.140.37
  114.108.150.156
@@ -13654,9 +13677,11 @@
  114.110.21.121
  114.110.21.50
  114.110.21.54
+114.112.161.155
  114.112.233.211
  114.112.69.102
  114.112.70.150
+114.112.81.10
  114.113.225.121
  114.113.237.67
  114.113.238.11
@@ -13665,11 +13690,12 @@
  114.118.10.141
  114.118.12.230
  114.118.16.78
-114.119.135.251
-114.119.146.29
-114.119.157.189
+114.119.135.181
  114.119.183.219
  114.124.130.41
+114.124.200.214
+114.124.210.198
+114.125.79.39
  114.129.17.51
  114.129.225.53
  114.129.225.72
@@ -13686,10 +13712,10 @@
  114.143.100.102
  114.143.118.242
  114.143.141.98
-114.143.230.186
  114.143.25.156
  114.179.127.48
  114.179.13.180
+114.189.249.238
  114.199.113.38
  114.199.113.78
  114.199.116.9
@@ -13697,34 +13723,38 @@
  114.199.159.159
  114.199.215.31
  114.200.154.181
+114.200.81.222
  114.201.54.70
  114.202.139.173
  114.203.1.152
  114.204.218.154
  114.206.60.98
  114.207.139.203
+114.207.77.60
+114.215.100.48
  114.215.103.83
  114.215.184.51
+114.215.200.96
  114.215.205.220
+114.216.155.177
+114.216.17.187
  114.216.17.208
-114.216.192.79
  114.216.206.226
  114.216.238.189
  114.216.238.30
  114.216.49.165
-114.216.49.99
  114.217.105.143
-114.217.105.209
  114.217.108.37
+114.218.32.48
  114.218.60.51
+114.218.86.189
+114.218.9.180
  114.219.127.116
-114.219.128.239
  114.219.149.32
  114.219.157.97
  114.219.18.147
-114.219.21.254
-114.220.164.167
  114.220.76.79
+114.221.154.48
  114.221.19.231
  114.222.12.59
  114.223.48.158
@@ -13800,8 +13830,9 @@
  114.230.177.227
  114.231.109.74
  114.231.243.176
+114.231.46.104
  114.231.82.146
-114.231.82.186
+114.231.82.26
  114.232.176.199
  114.233.123.152
  114.233.153.177
@@ -13876,7 +13907,6 @@
  114.235.248.241
  114.235.252.140
  114.235.3.33
-114.235.33.209
  114.235.34.235
  114.235.37.71
  114.235.42.74
@@ -13895,6 +13925,7 @@
  114.236.20.161
  114.236.23.186
  114.237.140.1
+114.237.154.100
  114.238.167.163
  114.238.171.204
  114.238.212.247
@@ -13909,6 +13940,7 @@
  114.239.124.14
  114.239.128.231
  114.239.144.218
+114.239.147.45
  114.239.151.41
  114.239.160.225
  114.239.161.249
@@ -13921,14 +13953,17 @@
  114.239.195.13
  114.239.209.28
  114.239.214.102
-114.239.222.253
+114.239.218.203
+114.239.221.26
+114.239.222.136
  114.239.24.157
  114.239.242.70
  114.239.244.183
  114.239.25.230
  114.239.26.189
-114.239.30.148
  114.239.31.164
+114.239.31.22
+114.239.31.79
  114.239.32.117
  114.239.36.28
  114.239.40.127
@@ -13944,20 +13979,18 @@
  114.239.92.227
  114.239.95.160
  114.239.95.60
+114.24.16.138
  114.24.35.172
  114.24.58.69
  114.242.139.19
  114.242.184.198
-114.242.236.140
  114.242.245.32
  114.244.8.196
  114.245.243.18
  114.246.34.154
-114.247.79.179
  114.247.84.26
  114.249.114.142
  114.249.116.156
-114.249.116.63
  114.25.133.159
  114.27.160.69
  114.27.4.110
@@ -13968,14 +14001,14 @@
  114.30.55.54
  114.31.15.22
  114.31.15.242
+114.31.188.202
  114.31.20.2
  114.31.4.122
  114.31.5.154
  114.32.205.167
-114.32.232.211
  114.32.31.1
  114.32.40.43
-114.32.89.199
+114.33.118.153
  114.33.206.143
  114.34.12.28
  114.34.53.250
@@ -13986,19 +14019,20 @@
  114.35.44.253
  114.36.129.86
  114.36.135.36
+114.36.148.40
  114.36.203.156
  114.37.135.250
  114.37.138.23
-114.37.175.42
  114.37.220.186
  114.4.121.90
  114.4.192.17
  114.4.227.194
  114.4.8.14
-114.4.83.56
  114.4.98.150
+114.40.142.169
  114.40.189.44
  114.41.211.35
+114.42.159.114
  114.44.1.165
  114.45.101.18
  114.47.227.212
@@ -14011,6 +14045,7 @@
  114.5.35.98
  114.5.64.49
  114.5.98.30
+114.55.28.190
  114.57.185.12
  114.57.189.130
  114.6.176.180
@@ -14023,6 +14058,7 @@
  114.6.94.94
  114.67.101.143
  114.67.103.151
+114.67.104.59
  114.67.105.113
  114.67.105.220
  114.67.106.197
@@ -14031,13 +14067,11 @@
  114.67.110.227
  114.67.122.61
  114.67.123.3
+114.67.125.228
  114.67.127.240
  114.67.168.0
  114.67.168.173
-114.67.179.254
  114.67.181.192
-114.67.198.134
-114.67.199.133
  114.67.212.168
  114.67.224.239
  114.67.229.212
@@ -14050,7 +14084,6 @@
  114.67.68.255
  114.67.69.0
  114.67.72.164
-114.67.74.5
  114.67.77.148
  114.67.77.150
  114.67.83.38
@@ -14116,12 +14149,14 @@
  114.7.97.193
  114.73.58.161
  114.79.130.166
+114.79.136.107
  114.79.161.94
  114.79.177.138
  114.80.156.113
  114.80.157.205
  114.80.96.138
  114.84.212.242
+114.84.96.168
  114.86.148.152
  114.87.232.237
  114.88.92.236
@@ -14129,13 +14164,12 @@
  114.93.39.146
  114.95.158.41
  114.95.233.11
-114.97.184.130
+114.97.184.31
+114.97.185.229
  114.98.160.201
  114.98.231.143
  114.98.236.124
  114.99.20.38
-114.99.30.203
-114.99.4.243
  1147.org
  114oldest.com
  115.100.249.238
@@ -14155,23 +14189,24 @@
  115.124.78.54
  115.124.86.169
  115.124.86.250
+115.124.92.162
  115.127.109.2
  115.127.114.76
  115.127.115.226
  115.127.16.89
+115.127.22.26
  115.127.23.165
  115.127.65.66
  115.127.75.18
  115.127.78.138
  115.127.92.179
-115.132.181.245
  115.133.124.151
  115.133.51.36
-115.133.55.73
+115.133.55.242
  115.133.55.95
  115.134.128.90
  115.134.130.53
-115.134.170.85
+115.134.169.68
  115.134.37.191
  115.134.58.173
  115.134.6.141
@@ -14185,7 +14220,10 @@
  115.144.238.94
  115.144.69.105
  115.146.122.237
+115.148.72.10
+115.148.85.155
  115.149.138.108
+115.150.22.117
  115.159.0.160
  115.159.100.145
  115.159.100.189
@@ -14201,7 +14239,6 @@
  115.159.118.68
  115.159.118.95
  115.159.120.142
-115.159.120.232
  115.159.123.146
  115.159.124.199
  115.159.126.211
@@ -14221,7 +14258,6 @@
  115.159.191.199
  115.159.194.90
  115.159.195.53
-115.159.197.21
  115.159.197.34
  115.159.199.238
  115.159.200.183
@@ -14232,6 +14268,7 @@
  115.159.209.172
  115.159.209.204
  115.159.212.230
+115.159.212.30
  115.159.213.101
  115.159.213.195
  115.159.214.208
@@ -14266,15 +14303,14 @@
  115.159.83.182
  115.159.85.147
  115.159.90.137
-115.159.90.184
-115.159.92.26
  115.159.95.57
  115.159.98.28
  115.159.99.113
  115.160.242.62
  115.164.177.119
-115.164.81.211
+115.164.85.34
  115.166.128.230
+115.166.18.149
  115.167.65.238
  115.171.156.25
  115.171.238.79
@@ -14284,8 +14320,8 @@
  115.178.49.238
  115.178.98.62
  115.182.105.68
+115.186.131.66
  115.186.173.154
-115.187.43.71
  115.187.45.172
  115.187.49.175
  115.187.54.219
@@ -14294,63 +14330,60 @@
  115.197.173.196
  115.197.83.141
  115.198.87.233
-115.201.123.145
  115.201.37.74
  115.201.42.185
  115.201.47.10
  115.202.237.182
  115.206.40.187
  115.206.60.63
-115.207.142.108
-115.207.158.28
-115.207.173.29
-115.207.175.181
-115.207.179.69
-115.207.181.164
+115.207.176.133
+115.207.182.224
  115.207.199.11
-115.207.30.221
  115.207.9.109
  115.208.117.143
  115.208.126.111
  115.208.134.3
+115.208.153.60
  115.208.192.204
  115.208.50.106
  115.208.86.253
  115.209.109.60
  115.209.48.36
+115.21.13.85
  115.21.206.36
  115.21.224.117
-115.213.199.79
  115.216.26.149
+115.217.158.37
  115.218.114.16
  115.219.2.133
-115.22.205.100
  115.22.82.128
  115.220.162.225
  115.220.4.84
  115.220.59.32
  115.221.11.39
-115.221.15.179
+115.224.145.237
  115.224.88.245
  115.225.205.198
  115.227.174.238
+115.227.193.70
  115.227.8.31
  115.229.249.129
  115.23.196.182
+115.230.127.179
  115.230.23.133
+115.230.43.206
  115.231.0.56
  115.231.175.80
  115.231.179.94
+115.231.234.6
  115.231.67.2
  115.231.96.152
  115.233.210.218
  115.236.100.36
-115.236.119.139
  115.236.182.186
  115.236.185.227
  115.236.52.122
  115.236.67.42
-115.236.8.253
  115.236.89.211
  115.238.146.107
  115.238.247.228
@@ -14363,99 +14396,92 @@
  115.239.226.46
  115.239.227.106
  115.239.77.55
-115.239.78.237
-115.239.79.207
  115.241.1.66
-115.243.116.202
  115.243.35.3
  115.243.35.98
-115.249.31.3
+115.28.128.14
  115.28.241.52
+115.29.246.243
  115.29.5.41
  115.29.7.25
  115.38.178.51
  115.4.56.5
+115.41.17.228
  115.42.127.133
  115.42.151.75
  115.42.32.106
  115.42.47.36
+115.42.64.147
  115.42.64.21
-115.42.67.139
  115.45.104.103
  115.46.156.215
  115.47.53.34
  115.48.137.170
-115.48.149.237
-115.48.200.43
-115.48.214.220
+115.48.161.178
+115.48.203.238
+115.48.206.211
  115.48.46.61
+115.48.98.117
  115.49.125.184
  115.49.17.10
-115.49.197.155
  115.49.210.221
  115.49.215.114
+115.49.22.56
  115.49.227.139
+115.49.254.38
+115.49.36.24
  115.49.37.204bin.sh
  115.49.44.187
+115.49.45.8
+115.49.59.137
  115.49.72.68
  115.49.75.103
  115.49.78.108
-115.49.90.245
-115.49.92.158
+115.49.92.114
  115.49.96.91
  115.49.97.55
  115.50.0.131
-115.50.102.231
-115.50.154.113
  115.50.155.106
  115.50.158.179
-115.50.16.8
-115.50.169.17
+115.50.161.139
+115.50.186.132
  115.50.187.9
-115.50.188.38
  115.50.2.126
-115.50.203.100
-115.50.204.201
  115.50.21.84
  115.50.219.28
  115.50.247.130
+115.50.39.206
+115.50.51.101
  115.50.56.92
-115.50.57.255
  115.50.60.125
-115.50.63.88
-115.50.92.156
+115.50.7.143
+115.50.7.220
  115.51.110.122
  115.51.111.224
-115.51.122.197
  115.51.30.213
  115.51.47.80
  115.52.12.28
-115.52.151.107
-115.52.19.207
-115.52.22.177
-115.52.234.121
+115.52.161.101
+115.52.238.186
  115.52.247.168
  115.52.247.21
+115.52.57.140
  115.52.58.160
  115.53.224.100
-115.53.252.235
-115.53.252.245
-115.53.30.209
-115.54.128.36
+115.53.228.157
  115.54.129.10
+115.54.158.67
+115.54.169.21
  115.54.183.113
-115.54.206.108
  115.54.214.163
-115.54.221.214
-115.54.71.108
-115.54.73.16
-115.55.106.18
+115.54.233.128
+115.55.107.118
+115.55.120.113
  115.55.130.195
  115.55.130.55
  115.55.131.30
  115.55.144.195
  115.55.145.253
-115.55.146.244
  115.55.146.3
  115.55.146.7
  115.55.148.117
@@ -14467,75 +14493,68 @@
  115.55.153.243
  115.55.153.83
  115.55.154.201
-115.55.154.206
-115.55.154.94
  115.55.156.198
  115.55.156.206
  115.55.157.2
+115.55.158.129
  115.55.158.52bin.sh
  115.55.159.46
  115.55.159.76
  115.55.161.184
-115.55.169.219
  115.55.176.134
  115.55.178.74
+115.55.182.75
+115.55.190.237
  115.55.202.175
-115.55.207.161
  115.55.208.186
-115.55.223.216
-115.55.30.151
-115.55.30.89
  115.55.32.190
  115.55.41.246
-115.55.5.150
-115.55.57.178
-115.55.61.111
-115.55.7.241
-115.55.77.92
+115.55.58.156
+115.55.74.218
  115.55.90.41
-115.56.111.136
+115.55.93.203
  115.56.114.233
+115.56.119.248
+115.56.119.84
  115.56.128.20
  115.56.128.237
  115.56.129.141
-115.56.130.219
  115.56.130.85
  115.56.131.111
  115.56.131.72
  115.56.132.235
  115.56.133.125
-115.56.134.211
  115.56.135.103bin.sh
  115.56.135.247
-115.56.136.236
  115.56.136.33
  115.56.137.47
  115.56.140.64
  115.56.142.123
  115.56.143.125
  115.56.143.13
-115.56.143.17
  115.56.143.29
  115.56.144.209
  115.56.144.96
  115.56.146.213
  115.56.147.73
+115.56.149.154
+115.56.149.32
+115.56.150.200
  115.56.153.210bin.sh
  115.56.154.102
  115.56.156.136
-115.56.159.117
  115.56.161.84
+115.56.178.204
  115.56.181.129
  115.56.181.237
  115.56.182.87
-115.56.183.70
-115.56.186.238
-115.56.189.103
  115.56.189.174
  115.56.218.72
  115.56.24.68
  115.56.25.144
  115.56.26.199
+115.56.26.92
+115.56.56.195
  115.58.132.230
  115.58.132.6
  115.58.132.92
@@ -14545,69 +14564,58 @@
  115.58.135.221
  115.58.135.244
  115.58.141.145
+115.58.155.16
  115.58.2.34
  115.58.209.70
-115.58.68.251
-115.58.85.61
-115.58.95.77
-115.59.17.202
+115.58.52.131
+115.58.69.118
+115.58.74.163
+115.59.19.205
  115.59.196.45
  115.59.199.35
  115.59.230.79
  115.59.232.120
-115.59.254.138
+115.59.236.126
  115.59.255.40
-115.59.32.112
  115.59.76.195
  115.59.82.114
  115.59.98.117
  115.60.201.21
  115.60.59.155
-115.60.59.215
  115.61.10.132
  115.61.102.167
-115.61.103.46
-115.61.108.32
+115.61.103.170
  115.61.109.200
-115.61.112.194
  115.61.112.47
-115.61.113.46
  115.61.121.109
  115.61.137.57
-115.61.138.110
-115.61.138.235
-115.61.139.226
  115.61.144.220
  115.61.160.47
  115.61.160.58
+115.61.169.203
+115.61.174.201
  115.61.182.102
  115.61.191.115
  115.61.196.189
-115.61.51.198
+115.61.208.70
+115.61.54.172
  115.61.96.164
  115.61.98.191
+115.61.99.37
  115.62.134.206
  115.62.144.135
  115.62.146.169
-115.62.15.15
-115.62.187.245
-115.62.190.115
-115.63.115.67
  115.63.139.114
-115.63.15.99
  115.63.186.148
  115.63.189.176
  115.63.19.124
-115.63.190.150
  115.63.202.136
  115.63.32.88
-115.63.58.93
  115.64.149.213
  115.66.180.253
  115.68.109.9
  115.68.177.78
  115.68.182.197
-115.68.190.124
  115.68.2.144
  115.68.232.221
  115.68.232.45
@@ -14633,6 +14641,7 @@
  115.72.135.152
  115.72.76.211
  115.72.80.127
+115.73.14.102
  115.73.208.10
  115.73.213.182
  115.73.213.31
@@ -14640,28 +14649,31 @@
  115.73.247.23
  115.74.217.2
  115.75.1.184
+115.75.153.9
  115.75.181.168
  115.75.34.141
+115.75.74.230
  115.75.88.125
  115.76.0.113
  115.76.164.206
  115.76.164.44
  115.76.165.53
  115.76.168.68
-115.76.171.198
  115.76.173.114
  115.76.175.18
  115.76.175.191
  115.76.2.249
+115.76.4.82
+115.76.5.142
  115.77.188.21
-115.77.191.180
  115.77.83.196
  115.78.1.222
+115.78.113.218
  115.78.126.92
+115.78.14.240
  115.78.161.106
  115.78.232.202
  115.78.4.219
-115.78.6.102
  115.78.9.145
  115.78.9.72
  115.78.95.253
@@ -14673,12 +14685,12 @@
  115.79.220.47
  115.79.35.110
  115.84.101.78
+115.84.112.138
  115.84.114.165
-115.84.117.222
-115.84.117.223
  115.84.121.30
  115.84.178.112
  115.84.235.77
+115.84.91.130
  115.84.91.215
  115.84.92.149
  115.84.92.214
@@ -14697,6 +14709,7 @@
  115.91.83.42
  115.92.118.52
  115.92.174.231
+115.93.131.228
  115.93.146.76
  115.93.207.110
  115.94.177.99
@@ -14706,9 +14719,9 @@
  115.96.135.5
  115.97.248.20
  115.97.31.199
+115.97.76.103
  115.97.83.137
  115.98.0.71
-115.98.154.223
  115.98.71.54
  115.99.115.105
  115.99.14.202
@@ -14728,6 +14741,7 @@
  116.1.180.22
  116.100.121.12
  116.101.231.124
+116.102.127.203
  116.103.210.14
  116.104.170.25
  116.105.193.90
@@ -14736,6 +14750,7 @@
  116.105.213.108
  116.105.213.232
  116.105.219.109
+116.105.220.54
  116.105.222.117
  116.106.16.127
  116.106.16.132
@@ -14746,27 +14761,24 @@
  116.106.18.196
  116.106.18.91
  116.106.19.247
-116.106.31.187
-116.107.138.161
-116.107.97.147
+116.107.20.159
  116.109.180.175
  116.11.106.5
-116.110.100.208
  116.110.100.55
  116.110.102.160
  116.110.112.187
+116.110.112.211
  116.110.114.123
  116.110.12.79
  116.110.124.48
-116.110.144.205
-116.110.208.254
-116.110.208.64
+116.110.159.126
  116.110.27.235
  116.110.31.51
  116.110.53.202
  116.110.6.2
  116.110.61.23
  116.110.65.12
+116.110.66.221
  116.110.73.86
  116.110.82.221
  116.110.89.13
@@ -14781,7 +14793,6 @@
  116.113.182.206
  116.114.19.204
  116.114.19.211
-116.114.30.62
  116.114.84.122
  116.114.95.100
  116.114.95.104
@@ -14844,13 +14855,13 @@
  116.12.52.141
  116.12.52.79
  116.120.108.26
-116.120.42.6
  116.121.119.103
  116.121.160.69
  116.122.157.168
  116.122.158.207
  116.122.36.61
  116.122.38.203
+116.123.108.169
  116.124.233.101
  116.125.120.88
  116.125.124.226
@@ -14859,19 +14870,13 @@
  116.126.85.123
  116.127.121.116
  116.127.121.39
-116.131.166.26
  116.131.212.180
  116.131.229.100
  116.132.47.50
-116.138.1.171
-116.14.251.43
+116.139.115.115
  116.14.56.127
  116.14.61.160
  116.140.77.152
-116.140.78.24
-116.140.78.245
-116.140.79.238
-116.140.79.52
  116.149.119.209
  116.149.195.56bin.sh
  116.149.201.215bin.sh
@@ -14882,12 +14887,8 @@
  116.149.243.161
  116.149.247.125
  116.149.247.146
-116.15.189.70
  116.15.5.204
  116.154.20.15
-116.16.13.70
-116.17.102.20
-116.17.102.29
  116.177.178.206
  116.177.179.202
  116.177.179.85
@@ -14898,9 +14899,7 @@
  116.179.130.137
  116.179.139.142
  116.179.149.121
-116.179.158.253
-116.179.32.102
-116.179.32.235
+116.179.32.208
  116.193.172.237
  116.193.216.209
  116.193.218.18
@@ -14923,6 +14922,7 @@
  116.197.133.146
  116.197.134.146
  116.197.134.197
+116.197.135.132
  116.198.160.39
  116.198.162.103
  116.198.162.181
@@ -14936,8 +14936,6 @@
  116.199.172.29
  116.199.174.1
  116.199.181.240
-116.199.63.218
-116.2.112.157
  116.2.241.81
  116.2.64.96
  116.202.0.237
@@ -14977,7 +14975,6 @@
  116.203.128.117
  116.203.143.6
  116.203.147.190
-116.203.147.199
  116.203.151.175
  116.203.152.66
  116.203.185.207
@@ -14988,14 +14985,11 @@
  116.203.221.74
  116.203.23.252
  116.203.230.250
-116.203.232.229
-116.203.243.102
  116.203.244.83
  116.203.249.151
  116.203.25.244
  116.203.29.242
  116.203.32.252
-116.203.35.250
  116.203.42.21
  116.203.47.157
  116.203.60.216
@@ -15003,6 +14997,7 @@
  116.203.75.230
  116.203.76.235
  116.203.92.131
+116.206.105.72
  116.206.177.50
  116.206.196.86
  116.206.233.10
@@ -15019,30 +15014,38 @@
  116.206.61.225
  116.206.61.33
  116.206.94.73
+116.206.99.10
+116.206.99.11
+116.206.99.12
+116.206.99.13
+116.206.99.14
+116.206.99.15
  116.207.197.74
  116.212.131.174
+116.212.131.58
  116.212.152.30
  116.212.66.214
  116.213.43.190
  116.213.52.200
  116.213.52.252
  116.213.52.253
-116.22.29.128
+116.22.253.254
+116.22.28.28
+116.22.29.178
  116.22.29.99
-116.22.30.154
  116.22.30.159
  116.22.31.77
  116.22.48.126
  116.22.48.128
  116.22.48.207
  116.22.48.233
+116.22.48.247
  116.22.51.163
-116.22.75.89
  116.228.114.182
  116.228.196.210
  116.228.233.91
  116.228.53.227
-116.23.16.11
+116.23.16.225
  116.232.151.47
  116.232.81.158
  116.233.21.177
@@ -15052,21 +15055,22 @@
  116.236.60.114
  116.236.91.34
  116.237.139.23
+116.237.143.152
  116.237.158.150
  116.238.33.160
  116.239.27.145
  116.239.4.130
+116.24.33.139
  116.24.64.23
  116.24.64.54
-116.24.66.254
-116.24.66.61
  116.24.66.75
+116.24.82.168
  116.240.144.112
  116.240.199.84
  116.246.20.2
  116.247.81.99
-116.249.11.248
  116.250.203.111
+116.251.12.150
  116.251.211.12
  116.252.80.181
  116.254.100.165
@@ -15080,29 +15084,32 @@
  116.255.254.41
  116.26.113.138
  116.26.114.6
-116.26.32.100
  116.3.198.40
+116.30.123.203
  116.4.11.9
-116.4.9.237
  116.43.244.112
+116.44.137.24
  116.48.136.128
+116.49.116.174
+116.49.123.63
+116.49.197.45
  116.49.215.98
  116.52.1.211
  116.52.9.220
  116.55.245.26
+116.55.44.87
+116.58.171.67
  116.58.224.56
  116.58.226.38
  116.58.227.10
  116.58.227.200
  116.58.227.236
  116.58.227.40
-116.58.227.80
  116.58.232.126
  116.58.232.177
  116.58.232.2
  116.58.232.200
  116.58.232.207
-116.58.232.21
  116.58.232.234
  116.58.232.51
  116.58.233.29
@@ -15110,8 +15117,6 @@
  116.58.235.18
  116.58.235.69
  116.58.236.161
-116.58.236.185
-116.58.240.179
  116.58.245.76
  116.58.247.119
  116.58.247.120
@@ -15119,13 +15124,14 @@
  116.58.247.148
  116.58.247.158
  116.58.247.168
-116.58.247.198
  116.58.247.207
  116.58.247.225
+116.58.247.33
  116.58.247.39
  116.58.247.44
  116.58.247.91
  116.58.251.162
+116.58.251.30
  116.58.251.85
  116.58.254.9
  116.58.43.35
@@ -15139,17 +15145,15 @@
  116.6.107.172
  116.6.18.115
  116.6.77.98
+116.62.102.247
  116.62.11.138
  116.62.124.123
-116.62.133.112
  116.62.216.238
-116.62.226.124
  116.62.229.19
  116.66.191.161
  116.66.191.217
  116.66.197.148
  116.66.197.210
-116.66.198.228
  116.66.207.53
  116.68.157.112
  116.68.160.114
@@ -15158,14 +15162,15 @@
  116.68.162.99
  116.68.194.61
  116.68.196.209
+116.68.202.221
  116.68.207.233
+116.68.96.123
  116.68.96.130
  116.68.96.140
  116.68.96.224
  116.68.96.233
  116.68.96.6
  116.68.96.90
-116.68.97.102
  116.68.97.13
  116.68.97.171
  116.68.97.172
@@ -15179,50 +15184,51 @@
  116.68.98.80
  116.68.98.81
  116.68.98.91
+116.68.99.167
  116.68.99.187
  116.68.99.51
  116.68.99.65
  116.68.99.73
  116.71.243.172
  116.72.0.99
-116.72.200.214
  116.73.4.196
  116.73.66.179
  116.74.112.79
  116.74.17.255
  116.74.223.188
+116.74.46.176
  116.75.103.58
  116.75.117.40bin.sh
-116.75.193.16
+116.75.193.228
+116.75.194.194
  116.75.34.61
  116.84.123.12
  116.85.26.21
  116.85.44.231
  116.85.46.54
-116.85.65.68
  116.85.66.176
  116.85.70.114
  116.85.71.133
  116.85.9.223
+116.86.30.42
  116.89.71.215
  116.90.118.1
  116.90.122.234
  116.90.165.26
  116.90.229.186
-116.90.238.251
  116.90.59.223
-116.90.74.204
  116.91.189.208
  116.91.240.96
  116.92.204.39
  116.92.213.114
  116.92.219.162
+116.92.222.38
  116.94.131.109
+116.96.79.17
  116.98.122.120
-116.98.160.226
  116.98.160.4
-116.98.162.85
  116.98.167.218
+116.98.168.60
  116.98.169.189
  116.98.170.70
  116.98.175.85
@@ -15232,7 +15238,7 @@
  1169732-dot-phonic-obelisk-274214.uk.r.appspot.com
  117.0.23.142
  117.1.16.131
-117.10.37.127
+117.1.45.57
  117.102.102.155
  117.102.104.44
  117.102.107.154
@@ -15246,6 +15252,7 @@
  117.102.127.130
  117.102.16.22
  117.102.224.38
+117.102.76.234
  117.102.77.2
  117.102.77.204
  117.102.82.42
@@ -15267,13 +15274,12 @@
  117.114.3.15
  117.117.165.131
  117.119.100.82
+117.12.100.153
  117.12.104.94
  117.12.190.36
-117.12.57.212
  117.120.7.93
  117.121.202.44
  117.121.204.80
-117.121.211.170
  117.121.215.101
  117.123.171.105
  117.127.16.205
@@ -15296,9 +15302,15 @@
  117.14.21.88
  117.141.155.241
  117.144.189.69
+117.146.123.138
+117.146.123.142
+117.146.123.165
+117.146.123.168
  117.146.174.210
+117.146.52.245
  117.149.10.58
  117.149.20.18
+117.15.6.213
  117.15.94.229
  117.156.119.39
  117.156.69.22
@@ -15306,10 +15318,9 @@
  117.158.107.107
  117.158.151.7
  117.158.208.67
-117.158.214.101
+117.158.208.68
  117.158.65.219
  117.158.87.112
-117.160.220.44
  117.161.25.180
  117.169.1.47
  117.169.16.205
@@ -15318,39 +15329,28 @@
  117.172.79.4
  117.173.67.119
  117.174.24.18
-117.176.183.4
  117.177.38.31
-117.177.76.241
  117.18.4.157
  117.18.5.133
  117.184.169.94
  117.186.244.210
  117.186.96.54
-117.192.224.236
  117.192.225.46
+117.192.225.72
  117.192.36.113
-117.192.42.33
  117.192.46.40
  117.192.48.104
  117.192.8.86
-117.193.34.20
-117.194.148.86
-117.194.151.208
-117.194.160.170
-117.194.160.59
-117.194.162.125
-117.194.162.188
-117.194.163.120
-117.194.163.210
-117.194.164.142
-117.194.164.26
-117.194.165.101
+117.194.148.236
+117.194.160.162
+117.194.160.214
+117.194.161.6
  117.194.165.160
-117.194.240.41
+117.194.167.47
+117.194.215.137
  117.195.240.9
  117.195.48.137
  117.195.57.109
-117.195.63.176
  117.196.197.61
  117.196.232.240
  117.196.233.137
@@ -15366,11 +15366,12 @@
  117.197.127.98
  117.197.40.192
  117.197.49.18
-117.197.53.8
  117.197.61.161
  117.197.61.203
  117.198.218.70
+117.198.78.55
  117.198.97.220
+117.199.198.168
  117.199.47.146
  117.2.120.221
  117.2.127.47
@@ -15378,6 +15379,7 @@
  117.2.139.117
  117.2.165.12
  117.2.165.159
+117.2.22.117
  117.2.22.85
  117.2.43.225
  117.20.192.45
@@ -15387,32 +15389,43 @@
  117.20.207.53
  117.20.230.39
  117.20.56.203
+117.20.67.254
  117.200.48.70
  117.200.48.82
  117.200.48.94
  117.202.20.66
  117.202.20.68
  117.202.20.70
+117.202.64.18
+117.202.65.162
+117.202.67.4
+117.202.68.100
+117.202.68.31
  117.202.68.39
-117.202.68.45
+117.202.69.12
+117.202.69.121
+117.202.69.98
+117.202.70.201
  117.202.8.55
  117.202.98.248
  117.203.209.137
  117.203.211.248
  117.204.254.14
  117.204.254.153
+117.204.254.44
  117.204.254.94
-117.204.87.142
  117.206.149.225
  117.206.155.158
  117.206.155.82
  117.206.159.20
  117.206.83.142
  117.206.83.218
-117.208.135.0
-117.208.148.72
+117.207.49.108
+117.208.1.242
+117.208.132.46
+117.208.133.158
+117.208.134.114
  117.210.149.169
-117.210.203.54
  117.210.208.167
  117.210.208.5
  117.210.212.63
@@ -15422,76 +15435,67 @@
  117.211.147.57
  117.211.166.168
  117.211.192.70
-117.211.74.2
  117.212.146.114
  117.212.193.62
-117.212.193.72
-117.212.194.20
  117.212.89.50
  117.212.93.78
-117.213.41.200
-117.213.43.121
-117.213.45.12
+117.213.40.183
+117.213.42.178
+117.213.42.244
+117.213.47.59
  117.214.123.217
-117.215.131.139
-117.215.209.87
-117.215.212.186
-117.215.213.38
-117.215.213.9
-117.215.215.197
+117.215.209.25
+117.215.210.25
+117.215.213.139
  117.215.222.132
  117.215.224.138
  117.215.241.111
  117.215.241.135
-117.215.251.76
+117.215.249.255
  117.215.71.67
  117.215.75.97
-117.215.8.135
  117.218.245.194
  117.220.15.119
  117.220.171.105
  117.220.171.209
-117.220.202.244
-117.220.211.4
-117.220.62.206
  117.220.8.95
  117.221.69.37
-117.222.161.146
-117.222.161.183
+117.222.119.98
+117.222.161.206
  117.222.161.243
-117.222.162.27
-117.222.164.234
  117.222.165.141
-117.222.167.57
+117.222.165.197
+117.222.165.218
+117.222.165.34
+117.222.166.228
  117.222.168.70
-117.222.171.130
-117.222.172.9
-117.222.173.39
+117.222.170.255
+117.222.171.165
+117.222.173.222
+117.222.173.58
+117.222.174.153
+117.222.174.244
+117.222.175.204
+117.222.175.254
  117.222.55.78
  117.222.58.155
  117.222.62.16
-117.222.62.168
-117.223.126.120
  117.223.136.107
-117.223.36.158
  117.232.113.131
-117.232.127.51
  117.232.96.204
-117.233.99.177
  117.236.225.1
-117.236.225.3
  117.236.225.4
-117.236.225.5
-117.236.225.6
-117.236.225.7
  117.236.225.8
-117.239.133.2
  117.239.153.219
  117.239.163.82
  117.239.209.24
+117.239.226.81
+117.239.226.85
  117.239.240.202
  117.239.39.51
+117.239.73.41
  117.239.78.204
+117.239.83.193
  117.24.6.118
  117.240.16.90
  117.240.173.73
@@ -15499,7 +15503,8 @@
  117.240.28.81
  117.240.59.115
  117.241.249.93
-117.242.122.186
+117.241.64.8
+117.242.111.174
  117.242.147.101
  117.242.147.109
  117.242.147.5
@@ -15509,35 +15514,39 @@
  117.242.188.82
  117.242.188.84
  117.242.188.86
-117.242.208.25
+117.242.208.115
+117.242.210.212
+117.242.211.9
  117.242.39.208
  117.247.179.136
-117.247.183.199
  117.247.200.214
-117.247.201.198
-117.247.201.44
-117.247.204.111
+117.247.201.156
+117.247.201.26
+117.247.204.149
+117.247.205.105
+117.247.207.68
  117.247.225.222
  117.247.236.51
  117.247.238.10
  117.247.86.58
  117.247.92.104
-117.247.96.62
-117.248.105.205
+117.248.18.118
  117.248.248.19
-117.248.62.54
+117.248.60.155
  117.25.145.151
+117.25.147.135
  117.25.154.164
  117.25.154.180
  117.25.29.218
-117.251.18.157
-117.251.56.92
+117.251.56.108
+117.251.58.37
+117.251.61.246
  117.251.63.215
  117.252.216.178
+117.252.217.152
  117.252.217.55
  117.252.219.48
-117.252.25.171
-117.252.64.50
+117.252.223.126
  117.252.65.12
  117.252.66.33
  117.252.67.124
@@ -15556,10 +15565,8 @@
  117.26.125.6
  117.26.179.26
  117.26.241.93
-117.26.41.209
  117.26.76.189
  117.26.88.25
-117.27.10.3
  117.27.147.135
  117.27.88.61
  117.28.25.50
@@ -15567,12 +15574,11 @@
  117.30.173.194
  117.33.128.218
  117.33.225.111
-117.33.31.202
  117.34.117.155
-117.34.205.218
  117.34.99.31
  117.35.118.42
  117.37.89.23
+117.39.63.46
  117.4.107.199
  117.4.113.14
  117.4.136.11
@@ -15580,20 +15586,20 @@
  117.4.145.16
  117.4.240.100
  117.4.241.135
-117.4.51.103
+117.41.38.16
  117.42.141.192
  117.42.29.2
  117.44.60.0
  117.48.195.2
  117.48.234.141
  117.5.136.85
-117.5.147.79
  117.5.154.222
  117.50.1.141
  117.50.1.221
  117.50.10.244
  117.50.11.185
  117.50.110.19
+117.50.118.171
  117.50.119.23
  117.50.137.13
  117.50.14.153
@@ -15610,8 +15616,10 @@
  117.50.3.120
  117.50.31.176
  117.50.34.131
+117.50.35.29
  117.50.36.137
  117.50.38.138
+117.50.39.62
  117.50.4.106
  117.50.4.73
  117.50.42.222
@@ -15631,6 +15639,8 @@
  117.50.65.68
  117.50.82.156
  117.50.82.6
+117.50.84.153
+117.50.84.176
  117.50.88.9
  117.50.9.112
  117.50.90.120
@@ -15649,15 +15659,12 @@
  117.51.150.202
  117.51.154.192
  117.51.157.210
-117.51.158.223
  117.52.91.248
-117.52.96.99
  117.53.45.125
  117.54.112.22
  117.54.12.99
  117.54.13.174
  117.54.130.66
-117.54.138.141
  117.54.200.134
  117.54.200.186
  117.54.234.36
@@ -15668,7 +15675,6 @@
  117.55.209.126
  117.55.232.193
  117.55.241.179
-117.55.241.61
  117.55.250.58
  117.58.240.177
  117.58.245.114
@@ -15681,13 +15687,13 @@
  117.6.240.170
  117.6.79.105
  117.6.86.134
+117.60.187.201
  117.60.204.195
  117.60.239.70
  117.60.25.22
  117.60.8.16
  117.60.8.52
  117.60.8.70
-117.62.173.248
  117.63.156.234
  117.63.158.101
  117.63.159.220
@@ -15700,45 +15706,45 @@
  117.63.51.128
  117.64.146.163
  117.64.147.99
-117.64.224.41
+117.64.224.13
+117.64.224.163
+117.64.224.175
  117.64.224.95
+117.64.225.221
  117.64.225.71
-117.64.235.152
-117.64.236.191
-117.64.236.237
+117.64.235.24
+117.64.235.95
+117.64.236.186
  117.67.150.128
  117.67.150.227
  117.67.151.140
+117.67.151.148
  117.67.151.28
-117.68.192.181
-117.68.192.3
+117.67.184.61
+117.67.185.113
+117.67.185.40
+117.68.192.235
  117.68.192.94
-117.68.192.99
-117.68.193.230
+117.68.193.247
  117.68.193.49
  117.68.194.117
  117.68.194.173
-117.68.195.111
  117.68.195.125
-117.68.195.179
+117.68.195.152
  117.68.195.246
  117.68.195.73
  117.69.187.204
-117.69.30.163
-117.69.30.18
-117.69.30.58
-117.69.31.219
-117.69.46.192
+117.69.31.22
  117.69.46.227
-117.69.46.42
+117.69.47.34
  117.7.108.204
  117.7.236.110
  117.7.37.238
  117.70.38.81
+117.71.141.252
  117.71.158.108
-117.71.50.240
+117.71.159.250
  117.71.59.108
-117.71.59.22
  117.74.120.224
  117.74.121.65
  117.74.122.114
@@ -15754,31 +15760,24 @@
  117.80.116.213
  117.80.119.63
  117.80.147.217
+117.80.212.113
  117.80.224.192
  117.80.225.245
  117.80.3.170
  117.80.3.240
-117.81.139.173
-117.81.154.162
-117.81.189.140
  117.81.242.138
  117.82.37.85
  117.82.70.22
-117.83.122.195
  117.83.196.25
-117.83.81.49
  117.83.83.235
-117.84.114.30
-117.84.114.69
+117.84.112.201
  117.84.146.251
  117.84.173.184
-117.84.91.227
-117.85.58.78
-117.85.59.225
+117.84.58.110
+117.84.91.58
  117.85.89.213
  117.86.212.189
  117.86.24.209
-117.86.27.180
  117.87.128.157
  117.87.128.8
  117.87.131.167
@@ -15792,7 +15791,6 @@
  117.87.171.157
  117.87.208.98
  117.87.209.179
-117.87.209.224
  117.87.225.69
  117.87.239.145
  117.87.239.200
@@ -15803,7 +15801,9 @@
  117.87.64.134
  117.87.72.142
  117.88.151.152
+117.88.162.189
  117.88.173.4
+117.89.52.69
  117.89.90.62
  117.90.0.223
  117.90.119.186
@@ -15814,13 +15814,13 @@
  117.90.20.196
  117.90.21.59
  117.90.254.53
-117.90.5.57
  117.90.75.236
  117.90.89.195
  117.90.89.95
  117.90.94.211
  117.92.45.234
  117.93.114.188
+117.93.115.109
  117.93.118.225
  117.93.118.65
  117.93.133.110
@@ -15831,7 +15831,6 @@
  117.93.193.132
  117.93.216.98
  117.93.47.6
-117.94.158.219
  117.94.174.64
  117.94.28.136
  117.94.50.123
@@ -15852,22 +15851,26 @@
  117.95.227.119
  117.95.227.50
  117.95.231.99
+117.95.232.210
  117.95.233.139
  117.95.235.160
  117.95.24.73
  117.95.32.19
  117.95.83.122
  117.98.190.242
-117.98.209.104
+117.98.212.71
  117.ip-51-178-82.eu
  11716-45741.ws4.pph-server.de
  1171j.projectsbit.org
  1177857-dot-n-e-w-me-ss-age-po-rt-al.wl.r.appspot.com
  117cbf81fba6f4aaa4363ed99db7fce674427f2d.info
+118.1.177.30
+118.100.127.116
  118.100.134.71
  118.100.156.200
  118.100.180.16
  118.100.183.120
+118.101.146.138
  118.101.192.62
  118.101.192.81
  118.102.168.199
@@ -15877,17 +15880,16 @@
  118.107.14.5
  118.107.162.36
  118.110.236.121
-118.113.95.60
+118.116.8.215
  118.120.145.eliterv.ca
  118.121.57.64
  118.121.61.158
  118.122.118.189
-118.122.124.78
  118.122.168.205
  118.122.38.61
  118.122.73.137
-118.122.77.22
  118.122.91.148
+118.123.19.159
  118.123.19.69
  118.123.244.100
  118.123.246.101
@@ -15911,8 +15913,6 @@
  118.129.167.63
  118.131.21.125
  118.131.36.38
-118.136.156.41
-118.136.22.219
  118.136.221.159
  118.137.216.92
  118.139.178.67
@@ -15930,19 +15930,20 @@
  118.161.91.197
  118.163.120.179
  118.163.120.181
+118.163.122.208
  118.163.13.200
  118.163.47.37
  118.163.74.160
-118.163.74.161
  118.163.80.67
  118.163.91.125
  118.163.97.19
-118.165.1.216
  118.168.111.60
  118.169.40.146
  118.169.44.151
  118.169.80.36
  118.17.46.169
+118.170.206.26
+118.171.88.183
  118.172.106.74
  118.172.113.121
  118.172.113.228
@@ -15960,9 +15961,12 @@
  118.172.201.32
  118.172.201.49
  118.172.201.5
+118.172.201.80
  118.172.201.89
+118.172.212.102
  118.172.217.42
  118.172.224.55
+118.172.228.13
  118.172.228.150
  118.172.228.31
  118.172.44.84
@@ -15970,13 +15974,11 @@
  118.172.51.84
  118.172.97.120
  118.172.97.208
-118.173.0.176
  118.173.108.229
+118.173.118.216
  118.173.128.127
-118.173.128.183
  118.173.128.203
  118.173.128.75
-118.173.129.167
  118.173.132.115
  118.173.132.166
  118.173.144.38
@@ -15984,8 +15986,6 @@
  118.173.153.117
  118.173.154.223
  118.173.166.81
-118.173.17.71
-118.173.175.120
  118.173.175.85
  118.173.197.241
  118.173.221.84
@@ -16054,6 +16054,8 @@
  118.174.65.251
  118.174.70.234
  118.174.87.238
+118.175.174.238
+118.175.207.180
  118.175.207.205
  118.175.207.84
  118.175.228.153
@@ -16061,6 +16063,7 @@
  118.175.236.208
  118.175.244.111
  118.175.7.114
+118.175.91.152
  118.175.93.103
  118.175.93.112
  118.175.93.137
@@ -16076,6 +16079,7 @@
  118.176.157.64
  118.176.238.219
  118.178.143.209
+118.178.20.28
  118.178.235.184
  118.178.88.228
  118.179.116.34
@@ -16085,7 +16089,7 @@
  118.179.173.253
  118.179.200.131
  118.179.208.162
-118.179.40.145
+118.179.208.170
  118.179.55.190
  118.184.13.225
  118.184.13.228
@@ -16097,20 +16101,20 @@
  118.185.130.194
  118.185.131.177
  118.185.159.137
+118.185.196.10
  118.185.38.153
  118.186.227.161
  118.189.139.212
  118.189.172.132
  118.189.187.219
+118.189.20.130
  118.189.74.228
  118.189.84.210
  118.189.9.9
  118.19.126.68
  118.190.154.234
-118.190.24.230
-118.190.52.217
+118.190.2.195
  118.190.60.24
-118.192.101.108
  118.193.151.250
  118.193.151.253
  118.193.151.51
@@ -16136,6 +16140,7 @@
  118.193.41.101
  118.193.41.84
  118.193.45.149
+118.193.45.28
  118.193.46.63
  118.193.47.131
  118.193.58.125
@@ -16161,12 +16166,11 @@
  118.220.255.156
  118.221.200.196
  118.223.5.149bin.sh
+118.232.73.150
  118.233.63.194
  118.233.63.194bin.sh
-118.239.27.12
  118.24.1.9
  118.24.100.198
-118.24.101.35
  118.24.102.189
  118.24.104.38
  118.24.104.55
@@ -16190,15 +16194,14 @@
  118.24.123.136
  118.24.123.34
  118.24.124.59
-118.24.125.81
  118.24.126.55
-118.24.128.112
  118.24.13.153
  118.24.134.15
  118.24.140.195
  118.24.146.186
  118.24.149.248
  118.24.150.193
+118.24.150.71
  118.24.151.254
  118.24.154.33
  118.24.156.184
@@ -16214,6 +16217,7 @@
  118.24.208.24
  118.24.211.170
  118.24.219.30
+118.24.22.5
  118.24.23.164
  118.24.231.93
  118.24.234.79
@@ -16226,12 +16230,12 @@
  118.24.246.251
  118.24.253.100
  118.24.255.210
-118.24.30.97
  118.24.36.247
  118.24.48.15
  118.24.48.244
  118.24.5.125
  118.24.51.199
+118.24.53.35
  118.24.58.155
  118.24.61.61
  118.24.63.50
@@ -16250,12 +16254,11 @@
  118.241.166.23
  118.241.9.15
  118.243.22.87
-118.243.222.122
  118.244.206.195
  118.249.206.100
  118.249.55.90
-118.249.56.206
  118.25.0.193
+118.25.1.118
  118.25.1.48
  118.25.103.195
  118.25.104.200
@@ -16264,6 +16267,7 @@
  118.25.11.8
  118.25.111.131
  118.25.114.195
+118.25.114.48
  118.25.125.187
  118.25.129.131
  118.25.133.121
@@ -16297,7 +16301,6 @@
  118.25.27.67
  118.25.3.65
  118.25.35.202
-118.25.39.110
  118.25.44.66
  118.25.47.17
  118.25.48.241
@@ -16309,6 +16312,7 @@
  118.25.62.49
  118.25.63.170
  118.25.64.152
+118.25.65.163
  118.25.69.157
  118.25.74.248
  118.25.79.235
@@ -16320,39 +16324,42 @@
  118.25.99.184
  118.250.0.166
  118.250.49.91
-118.253.80.38
-118.254.9.35
+118.255.176.150
  118.255.57.210
  118.26.37.228
  118.26.37.27
  118.26.65.146
  118.27.1.40
  118.27.103.223
-118.27.105.232
  118.27.106.230
  118.27.109.64
  118.27.11.126
  118.27.110.134
+118.27.111.211
  118.27.112.215
  118.27.113.79
  118.27.14.194
+118.27.14.227
  118.27.15.240
  118.27.19.199
  118.27.19.93
  118.27.19.96
  118.27.20.138
  118.27.21.129
-118.27.22.52
  118.27.23.60
  118.27.25.146
  118.27.25.231
  118.27.28.16
+118.27.28.25
  118.27.28.94
  118.27.29.30
  118.27.31.50
+118.27.33.112
  118.27.35.131
+118.27.37.117
  118.27.39.94
  118.27.4.225
+118.27.6.78
  118.27.72.122
  118.27.72.200
  118.27.72.85
@@ -16388,10 +16395,7 @@
  118.31.5.216
  118.31.52.208
  118.31.58.177
-118.31.59.85
-118.31.71.40
  118.31.74.165
-118.31.78.74
  118.32.210.177
  118.32.210.177bin.sh
  118.32.230.127
@@ -16407,9 +16411,7 @@
  118.36.66.178
  118.36.66.178bin.sh
  118.39.135.11
-118.39.160.46
  118.39.165.115
-118.40.218.99
  118.40.248.20
  118.41.163.105
  118.41.25.54
@@ -16418,18 +16420,20 @@
  118.42.233.90
  118.42.90.135
  118.43.114.17
-118.44.110.43
  118.45.172.5
  118.45.190.163
+118.62.122.103
  118.67.201.40
  118.67.216.238
  118.67.216.94
  118.67.217.41
+118.67.220.133
  118.67.249.115
  118.68.122.205
  118.69.128.181
  118.69.161.51
  118.69.161.67
+118.69.173.199
  118.69.183.237
  118.69.195.215
  118.69.196.93
@@ -16439,10 +16443,10 @@
  118.69.228.63
  118.69.50.154
  118.69.61.212
-118.69.63.217
  118.69.68.186
  118.69.72.155
  118.69.82.233
+118.69.94.70
  118.70.109.152
  118.70.12.171
  118.70.128.102
@@ -16455,7 +16459,6 @@
  118.70.220.116
  118.70.233.163
  118.70.233.206
-118.70.69.117
  118.70.72.103
  118.70.81.207
  118.71.196.154
@@ -16469,14 +16472,16 @@
  118.75.48.151
  118.76.143.108
  118.77.182.5
+118.79.110.212
+118.79.14.30
  118.79.145.227
  118.79.145.69
  118.79.146.100
  118.79.146.190
  118.79.146.212
+118.79.162.20
  118.79.178.248
  118.79.189.39
-118.79.195.201
  118.79.195.91
  118.79.218.111
  118.79.226.198
@@ -16487,7 +16492,6 @@
  118.79.61.232
  118.79.74.237
  118.79.75.183
-118.79.75.35
  118.79.91.199
  118.83.154.64
  118.83.180.76
@@ -16496,6 +16500,7 @@
  118.89.108.37
  118.89.111.225
  118.89.111.49
+118.89.120.110
  118.89.135.215
  118.89.138.117
  118.89.153.180
@@ -16503,6 +16508,7 @@
  118.89.157.234
  118.89.160.141
  118.89.162.187
+118.89.163.105
  118.89.164.55
  118.89.167.33
  118.89.19.73
@@ -16518,6 +16524,7 @@
  118.89.237.20
  118.89.239.113
  118.89.241.214
+118.89.243.51
  118.89.245.202
  118.89.249.96
  118.89.250.93
@@ -16540,6 +16547,7 @@
  118.92.41.104
  118.93.57.249
  118.96.214.134
+118.97.100.83
  118.97.107.65
  118.97.108.18
  118.97.119.130
@@ -16572,37 +16580,38 @@
  118.98.233.226
  118.98.96.184
  118.99.100.109
-118.99.100.2
-118.99.100.60
+118.99.100.144
+118.99.100.61
  118.99.104.153
  118.99.104.26
  118.99.104.29
-118.99.108.59
  118.99.109.120
  118.99.109.14
+118.99.112.10
  118.99.122.125
-118.99.122.153
+118.99.122.152
  118.99.122.230
  118.99.124.222
+118.99.183.235
  118.99.28.130
  118.99.65.164
+118.99.65.166
+118.99.65.170
  118.99.65.174
  118.99.65.179
-118.99.65.190
-118.99.73.142
+118.99.65.182
  118.99.76.21
  118.99.88.107
  118.99.90.130
  118.99.94.11
  118.99.94.133
+118.99.94.150
  118.99.94.82
-118.99.95.12
  118.99.95.27
  118.99.95.80
-118.99.95.82
+118.99.98.117
  118.99.98.123
  118.99.98.55
-118.99.98.81
  118.99.99.223
  118.99.99.38
  1184-ulster-plume.com
@@ -16619,55 +16628,58 @@
  119.102.153.184
  119.108.181.212
  119.108.251.81
+119.108.67.112
  119.108.91.241
  119.109.115.164
  119.11.240.78
  119.110.204.62
  119.110.205.66
  119.110.96.195
+119.115.0.97
  119.115.1.193
-119.115.1.226
  119.115.128.2
  119.115.18.143
+119.115.18.64
  119.115.19.114
-119.115.19.181
+119.115.19.26
  119.115.19.49
  119.115.23.108
-119.115.23.116
-119.115.23.154
  119.115.23.8
-119.115.26.141
-119.115.26.150
-119.115.26.6
-119.115.27.143
-119.115.29.237
-119.115.3.213
+119.115.24.137
+119.115.27.219
+119.115.3.116
  119.115.3.245
-119.115.31.175
-119.115.4.110
+119.115.31.225
+119.115.5.212
  119.115.5.236
-119.115.6.177
-119.115.6.210
  119.115.7.62
  119.117.24.199
+119.117.25.234
  119.117.26.1
-119.117.26.69
  119.117.27.255
-119.117.28.243
-119.117.29.149
-119.117.29.151
-119.117.29.193
+119.117.28.175
+119.117.28.50
+119.117.29.53
+119.117.30.140
+119.119.77.122
+119.122.113.199
  119.123.0.184
+119.123.173.170
+119.123.174.99
+119.123.175.128
  119.123.178.190
-119.123.2.16
+119.123.196.158
+119.123.238.82
  119.123.244.77
  119.125.129.86
  119.126.157.191
  119.128.113.250
  119.130.165.146
  119.130.165.203
-119.131.245.178
+119.130.165.239
  119.135.101.119
+119.136.124.146
+119.136.154.212
  119.136.27.138
  119.146.131.247
  119.147.137.79
@@ -16679,18 +16691,19 @@
  119.148.126.197
  119.148.36.141
  119.149.136.46
+119.15.82.242
  119.15.89.106
  119.15.93.38
  119.15.95.158
-119.155.138.229
  119.155.138.230
+119.155.39.26
  119.155.46.72
  119.156.68.182
  119.157.240.14
  119.157.53.151
  119.159.150.176
  119.160.102.95
-119.160.117.196
+119.160.103.147
  119.160.172.201
  119.160.218.110
  119.160.58.217
@@ -16708,8 +16721,8 @@
  119.164.89.226
  119.165.105.1
  119.165.107.65
+119.165.144.75
  119.165.165.210
-119.165.179.43
  119.165.201.170
  119.165.226.221
  119.165.238.248
@@ -16739,6 +16752,7 @@
  119.167.31.210
  119.167.41.123
  119.167.44.96
+119.167.51.119
  119.17.148.97
  119.17.151.61
  119.176.202.206
@@ -16746,10 +16760,10 @@
  119.178.144.102
  119.178.149.10
  119.178.155.156
-119.178.168.24
  119.178.169.238
  119.178.178.79
  119.178.202.229
+119.178.221.250
  119.178.223.172
  119.178.223.234
  119.178.234.66
@@ -16760,11 +16774,19 @@
  119.179.165.18
  119.179.170.212
  119.179.18.206
-119.179.184.99
-119.179.199.107
+119.179.199.108
  119.179.199.169
+119.179.199.193
+119.179.199.38
+119.179.199.70
+119.179.240.110
  119.179.240.170
  119.179.240.223
+119.179.240.90
+119.179.247.15
+119.179.247.191
+119.179.247.204
+119.179.35.157
  119.18.146.139
  119.18.147.125
  119.18.147.81
@@ -16789,16 +16811,18 @@
  119.18.159.34
  119.18.159.6
  119.18.194.168
-119.18.2.55
  119.18.33.91
  119.18.34.97
  119.18.38.176
  119.18.38.225
+119.18.52.177
  119.180.108.79
  119.180.134.107
+119.180.16.43
  119.180.168.179
+119.180.19.248
  119.180.204.103
-119.180.232.77
+119.180.228.94
  119.180.32.217
  119.180.62.80
  119.180.69.252
@@ -16822,15 +16846,14 @@
  119.185.149.74
  119.185.153.86
  119.185.155.1
-119.185.230.13
  119.185.236.186
  119.185.34.47
  119.185.83.235
  119.186.15.123
  119.186.199.200
  119.186.207.16
+119.186.226.215
  119.186.46.241
-119.187.117.38
  119.187.129.48
  119.187.146.163
  119.187.147.110
@@ -16844,12 +16867,11 @@
  119.187.57.86
  119.187.61.157
  119.187.63.132
-119.187.72.66
-119.187.74.99
-119.187.75.19
+119.187.74.78
+119.187.74.8
  119.187.77.195
  119.188.241.142
-119.188.244.81
+119.188.242.86
  119.188.3.66
  119.189.129.35
  119.189.167.145
@@ -16862,10 +16884,12 @@
  119.190.149.112
  119.190.180.197
  119.190.191.46
+119.190.208.18
  119.190.216.70
  119.190.240.25
  119.190.247.205
  119.190.64.150
+119.191.142.205
  119.191.146.45
  119.191.177.243
  119.191.178.42
@@ -16874,17 +16898,19 @@
  119.191.200.208
  119.191.207.68
  119.191.79.86
+119.192.141.109
  119.193.152.37
  119.193.33.206
+119.194.189.87
  119.194.214.43
  119.194.240.249
  119.194.240.249bin.sh
  119.194.242.212
-119.195.112.131
  119.195.112.73
  119.195.9.174
  119.195.9.174bin.sh
  119.196.115.20
+119.196.147.88
  119.196.216.112
  119.196.216.112bin.sh
  119.196.99.80bin.sh
@@ -16892,8 +16918,8 @@
  119.197.175.60
  119.197.176.105
  119.197.176.241
-119.197.2.158
  119.197.66.173
+119.198.128.138
  119.198.87.162
  119.199.155.17bin.sh
  119.2.122.133
@@ -16906,32 +16932,36 @@
  119.2.7.98
  119.2.88.37
  119.2.9.129
-119.200.120.165
  119.200.186.168
  119.201.68.12
+119.202.191.156
  119.202.191.46
+119.202.209.150
  119.202.76.160
+119.202.86.147
+119.204.110.102
  119.204.96.131
  119.205.95.101
+119.206.165.250
  119.206.255.171
  119.206.5.36
  119.206.62.129
  119.206.62.129bin.sh
  119.207.109.223
  119.207.76.245
+119.224.102.107
  119.226.226.116
  119.226.30.54
  119.23.104.38
  119.23.128.199
  119.23.141.196
-119.23.172.98
  119.23.21.39
+119.23.22.37
  119.23.238.165
-119.23.248.1
  119.23.31.104
-119.23.39.95
  119.235.19.254
  119.235.19.66
+119.235.22.3
  119.235.27.130
  119.235.27.46
  119.235.48.177
@@ -16942,10 +16972,20 @@
  119.235.51.241
  119.235.54.161
  119.235.54.45
-119.236.111.157
+119.236.138.19
+119.236.145.105
+119.236.156.115
+119.236.163.139
+119.236.231.94
  119.237.10.202
+119.237.105.38
+119.237.11.73
  119.237.147.236
+119.237.166.239
+119.237.176.16
+119.237.183.35
  119.237.6.209
+119.237.77.10
  119.243.95.62
  119.245.138.143
  119.246.154.102
@@ -16953,6 +16993,7 @@
  119.246.208.233
  119.246.39.250
  119.249.16.203
+119.249.24.233
  119.250.10.222
  119.250.218.62
  119.251.17.19
@@ -16960,9 +17001,9 @@
  119.251.99.21
  119.252.143.6
  119.252.161.234
+119.252.168.52
  119.252.169.173
  119.252.170.2
-119.252.188.45
  119.254.145.18
  119.254.155.187
  119.254.84.87
@@ -16974,19 +17015,13 @@
  119.27.189.190
  119.27.189.46
  119.27.189.65
-119.27.190.106
  119.27.191.172
  119.28.100.102
  119.28.113.246
  119.28.128.121
  119.28.128.211
-119.28.128.43
  119.28.128.79
-119.28.13.163
-119.28.130.157
-119.28.130.167
  119.28.132.211
-119.28.134.196
  119.28.136.26
  119.28.14.243
  119.28.140.134
@@ -17028,8 +17063,8 @@
  119.28.46.12
  119.28.46.187
  119.28.49.192
-119.28.5.102
  119.28.5.66
+119.28.53.96
  119.28.54.131
  119.28.54.93
  119.28.55.239
@@ -17039,12 +17074,10 @@
  119.28.65.231
  119.28.68.78
  119.28.7.104
-119.28.7.224
  119.28.71.109
  119.28.74.113
  119.28.74.39
  119.28.75.193
-119.28.75.244
  119.28.77.175
  119.28.83.164
  119.28.83.34
@@ -17064,9 +17097,7 @@
  119.29.102.152
  119.29.103.39
  119.29.104.205
-119.29.11.213
  119.29.110.249
-119.29.111.220
  119.29.113.233
  119.29.115.153
  119.29.116.2
@@ -17075,7 +17106,6 @@
  119.29.121.229
  119.29.13.177
  119.29.135.210
-119.29.142.151
  119.29.142.34
  119.29.143.201
  119.29.143.78
@@ -17084,6 +17114,7 @@
  119.29.155.214
  119.29.155.249
  119.29.155.57
+119.29.159.20
  119.29.16.190
  119.29.160.205
  119.29.161.236
@@ -17104,6 +17135,7 @@
  119.29.18.39
  119.29.18.76
  119.29.180.74
+119.29.181.192
  119.29.182.159
  119.29.182.185
  119.29.183.138
@@ -17137,13 +17169,12 @@
  119.29.36.75
  119.29.38.205
  119.29.38.92
-119.29.39.217
+119.29.40.118
  119.29.5.68
  119.29.52.12
  119.29.53.168
  119.29.54.159
  119.29.55.24
-119.29.56.139
  119.29.56.84
  119.29.60.52
  119.29.62.131
@@ -17159,13 +17190,12 @@
  119.29.83.177
  119.29.85.229
  119.29.86.132
-119.29.87.251
  119.29.88.56
  119.29.91.153
  119.29.91.228
  119.29.91.38
-119.29.93.25
  119.29.98.53
+119.3.203.174
  119.3.208.236
  119.3.240.100
  119.30.126.108
@@ -17179,18 +17209,13 @@
  119.40.83.242
  119.40.83.250
  119.40.92.17
-119.41.192.234
-119.41.194.191
-119.41.197.23
-119.41.201.173
  119.41.201.35
-119.41.203.115
  119.41.236.180
  119.42.103.233
  119.42.103.254
+119.42.103.4
  119.42.103.9
  119.42.108.178
-119.42.108.30
  119.42.110.84
  119.42.115.110
  119.42.115.126
@@ -17200,10 +17225,10 @@
  119.42.122.103
  119.42.122.130
  119.42.122.148
-119.42.122.163
  119.42.122.178
  119.42.122.183
  119.42.122.217
+119.42.122.219
  119.42.122.238
  119.42.122.39
  119.42.122.6
@@ -17222,6 +17247,7 @@
  119.42.123.209
  119.42.123.222
  119.42.123.243
+119.42.123.71
  119.42.123.90
  119.42.125.203
  119.42.125.56
@@ -17235,12 +17261,11 @@
  119.42.176.46
  119.42.178.6
  119.42.67.116
-119.42.67.120
  119.42.67.250
  119.42.67.48
  119.42.67.61
-119.42.67.75
-119.42.67.83
+119.42.67.66
+119.42.67.82
  119.42.72.170
  119.42.80.101
  119.42.80.107
@@ -17251,8 +17276,8 @@
  119.42.80.199
  119.42.80.25
  119.42.80.29
+119.42.80.53
  119.42.80.68
-119.42.80.90
  119.42.88.246
  119.42.95.106
  119.42.97.235
@@ -17263,6 +17288,7 @@
  119.45.105.184
  119.45.112.28
  119.45.113.118
+119.45.114.133
  119.45.116.10
  119.45.117.145
  119.45.12.105
@@ -17305,6 +17331,7 @@
  119.45.156.190
  119.45.156.93
  119.45.157.238
+119.45.159.220
  119.45.160.126
  119.45.162.248
  119.45.163.168
@@ -17357,9 +17384,9 @@
  119.45.202.178
  119.45.202.179
  119.45.202.43
+119.45.202.79
  119.45.203.170
  119.45.206.237
-119.45.206.87
  119.45.207.216
  119.45.208.164
  119.45.208.191
@@ -17370,7 +17397,9 @@
  119.45.213.69
  119.45.214.43
  119.45.215.155
+119.45.215.195
  119.45.218.145
+119.45.218.253
  119.45.219.139
  119.45.219.203
  119.45.22.71
@@ -17389,11 +17418,9 @@
  119.45.234.100
  119.45.234.112
  119.45.235.14
-119.45.236.239
  119.45.236.83
  119.45.238.225
  119.45.239.10
-119.45.239.247
  119.45.239.252
  119.45.239.67
  119.45.239.75
@@ -17460,7 +17487,7 @@
  119.45.8.125
  119.45.9.65
  119.45.92.250
-119.46.166.118
+119.46.176.222
  119.46.2.242
  119.46.2.244
  119.46.2.246
@@ -17470,13 +17497,14 @@
  119.5.1.72
  119.5.157.124
  119.5.252.202
-119.51.192.120
+119.51.91.222
  119.53.130.138
  119.53.130.182
+119.53.203.34
  119.54.39.243
-119.56.111.254
  119.56.130.60
  119.56.131.155
+119.56.140.73
  119.56.143.46
  119.56.143.51
  119.56.144.102
@@ -17514,16 +17542,16 @@
  119.65.149.106
  119.65.195.190
  119.65.249.4
-119.67.47.28
  119.68.194.119
  119.69.199.43
  119.7.237.43
-119.71.152.139
  119.73.122.157
  119.73.179.114
+119.75.170.194
  119.75.171.211
  119.76.140.113
  119.76.190.126
+119.79.224.91
  119.8.164.133
  119.8.34.6
  119.8.47.225
@@ -17569,7 +17597,6 @@
  119.9.72.162
  119.9.74.76
  119.9.75.6
-119.92.229.202
  119.92.72.169
  119.92.77.17
  119.93.122.233
@@ -17580,21 +17607,21 @@
  119.93.175.133
  119.93.234.41
  119.93.235.205
+119.93.29.243
+119.93.56.106
  119.93.67.200
  119.93.90.155
-119.94.104.128
  119.94.166.6
  119.94.191.83
-119.94.2.235
-119.94.4.214
+119.94.9.200
  119.95.76.22
+119.96.118.78
  119.96.158.238
+119.96.165.247
  119.96.171.162
  119.96.172.152
-119.96.175.184
  119.96.175.244
  119.96.189.177
-119.96.193.246
  119.96.200.248
  119.96.227.154
  119.96.237.39
@@ -17604,7 +17631,6 @@
  119.98.142.62
  119.98.152.205
  119.98.17.68
-119.98.225.217
  119.99.244.180bin.sh
  119.99.30.19
  11983914-0a5c-4955-a866-bae101828b59.htmlcomponentservice.com
@@ -17636,7 +17662,7 @@
  12.162.84.2
  12.162.84.9
  12.163.208.58
-12.171.244.204
+12.173.254.230
  12.175.220.98
  12.176.19.218
  12.179.46.6
@@ -17665,12 +17691,9 @@
  12.53.219.68
  12.69.91.226
  12.89.124.138
-120.12.120.126
  120.12.128.23
  120.12.137.125
  120.12.149.242
-120.12.212.234
-120.12.228.76
  120.131.1.97
  120.131.14.125
  120.131.2.210
@@ -17746,6 +17769,7 @@
  120.193.91.214bin.sh
  120.193.91.215
  120.193.91.233
+120.194.119.123
  120.194.189.235
  120.194.216.134
  120.195.23.27
@@ -17788,16 +17812,16 @@
  120.209.99.201
  120.210.46.10
  120.210.89.79
-120.211.100.18
  120.211.61.239
  120.211.63.91
-120.212.144.20
  120.212.210.199
  120.213.213.54
  120.221.149.166
  120.223.246.139
  120.224.48.33
+120.229.1.210
  120.229.137.191
+120.232.150.100
  120.232.150.110
  120.232.175.244
  120.232.182.40
@@ -17814,20 +17838,18 @@
  120.236.255.120
  120.237.118.139
  120.237.123.242
-120.237.208.217
  120.238.131.23
  120.24.148.204
  120.24.155.11
-120.24.24.246
-120.24.28.141
+120.24.239.8
+120.24.29.230
  120.24.40.26
  120.24.70.214
-120.24.85.106
  120.24.92.18
  120.240.95.154
-120.244.109.248
  120.244.110.184
  120.246.124.254
+120.246.32.2
  120.25.151.219
  120.25.156.28
  120.25.231.102
@@ -17836,39 +17858,36 @@
  120.25.60.70
  120.25.75.28
  120.25.80.195
-120.253.40.91
  120.26.118.68
+120.26.176.252
  120.26.199.103
  120.26.208.102
+120.26.241.157
  120.27.114.140
-120.27.133.211
-120.27.211.35
  120.27.224.215
+120.27.94.253
  120.28.109.188
  120.28.110.61
-120.28.196.200
  120.28.201.50
-120.28.23.146
  120.28.238.35
  120.28.45.202
  120.28.90.188
  120.29.125.240
  120.29.158.158
+120.29.158.69
+120.29.76.38
+120.29.78.156
  120.29.79.65
-120.29.86.117
  120.29.97.38
  120.31.131.172
  120.31.136.107
  120.31.71.238
-120.32.41.182
  120.34.164.7
  120.35.26.129
-120.36.202.128
  120.36.249.152
-120.38.5.219
  120.40.130.70
  120.43.128.99
-120.43.32.28
+120.43.144.236
  120.48.0.1
  120.48.12.238
  120.48.12.77
@@ -17884,9 +17903,8 @@
  120.48.20.241
  120.48.21.157
  120.48.21.252
+120.48.21.80
  120.48.22.116
-120.48.22.137
-120.48.23.46
  120.48.25.100
  120.48.25.245
  120.48.25.84
@@ -17899,6 +17917,8 @@
  120.48.31.111
  120.48.31.121
  120.48.31.123
+120.48.31.140
+120.48.31.43
  120.48.4.5
  120.48.5.102
  120.48.7.156
@@ -17928,19 +17948,24 @@
  120.53.121.152
  120.53.121.167
  120.53.121.178
+120.53.122.208
  120.53.122.66
  120.53.124.220
+120.53.13.226
  120.53.2.190
  120.53.21.151
  120.53.21.174
  120.53.222.157
  120.53.223.186
  120.53.223.202
+120.53.225.103
+120.53.225.60
  120.53.225.81
  120.53.23.24
  120.53.231.189
  120.53.232.114
  120.53.233.197
+120.53.235.224
  120.53.236.209
  120.53.237.161
  120.53.237.33
@@ -17949,6 +17974,7 @@
  120.53.24.160
  120.53.240.203
  120.53.243.163
+120.53.245.68
  120.53.251.82
  120.53.27.188
  120.53.28.165
@@ -17956,9 +17982,9 @@
  120.53.4.192
  120.53.9.190
  120.55.13.161
-120.56.115.125
+120.55.62.112
  120.56.119.118
-120.57.212.18
+120.57.102.172
  120.57.32.148
  120.57.33.11
  120.57.96.224
@@ -17975,7 +18001,6 @@
  120.68.2.66
  120.68.238.139
  120.68.239.224
-120.69.131.15
  120.69.169.136
  120.69.58.177
  120.69.6.8
@@ -17987,6 +18012,7 @@
  120.70.100.88
  120.70.100.89
  120.70.101.85
+120.70.102.239
  120.70.103.27
  120.70.98.132
  120.70.98.195
@@ -17994,44 +18020,50 @@
  120.71.145.166
  120.71.145.181
  120.71.145.189
+120.71.145.209
  120.71.145.254
  120.71.146.217
  120.71.147.115
-120.71.148.234
+120.71.147.93
+120.71.148.142
  120.71.181.83
  120.71.183.139
-120.76.219.77
+120.71.7.203
+120.76.244.212
  120.76.251.205
+120.76.97.156
+120.77.223.175
  120.77.253.219
  120.77.3.221
  120.77.36.28
-120.77.60.26
+120.77.82.92
  120.78.144.149
  120.78.168.214
+120.78.186.9
  120.78.193.26
  120.78.2.215
  120.78.53.133
-120.78.64.2
  120.78.67.152
  120.78.68.241
  120.79.106.130
+120.79.143.47
  120.79.151.95
  120.79.169.174
-120.79.169.194
  120.79.173.243
  120.79.188.144
+120.79.201.184
  120.79.212.174
  120.79.218.202
  120.79.222.140
  120.79.226.20
  120.79.25.8
+120.79.251.37
  120.79.48.236
+120.79.53.218
  120.79.92.64
  120.8.111.160
  120.82.116.30
  120.83.111.68
-120.83.78.131
-120.83.78.96
  120.85.112.243
  120.85.113.124
  120.85.113.127
@@ -18039,26 +18071,24 @@
  120.85.114.212
  120.85.115.139
  120.85.115.205
-120.85.116.14
  120.85.116.178
-120.85.116.204
  120.85.116.236
  120.85.117.186
-120.85.117.192
  120.85.117.242
  120.85.117.93
  120.85.118.238
  120.85.118.26
  120.85.119.199
+120.85.119.43
  120.85.91.172
  120.85.91.73
  120.85.92.181
  120.85.93.211
  120.85.93.221
  120.85.94.151
+120.88.113.186
  120.88.46.226
  120.89.74.111
-120.89.90.230
  120.9.111.175
  120.92.10.24
  120.92.103.250
@@ -18066,11 +18096,11 @@
  120.92.110.194
  120.92.110.219
  120.92.111.13
-120.92.111.227
  120.92.114.71
  120.92.132.245
  120.92.132.94
  120.92.133.133
+120.92.133.254
  120.92.133.80
  120.92.134.19
  120.92.136.168
@@ -18081,11 +18111,13 @@
  120.92.148.190
  120.92.149.124
  120.92.149.231
+120.92.15.26
  120.92.150.145
  120.92.155.99
  120.92.164.193
  120.92.166.166
  120.92.169.34
+120.92.169.65
  120.92.169.82
  120.92.174.218
  120.92.211.1
@@ -18094,7 +18126,9 @@
  120.92.34.203
  120.92.38.187
  120.92.38.249
+120.92.53.30
  120.92.74.249
+120.92.77.201
  120.92.79.133
  120.92.80.120
  120.92.83.246
@@ -18121,25 +18155,23 @@
  121.101.176.31
  121.101.186.242
  121.101.214.54
-121.102.98.35
  121.105.215.185
+121.11.110.200
  121.11.98.127
  121.111.247.200
  121.119.179.133
-121.12.118.6
  121.12.80.140
-121.120.100.50
  121.120.80.170
  121.121.134.80
  121.121.149.168
  121.121.88.177
+121.122.112.206
  121.122.139.104bin.sh
  121.122.40.109
  121.122.50.157
  121.122.90.146
-121.123.153.30
  121.123.25.106
-121.123.29.62
+121.123.46.139
  121.123.72.108
  121.123.88.229
  121.123.94.111
@@ -18160,6 +18192,7 @@
  121.131.116.192
  121.131.94.149
  121.133.0.232
+121.133.244.77
  121.134.159.21
  121.134.174.236
  121.134.176.102
@@ -18168,27 +18201,31 @@
  121.134.176.196
  121.134.176.208
  121.134.198.156
+121.134.227.185
+121.134.65.75
  121.135.117.53
  121.135.117.53bin.sh
  121.135.150.153
+121.135.150.73
  121.135.237.32
  121.136.180.124
  121.136.223.234
+121.137.103.81
  121.137.106.165
  121.137.138.140
  121.139.172.133
  121.139.172.4
  121.139.172.4bin.sh
-121.139.176.52
  121.139.218.165
  121.139.69.202
  121.140.0.70
  121.140.118.26
  121.141.34.205
+121.142.146.167
  121.142.87.218
  121.144.182.9
+121.144.22.184
  121.145.90.125
-121.147.94.185
  121.148.244.119
  121.148.39.242
  121.149.121.199bin.sh
@@ -18197,7 +18234,6 @@
  121.15.220.61
  121.15.245.215
  121.15.4.92
-121.15.7.26
  121.150.5.25
  121.151.78.166
  121.151.78.166bin.sh
@@ -18207,12 +18243,17 @@
  121.154.148.202
  121.154.229.125
  121.154.5.65
+121.154.84.91
  121.155.156.93
  121.155.156.93bin.sh
  121.155.159.244
  121.155.247.168
  121.155.40.80
  121.156.126.101
+121.157.136.163
+121.157.136.217
+121.157.136.3
+121.157.82.202
  121.159.170.231
  121.159.255.43
  121.159.53.15
@@ -18221,12 +18262,18 @@
  121.16.95.202
  121.161.20.5
  121.161.35.243
+121.162.235.144
+121.163.132.195
+121.163.87.43
  121.163.94.158
+121.164.111.64
  121.164.197.77
  121.165.140.242
+121.165.173.140
  121.165.225.81
  121.165.73.157
  121.166.10.200
+121.167.51.57
  121.168.185.22
  121.168.8.232
  121.169.110.121
@@ -18234,51 +18281,58 @@
  121.169.222.192
  121.17.210.114
  121.170.8.145
-121.171.132.157
  121.171.166.170
  121.172.108.19
  121.172.130.61
+121.172.92.167
  121.173.126.110
  121.173.145.245
  121.173.238.41
  121.173.82.5
  121.173.82.5bin.sh
  121.173.85.76
+121.177.168.160
  121.177.243.43
  121.178.198.49
-121.178.247.156
  121.18.88.186
  121.180.106.112
  121.180.106.112bin.sh
  121.180.162.248
+121.182.142.213
+121.182.194.62
+121.183.231.169
  121.184.131.249
  121.184.19.115
  121.185.110.225
  121.185.31.185
+121.185.91.102
  121.186.152.139
  121.186.155.138
  121.186.193.6
-121.186.48.200
+121.186.36.24
  121.188.43.201
  121.189.111.104bin.sh
  121.190.102.21
  121.190.141.240
  121.190.192.77
  121.191.47.134
-121.196.10.105
  121.196.12.93
  121.196.147.20
  121.196.155.249
+121.196.193.252
  121.196.232.2
  121.196.25.201
+121.196.27.235
  121.196.33.118
  121.196.44.230
  121.196.59.48
  121.199.60.92
  121.20.202.25
  121.20.206.223
+121.20.252.85
  121.200.48.58
  121.200.48.98
+121.200.53.153
  121.201.121.195
  121.201.124.176
  121.201.124.251
@@ -18287,7 +18341,6 @@
  121.201.45.212
  121.201.53.189
  121.201.53.77
-121.201.57.230
  121.201.74.154
  121.201.93.66
  121.201.94.17
@@ -18304,28 +18357,33 @@
  121.208.75.70
  121.21.92.217
  121.211.20.23
+121.211.201.98
  121.213.172.198
  121.215.45.82
+121.218.30.98
  121.218.43.17
-121.224.217.135
-121.224.217.9
-121.224.44.50
  121.225.132.212
  121.225.24.18
  121.225.85.131
  121.226.131.122
  121.226.131.146
  121.226.142.226
+121.226.152.125
  121.226.152.47
-121.226.153.30
-121.226.154.208
+121.226.152.94
+121.226.153.12
+121.226.153.23
+121.226.154.148
  121.226.154.250
-121.226.155.33
  121.226.158.186
  121.226.166.244
  121.226.177.125
  121.226.179.144
+121.226.186.246
+121.226.187.16
  121.226.187.18
+121.226.187.214
+121.226.187.24
  121.226.206.89
  121.226.207.145
  121.226.207.201
@@ -18340,10 +18398,8 @@
  121.226.94.109
  121.227.153.232
  121.227.236.221
-121.227.252.234
  121.227.31.13
  121.227.9.154
-121.228.72.107
  121.229.16.138
  121.229.19.200
  121.229.20.84
@@ -18368,8 +18424,8 @@
  121.231.12.61
  121.231.155.19
  121.231.164.108
-121.231.51.210
  121.231.83.134
+121.232.148.253
  121.232.179.201
  121.232.39.129bin.sh
  121.233.1.189
@@ -18397,22 +18453,20 @@
  121.233.73.203
  121.234.46.5
  121.234.96.152
-121.235.146.142
-121.235.147.115
-121.235.147.223
+121.235.144.230
+121.235.146.43
  121.235.195.11
-121.235.195.178
+121.235.195.213
  121.235.46.19
  121.236.175.251
  121.236.69.132
  121.237.140.151
  121.237.225.11bin.sh
-121.238.187.252
  121.239.170.234
  121.239.19.117
+121.239.19.71
  121.239.203.2
  121.239.26.122
-121.239.26.245
  121.239.85.33
  121.24.146.222
  121.24.92.115
@@ -18421,8 +18475,8 @@
  121.241.90.242
  121.242.232.157
  121.244.147.176
-121.244.213.182
  121.245.174.107
+121.25.106.151
  121.25.148.55
  121.25.204.174
  121.25.78.196
@@ -18430,11 +18484,14 @@
  121.254.228.21
  121.254.231.87
  121.254.235.62
+121.254.70.62
  121.26.219.202
  121.30.41.41
+121.32.150.82
  121.33.113.224
  121.33.220.158
  121.33.237.102
+121.34.150.139
  121.34.150.176
  121.36.202.22
  121.36.207.177
@@ -18454,10 +18511,9 @@
  121.4.116.226
  121.4.120.131
  121.4.121.128
-121.4.122.119
  121.4.122.148
+121.4.123.107
  121.4.123.149
-121.4.123.187
  121.4.123.39
  121.4.123.73
  121.4.125.228
@@ -18477,7 +18533,6 @@
  121.4.164.75
  121.4.165.92
  121.4.173.250
-121.4.177.234
  121.4.180.253
  121.4.189.34
  121.4.197.29
@@ -18486,7 +18541,9 @@
  121.4.201.38
  121.4.207.159
  121.4.212.150
+121.4.213.118
  121.4.216.109
+121.4.221.200
  121.4.223.139
  121.4.225.59
  121.4.225.7
@@ -18500,13 +18557,11 @@
  121.4.30.232
  121.4.31.241
  121.4.34.147
-121.4.35.109
  121.4.35.157
  121.4.35.38
  121.4.39.109
  121.4.39.217
  121.4.39.231
-121.4.39.63
  121.4.41.100
  121.4.41.204
  121.4.42.125
@@ -18568,35 +18623,36 @@
  121.4.97.211
  121.4.99.174
  121.40.105.124
+121.40.105.78
  121.40.141.226
  121.40.162.239
  121.40.203.142
  121.40.66.129
  121.41.140.221
  121.41.24.64
+121.42.160.48
  121.42.9.28
  121.42.9.57
  121.43.116.52
-121.43.145.115
  121.43.153.120
  121.43.163.43
+121.43.186.155
  121.44.145.75
  121.45.102.76
-121.45.173.245
+121.45.152.194
+121.45.250.66
  121.46.24.108
  121.46.244.194
  121.46.26.126
  121.46.26.17
  121.46.4.194
  121.48.165.2
-121.5.13.63
  121.5.137.166
  121.5.137.242
  121.5.141.234
  121.5.141.3
-121.5.143.119
  121.5.144.154
-121.5.19.193
+121.5.22.7
  121.5.23.131
  121.5.25.74
  121.5.26.106
@@ -18610,7 +18666,6 @@
  121.5.55.30
  121.5.55.53
  121.5.57.26
-121.5.57.95
  121.5.60.195
  121.5.61.96
  121.5.62.146
@@ -18635,25 +18690,23 @@
  121.54.168.251
  121.54.168.252
  121.54.168.253
-121.54.174.112
  121.54.189.15
  121.54.32.169
  121.54.58.242
+121.55.238.9
  121.58.195.140
  121.58.212.108
  121.58.243.202
  121.58.243.204
  121.58.246.247
-121.59.0.2
-121.6.110.132
  121.6.157.198
  121.6.190.227
+121.6.202.145
  121.6.219.179
  121.6.251.11
  121.60.117.228
  121.61.100.245
  121.61.106.104
-121.61.107.3
  121.61.111.145
  121.61.217.18
  121.61.38.226
@@ -18661,7 +18714,6 @@
  121.61.67.219
  121.61.77.223
  121.61.78.91
-121.61.97.141
  121.63.75.156
  121.63.82.89
  121.63.82.89bin.sh
@@ -18673,6 +18725,7 @@
  121.67.246.152
  121.67.246.252
  121.69.135.162
+121.69.5.10
  121.69.81.90
  121.7.7.25
  121.75.138.13
@@ -18684,16 +18737,19 @@
  121.78.223.195
  121.78.236.175
  121.78.60.134
+121.79.235.144
  121.8.146.99
-121.8.28.48
+121.8.74.44
  121.88.4.141
  121.88.4.74
  121.88.99.236
  121.89.181.39
  121.89.193.102
  121.89.194.147
+121.89.215.172
  121.9.252.250
  121.94.25.152
+121.98.113.22
  121.98.205.102
  121.99.129.72
  121.99.244.97
@@ -18701,9 +18757,9 @@
  121008.yolasite.com
  1215-qualitative.com
  122.10.119.32
+122.10.249.94
  122.10.85.55
  122.10.90.18
-122.10.97.117
  122.100.150.204
  122.100.188.50
  122.102.118.14
@@ -18738,7 +18794,7 @@
  122.115.51.155
  122.116.104.129
  122.116.104.238
-122.116.122.6
+122.116.158.85
  122.116.213.28
  122.116.233.207
  122.116.41.237
@@ -18747,7 +18803,9 @@
  122.117.44.59
  122.117.91.144
  122.118.155.59
+122.121.232.38
  122.121.88.198
+122.128.194.105
  122.129.112.209
  122.14.198.75
  122.14.200.208
@@ -18765,8 +18823,6 @@
  122.146.196.217
  122.148.234.170
  122.15.131.65
-122.15.2.242
-122.151.4.117
  122.151.43.82
  122.152.194.123
  122.152.196.222
@@ -18777,18 +18833,17 @@
  122.152.220.79
  122.152.222.180
  122.152.249.135
+122.152.54.1
  122.152.55.49
  122.153.212.195
+122.154.140.116
  122.154.141.244
  122.154.151.202
-122.154.162.2
-122.154.251.22
  122.154.56.18
  122.154.57.100
  122.154.57.103
  122.154.57.98
  122.154.59.10
-122.154.74.204
  122.155.0.205
  122.155.13.112
  122.155.160.151
@@ -18801,7 +18856,6 @@
  122.155.37.168
  122.155.7.117
  122.155.9.169
-122.156.219.212
  122.159.243.77
  122.159.95.19
  122.16.180.244
@@ -18815,40 +18869,37 @@
  122.160.99.22
  122.161.194.250
  122.161.196.254
-122.161.60.88
+122.161.227.201
  122.162.242.56
  122.163.120.143
-122.164.13.252
-122.164.176.195
+122.163.58.180
  122.165.149.75
  122.165.171.107
+122.165.171.31
  122.165.194.191
  122.165.20.209
-122.165.202.65
  122.165.206.136
  122.165.207.151
  122.166.144.74
-122.166.149.3
  122.166.155.243
  122.166.192.97
+122.166.216.212
  122.166.237.117
-122.168.78.224
  122.169.102.222
  122.169.114.254
-122.169.239.71
+122.169.114.41
  122.169.61.165
  122.170.109.61
  122.170.111.175
  122.170.156.50
+122.170.17.150
  122.170.255.51
-122.170.4.50
  122.170.5.123
+122.171.227.205
  122.171.250.126
-122.172.113.229
  122.172.139.86
-122.173.234.5
+122.172.36.41
  122.174.12.93
-122.175.197.166
  122.175.46.142
  122.176.112.13
  122.176.169.143
@@ -18862,16 +18913,14 @@
  122.176.87.177
  122.177.43.26
  122.178.115.118
+122.180.246.91
  122.180.254.6
  122.181.16.134
  122.183.139.104
  122.183.155.47
-122.185.137.98
  122.185.180.90
-122.188.209.214
  122.188.209.229
  122.190.95.117
-122.191.189.89
  122.191.189.91
  122.193.235.214
  122.194.187.119
@@ -18879,6 +18928,7 @@
  122.194.229.37
  122.194.44.48
  122.195.134.68
+122.195.73.55
  122.199.112.43
  122.199.140.158
  122.199.72.23
@@ -18914,8 +18964,8 @@
  122.201.23.45
  122.201.76.100
  122.201.82.218
+122.202.10.250
  122.202.32.70
-122.202.41.23
  122.202.48.251
  122.202.50.76
  122.202.51.74
@@ -18930,9 +18980,11 @@
  122.225.139.180
  122.225.218.234
  122.225.230.10
+122.225.55.70
  122.225.61.30
  122.226.113.66
  122.226.177.234
+122.226.177.236
  122.226.206.254
  122.226.57.70
  122.227.126.129
@@ -18944,24 +18996,18 @@
  122.228.210.110
  122.230.132.209
  122.230.133.47
-122.230.153.203
  122.230.3.104
  122.230.70.119
  122.231.47.237
-122.232.177.217
+122.232.130.140
+122.232.130.16
  122.233.150.192
  122.234.77.121
  122.236.192.162
  122.241.6.177
-122.241.73.92
  122.243.233.253
-122.246.148.141
-122.246.148.201
-122.246.148.74
  122.246.212.136
-122.246.220.146
  122.247.12.155
-122.247.51.216
  122.247.9.96
  122.248.103.64
  122.248.222.116
@@ -18976,7 +19022,6 @@
  122.252.239.5
  122.252.250.22
  122.254.33.214
-122.254.74.163
  122.254.87.161
  122.254.91.156
  122.3.145.89
@@ -18984,15 +19029,16 @@
  122.3.23.72
  122.3.255.114
  122.3.53.37
+122.35.41.28
  122.37.68.61
  122.4.249.171
-122.5.200.106
  122.50.5.148
  122.50.5.98
  122.51.100.145
  122.51.101.136
  122.51.103.120
  122.51.110.248
+122.51.121.78
  122.51.125.104
  122.51.125.231
  122.51.125.71
@@ -19011,6 +19057,7 @@
  122.51.178.89
  122.51.187.118
  122.51.195.36
+122.51.195.84
  122.51.196.235
  122.51.199.69
  122.51.200.223
@@ -19018,8 +19065,8 @@
  122.51.204.45
  122.51.207.208
  122.51.208.215
+122.51.208.60
  122.51.209.252
-122.51.210.116
  122.51.211.131
  122.51.214.230
  122.51.224.6
@@ -19030,6 +19077,8 @@
  122.51.231.211
  122.51.234.65
  122.51.235.215
+122.51.238.227
+122.51.239.82
  122.51.241.15
  122.51.241.65
  122.51.243.251
@@ -19065,13 +19114,12 @@
  122.51.96.57
  122.51.99.88
  122.52.107.94
-122.52.113.84
  122.52.127.96
-122.52.137.46
  122.52.183.184
  122.52.183.184bin.sh
-122.52.196.200
+122.52.48.92
  122.53.152.40
+122.53.176.253
  122.53.35.58
  122.53.63.135
  122.53.86.120
@@ -19088,13 +19136,10 @@
  122.58.118.224
  122.60.6.246
  122.60.70.79
-122.61.216.137
-122.61.5.100
  122.62.158.254
  122.70.128.168
  122.77.244.188
  122.9.67.134
-122.96.137.223
  122.97.162.201
  122.99.134.11
  122177-dot-n-e-w-me-ss-age-po-rt-al.wl.r.appspot.com
@@ -19102,34 +19147,33 @@
  122572447422481-dot-wetransfer-auth-file-341.appspot.com
  122980data.danzer.site
  122uc.com
+123.0.24.82
  123.1.180.246
  123.1.187.49
  123.1.189.132
  123.1.189.204
  123.1.189.70
-123.10.128.8
  123.10.129.234
  123.10.130.193
-123.10.14.238
  123.10.153.139
  123.10.157.219
  123.10.159.123
+123.10.16.112
  123.10.160.80
  123.10.165.76
-123.10.175.140
+123.10.167.160
  123.10.179.118
  123.10.18.3
  123.10.186.66
  123.10.2.38
  123.10.210.180
  123.10.213.244
-123.10.22.241
  123.10.28.162
-123.10.34.58
+123.10.48.177
  123.10.52.160
-123.10.82.119
+123.10.8.70
+123.100.226.191
  123.100.226.245
-123.100.241.85
  123.103.12.11
  123.103.242.12
  123.108.189.102
@@ -19141,17 +19185,17 @@
  123.108.97.200
  123.109.167.15
  123.11.108.210
+123.11.125.2
  123.11.13.233
-123.11.170.102
  123.11.193.137
  123.11.195.214
-123.11.195.94
-123.11.218.190
+123.11.2.196
+123.11.202.26
  123.11.235.95
-123.11.27.254
-123.11.30.195
+123.11.26.230
  123.11.4.81
  123.11.61.14
+123.11.72.216
  123.11.73.104
  123.11.78.153
  123.11.78.82
@@ -19172,11 +19216,12 @@
  123.12.181.91
  123.12.196.134
  123.12.197.46
-123.12.22.189
  123.12.221.108
  123.12.229.211
+123.12.23.229
  123.12.231.175
  123.12.233.247
+123.12.233.75
  123.12.243.129
  123.12.65.254
  123.120.115.145
@@ -19204,25 +19249,20 @@
  123.128.245.251
  123.128.245.251bin.sh
  123.129.130.188
+123.129.153.0
  123.129.166.147
  123.129.6.25
  123.129.60.134
  123.129.93.210
  123.13.110.19
  123.13.120.172
-123.13.121.12
  123.13.14.133
  123.13.157.48
  123.13.182.16
-123.13.196.218
  123.13.210.89
  123.13.22.7
  123.13.23.12
-123.13.235.49
-123.13.245.143
-123.13.246.69
  123.13.27.197
-123.13.57.162
  123.13.60.144
  123.13.61.76
  123.13.62.95
@@ -19236,12 +19276,13 @@
  123.130.178.94
  123.130.188.102
  123.130.19.225
+123.130.190.67
  123.130.20.127
  123.130.20.188
-123.130.208.198
  123.130.216.147
  123.130.216.196
  123.130.221.119
+123.130.225.177
  123.130.236.87
  123.130.58.14
  123.130.92.27
@@ -19262,12 +19303,12 @@
  123.133.168.134
  123.133.192.103
  123.133.193.0
-123.133.195.144
-123.133.195.202
  123.133.196.215
+123.133.197.203
  123.133.199.248
  123.133.202.241
-123.133.202.54
+123.133.204.188
+123.133.205.123
  123.133.206.30
  123.133.67.2
  123.134.16.254
@@ -19286,15 +19327,15 @@
  123.139.56.148
  123.139.56.238
  123.14.104.224
+123.14.106.188
  123.14.162.126
  123.14.199.130
-123.14.216.205
-123.14.252.32
  123.14.38.70
-123.14.51.211
+123.14.49.90
  123.14.54.100
-123.14.88.151
-123.14.95.165
+123.14.68.119
+123.14.69.4
+123.14.88.88
  123.14.95.248
  123.140.114.196
  123.140.114.252
@@ -19307,10 +19348,8 @@
  123.143.77.180
  123.143.98.5
  123.144.20.153
-123.145.231.237
  123.146.114.40
  123.148.140.145
-123.149.237.173
  123.150.9.164
  123.150.9.74
  123.150.94.82
@@ -19329,12 +19368,12 @@
  123.155.120.60
  123.156.136.233
  123.156.225.8
-123.159.139.115
  123.159.69.64
  123.159.70.163
  123.16.15.201
  123.16.188.2
  123.16.248.128
+123.16.253.27
  123.160.10.54
  123.163.122.122
  123.163.97.210
@@ -19346,15 +19385,15 @@
  123.170.221.93
  123.171.35.230
  123.174.27.111
+123.175.153.99
  123.176.158.247
  123.176.25.234
  123.176.38.70
-123.176.47.114
  123.177.19.13
  123.178.150.230
  123.18.206.22
  123.180.140.101
-123.181.211.237
+123.180.144.126
  123.181.235.123
  123.181.235.67
  123.182.143.222
@@ -19364,52 +19403,53 @@
  123.183.119.76
  123.183.16.207
  123.183.172.85
-123.183.224.113
  123.185.24.161
-123.185.25.225
-123.188.255.60
  123.19.129.66
  123.19.94.33
-123.191.45.129
  123.192.101.163bin.sh
  123.192.194.233
  123.192.64.68
  123.193.53.237
  123.194.52.79
+123.195.184.77
  123.195.60.250
  123.195.98.141
  123.195.99.9
  123.20.101.40
-123.20.209.229
  123.20.234.229
+123.20.41.120
  123.20.48.251
  123.200.11.230
  123.200.143.234
  123.200.15.218
+123.200.19.4
  123.200.20.242
  123.200.20.34
+123.200.22.46
  123.200.25.130
  123.200.26.202
  123.200.26.22
  123.200.31.226
  123.200.4.42
-123.201.114.186
+123.201.116.6
  123.201.131.62
  123.201.165.121
-123.201.165.41
  123.201.170.159
  123.201.174.106
  123.201.178.131
  123.201.182.76
  123.201.183.220
+123.201.194.67
  123.201.221.103
+123.201.221.236
  123.201.24.38
-123.201.44.40
+123.201.45.37
  123.201.55.1
  123.201.55.9
-123.201.80.230
  123.201.91.74
+123.202.140.45
  123.202.163.232
+123.202.17.22
  123.202.243.223
  123.203.122.235
  123.203.163.128
@@ -19440,6 +19480,7 @@
  123.206.50.168
  123.206.50.50
  123.206.51.192
+123.206.53.230
  123.206.58.135
  123.206.62.112
  123.206.67.211
@@ -19471,6 +19512,7 @@
  123.207.198.235
  123.207.201.105
  123.207.206.232
+123.207.207.83
  123.207.218.163
  123.207.218.168
  123.207.22.39
@@ -19478,6 +19520,7 @@
  123.207.222.213
  123.207.237.163
  123.207.250.132
+123.207.251.54
  123.207.252.190
  123.207.31.240
  123.207.34.86
@@ -19496,28 +19539,23 @@
  123.207.94.252
  123.207.95.121
  123.207.99.184
-123.208.73.56
  123.209.202.47
  123.209.93.122
  123.21.145.111
-123.21.185.250
-123.21.214.251
-123.21.220.187
  123.21.244.148
  123.21.7.182
  123.21.8.68
-123.212.1.151
  123.212.124.25
  123.212.190.82
  123.213.225.130
  123.213.70.176
  123.22.124.236
  123.220.251.190
-123.23.106.27
+123.222.208.27
  123.231.113.50
+123.231.123.46
  123.231.230.58
  123.231.65.170
-123.231.71.203
  123.232.100.2
  123.232.127.134
  123.232.170.69
@@ -19525,6 +19563,7 @@
  123.233.152.249
  123.233.185.116
  123.233.248.154
+123.234.116.110
  123.234.124.66
  123.234.124.66bin.sh
  123.234.191.51
@@ -19551,12 +19590,13 @@
  123.24.100.235
  123.24.205.116
  123.24.205.79
-123.24.47.88
  123.240.124.159
  123.240.79.61
  123.241.140.20
+123.241.167.150
+123.241.75.89
  123.242.179.10
-123.243.115.61
+123.245.58.168
  123.249.26.47
  123.25.1.66
  123.25.116.228
@@ -19565,17 +19605,20 @@
  123.252.173.162
  123.252.188.186
  123.252.218.62
+123.253.125.206
  123.253.125.75
  123.253.126.102
  123.253.126.13
  123.253.126.187
+123.253.141.132
  123.253.15.123
  123.253.221.74
  123.253.36.99
  123.253.97.118
  123.254.111.40
+123.255.249.102
  123.255.46.174
-123.26.70.196
+123.27.184.109
  123.27.3.246
  123.27.65.229
  123.28.217.23
@@ -19601,51 +19644,56 @@
  123.31.43.126
  123.31.43.172
  123.31.45.49
-123.4.189.73
-123.4.215.70
+123.4.147.107
+123.4.193.103
  123.4.218.103
+123.4.223.201
  123.4.249.127
-123.4.35.85
  123.4.45.192
-123.4.49.55
  123.4.54.219
+123.4.66.194
  123.4.69.229
+123.4.82.136
  123.4.83.114
  123.4.85.69
  123.4.87.146
  123.4.89.145
+123.4.89.238
+123.4.90.72
  123.4.91.169
  123.4.92.227
  123.49.41.129
  123.49.59.150
  123.5.0.6
-123.5.146.207
-123.5.148.7
-123.5.184.143
+123.5.140.36
+123.5.150.90
+123.5.184.141
  123.5.189.6
-123.5.199.137
+123.5.191.202
  123.5.248.97
-123.5.43.151
  123.5.6.52
  123.50.145.89
+123.50.67.135
  123.50.74.247
+123.50.77.16
+123.50.82.141
+123.50.83.54
+123.50.88.21
+123.50.93.237
  123.51.152.54
  123.51.168.240
  123.51.185.103
  123.51.185.39
-123.51.20.62
  123.51.239.121
+123.52.16.224
  123.52.18.114
-123.53.181.50
-123.56.129.28
-123.56.160.202
-123.56.166.95
+123.54.3.154
+123.56.109.173
  123.56.178.207
-123.56.226.102
-123.56.230.82
  123.56.232.214
  123.56.41.101
  123.56.41.15
+123.56.64.52
  123.56.89.191
  123.56.98.239
  123.57.150.34
@@ -19653,11 +19701,14 @@
  123.57.181.90
  123.57.188.141
  123.57.189.127
+123.57.189.46
  123.57.254.84
  123.57.27.201
+123.57.45.231
+123.57.54.188
  123.57.61.38
-123.57.70.231
  123.57.72.201
+123.57.72.45
  123.57.82.217
  123.58.109.42
  123.58.210.35
@@ -19675,7 +19726,6 @@
  123.59.120.107
  123.59.120.167
  123.59.120.251
-123.59.194.227
  123.59.195.165
  123.59.195.173
  123.59.209.197
@@ -19687,28 +19737,26 @@
  123.6.5.104
  123.6.90.65
  123.60.167.10
+123.63.164.225
  123.63.191.69
  123.63.242.115
  123.63.54.229
  123.7.63.169
+123.8.130.89
+123.8.177.0
  123.8.189.177
  123.8.190.0
  123.8.190.236
+123.8.226.152
  123.8.253.62
-123.8.255.211
-123.8.255.245
-123.8.35.241
  123.8.38.65
-123.8.89.25
+123.8.47.125
  123.9.111.220
  123.9.177.30
  123.9.181.216
  123.9.204.224
-123.9.219.12
-123.9.234.224
-123.9.40.220
+123.9.252.56
  123.97.134.232
-123.97.151.64
  123.97.154.113
  123.ltscr.cn
  123123123112312323.000webhostapp.com
@@ -19750,13 +19798,11 @@
  124.105.17.92
  124.105.173.17
  124.105.197.35
-124.105.199.163
  124.105.29.181
-124.105.34.149
  124.105.55.176
-124.106.150.246
  124.106.199.205
  124.106.77.49
+124.106.79.81
  124.109.1.146
  124.109.1.207
  124.109.1.58
@@ -19764,20 +19810,19 @@
  124.109.3.193
  124.109.33.176
  124.109.44.126
+124.109.48.90
  124.109.52.72
+124.110.140.120
  124.111.53.213
  124.112.204.144
-124.112.204.254
+124.112.204.175
  124.112.204.62
  124.112.204.87
+124.112.205.174
  124.112.205.237
  124.112.205.99
  124.112.62.199
-124.113.218.114
-124.113.218.238
-124.113.218.68
-124.113.219.101
-124.113.219.170
+124.113.219.79
  124.114.141.46
  124.115.146.99
  124.115.205.246
@@ -19795,34 +19840,38 @@
  124.120.187.152
  124.120.201.126
  124.120.86.125
+124.120.87.187
  124.120.87.24
+124.121.173.42
+124.121.177.209
  124.121.18.161
  124.121.19.10
  124.121.19.241
  124.121.193.81
-124.121.20.182
  124.121.205.8
  124.121.92.171
  124.122.103.237
  124.122.12.89
  124.122.120.17
-124.122.123.246
  124.122.161.49
  124.122.161.72
+124.122.17.101
  124.122.223.87
  124.122.34.184
  124.122.37.116
  124.122.37.148
  124.122.56.121
+124.123.107.75
  124.123.165.230
  124.123.179.104
+124.123.65.131
  124.123.77.175
-124.123.92.53
  124.124.197.72
  124.126.140.63
  124.126.18.130
  124.127.192.146
  124.127.42.42
+124.128.90.219
  124.129.1.163
  124.129.126.228
  124.129.153.168
@@ -19833,7 +19882,6 @@
  124.129.207.173
  124.129.59.57
  124.13.108.53
-124.13.164.138
  124.13.194.39
  124.13.20.40
  124.13.200.234
@@ -19845,7 +19893,6 @@
  124.130.40.162
  124.130.57.57
  124.131.109.149
-124.131.117.51
  124.131.131.184
  124.131.132.161
  124.131.134.14
@@ -19860,9 +19907,11 @@
  124.131.21.39
  124.131.239.254
  124.131.26.238
+124.131.26.78
  124.131.51.163
  124.133.252.204
  124.133.34.186
+124.133.9.122
  124.135.11.47
  124.135.160.139
  124.135.161.219
@@ -19877,8 +19926,6 @@
  124.138.58.3
  124.141.1.24
  124.149.227.24
-124.149.36.42
-124.149.46.93
  124.149.62.144
  124.150.132.74
  124.150.175.133
@@ -19900,13 +19947,10 @@
  124.156.114.53
  124.156.133.54
  124.156.134.69
-124.156.135.221
  124.156.135.242
  124.156.138.112
  124.156.139.91
  124.156.141.121
-124.156.148.119
-124.156.149.159
  124.156.149.43
  124.156.150.83
  124.156.151.14
@@ -19920,8 +19964,6 @@
  124.156.178.58
  124.156.180.189
  124.156.184.237
-124.156.187.176
-124.156.196.246
  124.156.214.135
  124.156.217.41
  124.156.218.50
@@ -19930,6 +19972,7 @@
  124.156.226.224
  124.156.226.238
  124.158.105.58
+124.158.12.202
  124.158.144.186
  124.158.144.187
  124.158.150.205
@@ -19939,11 +19982,14 @@
  124.158.179.13
  124.158.179.158
  124.158.179.222
+124.158.183.182
+124.158.183.184
  124.160.126.238
  124.160.83.138
  124.160.96.242
  124.160.96.249
  124.163.101.189
+124.163.105.120
  124.163.131.196
  124.163.144.140
  124.163.191.135
@@ -19951,26 +19997,25 @@
  124.163.38.2
  124.163.62.140
  124.163.67.122
-124.163.93.243
  124.163.96.71
  124.165.123.7
+124.165.147.110
+124.167.21.95
  124.167.226.214
  124.167.248.230
  124.169.198.21
  124.17.10.2
  124.170.217.160
+124.171.41.171
  124.172.232.49
  124.172.232.57
  124.172.244.163
-124.188.95.214
+124.189.147.69
  124.190.168.165
  124.190.217.63
  124.193.106.107
-124.193.120.136
  124.194.83.172
-124.195.206.42
  124.199.56.198
-124.202.180.190
  124.205.108.64
  124.205.119.183
  124.205.84.11
@@ -19989,16 +20034,16 @@
  124.207.221.66
  124.207.29.72
  124.207.98.213
+124.217.189.138
  124.217.230.195
+124.217.235.217
  124.217.242.70
-124.219.176.139
  124.225.17.145
  124.225.192.172
  124.225.71.220
  124.226.219.166
  124.226.233.115
  124.227.115.39
-124.229.24.114
  124.230.173.24
  124.230.175.141
  124.230.175.167
@@ -20028,9 +20073,9 @@
  124.238.57.104
  124.238.57.111
  124.238.57.127
+124.238.57.14
  124.238.57.145
  124.238.57.158
-124.238.57.174
  124.238.57.212
  124.238.57.22
  124.238.57.70
@@ -20039,6 +20084,7 @@
  124.238.58.182
  124.238.58.186
  124.238.58.234
+124.238.58.41
  124.238.58.67
  124.238.59.124
  124.238.59.197
@@ -20052,17 +20098,17 @@
  124.238.59.79
  124.238.59.80
  124.238.59.90
-124.238.61.22
  124.239.148.63
+124.239.149.153
  124.239.153.215
  124.239.168.74
  124.239.216.233
+124.239.77.24
  124.240.198.66
  124.248.165.248
  124.248.177.160
  124.248.177.243
  124.248.177.35
-124.248.177.72
  124.248.190.215
  124.248.191.38
  124.248.227.130
@@ -20073,17 +20119,18 @@
  124.251.110.148
  124.251.23.153
  124.253.204.157
-124.254.158.249
+124.253.3.202
  124.255.20.162
  124.255.20.163
  124.255.20.55
  124.28.218.130
  124.29.200.46
  124.29.207.184
-124.29.228.79
+124.29.208.158
  124.29.236.163
  124.29.237.240
  124.40.248.202
+124.40.55.22
  124.40.55.4
  124.41.211.110
  124.41.211.188
@@ -20092,9 +20139,9 @@
  124.41.211.212
  124.41.213.122
  124.41.213.201
+124.41.213.211
  124.41.213.44
  124.41.213.92
-124.41.226.27
  124.41.240.126
  124.41.240.140
  124.41.240.177
@@ -20106,9 +20153,13 @@
  124.41.243.22
  124.41.243.67
  124.41.243.72
+124.41.248.59
+124.42.68.14
+124.43.116.111
  124.43.12.185
-124.43.123.77
+124.43.171.33
  124.43.177.160
+124.43.210.5
  124.43.5.108
  124.43.85.156
  124.43.9.184
@@ -20123,7 +20174,7 @@
  124.65.130.86
  124.65.142.62
  124.65.144.38
-124.65.79.254
+124.65.241.154
  124.66.49.34
  124.67.89.18
  124.67.89.238
@@ -20146,19 +20197,21 @@
  124.77.6.15
  124.78.41.151
  124.78.54.247
+124.79.177.154
  124.80.46.73
  124.81.236.122
  124.81.239.170
  124.82.119.11
+124.82.222.209
+124.82.83.18
+124.83.99.186
  124.88.217.111
-124.89.116.178
  124.89.2.42
  124.89.218.25
  124.89.220.36
  124.90.36.152
  124.90.49.229
  124.90.51.128
-124.90.51.194
  124.90.51.197
  124.91.132.236
  124.91.133.220
@@ -20183,41 +20236,45 @@
  124insta3gram.000webhostapp.com
  125.104.231.209
  125.104.252.53
-125.105.140.68
+125.105.21.77
  125.106.34.241
  125.112.177.2
-125.112.182.117
  125.118.209.143
-125.118.241.96
  125.120.149.124
  125.120.203.152
  125.120.237.87
  125.121.135.105
-125.122.248.149
  125.123.212.71
  125.123.213.116
+125.123.239.60
  125.123.68.79
  125.123.70.251
  125.124.117.226
+125.124.120.123
  125.124.193.203
  125.124.209.123
  125.124.226.231
  125.124.44.135
+125.124.59.64
  125.124.65.223
  125.124.69.65
  125.124.72.157
-125.124.77.104
  125.124.97.15
  125.125.116.242
-125.125.198.64
+125.125.153.228
+125.125.156.186
+125.125.159.83
+125.125.194.49
  125.126.113.121
  125.126.254.180
-125.126.71.207
  125.126.84.109
  125.126.86.109
+125.126.89.224
  125.128.163.100
+125.130.190.104
  125.132.218.97
  125.134.61.237
+125.134.66.90
  125.134.92.170
  125.135.129.246
  125.135.221.94
@@ -20228,6 +20285,7 @@
  125.138.160.240
  125.139.190.46
  125.139.236.180
+125.139.69.167
  125.140.140.218
  125.140.159.29
  125.141.133.70
@@ -20256,13 +20314,13 @@
  125.141.59.19
  125.141.63.90
  125.141.91.138
-125.142.130.213
+125.142.127.16
  125.142.211.237
  125.142.232.64
-125.143.192.205
  125.143.3.230
  125.16.134.218
  125.16.144.145
+125.16.176.58
  125.16.217.170
  125.160.17.200
  125.160.207.65
@@ -20271,61 +20329,67 @@
  125.160.213.234
  125.160.226.31
  125.160.229.161
+125.160.231.107
  125.160.56.134
  125.160.65.5
  125.161.118.201
  125.161.129.177
  125.161.129.73
-125.161.136.181
  125.161.136.208
  125.161.138.235
+125.161.139.175
  125.161.139.238
+125.161.139.245
+125.161.139.34
  125.161.31.225
  125.161.31.65
-125.161.58.88
  125.161.65.27
  125.162.120.80
  125.162.130.78
  125.162.158.63
+125.162.210.231
  125.163.132.185
  125.163.137.107
  125.163.147.240
+125.163.160.180
  125.163.160.229
  125.163.190.51
+125.163.20.48
  125.163.67.75
+125.164.105.140
  125.164.107.157
  125.164.111.211
  125.164.111.46
-125.164.15.88
-125.164.251.87
  125.164.83.252
  125.164.97.94
  125.165.104.21
-125.165.106.17
  125.165.111.240
  125.165.112.19
+125.165.154.127
  125.165.179.254
  125.165.237.126
+125.165.251.176
  125.165.41.231
-125.165.6.67
  125.165.86.141
+125.166.101.7
+125.166.116.189
+125.166.119.179
  125.166.128.156
+125.166.187.137
  125.166.201.222
  125.166.30.3
-125.166.4.70
-125.167.1.201
+125.166.7.230
  125.167.148.53
  125.167.181.122
-125.167.183.4
  125.167.204.111
  125.167.32.158
+125.167.39.57
  125.167.52.98
  125.167.59.64
  125.167.62.46
  125.167.71.136
  125.167.86.83
  125.168.145.66bin.sh
-125.17.115.94
  125.177.73.48
  125.178.227.57
  125.18.20.150
@@ -20337,6 +20401,7 @@
  125.206.38.159bin.sh
  125.209.115.186
  125.209.116.138
+125.209.116.14
  125.209.116.234
  125.209.127.30
  125.209.235.170
@@ -20345,13 +20410,11 @@
  125.209.235.183
  125.209.67.74
  125.209.82.78
-125.21.123.234
  125.21.43.82
  125.21.54.26
  125.212.147.128
-125.212.156.192
  125.212.156.213
-125.212.173.29
+125.212.156.240
  125.212.193.1
  125.212.193.207
  125.212.193.208
@@ -20374,6 +20437,7 @@
  125.215.205.180
  125.215.207.40
  125.22.246.216
+125.22.9.186
  125.227.149.119
  125.227.16.170
  125.227.186.157
@@ -20385,17 +20449,17 @@
  125.234.98.50
  125.235.235.52
  125.235.236.14
-125.236.145.169
  125.236.215.133
  125.236.232.228
-125.239.42.72
  125.24.100.148
  125.24.115.163
-125.24.174.201
-125.24.180.144
+125.24.120.86
+125.24.130.183
+125.24.236.11
+125.24.237.49
  125.24.6.15
  125.24.7.95
-125.240.27.103
+125.24.75.247
  125.245.165.135
  125.247.211.3
  125.248.150.84
@@ -20408,17 +20472,13 @@
  125.25.184.10
  125.25.184.14
  125.25.187.225
-125.25.204.116
  125.25.215.174
  125.25.24.97
-125.25.45.107
  125.25.74.248
  125.25.74.97
-125.25.76.40
  125.25.77.19
  125.25.77.224
  125.25.79.199
-125.25.82.204
  125.251.133.3
  125.251.136.194
  125.251.147.194
@@ -20432,13 +20492,14 @@
  125.26.120.159
  125.26.130.61
  125.26.15.67
-125.26.15.68
  125.26.165.17
  125.26.165.244
  125.26.169.180
  125.26.178.210
+125.26.179.111
  125.26.183.167
  125.26.183.223
+125.26.188.14
  125.26.198.210
  125.26.202.91
  125.26.238.208
@@ -20446,11 +20507,11 @@
  125.26.7.124
  125.26.7.83
  125.26.82.66
-125.26.88.159
+125.26.97.12
  125.26.97.133
  125.26.97.18
  125.26.97.26
-125.26.97.41
+125.26.97.40
  125.26.99.185
  125.26.99.186
  125.26.99.212
@@ -20477,115 +20538,115 @@
  125.27.37.107
  125.27.48.227
  125.27.63.215
-125.30.97.57
+125.34.240.29
  125.34.240.33
  125.35.92.130
  125.36.208.161
+125.40.107.74
  125.40.113.83
  125.40.114.118
  125.40.114.24
  125.40.115.85
  125.40.152.165
-125.40.233.198
+125.40.16.98
+125.40.160.145
  125.40.25.23
-125.40.27.78
  125.40.73.220
+125.40.73.234
  125.40.74.126
  125.40.75.174
  125.40.75.47
-125.40.8.200
  125.40.91.15
  125.41.1.44
-125.41.10.248
  125.41.109.123
+125.41.12.70
  125.41.13.34
-125.41.152.225
+125.41.189.191
  125.41.196.128
+125.41.202.128
  125.41.204.217
  125.41.204.33
  125.41.205.24bin.sh
-125.41.214.86
  125.41.215.56
  125.41.4.137
-125.41.78.207
+125.41.72.135
+125.41.76.2
  125.41.80.120
  125.41.97.114
  125.42.120.241
  125.42.121.170
  125.42.121.67
-125.42.122.108
  125.42.124.68
-125.42.125.197
-125.42.15.144
  125.42.192.48
  125.42.239.99
  125.42.42.75
  125.42.90.144
+125.43.0.51
+125.43.112.120
  125.43.113.1
+125.43.210.92
  125.43.214.117
  125.43.222.127
-125.43.240.30
-125.43.27.229
  125.43.36.25
+125.43.37.30
  125.43.39.22
-125.43.41.176
-125.43.43.240
  125.43.50.22
-125.43.53.182
-125.43.67.230
+125.43.61.64
+125.43.74.236
  125.43.93.226
+125.44.12.16
  125.44.194.40
-125.44.209.229
-125.44.213.38
-125.44.214.137
+125.44.211.164
+125.44.212.72
  125.44.214.21
-125.44.224.214
  125.44.231.212
-125.44.30.73
-125.44.39.215
-125.44.45.247
+125.44.71.190
  125.44.8.248
+125.44.9.200
  125.45.179.132
  125.45.18.224
-125.45.18.69
  125.45.186.236bin.sh
  125.45.25.13
  125.45.42.23
+125.45.48.32
+125.45.64.191
+125.45.66.168
  125.45.67.112bin.sh
  125.45.77.161
  125.45.78.176
  125.45.79.125
-125.46.162.42
  125.46.163.117
+125.46.166.129
  125.46.169.47
  125.46.182.165
+125.46.184.108
  125.46.185.199
-125.46.196.78
  125.46.197.120
  125.46.197.224
-125.46.209.118
+125.46.205.44
+125.46.206.3
+125.46.222.138
  125.46.240.195
-125.46.247.34
+125.46.253.203
  125.46.81.106
  125.47.13.31
-125.47.160.231
  125.47.204.174
-125.47.207.49
  125.47.211.71
  125.47.226.219
-125.47.240.112
+125.47.235.160
  125.47.242.165
  125.47.243.219
  125.47.245.168
  125.47.245.184
  125.47.246.63
-125.47.247.150
-125.47.248.10
-125.47.45.153
-125.47.53.90
+125.47.248.218
+125.47.249.59
+125.47.255.113
  125.47.55.90
+125.47.57.173
  125.47.65.10
  125.47.65.136
+125.47.66.243
  125.47.69.4
  125.47.73.72
  125.47.74.248
@@ -20593,13 +20654,14 @@
  125.47.90.105
  125.47.90.241
  125.47.90.55
-125.47.91.99
+125.5.180.84
  125.5.184.218
  125.60.148.184
  125.62.198.65
  125.62.213.18
  125.62.213.94
  125.64.54.23
+125.64.91.103
  125.65.112.161
  125.65.112.168
  125.65.77.120
@@ -20608,12 +20670,15 @@
  125.65.94.122
  125.66.106.2
  125.66.2.64
+125.66.243.1
  125.67.17.160
  125.67.239.82
  125.68.172.20
  125.69.161.113
  125.69.71.33
+125.69.90.148
  125.70.244.6
+125.70.36.102
  125.71.214.59
  125.72.13.21
  125.74.8.51
@@ -20622,14 +20687,14 @@
  125.77.23.30
  125.77.25.119
  125.77.25.123
-125.78.227.220
+125.78.223.185
  125.78.32.186
  125.84.217.97
  125.88.169.233
+125.91.109.158
  125.91.109.200
  125.91.126.92
  125.93.193.211
-125.93.193.39
  125.94.117.128
  125.94.188.155
  125.94.236.109
@@ -20642,6 +20707,7 @@
  125.99.147.56
  125.99.159.93
  125.99.173.162
+125.99.209.18
  125.99.242.202
  125.99.46.49
  125.99.46.50
@@ -20649,7 +20715,6 @@
  125.99.61.162
  125478526j.weebly.com
  125fbe8e-c223-43d2-974f-9e171c4e36c0.htmlcomponentservice.com
-126.0.21.51
  126.0.63.53
  126.10.146.226
  126.103.172.79
@@ -20666,6 +20731,7 @@
  126mailbox-verification.duckdns.org
  1272125-dot-n-e-w-me-ss-age-po-rt-al.wl.r.appspot.com
  12774.psdzy.com
+128.0.135.167
  128.0.179.234
  128.0.190.26
  128.0.240.78
@@ -20722,7 +20788,6 @@
  128.177.105.222
  128.177.105.224
  128.177.105.225
-128.177.142.190
  128.187.32.223
  128.197.128.236
  128.197.189.187
@@ -20735,16 +20800,17 @@
  128.199.102.242
  128.199.103.239
  128.199.104.123
+128.199.104.17
  128.199.106.232
  128.199.106.97
  128.199.107.111
  128.199.107.150
-128.199.107.48
  128.199.108.203
  128.199.109.128
  128.199.11.84
  128.199.110.226
  128.199.112.240
+128.199.113.9
  128.199.114.22
  128.199.115.175
  128.199.116.139
@@ -20774,7 +20840,6 @@
  128.199.132.220
  128.199.133.125
  128.199.133.8
-128.199.135.134
  128.199.136.255
  128.199.136.56
  128.199.137.41
@@ -20803,6 +20868,7 @@
  128.199.151.172
  128.199.151.198
  128.199.152.105
+128.199.152.154
  128.199.152.57
  128.199.153.137
  128.199.154.133
@@ -20811,10 +20877,12 @@
  128.199.156.25
  128.199.158.182
  128.199.159.217
+128.199.159.52
  128.199.16.236
  128.199.162.108
  128.199.163.94
  128.199.164.15
+128.199.165.213
  128.199.165.98
  128.199.167.161
  128.199.167.163
@@ -20863,8 +20931,10 @@
  128.199.203.183
  128.199.204.164
  128.199.206.22
+128.199.206.6
  128.199.206.90
  128.199.208.93
+128.199.21.230
  128.199.210.89
  128.199.211.68
  128.199.212.194
@@ -20874,28 +20944,25 @@
  128.199.213.59
  128.199.214.126
  128.199.214.19
-128.199.215.124
  128.199.215.207
  128.199.218.126
  128.199.219.186
  128.199.22.32
  128.199.22.36
-128.199.220.215
  128.199.220.70
  128.199.223.178
  128.199.223.233
  128.199.224.178
-128.199.225.104
  128.199.226.249
  128.199.226.44
  128.199.227.155
+128.199.227.162
  128.199.227.236
  128.199.228.115
  128.199.229.21
  128.199.23.52
  128.199.231.162
  128.199.232.6
-128.199.233.143
  128.199.235.176
  128.199.239.9
  128.199.240.120
@@ -20908,12 +20975,12 @@
  128.199.248.200
  128.199.248.35
  128.199.249.142
+128.199.249.213
  128.199.249.246
  128.199.249.43
  128.199.25.223
  128.199.251.65
  128.199.253.208
-128.199.254.103
  128.199.254.188
  128.199.254.45
  128.199.26.242
@@ -20948,7 +21015,6 @@
  128.199.49.92
  128.199.50.213
  128.199.51.138
-128.199.51.183
  128.199.52.158
  128.199.52.4
  128.199.52.45
@@ -20956,6 +21022,7 @@
  128.199.55.169
  128.199.55.181
  128.199.55.243
+128.199.58.17
  128.199.58.60
  128.199.60.86
  128.199.61.84
@@ -20967,10 +21034,12 @@
  128.199.65.26
  128.199.66.19
  128.199.68.220
+128.199.68.38
  128.199.70.58
  128.199.72.121
  128.199.74.117
  128.199.75.250
+128.199.76.60
  128.199.78.229
  128.199.79.158
  128.199.79.175
@@ -20996,7 +21065,9 @@
  128.2.204.232
  128.201.100.84
  128.201.161.2
+128.201.175.202
  128.201.76.184
+128.201.77.94
  128.201.81.160
  128.201.81.163
  128.201.82.87
@@ -21013,25 +21084,19 @@
  128.59.169.134
  128.71.144.200
  128.71.165.79
-128.71.215.223
  128.71.23.180
  128.72.85.127
  128.75.151.66
-128.90.140.73
  128.90.168.112
-128.90.175.172
-128.90.176.223
  128.92.203.42
  128.98.26.242
  128988158812897-dot-fix-file-upstream.appspot.com
  129.10.65.146
  129.102.9.6
  129.121.177.81
-129.121.2.95
  129.122.16.156
  129.126.102.10
  129.126.102.14
-129.126.173.222
  129.126.65.78
  129.126.99.254
  129.13.189.206
@@ -21047,8 +21112,6 @@
  129.146.122.232
  129.146.171.142
  129.146.171.254
-129.146.173.121
-129.146.188.246
  129.146.246.249
  129.146.249.135
  129.146.250.102
@@ -21060,28 +21123,27 @@
  129.15.240.105
  129.150.194.230
  129.150.213.85
-129.151.34.251
  129.152.141.71
-129.154.67.65
  129.158.74.141
  129.158.78.147
  129.159.36.93
  129.159.38.139
  129.170.192.41
  129.192.83.191
-129.204.110.114
+129.204.101.225
  129.204.121.245
  129.204.121.71
+129.204.123.130
  129.204.125.231
  129.204.131.146
  129.204.131.218
  129.204.132.123
+129.204.143.161
  129.204.148.56
  129.204.152.84
  129.204.162.92
  129.204.17.191
  129.204.177.7
-129.204.184.97
  129.204.186.151
  129.204.188.41
  129.204.188.7
@@ -21090,7 +21152,6 @@
  129.204.198.141
  129.204.20.248
  129.204.201.238
-129.204.203.218
  129.204.208.231
  129.204.208.34
  129.204.209.175
@@ -21106,6 +21167,7 @@
  129.204.254.71
  129.204.33.26
  129.204.35.171
+129.204.39.137
  129.204.45.118
  129.204.46.170
  129.204.53.160
@@ -21117,8 +21179,6 @@
  129.204.77.136
  129.204.77.236
  129.204.82.4
-129.204.84.176
-129.205.106.123
  129.205.112.253
  129.205.138.194
  129.205.160.232
@@ -21130,7 +21190,6 @@
  129.205.210.90
  129.205.244.158
  129.205.98.54
-129.208.15.100
  129.21.148.57
  129.21.34.18
  129.211.10.111
@@ -21145,7 +21204,6 @@
  129.211.138.177
  129.211.14.18
  129.211.14.195
-129.211.14.58
  129.211.146.50
  129.211.149.34
  129.211.16.182
@@ -21161,6 +21219,7 @@
  129.211.174.106
  129.211.18.180
  129.211.185.246
+129.211.187.159
  129.211.188.162
  129.211.189.231
  129.211.191.185
@@ -21233,6 +21292,7 @@
  129.226.227.72
  129.226.49.27
  129.226.51.112
+129.226.55.85
  129.226.58.12
  129.226.63.78
  129.226.64.39
@@ -21246,12 +21306,11 @@
  129.232.208.54
  129.232.208.55
  129.232.208.60
+129.24.32.133
  129.28.103.85
  129.28.114.62
  129.28.12.228
  129.28.141.140
-129.28.142.81
-129.28.146.168
  129.28.154.240
  129.28.155.113
  129.28.155.12
@@ -21266,13 +21325,13 @@
  129.28.172.212
  129.28.172.220
  129.28.175.24
+129.28.176.136
  129.28.176.171
  129.28.177.29
  129.28.180.237
  129.28.183.62
  129.28.185.107
  129.28.185.31
-129.28.186.100
  129.28.189.173
  129.28.192.61
  129.28.192.71
@@ -21294,6 +21353,7 @@
  12h.tech
  12kh1.cn
  12login-amazon.serveirc.com
+12msnmicrosoft.weebly.com
  12online.cf
  12pm-premier.com
  12qwe.hbkjn.repl.co
@@ -21309,12 +21369,14 @@
  13-59-161-101.cprapid.com
  13-a-life-ft.com
  13.112.108.47
+13.112.109.34
  13.112.123.148
  13.113.116.175
  13.114.100.101
  13.114.162.117
  13.114.178.225
  13.115.180.145
+13.115.247.182
  13.115.26.69
  13.115.40.246
  13.124.176.17
@@ -21322,7 +21384,6 @@
  13.124.222.242
  13.124.238.252
  13.124.250.6
-13.124.42.194
  13.124.60.74
  13.124.65.191
  13.124.74.157
@@ -21333,23 +21394,19 @@
  13.125.241.129
  13.125.97.172
  13.126.144.12
-13.126.16.108
  13.126.181.139
  13.126.195.46
  13.126.233.244
  13.126.42.55
  13.126.49.193
  13.126.69.46
-13.127.112.75
  13.127.120.216
  13.127.130.18
  13.127.153.0
  13.127.8.76
-13.209.0.41
  13.209.102.77
  13.209.125.83
  13.209.215.189
-13.209.28.104
  13.209.66.255
  13.209.81.230
  13.210.163.7
@@ -21357,9 +21414,7 @@
  13.211.142.164
  13.211.157.229
  13.212.167.50
-13.212.94.123
  13.212.96.45
-13.228.104.57
  13.228.13.83
  13.228.130.195
  13.228.139.137
@@ -21367,6 +21422,7 @@
  13.228.36.171
  13.228.47.114
  13.228.53.43
+13.228.91.206
  13.229.105.154
  13.229.116.148
  13.229.126.201
@@ -21376,14 +21432,15 @@
  13.229.140.55
  13.229.150.245
  13.229.154.1
+13.229.217.87
  13.229.227.15
  13.229.228.245
  13.229.229.180
+13.229.234.225
  13.229.25.57
  13.229.64.51
  13.229.70.196
  13.229.76.177
-13.229.98.196
  13.230.125.114
  13.230.143.16
  13.230.184.219
@@ -21395,7 +21452,9 @@
  13.231.223.46
  13.231.8.224
  13.231.85.192
+13.232.178.66
  13.232.187.242
+13.232.206.172
  13.232.223.53
  13.233.100.89
  13.233.140.199
@@ -21403,13 +21462,14 @@
  13.233.153.105
  13.233.176.53
  13.233.216.152
+13.233.237.113
+13.233.73.212
  13.233.82.105
  13.233.83.130
  13.234.25.193
  13.234.48.39
  13.234.77.200
  13.235.133.133
-13.235.204.7
  13.235.43.39
  13.235.72.38
  13.236.100.67
@@ -21419,7 +21479,9 @@
  13.237.201.19
  13.237.210.134
  13.238.116.2
+13.238.200.41
  13.239.114.62
+13.244.114.105
  13.250.106.56
  13.250.111.70
  13.250.115.44
@@ -21439,10 +21501,12 @@
  13.251.201.226
  13.251.210.202
  13.251.77.185
+13.36.37.62
  13.48.104.1
  13.48.25.119
  13.48.31.194
  13.48.53.51
+13.49.144.251
  13.52.185.39
  13.52.215.54
  13.52.215.7
@@ -21470,10 +21534,12 @@
  13.56.232.134
  13.56.255.74
  13.56.56.48
+13.56.78.74
  13.56.79.45
  13.57.129.84
  13.57.181.54
  13.57.209.136
+13.57.216.7
  13.57.217.141
  13.57.224.254
  13.57.246.225
@@ -21490,6 +21556,7 @@
  13.58.30.119
  13.58.32.75
  13.58.4.41
+13.58.52.68
  13.58.54.219
  13.58.56.77
  13.58.80.103
@@ -21497,7 +21564,9 @@
  13.58.91.93
  13.59.11.163
  13.59.111.77
+13.59.129.192
  13.59.13.13
+13.59.148.67
  13.59.153.150
  13.59.154.158
  13.59.155.220
@@ -21509,6 +21578,7 @@
  13.59.195.245
  13.59.199.131
  13.59.214.96
+13.59.221.192
  13.59.224.78
  13.59.228.16
  13.59.234.98
@@ -21516,6 +21586,7 @@
  13.59.238.218
  13.59.24.85
  13.59.248.163
+13.59.252.113
  13.59.252.28
  13.59.252.31
  13.59.29.84
@@ -21528,11 +21599,13 @@
  13.64.175.205
  13.64.180.238
  13.64.77.225
+13.65.0.96
  13.65.147.163
  13.65.147.40
  13.65.215.106
  13.65.246.58
  13.65.42.254
+13.65.56.62
  13.65.80.18
  13.66.128.69
  13.66.131.233
@@ -21570,11 +21643,9 @@
  13.66.255.220
  13.66.28.137
  13.66.39.248
-13.66.8.23
  13.67.106.218
  13.67.106.29
  13.67.112.246
-13.67.141.199
  13.67.236.36
  13.67.32.123
  13.68.153.168
@@ -21583,13 +21654,12 @@
  13.68.229.202
  13.68.249.191
  13.69.153.185
-13.69.186.127
  13.69.199.206
  13.69.50.143
  13.71.136.69
-13.71.29.127
  13.71.46.226
  13.71.68.160
+13.72.103.144
  13.72.74.28
  13.72.80.225
  13.72.82.82
@@ -21598,7 +21668,6 @@
  13.73.1.69
  13.73.16.128
  13.73.16.134
-13.73.20.163
  13.73.23.121
  13.74.12.201
  13.74.157.69
@@ -21608,27 +21677,17 @@
  13.75.193.159
  13.75.194.31
  13.75.220.102
-13.76.1.44
+13.75.227.196
  13.76.100.168
+13.76.141.135
  13.76.142.50
-13.76.153.249
-13.76.155.104
-13.76.157.111
-13.76.158.86
  13.76.165.246
-13.76.186.30
-13.76.195.45
-13.76.230.187
  13.76.241.217
  13.76.242.131
  13.76.242.146
  13.76.246.8
  13.76.248.253
-13.76.34.103
  13.76.34.31
-13.76.36.87
-13.76.37.219
-13.76.39.39
  13.76.91.32
  13.77.204.88
  13.77.205.248
@@ -21650,27 +21709,26 @@
  13.80.134.215
  13.80.147.35
  13.80.67.162
-13.81.116.7
  13.81.250.228
  13.81.6.165
  13.82.0.138
  13.82.102.20
  13.82.105.123
+13.82.128.169
  13.82.147.112
  13.82.149.166
  13.82.179.224
  13.82.18.238
  13.82.187.131
  13.82.198.161
+13.82.199.50
  13.82.22.80
  13.82.220.196
  13.82.24.91
  13.82.29.22
  13.82.58.15
  13.82.60.6
-13.82.65.38
  13.82.81.171
-13.82.81.197
  13.82.84.112
  13.84.135.5
  13.84.146.71
@@ -21718,7 +21776,6 @@
  13.92.16.89
  13.92.184.128
  13.92.27.130
-13.92.29.114
  13.92.32.34
  13.92.38.69
  13.92.47.137
@@ -21742,19 +21799,21 @@
  130.149.80.221
  130.162.71.237
  130.164.129.124
+130.164.143.254
  130.180.28.106
  130.180.66.97
  130.180.99.26
  130.185.109.17
  130.185.123.80
  130.185.124.192
-130.185.124.219
  130.185.124.220
+130.185.126.219
  130.185.126.247
  130.185.152.148
  130.185.152.155
  130.185.152.2
  130.185.153.101
+130.185.153.104
  130.185.153.127
  130.185.153.64
  130.185.155.10
@@ -21765,7 +21824,6 @@
  130.185.157.80
  130.185.250.194
  130.185.250.76
-130.185.74.247
  130.185.76.142
  130.185.77.105
  130.185.77.218
@@ -21774,9 +21832,7 @@
  130.193.112.146
  130.193.48.245
  130.204.105.4
-130.204.115.164
  130.204.161.3
-130.204.237.146
  130.211.127.239
  130.211.147.219
  130.211.152.110
@@ -21798,26 +21854,27 @@
  130.211.87.95
  130.211.99.13
  130.226.169.137
+130.245.192.11
  130.25.112.13
  130.255.189.66
  130.255.189.68
+130.43.236.198
  130.51.200.132
  130.61.100.68
  130.61.106.221
  130.61.113.65
  130.61.118.231
  130.61.123.211
-130.61.127.112
  130.61.134.151
  130.61.227.100
  130.61.233.14
  130.61.253.198
  130.61.255.187
-130.61.255.76
  130.61.30.186
  130.61.33.94
  130.61.36.89
  130.61.38.29
+130.61.39.7
  130.61.47.75
  130.61.62.31
  130.61.77.167
@@ -21825,7 +21882,6 @@
  130.61.90.106
  130.61.92.43
  130.76.24.29
-130.88.179.98
  130.93.111.5
  130.zuole.ml
  1300345608.jclecardinal.com
@@ -21842,6 +21898,7 @@
  131.0.246.158
  131.0.86.130
  131.0.87.225
+131.0.89.202
  131.1.217.136
  131.100.238.33
  131.100.238.9
@@ -21854,7 +21911,6 @@
  131.108.114.113
  131.108.116.92
  131.108.118.103
-131.108.118.27
  131.108.16.133
  131.108.16.14
  131.108.16.195
@@ -21862,11 +21918,11 @@
  131.108.16.83
  131.108.45.72
  131.108.45.78
-131.108.75.71
  131.108.80.193
  131.117.150.106
  131.117.208.242
  131.147.11.231
+131.147.241.54
  131.147.86.142
  131.153.22.134
  131.153.38.126
@@ -21886,7 +21942,6 @@
  131.161.236.254
  131.161.238.14
  131.161.253.190
-131.161.255.6
  131.161.35.20
  131.161.54.14
  131.161.65.47
@@ -21895,15 +21950,18 @@
  131.161.68.37
  131.161.68.41
  131.161.68.45
+131.161.88.179
  131.161.9.195
  131.161.9.225
  131.161.9.239
  131.161.9.251
  131.188.40.191
  131.188.43.61
+131.196.141.111
  131.196.141.113
  131.196.141.116
  131.196.141.119
+131.196.141.123
  131.196.141.127
  131.196.141.149
  131.196.141.150
@@ -21912,22 +21970,26 @@
  131.196.141.164
  131.196.141.172
  131.196.141.176
+131.196.141.182
+131.196.141.188
  131.196.141.192
  131.196.141.195
  131.196.141.197
-131.196.141.198
+131.196.141.199
  131.196.141.203
  131.196.141.206
  131.196.141.210
+131.196.141.220
  131.196.141.243
  131.196.141.248
  131.196.141.47
  131.196.141.89
  131.196.141.90
-131.196.141.97
+131.196.141.98
  131.196.143.10
  131.196.143.107
  131.196.143.109
+131.196.143.117
  131.196.143.120
  131.196.143.129
  131.196.143.147
@@ -21936,9 +21998,9 @@
  131.196.143.178
  131.196.143.184
  131.196.143.191
-131.196.143.198
  131.196.143.206
  131.196.143.21
+131.196.143.210
  131.196.143.213
  131.196.143.230
  131.196.143.235
@@ -21979,15 +22041,16 @@
  131.221.217.176
  131.221.42.94
  131.221.73.211
-131.255.212.120
  131.255.32.45
  131.255.32.69
  131.255.4.96
+131.72.13.42
  131.72.139.150
  131.72.141.90
  131.72.201.187
  131.72.205.98
  131.94.129.191
+131010.xyz
  13123431043915105561.002.sh.cn
  131425.000webhostapp.com
  1314520bet.com
@@ -21997,32 +22060,32 @@
  132.145.165.79
  132.145.168.92
  132.145.18.53
-132.145.182.147
  132.145.199.52
  132.145.200.167
  132.145.210.51
  132.145.241.192
+132.145.242.131
+132.147.53.138
+132.147.67.58
  132.148.104.133
  132.148.134.226
  132.148.141.147
  132.148.144.101
  132.148.153.156
  132.148.154.8
-132.148.155.180
  132.148.159.44
  132.148.165.94
  132.148.166.225
  132.148.17.38
  132.148.22.79
+132.148.22.86
  132.148.28.20
-132.148.29.6
  132.148.37.253
  132.148.42.109
  132.148.80.37
  132.148.91.227
  132.148.99.126
  132.157.66.21
-132.232.1.155
  132.232.10.144
  132.232.108.149
  132.232.112.96
@@ -22059,11 +22122,9 @@
  132.232.49.143
  132.232.50.152
  132.232.50.203
-132.232.53.85
  132.232.57.135
  132.232.59.247
  132.232.59.78
-132.232.6.207
  132.232.60.183
  132.232.66.128
  132.232.67.52
@@ -22134,7 +22195,6 @@
  133.167.32.104
  133.167.95.209
  133.175.191.100
-133.18.195.141
  133.205.118.202
  133.208.23.52
  133.242.155.85
@@ -22147,10 +22207,13 @@
  133gvb.com
  134.0.10.177
  134.0.103.154
+134.0.115.57
  134.0.119.149
  134.0.119.176
  134.0.63.134
+134.101.148.145
  134.101.156.34
+134.101.214.83
  134.102.228.73
  134.119.179.146
  134.119.219.71
@@ -22162,7 +22225,7 @@
  134.122.103.82
  134.122.107.214
  134.122.108.202
-134.122.108.215
+134.122.111.15
  134.122.112.132
  134.122.112.89
  134.122.113.222
@@ -22172,7 +22235,6 @@
  134.122.118.167
  134.122.118.66
  134.122.124.193
-134.122.126.161
  134.122.126.36
  134.122.126.44
  134.122.130.145
@@ -22194,14 +22256,21 @@
  134.122.25.139
  134.122.25.32
  134.122.26.164
+134.122.27.230
+134.122.28.82
  134.122.29.105
  134.122.3.146
  134.122.32.20
  134.122.32.207
+134.122.33.111
+134.122.33.21
  134.122.33.236
+134.122.33.26
+134.122.33.86
+134.122.34.39
  134.122.40.54
  134.122.40.78
-134.122.42.167
+134.122.40.9
  134.122.43.92
  134.122.44.197
  134.122.44.93
@@ -22215,18 +22284,20 @@
  134.122.69.50
  134.122.69.7
  134.122.72.221
+134.122.72.53
+134.122.78.89
  134.122.81.145
  134.122.87.117
  134.122.9.180
  134.122.90.113
  134.122.90.115
+134.122.94.113
  134.122.94.183
  134.122.95.167
  134.17.25.212
  134.17.26.116
  134.17.26.161
  134.17.5.55
-134.17.94.150
  134.175.110.112
  134.175.111.215
  134.175.118.218
@@ -22270,7 +22341,6 @@
  134.19.146.45
  134.19.254.2
  134.208.10.111
-134.209.10.130
  134.209.100.103
  134.209.102.56
  134.209.103.181
@@ -22293,6 +22363,7 @@
  134.209.144.106
  134.209.145.206
  134.209.146.100
+134.209.147.203
  134.209.148.107
  134.209.149.246
  134.209.149.43
@@ -22307,18 +22378,20 @@
  134.209.159.76
  134.209.161.39
  134.209.163.219
-134.209.168.87
  134.209.172.2
  134.209.173.199
  134.209.174.133
+134.209.176.202
  134.209.178.106
  134.209.178.93
+134.209.179.57
  134.209.180.188
  134.209.181.49
  134.209.182.42
  134.209.183.34
  134.209.185.191
  134.209.185.4
+134.209.186.168
  134.209.188.212
  134.209.191.116
  134.209.192.235
@@ -22327,7 +22400,6 @@
  134.209.196.235
  134.209.205.100
  134.209.210.183
-134.209.211.240
  134.209.211.69
  134.209.213.50
  134.209.216.249
@@ -22340,6 +22412,7 @@
  134.209.228.10
  134.209.228.253
  134.209.23.58
+134.209.230.13
  134.209.234.186
  134.209.235.138
  134.209.236.154
@@ -22353,8 +22426,10 @@
  134.209.249.106
  134.209.253.145
  134.209.254.186
+134.209.255.157
  134.209.30.112
  134.209.30.141
+134.209.35.168
  134.209.36.254
  134.209.36.52
  134.209.38.215
@@ -22362,6 +22437,7 @@
  134.209.41.198
  134.209.53.17
  134.209.67.135
+134.209.67.45
  134.209.68.4
  134.209.69.207
  134.209.7.179
@@ -22375,7 +22451,6 @@
  134.209.79.60
  134.209.81.185
  134.209.82.166
-134.209.82.212
  134.209.83.193
  134.209.84.223
  134.209.85.106
@@ -22392,7 +22467,6 @@
  134.213.138.164
  134.213.153.11
  134.220.183.36
-134.236.109.19
  134.236.16.234
  134.236.2.221
  134.236.205.2
@@ -22415,35 +22489,30 @@
  134.249.198.175
  134.249.198.205
  134.249.198.42
-134.249.198.47
  134.249.199.121
-134.249.199.143
-134.249.199.15
  134.249.199.175
  134.249.199.62
  134.249.53.96
  134.249.54.230
  134.249.55.71
  134.255.225.20
+134.255.232.187
+134.255.62.138
  134.3.207.32
  134.3.227.7
-134.35.204.41
-134.35.222.85
-134.35.225.201
  134.35.225.55
  134.35.85.58
  134.41.180.102
  134.56.2.9
  134.6.212.170
-134.73.121.194
  134.73.199.154
  134.73.55.222
  134.90.149.147
  13453765871837679316.googlegroups.com
  134d384annuyy.000webhostapp.com
  135.0.15.17
+135.0.225.179
  135.12.178.167
-135.125.10.145
  135.125.101.50
  135.125.101.51
  135.125.101.52
@@ -22487,16 +22556,12 @@
  135.125.141.212
  135.125.141.239
  135.125.141.58
-135.125.141.79
-135.125.142.164
  135.125.142.168
-135.125.142.183
-135.125.142.210
-135.125.142.70
  135.125.24.240
  135.125.92.241
  135.148.2.109
  135.148.2.113
+135.148.2.114
  135.148.2.77
  135.148.2.82
  135.148.2.94
@@ -22518,7 +22583,6 @@
  135.148.32.176
  135.148.32.178
  135.148.32.179
-135.148.32.200
  135.148.33.100
  135.148.33.101
  135.148.33.102
@@ -22629,6 +22693,7 @@
  135.181.145.169
  135.181.15.104
  135.181.150.136
+135.181.152.128
  135.181.154.220
  135.181.16.238
  135.181.164.152
@@ -22640,15 +22705,15 @@
  135.181.181.161
  135.181.182.56
  135.181.197.116
+135.181.198.47
+135.181.208.79
  135.181.211.75
-135.181.233.202
  135.181.241.54
  135.181.242.50
  135.181.25.175
  135.181.41.129
  135.181.43.48
  135.181.44.249
-135.181.49.129
  135.181.49.56
  135.181.5.233
  135.181.82.169
@@ -22680,20 +22745,12 @@
  136.144.250.90
  136.144.43.159
  136.145.1.16
-136.158.11.2
-136.158.31.150
  136.158.31.205
-136.158.31.34
  136.158.32.110
-136.158.32.112
  136.158.32.129
-136.158.32.89
-136.158.33.244
  136.158.35.160
  136.169.169.185
-136.169.224.150
  136.169.224.97
-136.169.243.126
  136.2.1.104
  136.2.1.164
  136.2.1.169
@@ -22704,22 +22761,20 @@
  136.228.128.51
  136.228.131.104
  136.228.160.250
-136.228.161.27
  136.228.161.66
  136.228.161.67
+136.228.162.66
  136.228.168.53
  136.232.116.2
+136.232.124.14
  136.232.226.202
  136.232.236.6
  136.232.53.166
+136.233.130.146
  136.233.136.41
  136.233.23.226
-136.233.51.83
-136.233.51.85
-136.233.51.86
  136.24.119.249
  136.24.133.49
-136.24.78.123
  136.243.10.242
  136.243.10.75
  136.243.102.80
@@ -22736,6 +22791,7 @@
  136.243.152.18
  136.243.167.51
  136.243.172.46
+136.243.173.169
  136.243.174.119
  136.243.176.210
  136.243.201.249
@@ -22771,11 +22827,9 @@
  136.244.65.212
  136.244.77.163
  136.244.99.133
-136.26.72.110
  136.32.164.64
  136.32.230.54
  136.33.189.193
-136.33.232.165
  136.33.234.175
  136.34.197.3
  136.34.203.180
@@ -22788,13 +22842,11 @@
  136.36.6.245
  136.37.176.126
  136.49.100.117
-136.49.130.150
  136.49.140.142
  136.49.222.221
  136.49.96.161
  136.52.114.123
-136.52.12.245
-136.53.110.133
+136.52.29.174
  136.55.36.157
  136.55.40.183
  136.56.165.251
@@ -22812,13 +22864,10 @@
  136.8.33.69
  136.8.33.71
  136710.txtplug.com
-137.101.231.194
  137.101.65.24
-137.103.255.251
  137.103.89.159
+137.116.129.17
  137.116.144.63
-137.116.195.107
-137.116.197.105
  137.116.224.184
  137.116.242.214
  137.116.84.38
@@ -22826,35 +22875,37 @@
  137.117.178.120
  137.117.21.137
  137.117.212.72
+137.117.226.185
  137.119.36.33
  137.119.52.140
+137.119.55.25
  137.135.101.175
  137.135.101.9
  137.135.201.210
+137.175.10.77
  137.175.13.129
  137.175.13.130
  137.175.13.65
  137.175.13.68
+137.175.17.221
  137.175.2.201
  137.175.29.33
  137.175.29.34
  137.175.9.65
+137.220.133.118
  137.220.137.51
  137.220.175.190
  137.220.178.33
  137.220.232.221
-137.220.233.54
  137.25.140.167
  137.255.9.46
  137.26.118.22
-137.27.229.98
  137.59.110.53
  137.59.120.58
  137.59.162.114
  137.59.162.86
  137.59.18.162
  137.59.18.190
-137.59.185.253
  137.59.187.107
  137.59.187.126
  137.59.19.132
@@ -22863,7 +22914,6 @@
  137.59.243.42
  137.59.253.52
  137.59.50.225
-137.59.79.172
  137.74.0.3
  137.74.100.178
  137.74.106.111
@@ -22894,8 +22944,8 @@
  137.74.220.239
  137.74.227.71
  137.74.230.184
-137.74.233.168
  137.74.243.161
+137.74.245.180
  137.74.254.198
  137.74.254.242
  137.74.28.175
@@ -22907,12 +22957,13 @@
  137.74.64.244
  137.74.77.15
  137.74.80.246
+137.74.82.46
+137.74.82.61
  137.74.85.74
  13741.url.snwxn.com
  137645-securecheck-pp.icu
  138.0.102.246
  138.0.143.55
-138.0.200.147
  138.0.207.18
  138.0.210.114
  138.0.230.49
@@ -22921,7 +22972,6 @@
  138.117.143.226
  138.117.37.244
  138.117.39.201
-138.117.58.131
  138.117.85.17
  138.117.85.97
  138.118.213.213
@@ -22930,49 +22980,50 @@
  138.121.128.19
  138.121.128.34
  138.121.134.135
+138.121.16.95
+138.121.170.141
  138.121.170.194
-138.121.183.255
+138.121.183.228
  138.121.198.90
  138.121.245.93
  138.121.32.133
  138.121.32.182
  138.122.105.118
  138.122.140.88
+138.122.143.211
  138.122.143.40
  138.122.148.215
  138.122.192.10
  138.122.192.111
  138.122.192.129
-138.122.192.150
+138.122.192.13
  138.122.192.222
  138.122.192.227
-138.122.192.24
-138.122.192.240
  138.122.192.246
+138.122.192.58
+138.122.222.112
  138.122.240.1
  138.122.7.25
  138.122.7.33
  138.122.8.49
  138.124.187.29
+138.128.0.89
  138.128.1.189
  138.128.1.250
-138.128.10.207
  138.128.11.136
  138.128.11.138
  138.128.11.18
  138.128.11.59
  138.128.11.70
+138.128.119.35
  138.128.13.251
-138.128.13.47
  138.128.13.52
  138.128.13.82
  138.128.14.103
  138.128.14.230
  138.128.16.187
  138.128.160.90
-138.128.170.50
  138.128.196.177
-138.128.2.190
  138.128.201.92
  138.128.206.63
  138.128.209.124
@@ -22981,20 +23032,17 @@
  138.128.242.121
  138.128.3.20
  138.128.30.139
-138.128.34.124
-138.128.4.100
+138.128.30.245
  138.128.4.222
+138.128.40.215
  138.128.44.189
  138.128.45.103
  138.128.45.104
  138.128.45.109
  138.128.52.107
  138.128.59.184
-138.128.6.14
  138.128.69.61
-138.128.7.203
  138.128.84.138
-138.128.84.144
  138.128.84.151
  138.128.84.159
  138.134.102.16
@@ -23002,11 +23050,11 @@
  138.185.56.166
  138.186.122.105
  138.186.138.104
+138.186.138.39
  138.186.165.181
-138.186.4.153
-138.186.42.214
  138.19.24.123
  138.197.10.226
+138.197.100.112
  138.197.101.210
  138.197.102.10
  138.197.102.39
@@ -23047,8 +23095,10 @@
  138.197.149.107
  138.197.149.119
  138.197.149.97
+138.197.15.19
  138.197.15.250
  138.197.15.40
+138.197.15.67
  138.197.150.132
  138.197.151.125
  138.197.151.129
@@ -23060,7 +23110,6 @@
  138.197.157.80
  138.197.159.227
  138.197.161.96
-138.197.162.136
  138.197.162.193
  138.197.162.209
  138.197.163.127
@@ -23078,13 +23127,14 @@
  138.197.171.66
  138.197.171.79
  138.197.172.32
+138.197.174.161
  138.197.178.159
  138.197.178.85
  138.197.179.100
  138.197.180.102
-138.197.180.194
  138.197.181.95
  138.197.183.33
+138.197.184.178
  138.197.184.77
  138.197.185.5
  138.197.187.166
@@ -23121,6 +23171,7 @@
  138.197.215.65
  138.197.216.234
  138.197.217.164
+138.197.217.218
  138.197.221.218
  138.197.222.211
  138.197.225.93
@@ -23165,10 +23216,8 @@
  138.197.97.134
  138.197.97.212
  138.197.97.88
+138.197.98.133
  138.197.99.250
-138.199.18.77
-138.199.22.226
-138.199.26.186
  138.199.26.205
  138.201.101.22
  138.201.106.88
@@ -23198,6 +23247,7 @@
  138.201.35.218
  138.201.36.109
  138.201.36.175
+138.201.38.115
  138.201.44.27
  138.201.44.8
  138.201.52.104
@@ -23211,15 +23261,23 @@
  138.201.57.133
  138.201.58.141
  138.201.72.117
+138.201.89.179
  138.201.92.208
  138.204.100.70
  138.204.127.1
+138.204.140.113
  138.204.140.199
+138.204.143.80
  138.204.143.81
+138.204.143.82
+138.204.143.83
+138.204.143.84
+138.204.143.85
  138.204.171.108
  138.204.179.162
  138.204.195.185
  138.204.78.248
+138.207.154.32
  138.210.192.120
  138.210.193.11
  138.210.193.84
@@ -23234,9 +23292,7 @@
  138.219.236.4
  138.219.98.148
  138.229.109.162
-138.229.110.110
  138.229.114.30
-138.229.185.193
  138.229.234.41
  138.229.26.42
  138.255.0.27
@@ -23250,12 +23306,13 @@
  138.255.240.66
  138.36.0.36
  138.36.171.200
+138.36.200.126
+138.36.201.159
  138.36.22.108
  138.36.3.180
  138.36.40.54
  138.36.41.116
  138.36.77.76
-138.36.78.28
  138.36.98.107
  138.59.140.65
  138.59.140.74
@@ -23272,8 +23329,8 @@
  138.68.0.64
  138.68.0.87
  138.68.100.102
+138.68.101.231
  138.68.105.248
-138.68.106.253
  138.68.106.62
  138.68.106.82
  138.68.108.72
@@ -23323,7 +23380,6 @@
  138.68.19.195
  138.68.2.156
  138.68.2.190
-138.68.20.137
  138.68.20.197
  138.68.20.95
  138.68.21.125
@@ -23344,7 +23400,6 @@
  138.68.237.102
  138.68.239.219
  138.68.24.249
-138.68.24.88
  138.68.242.14
  138.68.242.68
  138.68.244.244
@@ -23427,7 +23482,6 @@
  138.68.98.102
  138.68.99.110
  138.68.99.81
-138.75.240.41
  138.91.120.191
  138.91.145.18
  138.91.162.26
@@ -23446,24 +23500,20 @@
  138.94.218.73
  138.94.49.70
  138.94.58.11
-138.94.76.146
-138.97.0.116
  138.97.0.162
-138.97.0.169
  138.97.0.8
  138.97.1.153
  138.97.1.175
+138.97.1.27
  138.97.1.53
  138.97.105.238
  138.97.116.168
  138.97.116.170
  138.97.116.190
  138.97.12.150
-138.97.2.204
  138.97.2.39
  138.97.2.43
  138.97.2.64
-138.97.215.251
  138.97.236.11
  138.97.236.13
  138.97.236.14
@@ -23480,8 +23530,7 @@
  138.97.244.130
  138.97.60.140
  138.97.60.141
-138.97.64.58
-138.97.92.192
+138.97.92.233
  138.97.93.187
  138.99.19.108
  138.99.224.223
@@ -23490,7 +23539,6 @@
  138.99.6.198
  138.99.65.27
  138.99.7.29
-138.99.7.75
  138.99.93.224
  138.99.93.227
  138.99.93.62
@@ -23506,6 +23554,7 @@
  139.0.54.168
  139.0.6.36
  139.0.77.165
+139.129.108.135
  139.129.206.8
  139.129.221.158
  139.130.206.73
@@ -23517,7 +23566,6 @@
  139.155.11.173
  139.155.127.59
  139.155.13.21
-139.155.15.21
  139.155.16.50
  139.155.17.13
  139.155.17.18
@@ -23526,12 +23574,10 @@
  139.155.174.181
  139.155.175.148
  139.155.179.136
-139.155.179.86
  139.155.181.145
  139.155.182.156
  139.155.183.3
  139.155.2.183
-139.155.2.51
  139.155.2.6
  139.155.204.11
  139.155.204.28
@@ -23540,7 +23586,6 @@
  139.155.226.161
  139.155.226.188
  139.155.229.38
-139.155.23.147
  139.155.23.172
  139.155.230.137
  139.155.231.29
@@ -23553,51 +23598,48 @@
  139.155.240.73
  139.155.242.183
  139.155.242.50
-139.155.243.48
  139.155.243.6
  139.155.243.80
  139.155.247.50
  139.155.248.142
  139.155.248.228
+139.155.249.13
  139.155.251.145
  139.155.252.237
  139.155.252.63
-139.155.254.25
  139.155.254.64
  139.155.29.40
-139.155.30.122
  139.155.34.16
  139.155.34.181
  139.155.35.220
  139.155.35.47
  139.155.39.22
  139.155.39.62
-139.155.42.189
  139.155.46.147
  139.155.5.118
  139.155.5.247
+139.155.5.75
  139.155.54.93
-139.155.68.58
+139.155.59.176
  139.155.69.205
-139.155.72.204
  139.155.73.239
  139.155.73.60
-139.155.74.13
  139.155.75.170
  139.155.76.42
  139.155.77.135
  139.155.77.44
  139.155.79.24
-139.155.81.79
  139.155.83.131
  139.155.84.160
-139.155.85.171
  139.155.86.214
  139.155.87.123
+139.155.87.149
  139.155.87.17
+139.155.87.225
  139.155.87.53
  139.155.88.128
  139.155.88.85
+139.155.89.11
  139.155.9.29
  139.155.90.176
  139.155.93.88
@@ -23623,6 +23665,7 @@
  139.162.115.29
  139.162.115.31
  139.162.119.235
+139.162.120.98
  139.162.121.170
  139.162.122.33
  139.162.124.224
@@ -23637,6 +23680,7 @@
  139.162.154.196
  139.162.155.203
  139.162.16.228
+139.162.160.244
  139.162.161.62
  139.162.162.104
  139.162.164.153
@@ -23658,6 +23702,7 @@
  139.162.193.105
  139.162.194.83
  139.162.196.194
+139.162.198.43
  139.162.20.92
  139.162.203.77
  139.162.204.110
@@ -23679,7 +23724,6 @@
  139.162.28.242
  139.162.30.134
  139.162.31.115
-139.162.31.31
  139.162.38.253
  139.162.39.15
  139.162.40.187
@@ -23694,6 +23738,7 @@
  139.162.56.72
  139.162.56.8
  139.162.57.114
+139.162.59.74
  139.162.60.124
  139.162.7.42
  139.162.70.46
@@ -23712,7 +23757,6 @@
  139.162.91.117
  139.162.97.52
  139.162.99.243
-139.167.161.166
  139.170.150.189
  139.170.150.250
  139.170.150.251
@@ -23731,12 +23775,10 @@
  139.180.137.38
  139.180.143.8
  139.180.147.144
-139.180.165.197
  139.180.173.188
  139.180.193.170
  139.180.193.222
  139.180.194.11
-139.180.2.93
  139.180.200.118
  139.180.202.99
  139.180.205.145
@@ -23777,20 +23819,20 @@
  139.186.68.53
  139.186.69.195
  139.186.69.226
-139.186.71.224
  139.186.72.25
  139.186.73.140
  139.186.74.211
  139.186.77.46
  139.186.78.122
  139.186.82.39
+139.190.238.152
  139.190.238.18
+139.190.238.9
  139.193.121.173
-139.193.168.43
-139.193.172.182
  139.194.130.103
  139.194.162.113
  139.195.21.227
+139.196.42.56
  139.198.120.226
  139.198.121.63
  139.198.122.116
@@ -23804,7 +23846,6 @@
  139.198.176.198
  139.198.177.151
  139.198.178.45
-139.198.179.130
  139.198.179.84
  139.198.18.230
  139.198.186.55
@@ -23829,7 +23870,6 @@
  139.199.189.158
  139.199.205.185
  139.199.22.202
-139.199.220.111
  139.199.223.208
  139.199.228.133
  139.199.23.233
@@ -23838,6 +23878,7 @@
  139.199.29.155
  139.199.3.24
  139.199.32.22
+139.199.32.57
  139.199.35.155
  139.199.35.168
  139.199.4.191
@@ -23851,6 +23892,7 @@
  139.199.80.67
  139.199.80.75
  139.199.87.1
+139.210.243.37
  139.210.98.218
  139.213.220.70
  139.215.195.61
@@ -23862,7 +23904,6 @@
  139.217.129.158
  139.217.134.138
  139.217.218.93
-139.217.227.225
  139.217.233.143
  139.217.7.111
  139.217.98.200
@@ -23872,9 +23913,10 @@
  139.219.10.21
  139.219.11.248
  139.219.11.254
+139.219.111.150
  139.219.12.104
  139.219.13.130
-139.219.130.173
+139.219.13.163
  139.219.14.115
  139.219.14.180
  139.219.15.1
@@ -23904,9 +23946,12 @@
  139.219.9.146
  139.219.9.60
  139.224.210.214
+139.224.24.169
  139.224.72.224
  139.224.81.41
  139.224.82.108
+139.226.21.48
+139.226.34.0
  139.227.130.25
  139.227.201.157
  139.228.91.246
@@ -23940,18 +23985,21 @@
  139.5.144.70
  139.5.145.154
  139.5.146.80
+139.5.157.228
  139.5.159.95
  139.5.16.174
  139.5.177.10
  139.5.177.73
  139.5.237.163
+139.5.254.107
+139.5.255.202
  139.5.29.97
  139.5.71.46
  139.5.73.52
+139.5.75.3
  139.59.1.159
  139.59.1.162
  139.59.1.195
-139.59.10.184
  139.59.10.90
  139.59.102.170
  139.59.104.33
@@ -23965,6 +24013,7 @@
  139.59.112.146
  139.59.112.158
  139.59.112.44
+139.59.113.131
  139.59.115.198
  139.59.115.54
  139.59.116.241
@@ -23979,7 +24028,6 @@
  139.59.12.65
  139.59.121.221
  139.59.121.225
-139.59.124.4
  139.59.125.61
  139.59.127.178
  139.59.128.39
@@ -23995,18 +24043,19 @@
  139.59.136.64
  139.59.136.84
  139.59.140.233
-139.59.141.105
  139.59.141.179
  139.59.142.223
  139.59.144.132
  139.59.145.220
  139.59.145.231
  139.59.146.28
+139.59.147.218
  139.59.148.192
  139.59.148.209
  139.59.148.212
-139.59.15.144
+139.59.150.105
  139.59.150.32
+139.59.153.133
  139.59.153.138
  139.59.154.228
  139.59.154.235
@@ -24014,6 +24063,7 @@
  139.59.156.228
  139.59.158.239
  139.59.159.135
+139.59.159.48
  139.59.16.118
  139.59.162.225
  139.59.162.37
@@ -24026,7 +24076,6 @@
  139.59.172.182
  139.59.172.23
  139.59.174.107
-139.59.176.221
  139.59.18.197
  139.59.18.215
  139.59.180.212
@@ -24039,11 +24088,12 @@
  139.59.187.138
  139.59.187.232
  139.59.19.157
-139.59.19.65
+139.59.19.36
  139.59.191.7
  139.59.196.82
  139.59.197.250
  139.59.2.146
+139.59.2.181
  139.59.20.81
  139.59.212.98
  139.59.213.25
@@ -24051,6 +24101,7 @@
  139.59.22.107
  139.59.22.194
  139.59.22.201
+139.59.22.254
  139.59.225.255
  139.59.226.129
  139.59.226.187
@@ -24058,7 +24109,6 @@
  139.59.228.156
  139.59.228.20
  139.59.230.202
-139.59.232.122
  139.59.234.147
  139.59.236.25
  139.59.238.45
@@ -24074,7 +24124,6 @@
  139.59.243.245
  139.59.244.237
  139.59.244.238
-139.59.245.17
  139.59.246.233
  139.59.247.235
  139.59.248.103
@@ -24096,6 +24145,7 @@
  139.59.31.173
  139.59.31.28
  139.59.32.156
+139.59.34.226
  139.59.35.52
  139.59.37.245
  139.59.38.252
@@ -24108,6 +24158,7 @@
  139.59.40.233
  139.59.41.34
  139.59.42.229
+139.59.43.196
  139.59.43.246
  139.59.43.75
  139.59.44.143
@@ -24120,7 +24171,6 @@
  139.59.56.149
  139.59.57.2
  139.59.57.39
-139.59.57.64
  139.59.60.244
  139.59.61.103
  139.59.61.215
@@ -24165,14 +24215,14 @@
  139.59.90.37
  139.59.92.213
  139.59.92.53
+139.59.93.135
  139.59.94.33
  139.59.95.250
  139.59.96.50
  139.59.99.11
  139.60.123.89
  139.60.183.10
-139.64.39.7
-139.87.66.121
+139.60.48.84
  139.87.67.24
  139.87.67.77
  139.87.70.118
@@ -24191,7 +24241,6 @@
  139.99.121.22
  139.99.123.236
  139.99.125.188
-139.99.125.35
  139.99.126.138
  139.99.133.150
  139.99.133.189
@@ -24217,6 +24266,7 @@
  139.99.237.135
  139.99.237.60
  139.99.239.230
+139.99.252.82
  139.99.26.68
  139.99.37.27
  139.99.40.151
@@ -24226,11 +24276,10 @@
  139.99.49.202
  139.99.5.210
  139.99.54.20
-139.99.62.61
+139.99.61.82
  139.99.66.231
  139.99.68.76
  139.99.69.189
-139.99.75.6
  139.99.79.185
  139.99.8.187
  139.99.8.31
@@ -24254,13 +24303,14 @@
  13r.lg.ua
  13stages.com
  13suntrust4.7m.pl
-14.0.136.134
  14.102.113.39
  14.102.118.236
  14.102.121.156
  14.102.13.244
  14.102.150.246
  14.102.155.74
+14.102.191.249
+14.102.26.201
  14.102.39.33
  14.102.40.169
  14.102.41.253
@@ -24269,10 +24319,8 @@
  14.102.64.209
  14.102.69.226
  14.102.7.19
-14.102.71.1
  14.102.71.10
  14.102.71.230
-14.102.71.90
  14.102.73.254
  14.102.74.99
  14.102.97.204
@@ -24285,8 +24333,7 @@
  14.116.149.110
  14.116.155.195
  14.116.205.182
-14.118.212.150
-14.118.215.2
+14.118.215.238
  14.120.35.42
  14.128.33.3
  14.128.9.199
@@ -24300,12 +24347,12 @@
  14.128.9.51
  14.128.9.53
  14.136.104.38
-14.136.105.170
  14.136.192.222
  14.136.201.82
  14.136.5.140
  14.136.80.242
  14.136.94.5
+14.137.7.149
  14.138.109.129
  14.138.109.133
  14.138.139.91bin.sh
@@ -24316,14 +24363,12 @@
  14.139.155.134
  14.139.185.114
  14.139.225.151
-14.139.237.162
  14.139.239.22
  14.139.242.247
  14.139.56.14
  14.139.57.195
  14.140.95.157
  14.141.175.107
-14.141.232.124
  14.141.254.244
  14.141.73.10
  14.141.93.162
@@ -24331,64 +24376,61 @@
  14.142.146.74
  14.143.137.18
  14.143.3.30
-14.146.94.156
  14.146.95.68
  14.152.18.104
  14.152.18.79
  14.152.95.91
-14.154.30.64
+14.155.17.220
  14.155.221.161
-14.156.203.238
+14.157.19.115
  14.160.120.172
  14.160.23.139
  14.160.93.230
  14.161.0.62
+14.161.225.56
  14.161.28.224
  14.161.44.120
  14.161.45.187
  14.161.46.132
+14.161.46.216
  14.161.47.128
  14.161.48.145
  14.161.48.4
  14.161.50.104
  14.161.6.201
+14.161.71.2
  14.162.144.102
  14.162.145.182
  14.162.146.128
  14.162.146.129
  14.162.157.19
-14.162.178.241
+14.162.174.243
  14.162.206.172
  14.162.23.1
+14.162.49.241
  14.163.33.209
+14.164.11.210
  14.164.212.100
  14.164.84.199
-14.165.187.233
  14.167.113.121
  14.168.243.105
  14.169.179.138
-14.169.239.251
  14.171.144.159
-14.172.102.126
-14.173.154.243
-14.173.74.221
+14.173.103.223
  14.174.29.252
-14.176.136.212
  14.176.168.170
-14.176.76.89
  14.177.156.159
  14.177.202.165
-14.177.232.93
+14.177.23.14
  14.177.235.178
-14.177.66.248
+14.177.253.32
  14.178.31.182
  14.178.39.68
  14.179.187.49
  14.179.224.67
  14.18.144.234
-14.180.131.228
-14.181.9.107
-14.182.42.193
+14.181.219.102
+14.181.245.84
  14.185.106.16
  14.185.20.188
  14.185.75.76
@@ -24396,54 +24438,57 @@
  14.186.170.4
  14.186.174.18
  14.188.114.136
-14.188.28.210
+14.188.233.243
  14.188.30.156
  14.189.198.194
  14.189.39.219
  14.190.200.107
  14.190.81.154
-14.191.213.178
  14.192.10.189
  14.192.143.92
  14.192.147.250
  14.192.192.17
  14.192.2.179
  14.192.208.49
-14.192.208.88
+14.192.209.11
  14.192.209.39
  14.192.213.136
-14.192.248.5
  14.192.31.17
  14.192.31.4
  14.192.31.65
  14.198.163.2
+14.200.1.238
  14.200.197.130
  14.200.204.192
+14.201.12.15
  14.201.234.2
  14.202.250.110
  14.203.57.50
+14.203.79.244
  14.204.20.35
  14.204.5.250
-14.207.123.102
+14.207.112.244
+14.207.13.182
  14.207.137.230
  14.207.147.87
  14.207.153.206
+14.207.164.39
  14.207.166.147
  14.207.177.235
-14.207.200.246
+14.207.19.158
+14.207.207.222
  14.207.28.116
-14.207.30.17
  14.207.36.110
  14.207.36.50
  14.207.56.68
  14.207.59.166
  14.207.62.84
  14.207.73.125
-14.207.73.157
  14.21.36.84
  14.213.136.17
  14.213.138.194
  14.214.192.183
+14.215.113.59
  14.215.158.100
  14.215.166.15
  14.215.166.17
@@ -24451,7 +24496,6 @@
  14.215.166.25
  14.215.237.205
  14.225.17.9
-14.225.19.80
  14.225.27.115
  14.225.27.184
  14.225.5.81
@@ -24461,13 +24505,13 @@
  14.226.65.151
  14.227.46.15
  14.227.89.44
+14.228.210.14
  14.228.238.38
-14.228.245.30
  14.228.32.155
  14.229.153.79
  14.229.62.205
  14.229.76.19
-14.230.246.93
+14.231.58.89
  14.232.155.45
  14.232.160.197
  14.232.160.213
@@ -24484,32 +24528,29 @@
  14.233.12.221
  14.233.138.195
  14.233.211.188
-14.236.133.7
-14.236.179.103
  14.238.1.202
  14.239.150.83
-14.240.78.4
+14.240.140.30
  14.241.209.27
  14.241.226.91
-14.241.234.67
  14.241.239.89
-14.241.242.43
  14.241.244.139
-14.241.254.169
-14.241.38.109
+14.241.40.18
+14.241.57.1
+14.241.91.49
  14.241.91.96
  14.244.24.204
-14.245.127.181
-14.248.128.173
+14.248.129.239
  14.248.137.211
-14.248.141.235
-14.248.183.178
-14.249.132.86
+14.248.167.238
+14.248.236.226
  14.249.153.67
  14.251.21.12
  14.251.46.203
  14.251.55.96
  14.252.170.203
+14.253.198.16
+14.253.254.54
  14.253.57.18
  14.254.178.5
  14.254.87.195
@@ -24517,47 +24558,51 @@
  14.29.160.20
  14.29.162.139
  14.29.184.45
+14.29.200.186
  14.29.247.69
  14.29.249.7
  14.29.64.91
  14.33.77.170
  14.36.251.30
-14.36.52.211
+14.37.102.177
  14.37.248.142
  14.37.43.23
  14.38.231.114
  14.39.108.194
  14.40.102.160bin.sh
  14.40.23.66
-14.40.78.198
  14.42.131.21
  14.42.144.52
  14.42.155.140
+14.42.161.205
  14.42.206.204
  14.42.89.179
  14.43.139.117
  14.43.191.134
+14.43.73.100
  14.45.11.198
-14.45.75.81
  14.46.12.180
  14.46.12.180bin.sh
  14.46.17.140
  14.46.190.42bin.sh
-14.46.199.21
  14.46.230.78
  14.47.124.192
  14.47.176.114
  14.47.232.33
  14.47.31.107
  14.48.96.34
+14.49.132.104
  14.49.37.103
  14.49.37.250
+14.50.80.36
  14.50.91.99
  14.51.6.13
  14.51.6.13bin.sh
+14.52.237.226
  14.52.249.27
  14.54.148.146
  14.54.16.206
+14.55.129.168
  14.56.180.103
  14.63.1.108
  14.63.160.219
@@ -24571,10 +24616,9 @@
  14.63.218.195
  14.63.37.135
  14.63.55.164
-14.7.60.174
  14.80.204.79
-14.9.210.64
  14.97.1.154
+14.98.115.50
  14.98.184.178
  14.98.4.82
  14.98.82.230
@@ -24587,13 +24631,13 @@
  14.99.33.34
  14.99.68.94
  14.99.81.218
+14.99.81.222
  14.ip-51-178-42.eu
  140-365.net
  140.112.36.193
  140.113.212.4
  140.113.88.236
  140.114.91.139
-140.115.197.237
  140.120.50.204
  140.128.85.2
  140.143.0.121
@@ -24626,7 +24670,6 @@
  140.143.195.181
  140.143.195.189
  140.143.20.100
-140.143.20.42
  140.143.200.251
  140.143.201.190
  140.143.206.191
@@ -24646,11 +24689,13 @@
  140.143.231.143
  140.143.231.85
  140.143.233.218
+140.143.233.249
  140.143.233.29
+140.143.236.227
  140.143.237.55
  140.143.239.72
  140.143.239.86
-140.143.24.254
+140.143.24.95
  140.143.240.237
  140.143.241.67
  140.143.243.27
@@ -24663,6 +24708,8 @@
  140.143.27.5
  140.143.28.158
  140.143.30.191
+140.143.30.37
+140.143.31.157
  140.143.31.202
  140.143.39.177
  140.143.39.200
@@ -24671,10 +24718,10 @@
  140.143.56.61
  140.143.57.159
  140.143.57.195
-140.143.57.203
  140.143.61.200
  140.143.88.110
  140.143.9.192
+140.143.90.154
  140.143.95.102
  140.147.236.194
  140.186.212.146
@@ -24687,6 +24734,7 @@
  140.206.72.238
  140.206.86.124
  140.206.86.125
+140.207.100.82
  140.207.114.138
  140.207.232.13
  140.207.232.28
@@ -24694,6 +24742,7 @@
  140.210.91.34
  140.210.92.82
  140.210.93.86
+140.213.200.108
  140.213.24.203
  140.213.9.52
  140.213.9.82
@@ -24705,7 +24754,6 @@
  140.238.167.184
  140.238.177.83
  140.238.188.191
-140.238.19.118
  140.238.191.193
  140.238.206.139
  140.238.244.154
@@ -24716,14 +24764,13 @@
  140.238.69.224
  140.240.81.70
  140.249.17.94
+140.249.19.110
  140.249.193.85
  140.249.202.128
  140.249.204.167
  140.249.205.149
-140.249.205.58
-140.249.213.243
+140.249.48.49
  140.249.49.140
-140.255.138.27
  140.78.60.4
  140.82.1.154
  140.82.28.35
@@ -24743,35 +24790,34 @@
  14079.url.snwxn.com
  140bd7dca2f0a46e46c62254903e7589-dot-dbenitonline.ey.r.appspot.com
  140teakwood.com
-141.0.11.241
-141.0.11.250
  141.0.20.5
-141.101.104.133
-141.101.104.231
-141.101.105.10
-141.101.105.107
-141.101.105.56
-141.101.105.70
+141.101.104.108
+141.101.104.237
+141.101.104.65
+141.101.105.32
+141.101.105.42
+141.101.105.76
+141.101.105.96
  141.101.107.138
  141.101.188.8
-141.101.77.122
-141.101.77.212
+141.101.69.181
+141.101.69.91
+141.101.76.6
+141.101.77.11
  141.101.8.36
-141.101.96.85
-141.101.97.11
  141.101.98.108
  141.101.98.128
-141.101.99.117
-141.101.99.171
+141.101.99.163
+141.101.99.19
+141.101.99.73
  141.105.65.254
-141.105.65.79
  141.105.68.25
  141.105.69.69
  141.108.255.109
  141.135.2.95
+141.136.241.25
  141.151.238.75
  141.154.76.46
-141.155.177.180
  141.164.56.244
  141.193.115.2
  141.223.5.11
@@ -24791,7 +24837,6 @@
  141.255.157.130
  141.255.166.190
  141.255.167.121
-141.255.69.49
  141.8.143.138
  141.8.143.163
  141.8.143.191
@@ -24799,9 +24844,10 @@
  141.8.143.205
  141.8.143.228
  141.8.55.249bin.sh
-141.8.99.75
+141.98.10.136
  141.98.10.142
  141.98.10.143
+141.98.10.183
  141.98.10.209
  141.98.10.210
  141.98.10.211
@@ -24811,14 +24857,17 @@
  141.98.10.43
  141.98.10.59
  141.98.100.69
-141.98.100.86
+141.98.103.108
  141.98.103.22
  141.98.103.23
  141.98.103.29
  141.98.252.163
-141.98.255.143
+141.98.255.144
  141.98.51.69
  141.98.51.70
+141.98.80.101
+141.98.80.102
+141.98.80.130
  141.98.80.132
  141.98.80.29
  141.98.80.59
@@ -24839,7 +24888,6 @@
  141.98.80.92
  141.98.80.93
  141.98.85.208
-141.98.85.252
  141.98.85.68
  1412studiodm.com
  14170.8wix.com
@@ -24899,17 +24947,22 @@
  142.112.81.183
  142.114.186.163
  142.114.220.39
+142.116.89.188
+142.118.192.166
  142.120.131.236
-142.126.123.118
+142.122.59.159
  142.126.166.36
  142.126.189.53
  142.126.205.172
-142.160.127.70
+142.134.182.107
  142.162.94.149
  142.165.133.55
+142.165.167.117
  142.165.34.200
  142.169.145.97
+142.179.224.4
  142.196.214.5
+142.197.121.38
  142.202.191.164
  142.202.205.28
  142.252.248.65
@@ -24921,8 +24974,8 @@
  142.4.196.34
  142.4.203.248
  142.4.204.122
-142.4.209.205
  142.4.211.170
+142.4.211.98
  142.4.212.121
  142.4.212.172
  142.4.214.151
@@ -24941,6 +24994,8 @@
  142.44.142.126
  142.44.142.226
  142.44.146.33
+142.44.147.96
+142.44.149.38
  142.44.156.131
  142.44.160.40
  142.44.161.132
@@ -24969,7 +25024,6 @@
  142.44.246.156
  142.44.247.154
  142.44.247.57
-142.44.247.60
  142.47.96.16
  142.54.161.10
  142.54.164.58
@@ -24988,7 +25042,6 @@
  142.54.194.104
  142.54.228.195
  142.54.231.33
-142.54.232.1
  142.54.235.12
  142.54.237.37
  142.54.239.4
@@ -25021,7 +25074,6 @@
  142.93.11.193
  142.93.110.43
  142.93.112.194
-142.93.112.222
  142.93.113.143
  142.93.113.159
  142.93.116.106
@@ -25035,6 +25087,7 @@
  142.93.124.101
  142.93.125.248
  142.93.125.253
+142.93.126.181
  142.93.13.27
  142.93.130.169
  142.93.131.1
@@ -25046,7 +25099,9 @@
  142.93.145.85
  142.93.147.210
  142.93.148.250
-142.93.150.156
+142.93.149.139
+142.93.151.119
+142.93.151.180
  142.93.159.172
  142.93.162.220
  142.93.166.13
@@ -25060,7 +25115,6 @@
  142.93.183.4
  142.93.187.214
  142.93.188.38
-142.93.191.127
  142.93.191.96
  142.93.194.76
  142.93.195.157
@@ -25085,7 +25139,6 @@
  142.93.212.91
  142.93.213.254
  142.93.215.195
-142.93.215.201
  142.93.216.97
  142.93.218.225
  142.93.219.158
@@ -25093,10 +25146,10 @@
  142.93.223.118
  142.93.223.152
  142.93.224.234
-142.93.224.5
  142.93.225.68
  142.93.228.111
  142.93.23.235
+142.93.231.137
  142.93.233.139
  142.93.235.47
  142.93.236.246
@@ -25113,9 +25166,7 @@
  142.93.245.242
  142.93.245.246
  142.93.245.253
-142.93.247.17
  142.93.248.50
-142.93.25.105
  142.93.250.60
  142.93.251.1
  142.93.255.200
@@ -25128,8 +25179,10 @@
  142.93.35.230
  142.93.37.1
  142.93.38.148
+142.93.39.226
  142.93.42.206
  142.93.43.120
+142.93.43.190
  142.93.44.136
  142.93.44.155
  142.93.45.249
@@ -25158,11 +25211,13 @@
  142.93.72.250
  142.93.78.168
  142.93.79.125
+142.93.8.164
  142.93.8.99
  142.93.85.123
  142.93.85.206
  142.93.85.97
  142.93.87.85
+142.93.88.26
  142.93.89.38
  142.93.9.108
  142.93.9.213
@@ -25171,6 +25226,7 @@
  142.93.94.49
  142.93.98.144
  142.93.99.234
+142.93.99.56
  142.ip-164-132-197.eu
  1423-thurman.com
  143.0.177.198
@@ -25183,25 +25239,30 @@
  143.110.151.242
  143.110.153.126
  143.110.153.150
+143.110.155.129
  143.110.157.115
  143.110.170.102
  143.110.176.80
  143.110.177.56
  143.110.182.228
  143.110.182.53
-143.110.183.180
  143.110.184.88
  143.110.185.100
  143.110.185.110
  143.110.188.7
  143.110.190.26
+143.110.191.90
  143.110.208.158
  143.110.218.150
+143.110.218.171
+143.110.220.194
  143.110.227.107
  143.110.227.194
+143.110.235.251
  143.110.236.72
  143.110.244.38
  143.110.244.5
+143.110.245.251
  143.110.246.46
  143.110.248.206
  143.110.248.63
@@ -25225,21 +25286,18 @@
  143.178.100.54
  143.178.139.0
  143.178.39.248
-143.178.43.240
  143.178.44.93
  143.178.57.3
  143.178.64.10
  143.202.136.51
  143.202.154.37
-143.202.163.78
+143.202.191.225
  143.202.209.47
  143.202.226.151
  143.202.226.208
  143.202.226.61
-143.202.227.100
  143.202.227.15
  143.202.227.26
-143.202.227.34
  143.202.227.49
  143.202.227.60
  143.202.227.80
@@ -25253,12 +25311,11 @@
  143.244.39.183
  143.244.39.225
  143.244.40.59
-143.244.41.11
  143.244.41.138
  143.244.41.59
  143.244.43.151
  143.244.43.91
-143.244.50.91
+143.244.44.162
  143.244.54.86
  143.244.57.102
  143.244.57.120
@@ -25268,13 +25325,13 @@
  143.255.105.5
  143.255.108.173
  143.255.111.32
+143.255.128.38
  143.255.130.2
  143.255.140.164
  143.255.140.232
  143.255.142.80
  143.255.198.246
  143.255.198.92
-143.255.221.162
  143.255.52.102
  143.255.52.195
  143.255.52.198
@@ -25282,6 +25339,7 @@
  143.255.54.244
  143.59.208.91
  143.89.60.134
+143.92.177.220
  143.92.186.18
  143.92.36.9
  143.92.45.236
@@ -25295,21 +25353,23 @@
  143.92.51.93
  143.92.61.230
  143.95.101.72
-143.95.146.76
  143.95.156.174
  144.121.29.100
+144.123.160.129
  144.123.160.137
  144.123.160.145
  144.123.160.165
  144.123.5.178
-144.126.196.87
  144.126.197.136
  144.126.199.235
  144.126.204.133
  144.126.216.90
  144.126.217.220
+144.126.219.67
  144.126.220.133
-144.133.214.172
+144.126.221.159
+144.126.222.106
+144.132.168.21
  144.136.211.198
  144.137.208.140
  144.137.29.181
@@ -25320,17 +25380,11 @@
  144.139.91.187
  144.163.107.203
  144.163.56.124
-144.163.57.196
  144.163.75.135
-144.163.76.165
-144.163.79.163
-144.163.92.28
  144.168.138.140
  144.168.138.216
  144.168.163.181
  144.168.164.26
-144.168.201.156
-144.168.201.203
  144.168.202.125
  144.168.202.15
  144.168.213.102
@@ -25342,6 +25396,7 @@
  144.168.213.188
  144.168.213.235
  144.168.213.28
+144.168.220.72
  144.168.230.66
  144.168.41.158
  144.168.45.117
@@ -25368,8 +25423,10 @@
  144.173.113.31
  144.2.101.100
  144.2.69.224
+144.2.69.69
  144.2.93.229
  144.202.100.47
+144.202.109.97
  144.202.120.7
  144.202.122.49
  144.202.124.184
@@ -25402,15 +25459,16 @@
  144.208.127.168
  144.208.65.145
  144.217.101.245
+144.217.103.195
  144.217.105.118
  144.217.105.209
+144.217.109.47
  144.217.117.146
  144.217.12.95
  144.217.128.227
  144.217.13.109
  144.217.13.183
  144.217.13.40
-144.217.137.33
  144.217.14.197
  144.217.145.161
  144.217.145.167
@@ -25426,10 +25484,10 @@
  144.217.190.197
  144.217.190.215
  144.217.191.227
-144.217.207.37
  144.217.240.89
  144.217.241.5
  144.217.243.216
+144.217.243.76
  144.217.245.243
  144.217.252.18
  144.217.29.74
@@ -25461,6 +25519,7 @@
  144.34.163.191
  144.34.170.120
  144.34.171.19
+144.34.171.214
  144.34.172.241
  144.34.178.90
  144.34.182.70
@@ -25479,10 +25538,9 @@
  144.48.109.179
  144.48.109.180
  144.48.109.182
-144.48.112.126
-144.48.134.12
  144.48.167.209
-144.48.170.146
+144.48.168.35
+144.48.170.202
  144.48.220.43
  144.48.220.44
  144.48.220.45
@@ -25496,7 +25554,6 @@
  144.48.243.135
  144.48.243.234
  144.48.30.181
-144.48.62.80
  144.48.9.159
  144.48.9.207
  144.52.233.243
@@ -25504,6 +25561,7 @@
  144.7.111.162
  144.7.116.1
  144.7.116.27
+144.7.122.94
  144.76.1.155
  144.76.1.20
  144.76.100.21
@@ -25532,10 +25590,10 @@
  144.76.158.79
  144.76.16.52
  144.76.162.37
+144.76.17.81
  144.76.176.150
  144.76.176.195
  144.76.176.72
-144.76.184.38
  144.76.185.71
  144.76.19.144
  144.76.19.195
@@ -25595,10 +25653,9 @@
  144.76.92.36
  144.76.93.214
  144.76.93.46
+144.76.94.101
  144.76.98.163
  144.76.99.197
-144.86.59.148
-144.91.104.12
  144.91.116.126
  144.91.116.146
  144.91.116.44
@@ -25609,24 +25666,22 @@
  144.91.67.109
  144.91.67.228
  144.91.69.193
-144.91.70.218
  144.91.70.224
  144.91.72.101
  144.91.73.41
+144.91.79.151
  144.91.80.213
  144.91.82.22
  144.91.84.171
  144.91.84.50
-144.91.85.172
  144.91.94.247
  144.91.95.185
-144.91.98.126
  1441518k4-85975353079.us-south.cf.appdomain.cloud
  1445.3190cfdae.com
  145-365.net
  145.129.237.112
-145.129.241.81
  145.131.25.134
+145.131.25.239
  145.131.25.242
  145.132.50.204
  145.14.157.145
@@ -25650,13 +25705,12 @@
  145.239.168.121
  145.239.174.59
  145.239.176.47
+145.239.180.16
  145.239.184.38
  145.239.188.142
  145.239.19.186
-145.239.196.140
  145.239.209.0
  145.239.21.235
-145.239.210.106
  145.239.211.242
  145.239.22.247
  145.239.224.31
@@ -25667,6 +25721,7 @@
  145.239.25.92
  145.239.252.230
  145.239.254.226
+145.239.28.197
  145.239.29.217
  145.239.35.192
  145.239.41.151
@@ -25681,6 +25736,7 @@
  145.239.78.59
  145.239.82.192
  145.239.85.21
+145.239.86.208
  145.239.87.224
  145.239.88.43
  145.239.9.15
@@ -25702,6 +25758,7 @@
  145.249.246.106
  145.253.118.157
  145.255.10.204
+145.255.165.214
  145.255.27.194
  145.255.28.122
  145.255.28.2
@@ -25862,9 +25919,9 @@
  146.185.200.61
  146.185.201.110
  146.185.201.84
-146.185.202.211
  146.185.202.63
  146.185.203.34
+146.185.204.50
  146.185.239.100
  146.185.251.188
  146.185.253.101
@@ -25877,6 +25934,7 @@
  146.196.63.192
  146.196.63.66
  146.196.63.89
+146.196.63.94
  146.196.67.88
  146.196.98.202
  146.20.103.191
@@ -25884,16 +25942,21 @@
  146.20.110.77
  146.200.136.75
  146.226.76.227
-146.241.129.140
-146.241.171.152
+146.241.150.110
  146.241.39.245
+146.241.72.32
+146.242.63.19
+146.242.63.24
+146.242.63.26
  146.247.158.29
  146.247.158.29bin.sh
+146.247.33.81
  146.255.24.28
  146.255.96.214
-146.255.98.49
  146.52.147.127
  146.52.16.170
+146.52.16.81
+146.52.44.197
  146.56.192.231
  146.56.195.192
  146.56.197.217
@@ -25901,6 +25964,7 @@
  146.56.201.178
  146.56.201.34
  146.56.203.31
+146.56.203.54
  146.56.205.205
  146.56.206.116
  146.56.216.83
@@ -25908,7 +25972,6 @@
  146.56.220.151
  146.56.220.189
  146.56.221.49
-146.56.221.75
  146.56.222.82
  146.56.226.92
  146.56.229.128
@@ -25916,6 +25979,7 @@
  146.56.246.34
  146.56.247.206
  146.56.248.232
+146.56.248.37
  146.59.146.249
  146.59.150.236
  146.59.153.177
@@ -25932,7 +25996,6 @@
  146.59.16.203
  146.59.17.99
  146.59.196.82
-146.59.207.132
  146.59.225.138
  146.59.225.194
  146.59.225.195
@@ -25943,7 +26006,6 @@
  146.59.248.244
  146.59.3.125
  146.59.3.161
-146.59.4.0
  146.66.178.78
  146.71.112.18
  146.71.77.244
@@ -25952,10 +26014,8 @@
  146.71.79.230
  146.83.216.186
  146.83.222.25
-146.88.240.4
  146.90.155.78
  1469-squid.com
-147.10.112.55
  147.114.226.194
  147.135.10.54
  147.135.10.96
@@ -25993,6 +26053,7 @@
  147.135.79.86
  147.139.130.224
  147.139.130.245
+147.139.134.59
  147.139.135.159
  147.139.138.116
  147.139.138.39
@@ -26003,13 +26064,15 @@
  147.139.167.155
  147.139.168.106
  147.139.168.137
+147.139.168.211
+147.139.168.215
  147.139.169.213
  147.139.172.122
-147.139.173.192
  147.139.174.29
  147.139.175.155
  147.139.177.71
  147.139.180.46
+147.139.181.138
  147.139.182.9
  147.139.184.149
  147.139.189.77
@@ -26018,37 +26081,38 @@
  147.139.29.173
  147.139.30.243
  147.139.31.203
-147.139.31.22
  147.139.32.95
  147.139.34.238
  147.139.34.79
  147.139.36.235
  147.139.37.49
+147.139.4.177
  147.139.5.254
-147.139.6.198
  147.139.6.81
  147.147.112.174
+147.161.8.205
+147.192.58.6
+147.192.99.80
  147.229.146.52
  147.229.75.77
  147.231.106.250
+147.253.211.48
  147.27.70.36
-147.75.113.209
-147.75.118.226
+147.32.89.74
  147.75.92.248
-147.75.92.37
  147.78.65.253
  147.78.67.33
  147.83.195.55
+147.83.40.11
  147.83.72.199
-147.91.111.132
-147.91.111.133
  147.91.111.134
-147.92.55.8
  1475a390633025231.temporary.link
  1477304571.storage.googleapis.com
  148.0.237.76
  148.0.40.231
+148.101.106.40
  148.101.169.71
+148.101.237.79
  148.102.17.158
  148.102.22.76
  148.102.25.170
@@ -26066,6 +26130,7 @@
  148.222.44.20
  148.223.120.122
  148.228.214.141
+148.229.3.242
  148.235.42.146
  148.235.42.147
  148.235.57.183
@@ -26077,7 +26142,6 @@
  148.243.72.112
  148.244.221.148
  148.245.13.21
-148.245.69.59
  148.251.1.20
  148.251.105.254
  148.251.110.53
@@ -26102,7 +26166,6 @@
  148.251.20.79
  148.251.208.48
  148.251.22.104
-148.251.233.162
  148.251.236.212
  148.251.236.72
  148.251.237.73
@@ -26126,11 +26189,12 @@
  148.251.87.112
  148.255.134.84
  148.255.243.12
+148.255.90.234
+148.3.121.69
  148.3.51.225
  148.56.17.55
  148.63.215.173
-148.64.121.254
-148.66.132.190
+148.66.126.246
  148.66.143.140
  148.66.143.78
  148.66.145.132
@@ -26148,7 +26212,6 @@
  148.66.57.195
  148.66.57.202
  148.66.58.138
-148.67.93.82
  148.69.222.213
  148.70.100.119
  148.70.102.225
@@ -26169,7 +26232,7 @@
  148.70.185.36
  148.70.195.242
  148.70.201.162
-148.70.209.112
+148.70.208.108
  148.70.229.221
  148.70.240.41
  148.70.250.254
@@ -26177,24 +26240,27 @@
  148.70.29.243
  148.70.29.56
  148.70.31.188
+148.70.33.136
  148.70.34.160
  148.70.35.135
  148.70.38.183
-148.70.39.4
-148.70.53.219
  148.70.7.7
+148.70.70.55
  148.70.76.237
-148.70.77.116
  148.70.84.202
  148.70.89.212
+148.70.93.176
  148.71.91.250
  148.72.105.246
  148.72.160.176
  148.72.202.188
+148.72.207.250
  148.72.208.210
  148.72.209.9
+148.72.211.177
  148.72.211.251
  148.72.212.161
+148.72.214.23
  148.72.215.181
  148.72.22.191
  148.72.23.181
@@ -26207,29 +26273,33 @@
  148.72.232.36
  148.72.232.39
  148.72.232.63
+148.72.64.192
  148.72.65.173
  148.72.65.90
  148.74.194.80
  148.77.34.194
  148.77.34.196
  148.77.34.200
+148.81.199.2
  148117-dot-n-e-w-me-ss-age-po-rt-al.wl.r.appspot.com
  149.107.0.76
  149.12.200.82
  149.129.101.217
  149.129.102.110
+149.129.128.16
  149.129.129.91
  149.129.136.55
  149.129.137.193
  149.129.139.95
  149.129.173.204
  149.129.174.104
+149.129.181.48
  149.129.182.216
  149.129.184.49
  149.129.187.188
  149.129.188.225
  149.129.190.133
-149.129.191.205
+149.129.191.24
  149.129.191.88
  149.129.214.115
  149.129.220.95
@@ -26245,6 +26315,7 @@
  149.129.241.21
  149.129.242.109
  149.129.242.144
+149.129.243.175
  149.129.244.23
  149.129.244.83
  149.129.245.133
@@ -26254,8 +26325,10 @@
  149.129.251.229
  149.129.252.182
  149.129.253.14
+149.129.254.198
  149.129.254.65
  149.129.255.180
+149.129.33.17
  149.129.34.80
  149.129.36.10
  149.129.36.157
@@ -26265,14 +26338,13 @@
  149.129.50.37
  149.129.54.136
  149.129.56.121
-149.129.57.246
-149.129.59.254
+149.129.57.134
  149.129.59.96
  149.129.61.164
  149.129.90.72
  149.129.95.189
  149.129.97.102
-149.154.69.168
+149.140.146.66
  149.167.99.190
  149.172.44.233
  149.20.244.78
@@ -26281,6 +26353,7 @@
  149.202.115.3
  149.202.12.9
  149.202.125.153
+149.202.133.94
  149.202.136.235
  149.202.155.146
  149.202.160.188
@@ -26314,12 +26387,14 @@
  149.202.38.124
  149.202.41.145
  149.202.42.114
+149.202.47.128
  149.202.47.15
  149.202.48.176
  149.202.48.192
  149.202.48.246
  149.202.50.155
  149.202.52.152
+149.202.52.67
  149.202.54.225
  149.202.55.18
  149.202.56.228
@@ -26333,31 +26408,36 @@
  149.202.8.66
  149.202.81.92
  149.202.83.78
+149.202.86.68
  149.202.87.175
  149.202.89.125
  149.202.93.136
-149.210.141.12
  149.210.143.165
  149.210.155.74
  149.210.160.125
  149.210.169.10
  149.210.184.136
  149.210.189.102
+149.224.135.29
+149.224.16.43
  149.224.246.170
-149.233.134.75
+149.224.75.54
  149.248.10.11
+149.248.54.69
  149.248.58.177
  149.248.59.143
  149.248.8.73
  149.248.9.85
  149.255.154.62
  149.255.214.19
+149.255.245.90
  149.255.245.93
+149.255.35.42
+149.255.35.55
  149.255.36.133
  149.255.36.185
  149.255.36.196
  149.255.62.89
-149.28.101.205
  149.28.112.35
  149.28.113.236
  149.28.117.43
@@ -26394,9 +26474,9 @@
  149.28.43.92
  149.28.46.48
  149.28.54.28
-149.28.56.211
  149.28.57.128
  149.28.58.44
+149.28.62.13
  149.28.64.55
  149.28.77.254
  149.28.78.252
@@ -26405,7 +26485,6 @@
  149.28.94.217
  149.29.2.107
  149.29.3.74
-149.3.110.97
  149.3.124.112
  149.3.124.17
  149.3.124.38
@@ -26414,18 +26493,26 @@
  149.3.170.237
  149.3.170.244
  149.3.36.210
+149.3.5.189
  149.3.73.242
+149.3.85.218
  149.3.85.245
  149.3.85.81
  149.31.6.24
  149.34.17.225
-149.34.3.196
+149.34.18.165
+149.34.18.20
+149.34.19.97
+149.34.2.245
+149.34.21.173
+149.34.23.251
  149.34.6.162
  149.5.193.125
  149.56.1.48
  149.56.100.209
  149.56.100.237
  149.56.101.170
+149.56.102.43
  149.56.108.38
  149.56.110.140
  149.56.110.240
@@ -26435,25 +26522,26 @@
  149.56.128.135
  149.56.13.111
  149.56.13.37
-149.56.130.248
  149.56.131.140
  149.56.132.202
  149.56.133.137
  149.56.133.146
  149.56.141.170
+149.56.142.1
  149.56.147.33
-149.56.15.110
  149.56.151.196
  149.56.170.37
  149.56.173.225
  149.56.19.4
  149.56.192.110
  149.56.202.35
+149.56.205.74
+149.56.22.52
  149.56.223.104
  149.56.223.241
  149.56.228.38
  149.56.229.16
-149.56.232.133
+149.56.252.31
  149.56.26.173
  149.56.41.33
  149.56.44.101
@@ -26468,10 +26556,9 @@
  149.62.172.62
  149.62.173.247
  149.62.41.187
-149.7.217.27
  149.71.33.45
-149.72.167.211
  149.72.183.21
+149.72.198.96
  149.74.120.231
  149.81.153.3
  149.81.157.0
@@ -26487,25 +26574,27 @@
  14h.pw
  14sucursalpersonastransaccionesbancolombia.com
  14upslipa.duckdns.org
+15.161.144.236
  15.164.169.212
  15.164.181.146
  15.164.27.100
  15.165.33.136
+15.184.81.168
  15.185.80.9
  15.188.127.194
  15.188.90.29
  15.206.158.199
  15.206.50.74
-15.206.69.14
  15.206.80.35
  15.207.205.197
  15.207.51.73
  15.207.55.168
  15.207.85.62
  15.207.88.225
-15.222.42.127
+15.228.49.161
  15.236.162.80
-15.236.212.92
+15.236.205.190
+15.237.51.152
  15.4buyuklergazete.com
  150.101.163.151
  150.107.103.64
@@ -26515,15 +26604,16 @@
  150.107.142.77
  150.107.142.81
  150.107.152.116
+150.107.180.132
  150.107.205.196
  150.107.205.20
  150.107.205.22
  150.107.207.137
-150.107.215.89
-150.107.232.223
  150.107.42.160
  150.107.75.82
+150.107.92.177
  150.109.100.65
+150.109.104.153
  150.109.11.178
  150.109.113.116
  150.109.113.254
@@ -26539,15 +26629,16 @@
  150.109.148.108
  150.109.15.69
  150.109.151.206
-150.109.16.122
  150.109.19.187
  150.109.21.234
+150.109.32.166
  150.109.34.205
  150.109.37.160
  150.109.51.175
  150.109.57.43
  150.109.58.69
  150.109.63.146
+150.109.64.153
  150.109.66.212
  150.109.7.77
  150.109.70.217
@@ -26555,30 +26646,30 @@
  150.109.78.53
  150.109.94.88
  150.109.99.243
-150.129.105.61
+150.129.102.16
  150.129.115.118
-150.129.128.80
  150.129.148.88
  150.129.148.99
  150.129.151.42
  150.129.151.83
+150.129.157.90
  150.129.170.13
  150.129.171.123
  150.129.171.35
+150.129.182.112
  150.129.182.164
  150.129.201.30
-150.129.207.72
-150.129.207.75
+150.129.237.226
  150.129.250.28
  150.129.52.74
  150.129.54.111
  150.129.56.138
-150.129.58.190
+150.129.57.235
  150.129.8.10
  150.129.8.32
  150.129.8.7
-150.129.89.97
  150.136.109.2
+150.136.124.78
  150.136.132.142
  150.136.137.192
  150.136.139.177
@@ -26586,7 +26677,6 @@
  150.136.146.96
  150.136.151.187
  150.136.152.190
-150.136.152.73
  150.136.160.141
  150.136.162.158
  150.136.171.137
@@ -26603,9 +26693,12 @@
  150.136.245.110
  150.136.246.125
  150.136.248.42
+150.136.252.98
+150.136.36.124
  150.136.62.105
  150.136.86.157
  150.138.106.174
+150.138.116.104
  150.138.118.252
  150.138.119.203
  150.138.178.18
@@ -26624,6 +26717,7 @@
  150.158.112.154
  150.158.113.106
  150.158.114.97
+150.158.115.139
  150.158.115.213
  150.158.120.81
  150.158.123.221
@@ -26651,7 +26745,6 @@
  150.158.165.46
  150.158.168.214
  150.158.168.228
-150.158.169.136
  150.158.169.168
  150.158.172.13
  150.158.172.248
@@ -26662,14 +26755,13 @@
  150.158.176.46
  150.158.178.63
  150.158.179.131
+150.158.179.191
  150.158.181.16
  150.158.184.61
-150.158.185.125
  150.158.185.176
  150.158.186.50
  150.158.190.76
  150.158.193.115
-150.158.194.184
  150.158.198.131
  150.158.213.30
  150.158.213.73
@@ -26677,19 +26769,21 @@
  150.158.4.230
  150.158.5.97
  150.165.212.10
-150.185.10.125
  150.185.8.115
  150.185.9.190
+150.187.25.18
  150.187.5.100
-150.223.13.155
  150.238.239.146
  150.238.65.127
+150.242.14.129
+150.242.14.88
  150.242.182.98
  150.242.219.5
  150.242.24.152
  150.242.254.51
  150.242.255.76
-150.242.64.44
+150.242.60.172
+150.242.63.57
  150.246.246.238
  150.246.65.18
  150.255.220.3
@@ -26697,7 +26791,6 @@
  150.95.108.112
  150.95.110.27
  150.95.113.198
-150.95.114.70
  150.95.131.174
  150.95.132.74
  150.95.138.39
@@ -26742,15 +26835,14 @@
  151.0.238.45
  151.1.168.39
  151.1.253.1
-151.106.11.180
  151.106.113.12
  151.106.12.202
  151.106.13.150
  151.106.13.158
  151.106.30.102
  151.106.34.139
-151.106.35.172
  151.106.38.210
+151.106.38.74
  151.106.39.198
  151.106.40.217
  151.106.40.23
@@ -26764,26 +26856,25 @@
  151.115.45.161
  151.115.45.183
  151.115.50.199
-151.115.55.106
  151.115.56.19
  151.124.247.200
  151.13.11.231
  151.16.41.80
+151.177.163.130
  151.177.163.87
+151.177.48.205
  151.177.48.40
+151.18.49.2
  151.182.44.17
-151.19.208.136
  151.196.45.109
  151.196.57.128
  151.197.64.219
  151.20.160.72
-151.20.169.198
  151.205.188.39
  151.217.31.131
  151.22.180.54
  151.228.114.115
  151.228.89.191
-151.234.36.230
  151.236.193.195
  151.236.218.195
  151.236.38.234
@@ -26792,21 +26883,19 @@
  151.236.60.57
  151.237.177.251
  151.237.179.42
-151.237.182.67
  151.237.185.110
  151.237.186.103
  151.237.186.142
  151.237.186.240
  151.237.36.220
  151.237.80.166
-151.237.84.13
-151.239.234.235
  151.240.126.105
-151.240.215.202
+151.241.177.62
+151.241.214.243
  151.248.114.191
  151.248.157.162
  151.248.221.176
-151.252.141.243
+151.251.240.50
  151.252.243.151
  151.252.70.33
  151.253.125.136
@@ -26815,36 +26904,31 @@
  151.253.233.70
  151.253.79.212
  151.27.234.155
-151.29.97.192
  151.31.50.20
  151.34.55.54
+151.36.69.52
  151.38.22.141
  151.38.66.104
-151.40.192.170
-151.40.84.100
  151.41.170.30
  151.42.109.51
  151.42.205.134
  151.45.71.27
  151.48.18.187
-151.49.195.218
-151.49.202.113
  151.50.97.232
  151.51.121.187
  151.51.237.54
-151.52.108.119
  151.55.117.0
  151.55.84.241
  151.62.100.219
-151.62.89.183
-151.63.211.148
+151.62.132.2
+151.62.18.60
  151.64.209.157
-151.65.120.140
  151.66.144.89
  151.67.112.146
+151.67.175.24
+151.67.30.123
  151.69.170.146
  151.70.64.197
-151.73.84.240
  151.80.119.61
  151.80.140.166
  151.80.140.233
@@ -26879,15 +26963,15 @@
  151.80.201.162
  151.80.211.128
  151.80.211.158
-151.80.235.153
+151.80.230.21
  151.80.241.194
  151.80.245.160
  151.80.248.125
  151.80.255.19
  151.80.26.121
  151.80.29.98
-151.80.33.11
  151.80.34.113
+151.80.34.51
  151.80.38.19
  151.80.38.48
  151.80.40.72
@@ -26898,7 +26982,6 @@
  151.80.44.205
  151.80.46.19
  151.80.46.95
-151.80.57.23
  151.80.58.175
  151.80.60.151
  151.80.61.159
@@ -26909,11 +26992,8 @@
  151.80.9.153
  151.80.96.140
  151.80.99.2
-151.81.209.133
  151.82.16.201
-151.82.44.34
  151.84.122.105
-151.95.225.70
  151.rs
  151051-dot-n-e-w-me-ss-age-po-rt-al.wl.r.appspot.com
  151114327519139.002.sh.cn
@@ -26936,8 +27016,10 @@
  152.136.114.118
  152.136.122.172
  152.136.124.97
+152.136.125.127
  152.136.125.49
  152.136.128.30
+152.136.130.118
  152.136.130.218
  152.136.131.242
  152.136.131.68
@@ -26945,7 +27027,6 @@
  152.136.133.117
  152.136.134.198
  152.136.134.77
-152.136.137.130
  152.136.137.62
  152.136.137.67
  152.136.138.231
@@ -26965,12 +27046,13 @@
  152.136.179.135
  152.136.183.147
  152.136.184.12
+152.136.184.133
  152.136.184.156
  152.136.187.161
  152.136.193.92
  152.136.196.155
+152.136.197.129
  152.136.198.101
-152.136.203.12
  152.136.203.208
  152.136.204.118
  152.136.204.182
@@ -26998,7 +27080,6 @@
  152.136.254.204
  152.136.34.209
  152.136.41.189
-152.136.43.147
  152.136.54.176
  152.136.71.133
  152.136.90.196
@@ -27017,9 +27098,7 @@
  152.170.65.133
  152.170.66.244
  152.170.79.100
-152.171.152.2
  152.171.99.219
-152.173.75.205
  152.179.12.86
  152.179.67.70
  152.200.131.38
@@ -27028,13 +27107,13 @@
  152.204.128.46
  152.231.105.205
  152.231.120.138
-152.231.128.156
  152.231.140.150
  152.231.29.72
  152.231.68.18
  152.231.82.134
  152.231.89.226
  152.231.93.130
+152.242.65.206
  152.249.142.153
  152.249.172.171
  152.249.74.216
@@ -27051,7 +27130,6 @@
  152.32.150.232
  152.32.154.39
  152.32.156.212
-152.32.159.188
  152.32.159.80
  152.32.172.162
  152.32.174.171
@@ -27083,11 +27161,10 @@
  152.32.78.24
  152.32.92.86
  152.36.193.2
-152.44.36.80
  152.57.210.118
-152.67.1.245
  152.67.109.176
  152.67.13.76
+152.67.165.129
  152.67.173.121
  152.67.188.191
  152.67.224.67
@@ -27096,6 +27173,7 @@
  152.67.35.185
  152.67.47.139
  152.67.48.62
+152.67.52.194
  152.67.58.141
  152.67.6.128
  152.67.65.128
@@ -27108,7 +27186,7 @@
  152.89.239.71
  152.89.239.85
  152.89.245.248
-152.89.42.198
+152.89.40.183
  152.89.62.59
  152asyabahis.com
  153.0.225.56
@@ -27119,7 +27197,6 @@
  153.101.37.132
  153.101.57.34
  153.101.57.40
-153.120.217.173
  153.120.33.139
  153.122.13.133
  153.122.72.80
@@ -27145,7 +27222,6 @@
  153.183.25.24
  153.19.105.90
  153.19.33.231
-153.228.254.113
  153.3.123.148
  153.3.124.100
  153.3.124.101
@@ -27179,11 +27255,12 @@
  153.37.85.131
  153.92.127.168
  153.92.4.153
+153.92.4.223
  153.92.93.114
  153284594738391.statictab.com
  15333291-5189-4750-a96c-2f9deb7920f7.htmlcomponentservice.com
  153884c0b3f5e35925a6a8b37e6eccb3-dot-maintance-online-pass.ey.r.appspot.com
-154.0.165.27
+154.0.15.166
  154.0.168.252
  154.0.175.203
  154.0.63.246
@@ -27199,23 +27276,20 @@
  154.118.10.225
  154.118.13.87
  154.118.52.216
-154.118.61.38
  154.119.79.254
-154.120.109.237
  154.120.110.125
+154.120.114.56
  154.120.133.190
  154.120.227.206
  154.120.232.182
  154.124.113.255
-154.124.202.71
-154.125.82.29
  154.126.32.138
  154.126.81.195
  154.127.113.242
  154.127.120.18
  154.127.32.105
  154.127.82.66
-154.13.1.12
+154.13.1.81
  154.16.0.204
  154.16.0.225
  154.16.10.198
@@ -27225,6 +27299,7 @@
  154.16.137.132
  154.16.138.48
  154.16.149.66
+154.16.159.223
  154.16.173.92
  154.16.203.123
  154.16.203.17
@@ -27241,6 +27316,7 @@
  154.16.33.250
  154.16.36.197
  154.16.36.206
+154.16.36.215
  154.16.36.224
  154.16.36.235
  154.16.36.246
@@ -27248,16 +27324,16 @@
  154.16.37.122
  154.16.37.41
  154.16.43.115
+154.16.43.69
  154.16.48.215
  154.16.49.148
-154.16.54.220
  154.16.55.20
  154.16.55.28
+154.16.56.205
  154.16.56.220
-154.16.62.131
+154.16.6.241
  154.16.86.188
-154.160.24.35
-154.160.7.40
+154.160.18.236
  154.160.73.154
  154.160.74.186
  154.160.74.91
@@ -27267,8 +27343,8 @@
  154.202.56.206
  154.204.26.130
  154.204.27.245
+154.204.31.234
  154.204.32.157
-154.204.42.107
  154.209.4.104
  154.209.4.189
  154.209.4.76
@@ -27276,7 +27352,6 @@
  154.209.93.155
  154.211.12.163
  154.211.12.167
-154.211.14.171
  154.211.14.244
  154.213.22.34
  154.213.58.193
@@ -27542,7 +27617,6 @@
  154.221.24.164
  154.221.25.187
  154.221.25.230
-154.221.26.34
  154.221.26.69
  154.221.27.251
  154.221.27.56
@@ -27551,11 +27625,11 @@
  154.221.30.173
  154.221.30.55
  154.221.31.10
+154.223.166.124
  154.223.189.86
  154.232.45.195
  154.236.168.187
  154.238.175.246
-154.243.50.101
  154.244.122.147
  154.3.40.111
  154.3.40.211
@@ -27570,7 +27644,6 @@
  154.6.28.69
  154.61.227.8
  154.61.75.210
-154.64.218.226
  154.65.14.19
  154.66.107.189
  154.66.109.105
@@ -27585,15 +27658,11 @@
  154.66.241.27
  154.66.245.47
  154.67.169.243
-154.68.195.194
  154.68.5.102
-154.68.5.51
  154.70.158.97
  154.70.208.66
  154.70.32.103
-154.72.162.109
  154.72.162.254
-154.72.167.65
  154.72.187.26
  154.72.192.26
  154.72.197.106
@@ -27627,6 +27696,7 @@
  154.79.244.66
  154.79.246.178
  154.79.248.124
+154.79.249.234
  154.79.250.100
  154.79.250.168
  154.79.252.148
@@ -27681,7 +27751,6 @@
  154.85.44.200
  154.85.45.145
  154.85.48.8
-154.85.50.239
  154.85.53.96
  154.85.55.166
  154.85.58.254
@@ -27690,6 +27759,7 @@
  154.85.62.149
  154.85.63.210
  154.89.4.247
+154.9.206.89
  154.90.14.41
  154.91.144.44
  154.91.2.187
@@ -27709,7 +27779,6 @@
  155.0.32.11
  155.12.53.17
  155.133.131.208
-155.133.202.93
  155.133.83.1
  155.133.83.109
  155.133.83.117
@@ -27719,11 +27788,13 @@
  155.133.83.45
  155.133.83.61
  155.133.89.24
-155.138.130.194
+155.138.139.164
+155.138.140.215
  155.138.147.151
  155.138.160.156
  155.138.160.98
  155.138.197.254
+155.138.210.238
  155.138.217.118
  155.138.222.174
  155.138.224.233
@@ -27738,10 +27809,12 @@
  155.254.49.4
  155.4.116.169
  155.4.117.22
-155.4.187.75
+155.4.4.200
  155.4.70.0
+155.89.207.92
  155.93.108.170
  155.93.109.218
+155.93.121.154
  155.94.129.148
  155.94.131.150
  155.94.141.227
@@ -27754,7 +27827,6 @@
  155.94.174.57
  155.94.194.105
  155.94.224.207
-155.94.240.163
  155.94.240.231
  155.94.67.7
  155.94.89.2
@@ -27762,7 +27834,6 @@
  1552477-dot-n-e-w-me-ss-age-po-rt-al.wl.r.appspot.com
  155361.streeteone.com
  15565556239457741.us-south.cf.appdomain.cloud
-156.0.212.33
  156.0.229.194
  156.146.33.82
  156.146.34.65
@@ -27772,21 +27843,21 @@
  156.146.51.128
  156.146.57.38
  156.146.59.89
+156.146.60.41
  156.155.163.232
  156.155.48.111
  156.155.48.148
-156.19.133.126
  156.19.19.90
-156.194.76.74
-156.203.44.45
+156.193.82.34
+156.204.178.80
  156.208.91.55
  156.212.108.176
  156.219.87.189
  156.220.253.28
  156.222.168.110
-156.223.132.138
+156.223.2.191
  156.223.27.113
-156.234.193.161
+156.223.54.24
  156.234.211.163
  156.236.65.24
  156.236.70.73
@@ -27797,6 +27868,7 @@
  156.236.73.68
  156.236.74.201
  156.236.74.207
+156.241.191.196
  156.247.12.158
  156.247.12.91
  156.247.14.227
@@ -27810,29 +27882,27 @@
  156.54.148.152
  156.67.106.36
  156.67.115.5
-156.67.129.28
  156.67.214.80
  156.67.216.125
+156.67.219.120
+156.67.220.243
  156.67.221.92
+156.70.5.202
  156.96.114.73
  156.96.118.179
  156.96.118.48
  156.96.118.58
-156.96.128.247
  156.96.151.236
  156.96.157.99
  156.96.48.136
  156.96.48.220
-156.96.62.84
  15688c.com
  1569webappssupport.com
+157.0.1.211
  157.0.134.164
  157.100.230.82
  157.119.108.183
  157.119.117.22
-157.119.183.160
-157.119.191.77
-157.119.204.191
  157.119.207.36
  157.119.222.180
  157.119.222.182
@@ -27842,7 +27912,6 @@
  157.119.50.74
  157.119.50.81
  157.122.149.18
-157.122.183.218
  157.13.61.66
  157.13.61.69
  157.13.61.72
@@ -27851,10 +27920,10 @@
  157.13.61.80
  157.13.61.82
  157.131.200.187
-157.131.240.195
  157.131.98.203
  157.138.20.22
  157.147.119.184
+157.147.126.207
  157.185.144.118
  157.185.144.68
  157.185.144.69
@@ -27873,6 +27942,7 @@
  157.230.0.113
  157.230.100.192
  157.230.103.189
+157.230.103.201
  157.230.103.25
  157.230.109.166
  157.230.109.55
@@ -27882,10 +27952,11 @@
  157.230.115.150
  157.230.116.65
  157.230.117.118
+157.230.118.118
  157.230.12.188
  157.230.12.231
  157.230.12.242
-157.230.120.201
+157.230.120.252
  157.230.121.242
  157.230.122.132
  157.230.122.80
@@ -27928,6 +27999,7 @@
  157.230.210.84
  157.230.211.196
  157.230.211.219
+157.230.212.8
  157.230.213.10
  157.230.218.123
  157.230.219.122
@@ -27944,6 +28016,7 @@
  157.230.23.31
  157.230.231.39
  157.230.232.67
+157.230.234.117
  157.230.234.93
  157.230.236.60
  157.230.238.19
@@ -27958,10 +28031,9 @@
  157.230.251.62
  157.230.252.123
  157.230.254.120
-157.230.254.58
  157.230.255.100
+157.230.255.209
  157.230.27.96
-157.230.28.130
  157.230.3.204
  157.230.30.126
  157.230.33.158
@@ -27981,7 +28053,6 @@
  157.230.45.31
  157.230.47.159
  157.230.47.241
-157.230.47.57
  157.230.48.155
  157.230.48.181
  157.230.48.243
@@ -28019,16 +28090,18 @@
  157.230.94.83
  157.230.95.8
  157.230.96.217
+157.230.98.77
  157.231.110.14
  157.231.113.130
+157.231.61.93
  157.245.1.200
  157.245.100.56
  157.245.101.31
  157.245.103.203
-157.245.103.50
  157.245.103.90
  157.245.104.163
  157.245.104.19
+157.245.106.153
  157.245.108.35
  157.245.109.222
  157.245.109.233
@@ -28052,6 +28125,7 @@
  157.245.145.87
  157.245.150.18
  157.245.163.0
+157.245.164.4
  157.245.166.197
  157.245.167.237
  157.245.168.191
@@ -28064,11 +28138,11 @@
  157.245.186.133
  157.245.186.182
  157.245.189.95
-157.245.201.109
  157.245.201.119
  157.245.203.130
  157.245.209.116
  157.245.212.8
+157.245.219.14
  157.245.221.80
  157.245.224.29
  157.245.227.165
@@ -28080,17 +28154,16 @@
  157.245.238.196
  157.245.242.125
  157.245.242.172
+157.245.243.14
  157.245.244.123
  157.245.245.31
  157.245.246.117
-157.245.246.213
  157.245.252.154
  157.245.252.34
  157.245.253.245
-157.245.253.61
  157.245.35.236
+157.245.37.203
  157.245.39.243
-157.245.4.119
  157.245.47.136
  157.245.5.133
  157.245.5.202
@@ -28100,10 +28173,12 @@
  157.245.6.58
  157.245.61.188
  157.245.63.101
+157.245.64.116
  157.245.64.140
  157.245.69.233
  157.245.72.129
  157.245.73.56
+157.245.77.56
  157.245.78.4
  157.245.81.223
  157.245.81.242
@@ -28114,7 +28189,6 @@
  157.245.92.141
  157.245.94.69
  157.245.97.107
-157.245.97.165
  157.245.98.151
  157.245.98.160
  157.245.98.161
@@ -28123,17 +28197,11 @@
  157.25.197.74
  157.25.23.231
  157.34.46.46
-157.34.59.9
-157.38.18.55
  157.44.128.75
-157.44.147.223
  157.44.153.102
+157.44.173.61
  157.44.64.76
-157.45.1.183
-157.45.107.88
-157.48.207.114
  157.52.151.84
-157.52.188.198
  157.52.252.141
  157.55.165.3
  157.55.175.69
@@ -28259,6 +28327,7 @@
  157.55.39.98
  157.55.80.72
  157.7.106.170
+157.7.133.190
  157.7.143.24
  157.7.164.178
  157.7.166.26
@@ -28268,11 +28337,9 @@
  157.7.233.185
  157.90.113.56
  157.90.114.56
-157.90.17.194
  157.90.21.130
  157.90.21.80
  157.90.35.190
-157.90.51.107
  157.92.13.105
  157.92.13.155
  157.92.13.189
@@ -28288,6 +28355,9 @@
  158.101.12.235
  158.101.148.43
  158.101.158.18
+158.101.19.129
+158.101.4.241
+158.101.5.114
  158.101.7.100
  158.101.97.4
  158.106.211.78
@@ -28301,6 +28371,7 @@
  158.140.164.2
  158.140.167.148
  158.140.169.104
+158.140.172.166
  158.140.173.212
  158.140.185.91
  158.170.64.23
@@ -28308,11 +28379,11 @@
  158.174.103.85
  158.174.122.199
  158.174.142.95
-158.174.166.88
  158.174.231.241
  158.174.239.183
  158.174.49.48
  158.174.54.161
+158.174.55.205
  158.174.61.67
  158.175.132.168
  158.175.71.83
@@ -28323,17 +28394,15 @@
  158.181.149.152
  158.181.18.158
  158.181.226.33
-158.222.15.17
+158.199.141.158
  158.222.4.134
  158.222.4.162
  158.222.4.189
  158.222.4.193
  158.222.4.196
  158.222.4.202
-158.222.6.143
  158.222.6.61
  158.247.226.155
-158.247.227.165
  158.248.198.75
  158.255.109.6
  158.255.213.71
@@ -28350,7 +28419,7 @@
  158.46.127.222
  158.51.113.12
  158.51.124.112
-158.51.126.157
+158.51.97.132
  158.58.131.27
  158.58.133.106
  158.58.133.187
@@ -28359,6 +28428,7 @@
  158.58.197.227
  158.64.79.183
  158.69.0.200
+158.69.0.74
  158.69.100.192
  158.69.100.194
  158.69.110.31
@@ -28366,11 +28436,14 @@
  158.69.118.130
  158.69.126.135
  158.69.127.117
+158.69.128.56
  158.69.137.105
  158.69.138.17
  158.69.153.243
  158.69.158.101
  158.69.158.103
+158.69.162.69
+158.69.162.70
  158.69.165.176
  158.69.170.217
  158.69.173.134
@@ -28394,6 +28467,7 @@
  158.69.225.36
  158.69.225.37
  158.69.227.12
+158.69.227.236
  158.69.228.225
  158.69.236.148
  158.69.236.151
@@ -28403,10 +28477,13 @@
  158.69.242.115
  158.69.243.148
  158.69.245.223
+158.69.248.120
  158.69.250.183
  158.69.250.210
  158.69.252.83
+158.69.253.232
  158.69.253.57
+158.69.254.105
  158.69.26.144
  158.69.26.193
  158.69.27.192
@@ -28464,10 +28541,10 @@
  159.138.87.18
  159.138.9.109
  159.147.220.39
+159.148.102.27
  159.148.118.19
  159.148.186.196
  159.148.3.177
-159.148.4.217
  159.192.104.53
  159.192.105.152
  159.192.106.183
@@ -28475,32 +28552,36 @@
  159.192.120.228
  159.192.121.240
  159.192.136.166
-159.192.138.170
  159.192.141.89
  159.192.142.221
  159.192.142.42
  159.192.143.249
  159.192.164.139
+159.192.175.9
+159.192.193.123
  159.192.199.199
+159.192.216.15
  159.192.227.218
  159.192.231.13
  159.192.234.214
  159.192.249.158
  159.192.249.186
-159.192.249.219
  159.192.249.221
+159.192.249.225
  159.192.250.183
  159.192.250.44
  159.192.250.79
  159.192.69.146
+159.192.75.67
+159.192.81.165
  159.192.81.61
  159.192.82.185
-159.192.96.254
  159.192.97.181
  159.192.97.80
  159.196.107.96
  159.196.228.157
  159.2.165.130
+159.2.67.102
  159.203.0.133
  159.203.102.122
  159.203.102.150
@@ -28509,13 +28590,14 @@
  159.203.106.106
  159.203.107.65
  159.203.108.17
+159.203.109.101
  159.203.109.81
  159.203.11.194
  159.203.11.3
  159.203.110.112
  159.203.110.210
  159.203.111.100
-159.203.113.102
+159.203.113.63
  159.203.115.201
  159.203.115.215
  159.203.115.233
@@ -28610,6 +28692,7 @@
  159.203.242.122
  159.203.242.199
  159.203.25.14
+159.203.25.49
  159.203.254.187
  159.203.255.95
  159.203.26.120
@@ -28652,7 +28735,6 @@
  159.203.63.152
  159.203.63.22
  159.203.64.53
-159.203.65.130
  159.203.65.139
  159.203.65.196
  159.203.67.100
@@ -28704,15 +28786,16 @@
  159.224.121.221
  159.224.166.129
  159.224.189.250
+159.224.20.79
+159.224.204.15
+159.224.217.30
  159.224.220.63
-159.224.223.92
  159.224.226.164
  159.224.243.185
  159.224.244.11
  159.224.254.71
  159.224.37.181
  159.226.73.77
-159.242.234.209
  159.246.29.101
  159.246.29.103
  159.246.29.104
@@ -28735,13 +28818,14 @@
  159.246.29.99
  159.250.153.179
  159.250.154.24
-159.250.37.90
  159.253.133.19
  159.253.143.53
  159.253.145.175
  159.253.20.130
  159.253.242.139
+159.253.46.18
  159.253.7.218
+159.255.10.74
  159.255.167.89
  159.255.250.241
  159.65.1.41
@@ -28765,6 +28849,7 @@
  159.65.124.47
  159.65.125.169
  159.65.128.16
+159.65.128.164
  159.65.128.182
  159.65.13.233
  159.65.130.102
@@ -28824,24 +28909,22 @@
  159.65.187.247
  159.65.19.77
  159.65.195.230
-159.65.196.121
  159.65.196.143
  159.65.196.65
  159.65.196.76
  159.65.197.202
  159.65.203.182
  159.65.203.213
-159.65.203.77
  159.65.203.86
  159.65.204.8
  159.65.207.22
  159.65.207.32
  159.65.216.121
  159.65.216.161
-159.65.216.38
  159.65.216.61
  159.65.216.84
  159.65.218.161
+159.65.219.142
  159.65.219.74
  159.65.220.170
  159.65.220.18
@@ -28854,7 +28937,6 @@
  159.65.226.229
  159.65.228.149
  159.65.229.162
-159.65.230.227
  159.65.233.97
  159.65.234.71
  159.65.234.92
@@ -28863,6 +28945,7 @@
  159.65.237.31
  159.65.238.45
  159.65.239.217
+159.65.239.34
  159.65.239.51
  159.65.240.11
  159.65.243.28
@@ -28888,6 +28971,7 @@
  159.65.63.101
  159.65.64.70
  159.65.64.76
+159.65.65.170
  159.65.65.60
  159.65.66.113
  159.65.66.80
@@ -28904,7 +28988,6 @@
  159.65.8.71
  159.65.81.246
  159.65.81.49
-159.65.83.68
  159.65.84.183
  159.65.86.130
  159.65.86.35
@@ -28926,7 +29009,7 @@
  159.69.167.254
  159.69.181.67
  159.69.184.137
-159.69.219.188
+159.69.204.95
  159.69.219.43
  159.69.221.6
  159.69.38.145
@@ -28936,11 +29019,9 @@
  159.69.85.172
  159.69.85.209
  159.75.103.252
-159.75.11.97
  159.75.114.159
  159.75.115.172
  159.75.12.178
-159.75.120.229
  159.75.122.248
  159.75.136.60
  159.75.139.208
@@ -28962,6 +29043,7 @@
  159.75.23.31
  159.75.26.109
  159.75.28.167
+159.75.28.220
  159.75.28.58
  159.75.28.67
  159.75.3.66
@@ -28989,12 +29071,13 @@
  159.89.109.77
  159.89.11.198
  159.89.11.236
-159.89.110.115
  159.89.110.200
  159.89.112.44
  159.89.114.40
  159.89.115.126
  159.89.115.74
+159.89.115.75
+159.89.117.209
  159.89.120.240
  159.89.121.240
  159.89.121.86
@@ -29015,8 +29098,8 @@
  159.89.134.87
  159.89.135.34
  159.89.137.243
+159.89.140.0
  159.89.141.2
-159.89.143.108
  159.89.143.31
  159.89.145.93
  159.89.148.68
@@ -29036,6 +29119,7 @@
  159.89.163.42
  159.89.164.104
  159.89.167.183
+159.89.168.131
  159.89.171.217
  159.89.171.81
  159.89.172.207
@@ -29068,6 +29152,7 @@
  159.89.202.95
  159.89.205.186
  159.89.207.146
+159.89.207.151
  159.89.21.232
  159.89.210.220
  159.89.221.73
@@ -29106,11 +29191,13 @@
  159.89.44.62
  159.89.47.106
  159.89.48.31
+159.89.48.56
  159.89.48.69
  159.89.49.225
  159.89.5.185
  159.89.5.237
  159.89.51.183
+159.89.51.228
  159.89.53.183
  159.89.54.88
  159.89.55.36
@@ -29156,12 +29243,13 @@
  160.0.203.139
  160.0.203.15
  160.0.203.23
-160.0.203.71
+160.0.203.70
  160.0.203.78
  160.1.93.241
-160.116.0.29
  160.116.55.90
+160.116.59.16
  160.116.59.237
+160.116.59.51
  160.116.59.52
  160.116.59.8
  160.119.128.102
@@ -29182,6 +29270,8 @@
  160.124.236.221
  160.124.236.222
  160.124.49.179
+160.124.49.211
+160.124.49.215
  160.124.49.223
  160.124.49.249
  160.124.50.93
@@ -29207,7 +29297,7 @@
  160.153.156.137
  160.153.203.129
  160.153.235.106
-160.153.244.20
+160.153.245.175
  160.153.251.133
  160.153.252.9
  160.154.39.6
@@ -29222,7 +29312,6 @@
  160.16.145.25
  160.16.198.89
  160.16.208.139
-160.16.216.195
  160.16.219.87
  160.16.230.197
  160.16.63.41
@@ -29232,13 +29321,13 @@
  160.174.129.174
  160.176.180.241
  160.176.191.17
+160.177.134.19
  160.177.19.217
-160.177.190.80
-160.178.102.130
-160.178.219.110
+160.178.102.210
  160.179.148.72
  160.179.70.94
  160.19.246.57
+160.19.50.141
  160.19.50.153
  160.2.52.234
  160.20.200.234
@@ -29251,6 +29340,7 @@
  160.202.163.124
  160.202.163.149
  160.202.163.41
+160.202.164.141
  160.202.40.20
  160.202.41.194
  160.202.42.132
@@ -29269,12 +29359,14 @@
  160.251.2.223
  160.251.2.239
  160.251.20.218
+160.251.21.74
  160.251.23.121
  160.251.3.228
  160.251.4.18
  160.251.8.225
  160.251.9.131
  160.251.9.25
+160.32.192.243
  160.39.192.136
  160.39.48.77
  160holiganbet.com
@@ -29284,28 +29376,28 @@
  161.10.62.36
  161.117.0.66
  161.117.10.46
+161.117.11.230
  161.117.11.53
  161.117.176.46
  161.117.179.214
-161.117.187.213
  161.117.191.130
  161.117.248.141
  161.117.254.85
+161.117.56.255
  161.117.57.88
  161.117.7.137
  161.117.7.172
-161.117.83.239
  161.117.87.188
  161.117.9.99
  161.129.35.214
  161.129.67.114
+161.132.100.45
  161.132.109.66
  161.132.181.182
  161.132.181.238
  161.132.219.125
  161.132.78.98
  161.156.175.40
-161.18.150.214
  161.200.98.10
  161.202.110.154
  161.202.124.146
@@ -29313,6 +29405,7 @@
  161.202.226.194
  161.202.41.12
  161.216.164.98
+161.230.87.255
  161.246.18.216
  161.35.1.155
  161.35.10.226
@@ -29338,11 +29431,14 @@
  161.35.141.82
  161.35.142.244
  161.35.143.38
+161.35.148.121
  161.35.148.134
  161.35.148.75
  161.35.15.150
  161.35.15.187
+161.35.158.138
  161.35.161.170
+161.35.164.12
  161.35.167.148
  161.35.17.214
  161.35.173.212
@@ -29358,18 +29454,22 @@
  161.35.190.246
  161.35.193.16
  161.35.193.6
+161.35.194.6
  161.35.195.211
  161.35.195.30
  161.35.197.166
  161.35.205.180
  161.35.208.228
+161.35.210.87
  161.35.212.223
  161.35.212.246
-161.35.212.32
+161.35.216.143
+161.35.218.90
+161.35.220.240
  161.35.225.155
  161.35.227.204
  161.35.23.222
-161.35.231.15
+161.35.232.202
  161.35.235.27
  161.35.235.28
  161.35.237.200
@@ -29381,7 +29481,6 @@
  161.35.34.147
  161.35.36.168
  161.35.38.38
-161.35.39.141
  161.35.4.201
  161.35.40.167
  161.35.45.62
@@ -29424,15 +29523,16 @@
  161.53.201.185
  161.53.232.83
  161.53.240.25
-161.81.36.21
  161.82.216.3
  161.82.246.91
  161.97.104.113
  161.97.107.17
+161.97.107.18
  161.97.109.229
  161.97.122.243
  161.97.127.179
  161.97.128.127
+161.97.128.130
  161.97.129.105
  161.97.131.168
  161.97.131.255
@@ -29442,7 +29542,6 @@
  161.97.134.34
  161.97.134.5
  161.97.137.189
-161.97.138.73
  161.97.139.67
  161.97.140.161
  161.97.141.29
@@ -29455,8 +29554,8 @@
  161.97.164.205
  161.97.165.27
  161.97.169.148
+161.97.170.136
  161.97.171.7
-161.97.174.16
  161.97.174.74
  161.97.176.229
  161.97.177.211
@@ -29468,14 +29567,15 @@
  161.97.68.59
  161.97.70.157
  161.97.70.30
+161.97.71.151
  161.97.73.168
-161.97.74.111
  161.97.78.179
  161.97.80.95
  161.97.84.78
  161.97.93.150
  161.97.94.184
  161.97.97.115
+161.97.99.159
  161272.comvocenaweb.com.br
  1615559.hnuconnect1.club
  1619services.com
@@ -29483,6 +29583,7 @@
  162-365.net
  162.0.208.13
  162.0.208.48
+162.0.213.26
  162.0.221.105
  162.0.224.159
  162.0.225.173
@@ -29493,7 +29594,6 @@
  162.0.227.56
  162.0.227.68
  162.0.228.57
-162.0.230.5
  162.0.231.190
  162.0.233.227
  162.0.234.152
@@ -29503,14 +29603,10 @@
  162.0.234.214
  162.0.234.96
  162.0.239.192
-162.104.161.192
  162.104.162.72
  162.104.167.224
-162.104.167.23
-162.104.169.212
  162.104.171.181
  162.104.171.249
-162.104.171.39
  162.112.41.65
  162.12.211.116
  162.13.14.243
@@ -29519,16 +29615,14 @@
  162.14.131.13
  162.14.18.58
  162.14.23.147
-162.142.125.128
-162.142.125.38
+162.142.125.19
  162.142.125.39
-162.142.125.40
-162.142.125.53
  162.142.125.54
  162.142.125.55
  162.142.125.56
  162.144.107.199
  162.144.108.177
+162.144.110.85
  162.144.127.197
  162.144.128.76
  162.144.141.141
@@ -29538,6 +29632,7 @@
  162.144.212.120
  162.144.221.185
  162.144.235.70
+162.144.236.55
  162.144.34.109
  162.144.34.147
  162.144.35.84
@@ -29549,34 +29644,43 @@
  162.144.51.3
  162.144.57.196
  162.144.60.237
+162.144.66.89
  162.144.67.62
  162.144.76.55
  162.144.79.7
  162.144.91.33
  162.144.96.64
  162.144.99.9
-162.154.108.213
  162.154.207.147
  162.154.38.103
+162.155.10.150
  162.156.152.42
  162.156.219.13
  162.156.221.80
  162.156.23.202
-162.157.71.213
-162.158.126.150
-162.158.134.100
-162.158.134.50
+162.158.111.185
+162.158.126.126
+162.158.126.128
+162.158.134.60
+162.158.134.98
  162.158.142.101
  162.158.154.185
  162.158.154.221
-162.158.154.95
+162.158.154.71
+162.158.154.94
+162.158.155.114
  162.158.155.36
+162.158.155.42
+162.158.155.78
  162.158.158.195
  162.158.158.245
-162.158.158.79
+162.158.158.78
  162.158.159.116
  162.158.159.136
  162.158.159.42
+162.158.159.62
+162.158.159.74
+162.158.159.8
  162.158.159.88
  162.158.159.92
  162.158.165.127
@@ -29603,6 +29707,7 @@
  162.158.165.51
  162.158.165.69
  162.158.165.91
+162.158.166.104
  162.158.166.118
  162.158.166.146
  162.158.166.177
@@ -29629,6 +29734,7 @@
  162.158.167.197
  162.158.167.27
  162.158.167.29
+162.158.167.43
  162.158.167.51
  162.158.167.53
  162.158.167.57
@@ -29636,15 +29742,8 @@
  162.158.167.73
  162.158.167.79
  162.158.167.9
-162.158.178.45
-162.158.183.103
-162.158.183.175
-162.158.183.213
-162.158.202.242
-162.158.202.244
+162.158.183.151
  162.158.63.191
-162.158.63.26
-162.158.74.213
  162.158.88.135
  162.158.91.54
  162.158.92.107
@@ -29655,7 +29754,6 @@
  162.17.167.210
  162.17.252.5
  162.191.49.51
-162.191.91.95
  162.198.89.189
  162.199.19.25
  162.204.185.45
@@ -29728,13 +29826,8 @@
  162.212.115.93
  162.212.115.95
  162.212.168.115
-162.212.168.76
  162.212.169.115
-162.212.169.140
-162.212.169.186
  162.212.169.2
-162.212.169.210
-162.212.169.225
  162.212.169.254
  162.212.169.35
  162.212.169.36
@@ -29750,8 +29843,8 @@
  162.212.171.37
  162.212.173.119
  162.212.173.189
+162.212.174.115
  162.212.174.238
-162.212.174.54
  162.212.174.62
  162.212.175.2
  162.212.175.202
@@ -29764,6 +29857,7 @@
  162.213.24.40
  162.213.25.67
  162.213.251.24
+162.213.255.122
  162.213.255.135
  162.213.255.198
  162.213.27.198
@@ -29772,6 +29866,8 @@
  162.214.101.179
  162.214.101.56
  162.214.103.187
+162.214.147.53
+162.214.148.112
  162.214.155.215
  162.214.28.25
  162.214.54.162
@@ -29791,9 +29887,12 @@
  162.217.175.208
  162.217.77.15
  162.218.234.56
+162.218.92.177
+162.218.92.179
  162.219.122.165
  162.219.176.211
  162.219.179.101
+162.219.197.152
  162.219.253.22
  162.219.4.93
  162.219.5.83
@@ -29816,10 +29915,10 @@
  162.223.91.10
  162.223.91.231
  162.227.78.128
-162.232.255.114
  162.238.132.255
  162.239.57.201
  162.241.108.15
+162.241.114.56
  162.241.117.105
  162.241.117.179
  162.241.117.37
@@ -29827,23 +29926,25 @@
  162.241.121.37
  162.241.125.106
  162.241.125.112
-162.241.138.75
  162.241.148.33
  162.241.148.86
+162.241.149.137
  162.241.149.45
  162.241.153.151
-162.241.153.250
  162.241.154.215
  162.241.158.222
+162.241.201.220
  162.241.204.233
  162.241.214.166
  162.241.218.103
  162.241.226.34
  162.241.234.166
+162.241.24.182
  162.241.242.173
  162.241.244.134
  162.241.41.111
  162.241.44.26
+162.241.48.63
  162.241.65.37
  162.241.72.243
  162.241.75.116
@@ -29872,7 +29973,6 @@
  162.243.125.182
  162.243.125.54
  162.243.126.220
-162.243.126.96
  162.243.128.125
  162.243.129.124
  162.243.129.240
@@ -29909,7 +30009,6 @@
  162.243.166.183
  162.243.167.60
  162.243.171.112
-162.243.172.158
  162.243.172.179
  162.243.173.29
  162.243.174.115
@@ -29964,7 +30063,6 @@
  162.243.81.182
  162.243.82.78
  162.243.84.55
-162.243.87.130
  162.243.91.84
  162.243.92.165
  162.243.93.167
@@ -29972,8 +30070,8 @@
  162.243.99.164
  162.244.10.211
  162.244.10.216
-162.244.146.16
  162.244.15.146
+162.244.152.241
  162.244.32.46
  162.244.32.47
  162.244.35.14
@@ -29995,7 +30093,6 @@
  162.247.155.129
  162.247.18.162
  162.247.19.213
-162.247.28.90
  162.247.72.199
  162.247.73.192
  162.247.73.206
@@ -30023,15 +30120,12 @@
  162.250.189.53
  162.250.235.127
  162.251.16.10
-162.251.201.249
-162.251.232.105
  162.253.129.115
  162.253.129.163
  162.253.129.179
  162.253.129.234
  162.253.129.67
  162.253.129.83
-162.253.131.106
  162.253.155.79
  162.253.66.50
  162.253.66.76
@@ -30051,15 +30145,16 @@
  162266.bibigor.com
  162783-dot-n-e-w-me-ss-age-po-rt-al.wl.r.appspot.com
  162840-dot-n-e-w-me-ss-age-po-rt-al.wl.r.appspot.com
+163.117.141.16
  163.121.188.3
-163.125.137.27
-163.125.17.122
-163.125.183.142
  163.125.193.101
  163.125.194.25
-163.125.195.154
-163.125.202.216
+163.125.195.107
+163.125.195.47
+163.125.201.227
+163.125.201.249
  163.125.205.247
+163.125.68.65
  163.13.182.105
  163.131.167.23
  163.139.169.79
@@ -30076,7 +30171,6 @@
  163.171.142.18
  163.172.101.137
  163.172.109.132
-163.172.112.2
  163.172.113.177
  163.172.115.25
  163.172.117.155
@@ -30086,6 +30180,7 @@
  163.172.129.30
  163.172.130.111
  163.172.132.199
+163.172.132.253
  163.172.133.23
  163.172.136.226
  163.172.136.227
@@ -30109,14 +30204,16 @@
  163.172.165.127
  163.172.167.225
  163.172.171.163
-163.172.177.98
  163.172.178.167
+163.172.18.192
  163.172.180.18
+163.172.182.130
  163.172.185.11
+163.172.187.114
  163.172.189.32
  163.172.190.160
  163.172.191.31
-163.172.204.173
+163.172.193.194
  163.172.211.176
  163.172.212.115
  163.172.212.180
@@ -30126,8 +30223,8 @@
  163.172.217.103
  163.172.219.130
  163.172.220.221
+163.172.226.76
  163.172.229.188
-163.172.234.206
  163.172.234.207
  163.172.234.209
  163.172.234.210
@@ -30144,6 +30241,7 @@
  163.172.30.76
  163.172.31.79
  163.172.32.190
+163.172.33.155
  163.172.35.247
  163.172.40.218
  163.172.41.115
@@ -30187,7 +30285,6 @@
  163.44.151.109
  163.44.152.32
  163.44.165.205
-163.44.168.207
  163.44.193.95
  163.44.194.47
  163.44.196.132
@@ -30200,13 +30297,13 @@
  163.47.158.137
  163.47.158.141
  163.47.158.193
+163.47.158.246
  163.47.158.41
  163.47.158.49
  163.47.158.53
  163.47.158.6
  163.47.158.73
  163.47.35.102
-163.47.86.163
  163.53.150.138
  163.53.168.122
  163.53.204.180
@@ -30223,14 +30320,15 @@
  164.115.22.45
  164.115.241.74
  164.115.32.169
-164.115.40.170
  164.115.42.200
  164.115.43.209
  164.115.5.63
  164.125.234.121
  164.132.103.232
  164.132.104.244
+164.132.107.245
  164.132.108.204
+164.132.108.73
  164.132.112.237
  164.132.126.140
  164.132.145.70
@@ -30263,6 +30361,7 @@
  164.132.44.25
  164.132.44.97
  164.132.46.129
+164.132.48.179
  164.132.54.215
  164.132.56.243
  164.132.57.16
@@ -30281,6 +30380,7 @@
  164.155.104.12
  164.155.104.184
  164.155.104.202
+164.155.104.9
  164.155.231.247
  164.155.231.251
  164.155.250.126
@@ -30299,13 +30399,13 @@
  164.163.250.88
  164.163.250.92
  164.163.250.94
-164.163.74.22
+164.163.74.30
  164.163.99.10
-164.177.0.65
  164.177.104.186
  164.177.178.104
  164.39.202.75
  164.52.13.53
+164.52.204.244
  164.52.24.164
  164.52.24.168
  164.52.42.6
@@ -30319,8 +30419,10 @@
  164.68.107.225
  164.68.108.59
  164.68.109.215
+164.68.111.10
  164.68.111.155
  164.68.114.114
+164.68.115.95
  164.68.116.168
  164.68.116.198
  164.68.117.12
@@ -30338,6 +30440,11 @@
  164.77.175.246
  164.77.188.106
  164.90.130.165
+164.90.141.214
+164.90.141.215
+164.90.141.216
+164.90.141.218
+164.90.141.219
  164.90.148.76
  164.90.154.227
  164.90.164.165
@@ -30351,20 +30458,17 @@
  164.90.217.133
  164.90.217.167
  164.90.225.28
+164.90.225.91
  164.90.227.92
  164.90.237.125
  164.90.241.64
  1643.31cf4fdae.com
  165.132.30.11
-165.138.4.55
  165.138.55.107
-165.16.105.186
  165.16.112.217
  165.16.118.206
  165.16.203.55
-165.16.23.10
  165.16.23.17
-165.16.23.9
  165.16.27.90
  165.16.42.92
  165.16.54.199
@@ -30384,7 +30488,6 @@
  165.165.132.60
  165.165.134.1
  165.165.144.251
-165.169.173.85
  165.169.65.9
  165.194.27.141
  165.22.1.102
@@ -30424,7 +30527,6 @@
  165.22.179.40
  165.22.184.212
  165.22.186.178
-165.22.2.186
  165.22.205.45
  165.22.206.182
  165.22.207.116
@@ -30440,6 +30542,7 @@
  165.22.214.73
  165.22.216.228
  165.22.217.96
+165.22.218.171
  165.22.219.167
  165.22.22.250
  165.22.220.151
@@ -30460,10 +30563,10 @@
  165.22.24.32
  165.22.24.71
  165.22.240.149
+165.22.242.39
  165.22.246.219
  165.22.247.18
  165.22.247.221
-165.22.249.223
  165.22.25.236
  165.22.250.229
  165.22.253.62
@@ -30472,10 +30575,10 @@
  165.22.26.88
  165.22.28.45
  165.22.30.70
+165.22.35.21
  165.22.35.80
-165.22.36.112
+165.22.40.128
  165.22.43.247
-165.22.43.8
  165.22.44.115
  165.22.46.146
  165.22.48.140
@@ -30483,6 +30586,7 @@
  165.22.50.136
  165.22.50.164
  165.22.50.208
+165.22.53.233
  165.22.57.164
  165.22.58.237
  165.22.61.205
@@ -30508,6 +30612,8 @@
  165.22.94.14
  165.22.94.141
  165.22.94.242
+165.22.94.245
+165.22.95.34
  165.22.95.53
  165.22.98.186
  165.22.99.12
@@ -30561,7 +30667,6 @@
  165.227.132.96
  165.227.133.181
  165.227.134.110
-165.227.134.165
  165.227.134.168
  165.227.135.4
  165.227.136.179
@@ -30582,7 +30687,6 @@
  165.227.163.85
  165.227.163.91
  165.227.165.102
-165.227.166.125
  165.227.166.128
  165.227.166.247
  165.227.167.172
@@ -30594,6 +30698,7 @@
  165.227.175.22
  165.227.177.68
  165.227.18.139
+165.227.18.3
  165.227.180.243
  165.227.180.91
  165.227.182.136
@@ -30608,6 +30713,7 @@
  165.227.197.244
  165.227.198.222
  165.227.199.191
+165.227.2.113
  165.227.2.127
  165.227.2.199
  165.227.20.194
@@ -30663,6 +30769,7 @@
  165.227.38.68
  165.227.4.30
  165.227.4.60
+165.227.43.226
  165.227.45.150
  165.227.46.89
  165.227.48.100
@@ -30682,22 +30789,24 @@
  165.227.62.249
  165.227.63.165
  165.227.63.41
+165.227.67.118
  165.227.68.198
  165.227.69.193
  165.227.7.187
  165.227.7.218
  165.227.71.30
+165.227.72.156
  165.227.72.166
  165.227.72.37
  165.227.72.48
  165.227.75.121
  165.227.75.135
-165.227.75.2
  165.227.76.73
  165.227.76.8
  165.227.78.191
  165.227.78.77
  165.227.8.84
+165.227.80.163
  165.227.80.194
  165.227.80.57
  165.227.81.93
@@ -30731,19 +30840,19 @@
  165.231.103.223
  165.231.103.224
  165.231.103.89
-165.231.105.158
+165.231.105.124
  165.231.105.19
-165.231.105.199
  165.231.108.8
  165.231.120.251
-165.231.130.156
-165.231.130.233
  165.231.143.113
-165.231.143.119
+165.231.143.122
+165.231.143.179
  165.231.143.195
  165.231.143.212
+165.231.143.216
  165.231.143.226
  165.231.143.235
+165.231.168.150
  165.231.212.14
  165.231.212.84
  165.231.24.107
@@ -30762,6 +30871,7 @@
  165.231.84.51
  165.231.84.56
  165.231.84.80
+165.231.92.158
  165.231.95.127
  165.231.95.132
  165.231.95.139
@@ -30774,23 +30884,27 @@
  165.231.98.136
  165.231.98.57
  165.232.105.80
+165.232.107.187
  165.232.111.17
  165.232.122.135
  165.232.122.187
  165.232.133.191
  165.232.137.166
  165.232.148.71
+165.232.152.15
  165.232.184.239
  165.232.65.66
  165.232.66.234
  165.232.70.243
  165.232.98.175
+165.254.255.17
+165.255.137.165
  165.255.254.204
-165.255.51.85
  165.255.67.129
  165.255.89.209
  165.255.90.187
  165.255.92.241
+165.3.86.134
  165.3.87.121
  165.3.87.123
  165.3.87.162
@@ -30809,10 +30923,9 @@
  165.3.92.2
  165.3.93.81
  165.51.228.178
-165.56.184.158
  165.56.7.202
  165.73.62.31
-165.73.89.75
+165.73.91.127
  165.73.99.36
  165.84.180.12
  165.84.180.33
@@ -30826,7 +30939,6 @@
  165.90.60.69
  165.90.60.73
  165.90.95.114
-165.98.137.172
  16512.url.789msw.com
  1654.3190cfdae.com
  166.111.138.162
@@ -30861,8 +30973,6 @@
  166.137.252.93
  166.137.8.113
  166.137.90.15
-166.141.23.200
-166.142.243.191
  166.166.84.239
  166.170.0.117
  166.170.14.108
@@ -30918,6 +31028,7 @@
  167.114.174.95
  167.114.185.237
  167.114.197.46
+167.114.198.79
  167.114.203.163
  167.114.203.73
  167.114.209.38
@@ -30926,6 +31037,7 @@
  167.114.213.144
  167.114.213.214
  167.114.219.41
+167.114.22.13
  167.114.221.238
  167.114.224.218
  167.114.224.6
@@ -30936,6 +31048,7 @@
  167.114.25.102
  167.114.251.164
  167.114.254.142
+167.114.28.7
  167.114.29.88
  167.114.3.105
  167.114.3.158
@@ -30965,6 +31078,7 @@
  167.160.36.151
  167.160.72.223
  167.160.74.223
+167.160.74.248
  167.160.76.242
  167.160.76.44
  167.160.76.56
@@ -30997,7 +31111,6 @@
  167.172.145.168
  167.172.145.53
  167.172.146.98
-167.172.148.206
  167.172.150.57
  167.172.151.135
  167.172.151.136
@@ -31008,6 +31121,7 @@
  167.172.158.68
  167.172.16.47
  167.172.161.10
+167.172.161.169
  167.172.161.171
  167.172.162.100
  167.172.162.119
@@ -31016,44 +31130,41 @@
  167.172.164.37
  167.172.164.73
  167.172.165.228
-167.172.165.34
-167.172.165.68
  167.172.166.193
  167.172.166.232
  167.172.167.211
  167.172.167.26
  167.172.167.39
-167.172.168.198
-167.172.169.169
-167.172.169.236
  167.172.169.44
-167.172.169.97
  167.172.170.145
  167.172.170.155
  167.172.171.189
  167.172.173.54
+167.172.177.33
  167.172.179.135
  167.172.180.190
+167.172.180.40
  167.172.180.46
+167.172.181.231
+167.172.181.42
  167.172.184.166
  167.172.185.17
  167.172.186.163
  167.172.186.21
  167.172.188.45
  167.172.190.236
+167.172.190.42
  167.172.191.249
  167.172.194.16
  167.172.194.231
-167.172.195.183
  167.172.195.99
  167.172.204.125
  167.172.205.116
-167.172.207.139
  167.172.209.140
  167.172.209.209
  167.172.209.22
+167.172.215.83
  167.172.216.125
-167.172.224.137
  167.172.226.175
  167.172.227.174
  167.172.229.168
@@ -31066,7 +31177,6 @@
  167.172.242.166
  167.172.242.210
  167.172.242.89
-167.172.244.253
  167.172.246.182
  167.172.246.23
  167.172.246.245
@@ -31080,8 +31190,8 @@
  167.172.250.115
  167.172.251.74
  167.172.252.132
+167.172.253.42
  167.172.254.177
-167.172.28.187
  167.172.29.206
  167.172.29.44
  167.172.31.31
@@ -31097,12 +31207,11 @@
  167.172.61.145
  167.172.78.207
  167.172.78.73
-167.172.96.42
  167.172.97.140
  167.172.97.162
  167.172.97.229
-167.172.98.80
  167.172.98.89
+167.179.139.79
  167.179.147.174
  167.179.166.238
  167.179.29.103
@@ -31119,17 +31228,16 @@
  167.179.96.172
  167.179.97.228
  167.248.133.19
-167.248.133.37
+167.248.133.26
  167.248.133.38
  167.248.133.39
-167.248.133.53
  167.248.133.54
-167.248.133.55
  167.248.133.56
  167.249.13.244
  167.249.168.126
  167.249.170.26
  167.249.212.17
+167.249.52.17
  167.249.66.0
  167.249.9.37
  167.250.127.235
@@ -31138,18 +31246,19 @@
  167.250.48.115
  167.250.49.155
  167.250.65.246
+167.250.95.235
  167.56.201.108
  167.56.252.192
  167.56.7.75
-167.57.77.200
+167.57.25.238
  167.61.134.107
  167.68.23.251
  167.71.10.37
-167.71.100.47
  167.71.102.102
  167.71.102.201
-167.71.109.120
+167.71.104.1
  167.71.109.45
+167.71.111.16
  167.71.112.8
  167.71.114.229
  167.71.117.84
@@ -31169,6 +31278,7 @@
  167.71.15.69
  167.71.152.101
  167.71.153.244
+167.71.154.15
  167.71.159.219
  167.71.16.200
  167.71.162.16
@@ -31184,6 +31294,7 @@
  167.71.196.176
  167.71.202.109
  167.71.202.40
+167.71.202.93
  167.71.203.215
  167.71.204.250
  167.71.208.85
@@ -31221,7 +31332,8 @@
  167.71.235.61
  167.71.236.220
  167.71.236.26
-167.71.241.109
+167.71.237.237
+167.71.238.241
  167.71.243.10
  167.71.249.88
  167.71.251.16
@@ -31249,8 +31361,10 @@
  167.71.59.56
  167.71.59.91
  167.71.6.91
+167.71.63.47
  167.71.7.109
  167.71.72.70
+167.71.74.3
  167.71.74.39
  167.71.81.215
  167.71.81.29
@@ -31259,7 +31373,6 @@
  167.71.9.180
  167.71.91.219
  167.71.91.58
-167.71.92.8
  167.71.95.157
  167.71.96.148
  167.71.98.172
@@ -31289,6 +31402,7 @@
  167.86.81.74
  167.86.87.90
  167.86.90.239
+167.86.93.214
  167.86.94.107
  167.86.98.148
  167.86.98.81
@@ -31303,11 +31417,10 @@
  167.88.181.200
  167.88.181.219
  167.88.7.134
-167.89.100.129
-167.89.109.97
  167.89.80.39
  167.98.71.52
  167.99.10.147
+167.99.10.176
  167.99.101.77
  167.99.104.19
  167.99.105.223
@@ -31338,6 +31451,7 @@
  167.99.148.91
  167.99.155.233
  167.99.155.36
+167.99.156.117
  167.99.159.142
  167.99.160.9
  167.99.161.236
@@ -31371,7 +31485,6 @@
  167.99.209.21
  167.99.210.7
  167.99.211.164
-167.99.211.66
  167.99.211.71
  167.99.212.138
  167.99.212.191
@@ -31393,19 +31506,17 @@
  167.99.222.220
  167.99.223.249
  167.99.224.10
-167.99.224.109
  167.99.226.56
-167.99.227.19
  167.99.228.58
  167.99.230.48
  167.99.231.236
+167.99.234.1
  167.99.234.199
  167.99.234.37
  167.99.234.59
  167.99.236.14
  167.99.236.253
  167.99.240.241
-167.99.242.205
  167.99.246.177
  167.99.247.118
  167.99.251.192
@@ -31416,7 +31527,6 @@
  167.99.28.116
  167.99.31.63
  167.99.32.92
-167.99.33.124
  167.99.33.32
  167.99.34.95
  167.99.35.70
@@ -31431,9 +31541,7 @@
  167.99.40.117
  167.99.40.161
  167.99.40.234
-167.99.40.38
  167.99.40.42
-167.99.41.0
  167.99.41.124
  167.99.41.147
  167.99.42.220
@@ -31463,6 +31571,7 @@
  167.99.66.74
  167.99.67.142
  167.99.67.42
+167.99.68.226
  167.99.68.242
  167.99.68.65
  167.99.69.167
@@ -31477,9 +31586,9 @@
  167.99.77.94
  167.99.82.213
  167.99.82.226
-167.99.82.91
  167.99.87.4
  167.99.88.37
+167.99.90.240
  167.99.90.243
  167.99.90.25
  167.99.90.37
@@ -31489,24 +31598,24 @@
  167.99.96.114
  167.99.96.163
  167.99.98.92
-167.99.99.10
  168.0.108.70
  168.0.155.15
  168.103.128.133
  168.103.13.215
-168.103.134.226
-168.103.41.159
  168.119.0.182
  168.119.104.150
  168.119.105.145
  168.119.116.237
+168.119.128.81
  168.119.140.58
  168.119.144.245
  168.119.147.148
+168.119.155.167
  168.119.158.57
  168.119.158.58
  168.119.177.31
  168.119.18.7
+168.119.202.71
  168.119.234.66
  168.119.238.100
  168.119.24.250
@@ -31538,20 +31647,18 @@
  168.143.19.89
  168.144.170.33
  168.144.91.77
+168.151.119.150
  168.151.226.122
  168.151.226.159
  168.151.226.180
  168.151.226.228
  168.151.227.134
  168.151.227.4
-168.151.228.151
  168.151.228.185
  168.151.228.224
  168.151.228.228
  168.151.228.3
-168.151.229.178
  168.151.229.199
-168.151.229.26
  168.151.229.58
  168.151.229.76
  168.181.121.195
@@ -31560,6 +31667,7 @@
  168.181.196.33
  168.181.242.81
  168.181.245.129
+168.181.252.201
  168.184.14.14
  168.187.77.177
  168.187.86.194
@@ -31579,29 +31687,28 @@
  168.195.196.29
  168.195.205.154
  168.195.229.60
+168.195.242.209
+168.195.81.63
  168.196.114.201
  168.196.114.205
  168.196.114.241
  168.196.114.7
  168.196.115.193
  168.196.115.7
-168.196.12.27
+168.196.24.61
  168.196.96.37
  168.197.176.8
  168.197.194.146
  168.197.52.224
  168.197.73.182
  168.205.140.224
-168.205.200.236
  168.205.217.164
  168.205.217.170
-168.205.217.21
  168.205.217.32
  168.205.217.78
  168.205.217.8
  168.205.218.145
  168.205.218.211
-168.205.218.6
  168.205.218.71
  168.205.218.72
  168.215.65.65
@@ -31634,15 +31741,11 @@
  168.227.158.9
  168.227.169.68
  168.227.212.130
-168.227.41.201
  168.227.78.94
  168.227.99.11
  168.228.118.25
-168.228.150.5
-168.228.166.239
  168.228.192.13
  168.228.192.166
-168.228.195.90
  168.228.204.250
  168.228.207.98
  168.228.38.89
@@ -31670,12 +31773,12 @@
  168.235.98.150
  168.253.115.79
  168.61.100.225
+168.61.18.166
  168.61.36.226
  168.61.55.120
  168.61.97.5
  168.62.175.22
  168.62.218.152
-168.62.245.222
  168.62.248.25
  168.63.137.51
  168.63.215.201
@@ -31683,8 +31786,9 @@
  168.70.43.159
  168.70.49.38
  168.70.62.91
+168.80.101.52
  168.80.228.114
-168.90.196.129
+168.81.225.96
  168.90.196.156
  168.90.196.163
  168.90.196.236
@@ -31698,7 +31802,6 @@
  168.90.196.88
  168.90.196.91
  168.90.197.127
-168.90.197.235
  168.90.199.130
  168.90.199.154
  168.90.199.156
@@ -31713,6 +31816,7 @@
  168.90.29.245
  168.90.34.148
  168.90.34.196
+168.90.34.212
  168.90.34.217
  168.90.50.118
  168.90.88.40
@@ -31723,36 +31827,36 @@
  168.90.90.57
  168.90.92.34
  168.91.45.114
-168.91.76.228
-168.91.76.81
-168.91.80.209
+168.91.46.103
+168.91.80.152
  168.91.81.165
  168.91.81.216
+168.91.81.98
  168.91.82.130
  168.91.82.250
+168.91.83.223
  168.wtuo100.com
  1685602.servicesbpd.club
  16873.url.snwxn.com
  168ishop.com
  168kj.cn
  168ob.com
-169.0.243.179
  169.0.249.109
  169.0.67.26
  169.149.133.127
-169.159.30.246
  169.239.123.249
  169.239.166.134
  169.239.171.59
+169.239.176.120
  169.239.182.217
  169.239.193.65
  169.239.221.46
  169.239.223.136
  169.239.236.101
  169.239.236.27
+169.239.39.15
  169.239.45.37
  169.239.45.78
-169.239.66.145
  169.255.114.48
  169.255.126.211
  169.255.136.14
@@ -31768,6 +31872,7 @@
  169.38.128.7
  169.38.76.22
  169.44.34.203
+169.48.104.70
  169.48.163.176
  169.48.92.229
  169.50.3.171
@@ -31785,21 +31890,18 @@
  169.57.219.244
  169.60.128.104
  169.61.24.157
-169.62.197.218
  16acc1ba3b3001611.temporary.link
  16julpdtr-moviesplsnetfflx.com
  16nisatadiatlariniz.com
  16tiles.com
  17.142.150.242
  17.5studio.eu
-170.0.100.2
  170.0.126.252
  170.0.134.250
  170.0.202.6
  170.0.203.0
  170.0.203.117
-170.0.44.195
-170.0.45.102
+170.0.44.181
  170.0.52.146
  170.0.52.226
  170.0.52.29
@@ -31833,8 +31935,16 @@
  170.130.100.10
  170.130.100.11
  170.130.100.12
+170.130.100.13
+170.130.100.17
+170.130.100.19
  170.130.100.2
+170.130.100.20
+170.130.100.22
+170.130.100.26
+170.130.100.28
  170.130.100.3
+170.130.100.30
  170.130.100.4
  170.130.100.5
  170.130.100.6
@@ -31847,8 +31957,7 @@
  170.130.172.42
  170.130.183.28
  170.130.187.14
-170.130.187.18
-170.130.187.46
+170.130.187.38
  170.130.187.6
  170.130.205.117
  170.130.31.177
@@ -31861,11 +31970,15 @@
  170.130.63.42
  170.130.63.95
  170.150.101.166
+170.150.101.22
  170.150.102.109
  170.150.102.221
  170.150.103.20
  170.150.103.209
-170.150.103.231
+170.150.138.199
+170.150.139.135
+170.150.139.148
+170.150.139.150
  170.150.52.210
  170.150.52.5
  170.150.52.65
@@ -31874,6 +31987,7 @@
  170.205.163.198
  170.210.121.208
  170.210.136.56
+170.210.176.254
  170.210.192.78
  170.210.203.201
  170.210.203.215
@@ -31882,6 +31996,7 @@
  170.210.71.10
  170.210.83.119
  170.231.187.209
+170.231.194.193
  170.231.232.97
  170.231.56.3
  170.231.56.49
@@ -31896,7 +32011,6 @@
  170.238.142.66
  170.238.156.30
  170.238.74.61
-170.238.98.152
  170.239.108.10
  170.239.222.182
  170.239.247.212
@@ -31922,13 +32036,13 @@
  170.244.64.198
  170.244.64.225
  170.244.68.106
+170.244.76.102
  170.244.76.84
  170.244.88.67
-170.244.93.60
+170.244.93.199
  170.245.200.100
  170.245.67.112
  170.246.3.242
-170.246.69.189
  170.246.85.106
  170.246.85.108
  170.246.85.38
@@ -31946,28 +32060,25 @@
  170.247.201.17
  170.247.202.121
  170.247.203.14
-170.247.41.191
  170.247.43.142
  170.249.191.114
  170.250.84.130
  170.253.53.165
+170.254.147.158
  170.254.148.94
  170.254.150.190
+170.254.224.7
  170.254.226.157
  170.254.248.61
  170.254.92.198
-170.39.76.111
-170.55.134.174
  170.75.149.14
  170.75.150.50
-170.75.162.211
  170.75.162.97
  170.78.21.156
  170.78.38.96
  170.78.39.12
  170.78.39.132
  170.78.39.58bin.sh
-170.78.70.175
  170.78.96.2
  170.79.148.21
  170.79.181.118
@@ -31980,7 +32091,6 @@
  170.79.181.82
  170.79.233.162
  170.79.43.7
-170.79.85.224
  170.79.87.178
  170.79.9.54
  170.79.91.98
@@ -32004,7 +32114,8 @@
  170.81.141.49
  170.81.141.97
  170.81.202.167
-170.81.202.5
+170.81.202.45
+170.81.202.46
  170.81.231.150
  170.81.34.54
  170.81.35.26
@@ -32012,14 +32123,14 @@
  170.81.48.2
  170.81.92.102
  170.81.93.44
-170.82.133.196
  170.82.181.66
+170.82.189.152
  170.82.52.48
  170.82.54.39
-170.83.108.65
  170.83.115.4
  170.83.147.242
  170.83.156.14
+170.83.176.100
  170.83.176.109
  170.83.176.123
  170.83.176.147
@@ -32029,6 +32140,7 @@
  170.83.176.19
  170.83.176.193
  170.83.176.199
+170.83.176.215
  170.83.176.225
  170.83.176.253
  170.83.176.3
@@ -32036,10 +32148,10 @@
  170.83.176.67
  170.83.176.74
  170.83.176.82
+170.83.176.86
  170.83.177.114
  170.83.177.128
  170.83.177.13
-170.83.177.15
  170.83.177.150
  170.83.177.159
  170.83.177.188
@@ -32047,6 +32159,7 @@
  170.83.177.60
  170.83.177.66
  170.83.178.104
+170.83.178.126
  170.83.178.140
  170.83.178.141
  170.83.178.155
@@ -32059,9 +32172,7 @@
  170.83.179.128
  170.83.179.198
  170.83.179.232
-170.83.187.60
  170.83.199.9
-170.84.183.196
  170.84.210.196
  170.84.224.240
  170.84.48.102
@@ -32078,24 +32189,25 @@
  1700restaurant.com
  1702525-dot-n-e-w-me-ss-age-po-rt-al.wl.r.appspot.com
  171.100.102.154
-171.100.251.252
+171.100.183.155
+171.100.250.26
  171.100.51.250
  171.100.8.82
  171.100.9.126
  171.101.100.225
  171.101.102.20
-171.101.116.136
  171.101.19.69
  171.101.216.125
  171.101.217.126
-171.101.218.178
  171.101.38.232
+171.101.94.227
+171.101.97.177
+171.101.98.142
  171.101.99.79
-171.103.174.222
-171.103.199.202
-171.103.78.130
+171.103.195.50
  171.103.9.22
  171.104.126.183
+171.106.203.211
  171.107.184.213
  171.108.154.67
  171.111.153.216
@@ -32106,21 +32218,17 @@
  171.118.24.229
  171.119.209.26
  171.119.223.219
-171.120.215.74
  171.121.122.102
  171.122.132.240
  171.123.109.137
  171.123.120.177
  171.123.134.174
  171.123.15.218
-171.123.224.238
  171.125.14.205
-171.125.156.27
  171.125.184.101
  171.125.195.122
-171.125.214.86
-171.125.34.49
  171.125.50.166
+171.125.94.119
  171.126.164.104
  171.126.70.231
  171.15.17.161
@@ -32135,37 +32243,32 @@
  171.22.122.124
  171.22.122.168
  171.22.122.227
-171.22.123.129
-171.22.123.16
+171.22.123.172
  171.22.123.182
-171.22.123.202
  171.22.123.221
  171.22.123.40
  171.22.123.44
-171.22.123.78
+171.22.123.83
  171.22.145.107
  171.22.145.15
  171.22.145.6
-171.22.24.177
  171.22.24.185
  171.22.24.246
-171.22.253.208
  171.22.255.146
  171.221.149.19
+171.221.149.248
  171.221.200.175
  171.221.217.145
+171.224.179.44
  171.224.180.133
-171.224.180.146
  171.225.252.171
  171.226.1.132
  171.226.1.142
  171.226.1.24
  171.226.1.242
  171.226.1.56
-171.226.2.195
-171.226.2.35
-171.226.3.244
  171.226.3.34
+171.226.36.248
  171.226.4.120
  171.226.4.221
  171.226.4.37
@@ -32175,10 +32278,8 @@
  171.227.210.72
  171.227.212.22
  171.227.213.238
-171.227.213.89
  171.227.214.90
  171.227.215.117
-171.227.215.170
  171.227.215.226
  171.227.215.60
  171.227.26.217
@@ -32186,9 +32287,11 @@
  171.228.211.13
  171.228.220.53
  171.228.69.230
+171.231.1.19
  171.231.15.98
  171.231.5.16
  171.232.183.85
+171.232.240.207
  171.232.243.179
  171.232.244.141
  171.232.249.39
@@ -32197,50 +32300,49 @@
  171.235.62.33
  171.235.63.50
  171.235.82.17
-171.235.84.29
  171.235.85.75
  171.235.86.129
  171.236.141.180
-171.236.148.130
-171.236.56.175
+171.236.59.2
+171.236.59.33
  171.236.64.146
-171.237.152.11
+171.238.52.31
  171.239.248.84
+171.239.248.88
  171.239.248.95
  171.239.250.184
  171.239.250.243
  171.239.251.108
+171.239.251.202
  171.239.251.235
  171.239.252.64
  171.239.253.173
+171.240.110.160
  171.240.193.161
  171.240.194.155
  171.240.194.178
  171.240.194.61
  171.240.195.203
  171.240.195.82
-171.240.196.43
  171.240.202.57
  171.240.204.189
-171.240.204.28
-171.240.205.2
  171.240.207.76
  171.241.173.144
-171.241.21.165
  171.241.28.59
+171.241.59.109
  171.241.68.142
-171.242.208.90
  171.243.203.16
-171.243.245.147
  171.244.1.84
  171.244.132.198
  171.244.137.147
  171.244.139.178
  171.244.139.236
+171.244.139.243
  171.244.139.67
  171.244.140.174
  171.244.142.202
  171.244.142.74
+171.244.15.38
  171.244.16.85
  171.244.18.14
  171.244.188.205
@@ -32249,15 +32351,14 @@
  171.244.45.137
  171.244.48.33
  171.244.51.114
+171.246.147.209
  171.246.77.95
  171.247.100.133
  171.247.101.215
  171.247.101.253
-171.247.102.124
  171.247.102.54
  171.247.102.66
  171.247.152.81
-171.247.23.199
  171.249.137.166
  171.249.137.191
  171.249.137.63
@@ -32270,36 +32371,35 @@
  171.25.193.25
  171.25.193.77
  171.25.193.78
+171.250.125.37
  171.250.14.117
  171.251.232.197
  171.251.237.64
  171.251.25.67
  171.251.30.5
  171.251.31.46
+171.252.189.121
  171.254.231.67
  171.255.199.129
-171.255.211.55
-171.34.112.204
  171.34.113.168
  171.34.178.214
  171.34.178.93
  171.34.70.28
  171.35.143.208
  171.35.160.185
-171.35.160.78
  171.35.163.235
  171.35.169.114
  171.35.170.35
-171.35.171.185
+171.35.172.37
+171.35.174.129
+171.35.175.48
  171.36.43.216
  171.37.3.68
-171.38.147.206
-171.38.148.195
-171.38.193.28
-171.4.227.13
+171.38.151.119
+171.38.192.249
+171.4.224.105
  171.42.161.164bin.sh
-171.44.224.44
-171.48.101.143
+171.48.44.25
  171.5.16.129
  171.5.164.84
  171.5.165.90
@@ -32307,49 +32407,41 @@
  171.5.222.124
  171.5.24.91
  171.5.25.237
-171.5.250.176
-171.5.251.73
  171.5.29.96
  171.5.30.241
  171.5.41.43
  171.50.153.93
  171.6.114.163
+171.6.12.15
  171.6.130.239
+171.6.135.43
  171.6.221.181
  171.6.229.229
-171.6.6.2
  171.60.161.182
-171.60.166.192
  171.60.176.131
  171.7.11.172
  171.7.14.149
  171.7.25.239
-171.79.186.63
+171.76.71.102
  171.79.187.95
  171.80.187.35
  171.81.75.110
-171.83.202.37
  171.84.2.6
  171.84.2.77
-171.94.239.79
  171.96.138.44
-171.96.158.246
  171.96.159.150
-171.96.192.178
  171.96.220.134
  171.96.220.220
-171.96.220.95
  171.96.221.47
  171.96.247.18
+171.96.81.160
  171.97.107.132
  171.97.129.201
  171.97.141.125
-171.97.169.24
-171.97.216.155
-171.97.35.123
  171.97.40.211
-171.98.28.228
+171.97.85.31
  171.98.73.6
+171.99.153.72
  171.99.167.98
  171298-dot-n-e-w-me-ss-age-po-rt-al.wl.r.appspot.com
  1717jackwills.000webhostapp.com
@@ -32357,7 +32449,6 @@
  172.101.239.215
  172.103.171.91
  172.103.172.26
-172.103.190.165
  172.104.108.126
  172.104.108.227
  172.104.108.70
@@ -32366,8 +32457,6 @@
  172.104.111.181
  172.104.112.110
  172.104.112.161
-172.104.117.54
-172.104.120.222
  172.104.120.61
  172.104.125.36
  172.104.125.55
@@ -32406,6 +32495,7 @@
  172.104.180.44
  172.104.181.119
  172.104.182.103
+172.104.183.78
  172.104.186.166
  172.104.191.206
  172.104.208.218
@@ -32446,6 +32536,7 @@
  172.104.46.84
  172.104.5.26
  172.104.50.55
+172.104.51.37
  172.104.52.173
  172.104.52.85
  172.104.56.66
@@ -32460,6 +32551,7 @@
  172.104.8.24
  172.104.81.87
  172.104.9.251
+172.104.90.254
  172.104.90.95
  172.104.92.108
  172.104.96.149
@@ -32579,26 +32671,24 @@
  172.105.86.176
  172.105.87.200
  172.105.89.150
+172.105.89.161
  172.105.89.216
  172.105.9.197
  172.105.90.171
  172.105.91.109
  172.105.95.10
  172.105.96.80
-172.105.97.61
  172.105.98.119
  172.105.98.240
  172.106.0.67
  172.106.18.236
  172.106.88.4
  172.107.51.66
-172.110.30.81
-172.111.144.103
+172.111.144.81
  172.111.203.58
  172.114.161.190
  172.114.72.186
  172.114.84.139
-172.116.164.181
  172.117.105.95
  172.124.6.152
  172.125.174.154
@@ -32608,10 +32698,11 @@
  172.193.14.201
  172.2.202.190
  172.218.182.132
+172.241.112.18
  172.241.192.46
  172.241.242.197
+172.241.243.52
  172.241.37.123
-172.245.10.143
  172.245.10.85
  172.245.104.116
  172.245.104.118
@@ -32620,62 +32711,59 @@
  172.245.110.123
  172.245.110.143
  172.245.112.72
-172.245.113.113
  172.245.113.194
  172.245.113.238
  172.245.113.75
-172.245.129.120
  172.245.135.133
  172.245.14.217
  172.245.154.107
  172.245.158.131
-172.245.163.33
  172.245.163.40
-172.245.163.44
  172.245.179.148
  172.245.181.157
  172.245.181.222
-172.245.181.226
-172.245.181.246
  172.245.181.253
  172.245.184.199
  172.245.185.165
  172.245.194.241
-172.245.196.62
  172.245.205.137
  172.245.208.130
+172.245.208.159
  172.245.208.227
+172.245.211.71
+172.245.211.82
  172.245.211.91
  172.245.218.53
  172.245.220.82
-172.245.224.62
  172.245.228.19
  172.245.228.73
-172.245.228.74
+172.245.228.87
  172.245.229.106
+172.245.229.85
  172.245.230.184
  172.245.230.185
  172.245.230.186
-172.245.242.222
  172.245.244.25
  172.245.244.28
  172.245.248.239
  172.245.25.33
  172.245.250.173
-172.245.253.21
  172.245.253.57
+172.245.254.39
  172.245.254.7
  172.245.254.8
+172.245.26.136
  172.245.28.175
  172.245.30.178
  172.245.30.191
  172.245.4.26
  172.245.40.158
-172.245.40.217
+172.245.40.214
  172.245.40.222
  172.245.44.95
  172.245.5.11
  172.245.5.122
+172.245.52.102
  172.245.52.122
  172.245.52.225
  172.245.52.231
@@ -32696,6 +32784,7 @@
  172.245.91.200
  172.245.92.147
  172.245.97.184
+172.247.157.210
  172.249.152.66
  172.249.171.9
  172.250.250.224
@@ -32704,24 +32793,18 @@
  172.254.154.243
  172.255.125.138
  172.255.80.155
+172.255.80.17
  172.255.80.21
+172.255.80.210
  172.255.80.232
  172.255.80.42
  172.255.81.239
-172.255.81.37
  172.255.83.14
-172.255.83.38
  172.4.242.253
-172.58.159.11
-172.58.32.185
-172.68.10.110
-172.68.10.182
-172.68.10.204
-172.68.10.244
+172.68.10.232
  172.68.11.245
-172.68.11.51
-172.68.11.55
-172.68.129.138
+172.68.11.39
+172.68.143.51
  172.68.144.144
  172.68.146.121
  172.68.146.145
@@ -32730,62 +32813,55 @@
  172.68.146.193
  172.68.146.199
  172.68.146.229
+172.68.182.100
  172.68.211.5
-172.68.238.115
-172.68.238.118
-172.68.238.239
+172.68.239.101
  172.68.239.115
  172.68.239.127
-172.68.239.215
+172.68.239.197
  172.68.239.225
  172.68.239.229
  172.68.239.43
  172.68.239.49
-172.68.244.156
-172.68.244.54
-172.68.245.133
-172.68.246.116
-172.68.246.120
+172.68.239.61
+172.68.246.128
+172.68.246.174
  172.68.246.230
-172.68.29.144
+172.68.25.109
+172.68.25.157
  172.68.46.192
-172.68.50.24
-172.68.50.247
-172.68.50.76
+172.68.50.219
+172.68.50.54
  172.69.134.104
  172.69.134.116
  172.69.134.146
  172.69.134.170
  172.69.134.182
-172.69.135.113
  172.69.135.117
  172.69.135.135
  172.69.135.177
  172.69.135.209
-172.69.135.230
  172.69.135.235
  172.69.135.239
  172.69.135.241
  172.69.135.57
  172.69.135.87
-172.69.138.11
-172.69.138.14
-172.69.138.20
+172.69.138.22
  172.69.138.34
  172.69.138.46
  172.69.138.52
-172.69.138.60
-172.69.170.132
-172.69.190.11
-172.69.190.25
-172.69.190.68
-172.69.194.16
+172.69.190.12
+172.69.190.19
+172.69.190.76
  172.69.194.26
-172.69.194.34
-172.69.194.46
-172.69.194.58
+172.69.194.43
+172.69.194.50
  172.69.194.64
  172.69.22.231
+172.69.33.77
+172.69.34.188
+172.69.34.30
+172.69.55.137
  172.74.184.175
  172.81.131.110
  172.81.131.111
@@ -32812,8 +32888,8 @@
  172.82.128.202
  172.82.149.130
  172.82.149.234
-172.83.45.133
-172.83.45.192
+172.83.45.139
+172.83.45.235
  172.84.112.179
  172.84.114.20
  172.86.114.2
@@ -32828,6 +32904,7 @@
  172.86.64.15
  172.86.64.17
  172.86.64.18
+172.86.75.206
  172.86.84.57
  172.87.193.178
  172.89.32.216
@@ -32848,6 +32925,7 @@
  172.93.49.142
  172.94.109.38
  172.94.125.45
+172.94.34.66
  172.94.34.67
  172.94.34.83
  172.94.34.84
@@ -32875,11 +32953,11 @@
  172.96.242.6
  172.96.251.203
  172.96.95.213
-172.97.13.229
  172.97.231.162
  172.98.193.43
  172.98.193.62
  172.98.64.135
+172.98.66.22
  172.98.67.34
  172.98.67.59
  172.98.67.74
@@ -32903,25 +32981,24 @@
  173.12.181.181
  173.13.139.133
  173.13.234.122
-173.14.66.203
  173.15.162.151
  173.15.162.156
  173.15.162.157
  173.15.28.165
  173.15.85.9
+173.16.254.243
  173.161.208.193
  173.161.87.170
  173.163.39.49
  173.164.210.49
-173.165.121.157
  173.167.85.89
  173.173.254.105
  173.173.77.90
  173.174.105.66
  173.174.181.12
+173.175.91.75
  173.176.184.54
  173.177.237.29
-173.18.210.199
  173.184.29.223
  173.192.125.10
  173.192.34.95
@@ -32929,6 +33006,7 @@
  173.193.136.52
  173.193.219.168
  173.193.22.6
+173.195.15.73
  173.199.114.115
  173.199.114.171
  173.199.114.99
@@ -32948,8 +33026,7 @@
  173.199.186.15
  173.199.71.150
  173.2.187.186
-173.20.18.189
-173.20.26.142
+173.20.88.20
  173.201.196.116
  173.201.196.67
  173.201.196.7
@@ -32958,24 +33035,13 @@
  173.201.39.206
  173.201.45.104
  173.202.115.94
-173.202.155.247
  173.202.17.144
-173.202.176.163
-173.202.178.166
-173.202.19.15
-173.202.19.215
-173.202.200.202
  173.202.200.250
-173.202.202.230
-173.202.202.246
  173.202.204.19
-173.202.226.41
  173.202.23.228
  173.202.26.138
  173.202.26.159
-173.202.26.91
  173.202.26.94
-173.202.29.183
  173.202.80.16
  173.203.126.125
  173.203.215.83
@@ -33031,6 +33097,7 @@
  173.212.197.237
  173.212.197.63
  173.212.199.6
+173.212.202.20
  173.212.202.220
  173.212.202.65
  173.212.203.104
@@ -33062,15 +33129,15 @@
  173.212.241.77
  173.212.243.27
  173.212.245.133
+173.212.245.245
  173.212.249.235
  173.212.252.65
  173.212.253.137
  173.212.253.26
  173.212.254.171
  173.212.254.30
-173.213.85.43
-173.213.87.156
-173.213.87.82
+173.213.87.209
+173.213.87.30
  173.213.96.68
  173.214.174.108
  173.214.181.39
@@ -33088,13 +33155,13 @@
  173.227.0.76
  173.228.213.12
  173.228.213.97
-173.23.26.135
  173.230.129.187
  173.230.131.20
  173.230.132.71
  173.230.134.216
  173.230.141.168
  173.230.142.20
+173.230.153.184
  173.230.157.253
  173.230.158.189
  173.230.189.238
@@ -33103,6 +33170,7 @@
  173.231.200.117
  173.231.200.98
  173.231.59.195
+173.231.59.216
  173.231.63.88
  173.232.146.105
  173.232.146.141
@@ -33124,6 +33192,7 @@
  173.234.154.116
  173.234.154.146
  173.234.154.183
+173.234.154.2
  173.234.159.250
  173.234.194.23
  173.234.194.237
@@ -33901,6 +33970,7 @@
  173.234.48.138
  173.234.48.69
  173.235.155.45
+173.236.144.241
  173.236.144.82
  173.236.152.135
  173.236.176.109
@@ -33968,20 +34038,22 @@
  173.236.183.115
  173.236.183.133
  173.236.183.180
-173.236.183.212
  173.236.183.244
  173.236.183.55
  173.236.183.98
+173.236.193.48
  173.236.194.65
  173.236.224.16
+173.236.241.162
+173.236.255.123
  173.236.61.20
+173.237.133.213
  173.237.189.15
  173.239.16.148
  173.239.199.97
  173.239.3.93
  173.239.33.85
  173.239.33.90
-173.239.71.130
  173.24.113.136
  173.242.112.93
  173.242.116.219
@@ -33996,9 +34068,8 @@
  173.244.36.48
  173.244.48.66
  173.245.202.131
-173.245.202.137
-173.245.202.184
-173.245.203.99
+173.245.203.194
+173.245.203.249
  173.245.89.199
  173.246.13.149
  173.246.159.134
@@ -34008,10 +34079,8 @@
  173.247.228.10
  173.247.239.186
  173.248.108.194
-173.248.110.156
  173.248.112.45
  173.248.113.65
-173.248.115.170
  173.248.241.176
  173.248.241.78
  173.248.242.102
@@ -34027,7 +34096,6 @@
  173.249.16.132
  173.249.2.204
  173.249.2.209
-173.249.20.32
  173.249.22.26
  173.249.24.64
  173.249.25.141
@@ -34068,7 +34136,6 @@
  173.254.204.69
  173.254.204.89
  173.254.216.66
-173.254.222.162
  173.254.222.170
  173.254.242.215
  173.254.250.14
@@ -34076,6 +34143,7 @@
  173.255.115.135
  173.255.193.118
  173.255.193.235
+173.255.193.24
  173.255.194.65
  173.255.197.68
  173.255.199.69
@@ -34096,34 +34164,30 @@
  173.255.246.77
  173.255.248.135
  173.255.250.144
-173.255.252.222
  173.28.145.40
  173.28.153.247
-173.28.59.108
-173.3.182.113
+173.3.31.132
  173.30.96.81
  173.31.161.228
  173.31.177.245
+173.31.179.82
+173.31.204.211
  173.33.40.166
-173.33.80.245
  173.35.147.204
  173.44.123.163
  173.44.152.112
  173.44.152.127
  173.44.152.128
-173.44.152.152
  173.44.152.155
  173.44.152.168
-173.44.152.21
  173.44.152.247
  173.44.152.36
  173.44.152.5
  173.44.155.132
  173.44.155.213
-173.44.155.226
+173.44.164.49
  173.44.165.48
  173.44.165.65
-173.44.167.128
  173.44.167.139
  173.44.167.157
  173.44.167.164
@@ -34152,11 +34216,13 @@
  173.47.158.170
  173.49.115.68
  173.51.177.2
+173.51.217.44
  173.56.235.225
  173.56.92.166
  173.59.224.21
  173.59.247.22
  173.62.236.28
+173.62.237.150
  173.62.253.103
  173.63.146.243
  173.63.203.104
@@ -34173,8 +34239,8 @@
  173.69.200.104
  173.69.212.33
  173.70.61.180
+173.72.155.114
  173.73.115.178
-173.73.180.41
  173.73.201.171
  173.74.84.197
  173.74.84.198
@@ -34191,7 +34257,6 @@
  173.81.34.73
  173.82.105.129
  173.82.119.161
-173.82.12.77
  173.82.123.229
  173.82.123.232
  173.82.123.243
@@ -34243,6 +34308,7 @@
  173nvrenw.com
  174-365.net
  174.0.252.47
+174.0.79.91
  174.100.209.2
  174.100.27.229
  174.101.1.178
@@ -34252,12 +34318,12 @@
  174.109.212.183
  174.110.88.87
  174.111.19.140
+174.112.106.248
  174.112.205.57
  174.112.209.252
  174.113.105.65
  174.113.69.136
  174.114.102.41
-174.115.197.190
  174.115.4.130
  174.115.44.214
  174.116.40.112
@@ -34270,66 +34336,39 @@
  174.122.153.66
  174.123.174.34
  174.123.86.2
-174.124.121.196
-174.124.121.252
  174.124.123.109
  174.124.136.149
-174.124.136.97
  174.124.137.166
-174.124.139.207
  174.124.140.71
-174.124.141.98
  174.124.142.13
-174.124.143.109
  174.124.143.90
  174.124.212.178
  174.124.212.229
  174.124.214.159
-174.124.215.161
  174.124.215.195
  174.124.215.34
  174.124.220.245
-174.124.221.174
-174.124.221.248
-174.124.223.234
  174.124.223.35
  174.124.226.172
-174.124.227.11
  174.124.228.83
-174.124.229.176
  174.124.229.188
  174.124.229.254
  174.124.230.201
  174.124.232.202
-174.124.232.217
-174.124.41.59
-174.124.42.54
-174.124.45.19
  174.124.45.202
  174.124.45.248
  174.124.47.228
  174.124.53.250
  174.124.54.108
  174.124.54.114
-174.124.55.64
  174.125.126.141
  174.125.13.169
  174.125.130.42
  174.125.131.252
  174.125.148.57
  174.125.149.103
-174.125.149.231
-174.125.150.202
-174.125.19.48
-174.125.20.199
  174.125.21.131
-174.125.22.244
-174.125.23.17
-174.125.23.248
-174.125.25.14
-174.125.25.80
  174.125.3.152
-174.125.31.37
  174.125.33.241
  174.125.4.14
  174.125.48.39
@@ -34338,16 +34377,14 @@
  174.125.51.215
  174.125.52.115
  174.125.60.87
-174.125.61.231
  174.125.62.253
-174.125.63.41
  174.127.155.118
  174.127.68.49
  174.128.226.101
+174.128.227.22
  174.128.235.243
  174.128.244.218
  174.128.245.209
-174.128.251.150
  174.129.10.127
  174.129.107.95
  174.129.116.139
@@ -34386,11 +34423,9 @@
  174.138.116.11
  174.138.12.229
  174.138.14.107
-174.138.14.112
  174.138.14.60
  174.138.15.47
  174.138.18.194
-174.138.182.118
  174.138.2.114
  174.138.20.105
  174.138.20.237
@@ -34436,6 +34471,7 @@
  174.138.6.113
  174.138.6.46
  174.138.61.227
+174.138.61.254
  174.138.61.46
  174.138.64.163
  174.138.67.137
@@ -34444,7 +34480,7 @@
  174.138.70.49
  174.138.8.138
  174.138.8.152
-174.138.8.171
+174.138.8.169
  174.138.80.118
  174.138.92.116
  174.138.96.132
@@ -34465,7 +34501,6 @@
  174.139.126.93
  174.139.126.99
  174.139.21.70
-174.139.22.51
  174.139.241.42
  174.139.46.122
  174.139.46.123
@@ -34492,67 +34527,35 @@
  174.143.150.20
  174.143.173.119
  174.153.42.217
+174.16.111.167
  174.16.123.150
  174.16.126.1
-174.16.158.140
-174.16.207.206
-174.16.212.208
-174.16.33.220
-174.17.16.204
-174.17.16.94
-174.17.26.69
-174.17.28.134
-174.17.48.8
  174.17.55.207
-174.18.116.77
  174.18.138.99
-174.18.154.132
-174.18.21.75
-174.18.63.191
-174.18.75.205
  174.18.78.48
  174.18.88.224
-174.19.10.113
  174.19.102.73
-174.19.107.182
-174.19.109.231
-174.19.11.129
-174.19.11.176
  174.19.111.174
  174.19.117.15
-174.19.119.113
  174.19.12.7
  174.19.12.71
  174.19.120.200
-174.19.122.155
  174.19.124.214
-174.19.125.227
  174.19.125.251
-174.19.126.111
  174.19.126.16
  174.19.14.174
  174.19.15.129
  174.19.15.208
-174.19.15.61
-174.19.16.208
  174.19.18.71
  174.19.20.218
  174.19.26.127
  174.19.26.229
  174.19.26.46
-174.19.29.153
-174.19.29.27
-174.19.30.91
-174.19.32.65
-174.19.33.184
  174.19.33.98
-174.19.4.210
  174.19.6.139
  174.19.65.151
-174.19.8.195
-174.20.114.208
-174.20.124.145
  174.20.132.121
+174.20.154.155
  174.20.164.103
  174.20.177.60
  174.20.191.230
@@ -34563,51 +34566,31 @@
  174.22.195.68
  174.22.196.183
  174.22.217.82
-174.23.129.199
-174.24.130.248
-174.24.135.253
+174.227.143.18
  174.24.137.236
-174.24.140.177
  174.24.161.119
-174.24.162.199
  174.24.165.226
  174.24.167.181
-174.24.168.159
-174.24.168.184
-174.24.170.182
-174.24.176.45
-174.24.188.60
-174.24.190.238
  174.24.190.62
  174.24.191.223
  174.24.72.140
  174.24.74.115
  174.24.81.49
-174.25.100.44
  174.25.132.190
-174.25.133.83
-174.25.145.223
  174.25.154.127
-174.25.160.14
-174.25.167.155
  174.25.172.21
  174.25.174.98
-174.25.177.24
  174.25.190.169
  174.25.97.213
-174.25.98.43
  174.25.99.168
  174.26.113.49
  174.26.145.37
  174.26.147.183
-174.26.157.156
-174.26.212.47
  174.26.221.242
  174.26.222.235
  174.26.227.194
  174.26.251.52
  174.26.74.254
-174.27.155.234
  174.27.178.37
  174.27.179.174
  174.27.22.203
@@ -34618,111 +34601,56 @@
  174.27.94.99
  174.28.140.239
  174.28.153.97
-174.28.17.85
-174.28.186.208
-174.28.226.120
  174.28.34.87
-174.28.53.120
-174.29.199.168
-174.29.218.102
-174.29.242.32
-174.29.244.27
  174.3.197.218
  174.3.214.194
  174.3.4.232
-174.30.100.82
-174.30.101.26
-174.30.103.134
  174.30.104.190
-174.30.106.40
  174.30.109.183
  174.30.109.44
  174.30.109.64
-174.30.11.244
  174.30.11.98
  174.30.110.129
-174.30.110.47
-174.30.111.103
  174.30.115.201
  174.30.116.88
-174.30.117.13
  174.30.117.230
  174.30.119.79
  174.30.12.9
  174.30.121.37
  174.30.123.144
  174.30.123.48
-174.30.124.57
-174.30.125.100
-174.30.125.233
  174.30.161.148
-174.30.163.24
  174.30.165.156
  174.30.167.135
-174.30.167.136
  174.30.167.148
  174.30.167.84
  174.30.17.161
  174.30.170.1
  174.30.173.105
-174.30.192.115
-174.30.192.147
-174.30.193.134
-174.30.195.152
-174.30.195.47
  174.30.195.56
-174.30.197.145
-174.30.197.191
  174.30.197.66
  174.30.20.155
  174.30.20.193
  174.30.20.231
-174.30.22.218
  174.30.225.24
-174.30.225.241
  174.30.226.165
-174.30.228.81
-174.30.230.143
-174.30.231.166
  174.30.231.181
-174.30.231.20
-174.30.231.214
  174.30.234.218
-174.30.235.178
  174.30.238.23
-174.30.36.57
-174.30.37.156
-174.30.37.198
  174.30.37.213
  174.30.40.182
-174.30.42.134
-174.30.43.113
-174.30.46.37
-174.30.46.67
  174.30.48.59
  174.30.51.142
  174.30.51.169
-174.30.52.20
-174.30.53.220
-174.30.53.41
  174.30.61.157
  174.30.61.203
  174.30.69.39
  174.30.70.153
-174.30.71.81
  174.30.72.96
-174.30.73.114
-174.30.74.13
-174.30.75.111
  174.30.76.136
-174.30.76.138
  174.30.77.192
  174.30.78.230
-174.30.80.121
  174.30.81.90
-174.30.84.128
-174.30.84.222
-174.30.86.130
  174.30.88.188
  174.30.89.116
  174.30.91.37
@@ -34730,19 +34658,14 @@
  174.30.92.87
  174.30.93.3
  174.30.94.153
-174.30.96.246
-174.30.99.126
  174.31.181.115
  174.31.187.221
  174.31.80.228
-174.31.84.152
  174.34.135.242
+174.34.84.59
  174.36.149.83
  174.37.231.112
  174.37.60.226
-174.4.52.195
-174.4.9.52
-174.44.57.198
  174.45.13.118
  174.50.185.41
  174.50.230.87
@@ -34762,7 +34685,6 @@
  174.62.110.179
  174.64.199.79
  174.64.199.82
-174.65.18.185
  174.7.29.42
  174.70.100.90
  174.70.241.10
@@ -34772,13 +34694,11 @@
  174.70.241.27
  174.70.241.7
  174.70.241.8
+174.71.229.215
  174.71.36.195
  174.72.49.29
  174.72.93.110
  174.74.15.121
-174.74.42.158
-174.75.211.204
-174.75.211.211
  174.75.211.222
  174.76.35.7
  174.76.48.228
@@ -34788,12 +34708,13 @@
  174.76.48.252
  174.77.111.196
  174.77.111.197
+174.80.109.64
  174.80.197.141
  174.81.128.121
+174.81.129.118
  174.81.221.75
  174.81.229.190
  174.85.97.210
-174.86.203.236
  174.87.100.122
  174.87.80.166
  174.88.159.10
@@ -34803,6 +34724,8 @@
  174.89.83.6
  174.91.5.72
  174.92.219.108
+174.92.3.102
+174.93.149.68
  174.93.15.90
  174.93.238.73
  174.94.121.24
@@ -34814,21 +34737,18 @@
  174.96.232.25
  174.96.30.156
  175-365.net
-175.0.80.103
-175.0.9.153
  175.10.144.100
  175.10.144.174
  175.10.145.138
-175.10.50.3
  175.100.103.132
  175.100.103.170
+175.100.138.49
  175.100.151.50
  175.100.16.20
  175.100.18.45
  175.100.181.190
  175.100.30.156
  175.100.47.144
-175.100.5.52
  175.100.72.95
  175.100.73.206
  175.100.86.17
@@ -34841,6 +34761,7 @@
  175.106.10.226
  175.106.12.182
  175.106.12.6
+175.106.14.18
  175.106.17.222
  175.106.17.62
  175.106.17.93
@@ -34873,6 +34794,7 @@
  175.111.91.143
  175.113.50.47
  175.114.101.5
+175.116.147.39
  175.116.222.106
  175.116.222.47
  175.117.144.37
@@ -34880,8 +34802,6 @@
  175.118.126.20
  175.118.126.99
  175.118.152.100
-175.119.22.245
-175.119.224.20
  175.123.253.188
  175.123.253.220
  175.123.253.79
@@ -34903,19 +34823,18 @@
  175.137.121.75
  175.137.174.65
  175.138.108.78
-175.138.117.151
  175.138.188.97
  175.138.233.116
  175.138.48.167
  175.138.49.82
+175.138.61.147
  175.139.166.1
  175.139.166.152
-175.139.167.194
  175.139.179.65
-175.139.201.45
  175.139.242.49
  175.139.250.200
  175.139.252.193
+175.140.137.249
  175.140.138.193
  175.140.139.150
  175.140.184.75
@@ -34927,18 +34846,20 @@
  175.141.225.61
  175.141.33.164
  175.141.69.201
+175.141.98.109
  175.142.214.115
-175.143.5.17
  175.143.51.221
  175.143.79.81
  175.144.198.13
  175.144.198.225
  175.144.198.226
  175.144.244.240
+175.144.45.138
  175.144.45.221
  175.144.57.167
  175.144.82.119
  175.145.109.202
+175.145.111.135
  175.145.178.96
  175.145.200.216
  175.145.228.23
@@ -34947,23 +34868,31 @@
  175.146.209.249
  175.146.95.224
  175.147.21.193
+175.148.76.202
  175.157.41.60
-175.157.98.18
+175.158.38.105
+175.158.38.118
  175.158.38.124
  175.158.53.131
-175.158.53.169
  175.160.97.107
+175.161.163.63
  175.162.1.96
  175.162.126.61
-175.168.94.76
+175.165.229.206
+175.168.147.61
  175.170.149.29
+175.171.4.60
  175.172.37.148
  175.172.59.4
+175.174.151.24
  175.176.184.5
  175.176.185.106
  175.176.187.110
  175.176.223.133
-175.176.70.28
+175.176.37.133
+175.176.37.136
+175.176.37.141
+175.176.37.145
  175.182.109.41
  175.182.225.244
  175.182.7.73
@@ -34975,35 +34904,42 @@
  175.19.143.209
  175.19.30.46
  175.193.13.3
+175.193.198.238
  175.193.2.152
  175.193.2.152bin.sh
  175.193.97.249
  175.194.54.93
  175.195.33.102
+175.196.10.125
  175.197.233.197
+175.198.238.224
  175.198.80.24
  175.199.229.203
  175.199.229.203bin.sh
-175.20.241.2
  175.201.64.37
  175.202.121.127
  175.203.205.164
  175.206.182.103
  175.207.12.134
-175.207.12.252
  175.207.13.22
  175.207.13.56
  175.207.55.232
+175.208.191.37
+175.208.194.101
  175.208.251.15
  175.209.141.227
+175.210.103.203
+175.211.193.228
+175.211.52.30
  175.211.69.151
  175.212.180.131
-175.213.81.19
+175.212.6.169
+175.213.81.169
  175.213.81.4
  175.213.82.161
-175.213.82.172
  175.213.82.174
  175.213.82.57
+175.214.73.251
  175.215.202.131
  175.24.1.203
  175.24.100.238
@@ -35015,6 +34951,7 @@
  175.24.107.175
  175.24.111.172
  175.24.113.82
+175.24.114.208
  175.24.116.15
  175.24.117.78
  175.24.119.184
@@ -35027,7 +34964,6 @@
  175.24.126.194
  175.24.127.209
  175.24.131.120
-175.24.147.126
  175.24.152.35
  175.24.17.159
  175.24.17.53
@@ -35042,7 +34978,6 @@
  175.24.191.251
  175.24.2.195
  175.24.21.18
-175.24.232.72
  175.24.233.220
  175.24.235.245
  175.24.24.104
@@ -35051,7 +34986,6 @@
  175.24.35.40
  175.24.42.244
  175.24.44.217
-175.24.45.144
  175.24.46.21
  175.24.49.210
  175.24.50.107
@@ -35080,6 +35014,7 @@
  175.29.188.27
  175.29.188.9
  175.30.204.139
+175.38.180.178
  175.4.210.99
  175.41.191.216
  175.41.218.218
@@ -35088,8 +35023,6 @@
  175.41.44.51
  175.41.45.129
  175.42.100.24
-175.42.114.235
-175.42.64.121
  175.42.75.3
  175.43.176.182
  175.43.240.243
@@ -35104,9 +35037,10 @@
  175.5.35.230
  175.6.102.248
  175.6.108.125
-175.6.130.39
+175.6.115.99
  175.6.146.207
  175.6.254.57
+175.6.32.134
  175.6.35.140
  175.6.35.166
  175.6.35.197
@@ -35114,20 +35048,17 @@
  175.6.35.207
  175.6.35.228
  175.6.35.46
-175.6.35.82
  175.6.35.93
  175.6.40.14
  175.6.70.180
  175.6.73.4
  175.6.76.71
  175.6.99.102
-175.8.115.39
  175.8.142.21
+175.8.211.47
  175.8.41.237
  175.8.61.45
-175.9.120.138
  175.97.132.101
-175.97.135.16
  175.97.136.186
  175.97.161.8
  1758681625.rsc.cdn77.org
@@ -35136,22 +35067,26 @@
  176.10.125.5
  176.10.208.98
  176.10.44.190
+176.10.45.206
  176.10.99.196
  176.10.99.200
+176.100.4.31
  176.100.75.27
+176.101.107.173
  176.101.119.72
  176.101.221.119
  176.101.237.106
-176.102.176.181
  176.102.224.53
  176.103.174.123
  176.103.174.198
  176.103.174.82
+176.103.25.138
  176.103.45.24
  176.103.74.89
  176.103.91.193
  176.104.176.188
  176.104.180.238
+176.104.243.57
  176.104.25.140
  176.104.52.46
  176.104.54.43
@@ -35163,6 +35098,7 @@
  176.106.36.183
  176.106.39.147
  176.106.41.214
+176.106.41.63
  176.107.176.111
  176.107.176.164
  176.107.176.178
@@ -35172,6 +35108,7 @@
  176.107.177.205
  176.107.177.209
  176.107.177.60
+176.107.178.164
  176.107.179.133
  176.107.179.134
  176.107.179.135
@@ -35182,16 +35119,20 @@
  176.107.185.4
  176.107.187.118
  176.107.188.5
+176.107.199.152
  176.108.104.84
  176.108.148.224
  176.108.176.181
  176.109.0.30
-176.109.14.34
  176.110.121.90
  176.110.125.233
  176.110.130.150
-176.110.166.82
+176.110.134.2
+176.110.43.105
+176.110.47.125
+176.110.49.82
  176.111.173.0
+176.111.173.10
  176.111.173.11
  176.111.173.12
  176.111.173.13
@@ -35209,7 +35150,10 @@
  176.111.173.50
  176.111.173.7
  176.111.173.97
+176.111.174.14
  176.111.174.35
+176.111.174.67
+176.111.178.183
  176.111.180.209
  176.111.60.55
  176.111.73.57
@@ -35268,20 +35212,20 @@
  176.113.161.94
  176.113.161.95
  176.113.209.13
-176.113.226.68
-176.113.227.152
  176.113.72.133
  176.113.80.252
  176.114.0.74
  176.114.131.205
  176.114.153.10
  176.114.153.113
-176.114.153.23
  176.114.153.24
  176.114.153.4
+176.114.153.76
  176.114.153.85
  176.114.153.91
+176.114.199.56
  176.114.228.40
+176.114.36.185
  176.115.197.118
  176.116.57.51
  176.117.126.22
@@ -35295,19 +35239,17 @@
  176.118.51.176
  176.118.54.104
  176.118.54.134
-176.118.54.99
  176.118.55.158
  176.118.55.25
  176.119.1.103
  176.119.1.180
  176.119.1.75
  176.119.109.177
-176.119.134.117
+176.119.134.111
  176.119.156.8
  176.119.26.12
  176.119.29.70
  176.119.29.8
-176.120.110.18
  176.120.216.143
  176.120.220.199
  176.120.37.114
@@ -35315,11 +35257,10 @@
  176.120.48.91
  176.120.59.85
  176.121.14.109
-176.121.209.157
-176.121.243.10
+176.121.212.214
  176.122.129.114
-176.122.141.223
  176.122.149.209
+176.122.156.32
  176.122.158.234
  176.122.160.85
  176.122.161.175
@@ -35339,8 +35280,11 @@
  176.123.3.98
  176.123.5.150
  176.123.5.193
+176.123.5.219
+176.123.5.222
  176.123.5.227
  176.123.5.250
+176.123.5.95
  176.123.6.10
  176.123.6.138
  176.123.6.155
@@ -35354,6 +35298,7 @@
  176.123.7.102
  176.123.7.115
  176.123.7.119
+176.123.7.186
  176.123.7.23
  176.123.7.234
  176.123.7.238
@@ -35364,46 +35309,50 @@
  176.123.9.100
  176.123.9.13
  176.123.9.171
+176.123.9.211
  176.123.9.32
  176.124.146.59
  176.124.188.3
  176.124.231.76
  176.125.230.135
+176.125.230.139
+176.125.230.140
  176.125.230.143
+176.125.230.144
  176.126.167.10
  176.126.167.107
  176.126.84.210
  176.126.85.207
  176.133.21.38
+176.134.163.155
+176.136.239.254
  176.14.135.119
  176.14.137.126
  176.14.139.153
  176.14.153.168
  176.14.153.182
  176.14.156.48
-176.14.212.13
  176.141.56.25
  176.143.111.17
  176.15.184.61
  176.151.196.117
  176.152.45.213
  176.158.56.29
+176.163.6.57
  176.165.48.246
-176.165.60.67
-176.169.154.165
+176.168.131.91
  176.172.126.216
  176.174.199.40
  176.181.56.34
  176.184.131.5
  176.186.127.43
  176.187.156.226
-176.19.177.59
-176.190.52.191
  176.191.116.53
  176.191.182.3
  176.192.8.206
  176.193.18.170
  176.194.178.241
+176.194.189.39
  176.196.240.34
  176.196.84.138
  176.197.100.134
@@ -35414,7 +35363,6 @@
  176.197.5.218
  176.197.95.2
  176.198.40.56
-176.198.73.77
  176.198.94.109
  176.20.60.141
  176.202.169.139
@@ -35457,14 +35405,11 @@
  176.223.139.243
  176.223.143.145
  176.223.60.10
-176.225.69.196
  176.226.129.196
  176.226.224.47
-176.226.235.49
  176.227.188.16
  176.227.188.66
  176.227.246.168
-176.232.56.15
  176.235.137.2
  176.235.139.114
  176.235.164.177
@@ -35473,9 +35418,9 @@
  176.235.178.181
  176.235.178.184
  176.235.178.187
-176.235.182.79
  176.235.191.132
  176.235.192.133
+176.235.216.155
  176.235.221.83
  176.235.90.242
  176.235.93.0
@@ -35490,8 +35435,6 @@
  176.236.163.34
  176.236.163.36
  176.236.163.38
-176.236.198.140
-176.236.3.92
  176.236.37.119
  176.236.37.132
  176.236.37.135
@@ -35502,18 +35445,18 @@
  176.237.4.193
  176.239.0.210
  176.240.40.142
+176.240.84.106
  176.241.188.218
+176.241.85.86
  176.241.89.170
  176.241.92.38
  176.241.94.146
  176.241.94.228
-176.25.250.86
-176.253.125.156
+176.243.219.7
  176.28.116.58
  176.30.212.184
  176.30.212.190
  176.30.212.193
-176.30.215.40
  176.31.105.112
  176.31.107.25
  176.31.110.229
@@ -35560,6 +35503,7 @@
  176.31.255.63
  176.31.31.172
  176.31.34.12
+176.31.38.227
  176.31.46.178
  176.31.46.240
  176.31.47.100
@@ -35576,19 +35520,17 @@
  176.34.254.113
  176.34.89.217
  176.36.20.67
-176.36.218.209
  176.36.37.21
-176.36.42.186
  176.36.81.57
-176.37.248.76
  176.37.44.170
  176.37.99.111
+176.38.200.18
  176.38.7.43
+176.41.28.105
  176.42.114.128
-176.44.28.186
+176.44.114.192
  176.48.22.63
-176.50.86.64
-176.51.101.249
+176.48.51.157
  176.52.200.130
  176.52.219.6
  176.52.253.14
@@ -35605,15 +35547,13 @@
  176.56.107.182
  176.56.107.197
  176.56.107.199
-176.56.107.202
  176.56.107.204
-176.56.107.211
  176.56.107.213
  176.56.107.222
+176.56.107.225
  176.56.107.230
  176.56.107.234
  176.56.107.237
-176.56.107.240
  176.56.107.243
  176.56.107.244
  176.56.107.248
@@ -35637,12 +35577,13 @@
  176.58.107.100
  176.58.110.181
  176.58.121.177
+176.58.125.93
  176.58.65.52
  176.58.89.182
  176.58.93.123
-176.59.115.149
-176.59.115.166
+176.59.146.123
  176.59.3.30
+176.59.54.163
  176.59.56.3
  176.59.8.161
  176.61.137.230
@@ -35654,16 +35595,13 @@
  176.61.143.38
  176.61.233.67
  176.61.60.76
-176.62.178.247
  176.62.180.164
  176.62.185.72
-176.62.188.65
-176.63.18.35
  176.63.18.51
  176.63.203.149
  176.63.205.248
  176.65.242.30
-176.67.85.215
+176.67.1.67
  176.67.86.125
  176.67.86.128
  176.67.86.129
@@ -35693,10 +35631,11 @@
  176.77.133.147
  176.78.83.96
  176.79.86.83
+176.8.199.97
  176.86.165.85
-176.88.124.227
-176.88.125.157
  176.88.209.174
+176.88.75.178
+176.9.1.42
  176.9.10.227
  176.9.101.122
  176.9.101.91
@@ -35714,6 +35653,7 @@
  176.9.125.173
  176.9.125.79
  176.9.131.69
+176.9.136.67
  176.9.140.115
  176.9.140.241
  176.9.143.74
@@ -35722,7 +35662,7 @@
  176.9.156.228
  176.9.156.51
  176.9.165.169
-176.9.174.136
+176.9.17.6
  176.9.188.7
  176.9.198.28
  176.9.219.38
@@ -35745,7 +35685,6 @@
  176.9.57.185
  176.9.60.201
  176.9.61.104
-176.9.62.16
  176.9.63.112
  176.9.63.240
  176.9.65.102
@@ -35762,14 +35701,12 @@
  176.9.91.5
  176.9.99.134
  176.90.137.156
-176.90.73.250
-176.92.182.79
-176.92.189.235
  176.95.184.111
  176.95.67.190
-176.96.238.86
+176.96.163.134
  176.97.247.9
  176.98.156.64
+176.98.20.71
  176.98.23.213
  176.98.43.69
  176.98.48.66
@@ -35809,7 +35746,6 @@
  177.10.84.121
  177.10.84.192
  177.100.56.96
-177.101.124.34
  177.101.125.251
  177.101.172.14
  177.101.190.171
@@ -35818,6 +35754,7 @@
  177.103.159.44
  177.103.182.12
  177.103.223.147
+177.103.229.230
  177.103.229.58
  177.103.240.93
  177.104.124.235
@@ -35826,27 +35763,22 @@
  177.104.82.100
  177.105.135.54
  177.105.135.57
-177.105.157.86
-177.105.239.14
  177.105.35.54
  177.105.65.45
  177.105.67.205
  177.105.68.100
  177.105.68.105
  177.105.68.118
-177.105.68.12
  177.105.68.120
  177.105.68.127
-177.105.68.128
-177.105.68.131
+177.105.68.13
  177.105.68.132
  177.105.68.135
  177.105.68.136
  177.105.68.139
  177.105.68.14
-177.105.68.140
-177.105.68.163
-177.105.68.168
+177.105.68.16
+177.105.68.162
  177.105.68.172
  177.105.68.174
  177.105.68.179
@@ -35865,24 +35797,25 @@
  177.105.68.249
  177.105.68.252
  177.105.68.26
+177.105.68.28
  177.105.68.35
  177.105.68.37
  177.105.68.41
  177.105.68.5
-177.105.68.53
  177.105.68.60
  177.105.68.68
-177.105.68.80
+177.105.68.70
+177.105.68.81
  177.105.68.82
  177.105.68.86
  177.105.68.92
-177.105.68.95
  177.105.68.97
+177.106.14.124
  177.106.250.152
  177.106.254.48
  177.107.134.94
  177.107.50.18
-177.107.68.19
+177.11.118.237
  177.11.150.237
  177.11.156.246
  177.11.65.126
@@ -35890,7 +35823,6 @@
  177.11.75.18
  177.11.85.77
  177.11.85.9
-177.118.129.140
  177.12.177.242
  177.12.2.53
  177.12.227.131
@@ -35900,22 +35832,19 @@
  177.124.10.53
  177.124.101.103
  177.124.102.135
-177.124.184.52
  177.124.184.72
  177.124.201.61
  177.124.217.185
  177.124.225.106
  177.124.98.210
+177.125.160.16
  177.125.160.203
  177.125.163.14
-177.125.163.230
  177.125.165.216
  177.125.165.232
-177.125.20.67
+177.125.204.122
  177.125.204.238
-177.125.204.250
  177.125.205.21
-177.125.206.144
  177.125.206.233
  177.125.22.36
  177.126.0.115
@@ -35934,9 +35863,9 @@
  177.129.17.52
  177.129.202.92
  177.129.202.97
-177.129.206.150
  177.129.207.23
  177.129.207.36
+177.129.30.163
  177.129.48.34
  177.129.8.18
  177.129.90.94
@@ -35946,7 +35875,6 @@
  177.130.95.172
  177.131.13.9
  177.131.22.186
-177.133.92.135
  177.134.167.230
  177.134.233.245
  177.135.250.32
@@ -35955,7 +35883,7 @@
  177.136.14.178
  177.136.185.200
  177.136.210.144
-177.136.210.90
+177.136.210.51
  177.136.212.139
  177.136.212.167
  177.136.227.157
@@ -35975,9 +35903,8 @@
  177.137.163.63
  177.137.168.129
  177.137.168.130
-177.137.168.132
  177.137.168.135
-177.137.168.136
+177.137.168.137
  177.137.168.139
  177.137.168.143
  177.137.168.147
@@ -35986,8 +35913,9 @@
  177.137.168.157
  177.137.170.163
  177.137.170.165
+177.137.170.168
+177.137.170.170
  177.137.170.183
-177.137.170.196
  177.137.170.204
  177.137.170.207
  177.137.227.14
@@ -35996,6 +35924,7 @@
  177.139.169.206
  177.139.176.122
  177.139.176.242
+177.140.102.140
  177.140.140.36
  177.140.196.172
  177.140.40.11
@@ -36006,18 +35935,19 @@
  177.144.130.105
  177.144.135.2
  177.144.183.174
-177.148.103.141
  177.152.124.19
  177.152.124.20
  177.152.124.21
  177.152.124.24
+177.152.144.58
+177.152.238.100
  177.152.64.35
  177.152.84.140
  177.152.89.100
-177.152.96.38
  177.153.33.35
  177.154.16.102
  177.154.224.206
+177.154.236.189
  177.154.52.34
  177.154.55.114
  177.155.151.95
@@ -36039,6 +35969,7 @@
  177.184.140.222
  177.184.192.50
  177.184.207.125
+177.184.218.252
  177.184.64.2
  177.184.67.1
  177.184.67.13
@@ -36068,7 +35999,6 @@
  177.19.164.149
  177.19.165.26
  177.19.171.23
-177.19.187.79
  177.19.226.178
  177.19.238.230
  177.190.145.196
@@ -36078,8 +36008,8 @@
  177.190.170.8
  177.190.196.170
  177.190.254.18
-177.190.77.225
  177.191.168.77
+177.191.22.187
  177.193.115.4
  177.20.209.232
  177.20.209.233
@@ -36091,21 +36021,21 @@
  177.20.209.239
  177.200.160.34
  177.200.189.205
+177.200.207.11
  177.200.247.235
+177.200.66.193
  177.200.72.214
-177.200.81.115
  177.200.82.126
  177.200.89.62
  177.200.94.150
-177.202.108.18
  177.202.118.44
  177.204.167.141
  177.204.83.112
+177.205.139.196
  177.206.250.96
  177.207.192.137
  177.21.120.102
  177.21.19.87
-177.21.222.163
  177.21.30.32
  177.21.36.73
  177.21.96.222
@@ -36121,7 +36051,6 @@
  177.220.141.134
  177.220.161.250
  177.220.173.134
-177.220.174.58
  177.220.175.114
  177.220.178.247
  177.220.188.213
@@ -36130,7 +36059,8 @@
  177.221.176.66
  177.221.202.246
  177.221.73.75
-177.222.48.20
+177.222.62.207
+177.223.225.110
  177.223.48.126
  177.223.50.130
  177.223.58.68
@@ -36138,7 +36068,7 @@
  177.223.63.26
  177.224.90.29
  177.226.25.78
-177.227.224.60
+177.227.225.234
  177.23.16.17
  177.23.16.73
  177.23.184.166
@@ -36146,33 +36076,34 @@
  177.23.7.151
  177.230.20.38
  177.234.154.77
-177.237.35.81
  177.238.248.101
  177.239.160.121
  177.239.51.129
  177.240.174.84
  177.240.195.235
  177.240.204.200
-177.241.60.139
  177.244.36.134
  177.247.70.91
  177.25.215.20
-177.25.4.182
+177.25.235.208
  177.27.212.119
+177.31.31.173
  177.32.8.85
  177.34.59.115
  177.36.128.162
  177.36.159.34
+177.36.221.10
  177.36.221.11
  177.36.248.221
  177.36.37.116
  177.36.37.241
-177.37.159.240
+177.36.8.213
  177.37.161.4
+177.37.166.166
  177.37.176.172
  177.37.184.111
-177.37.187.255
  177.37.187.87
+177.37.200.67
  177.37.240.52
  177.37.71.40
  177.37.94.10
@@ -36182,11 +36113,10 @@
  177.38.243.90
  177.38.39.130
  177.38.5.113
-177.38.5.128
  177.38.5.137
  177.38.5.165
-177.38.5.171
  177.38.5.205
+177.38.5.216
  177.38.5.225
  177.38.5.230
  177.38.5.242
@@ -36195,7 +36125,6 @@
  177.38.5.85
  177.38.5.89
  177.38.61.237
-177.38.62.116
  177.38.69.111
  177.39.157.90
  177.39.187.70
@@ -36210,14 +36139,13 @@
  177.42.168.184
  177.42.173.136
  177.43.223.91
-177.43.86.211
+177.43.249.42
  177.44.175.198
  177.44.18.114
  177.44.18.124
  177.44.18.96
  177.44.208.107
  177.44.6.130
-177.44.60.17
  177.44.74.59
  177.44.82.232
  177.44.88.168
@@ -36226,10 +36154,10 @@
  177.46.147.89
  177.46.147.94
  177.47.194.82
-177.47.203.201
  177.47.224.1
  177.47.27.234
  177.5.250.104
+177.5.53.176
  177.52.13.252
  177.52.173.62
  177.52.216.12
@@ -36254,10 +36182,11 @@
  177.54.224.222
  177.54.224.245
  177.54.52.163
+177.55.117.137
  177.55.143.141
-177.58.18.9
+177.58.211.116
+177.6.227.84
  177.6.254.194
-177.63.208.251
  177.66.118.20
  177.66.184.237
  177.66.187.14
@@ -36267,15 +36196,16 @@
  177.66.221.5
  177.66.247.233
  177.66.247.81
-177.66.54.74
  177.66.89.50
  177.67.10.15
  177.67.162.42
  177.67.162.43
  177.67.166.189
+177.67.201.250
  177.67.203.135
  177.67.217.30
  177.67.219.1
+177.67.36.180
  177.67.46.99
  177.67.8.223
  177.67.8.80
@@ -36291,6 +36221,7 @@
  177.69.196.61
  177.69.237.57
  177.69.237.60
+177.69.238.9
  177.69.45.188
  177.69.67.242
  177.7.17.230
@@ -36331,7 +36262,6 @@
  177.73.248.26
  177.73.248.38
  177.73.248.6
-177.73.25.44
  177.73.25.85
  177.73.250.160
  177.73.250.193
@@ -36345,7 +36275,6 @@
  177.74.117.158
  177.74.119.222
  177.74.136.194
-177.74.143.144
  177.74.143.175
  177.74.143.97
  177.74.2.10
@@ -36354,15 +36283,18 @@
  177.75.143.112
  177.75.15.162
  177.75.155.144
+177.75.155.4
  177.75.159.200
-177.75.4.34
+177.75.199.134
  177.75.69.142
-177.76.141.122
+177.78.233.253
+177.79.62.181
  177.8.141.54
-177.8.169.172
+177.8.172.218
  177.8.216.114
  177.81.228.212
  177.81.29.164
+177.82.7.55
  177.84.108.76
  177.84.109.10
  177.84.143.142
@@ -36394,8 +36326,6 @@
  177.86.160.4
  177.86.181.206
  177.86.182.57
-177.86.201.22
-177.86.233.238
  177.86.64.1
  177.86.64.117
  177.86.64.145
@@ -36409,6 +36339,7 @@
  177.86.64.253
  177.86.64.89
  177.86.64.93
+177.87.0.7
  177.87.10.186
  177.87.108.93
  177.87.218.54
@@ -36419,11 +36350,9 @@
  177.87.36.193
  177.89.197.12
  177.9.139.221
-177.91.182.74
  177.91.186.60
  177.91.19.194
  177.91.214.89
-177.91.33.12
  177.91.33.131
  177.91.33.55
  177.91.35.21
@@ -36434,11 +36363,13 @@
  177.91.75.193
  177.91.80.8
  177.91.9.17
+177.92.141.164
+177.92.141.241
  177.92.160.254
  177.92.165.73
-177.92.247.110
  177.92.247.8
  177.92.249.112
+177.92.44.122
  177.92.66.227
  177.92.9.10
  177.92.9.12
@@ -36453,9 +36384,9 @@
  177.94.206.67
  177.94.227.188
  177.95.75.169
-177.96.39.30
  177.99.175.58
  177.99.206.82
+177.99.66.99
  177.99.9.92
  1770122162.jclecardinal.com
  177306689.servehalflife.com
@@ -36463,10 +36394,13 @@
  177momo.com
  178-365.net
  178.0.53.246
+178.10.10.224
+178.112.35.111
  178.114.151.159
  178.115.131.233
  178.116.213.31
  178.116.96.223
+178.117.233.13
  178.12.221.130
  178.120.22.2
  178.120.48.199
@@ -36484,7 +36418,6 @@
  178.125.17.15
  178.125.183.115
  178.125.221.124
-178.128.0.168
  178.128.1.219
  178.128.100.167
  178.128.101.249
@@ -36497,6 +36430,7 @@
  178.128.108.166
  178.128.11.149
  178.128.11.189
+178.128.111.115
  178.128.112.127
  178.128.115.138
  178.128.116.50
@@ -36514,7 +36448,6 @@
  178.128.121.137
  178.128.122.111
  178.128.122.230
-178.128.123.111
  178.128.124.89
  178.128.125.217
  178.128.125.4
@@ -36526,11 +36459,11 @@
  178.128.14.47
  178.128.144.227
  178.128.144.245
-178.128.144.28
  178.128.146.154
  178.128.146.170
  178.128.146.87
  178.128.147.114
+178.128.147.146
  178.128.148.223
  178.128.15.57
  178.128.15.96
@@ -36547,14 +36480,16 @@
  178.128.161.170
  178.128.162.10
  178.128.162.115
+178.128.162.42
  178.128.164.145
  178.128.164.154
  178.128.166.156
  178.128.168.87
+178.128.169.213
  178.128.169.88
  178.128.17.153
-178.128.176.16
  178.128.18.14
+178.128.180.162
  178.128.180.252
  178.128.181.61
  178.128.183.90
@@ -36566,6 +36501,7 @@
  178.128.199.106
  178.128.199.70
  178.128.20.19
+178.128.203.77
  178.128.205.229
  178.128.206.34
  178.128.206.59
@@ -36580,6 +36516,7 @@
  178.128.215.16
  178.128.215.76
  178.128.216.253
+178.128.216.9
  178.128.217.42
  178.128.217.58
  178.128.218.188
@@ -36595,6 +36532,8 @@
  178.128.224.143
  178.128.225.74
  178.128.226.2
+178.128.23.255
+178.128.230.35
  178.128.230.50
  178.128.231.190
  178.128.232.28
@@ -36633,6 +36572,7 @@
  178.128.250.149
  178.128.252.135
  178.128.252.216
+178.128.252.220
  178.128.252.228
  178.128.252.40
  178.128.252.63
@@ -36671,16 +36611,15 @@
  178.128.52.226
  178.128.53.79
  178.128.55.198
-178.128.55.215
  178.128.58.12
  178.128.58.16
  178.128.58.237
  178.128.60.11
  178.128.61.211
  178.128.62.201
-178.128.63.182
  178.128.63.183
  178.128.64.238
+178.128.68.121
  178.128.7.8
  178.128.70.115
  178.128.72.117
@@ -36696,6 +36635,7 @@
  178.128.77.226
  178.128.8.160
  178.128.8.241
+178.128.8.41
  178.128.80.85
  178.128.83.165
  178.128.83.219
@@ -36714,6 +36654,7 @@
  178.128.97.48
  178.128.98.103
  178.128.98.15
+178.129.180.150
  178.130.171.251
  178.130.86.118
  178.132.2.246
@@ -36734,10 +36675,12 @@
  178.134.185.75
  178.134.185.86
  178.134.190.55
+178.134.198.90
  178.134.208.126
  178.134.216.46
  178.134.71.138
  178.135.51.30
+178.136.2.208
  178.136.56.246
  178.137.16.0
  178.137.16.1
@@ -36998,6 +36941,7 @@
  178.137.163.125
  178.137.166.33
  178.137.208.162
+178.137.252.26
  178.137.82.147
  178.137.83.243
  178.137.87.242
@@ -37006,21 +36950,18 @@
  178.137.89.28
  178.137.93.24
  178.137.95.244
-178.138.195.212
  178.138.98.8
  178.140.108.240
  178.140.8.141
  178.141.0.203
-178.141.146.170
  178.141.165.37
  178.141.166.51
  178.141.180.25
-178.141.231.117
  178.141.4.175
  178.142.62.155
-178.142.62.32
  178.143.12.103
  178.143.52.84
+178.147.199.104
  178.148.21.70
  178.149.157.252
  178.149.192.80
@@ -37029,12 +36970,12 @@
  178.150.139.210
  178.150.15.194
  178.150.194.243
-178.150.207.53
  178.150.222.54
  178.150.237.198
  178.150.237.227
  178.150.31.232
  178.150.47.62
+178.150.93.128
  178.150.96.46
  178.150.97.102
  178.150.97.87
@@ -37043,12 +36984,10 @@
  178.151.238.148
  178.151.24.64
  178.151.241.122
-178.151.34.43
-178.151.65.138
+178.152.91.31
  178.153.109.59
  178.153.215.49
  178.154.226.80
-178.154.228.6
  178.154.230.105
  178.154.253.235
  178.155.12.177
@@ -37057,12 +36996,14 @@
  178.155.5.191
  178.155.5.208
  178.155.5.220
-178.155.5.243
+178.155.5.230
  178.155.5.76
  178.155.5.9
  178.156.44.128
+178.156.92.32
  178.157.91.246
  178.158.0.218
+178.158.0.64
  178.158.18.157
  178.158.23.244
  178.158.32.40
@@ -37112,6 +37053,7 @@
  178.162.205.26
  178.162.205.27
  178.162.210.136
+178.162.210.153
  178.162.210.17
  178.162.211.200
  178.162.211.211
@@ -37119,15 +37061,14 @@
  178.162.216.1
  178.162.218.42
  178.162.222.227
+178.163.49.146
+178.164.136.53
  178.164.183.200
-178.164.211.179
  178.165.103.188
  178.165.21.58
  178.165.44.122
  178.165.48.209
-178.165.70.181
  178.165.72.177
-178.165.91.245
  178.168.120.136
  178.168.19.139
  178.168.203.224
@@ -37170,65 +37111,93 @@
  178.170.168.212
  178.170.220.162
  178.170.48.17
-178.170.84.26
  178.172.147.45
-178.172.194.137
+178.172.208.244
  178.173.171.10
  178.174.148.58
-178.174.154.249
  178.174.159.163
-178.175.0.146
+178.175.0.165
  178.175.0.169
  178.175.1.115
  178.175.1.243
-178.175.101.231
+178.175.10.164
+178.175.10.99
+178.175.100.118
+178.175.100.15
+178.175.101.139
+178.175.101.196
+178.175.101.22
+178.175.102.198
+178.175.102.232
  178.175.102.250
-178.175.103.197
-178.175.103.50
+178.175.103.108
+178.175.103.171
+178.175.105.166
+178.175.105.175
  178.175.105.177
-178.175.105.250
  178.175.105.252
  178.175.106.11
  178.175.106.13
  178.175.106.179
+178.175.106.202
+178.175.106.242
  178.175.106.252
-178.175.106.47
+178.175.107.13
+178.175.107.202
  178.175.109.37
+178.175.11.108
+178.175.11.180
  178.175.11.235
  178.175.110.20
  178.175.111.1
-178.175.111.37
+178.175.111.133
+178.175.112.246
  178.175.113.116
+178.175.113.13
+178.175.113.177
  178.175.113.252
+178.175.114.101
  178.175.114.11
  178.175.114.114
-178.175.114.2
-178.175.114.201
  178.175.115.213
-178.175.115.249
-178.175.115.62
+178.175.115.216
+178.175.115.99
  178.175.116.107
-178.175.116.59
+178.175.117.11
  178.175.117.73
-178.175.117.75
+178.175.118.104
  178.175.118.169
-178.175.118.34
-178.175.118.38
+178.175.118.33
  178.175.118.4
-178.175.118.48
  178.175.119.165
+178.175.119.183
+178.175.119.203
+178.175.12.11
+178.175.12.217
+178.175.12.31
+178.175.120.126
+178.175.120.129
  178.175.120.223
+178.175.121.154
+178.175.121.205
+178.175.122.124
  178.175.122.207
-178.175.122.252
-178.175.123.1
+178.175.122.224
+178.175.122.239
+178.175.123.131
  178.175.123.210
-178.175.123.214
+178.175.123.237
+178.175.124.221
+178.175.125.42
+178.175.125.48
+178.175.125.77
+178.175.126.108
+178.175.126.202
  178.175.126.69
  178.175.127.176
  178.175.127.217
  178.175.129.41
  178.175.129.42
-178.175.13.0
  178.175.130.250
  178.175.130.253
  178.175.131.194
@@ -37239,106 +37208,225 @@
  178.175.132.74
  178.175.132.77
  178.175.132.78
+178.175.14.163
+178.175.14.63
+178.175.142.132
  178.175.144.126
  178.175.148.148
  178.175.148.224
-178.175.15.37
-178.175.16.46
+178.175.15.250
+178.175.17.102
  178.175.17.185
-178.175.17.29
+178.175.17.188
+178.175.17.58
+178.175.18.130
  178.175.19.212
  178.175.19.224
-178.175.2.94
-178.175.20.125
-178.175.20.150
+178.175.19.29
+178.175.2.221
+178.175.20.14
+178.175.20.50
  178.175.20.84
  178.175.21.164
-178.175.21.175
-178.175.22.255
-178.175.24.116
+178.175.21.201
+178.175.21.25
+178.175.22.211
+178.175.22.221
+178.175.22.226
+178.175.22.249
+178.175.24.91
  178.175.25.241
+178.175.26.124
+178.175.26.228
+178.175.26.241
+178.175.26.253
  178.175.26.58
+178.175.27.109
  178.175.27.124
+178.175.27.175
+178.175.28.117
+178.175.28.165
+178.175.28.206
  178.175.28.253
-178.175.29.219
+178.175.28.88
+178.175.29.234
  178.175.29.255
  178.175.29.46
  178.175.3.126
-178.175.31.74
-178.175.32.183
+178.175.31.171
+178.175.31.181
+178.175.32.109
+178.175.33.142
+178.175.34.240
+178.175.35.101
  178.175.36.10
-178.175.37.23
-178.175.4.108
+178.175.36.99
+178.175.37.10
+178.175.37.169
+178.175.37.203
+178.175.37.246
+178.175.37.26
+178.175.37.29
+178.175.37.67
+178.175.37.88
+178.175.38.123
+178.175.38.22
+178.175.38.55
+178.175.39.101
+178.175.39.127
+178.175.4.215
+178.175.4.75
  178.175.40.233
-178.175.40.81
+178.175.41.105
  178.175.41.151
+178.175.41.153
+178.175.41.214
  178.175.41.82
-178.175.43.239
-178.175.44.235
-178.175.44.30
-178.175.46.65
-178.175.48.123
+178.175.43.210
+178.175.45.122
+178.175.45.154
+178.175.45.236
+178.175.45.244
+178.175.46.220
+178.175.47.190
+178.175.47.41
+178.175.48.103
+178.175.48.110
+178.175.48.187
  178.175.48.252
+178.175.48.59
+178.175.49.126
+178.175.49.213
+178.175.49.227
  178.175.50.236
+178.175.50.87
+178.175.51.120
  178.175.51.15
-178.175.51.18
-178.175.51.226
-178.175.52.180
-178.175.54.35
+178.175.51.181
+178.175.52.118
+178.175.52.122
+178.175.52.199
+178.175.52.247
+178.175.54.23
+178.175.56.6
+178.175.57.131
  178.175.57.137
  178.175.57.215
-178.175.59.154
+178.175.57.232
+178.175.57.96
+178.175.58.99
+178.175.59.139
+178.175.59.162
  178.175.59.189
  178.175.59.61
+178.175.59.8
  178.175.6.216
  178.175.60.104
-178.175.60.177
-178.175.63.56
+178.175.60.89
+178.175.61.190
+178.175.61.230
+178.175.63.149
+178.175.63.159
  178.175.63.57
-178.175.65.112
+178.175.64.145
+178.175.64.198
+178.175.65.236
+178.175.66.174
+178.175.67.74
  178.175.67.8
-178.175.7.174
-178.175.71.198
+178.175.68.222
+178.175.68.243
+178.175.69.149
+178.175.69.219
+178.175.7.128
+178.175.7.28
+178.175.7.92
+178.175.70.164
+178.175.70.93
+178.175.71.11
+178.175.71.246
  178.175.72.194
+178.175.73.142
+178.175.73.2
+178.175.73.34
+178.175.73.76
+178.175.73.99
  178.175.74.138
-178.175.74.176
-178.175.77.110
-178.175.78.175
+178.175.74.241
+178.175.74.38
+178.175.76.151
+178.175.76.159
+178.175.76.185
+178.175.76.230
+178.175.77.137
+178.175.78.141
+178.175.78.58
+178.175.78.66
  178.175.79.116
  178.175.79.244
+178.175.8.180
  178.175.8.186
-178.175.80.103
-178.175.81.185
+178.175.8.188
+178.175.8.56
+178.175.80.128
+178.175.80.177
+178.175.81.200
+178.175.82.117
+178.175.82.181
  178.175.82.87
-178.175.83.141
-178.175.84.146
-178.175.84.180
+178.175.83.203
+178.175.83.230
+178.175.83.29
+178.175.83.4
+178.175.84.105
+178.175.84.120
+178.175.84.13
+178.175.84.204
+178.175.84.5
+178.175.85.127
+178.175.85.14
+178.175.85.15
  178.175.85.166
-178.175.85.219
-178.175.86.251
-178.175.86.39
-178.175.86.49
-178.175.86.52
-178.175.87.200
+178.175.85.243
+178.175.85.91
+178.175.86.167
+178.175.86.207
+178.175.86.76
+178.175.87.251
  178.175.87.42
-178.175.89.238
+178.175.88.21
+178.175.88.23
+178.175.9.195
+178.175.91.172
+178.175.91.205
+178.175.92.211
  178.175.92.234
+178.175.92.51
+178.175.92.96
  178.175.93.103
-178.175.93.40
+178.175.93.240
+178.175.94.138
+178.175.94.71
+178.175.94.83
+178.175.95.183
  178.175.95.228
-178.175.97.101
+178.175.96.70
  178.175.97.212
+178.175.97.23
+178.175.98.20
+178.175.98.92
+178.175.99.118
+178.175.99.157
  178.175.99.6
  178.176.169.30
  178.176.169.86
-178.176.174.108
-178.176.174.162
  178.176.174.223
-178.176.174.68
  178.176.224.36
  178.176.61.193
  178.176.72.172
  178.176.74.254
+178.176.74.70
+178.176.76.76
  178.176.78.81
  178.18.138.41
  178.18.16.21
@@ -37347,22 +37435,18 @@
  178.18.19.163
  178.18.84.73
  178.183.1.9
-178.183.76.21
-178.184.3.18
  178.184.89.255
  178.188.67.190
  178.19.106.234
  178.19.107.27
  178.19.179.30
  178.19.247.25
-178.190.154.202
  178.191.251.132
  178.192.160.46
  178.192.216.114
  178.192.42.67
  178.193.226.120
  178.194.110.8
-178.194.193.94
  178.194.26.106
  178.195.206.195
  178.195.53.244
@@ -37373,7 +37457,6 @@
  178.199.129.214
  178.20.100.35
  178.20.137.178
-178.20.157.104
  178.20.227.53
  178.20.37.58
  178.20.55.16
@@ -37382,6 +37465,7 @@
  178.200.152.49
  178.200.66.234
  178.201.166.4
+178.201.181.33
  178.202.47.90
  178.203.120.68
  178.203.146.227
@@ -37394,13 +37478,15 @@
  178.205.89.187
  178.206.227.68
  178.208.101.84
+178.208.103.98
+178.208.168.45
+178.208.225.148
  178.208.255.8
  178.208.75.227
  178.209.170.75
  178.209.42.84
  178.21.10.44
  178.21.20.102
-178.210.129.150
  178.210.146.102
  178.210.163.36
  178.210.44.131
@@ -37409,7 +37495,6 @@
  178.212.176.82
  178.212.54.137
  178.212.64.52
-178.212.98.214
  178.213.0.207
  178.213.130.101
  178.213.130.159
@@ -37428,23 +37513,22 @@
  178.216.2.229
  178.216.200.48
  178.216.233.110
-178.216.248.36
  178.216.31.250
  178.216.48.130
  178.216.48.131
-178.216.48.182
  178.216.49.147
  178.217.106.245
  178.217.152.234
  178.217.169.10
  178.217.172.234
+178.217.173.54
  178.217.216.184
  178.217.40.208
  178.218.104.42
  178.218.104.8
-178.218.118.230
+178.218.207.89
  178.218.222.185
-178.218.244.234
+178.219.170.40
  178.219.171.43
  178.219.173.193
  178.219.175.128
@@ -37454,25 +37538,19 @@
  178.22.168.44
  178.22.221.201
  178.22.65.147
-178.220.33.49
-178.220.64.194
  178.221.100.131
  178.221.110.179
-178.221.183.211
  178.221.39.148
  178.221.41.10
  178.222.148.139
  178.222.247.29
-178.222.252.130
  178.223.114.125
  178.223.68.233
  178.23.244.208
  178.230.81.29
  178.233.97.54
-178.234.29.184
  178.234.35.26
  178.234.37.197
-178.235.181.29
  178.235.3.236
  178.236.137.63
  178.236.232.8
@@ -37489,16 +37567,13 @@
  178.238.78.15
  178.239.168.57
  178.239.169.130
-178.239.173.220
-178.239.198.13
  178.239.198.23
+178.239.198.86
  178.239.50.139
  178.239.50.140
  178.239.59.82
  178.239.62.113
-178.242.114.185
  178.242.114.188
-178.242.114.193
  178.242.126.255
  178.242.41.26
  178.248.108.51
@@ -37511,20 +37586,17 @@
  178.250.157.177
  178.250.28.171
  178.250.54.208
-178.251.104.85
  178.251.107.253
  178.251.140.3
-178.251.222.170
  178.251.242.231
  178.252.122.139
  178.252.127.236
-178.252.179.13
  178.252.197.64
  178.252.199.46
  178.252.75.13
  178.252.80.226
  178.253.198.2
-178.253.244.211
+178.253.204.6
  178.253.248.146
  178.254.138.82
  178.254.139.33
@@ -37534,6 +37606,7 @@
  178.254.148.37
  178.254.149.33
  178.254.149.37
+178.254.170.110
  178.254.171.41
  178.254.171.46
  178.254.174.196
@@ -37555,18 +37628,17 @@
  178.27.122.202
  178.27.194.187
  178.30.241.242
-178.30.75.243
  178.32.1.128
+178.32.109.161
+178.32.113.41
  178.32.121.17
  178.32.123.182
  178.32.167.73
  178.32.181.66
  178.32.189.89
  178.32.192.85
-178.32.197.84
  178.32.198.183
  178.32.205.2
-178.32.213.119
  178.32.213.127
  178.32.216.133
  178.32.217.138
@@ -37581,14 +37653,13 @@
  178.32.58.209
  178.32.79.49
  178.32.88.23
-178.33.104.227
-178.33.129.133
  178.33.131.26
  178.33.132.215
  178.33.134.34
  178.33.137.7
  178.33.14.216
  178.33.14.218
+178.33.141.120
  178.33.145.40
  178.33.145.43
  178.33.145.46
@@ -37600,12 +37671,11 @@
  178.33.207.147
  178.33.209.195
  178.33.216.187
+178.33.216.209
  178.33.228.210
  178.33.232.69
  178.33.233.230
  178.33.38.55
-178.33.48.250
-178.33.55.229
  178.33.67.12
  178.33.68.20
  178.33.68.21
@@ -37615,12 +37685,13 @@
  178.34.161.139
  178.34.32.63
  178.38.132.54
-178.38.49.155
  178.38.71.231
  178.39.218.49
  178.41.143.77
  178.42.48.18
+178.44.222.230
  178.45.129.108
+178.46.119.174
  178.46.163.191
  178.46.199.220
  178.47.131.202
@@ -37628,10 +37699,8 @@
  178.47.139.50
  178.47.141.128
  178.47.141.196
-178.47.141.85
  178.47.143.198
  178.47.65.105
-178.48.13.49
  178.48.31.141
  178.48.53.163
  178.48.68.189
@@ -37639,15 +37708,13 @@
  178.48.68.9
  178.49.120.199
  178.49.192.210
-178.5.107.152
  178.57.115.124
  178.57.124.37
  178.57.125.78
-178.59.11.53
-178.59.64.91
+178.57.237.228
  178.60.28.98
-178.61.149.77
  178.62.10.18
+178.62.100.17
  178.62.101.135
  178.62.103.168
  178.62.103.30
@@ -37656,11 +37723,12 @@
  178.62.106.182
  178.62.106.78
  178.62.106.98
+178.62.110.223
  178.62.114.26
  178.62.114.33
-178.62.115.251
  178.62.115.45
  178.62.115.86
+178.62.116.88
  178.62.117.106
  178.62.117.223
  178.62.119.91
@@ -37718,6 +37786,7 @@
  178.62.227.177
  178.62.228.162
  178.62.230.5
+178.62.231.95
  178.62.233.72
  178.62.238.244
  178.62.239.233
@@ -37731,11 +37800,11 @@
  178.62.246.169
  178.62.247.109
  178.62.247.57
-178.62.249.167
  178.62.25.71
  178.62.250.110
  178.62.250.186
  178.62.251.156
+178.62.252.206
  178.62.253.153
  178.62.253.169
  178.62.254.156
@@ -37743,12 +37812,10 @@
  178.62.255.217
  178.62.26.232
  178.62.27.101
-178.62.27.184
  178.62.29.24
  178.62.29.94
  178.62.32.11
  178.62.33.222
-178.62.36.111
  178.62.37.78
  178.62.40.33
  178.62.42.116
@@ -37770,6 +37837,7 @@
  178.62.59.36
  178.62.6.215
  178.62.60.233
+178.62.61.141
  178.62.63.15
  178.62.68.245
  178.62.69.100
@@ -37777,7 +37845,6 @@
  178.62.7.227
  178.62.7.30
  178.62.71.93
-178.62.76.83
  178.62.77.137
  178.62.77.224
  178.62.78.193
@@ -37801,8 +37868,8 @@
  178.62.9.157
  178.62.9.160
  178.62.9.39
+178.62.92.225
  178.62.92.247
-178.62.95.17
  178.62.96.23
  178.63.127.148
  178.63.127.150
@@ -37812,6 +37879,7 @@
  178.63.174.225
  178.63.189.139
  178.63.2.220
+178.63.246.82
  178.63.246.83
  178.63.247.209
  178.63.253.33
@@ -37833,7 +37901,9 @@
  178.63.97.34
  178.63.98.228
  178.64.248.62
+178.65.118.134
  178.65.164.197
+178.66.182.76
  178.67.195.64
  178.67.205.104
  178.69.0.10
@@ -37841,6 +37911,8 @@
  178.69.191.120
  178.69.229.2
  178.70.128.126
+178.70.19.104
+178.71.188.198
  178.72.162.242
  178.72.163.252
  178.72.68.112
@@ -37869,7 +37941,6 @@
  178.72.69.143
  178.72.69.144
  178.72.69.166
-178.72.69.168
  178.72.69.182
  178.72.69.220
  178.72.69.238
@@ -37881,7 +37952,6 @@
  178.72.70.133
  178.72.70.169
  178.72.70.173
-178.72.70.179
  178.72.70.192
  178.72.70.216
  178.72.70.248
@@ -37889,7 +37959,6 @@
  178.72.70.30
  178.72.70.33
  178.72.70.34
-178.72.70.4
  178.72.70.44
  178.72.70.48
  178.72.70.84
@@ -37900,6 +37969,7 @@
  178.72.71.136
  178.72.71.168
  178.72.71.176
+178.72.71.187
  178.72.71.199
  178.72.71.207
  178.72.71.214
@@ -37911,17 +37981,15 @@
  178.72.71.63
  178.72.71.64
  178.72.71.79
-178.72.71.96
  178.72.74.40
-178.73.192.3
  178.73.215.171
+178.74.37.90
  178.75.143.33
  178.75.27.131
  178.76.234.182
  178.76.238.246
  178.76.254.130
  178.76.69.132
-178.77.1.214
  178.77.154.111
  178.77.238.2
  178.78.104.202
@@ -37937,6 +38005,8 @@
  178.79.187.33
  178.79.189.74
  178.79.24.36
+178.79.30.9
+178.82.50.84
  178.84.195.232
  178.84.197.175
  178.84.26.71
@@ -37944,22 +38014,17 @@
  178.85.133.89
  178.85.97.102
  178.86.163.62
-178.89.126.76
  178.89.32.171
-178.90.249.89
+178.93.1.108
  178.93.11.9
  178.93.11.92
-178.93.13.221
  178.93.14.61
  178.93.14.65
-178.93.15.111
  178.93.2.42
-178.93.20.99
  178.93.21.32
  178.93.22.137
  178.93.23.148
  178.93.24.214
-178.93.28.187
  178.93.28.53
  178.93.30.175
  178.93.30.50
@@ -37975,11 +38040,12 @@
  178.93.50.121
  178.93.50.236
  178.93.50.241
-178.93.50.42
  178.93.50.93
  178.93.51.204
+178.93.51.54
  178.93.52.131
  178.93.55.85
+178.93.57.151
  178.93.6.134
  178.93.6.225
  178.93.6.95
@@ -37988,20 +38054,20 @@
  178.93.63.239
  178.93.7.161
  178.93.8.245
-178.93.8.89
  178.94.146.50
  178.94.149.31
+178.94.169.178
  178.94.173.6
  178.94.25.85
-178.94.33.16
+178.95.132.49
  178.95.136.35
  178.95.199.144
-178.95.201.230
  178j.life
  179.1.1.11
  179.1.91.130
+179.100.41.78
+179.104.230.158
  179.104.29.100
-179.104.29.205
  179.106.150.4
  179.106.150.5
  179.106.150.7
@@ -38009,12 +38075,10 @@
  179.106.223.27
  179.107.191.209
  179.107.34.178
-179.107.57.107
  179.107.57.27
  179.107.58.110
  179.107.58.23
  179.107.58.248
-179.107.58.52
  179.107.59.220
  179.107.62.108
  179.107.67.80
@@ -38034,7 +38098,6 @@
  179.108.250.24
  179.108.251.41
  179.108.5.146
-179.110.222.69
  179.111.212.162
  179.111.216.11
  179.111.42.156
@@ -38050,11 +38113,9 @@
  179.125.172.177
  179.125.172.210
  179.125.25.218
-179.125.28.58
  179.125.39.230
  179.125.46.2
  179.125.65.3
-179.126.116.213
  179.126.41.66
  179.127.140.113
  179.127.140.142
@@ -38064,19 +38125,21 @@
  179.131.10.103
  179.131.11.234
  179.145.16.211
+179.151.183.162
  179.154.224.95
  179.155.190.218
  179.157.206.101
  179.157.224.109
  179.157.4.188
-179.171.65.199
+179.159.58.134
+179.171.61.239
  179.174.22.147
+179.175.8.158
  179.176.12.76
-179.176.133.63
+179.176.132.147
  179.176.243.182
  179.177.139.16
  179.177.186.121
-179.177.46.231
  179.180.132.228
  179.180.98.209
  179.181.122.204
@@ -38089,32 +38152,31 @@
  179.184.186.170
  179.184.230.194
  179.184.89.228
-179.185.181.212
  179.185.50.182
  179.185.66.242
  179.185.77.218
-179.186.105.118
  179.186.109.25
  179.187.226.213
  179.187.95.150
-179.188.30.195
  179.189.125.222
  179.189.229.82
+179.189.245.246
  179.189.253.122
  179.189.27.28
  179.191.108.214
  179.191.108.58
  179.191.15.59
-179.191.150.163
  179.191.245.58
+179.191.55.38
+179.191.68.86
  179.191.69.146
+179.191.99.218
  179.199.146.156
+179.199.226.171
  179.208.125.217
  179.208.93.75
  179.210.120.225
  179.210.160.46
-179.210.251.99
-179.211.209.4
  179.211.32.189
  179.213.13.110
  179.213.33.206
@@ -38124,37 +38186,33 @@
  179.217.34.158
  179.219.99.100
  179.219.99.144
-179.222.121.142
  179.222.67.144
-179.224.90.142
+179.223.210.143
  179.225.253.69
  179.228.215.246
+179.228.221.91
  179.228.242.19
  179.228.74.3
  179.232.75.13
-179.233.3.103
  179.233.3.89
  179.234.1.38
  179.234.232.150
  179.234.40.169
  179.238.216.245
-179.24.136.224
-179.24.227.247
+179.24.19.63
  179.24.23.212
  179.25.10.198
-179.25.73.155
+179.250.239.76
+179.26.67.134
  179.27.214.238
  179.27.60.34
  179.27.66.106
  179.27.73.234
  179.27.83.222
-179.32.53.14
  179.32.70.214
-179.35.29.233
  179.40.75.1
  179.41.4.149
  179.42.105.0
-179.42.196.78
  179.42.233.226
  179.43.101.47
  179.43.128.245
@@ -38191,7 +38249,6 @@
  179.43.167.230
  179.43.170.150
  179.43.170.152
-179.43.174.203
  179.43.60.1
  179.43.80.6
  179.43.97.40
@@ -38202,28 +38259,27 @@
  179.52.118.143
  179.53.73.70
  179.56.248.64
+179.57.13.9
  179.6.193.93
-179.6.200.187
-179.6.206.141
+179.6.44.240
  179.6.47.76
  179.60.132.42
  179.60.229.168
  179.60.243.38
  179.61.128.12
+179.61.130.2
+179.61.134.170
  179.61.136.251
-179.61.142.108
  179.61.142.121
  179.61.145.55
  179.61.146.87
  179.61.148.164
  179.61.148.176
  179.61.148.179
-179.61.149.47
  179.61.152.118
+179.61.162.138
  179.61.162.153
  179.61.163.216
-179.61.163.62
-179.61.164.61
  179.61.164.9
  179.61.166.69
  179.61.167.28
@@ -38247,18 +38303,23 @@
  179.7.52.117
  179.9.160.50
  179.93.149.17
+179.93.167.7
  179.93.21.58
+179.93.23.103
  179.93.58.206
+179.95.105.197
  179.95.232.131
  179.95.28.31
+179.95.3.24
  179.95.63.24
+179.96.162.14
  179.96.184.70
  179.96.20.138
  179.96.28.225
+179.96.28.233
  179.96.28.58
  179.97.228.91
  179.97.243.206
-179.97.67.188
  179.97.86.254
  179.98.79.120
  179.99.200.39
@@ -38280,6 +38341,7 @@
  18.130.144.147
  18.130.147.87
  18.130.151.248
+18.130.154.64
  18.130.172.182
  18.130.181.59
  18.130.181.66
@@ -38292,6 +38354,7 @@
  18.130.68.77
  18.130.73.244
  18.130.77.246
+18.130.92.106
  18.130.99.113
  18.132.10.97
  18.136.118.221
@@ -38300,14 +38363,16 @@
  18.136.202.37
  18.136.72.135
  18.136.74.240
+18.139.111.226
  18.139.212.16
  18.140.214.227
  18.141.210.87
+18.141.239.85
+18.144.47.45
  18.144.49.66
  18.144.54.86
  18.144.68.200
  18.144.73.74
-18.156.162.107
  18.156.64.16
  18.156.81.115
  18.157.86.215
@@ -38322,12 +38387,12 @@
  18.163.183.198
  18.163.198.1
  18.166.70.149
-18.176.254.180
  18.177.147.97
  18.178.178.85
  18.179.123.64
  18.179.206.81
  18.179.39.98
+18.179.4.92
  18.179.50.95
  18.18.248.17
  18.181.109.120
@@ -38363,7 +38428,6 @@
  18.188.2.244
  18.188.210.105
  18.188.211.162
-18.188.214.137
  18.188.34.228
  18.188.66.202
  18.188.69.107
@@ -38379,10 +38443,10 @@
  18.191.174.150
  18.191.174.89
  18.191.190.27
-18.191.205.64
  18.191.214.193
  18.191.215.120
  18.191.227.63
+18.191.229.101
  18.191.233.36
  18.191.24.139
  18.191.253.121
@@ -38401,7 +38465,6 @@
  18.194.121.64
  18.194.124.47
  18.194.146.215
-18.194.196.202
  18.194.221.29
  18.194.36.11
  18.194.87.132
@@ -38418,10 +38481,8 @@
  18.196.79.108
  18.197.104.87
  18.197.121.76
-18.197.125.181
  18.197.130.212
  18.197.194.34
-18.197.23.215
  18.197.34.112
  18.197.41.88
  18.197.75.37
@@ -38433,9 +38494,11 @@
  18.202.116.130
  18.202.173.173
  18.202.230.228
+18.202.251.247
  18.202.28.185
  18.202.91.9
  18.202.97.50
+18.203.205.125
  18.203.214.161
  18.203.235.181
  18.204.34.190
@@ -38444,12 +38507,10 @@
  18.205.180.185
  18.205.243.73
  18.206.158.128
-18.206.165.149
  18.206.201.164
  18.206.223.137
  18.206.238.251
  18.206.58.239
-18.206.74.141
  18.206.79.198
  18.207.105.173
  18.207.110.64
@@ -38479,7 +38540,6 @@
  18.212.25.96
  18.212.57.172
  18.212.70.205
-18.213.202.30
  18.214.113.12
  18.214.121.165
  18.214.39.103
@@ -38555,6 +38615,7 @@
  18.220.171.207
  18.220.179.17
  18.220.191.227
+18.220.194.39
  18.220.207.182
  18.220.215.19
  18.220.223.47
@@ -38574,6 +38635,7 @@
  18.221.226.11
  18.221.227.81
  18.221.233.177
+18.221.242.5
  18.221.252.75
  18.221.43.112
  18.221.46.94
@@ -38592,6 +38654,7 @@
  18.222.210.24
  18.222.218.210
  18.222.226.53
+18.222.227.160
  18.222.229.143
  18.222.23.38
  18.222.255.206
@@ -38614,13 +38677,13 @@
  18.224.229.143
  18.224.234.85
  18.224.51.173
-18.224.56.142
  18.224.71.43
  18.224.73.43
  18.225.13.83
  18.225.17.4
  18.225.34.180
  18.228.0.28
+18.228.122.94
  18.228.144.20
  18.228.189.224
  18.228.67.12
@@ -38642,10 +38705,11 @@
  18.233.171.117
  18.233.226.112
  18.233.99.209
-18.234.105.108
+18.234.166.152
  18.234.174.252
  18.234.208.74
  18.234.221.133
+18.234.249.212
  18.234.79.31
  18.236.105.250
  18.236.113.157
@@ -38670,12 +38734,11 @@
  18.27.79.17
  180.100.206.226
  180.100.206.35
-180.100.213.72
  180.100.243.210
  180.101.147.147
  180.101.202.30
  180.101.221.152
-180.102.132.248
+180.101.248.148
  180.103.225.65
  180.103.250.217
  180.104.13.145
@@ -38698,7 +38761,6 @@
  180.104.39.202
  180.104.59.28
  180.104.61.229
-180.104.65.30
  180.104.74.135
  180.104.76.83
  180.104.79.77
@@ -38709,39 +38771,30 @@
  180.107.109.21
  180.107.128.195
  180.107.134.173
-180.107.58.81
+180.107.135.30
  180.107.76.147
-180.108.121.54
-180.108.207.102
+180.108.155.73
  180.108.207.43
  180.108.229.41
-180.108.9.18
  180.108.98.107
  180.111.5.163
  180.111.90.68
  180.112.185.135
  180.112.191.24
  180.112.34.16
-180.113.138.184
  180.113.141.217
-180.113.147.97
+180.113.143.100
+180.113.145.249
+180.113.146.139
  180.113.61.65
-180.113.62.122
-180.113.64.136
  180.114.101.116
-180.114.150.53
-180.114.151.123
+180.114.150.157
+180.114.150.206
  180.114.151.157
-180.114.151.162
  180.114.169.253
-180.114.176.211
  180.114.176.240
-180.114.176.247
-180.114.177.168
-180.114.177.61
-180.114.178.175
-180.114.178.209
  180.114.178.49
+180.114.179.11
  180.114.194.102
  180.114.77.193
  180.115.100.182
@@ -38821,6 +38874,7 @@
  180.123.29.59
  180.123.36.177
  180.123.36.193
+180.123.42.115
  180.123.47.238
  180.123.59.159
  180.123.59.230
@@ -38838,7 +38892,6 @@
  180.124.126.199
  180.124.127.227
  180.124.132.176
-180.124.133.216
  180.124.134.163
  180.124.146.205
  180.124.161.152
@@ -38865,8 +38918,6 @@
  180.124.90.224
  180.125.169.29
  180.125.170.131
-180.125.212.174
-180.125.212.199
  180.125.213.222
  180.125.239.161
  180.125.243.242
@@ -38874,8 +38925,7 @@
  180.125.249.94
  180.125.44.203
  180.125.98.225
-180.127.76.144
-180.127.94.160
+180.127.95.52
  180.128.0.237
  180.128.1.30
  180.128.1.87
@@ -38886,8 +38936,6 @@
  180.137.45.182
  180.139.132.71
  180.142.130.246
-180.143.165.45
-180.145.111.180
  180.148.214.178
  180.148.215.101
  180.148.33.203
@@ -38909,17 +38957,19 @@
  180.150.227.71
  180.150.230.16
  180.150.35.183
+180.150.44.82
  180.150.50.188
  180.150.58.14
+180.150.73.103
  180.150.86.215
  180.151.198.70
  180.151.249.194
  180.151.43.134
  180.151.56.114
-180.151.56.119
  180.151.56.122
  180.151.56.124
  180.151.56.99
+180.151.63.66
  180.151.69.138
  180.151.90.79
  180.151.98.12
@@ -38928,6 +38978,7 @@
  180.153.91.15
  180.153.91.17
  180.157.10.59
+180.157.250.73
  180.158.22.213
  180.163.86.208
  180.163.91.154
@@ -38963,7 +39014,6 @@
  180.176.214.171bin.sh
  180.177.180.6
  180.177.243.251
-180.178.127.42
  180.178.37.186
  180.178.63.10
  180.178.97.90
@@ -38980,7 +39030,7 @@
  180.180.123.41
  180.180.136.251
  180.180.141.131
-180.180.143.79
+180.180.146.3
  180.180.151.234
  180.180.151.241
  180.180.151.39
@@ -38997,16 +39047,16 @@
  180.180.201.121
  180.180.201.4
  180.180.202.180
-180.180.202.64
-180.180.202.69
  180.180.203.105
  180.180.216.177
  180.180.218.12
  180.180.224.34
+180.180.226.103
  180.180.238.250
  180.180.241.93
  180.180.26.182
-180.180.7.31
+180.180.4.55
+180.180.54.37
  180.180.71.150
  180.180.72.132
  180.180.75.79
@@ -39017,8 +39067,8 @@
  180.183.0.172
  180.183.1.217
  180.183.1.80
+180.183.100.44
  180.183.114.180
-180.183.116.57
  180.183.121.197
  180.183.123.110
  180.183.126.86
@@ -39031,7 +39081,8 @@
  180.183.173.254
  180.183.180.18
  180.183.219.31
-180.183.26.121
+180.183.228.114
+180.183.237.86
  180.183.26.165
  180.183.44.213
  180.183.5.87
@@ -39040,11 +39091,13 @@
  180.183.98.216
  180.188.241.130
  180.188.241.131
+180.188.241.175
  180.188.241.197
  180.188.241.249
-180.190.171.65
+180.191.160.205
+180.191.160.215
+180.191.185.7
  180.191.185.85
-180.191.20.148
  180.210.201.54
  180.210.201.57
  180.210.205.53
@@ -39087,10 +39140,10 @@
  180.211.183.178
  180.211.183.2
  180.211.183.30
+180.211.186.222
  180.211.191.94
  180.211.193.214
  180.211.195.18
-180.211.248.222
  180.211.91.178
  180.211.91.182
  180.211.91.184
@@ -39102,7 +39155,6 @@
  180.211.97.204
  180.214.236.190
  180.214.236.98
-180.214.237.105
  180.214.237.13
  180.214.238.5
  180.214.239.54
@@ -39119,12 +39171,13 @@
  180.215.227.16
  180.215.227.32
  180.215.255.4
+180.215.255.6
  180.216.246.81
  180.216.71.170
+180.218.161.74
  180.218.5.171
  180.222.161.85
  180.222.182.4
-180.229.5.108
  180.231.222.41
  180.232.123.251
  180.233.106.140
@@ -39134,8 +39187,6 @@
  180.235.138.247
  180.235.138.96
  180.241.132.57
-180.241.154.179
-180.241.156.13
  180.241.168.29
  180.241.218.227
  180.241.242.120
@@ -39145,39 +39196,40 @@
  180.241.55.206
  180.241.75.230
  180.241.77.184
-180.241.83.15
  180.242.212.73
-180.242.213.201
  180.242.213.97
  180.242.214.52
  180.242.215.223
-180.242.233.81
  180.242.70.73
  180.242.9.241
-180.243.32.52
+180.243.162.172
  180.243.52.129
-180.244.235.253
-180.246.149.23
+180.245.162.198
+180.245.163.49
  180.246.151.211
  180.246.175.238
-180.246.227.153
+180.246.27.71
  180.246.32.253
  180.246.56.48
  180.246.97.44
+180.247.101.199
  180.247.197.223
  180.247.199.195
  180.247.59.224
-180.247.61.132
  180.248.0.149
  180.248.123.83
  180.248.13.77
  180.248.161.161
+180.248.188.175
  180.248.220.209
  180.248.43.148
-180.249.164.192
+180.248.81.56
+180.249.117.88
+180.249.158.231
+180.249.164.138
  180.249.166.111
  180.249.231.79
-180.250.115.121
+180.250.101.146
  180.250.124.162
  180.250.124.164
  180.250.124.179
@@ -39190,8 +39242,6 @@
  180.250.165.200
  180.250.170.210
  180.250.180.66
-180.250.188.26
-180.250.188.28
  180.250.19.92
  180.250.197.91
  180.250.198.138
@@ -39214,9 +39264,11 @@
  180.250.97.19
  180.251.114.36
  180.251.146.136
+180.251.242.155
  180.251.38.43
+180.252.114.157
+180.252.115.99
  180.252.124.41
-180.252.126.104
  180.252.131.157
  180.252.243.60
  180.252.247.147
@@ -39225,39 +39277,38 @@
  180.253.138.182
  180.253.142.106
  180.253.162.72
-180.253.164.117
  180.253.166.55
  180.253.175.119
+180.253.177.69
  180.253.20.42
  180.253.211.157
+180.253.212.28
+180.253.26.124
  180.253.66.111
  180.253.67.105
-180.253.80.34
+180.253.72.121
  180.254.12.125
-180.254.23.38
  180.254.244.220
  180.254.34.139
-180.254.48.181
  180.254.91.119
  180.33.192.153
-180.42.14.218
  180.64.119.18
  180.66.102.25
  180.66.53.93
  180.68.49.93
+180.69.129.208
  180.69.254.177
-180.70.209.209
  180.71.47.198
  180.71.58.134
  180.76.101.229
  180.76.103.247
  180.76.104.101
  180.76.105.122
+180.76.105.147
  180.76.105.165
  180.76.111.247
  180.76.111.55
  180.76.114.156
-180.76.117.206
  180.76.121.95
  180.76.124.53
  180.76.133.173
@@ -39286,7 +39337,6 @@
  180.76.180.231
  180.76.181.47
  180.76.184.227
-180.76.188.4
  180.76.227.138
  180.76.227.202
  180.76.228.15
@@ -39295,9 +39345,11 @@
  180.76.231.121
  180.76.231.234
  180.76.232.118
+180.76.233.88
  180.76.234.185
  180.76.235.75
  180.76.235.96
+180.76.236.239
  180.76.237.37
  180.76.238.133
  180.76.238.183
@@ -39312,8 +39364,10 @@
  180.76.247.103
  180.76.248.220
  180.76.250.18
+180.76.38.88
  180.76.50.249
  180.76.51.143
+180.76.53.208
  180.76.53.241
  180.76.54.70
  180.76.57.17
@@ -39326,48 +39380,41 @@
  180.87.195.22
  180.89.58.27
  180.92.233.82
+180.92.238.139
  180.92.238.251
  180.92.239.110
  180.92.239.217
  180.94.170.166
  180.94.188.76
  180.94.64.114
+180.94.77.122
+180.95.183.214
  180.96.11.20
  180.96.63.162
  180.97.182.111
  180.97.197.171
  180.97.31.28
  180.97.80.12
-180.97.80.246
  18013.url.789msw.com
  180betper.blogspot.com
  180clubrealestate.com
  180jxlh.com
  181.10.129.85
  181.10.133.12
-181.10.160.156
  181.10.204.106
  181.10.210.99
  181.10.45.170
  181.10.46.92
  181.102.108.252
-181.102.110.238
  181.102.113.162
-181.102.115.221
-181.102.121.162
  181.102.121.35
-181.102.130.1
+181.102.132.44
  181.102.138.179
  181.102.139.168
-181.102.146.57
  181.102.203.11
-181.102.3.3
-181.102.37.206
  181.102.47.119
  181.102.56.89
-181.102.59.49
  181.102.74.24
-181.102.80.251
  181.102.83.200
  181.102.96.180
  181.102.97.146
@@ -39395,23 +39442,26 @@
  181.113.28.150
  181.113.32.66
  181.113.34.70
+181.113.34.86
  181.113.35.6
+181.113.37.86
  181.113.66.146
  181.113.67.54
  181.114.212.131
  181.115.146.34
  181.115.156.38
  181.115.156.59
+181.115.166.120
  181.115.168.69
-181.115.204.74
  181.115.38.146
-181.115.67.3
  181.118.101.22
  181.118.126.20
  181.119.20.201
  181.119.27.62
  181.119.30.26
+181.121.213.151
  181.121.72.54
+181.122.63.44
  181.123.13.77
  181.124.152.197
  181.124.153.25
@@ -39473,7 +39523,6 @@
  181.15.154.154
  181.15.154.156
  181.15.156.170
-181.16.120.3
  181.16.136.1
  181.16.136.41
  181.16.17.210
@@ -39489,8 +39538,6 @@
  181.165.24.88
  181.165.68.127
  181.166.106.224
-181.166.18.88
-181.166.217.170
  181.167.247.186
  181.168.141.194
  181.168.206.106
@@ -39498,25 +39545,23 @@
  181.169.224.89
  181.170.24.194
  181.171.120.21
-181.171.200.57
  181.171.209.241
  181.174.100.66
  181.174.166.112
  181.174.166.113
  181.174.166.9
  181.174.194.62
+181.174.47.79
  181.176.161.19
  181.176.164.179
  181.176.222.68
  181.176.241.142
  181.176.242.168
  181.177.111.136
-181.177.111.141
-181.177.111.240
  181.177.111.52
  181.177.111.56
  181.177.111.63
-181.177.111.68
+181.177.111.7
  181.177.112.111
  181.177.112.225
  181.177.112.231
@@ -39527,10 +39572,10 @@
  181.177.20.15
  181.177.231.245
  181.177.245.165
-181.177.84.224
-181.177.84.94
-181.177.87.27
+181.177.85.170
+181.177.87.83
  181.177.96.104
+181.177.96.130
  181.177.96.135
  181.177.96.140
  181.177.96.183
@@ -39553,7 +39598,9 @@
  181.191.180.110
  181.191.82.196bin.sh
  181.191.85.114
+181.192.2.233
  181.196.1.162
+181.196.1.27
  181.196.142.114
  181.196.176.22
  181.196.177.30
@@ -39567,6 +39614,7 @@
  181.196.31.34
  181.196.57.230
  181.197.108.171
+181.198.135.184
  181.198.2.22
  181.198.203.45
  181.198.32.211
@@ -39581,7 +39629,10 @@
  181.199.170.205
  181.199.170.222
  181.199.170.230
+181.199.210.219
+181.199.60.212
  181.206.20.11
+181.208.194.106
  181.209.134.138
  181.209.159.166
  181.209.23.195
@@ -39589,13 +39640,12 @@
  181.209.74.234
  181.209.82.154
  181.209.86.130
-181.21.79.90
  181.211.101.90
  181.211.11.78
+181.211.162.86
  181.211.167.206
  181.211.241.210
  181.211.246.18
-181.211.250.138
  181.211.38.62
  181.211.6.34
  181.214.140.71
@@ -39603,9 +39653,10 @@
  181.214.182.224
  181.214.184.197
  181.214.190.80
+181.214.209.198
+181.214.209.213
  181.214.211.203
  181.214.249.98
-181.214.8.34
  181.214.87.25
  181.214.89.199
  181.214.89.208
@@ -39613,26 +39664,25 @@
  181.214.89.252
  181.214.92.100
  181.215.114.160
-181.215.18.39
  181.215.205.247
  181.222.106.28
+181.222.247.43
  181.223.160.231
  181.223.88.209
  181.224.161.168
  181.224.161.173
  181.224.228.186
  181.224.253.233
+181.225.213.227
  181.225.65.106
  181.225.65.242
  181.225.65.244
  181.228.55.57
  181.228.9.190
-181.229.44.252
  181.229.62.26
  181.230.116.163
-181.230.164.105
  181.230.219.66
-181.230.99.49
+181.230.57.242
  181.231.220.232
  181.231.54.156
  181.234.80.108
@@ -39642,16 +39692,16 @@
  181.236.247.136
  181.238.51.152
  181.239.208.122
+181.24.5.236
  181.28.101.14
  181.28.152.133
  181.28.173.192
  181.30.101.242
  181.30.118.202
  181.30.126.66
-181.30.28.174
  181.30.28.198
  181.30.28.201
-181.30.28.219
+181.30.28.230
  181.30.28.65
  181.30.30.166
  181.30.61.163
@@ -39663,27 +39713,23 @@
  181.31.249.110
  181.36.42.205
  181.39.135.122
-181.39.22.150
-181.39.48.2
  181.40.122.102
  181.40.122.2
  181.40.73.86
  181.40.84.38
  181.40.84.50
-181.41.0.209
-181.41.217.224
  181.41.241.239
+181.42.29.238
+181.44.129.19
  181.44.6.160
  181.45.71.86
  181.46.136.237
+181.46.33.32
  181.46.69.120
-181.46.9.239
-181.47.103.20
+181.47.15.110
  181.48.105.6
-181.48.111.246
  181.48.120.220
  181.48.134.226
-181.48.134.66
  181.48.139.118
  181.48.147.11
  181.48.15.227
@@ -39706,7 +39752,6 @@
  181.49.154.26
  181.49.236.4
  181.49.254.230
-181.49.254.238
  181.49.38.43
  181.49.42.30
  181.49.43.210
@@ -39716,18 +39761,21 @@
  181.49.96.186
  181.5.198.62
  181.5.203.224
+181.5.220.191
  181.5.224.237
  181.5.227.14
+181.5.233.62
  181.5.235.252
  181.5.255.147
  181.50.251.25
  181.51.212.3
  181.52.121.54
+181.52.172.107
+181.52.220.38
  181.52.237.106
  181.52.249.181
  181.52.249.213
  181.52.85.249
-181.53.12.87
  181.53.251.181
  181.53.251.199
  181.53.255.145
@@ -39741,60 +39789,51 @@
  181.58.39.15
  181.6.1.8
  181.6.101.58
-181.6.102.43
+181.6.102.193
  181.6.11.39
  181.6.154.218
-181.6.161.77
  181.6.179.156
-181.6.193.140
+181.6.195.233
  181.6.20.170
  181.6.202.139
-181.6.22.135
  181.6.24.77
  181.6.242.231
  181.6.25.1
  181.6.251.233
+181.6.35.167
  181.6.37.28
  181.6.41.170
-181.6.44.203
  181.6.56.136
-181.6.62.130
  181.6.77.74
  181.6.81.109
-181.6.82.110
  181.6.91.67
  181.6.93.147
-181.6.94.44
  181.6.96.31
  181.6.97.21
  181.60.79.253
+181.61.219.97
  181.62.161.242
  181.62.245.247
-181.62.53.196
-181.62.53.95
  181.63.248.149
  181.64.160.234
-181.64.193.47
  181.64.193.7
  181.65.138.218
  181.65.142.122
  181.65.142.125
  181.65.155.20
+181.65.81.236
+181.67.185.13
  181.7.197.42
-181.7.199.169
  181.7.202.106
  181.7.228.38
  181.7.230.146
  181.7.241.80
-181.7.245.86
  181.7.254.164
  181.72.201.229
  181.78.8.42
  181.78.8.43
  181.82.234.192
  181.82.236.169
-181.82.236.215
-181.83.232.162
  181.83.233.138
  181.83.235.213
  181.88.176.122
@@ -39802,6 +39841,7 @@
  181.93.137.244
  181.94.221.15
  181.94.226.236
+181.94.227.218
  181.94.244.133
  181.94.244.213
  181.94.89.254
@@ -39809,93 +39849,89 @@
  181.98.48.161
  18141190156-xxyyzzaa.azurewebsites.net
  18190.8wix.com
+182.1.79.181
  182.101.207.11
  182.106.188.249
  182.106.189.57
  182.106.215.108
  182.107.107.224
+182.107.126.185
  182.110.183.193
-182.112.12.158
-182.112.142.175
+182.112.102.19
  182.112.183.150
  182.112.214.72
-182.112.31.220
-182.112.35.182
+182.112.3.86
+182.112.42.25
  182.112.43.119
+182.112.52.151
+182.112.56.226
  182.112.68.126
+182.112.69.15
  182.112.9.196
  182.113.10.66
+182.113.14.117
+182.113.211.133
  182.113.211.248
  182.113.215.240
+182.113.225.151
  182.113.228.239
  182.113.238.135
-182.113.239.128
-182.113.247.209
-182.113.254.228
-182.113.3.20
+182.113.245.62
+182.113.4.189
  182.113.43.246
  182.113.58.37
-182.114.108.100
-182.114.110.74
-182.114.125.133
+182.113.9.134
+182.114.104.244
+182.114.105.197
  182.114.20.91
  182.114.202.76
-182.114.205.89
-182.114.211.137
-182.114.214.148
-182.114.244.185
-182.114.253.238
  182.114.254.27
  182.114.254.79
+182.114.56.245
  182.114.64.33
-182.114.83.56
+182.114.85.119
  182.114.92.204
  182.115.199.21
+182.115.201.145
+182.116.101.187
  182.116.101.36
  182.116.102.170
-182.116.103.90
-182.116.104.152
-182.116.107.103
  182.116.107.123
  182.116.108.16
  182.116.109.173
  182.116.109.252
  182.116.110.177
+182.116.110.31
  182.116.111.131
  182.116.115.46
  182.116.115.78
-182.116.116.46
  182.116.118.172
+182.116.119.236
  182.116.254.117
  182.116.38.160
-182.116.45.28
  182.116.50.51
+182.116.53.56
  182.116.70.143
  182.116.71.231
-182.116.83.133
+182.116.81.135
+182.116.89.242
  182.116.96.194
  182.116.96.69
  182.116.97.133
-182.116.97.191
  182.116.98.31
-182.116.99.110
  182.116.99.66
-182.116.99.90
  182.117.10.20
  182.117.103.176
  182.117.111.133
-182.117.124.124
-182.117.178.194
+182.117.178.22
  182.117.207.206
-182.117.225.172
  182.117.227.55
  182.117.230.78
-182.117.25.228
  182.117.27.218
  182.117.28.104
+182.117.29.228
  182.117.31.16
-182.117.40.92
-182.117.40.94
+182.117.50.94
  182.117.67.215
  182.117.71.196
  182.117.75.235
@@ -39906,98 +39942,100 @@
  182.117.94.187
  182.117.96.14
  182.118.135.231
+182.119.11.131
  182.119.12.199
+182.119.14.247
  182.119.160.254
+182.119.163.38
  182.119.166.151
  182.119.167.42
+182.119.17.103
  182.119.183.18
  182.119.189.90
-182.119.201.119
+182.119.191.227
  182.119.201.234
-182.119.206.152
  182.119.207.145
  182.119.207.5
+182.119.21.12
  182.119.213.5
+182.119.215.196
  182.119.215.94
  182.119.219.132
  182.119.229.80
  182.119.249.46
  182.119.252.235
-182.119.255.80
  182.119.32.89
  182.119.49.113
-182.119.54.196
-182.119.56.229
  182.119.58.142
  182.119.58.36
+182.119.59.114
  182.119.9.51
  182.119.96.41
  182.120.16.115
-182.120.16.16
  182.120.16.209
  182.120.245.222
+182.120.247.5
  182.120.3.148
  182.120.3.221
  182.120.33.50
-182.120.34.206
  182.120.36.28bin.sh
-182.120.37.72
  182.120.40.42
-182.120.48.197
-182.120.60.9
  182.120.86.249
-182.120.86.46
  182.121.117.254
-182.121.153.34
-182.121.156.76
+182.121.118.242
+182.121.119.67
+182.121.124.219
+182.121.126.91
+182.121.152.17
+182.121.155.56
  182.121.157.170
-182.121.18.48
-182.121.203.154
-182.121.203.229
  182.121.21.121
  182.121.219.65
-182.121.247.230
+182.121.249.174
  182.121.25.182
+182.121.250.22
  182.121.251.78
-182.121.40.137
+182.121.48.127
  182.121.49.129
-182.121.49.134
  182.121.53.46
-182.121.78.109
-182.121.80.203
+182.121.70.197
+182.121.72.175
+182.121.82.87
  182.121.84.65
-182.121.93.221
+182.121.91.91
+182.121.98.12
+182.122.137.71
  182.122.160.137
  182.122.208.41
+182.122.216.210
  182.122.249.8
+182.122.25.31
  182.122.25.85
  182.122.251.210
  182.122.251.231bin.sh
  182.122.254.42
+182.122.56.179
  182.122.56.237
+182.123.196.94
+182.123.208.190
  182.123.208.31
  182.123.210.25
  182.123.211.164
-182.123.226.29
  182.123.251.182
-182.123.251.243
  182.124.113.64
  182.124.159.26
-182.124.188.57
-182.124.193.163
+182.124.215.214
  182.124.217.212
+182.124.39.71
  182.124.5.172
+182.124.92.159
  182.126.101.85
-182.126.113.40
  182.126.115.133
-182.126.117.186
  182.126.118.161
-182.126.119.105
-182.126.123.237
-182.126.172.135
+182.126.138.138
  182.126.192.223
  182.126.193.96
-182.126.199.14
+182.126.208.180
  182.126.234.24
  182.126.65.75
  182.126.69.180
@@ -40005,31 +40043,24 @@
  182.126.71.233
  182.126.73.51
  182.126.80.161
-182.126.81.149
-182.126.86.58
-182.126.90.13
-182.126.90.233
-182.126.95.152
-182.127.0.191
+182.126.86.226
+182.127.112.135
+182.127.136.196
+182.127.139.236
  182.127.152.142
  182.127.155.174
  182.127.156.246
  182.127.171.4
-182.127.21.48
-182.127.23.28
  182.127.29.87
-182.127.72.146
+182.127.66.86
  182.127.72.167
  182.127.96.33
-182.127.97.116
  182.139.182.190
  182.142.112.88
  182.142.115.84
  182.142.118.25
  182.145.110.181
-182.148.176.48
  182.150.117.234
-182.150.57.34
  182.150.63.195
  182.151.16.46
  182.151.2.98
@@ -40039,12 +40070,14 @@
  182.151.34.106
  182.151.38.79
  182.151.52.16
+182.155.160.66
  182.156.209.222
  182.156.213.183
  182.156.214.14
  182.16.10.90
  182.16.10.91
  182.16.10.94
+182.16.104.10
  182.16.163.10
  182.16.163.233
  182.16.165.62
@@ -40072,9 +40105,7 @@
  182.160.110.178
  182.160.117.130
  182.160.121.2
-182.160.123.148
  182.160.124.26
-182.160.125.174
  182.160.127.53
  182.160.163.131
  182.160.96.46
@@ -40082,16 +40113,16 @@
  182.161.19.122
  182.161.38.26
  182.162.104.239
-182.162.81.133
  182.163.103.106
  182.165.90.235
  182.172.36.95
  182.176.113.27
-182.176.78.121
+182.176.211.2
+182.176.222.232
+182.179.139.184
  182.18.144.99
  182.18.152.36
  182.18.153.206
-182.180.122.134
  182.180.128.132
  182.180.128.134
  182.180.145.56
@@ -40101,24 +40132,23 @@
  182.180.82.28
  182.180.83.118
  182.180.96.38
-182.182.108.173
-182.183.144.182
-182.183.144.61
  182.183.159.25
+182.183.183.206
  182.183.213.19
  182.184.109.172
  182.184.111.206
+182.185.113.181
  182.185.139.224
  182.185.194.231
  182.185.215.112
-182.186.94.170
+182.185.246.197
+182.187.107.163
  182.187.30.67
  182.189.32.68
  182.189.62.227
  182.19.41.145
  182.19.65.177
  182.19.88.253
-182.191.67.239
  182.191.84.39
  182.201.242.20
  182.208.124.155
@@ -40139,6 +40169,7 @@
  182.23.54.0
  182.23.54.146
  182.23.54.211
+182.23.56.138
  182.23.62.195
  182.23.79.162
  182.23.82.18
@@ -40146,6 +40177,7 @@
  182.232.179.186
  182.232.245.64
  182.232.37.55
+182.237.150.228
  182.239.123.252
  182.239.124.39
  182.239.129.154
@@ -40169,6 +40201,7 @@
  182.253.119.50
  182.253.122.137
  182.253.122.74
+182.253.130.131
  182.253.141.25
  182.253.142.11
  182.253.142.14
@@ -40178,14 +40211,15 @@
  182.253.16.174
  182.253.16.3
  182.253.167.94
+182.253.168.161
  182.253.169.170
  182.253.172.152
  182.253.172.222
-182.253.172.226
-182.253.172.57
  182.253.173.102
  182.253.173.190
+182.253.173.45
  182.253.174.121
+182.253.174.38
  182.253.175.17
  182.253.175.22
  182.253.18.141
@@ -40207,14 +40241,9 @@
  182.253.232.39
  182.253.232.99
  182.253.233.143
-182.253.233.241
  182.253.233.253
-182.253.233.43
-182.253.233.68
-182.253.233.73
-182.253.233.81
+182.253.234.10
  182.253.234.128
-182.253.234.17
  182.253.234.44
  182.253.234.88
  182.253.235.147
@@ -40224,10 +40253,10 @@
  182.253.235.223
  182.253.235.250
  182.253.235.26
+182.253.235.57
  182.253.244.152
  182.253.34.49
  182.253.43.24
-182.253.45.100
  182.253.6.234
  182.253.60.170
  182.253.62.194
@@ -40235,10 +40264,10 @@
  182.253.68.18
  182.253.78.34
  182.253.80.134
+182.253.90.49
  182.253.93.5
  182.254.130.92
  182.254.134.57
-182.254.134.77
  182.254.136.29
  182.254.137.75
  182.254.140.176
@@ -40253,7 +40282,6 @@
  182.254.153.138
  182.254.153.41
  182.254.155.254
-182.254.156.220
  182.254.158.205
  182.254.161.202
  182.254.161.98
@@ -40282,6 +40310,7 @@
  182.254.223.219
  182.254.223.220
  182.254.225.13
+182.254.225.85
  182.254.226.225
  182.254.227.79
  182.254.228.49
@@ -40294,7 +40323,6 @@
  182.254.245.23
  182.254.247.241
  182.254.247.245
-182.34.223.97
  182.38.195.24
  182.42.47.133
  182.43.234.34
@@ -40304,6 +40332,7 @@
  182.48.70.145
  182.48.70.154
  182.48.81.222
+182.48.82.213
  182.48.83.170
  182.48.87.170
  182.48.88.205
@@ -40323,6 +40352,7 @@
  182.50.169.78
  182.50.64.214
  182.52.103.135
+182.52.103.219
  182.52.108.104
  182.52.110.183
  182.52.110.199
@@ -40335,6 +40365,8 @@
  182.52.131.194
  182.52.137.125
  182.52.137.23
+182.52.19.103
+182.52.19.105
  182.52.19.173
  182.52.22.58
  182.52.229.165
@@ -40357,9 +40389,11 @@
  182.52.51.101
  182.52.51.154
  182.52.51.181
+182.52.51.24
  182.52.51.47
  182.52.52.102
  182.52.58.44
+182.52.63.50
  182.52.63.95
  182.52.65.7
  182.52.67.122
@@ -40368,19 +40402,21 @@
  182.52.90.164
  182.52.90.42
  182.53.135.214
+182.53.135.221
  182.53.135.229
  182.53.135.240
  182.53.135.245
  182.53.135.247
+182.53.135.253
  182.53.137.210
  182.53.166.3
+182.53.193.153
  182.53.197.156
  182.53.197.223
  182.53.200.108
  182.53.200.54
  182.53.200.87
  182.53.201.184
-182.53.201.42
  182.53.201.55
  182.53.206.138
  182.53.206.175
@@ -40388,10 +40424,9 @@
  182.53.206.26
  182.53.206.40
  182.53.206.44
-182.53.55.105
-182.53.55.232
  182.53.58.53
  182.53.79.184
+182.53.79.98
  182.53.90.6
  182.53.96.140
  182.53.96.215
@@ -40401,19 +40436,17 @@
  182.54.151.2
  182.54.151.5
  182.54.151.9
-182.54.173.204
+182.54.157.41
  182.54.174.109
  182.54.207.74
  182.55.245.25
+182.56.35.156
  182.57.111.30
+182.57.240.101
  182.58.49.77
-182.59.100.233
-182.59.118.147
-182.59.125.209
-182.59.167.107
  182.59.2.193
-182.59.206.110
  182.59.3.33
+182.59.84.124
  182.61.1.1
  182.61.10.28
  182.61.12.9
@@ -40429,6 +40462,7 @@
  182.61.146.37
  182.61.147.176
  182.61.147.252
+182.61.149.103
  182.61.149.138
  182.61.15.196
  182.61.15.79
@@ -40454,20 +40488,17 @@
  182.61.36.44
  182.61.37.144
  182.61.38.212
-182.61.40.103
  182.61.40.124
  182.61.40.161
  182.61.40.198
  182.61.40.227
  182.61.40.252
  182.61.41.102
-182.61.43.141
  182.61.43.196
  182.61.43.226
  182.61.43.33
  182.61.44.194
  182.61.45.242
-182.61.45.46
  182.61.49.107
  182.61.50.174
  182.61.52.98
@@ -40475,16 +40506,15 @@
  182.61.55.254
  182.64.115.245
  182.64.169.159
-182.64.187.71
  182.64.212.140
  182.64.4.50
  182.65.189.177
+182.68.139.30
+182.68.226.207
  182.68.251.215
-182.68.69.121
  182.70.29.6
  182.70.8.59
-182.71.138.178
-182.71.152.78
+182.71.188.10
  182.71.197.195
  182.71.223.194
  182.71.46.37
@@ -40493,34 +40523,41 @@
  182.71.90.202
  182.72.142.62
  182.72.162.16
+182.72.163.150
  182.72.171.242
+182.72.180.58
+182.72.199.130
  182.72.222.98
  182.72.223.90
  182.72.235.174
  182.72.30.66
  182.72.94.146
+182.73.136.26
  182.73.141.2
  182.73.143.146
  182.73.147.154
  182.73.162.6
+182.73.180.5
  182.73.240.90
+182.73.35.134
  182.73.39.13
  182.73.7.59
+182.73.75.246
  182.73.76.154
  182.73.95.218
+182.74.107.202
  182.74.18.26
+182.74.205.218
  182.74.215.50
  182.74.25.246
-182.74.51.206
+182.74.61.136
  182.74.86.27
  182.75.112.254
  182.75.115.59
  182.75.125.50
-182.75.125.78
  182.75.130.222
  182.75.139.222
  182.75.139.26
-182.75.175.14
  182.75.216.74
  182.75.249.98
  182.75.35.100
@@ -40529,25 +40566,26 @@
  182.76.142.58
  182.76.169.195
  182.76.204.237
-182.76.22.54
+182.76.214.254
+182.76.231.178
  182.76.237.118
  182.76.28.148
-182.76.45.218
-182.77.116.1
-182.77.126.25
  182.77.61.249
  182.78.194.78
+182.84.124.107
  182.84.124.222
  182.84.186.225
-182.84.94.202
-182.87.110.67
  182.87.151.237
+182.89.69.25
  182.90.201.155
  182.92.107.145
  182.92.113.148
  182.92.121.8
  182.92.149.40
  182.92.242.11
+182.92.68.142
+182.92.73.162
+182.92.79.232
  182.92.81.194
  182.92.84.176
  182.93.222.39
@@ -40562,12 +40600,12 @@
  182.93.84.136
  182.93.94.80
  182.93.95.146
-182.96.98.21
  1821456.dg398993.web.hosting-test.net
  182elexusbet.com
  183.0.148.121
-183.0.149.201
-183.100.152.130
+183.100.216.195
+183.100.216.224
+183.100.216.226
  183.100.31.47
  183.101.176.223
  183.101.185.36
@@ -40576,20 +40614,24 @@
  183.103.86.116
  183.104.248.85
  183.105.104.25
-183.105.106.53
  183.106.163.80
+183.108.168.85
  183.108.186.233
  183.108.77.67
  183.109.124.137
  183.109.79.253
  183.109.80.156
  183.11.238.29
+183.11.74.225
  183.110.220.210
  183.111.104.197
+183.111.188.94
  183.111.204.148
  183.111.96.15
  183.111.96.44
-183.128.115.93
+183.111.96.46
+183.114.250.102
+183.129.129.132
  183.129.159.211
  183.129.163.142
  183.129.170.114
@@ -40598,7 +40640,6 @@
  183.131.180.89
  183.131.231.135
  183.131.249.58
-183.131.74.242
  183.131.85.50
  183.132.23.90
  183.134.65.197
@@ -40618,41 +40659,59 @@
  183.136.225.46
  183.136.225.56
  183.136.239.218
+183.141.14.141
  183.146.213.157
  183.146.213.198
  183.147.255.51
  183.15.176.150
+183.15.177.24
  183.15.179.170
-183.15.179.179
  183.15.204.110
-183.15.89.41
  183.15.90.227
-183.150.43.167
  183.154.66.180
  183.154.89.252
  183.156.2.119
-183.157.74.242
-183.158.130.66
  183.158.135.145
  183.158.138.65
-183.158.143.181
  183.158.55.229
-183.16.101.226
+183.160.100.106
+183.160.100.210
+183.160.100.47
+183.160.100.48
+183.160.101.147
  183.160.101.160
+183.160.101.243
+183.161.35.38
  183.162.230.169
  183.162.79.39
-183.165.41.4
+183.165.28.152
+183.165.28.179
+183.165.28.181
+183.165.29.35
+183.165.29.64
+183.165.40.83
+183.165.41.206
+183.165.60.190
+183.165.60.243
  183.165.60.249
-183.166.136.131
+183.165.61.220
+183.165.61.51
  183.166.145.144
  183.166.168.211
-183.166.98.223
-183.166.99.147
-183.166.99.22
-183.166.99.85
+183.166.98.199
+183.166.98.243
+183.166.99.114
+183.166.99.237
+183.17.124.192
  183.17.124.214
+183.17.125.130
  183.17.125.147
+183.17.126.160
+183.17.127.1
+183.17.127.175
  183.17.127.233
+183.17.127.88
+183.17.228.250
  183.171.71.25
  183.178.60.201
  183.181.164.180
@@ -40660,7 +40719,6 @@
  183.181.174.169
  183.181.88.119
  183.182.101.32
-183.182.110.123
  183.182.113.242
  183.182.119.247
  183.186.84.54
@@ -40668,11 +40726,9 @@
  183.187.2.91
  183.188.103.56
  183.188.114.227
-183.188.130.159
  183.188.130.5
  183.188.134.235
  183.188.165.238
-183.188.196.122
  183.188.198.118
  183.188.198.136
  183.188.204.2
@@ -40680,7 +40736,6 @@
  183.188.229.55
  183.188.248.26
  183.188.45.189
-183.188.51.28
  183.188.55.170
  183.188.95.210
  183.190.148.241
@@ -40710,7 +40765,6 @@
  183.197.56.139
  183.197.56.14
  183.197.56.140
-183.197.56.142
  183.197.56.144
  183.197.56.147
  183.197.56.15
@@ -40728,12 +40782,11 @@
  183.197.56.182
  183.197.56.183
  183.197.56.185
-183.197.56.188
  183.197.56.189
  183.197.56.190
  183.197.56.196
  183.197.56.198
-183.197.56.201
+183.197.56.205
  183.197.56.209
  183.197.56.212
  183.197.56.217
@@ -40742,7 +40795,6 @@
  183.197.56.232
  183.197.56.234
  183.197.56.235
-183.197.56.238
  183.197.56.241
  183.197.56.248
  183.197.56.249
@@ -40756,7 +40808,6 @@
  183.197.56.5
  183.197.56.50
  183.197.56.54
-183.197.56.57
  183.197.56.58
  183.197.56.59
  183.197.56.62
@@ -40777,8 +40828,8 @@
  183.197.56.98
  183.197.56.99
  183.199.125.1
+183.199.125.104
  183.199.125.106
-183.199.125.107
  183.199.125.111
  183.199.125.113
  183.199.125.114
@@ -40801,11 +40852,13 @@
  183.199.125.158
  183.199.125.160
  183.199.125.163
+183.199.125.165
  183.199.125.168
  183.199.125.17
  183.199.125.171
  183.199.125.174
  183.199.125.178
+183.199.125.182
  183.199.125.184
  183.199.125.188
  183.199.125.194
@@ -40821,6 +40874,7 @@
  183.199.125.225
  183.199.125.226
  183.199.125.230
+183.199.125.239
  183.199.125.245
  183.199.125.247
  183.199.125.250
@@ -40829,7 +40883,6 @@
  183.199.125.255
  183.199.125.27
  183.199.125.3
-183.199.125.32
  183.199.125.36
  183.199.125.40
  183.199.125.44
@@ -40849,15 +40902,20 @@
  183.199.125.83
  183.199.125.93
  183.199.125.96
+183.199.223.109
  183.203.157.188
  183.203.204.186
  183.207.176.78
  183.213.26.13
  183.214.237.200
+183.220.144.85
  183.220.46.166
  183.221.125.206
  183.224.38.56
  183.224.44.69
+183.230.248.229
+183.230.248.85
+183.230.248.91
  183.230.37.94
  183.230.91.108
  183.232.228.66
@@ -40879,8 +40937,10 @@
  183.242.4.146
  183.246.176.179
  183.246.91.150
+183.251.50.162
  183.251.87.5
  183.253.9.52
+183.33.59.7
  183.4.28.24
  183.4.30.105
  183.4.30.251
@@ -40903,12 +40963,13 @@
  183.62.197.115
  183.62.20.2
  183.62.222.10
-183.62.25.218
  183.62.48.226
  183.62.69.34
  183.63.148.219
  183.63.233.238
  183.64.239.19
+183.66.119.66
+183.7.172.216
  183.7.172.56
  183.7.32.245
  183.77.157.168
@@ -40916,7 +40977,6 @@
  183.77.72.44
  183.78.10.31
  183.78.10.31bin.sh
-183.78.192.211
  183.80.157.166
  183.80.199.151
  183.81.152.82
@@ -40929,11 +40989,13 @@
  183.81.157.217
  183.81.158.105
  183.82.0.15
+183.82.102.66
  183.82.108.241
  183.82.115.221
  183.82.121.34
  183.82.126.97
  183.82.152.79
+183.82.190.69
  183.82.32.153
  183.82.34.162
  183.82.34.246
@@ -40944,12 +41006,14 @@
  183.82.57.214
  183.82.96.76
  183.82.97.25
-183.83.0.230
+183.82.97.45
  183.83.1.9
-183.83.124.36
-183.83.19.157
+183.83.105.181
+183.83.115.75
  183.83.217.190
  183.83.23.83
+183.83.24.228
+183.83.31.3
  183.83.37.175
  183.83.47.210
  183.83.52.200
@@ -40972,17 +41036,17 @@
  183.87.69.233
  183.87.70.210
  183.87.76.17
-183.88.124.245
+183.88.1.253
  183.88.128.164
  183.88.128.227
  183.88.131.130
  183.88.145.70
  183.88.17.157
  183.88.17.76
-183.88.176.167
  183.88.178.119
+183.88.178.15
+183.88.187.140
  183.88.19.70
-183.88.192.171
  183.88.212.141
  183.88.212.247
  183.88.214.143
@@ -40999,13 +41063,15 @@
  183.88.253.14
  183.88.253.18
  183.88.36.127
-183.88.45.221
+183.88.5.7
  183.88.5.98
  183.88.68.177
+183.88.79.114
  183.88.86.137
  183.88.86.241
  183.88.92.144
  183.89.10.228
+183.89.113.110
  183.89.114.146
  183.89.117.214
  183.89.118.125
@@ -41017,16 +41083,17 @@
  183.89.153.84
  183.89.155.159
  183.89.156.144
+183.89.159.20
  183.89.161.57
  183.89.163.151
  183.89.164.169
  183.89.165.187
-183.89.178.143
  183.89.179.225
  183.89.182.173
  183.89.186.9
  183.89.194.145
  183.89.196.77
+183.89.197.137
  183.89.198.135
  183.89.25.38
  183.89.3.216
@@ -41040,9 +41107,9 @@
  183.89.96.157
  183.89.98.148
  183.89.99.130
+183.90.168.106
  183.90.250.15
  183.90.250.38
-183.90.82.248
  183.91.11.21
  183.91.13.3
  183.91.3.63
@@ -41067,57 +41134,47 @@
  183.96.155.93
  183.96.65.145
  183.96.89.113
+183.97.22.14
  183.97.39.5
  183.97.40.9
+183.98.32.66
  183.98.48.163
+183.99.236.232
  1830488.synergyglobal.one
  1834.31cf4fdae.com
  183da2ac-98c9-41cf-9f59-0c377e76b19b.htmlcomponentservice.com
  184.0.113.135
  184.0.114.148
-184.0.119.56
  184.0.121.67
-184.0.123.174
  184.0.123.204
  184.0.128.172
  184.0.131.89
  184.0.134.252
-184.0.134.66
  184.0.209.156
  184.0.213.80
  184.0.215.121
  184.0.72.251
  184.1.156.160
  184.1.208.33
-184.100.128.244
  184.100.135.46
  184.100.149.17
  184.100.149.242
  184.100.197.178
  184.100.20.173
  184.100.219.130
-184.100.220.65
  184.100.227.197
  184.100.239.68
-184.100.34.34
  184.100.40.135
-184.100.41.114
-184.100.41.251
  184.100.49.82
  184.100.56.148
  184.100.58.136
  184.100.64.76
-184.101.119.106
  184.101.164.154
  184.101.170.207
-184.101.203.145
  184.101.23.113
  184.101.244.91
  184.101.252.212
-184.101.55.1
  184.101.58.107
-184.101.64.252
-184.101.74.104
  184.101.84.179
  184.102.100.106
  184.102.100.229
@@ -41127,74 +41184,43 @@
  184.102.106.194
  184.102.107.178
  184.102.107.235
-184.102.110.187
  184.102.114.129
  184.102.118.78
  184.102.121.30
-184.102.122.79
-184.102.125.146
  184.102.125.69
-184.102.129.136
-184.102.133.48
  184.102.158.137
  184.102.176.179
  184.102.176.87
-184.102.180.16
-184.102.181.205
-184.102.183.127
-184.102.183.87
  184.102.184.45
  184.102.193.159
  184.102.195.127
  184.102.195.15
  184.102.195.175
  184.102.197.11
-184.102.199.97
-184.102.204.162
-184.102.204.99
  184.102.206.19
-184.102.208.245
  184.102.208.84
  184.102.211.189
  184.102.211.5
  184.102.213.77
  184.102.216.57
  184.102.32.148
-184.102.32.172
  184.102.32.90
  184.102.33.226
  184.102.33.55
  184.102.34.14
  184.102.37.82
  184.102.39.212
-184.102.40.10
-184.102.41.97
  184.102.42.246
-184.102.67.174
  184.102.70.222
-184.102.70.251
-184.102.71.73
  184.102.72.197
-184.102.76.26
-184.102.78.201
  184.102.78.81
-184.102.79.144
-184.102.85.189
  184.102.97.112
  184.103.139.39
-184.103.146.39
-184.103.152.174
-184.103.156.176
  184.103.158.175
-184.103.158.43
  184.103.164.209
  184.103.195.156
-184.103.202.174
-184.103.213.19
-184.103.22.77
  184.103.224.212
  184.103.24.30
-184.103.255.244
  184.103.32.191
  184.103.36.67
  184.103.53.39
@@ -41207,6 +41233,7 @@
  184.103.75.197
  184.103.9.116
  184.105.133.1
+184.105.133.250
  184.105.134.166
  184.105.146.50
  184.105.162.196
@@ -41215,13 +41242,11 @@
  184.105.242.154
  184.105.70.100
  184.107.80.235
+184.14.144.218
  184.144.204.194
  184.145.167.92
-184.145.207.60
  184.148.38.190
  184.149.19.154
-184.152.235.76
-184.152.38.130
  184.153.135.2
  184.153.247.218
  184.154.109.10
@@ -41230,16 +41255,9 @@
  184.154.94.218
  184.155.36.194
  184.156.182.109
-184.156.98.180
-184.157.16.134
-184.157.17.20
-184.157.19.117
  184.157.218.247
-184.157.22.190
  184.157.24.172
  184.157.24.35
-184.157.25.127
-184.157.25.161
  184.157.28.229
  184.158.11.188
  184.158.17.129
@@ -41253,33 +41271,21 @@
  184.158.250.196
  184.158.32.131
  184.158.33.162
-184.158.35.224
  184.158.36.113
  184.158.36.84
-184.158.37.89
-184.158.38.28
  184.158.39.158
  184.158.40.113
-184.158.40.21
-184.158.41.134
  184.158.42.28
-184.158.44.108
  184.158.49.237
  184.158.50.24
  184.158.51.45
  184.158.52.206
-184.158.52.212
-184.158.52.90
  184.158.53.43
  184.158.6.203
  184.158.66.206
  184.158.70.206
  184.158.73.218
-184.159.225.104
-184.159.225.77
-184.159.227.235
  184.159.229.103
-184.159.229.57
  184.159.230.254
  184.16.68.0
  184.160.203.112
@@ -41305,13 +41311,13 @@
  184.168.46.129
  184.168.46.187
  184.168.46.220
-184.17.79.242
  184.170.145.60
  184.170.212.94
-184.170.241.131
  184.170.242.191
+184.170.248.1
  184.170.249.69
  184.170.251.26
+184.170.69.117
  184.171.208.109
  184.171.250.187
  184.171.250.188
@@ -41320,12 +41326,8 @@
  184.173.190.42
  184.173.222.71
  184.174.70.105
-184.175.40.235
-184.176.58.126
-184.178.172.10
-184.178.172.12
+184.175.55.105
  184.178.172.13
-184.178.172.16
  184.178.172.18
  184.178.172.21
  184.178.172.25
@@ -41333,17 +41335,15 @@
  184.178.172.5
  184.178.172.7
  184.178.172.8
-184.179.216.137
  184.179.216.140
  184.179.216.141
  184.179.216.142
-184.179.216.144
  184.179.216.145
  184.179.216.150
+184.179.216.151
  184.18.211.199
  184.180.129.98
  184.180.181.202
-184.181.217.210
  184.185.2.103
  184.185.2.149
  184.185.2.190
@@ -41354,32 +41354,22 @@
  184.22.234.114
  184.22.25.207
  184.22.57.148
-184.22.7.21
-184.3.110.232
+184.22.87.183
+184.22.97.82
  184.3.125.221
-184.3.143.59
-184.3.147.14
-184.3.147.255
  184.3.162.169
-184.3.164.17
  184.3.166.186
-184.3.169.136
  184.3.170.253
  184.3.173.143
-184.3.176.18
-184.3.189.98
-184.3.190.160
  184.3.195.166
  184.3.208.98
  184.3.216.249
  184.3.230.101
-184.3.24.203
  184.3.245.142
  184.3.250.222
  184.3.28.209
  184.3.39.151
  184.3.73.74
-184.3.76.20
  184.3.83.125
  184.3.91.36
  184.4.154.194
@@ -41389,7 +41379,6 @@
  184.4.208.254
  184.4.216.110
  184.4.216.137
-184.4.38.164
  184.4.42.214
  184.4.58.76
  184.4.77.213
@@ -41410,22 +41399,19 @@
  184.5.244.219
  184.5.250.79
  184.5.46.192
+184.54.157.183
  184.55.177.112
  184.57.184.168
+184.57.39.18
  184.57.66.197
  184.59.224.76
  184.6.10.2
  184.6.15.165
-184.6.17.181
  184.6.186.181
-184.6.187.46
-184.6.190.51
  184.6.214.169
  184.6.23.140
  184.64.190.218
  184.66.129.200
-184.67.105.182
-184.67.123.222
  184.68.152.178
  184.68.18.59
  184.68.66.178
@@ -41433,10 +41419,8 @@
  184.7.171.88
  184.7.178.237
  184.7.182.147
-184.7.182.177
  184.7.184.202
  184.7.185.174
-184.7.244.208
  184.7.55.99
  184.70.15.166
  184.70.244.67
@@ -41454,6 +41438,7 @@
  184.73.32.232
  184.73.70.225
  184.73.9.73
+184.73.90.224
  184.74.135.242
  184.74.150.189
  184.74.240.157
@@ -41461,16 +41446,17 @@
  184.75.211.146
  184.75.211.154
  184.75.221.203
+184.82.106.53
  184.82.107.64
+184.82.111.216
  184.82.128.211
-184.82.140.181
  184.82.140.191
  184.82.141.61
  184.82.141.73
  184.82.143.58
  184.82.146.6
  184.82.192.19
-184.82.236.34
+184.82.231.149
  184.82.29.169
  184.82.33.44
  184.82.92.72
@@ -41481,10 +41467,7 @@
  184.96.128.47
  184.96.176.25
  184.96.179.161
-184.96.189.35
-184.96.197.178
  184.96.215.233
-184.96.241.60
  184.96.245.166
  184.96.248.69
  184.97.106.174
@@ -41495,38 +41478,21 @@
  184.97.204.168
  184.97.208.153
  184.97.229.163
-184.97.235.51
-184.97.236.66
-184.97.237.72
-184.97.32.60
-184.97.4.96
  184.97.48.173
-184.97.5.204
-184.97.63.124
  184.97.65.68
  184.97.84.226
  184.97.91.168
  184.97.97.145
-184.98.147.183
  184.98.149.22
  184.98.229.18
-184.98.231.201
  184.98.244.10
-184.98.249.104
-184.99.125.172
-184.99.131.193
-184.99.139.117
  184.99.147.75
-184.99.148.236
  184.99.150.255
  184.99.154.235
-184.99.154.57
-184.99.157.202
  184.99.157.39
  184.99.159.4
  184.99.163.55
  184.99.165.246
-184.99.177.53
  184.99.180.20
  184.99.83.92
  184249-dot-n-e-w-me-ss-age-po-rt-al.wl.r.appspot.com
@@ -41548,6 +41514,7 @@
  185.10.68.75
  185.10.68.92
  185.10.73.233
+185.100.65.199
  185.100.84.149
  185.100.85.101
  185.100.85.61
@@ -41574,11 +41541,9 @@
  185.101.35.79
  185.101.93.105
  185.103.110.146
-185.103.110.161
  185.103.138.65
  185.103.181.2
  185.103.199.101
-185.103.246.201
  185.103.252.12
  185.103.37.61
  185.103.96.143
@@ -41617,7 +41582,6 @@
  185.104.217.238
  185.104.217.90
  185.104.218.77
-185.104.218.82
  185.104.219.69
  185.104.29.4
  185.104.71.86
@@ -41631,9 +41595,9 @@
  185.106.121.142
  185.106.121.32
  185.106.122.100
+185.106.129.123
  185.106.137.1
  185.106.209.68
-185.106.30.208
  185.106.92.164
  185.106.92.47
  185.106.94.2
@@ -41656,27 +41620,27 @@
  185.107.94.183
  185.107.94.233
  185.107.95.215
-185.108.106.202
+185.108.105.114
  185.108.106.206
  185.108.106.242
+185.108.107.23
  185.108.107.42
-185.108.107.55
+185.108.107.54
+185.108.167.241
  185.108.197.122
  185.108.244.41
  185.109.54.99
  185.11.146.210
-185.11.152.35
-185.11.152.37
  185.11.167.190
  185.11.180.171
  185.11.240.175
  185.110.187.33
  185.110.189.208
-185.110.214.234
  185.110.216.1
  185.110.217.65
  185.110.237.34
-185.110.28.228
+185.110.241.187
+185.110.47.147
  185.110.91.235
  185.111.100.184
  185.111.216.164
@@ -41689,6 +41653,7 @@
  185.112.249.123
  185.112.249.208
  185.112.250.128
+185.112.33.46
  185.113.128.30
  185.113.129.154
  185.113.134.213
@@ -41697,7 +41662,6 @@
  185.114.157.61
  185.114.23.40
  185.114.82.89
-185.115.100.69
  185.115.100.72
  185.116.214.194
  185.116.254.15
@@ -41705,13 +41669,10 @@
  185.116.254.5
  185.116.254.8
  185.117.10.122
-185.117.118.179
-185.117.118.183
  185.117.118.34
  185.117.119.189
  185.117.119.235
  185.117.119.94
-185.117.155.118
  185.117.168.46
  185.117.215.9
  185.117.244.136
@@ -41723,12 +41684,12 @@
  185.118.48.206
  185.118.65.230
  185.118.66.114
-185.119.81.106
  185.119.81.107
  185.119.81.110
  185.12.102.80
  185.12.179.222
  185.12.20.205
+185.12.222.138
  185.12.45.114
  185.12.45.115
  185.12.45.116
@@ -41736,10 +41697,9 @@
  185.12.45.118
  185.12.94.236
  185.120.13.159
+185.120.213.250
  185.120.38.103
  185.121.2.31
-185.121.26.134
-185.121.26.160
  185.121.69.16
  185.121.69.40
  185.121.69.41
@@ -41747,8 +41707,10 @@
  185.122.104.171
  185.122.144.98
  185.122.170.102
+185.122.170.108
  185.122.170.127
  185.122.170.166
+185.122.170.188
  185.122.170.246
  185.122.170.80
  185.122.44.218
@@ -41756,22 +41718,20 @@
  185.124.112.133
  185.124.183.102
  185.125.207.72
+185.125.226.9
+185.125.227.9
  185.125.231.156
-185.125.33.228
  185.126.131.37
  185.126.178.243
  185.126.183.127
-185.126.218.30
  185.126.218.9
  185.127.216.205
  185.127.255.92
-185.127.27.51
  185.128.126.18
  185.128.245.68
  185.128.38.100
  185.128.38.146
  185.128.43.174
-185.129.0.170
  185.129.1.165
  185.129.148.167
  185.129.248.187
@@ -41782,7 +41742,6 @@
  185.13.39.199
  185.130.144.191
  185.130.145.121
-185.130.184.200
  185.130.184.202
  185.130.184.213
  185.130.184.220
@@ -41806,8 +41765,8 @@
  185.130.5.247
  185.130.6.49
  185.130.7.22
+185.131.62.250
  185.131.62.51
-185.131.63.83
  185.132.125.190
  185.132.132.154
  185.132.133.160
@@ -41833,14 +41792,12 @@
  185.132.53.143
  185.132.53.144
  185.132.53.147
-185.132.53.156
  185.132.53.159
  185.132.53.161
  185.132.53.166
  185.132.53.191
  185.132.53.194
  185.132.53.2
-185.132.53.208
  185.132.53.222
  185.132.53.229
  185.132.53.233
@@ -41864,7 +41821,6 @@
  185.134.28.4
  185.134.81.11
  185.134.81.16
-185.134.96.34
  185.134.99.238
  185.135.10.154
  185.135.11.179
@@ -41902,7 +41858,6 @@
  185.14.187.39
  185.14.187.86
  185.14.192.14
-185.14.192.67
  185.14.192.96
  185.14.194.101
  185.14.194.194
@@ -41926,15 +41881,11 @@
  185.141.10.67
  185.141.105.60
  185.141.11.202
-185.141.171.11
  185.141.24.195
  185.141.24.198
  185.141.25.150
  185.141.27.112
  185.141.27.116
-185.141.58.210
-185.141.58.235
-185.141.59.128
  185.141.60.33
  185.141.60.36
  185.141.61.189
@@ -41948,14 +41899,13 @@
  185.142.239.16
  185.142.239.42
  185.142.239.49
-185.142.24.117
  185.142.43.132
  185.142.67.23
  185.143.145.113
  185.143.146.57
  185.143.223.136
  185.143.228.214
-185.143.231.197
+185.143.228.245
  185.143.231.215
  185.144.78.40
  185.144.82.236
@@ -41974,20 +41924,21 @@
  185.146.113.157
  185.146.159.217
  185.147.160.246
-185.147.213.115
  185.147.213.127
  185.147.213.140
  185.147.213.145
  185.147.213.157
+185.147.213.176
  185.147.213.194
  185.147.213.55
  185.147.213.73
  185.147.214.100
  185.147.214.117
  185.147.214.130
-185.147.214.147
+185.147.214.148
  185.147.214.177
  185.147.214.43
+185.147.214.50
  185.147.214.70
  185.147.214.94
  185.147.214.99
@@ -41996,12 +41947,12 @@
  185.148.147.47
  185.148.3.227
  185.148.44.65
-185.148.84.48
  185.15.92.18
  185.150.162.111
  185.150.8.157
  185.151.151.190
  185.151.204.9
+185.151.21.166
  185.151.242.196
  185.151.243.250
  185.151.247.94
@@ -42013,7 +41964,7 @@
  185.153.196.209
  185.153.196.230
  185.153.196.45
-185.153.197.37
+185.153.197.101
  185.153.198.229
  185.153.198.231
  185.153.198.234
@@ -42021,13 +41972,11 @@
  185.154.131.4
  185.154.15.87
  185.154.159.164
-185.154.16.73
  185.154.16.92
  185.154.2.3
  185.154.52.140
  185.154.52.207
  185.154.53.147
-185.155.235.235
  185.155.33.1
  185.155.33.209
  185.155.34.129
@@ -42036,11 +41985,12 @@
  185.156.173.116
  185.156.214.34
  185.156.35.156
+185.156.73.67
  185.156.74.65
+185.157.221.191
  185.157.79.3
  185.157.81.54
  185.158.114.106
-185.158.114.14
  185.158.114.184
  185.158.114.235
  185.158.115.162
@@ -42057,19 +42007,21 @@
  185.159.80.116
  185.159.80.204
  185.159.81.162
+185.16.124.11
  185.16.204.58
  185.16.32.203
  185.16.32.66
  185.16.38.10
  185.16.38.123
-185.16.38.153
-185.160.226.138
+185.16.38.89
  185.161.112.244
  185.161.208.127
  185.161.208.97
  185.161.209.119
+185.161.210.13
  185.161.210.92
  185.161.211.134
+185.161.211.58
  185.161.211.59
  185.161.224.226
  185.161.244.75
@@ -42082,6 +42034,7 @@
  185.161.71.209
  185.161.71.236
  185.161.71.24
+185.161.71.28
  185.161.71.34
  185.161.71.44
  185.162.128.143
@@ -42098,7 +42051,6 @@
  185.164.30.78
  185.164.56.180
  185.164.56.218
-185.164.56.252
  185.164.56.67
  185.164.57.202
  185.164.57.213
@@ -42119,7 +42071,6 @@
  185.165.169.83
  185.165.175.52
  185.165.190.104
-185.165.190.108
  185.165.190.34
  185.165.242.32
  185.165.243.76
@@ -42129,7 +42080,6 @@
  185.165.29.84
  185.165.31.12
  185.165.88.222
-185.165.91.169
  185.166.239.49
  185.166.86.13
  185.166.87.198
@@ -42140,9 +42090,6 @@
  185.167.95.149
  185.167.95.176
  185.167.95.178
-185.167.96.145
-185.167.97.31
-185.169.16.152
  185.169.17.254
  185.169.181.10
  185.169.181.12
@@ -42150,7 +42097,6 @@
  185.169.181.24
  185.169.181.28
  185.169.243.125
-185.169.255.10
  185.17.105.32
  185.17.121.212
  185.17.132.15
@@ -42246,7 +42192,6 @@
  185.174.100.242
  185.174.100.60
  185.174.102.15
-185.174.111.219
  185.174.195.130
  185.174.195.131
  185.174.195.133
@@ -42287,7 +42232,6 @@
  185.177.59.184
  185.178.208.151
  185.178.220.126
-185.18.206.156
  185.18.212.227
  185.18.245.66
  185.18.6.65
@@ -42295,20 +42239,21 @@
  185.180.221.201
  185.180.221.7
  185.181.10.234
-185.181.102.18
  185.181.176.246
  185.181.244.153
  185.181.245.67
  185.181.246.101
+185.181.247.110
  185.181.41.134
  185.181.61.140
+185.181.61.31
+185.181.61.39
  185.181.9.76
  185.182.56.123
  185.183.12.25
  185.183.16.47
  185.183.195.23
  185.183.34.223
-185.183.94.203
  185.183.95.105
  185.183.96.77
  185.183.97.164
@@ -42317,7 +42262,7 @@
  185.183.98.244
  185.183.99.214
  185.183.99.215
-185.184.245.73
+185.184.12.132
  185.184.25.235
  185.185.170.27
  185.185.26.141
@@ -42327,7 +42272,7 @@
  185.186.143.53
  185.186.143.62
  185.186.143.95
-185.186.208.163
+185.186.208.162
  185.186.246.141
  185.186.69.114
  185.186.71.56
@@ -42377,7 +42322,6 @@
  185.189.211.70
  185.189.243.32
  185.189.252.121
-185.189.52.86
  185.19.176.237
  185.19.24.111
  185.19.28.195
@@ -42386,14 +42330,14 @@
  185.19.31.6
  185.190.165.83
  185.190.42.200
+185.191.105.97
  185.191.107.107
  185.191.124.143
  185.191.124.150
  185.191.124.151
  185.191.124.152
  185.191.124.153
-185.191.171.34
-185.191.179.39
+185.191.166.81
  185.191.204.3
  185.191.215.99
  185.191.32.210
@@ -42407,19 +42351,17 @@
  185.193.233.248
  185.193.70.71
  185.193.9.30
+185.194.143.172
  185.194.25.23
  185.194.25.77
  185.194.49.132
-185.194.93.130
-185.195.106.244
  185.195.129.164
  185.195.129.243
-185.195.56.19
+185.195.18.107
  185.196.2.251
  185.196.8.229
  185.197.160.160
  185.197.241.45
-185.197.241.94
  185.197.33.254
  185.198.184.14
  185.198.188.48
@@ -42431,8 +42373,6 @@
  185.198.58.47
  185.199.197.148
  185.199.224.233
-185.199.87.243
-185.2.102.126
  185.2.140.155
  185.2.154.15
  185.2.4.105
@@ -42454,9 +42394,12 @@
  185.20.187.20
  185.20.187.23
  185.20.215.136
+185.20.44.244
  185.20.90.50
  185.200.116.185
+185.200.176.137
  185.200.176.63
+185.200.248.241
  185.200.36.113
  185.200.36.91
  185.200.77.184
@@ -42469,7 +42412,6 @@
  185.202.172.246
  185.202.174.84
  185.202.174.91
-185.202.3.44
  185.203.117.232
  185.203.117.254
  185.203.119.55
@@ -42477,12 +42419,8 @@
  185.203.243.88
  185.204.0.87
  185.204.1.74
-185.204.183.250
  185.204.56.34
  185.205.108.206
-185.205.140.46
-185.205.194.144
-185.205.194.47
  185.205.209.166
  185.205.209.205
  185.205.209.241
@@ -42499,7 +42437,6 @@
  185.206.224.213
  185.206.224.221
  185.206.224.232
-185.206.225.228
  185.206.91.42
  185.206.93.87
  185.207.106.34
@@ -42517,7 +42454,6 @@
  185.207.205.130
  185.207.205.134
  185.207.206.35
-185.207.96.210
  185.208.100.49
  185.208.100.72
  185.208.211.67
@@ -42539,7 +42475,6 @@
  185.210.144.80
  185.210.217.10
  185.210.217.243
-185.210.217.252
  185.210.217.56
  185.210.217.62
  185.210.217.9
@@ -42561,17 +42496,15 @@
  185.212.169.187
  185.212.201.26
  185.212.47.150
-185.213.110.65
-185.213.144.24
  185.213.155.163
  185.213.155.169
  185.214.165.113
  185.214.187.38
  185.215.113.205
  185.215.113.207
+185.215.113.23
  185.215.113.47
  185.215.113.48
-185.215.113.77
  185.215.150.204
  185.215.150.209
  185.215.227.107
@@ -42585,12 +42518,12 @@
  185.216.179.32
  185.216.179.60
  185.216.179.80
-185.216.179.82
  185.216.215.13
  185.216.27.185
  185.216.32.130
  185.216.33.137
  185.216.34.233
+185.217.1.114
  185.217.1.246
  185.217.1.30
  185.217.170.67
@@ -42746,7 +42679,6 @@
  185.220.70.168
  185.221.135.98
  185.221.201.34
-185.221.237.144
  185.222.202.104
  185.222.202.12
  185.222.202.133
@@ -42759,7 +42691,6 @@
  185.222.57.183
  185.222.57.251
  185.222.58.100
-185.222.94.52
  185.223.234.58
  185.223.28.89
  185.223.29.137
@@ -42770,8 +42701,8 @@
  185.224.138.48
  185.224.171.130
  185.224.80.108
+185.225.136.209
  185.225.136.40
-185.225.137.174
  185.225.137.206
  185.225.139.7
  185.225.16.146
@@ -42781,11 +42712,11 @@
  185.225.208.25
  185.225.208.36
  185.225.208.38
+185.225.38.226
  185.226.113.180
  185.226.145.55
  185.226.196.211
  185.226.90.141
-185.226.93.251
  185.227.109.30
  185.227.111.133
  185.227.153.228
@@ -42794,12 +42725,12 @@
  185.228.133.6
  185.228.137.238
  185.228.235.25
+185.23.128.180
  185.23.151.171
  185.23.200.56
  185.230.125.36
  185.230.125.40
  185.230.160.252
-185.230.4.220
  185.231.155.153
  185.232.182.218
  185.232.21.115
@@ -42813,6 +42744,7 @@
  185.232.65.171
  185.232.68.229
  185.232.70.140
+185.232.70.226
  185.232.71.197
  185.233.100.23
  185.233.104.69
@@ -42864,13 +42796,16 @@
  185.234.218.50
  185.234.218.86
  185.234.72.64
+185.235.165.134
+185.235.165.176
+185.235.165.178
  185.235.165.188
-185.235.165.51
+185.235.165.192
+185.235.165.200
  185.235.42.232
  185.235.42.72
  185.235.42.78
-185.236.11.6
-185.236.201.215
+185.236.11.8
  185.236.202.151
  185.236.202.168
  185.236.202.170
@@ -42881,24 +42816,22 @@
  185.236.203.49
  185.236.232.118
  185.236.232.122
-185.236.39.108
  185.236.39.131
  185.236.39.151
  185.236.39.159
  185.236.39.166
-185.236.39.194
+185.236.42.23
  185.236.77.144
  185.236.77.195
  185.236.77.62
  185.236.77.8
  185.236.77.9
  185.236.78.112
-185.237.137.29
  185.237.179.99
-185.237.85.59
  185.238.128.119
  185.238.128.48
  185.238.129.113
+185.238.131.19
  185.238.29.11
  185.239.104.112
  185.239.106.97
@@ -42906,6 +42839,7 @@
  185.239.226.19
  185.239.227.63
  185.239.242.104
+185.239.242.105
  185.239.242.107
  185.239.242.108
  185.239.242.158
@@ -42916,32 +42850,29 @@
  185.239.242.180
  185.239.242.195
  185.239.242.197
+185.239.242.211
  185.239.242.223
  185.239.242.241
  185.239.242.247
  185.239.242.249
  185.239.242.251
-185.239.242.63
  185.239.242.79
  185.239.242.86
+185.239.242.87
  185.239.242.92
-185.239.42.52
  185.239.68.18
  185.239.70.31
  185.24.233.209
-185.24.233.21
  185.24.233.33
  185.24.233.48
  185.24.234.230
  185.24.235.206
  185.24.237.130
  185.24.92.236
-185.240.64.181
  185.241.100.1
  185.241.101.5
  185.241.102.1
  185.241.103.1
-185.241.174.33
  185.241.53.116
  185.242.104.197
  185.242.104.78
@@ -42958,7 +42889,8 @@
  185.242.217.66
  185.242.250.67
  185.242.5.120
-185.242.7.11
+185.242.5.178
+185.242.6.4
  185.243.112.207
  185.243.113.110
  185.243.113.221
@@ -42972,7 +42904,6 @@
  185.244.150.165
  185.244.150.223
  185.244.150.241
-185.244.151.165
  185.244.151.83
  185.244.192.119
  185.244.194.174
@@ -43003,23 +42934,17 @@
  185.244.41.10
  185.244.41.12
  185.244.41.14
-185.244.41.32
  185.244.41.33
-185.244.41.34
-185.244.41.35
-185.244.41.36
-185.244.41.40
  185.244.41.42
  185.244.41.43
  185.244.41.44
-185.244.41.46
  185.244.41.7
  185.244.41.9
  185.245.2.168
  185.245.84.153
+185.245.84.22
  185.245.84.48
  185.245.84.56
-185.245.84.58
  185.245.85.20
  185.245.85.23
  185.245.85.25
@@ -43029,8 +42954,9 @@
  185.245.85.44
  185.245.85.46
  185.246.116.155
+185.246.208.131
  185.246.210.17
-185.246.39.125
+185.246.210.6
  185.246.65.34
  185.247.116.43
  185.247.143.59
@@ -43046,14 +42972,12 @@
  185.248.160.65
  185.249.198.100
  185.249.199.106
+185.249.89.146
  185.25.119.29
  185.25.148.240
  185.25.151.159
-185.25.204.241
  185.25.224.202
-185.25.253.5
  185.25.48.114
-185.25.48.149
  185.25.48.184
  185.25.48.215
  185.25.48.7
@@ -43064,19 +42988,15 @@
  185.25.51.155
  185.25.51.5
  185.25.51.72
-185.250.106.178
  185.250.206.56
  185.250.207.56
-185.250.39.120
-185.250.39.142
-185.250.39.16
  185.250.39.186
  185.250.39.77
  185.250.44.118
  185.250.46.108
  185.250.46.134
-185.250.46.143
  185.250.47.66
+185.250.61.42
  185.251.161.54
  185.251.249.118
  185.251.39.230
@@ -43086,19 +43006,18 @@
  185.252.77.220
  185.253.160.132
  185.253.160.139
+185.253.162.12
  185.253.162.134
  185.253.162.137
  185.253.162.143
  185.253.162.8
  185.253.163.134
  185.253.219.160
-185.253.219.185
  185.253.74.206
  185.253.97.246
  185.253.98.19
  185.254.141.80
  185.254.44.102
-185.254.92.135
  185.255.132.68
  185.255.132.77
  185.255.135.33
@@ -43109,7 +43028,6 @@
  185.255.47.27
  185.255.47.50
  185.26.179.237
-185.26.181.241
  185.26.197.148
  185.26.218.158
  185.26.219.34
@@ -43179,7 +43097,6 @@
  185.35.67.109
  185.35.78.77
  185.36.157.30
-185.36.163.5
  185.36.189.6
  185.36.189.8
  185.36.191.0
@@ -43194,7 +43111,6 @@
  185.38.111.5
  185.38.14.171
  185.38.14.215
-185.38.150.96
  185.38.175.71
  185.38.175.72
  185.38.227.41
@@ -43273,12 +43189,14 @@
  185.5.55.45
  185.5.55.62
  185.50.25.12
-185.50.250.175
+185.50.25.38
  185.50.250.193
  185.51.134.199
  185.51.246.114
  185.51.246.4
  185.51.247.135
+185.51.60.148
+185.51.61.244
  185.51.92.103
  185.51.92.108
  185.51.92.84
@@ -43288,6 +43206,7 @@
  185.53.140.60
  185.53.143.118
  185.53.152.189
+185.53.154.229
  185.53.156.174
  185.53.168.96
  185.53.173.64
@@ -43296,10 +43215,12 @@
  185.53.88.6
  185.53.90.8
  185.54.179.131
+185.55.1.182
  185.55.40.78
  185.56.136.106
  185.56.153.236
  185.56.171.94
+185.56.209.114
  185.56.80.65
  185.56.81.8
  185.56.82.14
@@ -43312,7 +43233,7 @@
  185.59.139.99
  185.59.223.86
  185.59.244.16
-185.6.51.98
+185.59.246.211
  185.60.135.103
  185.61.137.165
  185.61.148.69
@@ -43331,8 +43252,10 @@
  185.61.92.228
  185.61.94.65
  185.61.94.70
+185.62.103.21
  185.62.136.25
  185.62.136.26
+185.62.151.71
  185.62.188.204
  185.62.188.26
  185.62.188.4
@@ -43341,6 +43264,7 @@
  185.62.190.112
  185.62.190.156
  185.62.190.55
+185.63.188.200
  185.63.191.226
  185.63.252.55
  185.63.253.201
@@ -43351,9 +43275,12 @@
  185.64.104.227
  185.64.104.229
  185.64.104.234
+185.64.106.226
  185.64.116.15
  185.64.18.25
  185.64.208.177
+185.64.210.88
+185.64.221.7
  185.64.238.229
  185.64.51.5
  185.65.132.100
@@ -43369,17 +43296,21 @@
  185.66.143.190
  185.66.180.33
  185.66.228.149
+185.66.233.61
  185.66.56.2
  185.66.57.104
  185.66.57.106
  185.66.57.109
+185.66.57.110
  185.66.57.113
  185.66.57.115
  185.66.57.118
  185.66.57.121
+185.66.57.124
+185.66.57.129
  185.66.57.139
  185.66.57.143
-185.66.57.147
+185.66.57.146
  185.66.57.152
  185.66.57.154
  185.66.57.156
@@ -43393,6 +43324,7 @@
  185.66.57.180
  185.66.57.182
  185.66.57.186
+185.66.57.191
  185.66.57.196
  185.66.58.100
  185.66.58.103
@@ -43403,7 +43335,6 @@
  185.66.58.117
  185.66.58.120
  185.66.58.122
-185.66.58.126
  185.66.58.128
  185.66.58.132
  185.66.58.140
@@ -43411,6 +43342,7 @@
  185.66.58.145
  185.66.58.148
  185.66.58.150
+185.66.58.152
  185.66.58.161
  185.66.58.162
  185.66.58.164
@@ -43418,10 +43350,10 @@
  185.66.58.168
  185.66.58.170
  185.66.58.181
+185.66.58.185
  185.66.58.189
  185.66.58.195
-185.66.59.192
-185.66.59.198
+185.66.59.193
  185.66.59.200
  185.66.59.203
  185.66.59.204
@@ -43434,11 +43366,10 @@
  185.66.59.225
  185.66.59.228
  185.66.59.230
-185.66.59.232
  185.66.59.234
  185.66.59.236
  185.66.59.254
-185.66.59.4
+185.66.59.5
  185.67.101.35
  185.67.45.160
  185.68.93.27
@@ -43454,8 +43385,6 @@
  185.70.184.80
  185.70.185.34
  185.70.185.56
-185.70.196.27
-185.70.52.136
  185.70.54.228
  185.73.235.114
  185.74.4.17
@@ -43468,6 +43397,8 @@
  185.77.129.163
  185.77.129.165
  185.77.149.213
+185.77.221.17
+185.77.221.234
  185.77.225.144
  185.77.248.12
  185.77.248.4
@@ -43492,13 +43423,11 @@
  185.8.50.245
  185.80.128.130
  185.80.128.200
-185.80.129.68
  185.80.130.37
  185.80.172.199
  185.80.21.93
  185.80.219.132
  185.80.222.96
-185.80.32.194
  185.80.53.147
  185.81.106.52
  185.81.157.102
@@ -43506,6 +43435,7 @@
  185.81.157.12
  185.81.157.121
  185.81.157.136
+185.81.157.14
  185.81.157.142
  185.81.157.167
  185.81.157.189
@@ -43555,12 +43485,12 @@
  185.86.151.146
  185.86.151.152
  185.86.167.46
+185.86.231.10
  185.86.4.132
-185.87.121.196
-185.87.121.83
  185.87.123.170
  185.87.123.34
  185.87.48.123
+185.87.49.231
  185.87.51.159
  185.87.70.237
  185.88.196.187
@@ -43609,10 +43539,11 @@
  185.88.36.97
  185.88.36.98
  185.88.36.99
+185.88.37.188
+185.88.37.242
  185.89.0.22
  185.89.0.237
  185.89.101.59
-185.89.101.98
  185.89.158.126
  185.89.159.178
  185.89.161.157bin.sh
@@ -43623,13 +43554,13 @@
  185.91.165.87
  185.91.166.37
  185.91.252.109
-185.92.151.223
  185.92.220.7
  185.92.73.100
  185.92.73.125
  185.92.73.98
  185.92.73.99
  185.93.182.138
+185.94.172.84
  185.94.191.100
  185.94.191.18
  185.94.191.94
@@ -43662,14 +43593,16 @@
  185.95.157.191
  185.95.157.27
  185.95.157.63
-185.95.159.119
+185.95.159.175
+185.95.159.198
  185.95.159.20
+185.95.159.205
+185.95.159.211
  185.95.159.234
  185.95.159.253
  185.95.159.44
  185.95.2.100
  185.95.219.53
-185.95.55.8
  185.96.162.105
  185.96.162.126
  185.96.162.141
@@ -43681,7 +43614,7 @@
  185.98.1.60
  185.98.128.90
  185.98.26.21
-185.99.212.229
+185.99.3.131
  185.99.3.134
  185.99.3.135
  185.99.3.136
@@ -43706,7 +43639,6 @@
  186.10.127.170
  186.10.231.10
  186.10.245.152
-186.10.33.105
  186.10.59.64
  186.10.80.122
  186.10.82.22
@@ -43721,11 +43653,12 @@
  186.103.215.118
  186.103.220.234
  186.109.81.112
+186.109.88.187
+186.11.46.49
  186.113.21.156
-186.119.105.58
+186.116.69.72
  186.119.116.226
  186.119.122.11
-186.12.56.130
  186.121.204.10
  186.121.206.237
  186.121.206.241
@@ -43733,28 +43666,21 @@
  186.122.148.9
  186.122.149.191
  186.122.150.31
-186.122.252.222
  186.124.194.95
  186.125.171.245
+186.125.59.12
  186.125.59.8
  186.126.10.73
-186.126.100.227
-186.126.101.3
-186.126.105.147
  186.126.105.86
  186.126.108.150
-186.126.108.169
  186.126.108.232
  186.126.111.248
  186.126.129.105
  186.126.130.126
  186.126.130.147
-186.126.133.204
  186.126.139.125
  186.126.141.158
-186.126.142.115
  186.126.144.221
-186.126.149.26
  186.126.151.62
  186.126.160.7
  186.126.162.126
@@ -43763,38 +43689,27 @@
  186.126.169.47
  186.126.174.67
  186.126.177.80
-186.126.178.169
-186.126.182.114
  186.126.19.77
-186.126.200.229
-186.126.207.77
-186.126.209.41
-186.126.210.219
  186.126.219.219
-186.126.219.58
-186.126.232.103
  186.126.232.70
  186.126.35.37
  186.126.41.94
  186.126.48.252
  186.126.59.141
-186.126.65.93
  186.126.82.62
  186.126.93.16
  186.126.94.48
  186.126.94.61
  186.126.96.77
-186.129.92.176
-186.130.219.240
  186.136.45.239
+186.137.197.124
  186.137.79.39
  186.138.186.74
  186.138.67.81
-186.144.118.18
+186.14.250.169
  186.145.120.68
  186.145.239.222
  186.145.254.158
-186.146.0.102
  186.146.1.186
  186.146.2.111
  186.146.229.172
@@ -43804,20 +43719,17 @@
  186.147.235.6
  186.147.237.152
  186.147.237.51
+186.147.245.81
  186.147.28.106
  186.147.35.76
  186.148.162.100
  186.148.170.104
-186.148.171.70
  186.148.172.19
-186.148.184.134
  186.148.190.78
-186.148.191.236
  186.149.143.2
  186.149.243.229
  186.15.116.27
  186.15.152.87
-186.15.156.121
  186.15.233.218
  186.15.25.50
  186.15.49.12
@@ -43826,39 +43738,38 @@
  186.151.122.187
  186.151.160.174
  186.151.57.137
+186.153.220.174
+186.153.221.23
  186.154.197.178
  186.154.200.42
  186.154.241.229
+186.155.18.29
  186.155.19.14
  186.155.215.238
  186.155.226.43
  186.156.79.6
+186.157.136.175
  186.159.1.217
  186.159.1.58
-186.159.115.66
  186.159.2.153
  186.159.2.241
  186.159.2.57
-186.159.243.253
  186.159.246.121
  186.159.3.193
  186.159.3.41
  186.16.209.222
  186.16.210.34
-186.167.248.78
  186.167.33.244
  186.177.141.223
  186.177.165.196
  186.177.174.163
-186.179.100.118
-186.179.100.134
-186.179.100.185
-186.179.100.20
+186.179.100.105
+186.179.100.176
+186.179.100.214
  186.179.100.22
  186.179.100.229
-186.179.100.37
+186.179.100.23
  186.179.103.118
-186.179.106.228
  186.179.106.36
  186.179.18.145
  186.179.18.192
@@ -43868,13 +43779,14 @@
  186.179.18.54
  186.179.18.75
  186.179.243.77
-186.179.40.34
  186.179.40.9
  186.179.42.11
  186.179.42.177
  186.179.42.227
+186.179.42.238
  186.179.42.249
  186.179.42.63
+186.179.42.81
  186.179.42.82
  186.179.42.90
  186.179.43.167
@@ -43886,6 +43798,7 @@
  186.18.224.149
  186.183.184.218
  186.183.199.203
+186.188.175.72
  186.189.193.207
  186.189.238.44
  186.192.17.242
@@ -43893,7 +43806,6 @@
  186.192.253.71
  186.192.254.10
  186.192.98.250
-186.193.117.9
  186.193.140.177
  186.193.143.18
  186.193.181.215
@@ -43912,12 +43824,13 @@
  186.193.8.118
  186.193.8.121
  186.193.8.122
+186.193.8.124
  186.193.8.126
-186.194.225.131
-186.194.240.46
-186.194.25.23
+186.194.213.254
+186.195.108.66
  186.195.90.16
  186.2.161.231
+186.20.208.239
  186.200.205.170
  186.200.68.34
  186.201.43.66
@@ -43926,6 +43839,7 @@
  186.206.129.160
  186.206.129.189
  186.206.157.14
+186.206.255.173
  186.207.131.216
  186.207.189.33
  186.208.106.62
@@ -43945,6 +43859,7 @@
  186.209.67.23
  186.209.69.141
  186.210.157.174
+186.210.241.69
  186.211.105.202
  186.211.106.227
  186.211.110.178
@@ -43960,13 +43875,14 @@
  186.211.6.137
  186.211.8.1
  186.213.111.186
+186.213.114.137
  186.213.24.136
  186.214.134.249
  186.215.100.50
  186.215.199.65
  186.215.202.34
-186.216.174.61
  186.216.81.21
+186.219.137.181
  186.219.210.86
  186.219.211.6
  186.219.211.9
@@ -43979,9 +43895,9 @@
  186.219.96.193
  186.219.96.225
  186.219.96.47
-186.22.238.205
+186.22.36.45
  186.220.212.101
-186.220.9.191
+186.223.165.219
  186.224.225.98
  186.224.238.32
  186.224.240.53
@@ -44008,12 +43924,11 @@
  186.225.98.234
  186.226.162.249
  186.226.167.12
-186.226.169.223
-186.226.170.47
+186.226.167.208
  186.226.171.94
  186.226.172.1
  186.226.172.165
-186.226.175.129
+186.226.172.223
  186.226.183.170
  186.226.37.125
  186.227.148.107
@@ -44021,25 +43936,28 @@
  186.227.55.102
  186.227.55.78
  186.228.147.58
+186.23.19.160
  186.23.211.154
  186.230.39.13
  186.232.119.58
+186.232.128.128
  186.232.15.9
  186.232.161.234
  186.232.200.51
  186.232.48.98
  186.232.51.25
-186.233.17.196
  186.233.176.26
  186.233.98.146
  186.233.98.173
  186.234.249.196
  186.234.80.193
+186.235.132.2
  186.235.184.194
  186.235.184.9
  186.235.53.196
  186.235.54.10
  186.236.110.30
+186.236.97.239
  186.237.131.122
  186.237.161.142
  186.237.161.50
@@ -44077,11 +43995,13 @@
  186.249.83.86
  186.250.20.13
  186.250.202.201
+186.250.244.138
  186.250.52.226
  186.250.53.118
  186.250.53.145
  186.250.55.5
  186.250.56.135
+186.251.162.158
  186.251.197.84
  186.251.208.121
  186.251.208.139
@@ -44121,21 +44041,19 @@
  186.251.255.221
  186.251.255.225
  186.251.255.229
-186.251.255.237
+186.251.255.233
  186.251.255.245
-186.251.255.249
  186.251.255.25
+186.251.255.29
  186.251.255.33
  186.251.255.41
-186.251.255.49
  186.251.255.53
  186.251.255.61
-186.251.255.65
  186.251.255.73
  186.251.255.77
  186.251.255.81
+186.251.255.93
  186.251.60.254
-186.251.93.58
  186.26.124.170
  186.28.125.169
  186.28.136.135
@@ -44162,97 +44080,59 @@
  186.31.40.183
  186.32.212.112
  186.32.90.204
-186.33.104.111
  186.33.104.112
-186.33.104.114
-186.33.104.120
-186.33.104.125
-186.33.104.131
  186.33.104.134
+186.33.104.136
  186.33.104.137
  186.33.104.138
-186.33.104.139
-186.33.104.14
-186.33.104.140
-186.33.104.146
-186.33.104.149
-186.33.104.166
-186.33.104.169
+186.33.104.168
  186.33.104.17
-186.33.104.171
-186.33.104.177
+186.33.104.176
  186.33.104.183
-186.33.104.189
-186.33.104.199
-186.33.104.201
-186.33.104.207
-186.33.104.209
  186.33.104.210
  186.33.104.23
-186.33.104.24
-186.33.104.25
-186.33.104.27
-186.33.104.47
  186.33.104.51
-186.33.104.59
-186.33.104.61
  186.33.104.66
+186.33.104.79
  186.33.104.8
  186.33.104.83
  186.33.104.96
-186.33.104.97
+186.33.116.114
  186.33.122.109
-186.33.122.112
  186.33.122.118
-186.33.122.122
  186.33.122.129
+186.33.122.132
  186.33.122.133
  186.33.122.140
  186.33.122.142
  186.33.122.152
-186.33.122.160
  186.33.122.166
  186.33.122.170
-186.33.122.174
  186.33.122.180
  186.33.122.191
-186.33.122.216
+186.33.122.220
  186.33.122.226
-186.33.122.24
-186.33.122.241
-186.33.122.254
  186.33.122.29
-186.33.122.30
-186.33.122.37
-186.33.122.39
+186.33.122.32
  186.33.122.41
+186.33.122.43
  186.33.122.48
-186.33.122.5
  186.33.122.59
  186.33.122.70
+186.33.122.9
  186.33.123.0
  186.33.123.106
  186.33.123.108
-186.33.123.111
-186.33.123.113
-186.33.123.116
-186.33.123.125
-186.33.123.127
+186.33.123.123
  186.33.123.128
-186.33.123.133
  186.33.123.136
-186.33.123.14
  186.33.123.143
-186.33.123.28
  186.33.123.33
-186.33.123.46
+186.33.123.38
  186.33.123.62
-186.33.123.67
  186.33.123.74
-186.33.123.83
  186.34.92.253
  186.35.50.22
-186.36.82.171
  186.37.145.162
  186.38.26.5
  186.38.38.2
@@ -44261,6 +44141,7 @@
  186.4.172.5
  186.4.192.202
  186.4.200.221
+186.4.222.45
  186.42.101.234
  186.42.120.170
  186.42.124.130
@@ -44271,12 +44152,10 @@
  186.42.186.202
  186.42.198.70
  186.45.188.4
-186.45.69.168
  186.46.120.230
  186.46.136.70
  186.46.151.173
  186.46.184.182
-186.46.187.26
  186.46.222.226
  186.46.237.90
  186.46.25.210
@@ -44285,26 +44164,28 @@
  186.47.102.166
  186.47.212.166
  186.47.213.34
+186.47.74.122
  186.47.81.50
  186.47.82.6
+186.47.82.62
  186.47.83.126
  186.48.128.233
  186.48.94.83
-186.49.68.108
  186.5.201.1
  186.5.203.1
  186.5.204.2
  186.5.205.1
  186.5.206.1
  186.5.207.1
+186.50.15.136
+186.50.155.215
+186.50.88.161
  186.53.148.112
-186.54.150.126
-186.54.96.46
-186.58.112.198
+186.56.10.51
  186.58.12.163
  186.58.250.82
+186.58.94.140
  186.59.132.129
-186.60.45.24
  186.60.99.67
  186.62.56.154
  186.64.118.125
@@ -44315,10 +44196,10 @@
  186.67.159.101
  186.67.164.77
  186.67.224.156
-186.67.27.174
  186.67.51.43
  186.68.141.218
  186.68.93.46
+186.69.246.194
  186.71.71.44
  186.73.132.114
  186.73.188.132
@@ -44327,10 +44208,11 @@
  186.74.221.210
  186.75.130.46
  186.75.241.230
-186.78.42.174
-186.79.176.13
+186.79.191.17
  186.80.27.227
-186.83.36.82
+186.82.84.5
+186.82.86.228
+186.83.66.200
  186.84.173.153
  186.84.174.13
  186.84.174.237
@@ -44339,17 +44221,18 @@
  186.84.89.221
  186.85.159.135
  186.86.247.169
-186.87.51.33
  186.88.132.250
  186.88.44.220
+186.89.188.248
  186.89.212.45
+186.89.52.172
  186.9.11.188
  186.90.29.228
-186.91.189.243
  186.91.201.210
  186.91.240.234
-186.91.72.110
+186.93.63.120
  186.94.42.146
+186.96.102.198
  186.96.109.181
  186.96.110.5
  186.96.113.26
@@ -44364,19 +44247,22 @@
  186bahsegel.com
  186login-amazon.serveirc.com
  187.0.172.10
+187.0.175.178
  187.0.195.66
  187.1.178.102
  187.1.188.158
+187.1.67.202
+187.1.67.34
  187.1.81.161
  187.10.71.30
  187.102.12.133
  187.102.12.234
  187.102.16.70
-187.102.165.13
  187.102.71.1
  187.102.96.95
  187.103.15.17
  187.103.15.54
+187.103.232.26
  187.103.74.137
  187.103.75.245
  187.103.82.91
@@ -44388,8 +44274,6 @@
  187.108.38.170
  187.108.46.204
  187.108.86.40
-187.108.90.163
-187.109.10.100
  187.109.116.64
  187.109.155.127
  187.109.181.77
@@ -44406,7 +44290,6 @@
  187.111.160.23
  187.111.160.29
  187.111.160.8
-187.111.176.193
  187.111.192.125
  187.111.192.165
  187.111.192.181
@@ -44436,37 +44319,40 @@
  187.12.157.82
  187.12.167.85
  187.12.181.106
-187.120.15.26
  187.120.221.165
  187.120.253.119
+187.120.28.215
  187.121.110.42
  187.121.119.231
  187.121.122.15
  187.121.124.75
+187.121.35.166
+187.121.81.194
  187.121.86.27
  187.121.87.10
  187.121.87.125
+187.121.88.117
  187.121.92.122
  187.121.98.65
  187.121.99.135
  187.123.0.78
  187.123.56.57
  187.125.30.122
-187.125.44.110
  187.133.59.220
+187.134.224.82
+187.134.233.131
  187.134.246.25
  187.134.64.181
-187.137.0.217
+187.138.51.153
  187.138.66.40
  187.141.128.42
  187.141.129.86
-187.141.34.169
+187.141.143.180
  187.143.75.193
  187.144.50.63
  187.145.17.226
  187.146.56.241
  187.148.2.58
-187.149.60.246
  187.149.71.247
  187.150.96.11
  187.16.109.209
@@ -44477,22 +44363,23 @@
  187.160.51.215
  187.161.206.24
  187.162.11.94
-187.162.138.104
-187.162.208.202
+187.162.171.2
  187.162.248.237
  187.162.39.237
  187.162.62.89
-187.167.233.37
+187.167.198.209
+187.167.221.253
  187.17.145.237
  187.17.172.218
  187.17.19.90
-187.17.33.75
  187.170.158.21
+187.170.234.27
  187.170.243.203
  187.174.226.29
  187.174.65.4
  187.177.155.123
  187.178.144.187
+187.178.230.80
  187.178.241.208
  187.18.108.73
  187.18.125.34
@@ -44500,32 +44387,28 @@
  187.18.47.210
  187.18.73.115
  187.184.98.222
-187.187.201.86
-187.187.224.108
  187.188.107.115
-187.188.149.151
  187.188.166.192
  187.188.17.134
  187.188.182.87
-187.188.183.89
  187.188.190.217
+187.188.195.157
+187.188.195.27
  187.188.200.2
  187.188.200.20
+187.188.202.186
  187.188.213.4
  187.188.236.198
  187.188.240.7
-187.188.27.218
  187.188.34.191
  187.188.34.221
  187.188.90.141
-187.189.122.67
+187.189.116.83
  187.189.153.165
-187.189.153.173
  187.189.170.100
  187.189.195.208
-187.189.211.40
  187.189.225.104
-187.189.230.108
+187.189.232.175
  187.189.237.7
  187.189.243.167
  187.189.51.115
@@ -44550,25 +44433,32 @@
  187.19.204.23
  187.19.205.226
  187.19.234.82
-187.190.10.175
+187.190.109.135
  187.190.109.158
  187.190.23.173
  187.190.236.88
  187.190.237.69
  187.190.237.71
+187.190.255.230
  187.190.36.83
  187.190.40.95
+187.190.49.55
  187.190.60.72
  187.191.39.189
  187.191.4.88
  187.191.42.118
+187.191.8.155
  187.191.96.60
  187.192.119.193
+187.194.134.62
+187.194.246.8
  187.194.80.233
  187.195.74.33
  187.198.198.227
  187.199.80.57
+187.20.175.212
  187.20.214.78
+187.200.149.186
  187.200.39.233
  187.202.73.186
  187.205.193.110
@@ -44590,10 +44480,10 @@
  187.217.199.20
  187.217.246.82
  187.217.39.84
+187.22.133.228
+187.223.120.78
  187.223.162.79
  187.226.38.73
-187.227.11.133
-187.227.227.199
  187.228.161.166
  187.230.99.107
  187.237.103.210
@@ -44608,12 +44498,11 @@
  187.243.253.2
  187.243.255.174
  187.247.150.215
-187.248.21.27
  187.248.75.226
  187.250.149.15
  187.250.151.197
  187.252.154.90
-187.26.57.56
+187.32.140.237
  187.32.175.203
  187.32.209.55
  187.32.212.208
@@ -44626,22 +44515,27 @@
  187.33.91.85
  187.33.92.54
  187.33.93.157
-187.35.140.169
  187.35.147.87
  187.36.186.3
  187.37.76.92
+187.37.9.6
+187.38.145.211
  187.4.114.105
+187.4.165.58
  187.4.165.66
+187.4.165.90
+187.4.178.196
  187.4.67.26
  187.40.29.86
  187.41.26.245
  187.44.1.206
  187.44.110.157
  187.44.126.204
+187.44.138.148
  187.44.138.149
+187.44.138.150
  187.44.138.151
  187.44.14.19
-187.44.159.110
  187.44.167.78
  187.44.177.134
  187.44.177.178
@@ -44659,19 +44553,14 @@
  187.45.193.159
  187.49.207.65
  187.50.136.210
-187.50.93.202
-187.54.119.89
-187.54.180.73
  187.54.225.76
  187.54.67.162
  187.54.74.23
+187.56.28.85
  187.57.12.226
  187.58.107.81
  187.58.131.11
  187.58.163.78
-187.58.181.236
-187.59.201.247
-187.6.29.211
  187.60.34.234
  187.60.34.86
  187.60.36.164
@@ -44696,6 +44585,8 @@
  187.72.177.131
  187.72.231.193
  187.72.239.185
+187.72.53.90
+187.72.56.107
  187.72.66.1
  187.72.66.10
  187.72.66.16
@@ -44708,13 +44599,12 @@
  187.73.214.161
  187.73.68.14
  187.73.95.43
+187.74.43.236
  187.75.209.161
  187.76.190.74
  187.8.113.122
  187.8.182.30
-187.8.226.10
  187.8.78.101
-187.84.141.44
  187.84.177.17
  187.84.187.33
  187.84.191.129
@@ -44734,19 +44624,17 @@
  187.85.150.148
  187.85.164.7
  187.85.8.193
+187.85.83.90
  187.85.84.202
+187.85.84.242
  187.86.128.94
  187.86.129.122
  187.86.129.132
  187.86.129.134
  187.86.137.141
-187.86.152.107
-187.86.164.132
  187.86.201.4
-187.87.1.105
  187.87.204.202
  187.87.204.205
-187.87.64.33
  187.9.119.44
  187.93.151.122
  187.94.16.59
@@ -44759,12 +44647,12 @@
  187.95.119.2
  187.95.124.103
  187.95.170.24
+187.95.29.50
  187.95.80.137
  187.95.80.141
  187.95.82.109
  187.95.82.146
  187.95.82.175
-187.95.82.38
  187.95.82.45
  187.95.82.49
  187.95.82.53
@@ -44774,21 +44662,23 @@
  1875-financeinvest.com
  187bahsegel.com
  188.0.135.237
-188.0.138.11
+188.0.151.209
+188.0.152.236
  188.0.161.45
  188.0.167.7
  188.0.184.78
  188.0.191.219
  188.0.240.178
  188.0.240.38
+188.10.161.2
  188.10.210.132
  188.100.219.227
  188.101.237.29
-188.103.9.34
-188.104.127.52
  188.104.156.80
+188.105.52.54
  188.108.55.236
  188.108.55.90
+188.110.65.113
  188.112.145.230
  188.113.106.183
  188.113.158.18
@@ -44810,12 +44700,14 @@
  188.120.242.246
  188.120.243.11
  188.120.245.247
+188.120.249.12
  188.121.16.15
  188.121.2.186
  188.121.252.236
  188.121.57.10
  188.121.57.5
  188.122.2.55
+188.122.215.2
  188.122.27.252
  188.123.126.172
  188.123.126.176
@@ -44823,7 +44715,7 @@
  188.124.42.106
  188.124.42.107
  188.124.42.119
-188.124.94.140
+188.124.51.9
  188.125.107.117
  188.126.116.26
  188.126.73.10
@@ -44840,7 +44732,6 @@
  188.126.73.216
  188.126.73.217
  188.126.73.222
-188.126.8.105
  188.126.89.102
  188.126.89.104
  188.126.89.106
@@ -44861,10 +44752,10 @@
  188.126.89.4
  188.126.89.45
  188.126.89.69
-188.127.123.73
  188.127.188.23
  188.127.229.105
  188.127.230.213
+188.127.231.118
  188.127.237.104
  188.127.237.115
  188.127.237.136
@@ -44874,14 +44765,12 @@
  188.127.251.245
  188.128.202.35.bc.googleusercontent.com
  188.128.39.127
-188.128.39.28
  188.128.50.217
  188.128.81.170
  188.129.161.55
  188.13.92.24
  188.130.128.190
  188.130.129.138
-188.130.129.156
  188.130.136.251
  188.130.137.111
  188.130.138.105
@@ -44897,20 +44786,20 @@
  188.130.7.221
  188.131.109.223
  188.131.129.98
-188.131.131.210
  188.131.133.196
  188.131.135.188
  188.131.135.227
+188.131.142.109
  188.131.144.29
  188.131.144.58
  188.131.146.143
  188.131.146.4
  188.131.146.88
  188.131.150.251
+188.131.151.171
  188.131.151.197
  188.131.154.143
  188.131.158.128
-188.131.172.48
  188.131.177.59
  188.131.179.87
  188.131.183.242
@@ -44921,7 +44810,6 @@
  188.131.235.218
  188.131.249.145
  188.131.63.124
-188.132.169.90
  188.133.160.22
  188.133.165.206
  188.134.16.191
@@ -44929,9 +44817,11 @@
  188.134.6.84
  188.134.74.188
  188.134.8.36
+188.134.81.196
  188.134.82.97
  188.134.94.99
  188.135.15.49
+188.135.28.182
  188.136.167.33
  188.137.28.253
  188.138.11.56
@@ -44951,6 +44841,7 @@
  188.14.85.21
  188.141.34.156
  188.141.79.43
+188.143.136.227
  188.143.220.152
  188.143.232.0
  188.143.232.1
@@ -45465,12 +45356,16 @@
  188.143.233.98
  188.143.233.99
  188.143.235.21
-188.146.38.210
+188.148.149.150
+188.148.150.176
+188.148.155.45
  188.148.188.231
+188.148.188.241
  188.148.227.92
  188.148.246.1
  188.149.149.142
  188.152.189.220
+188.152.41.141
  188.152.7.140
  188.152.86.241
  188.154.206.50
@@ -45479,21 +45374,25 @@
  188.155.218.95
  188.155.91.186
  188.156.113.87
+188.156.240.240
+188.161.68.153
  188.162.197.28
-188.162.199.157
  188.162.41.226
  188.162.41.78
+188.162.43.158
  188.162.43.164
-188.162.43.252
  188.162.43.5
-188.163.101.11
+188.162.44.32
  188.163.104.113
+188.163.108.198
  188.163.109.142
  188.163.170.130
  188.163.19.0
+188.163.30.58
  188.163.42.254
  188.163.46.254
  188.163.47.9
+188.163.56.153
  188.165.11.196
  188.165.119.138
  188.165.121.242
@@ -45502,11 +45401,12 @@
  188.165.140.127
  188.165.142.194
  188.165.16.230
+188.165.169.0
+188.165.169.140
  188.165.180.120
  188.165.194.99
  188.165.196.203
  188.165.198.108
-188.165.198.23
  188.165.201.139
  188.165.202.199
  188.165.210.176
@@ -45515,6 +45415,7 @@
  188.165.214.98
  188.165.218.62
  188.165.228.188
+188.165.228.82
  188.165.228.9
  188.165.229.5
  188.165.230.116
@@ -45522,13 +45423,17 @@
  188.165.238.140
  188.165.239.119
  188.165.239.211
+188.165.24.200
  188.165.240.181
  188.165.240.54
  188.165.244.143
+188.165.246.50
+188.165.247.31
  188.165.25.196
  188.165.250.115
  188.165.29.122
  188.165.34.119
+188.165.4.7
  188.165.4.88
  188.165.42.223
  188.165.44.214
@@ -45557,10 +45462,8 @@
  188.166.116.147
  188.166.118.43
  188.166.12.196
-188.166.12.220
  188.166.121.60
  188.166.122.214
-188.166.125.121
  188.166.126.191
  188.166.127.202
  188.166.13.91
@@ -45575,10 +45478,10 @@
  188.166.151.190
  188.166.153.62
  188.166.154.203
+188.166.157.95
  188.166.158.134
  188.166.158.69
  188.166.159.127
-188.166.16.155
  188.166.16.36
  188.166.164.10
  188.166.165.121
@@ -45588,6 +45491,7 @@
  188.166.177.99
  188.166.178.39
  188.166.18.102
+188.166.180.116
  188.166.180.17
  188.166.182.246
  188.166.183.217
@@ -45600,6 +45504,7 @@
  188.166.185.245
  188.166.187.179
  188.166.188.247
+188.166.189.43
  188.166.19.131
  188.166.190.146
  188.166.190.154
@@ -45607,7 +45512,6 @@
  188.166.190.187
  188.166.190.221
  188.166.190.225
-188.166.191.22
  188.166.191.96
  188.166.193.249
  188.166.197.9
@@ -45625,6 +45529,7 @@
  188.166.211.194
  188.166.211.63
  188.166.211.7
+188.166.212.238
  188.166.212.31
  188.166.214.226
  188.166.218.105
@@ -45642,9 +45547,11 @@
  188.166.226.188
  188.166.229.193
  188.166.23.215
+188.166.230.148
  188.166.232.159
  188.166.233.216
  188.166.234.31
+188.166.234.53
  188.166.236.56
  188.166.236.57
  188.166.24.63
@@ -45654,6 +45561,7 @@
  188.166.244.203
  188.166.246.158
  188.166.246.167
+188.166.247.170
  188.166.247.82
  188.166.248.209
  188.166.248.83
@@ -45663,7 +45571,6 @@
  188.166.255.224
  188.166.255.227
  188.166.255.49
-188.166.26.55
  188.166.27.111
  188.166.3.185
  188.166.3.215
@@ -45671,32 +45578,32 @@
  188.166.31.157
  188.166.32.250
  188.166.32.64
-188.166.33.123
  188.166.33.15
  188.166.35.206
  188.166.35.27
  188.166.35.81
  188.166.36.61
  188.166.37.137
+188.166.38.221
  188.166.4.178
  188.166.41.52
  188.166.42.88
  188.166.43.209
-188.166.46.194
  188.166.46.210
  188.166.48.223
  188.166.49.115
  188.166.5.210
  188.166.5.50
  188.166.5.84
+188.166.52.171
  188.166.53.163
+188.166.56.186
  188.166.56.221
  188.166.56.50
  188.166.58.130
  188.166.58.159
  188.166.58.179
  188.166.58.240
-188.166.58.91
  188.166.58.96
  188.166.6.12
  188.166.6.130
@@ -45708,6 +45615,7 @@
  188.166.64.245
  188.166.65.134
  188.166.65.239
+188.166.68.70
  188.166.69.102
  188.166.69.34
  188.166.69.56
@@ -45732,6 +45640,7 @@
  188.166.87.132
  188.166.87.163
  188.166.87.188
+188.166.87.207
  188.166.87.22
  188.166.89.217
  188.166.9.210
@@ -45739,13 +45648,13 @@
  188.166.92.161
  188.166.97.208
  188.166.99.160
+188.166.99.239
  188.166.99.74
  188.167.158.203
-188.167.251.159
-188.167.253.212
  188.168.27.71
  188.168.27.73
  188.168.56.31
+188.168.56.82
  188.168.75.254
  188.168.96.34
  188.169.142.196
@@ -45765,7 +45674,6 @@
  188.169.237.144
  188.169.30.211
  188.169.30.30
-188.169.36.159
  188.169.36.163
  188.169.36.206
  188.169.36.214
@@ -45793,8 +45701,9 @@
  188.170.33.57
  188.170.41.6
  188.170.63.9
-188.170.75.64
+188.170.73.130
  188.170.8.109
+188.172.109.38
  188.172.220.70
  188.172.220.71
  188.172.94.56
@@ -45807,7 +45716,6 @@
  188.18.81.107
  188.18.88.17
  188.181.73.110
-188.182.98.94
  188.186.180.135
  188.186.196.23
  188.187.0.42
@@ -45823,6 +45731,7 @@
  188.190.101.143
  188.190.124.1
  188.190.173.154
+188.190.23.127
  188.190.234.13
  188.190.245.135
  188.191.103.67
@@ -45830,22 +45739,22 @@
  188.191.232.66
  188.191.233.57
  188.191.28.109
+188.191.47.160
  188.192.100.71
  188.192.12.35
+188.192.175.128
  188.193.103.156
  188.193.44.23
  188.194.146.122
  188.194.188.88
  188.194.56.23
-188.194.57.34
-188.194.76.95
-188.195.139.29
+188.194.59.14
  188.195.169.0
  188.2.74.234
  188.205.25.124
  188.209.49.164
  188.210.222.151
-188.210.53.150
+188.210.54.241
  188.212.100.2
  188.213.134.170
  188.213.170.40
@@ -45853,7 +45762,6 @@
  188.213.49.166
  188.213.49.210
  188.214.104.146
-188.214.104.76
  188.214.128.192
  188.214.132.45
  188.214.133.114
@@ -45863,10 +45771,8 @@
  188.215.70.115
  188.216.254.72
  188.217.181.18
-188.217.251.67
  188.217.97.1
  188.218.232.45
-188.219.117.26
  188.219.31.12
  188.222.178.151
  188.222.251.123
@@ -45878,6 +45784,7 @@
  188.225.202.1
  188.225.32.231
  188.225.46.245
+188.225.82.163
  188.225.85.8
  188.226.128.122
  188.226.130.128
@@ -45899,6 +45806,7 @@
  188.226.179.232
  188.226.180.234
  188.226.188.45
+188.226.189.117
  188.226.192.115
  188.226.233.196
  188.227.195.66
@@ -45910,7 +45818,6 @@
  188.230.136.208
  188.230.189.138
  188.230.241.10
-188.230.252.183
  188.234.216.99
  188.234.218.19
  188.234.247.110
@@ -45925,10 +45832,13 @@
  188.235.61.22
  188.235.61.25
  188.235.8.5
+188.237.135.116
  188.237.135.3
  188.239.35.10
+188.239.53.22
  188.24.146.37
  188.24.148.251
+188.24.76.85
  188.240.136.75
  188.240.191.163
  188.240.208.26
@@ -45939,15 +45849,16 @@
  188.241.68.116
  188.241.68.131
  188.241.73.75
+188.241.82.143
  188.241.82.160
  188.242.133.111
  188.242.167.159
+188.242.35.86
  188.242.5.172
  188.243.116.199
  188.243.124.19
  188.243.190.110
  188.243.58.75
-188.243.62.212
  188.243.71.145
  188.244.142.10
  188.244.20.242
@@ -45958,12 +45869,13 @@
  188.247.144.62
  188.247.39.14
  188.247.65.179
+188.247.72.195
  188.247.90.252
  188.247.90.253
  188.25.125.222
  188.250.114.80
  188.250.158.53
-188.251.203.137
+188.251.196.56
  188.252.196.2
  188.252.196.203
  188.252.199.37
@@ -45976,7 +45888,6 @@
  188.254.163.174
  188.254.172.147
  188.254.172.151
-188.254.98.46
  188.255.118.20
  188.255.120.9
  188.255.156.137
@@ -46023,11 +45934,9 @@
  188.255.214.5
  188.255.214.9
  188.26.112.21
-188.26.202.18
  188.26.5.254
  188.26.86.244
  188.27.137.163
-188.27.146.34
  188.27.179.80
  188.27.36.71
  188.3.175.201
@@ -46043,11 +45952,12 @@
  188.34.200.56
  188.35.165.21
  188.35.167.7
+188.37.113.245
  188.37.190.74
  188.37.24.190
-188.38.206.211
  188.38.31.3
  188.38.97.58
+188.4.7.188
  188.40.114.21
  188.40.136.208
  188.40.155.227
@@ -46062,11 +45972,10 @@
  188.43.225.109
  188.43.226.233
  188.43.52.166
-188.44.20.156
-188.49.241.235
+188.44.123.222
  188.50.127.101
-188.51.44.26
-188.51.86.53
+188.50.36.100
+188.52.201.235
  188.53.7.172
  188.53.88.202
  188.55.47.202
@@ -46075,7 +45984,6 @@
  188.6.164.138
  188.64.132.119
  188.64.186.224
-188.64.77.203
  188.65.237.16
  188.65.73.110
  188.65.74.60
@@ -46089,12 +45997,12 @@
  188.68.56.168
  188.68.56.223
  188.69.135.214
-188.69.223.106
-188.70.26.91
+188.71.228.148
+188.72.115.101
  188.72.202.147
  188.72.6.98
  188.73.195.138
-188.74.12.187
+188.74.13.195
  188.75.138.234
  188.75.139.60
  188.75.173.148
@@ -46102,22 +46010,19 @@
  188.75.186.162
  188.76.11.106
  188.78.195.127
-188.78.62.171
  188.78.62.213
  188.79.49.195
  188.80.116.177
-188.80.144.58
  188.81.184.100
  188.81.227.188
-188.82.172.4
+188.82.232.92
  188.82.39.247
-188.82.58.67
-188.83.59.148
  188.85.143.170
  188.92.190.38
  188.92.243.82
  188.92.244.38
  188.92.73.91
+188.92.78.78
  188.93.104.2
  188.93.111.77
  188.93.208.12
@@ -46125,6 +46030,7 @@
  188.93.64.242
  188.93.65.58
  188.94.164.178
+188.94.42.24
  188.94.66.42
  188.95.234.6
  18850306919.mer.lstest.siquality.com
@@ -46146,31 +46052,31 @@
  189.1.4.129
  189.100.253.150
  189.101.19.103
-189.107.151.82
  189.107.23.86
  189.108.178.6
  189.108.236.148
-189.109.236.166
  189.109.252.155
  189.11.126.17
  189.110.148.31
-189.110.165.91
  189.110.89.65
+189.111.36.244
  189.112.125.209
  189.112.125.212
  189.112.126.171
-189.112.147.1
  189.112.179.115
  189.112.223.113
  189.112.228.153
  189.112.238.216
  189.112.61.117
+189.112.61.53
  189.112.89.17
  189.113.169.101
  189.113.2.23
  189.113.217.35
+189.114.2.68
  189.114.67.217
  189.114.93.191
+189.120.114.43
  189.122.185.116
  189.123.173.24
  189.123.232.5
@@ -46188,9 +46094,9 @@
  189.127.107.43
  189.127.128.226
  189.127.15.106
+189.127.167.8
  189.127.239.27
  189.128.56.231
-189.130.43.71
  189.131.201.231
  189.132.112.125
  189.132.76.152
@@ -46202,27 +46108,25 @@
  189.135.38.43
  189.138.59.0
  189.138.94.69
-189.139.77.107
  189.14.124.17
  189.14.193.111
-189.14.193.242
  189.14.193.94
  189.14.194.113
-189.14.209.3
  189.14.233.26
  189.14.96.74
-189.145.19.171
-189.146.156.58
  189.147.5.56
+189.147.96.57
  189.148.103.223
  189.15.17.127
  189.150.164.106
  189.150.189.172
+189.150.191.147
  189.150.192.37
-189.150.206.170
+189.150.197.155
+189.150.204.227
+189.150.207.115
  189.150.225.65
  189.150.236.234
-189.150.238.248
  189.152.130.84
  189.152.2.89
  189.152.213.9
@@ -46230,6 +46134,8 @@
  189.153.95.182
  189.154.96.235
  189.156.60.5
+189.156.63.29
+189.159.187.153
  189.16.123.100
  189.162.187.155
  189.163.2.11
@@ -46239,24 +46145,19 @@
  189.164.155.152
  189.164.173.108
  189.164.191.78
-189.164.195.212
  189.164.216.70
  189.164.218.235
  189.164.231.15
  189.164.237.130
  189.166.212.235
  189.167.19.196
-189.17.228.136
  189.171.65.89
-189.172.47.107
  189.173.16.58
  189.177.110.65
  189.177.80.175
  189.178.112.205
  189.178.120.60
-189.178.202.5
-189.179.182.109
-189.179.182.8
+189.178.238.160
  189.18.178.45
  189.18.181.106
  189.180.8.85
@@ -46266,6 +46167,7 @@
  189.195.23.210
  189.198.135.118
  189.198.135.158
+189.198.210.234
  189.199.106.202
  189.2.127.243
  189.2.127.244
@@ -46285,13 +46187,13 @@
  189.201.242.24
  189.201.248.205
  189.201.250.173
-189.203.139.37
-189.203.142.151
+189.203.164.119
  189.203.194.2
  189.203.26.46
  189.203.45.199
  189.203.73.102
  189.203.84.178
+189.204.242.178
  189.204.49.40
  189.206.165.62
  189.206.166.12
@@ -46303,11 +46205,9 @@
  189.209.110.202
  189.209.217.49
  189.209.7.168
-189.211.188.170
  189.212.103.237
  189.212.199.126
  189.213.106.197
-189.213.219.40
  189.213.228.237
  189.214.64.34
  189.216.247.168
@@ -46320,11 +46220,9 @@
  189.219.72.148
  189.22.180.250
  189.22.55.34
-189.222.119.59
  189.222.175.66
  189.223.19.109
  189.228.77.34
-189.231.53.80
  189.231.68.220
  189.235.87.72
  189.236.122.23
@@ -46341,13 +46239,16 @@
  189.241.255.198
  189.243.25.216
  189.243.98.161
+189.244.102.63
  189.244.155.123
  189.248.208.220
  189.248.93.110
  189.25.249.37
  189.250.126.76
  189.250.245.29
+189.251.52.204
  189.252.102.40
+189.252.131.16
  189.252.156.96
  189.252.54.113
  189.254.242.60
@@ -46355,9 +46256,9 @@
  189.254.255.3
  189.26.128.138
  189.26.78.155
+189.27.46.82
  189.27.95.55
  189.28.186.26
-189.28.242.23
  189.30.181.98
  189.38.90.83
  189.39.102.67
@@ -46366,11 +46267,13 @@
  189.39.106.58
  189.39.127.118
  189.39.29.119
+189.4.1.12
  189.4.11.237
  189.4.128.122
  189.4.223.50
+189.4.3.44
  189.41.109.15
-189.41.155.56
+189.41.139.67
  189.44.178.170
  189.45.144.26
  189.45.172.74
@@ -46401,24 +46304,26 @@
  189.57.62.34
  189.57.73.18
  189.58.110.129
+189.59.69.3
  189.6.13.227
+189.6.30.178
  189.6.37.81
  189.6.78.34
+189.62.200.244
  189.62.207.53
-189.63.87.20
-189.64.197.1
-189.66.238.112
  189.68.245.110
  189.7.129.60
  189.7.217.23
  189.7.25.246
-189.7.81.29
+189.71.248.175
  189.75.115.204
  189.78.145.44
  189.78.156.8
+189.78.34.117
+189.79.110.214
  189.79.118.149
+189.79.183.167
  189.79.193.173
-189.79.94.242
  189.8.7.219
  189.80.111.66
  189.80.219.59
@@ -46449,16 +46354,16 @@
  189.9.25.92
  189.9.25.94
  189.90.114.37
-189.90.202.125
  189.90.244.46
  189.90.244.82
+189.90.255.173
  189.91.100.50
  189.91.101.54
  189.91.115.6
  189.91.192.138
  189.91.239.194
  189.91.84.25
-189.92.157.155
+189.91.97.52
  189cj.cn
  189zx.com
  18a.buzz
@@ -46488,12 +46393,16 @@
  190.0.236.200
  190.0.242.217
  190.0.246.9
+190.0.26.69
+190.0.49.206
  190.0.53.213
  190.0.61.18
  190.0.8.134
  190.1.203.180
  190.100.117.152
  190.100.170.253
+190.100.231.192
+190.101.113.209
  190.101.168.19
  190.102.59.97
  190.103.1.146
@@ -46504,8 +46413,8 @@
  190.103.28.14
  190.103.28.76
  190.103.29.236
-190.104.124.191
  190.104.149.194
+190.104.150.2
  190.104.17.3
  190.104.17.4
  190.104.175.34
@@ -46525,13 +46434,13 @@
  190.104.68.246
  190.104.69.241
  190.105.213.165
+190.105.59.165
  190.106.103.250
  190.106.104.2
  190.106.125.41
  190.106.97.230
  190.107.118.125
  190.107.240.220
-190.107.54.68
  190.108.228.48
  190.108.84.166
  190.109.160.73
@@ -46544,7 +46453,6 @@
  190.109.178.180
  190.109.196.41
  190.109.196.44
-190.109.227.243
  190.109.67.22
  190.109.72.10
  190.109.72.21
@@ -46555,8 +46463,8 @@
  190.109.75.253
  190.11.15.14
  190.11.15.2
-190.11.168.226
  190.11.198.89
+190.11.50.47
  190.110.197.18
  190.110.86.134
  190.111.151.164
@@ -46578,10 +46486,9 @@
  190.112.136.201
  190.112.196.12
  190.113.162.53
-190.113.165.70
  190.113.236.48
  190.113.239.244
-190.113.239.46
+190.114.253.124
  190.114.254.163
  190.115.21.205
  190.115.218.2
@@ -46591,6 +46498,7 @@
  190.117.147.185
  190.117.148.237
  190.117.206.153
+190.119.175.42
  190.119.197.210
  190.119.199.18
  190.119.199.201
@@ -46609,6 +46517,7 @@
  190.120.23.157
  190.120.254.17
  190.120.254.37
+190.120.254.76
  190.120.96.33
  190.120.96.37
  190.120.96.41
@@ -46664,13 +46573,10 @@
  190.128.26.98
  190.128.68.123
  190.128.88.4
-190.129.143.30
  190.129.39.114
  190.129.49.62
  190.129.69.101
-190.129.99.134
  190.13.138.50
-190.13.173.67
  190.13.82.242
  190.13.84.221
  190.131.167.50
@@ -46680,24 +46586,29 @@
  190.131.229.126
  190.135.50.255
  190.136.178.52
-190.136.63.44
+190.137.230.166
  190.138.206.15
  190.138.206.16
  190.138.206.18
  190.138.221.134
  190.14.141.177
  190.14.170.109
+190.14.18.126
  190.14.225.117
  190.14.231.212
+190.14.3.10
+190.14.3.9
  190.14.39.239
+190.140.119.28
+190.140.122.122
+190.140.146.154
+190.140.38.29
+190.141.102.125
  190.141.196.80
-190.141.2.6
  190.142.137.87
  190.143.137.114
  190.143.39.211
-190.143.67.245
  190.144.114.162
-190.144.135.118
  190.144.139.235
  190.144.14.170
  190.144.163.254
@@ -46730,7 +46641,6 @@
  190.145.5.170
  190.145.52.254
  190.145.60.229
-190.145.69.123
  190.145.77.219
  190.145.81.37
  190.145.92.18
@@ -46750,16 +46660,14 @@
  190.148.69.74
  190.149.165.162
  190.149.216.74
-190.15.210.81
-190.150.192.71
  190.151.100.10
  190.151.94.2
-190.151.94.3
  190.152.0.130
  190.152.12.54
  190.152.15.194
  190.152.17.62
  190.152.180.90
+190.152.182.150
  190.152.183.174
  190.152.19.190
  190.152.19.62
@@ -46775,15 +46683,16 @@
  190.152.71.46
  190.152.8.146
  190.152.88.114
+190.153.197.66
  190.153.222.250
  190.153.249.99
+190.154.106.88
  190.155.106.74
  190.156.227.27
  190.156.229.215
  190.156.231.182
  190.156.231.245
  190.156.238.155
-190.158.26.2
  190.160.53.126
  190.161.67.63
  190.162.135.242
@@ -46793,7 +46702,6 @@
  190.164.232.254
  190.165.166.138
  190.165.175.167
-190.166.117.29
  190.166.28.179
  190.166.90.2
  190.167.215.170
@@ -46814,14 +46722,14 @@
  190.18.207.58
  190.18.3.250
  190.18.63.166
-190.18.79.110
  190.181.113.202
  190.181.122.225
  190.181.122.233
  190.181.190.30
-190.181.239.105
+190.182.179.18
  190.182.232.250
  190.182.88.214
+190.182.88.226
  190.182.88.242
  190.183.239.249
  190.183.60.210
@@ -46835,21 +46743,21 @@
  190.185.113.103
  190.185.113.98
  190.185.119.44
+190.185.149.84
  190.185.150.4
  190.186.1.186
  190.186.1.46
  190.186.144.99
  190.186.170.82
-190.186.253.86
  190.186.76.19
  190.186.89.150
+190.187.100.17
  190.187.112.66
  190.187.236.42
  190.187.240.84
-190.187.6.153
  190.188.245.242
  190.189.170.52
-190.189.227.211
+190.189.21.178
  190.19.169.69
  190.190.159.143
  190.190.219.184
@@ -46860,6 +46768,7 @@
  190.192.214.192
  190.192.39.136
  190.192.39.80
+190.193.166.254
  190.193.8.28
  190.194.12.132
  190.194.176.228
@@ -46867,11 +46776,11 @@
  190.195.129.227
  190.195.148.163
  190.195.static.wline.lns.sme.cust.swisscom-ipv6.ch
-190.196.150.40
  190.196.161.110
  190.196.20.166
  190.196.23.170
  190.196.231.36
+190.196.33.39
  190.196.60.122
  190.196.66.74
  190.196.66.76
@@ -46880,6 +46789,8 @@
  190.196.9.155
  190.198.118.138
  190.198.187.63
+190.198.247.250
+190.2.103.121
  190.2.130.195
  190.2.130.44
  190.2.134.140
@@ -46895,10 +46806,12 @@
  190.2.21.153
  190.2.210.106
  190.2.211.18
-190.2.239.72
  190.2.31.172
  190.20.97.244
+190.200.112.218
  190.200.114.102
+190.200.98.164
+190.201.205.219
  190.202.109.244
  190.202.124.93
  190.202.147.253
@@ -46906,12 +46819,14 @@
  190.202.24.66
  190.202.44.194
  190.202.54.12
+190.203.113.114
+190.204.72.195
  190.205.156.139
+190.205.24.41
  190.205.48.28
  190.206.113.156
  190.206.171.92
-190.206.22.61
-190.207.108.147
+190.207.169.113
  190.208.17.136
  190.21.255.69
  190.21.43.44
@@ -46925,7 +46840,7 @@
  190.210.72.84
  190.210.8.69
  190.210.93.9
-190.211.105.86
+190.211.115.66
  190.211.160.114
  190.211.254.191
  190.211.254.193
@@ -46947,6 +46862,7 @@
  190.214.44.230
  190.214.50.158
  190.214.51.166
+190.214.52.226
  190.214.53.134
  190.214.55.138
  190.214.77.246
@@ -46957,7 +46873,6 @@
  190.215.220.34
  190.215.220.36
  190.215.220.38
-190.215.41.110
  190.215.48.118
  190.215.76.30
  190.216.166.200
@@ -46976,15 +46891,17 @@
  190.217.68.210
  190.217.68.211
  190.217.68.212
-190.217.9.241
  190.219.149.236
+190.219.16.2
  190.219.179.200
+190.219.89.7
  190.220.16.92
  190.220.17.34
  190.221.152.130
  190.221.46.78
  190.223.26.38
  190.223.38.195
+190.224.126.229
  190.224.35.254
  190.226.244.9
  190.226.46.114
@@ -47002,16 +46919,12 @@
  190.229.255.239
  190.230.60.129
  190.232.109.139
-190.233.187.198
-190.234.212.18
-190.235.10.81
-190.235.116.107
-190.236.246.39
-190.236.47.154
  190.236.76.178
+190.236.76.222
  190.237.15.64
  190.237.55.64
  190.239.1.225
+190.239.215.212
  190.24.131.38
  190.24.243.186
  190.24.50.205
@@ -47026,11 +46939,12 @@
  190.244.96.69
  190.246.152.105
  190.246.155.29
+190.246.186.16
  190.246.87.122
  190.247.139.101
  190.248.153.162
  190.248.68.18
-190.249.147.162
+190.249.137.158
  190.249.150.97
  190.25.168.216
  190.25.189.178
@@ -47039,6 +46953,7 @@
  190.251.200.206
  190.251.216.100
  190.253.19.101
+190.254.21.178
  190.254.58.196
  190.255.49.83
  190.26.164.111
@@ -47056,22 +46971,22 @@
  190.29.96.187
  190.3.117.18
  190.3.194.209
-190.3.194.237
  190.3.23.35
  190.30.139.166
+190.32.173.122
  190.34.149.226
  190.34.204.10
  190.37.208.145
+190.37.27.215
  190.38.14.52
  190.38.151.251
-190.39.18.80
  190.39.40.145
  190.4.0.246
  190.4.204.163
  190.4.205.226
  190.4.56.17
  190.40.85.200
-190.42.190.188
+190.42.137.254
  190.43.231.100
  190.44.157.81
  190.45.24.210
@@ -47083,6 +46998,7 @@
  190.5.85.242
  190.52.131.234
  190.52.168.20
+190.52.181.228
  190.52.187.226
  190.52.191.49
  190.52.193.102
@@ -47090,13 +47006,12 @@
  190.52.193.97
  190.52.199.200
  190.52.34.43
-190.53.108.49
-190.53.31.170
  190.53.34.118
  190.53.38.98
  190.53.46.14
  190.53.46.2
  190.55.181.54
+190.55.21.175
  190.55.5.142
  190.56.229.41
  190.56.255.118
@@ -47109,13 +47024,13 @@
  190.57.240.29
  190.58.130.230
  190.6.193.152
+190.60.71.124
  190.61.80.224
  190.61.80.227
  190.63.144.26
  190.63.144.29
  190.63.160.62
  190.63.7.166
-190.64.135.122
  190.64.136.122
  190.64.141.18
  190.64.142.122
@@ -47147,29 +47062,29 @@
  190.72.61.223
  190.73.12.20
  190.74.160.110
-190.77.126.102
+190.75.20.184
  190.77.210.230
  190.77.38.232
  190.78.124.22
-190.78.53.211
-190.78.86.14
  190.79.131.206
+190.79.64.178
  190.79.75.7
  190.8.149.146
  190.8.169.206
+190.80.159.189
  190.80.159.210
  190.80.243.251
  190.80.61.113
  190.83.31.2
  190.84.232.82
  190.85.10.147
+190.85.102.124
  190.85.108.186
  190.85.115.78
  190.85.12.42
  190.85.129.187
  190.85.130.174
  190.85.131.57
-190.85.149.107
  190.85.183.250
  190.85.184.114
  190.85.186.254
@@ -47204,31 +47119,31 @@
  190.89.28.16
  190.89.28.162
  190.89.28.199
-190.89.28.21
+190.89.28.20
  190.89.28.216
  190.89.28.22
  190.89.28.222
  190.89.28.225
  190.89.28.24
+190.89.28.253
  190.89.28.28
  190.89.28.3
  190.89.28.31
  190.89.28.33
  190.89.28.4
  190.89.28.48
+190.89.28.52
+190.89.28.55
  190.89.28.56
  190.89.28.6
  190.89.28.61
  190.89.28.63
  190.89.28.64
-190.89.28.66
  190.89.28.69
-190.89.28.73
  190.89.28.76
  190.89.28.78
  190.89.28.80
  190.89.28.83
-190.89.28.84
  190.89.28.89
  190.89.28.9
  190.89.28.92
@@ -47239,9 +47154,11 @@
  190.89.29.102
  190.89.29.25
  190.89.29.9
+190.89.8.1
  190.9.128.96
  190.9.249.221
  190.90.140.55
+190.90.156.90
  190.90.20.229
  190.90.20.230
  190.90.79.198
@@ -47252,7 +47169,6 @@
  190.93.176.70
  190.94.144.157
  190.94.148.130
-190.95.214.178
  190.95.214.183
  190.95.214.185
  190.95.231.98
@@ -47262,14 +47178,16 @@
  190.96.127.114
  190.96.127.42
  190.96.15.50
+190.96.172.101
  190.96.214.59
  190.96.40.105
+190.96.78.124
  190.97.167.214
  190.97.219.241
  190.97.219.4
  190.97.240.82
  190.97.30.167
-190.98.234.183
+190.98.203.195
  190.98.37.200
  190.98.41.33
  190.99.76.98
@@ -47277,6 +47195,7 @@
  191.100.20.14
  191.100.20.187
  191.100.24.91
+191.100.25.73
  191.100.28.217
  191.100.30.245
  191.101.109.187
@@ -47293,7 +47212,6 @@
  191.101.215.180
  191.101.230.216
  191.101.243.42
-191.101.250.166
  191.101.250.202
  191.101.250.238
  191.101.250.87
@@ -47311,105 +47229,92 @@
  191.101.39.27
  191.101.39.29
  191.101.39.81
-191.101.64.119
  191.101.66.62
  191.101.67.1
  191.101.70.105
  191.101.70.94
+191.101.72.60
+191.101.76.144
  191.101.76.235
  191.101.78.38
+191.101.79.44
  191.101.81.137
  191.101.82.146
+191.101.85.113
  191.101.87.151
-191.101.90.26
-191.101.90.28
  191.101.90.60
-191.101.92.118
-191.101.94.97
  191.101.95.63
-191.101.96.126
  191.101.96.140
  191.101.99.92
  191.102.106.1
-191.102.120.13
-191.102.120.145
-191.102.120.148
+191.102.120.112
+191.102.120.117
+191.102.120.175
+191.102.120.182
  191.102.120.38
+191.102.120.85
  191.102.122.180
  191.102.130.138
-191.102.130.180
  191.102.131.146
-191.102.131.164
  191.102.131.175
-191.102.131.181
-191.102.148.143
+191.102.134.159
  191.102.150.101
+191.102.150.11
  191.102.150.144
-191.102.150.231
  191.102.150.24
  191.102.150.3
  191.102.150.39
  191.102.150.55
-191.102.150.87
  191.102.150.98
  191.102.151.54
  191.102.151.57
  191.102.151.92
  191.102.151.99
  191.102.153.179
-191.102.153.183
  191.102.153.225
  191.102.153.251
-191.102.153.58
  191.102.154.66
  191.102.156.133
  191.102.156.19
  191.102.156.237
  191.102.156.40
  191.102.164.10
+191.102.164.102
  191.102.164.160
  191.102.164.176
  191.102.164.222
  191.102.164.4
+191.102.164.51
  191.102.165.226
  191.102.166.146
  191.102.166.34
  191.102.167.241
  191.102.167.39
  191.102.167.52
-191.102.188.114
-191.102.188.231
-191.102.189.107
  191.102.78.240
  191.102.83.167
  191.102.88.218
  191.102.95.171
  191.103.219.225
+191.103.251.33
  191.103.254.125
  191.103.254.145
  191.111.139.49
  191.113.244.94
-191.115.227.58
  191.13.251.209
  191.137.210.227
  191.143.172.196
-191.143.73.137
-191.162.207.245
  191.162.208.237
-191.177.234.71
  191.182.144.80
  191.182.6.118
  191.183.21.190
  191.185.45.228
-191.185.93.143
  191.186.143.99
  191.187.146.77
  191.188.70.175
  191.189.17.177
-191.189.17.226
  191.189.226.247
  191.19.199.214
-191.193.236.197
  191.205.248.196
  191.209.114.90
  191.209.21.188
@@ -47418,10 +47323,12 @@
  191.209.88.62
  191.217.170.33
  191.217.184.46
+191.217.84.232
  191.223.254.101
  191.223.36.170
  191.232.136.43
  191.232.136.87
+191.232.166.69
  191.232.169.208
  191.232.172.50
  191.232.176.226
@@ -47429,8 +47336,6 @@
  191.232.211.83
  191.232.241.128
  191.232.247.86
-191.232.48.213
-191.232.54.142
  191.232.55.25
  191.233.137.53
  191.233.192.40
@@ -47443,7 +47348,6 @@
  191.235.100.148
  191.235.112.72
  191.235.64.156
-191.235.65.126
  191.235.71.26
  191.235.72.144
  191.235.98.48
@@ -47451,13 +47355,14 @@
  191.237.250.121
  191.237.253.183
  191.237.253.239
+191.237.255.177
  191.237.42.132
  191.238.208.183
-191.239.249.178
  191.239.255.175
  191.240.152.129
  191.240.152.132
  191.240.152.134
+191.240.154.122
  191.240.157.186
  191.240.236.10
  191.240.28.25
@@ -47473,24 +47378,22 @@
  191.241.34.210
  191.241.67.10
  191.242.112.221
-191.242.178.209
  191.242.179.138
  191.242.182.132
  191.242.188.77
  191.242.232.10
  191.242.232.33
-191.242.61.193
-191.243.187.88
  191.243.221.6
  191.243.3.172
+191.243.31.7
  191.243.31.98
  191.243.54.245
  191.243.72.2
  191.243.72.34
-191.246.122.168
  191.248.206.172
  191.250.194.37
  191.250.238.185
+191.250.251.1
  191.252.113.123
  191.252.120.133
  191.252.205.120
@@ -47504,16 +47407,16 @@
  191.30.231.31
  191.31.104.17
  191.31.17.212
+191.31.172.222
  191.31.20.83
  191.31.31.21
  191.33.23.40
  191.35.189.163
  191.36.173.34
  191.37.0.214
-191.37.0.223
-191.37.129.89
  191.37.145.148
  191.37.145.231
+191.37.147.106
  191.37.147.55
  191.37.165.82
  191.37.165.84
@@ -47526,9 +47429,10 @@
  191.5.55.7
  191.53.112.170
  191.54.124.64
-191.55.188.104
  191.55.188.172
  191.55.189.234
+191.55.190.136
+191.55.190.164
  191.6.132.105
  191.6.132.126
  191.6.132.65
@@ -47562,12 +47466,13 @@
  191.7.211.234
  191.7.215.236
  191.8.89.80
-191.81.19.137
-191.84.192.228
-191.89.226.182
+191.82.188.45
  191.89.80.21
+191.96.103.153
+191.96.103.190
  191.96.149.36
  191.96.164.95
+191.96.17.152
  191.96.170.107
  191.96.191.195
  191.96.232.207
@@ -47577,23 +47482,20 @@
  191.96.249.3
  191.96.249.4
  191.96.25.226
-191.96.250.176
-191.96.250.219
  191.96.252.145
  191.96.253.10
-191.96.253.104
  191.96.253.122
  191.96.253.60
  191.96.253.77
-191.96.32.10
-191.96.32.135
  191.96.32.177
  191.96.43.183
  191.96.63.162
-191.97.11.121
+191.97.12.212
  191.97.3.195
+191.97.4.238
  191.97.53.43
  191.97.53.72
+191.97.56.119
  191.97.6.213
  191.97.7.165
  191.98.144.217
@@ -47621,19 +47523,15 @@
  191gm.com
  192-168-1-45.000webhostapp.com
  192.0.102.194
-192.0.82.48
  192.100.213.83
  192.109.110.108
  192.109.110.137
  192.109.110.14
-192.109.110.144
  192.109.110.150
  192.109.110.4
  192.109.165.108
  192.109.165.129
-192.109.165.139
  192.109.165.222
-192.109.165.55
  192.109.210.172
  192.111.129.150
  192.111.130.2
@@ -47643,6 +47541,7 @@
  192.111.138.29
  192.111.139.162
  192.111.139.165
+192.111.143.93
  192.111.146.37
  192.116.142.153
  192.117.146.110
@@ -47677,6 +47576,7 @@
  192.12.112.66
  192.12.112.68
  192.121.16.196
+192.124.170.105
  192.126.156.1
  192.126.156.108
  192.126.156.42
@@ -47692,7 +47592,6 @@
  192.126.162.243
  192.126.162.52
  192.126.204.22
-192.126.226.143
  192.126.226.210
  192.126.243.49
  192.126.243.56
@@ -47703,6 +47602,7 @@
  192.129.212.87
  192.129.227.26
  192.129.245.69
+192.130.146.163
  192.139.15.34
  192.139.35.143
  192.140.42.28
@@ -47733,6 +47633,7 @@
  192.144.167.212
  192.144.170.155
  192.144.171.119
+192.144.171.165
  192.144.172.241
  192.144.184.208
  192.144.185.202
@@ -47757,6 +47658,7 @@
  192.144.227.166
  192.144.227.36
  192.144.227.85
+192.144.228.16
  192.144.228.40
  192.144.230.43
  192.144.232.129
@@ -47781,7 +47683,6 @@
  192.145.239.221
  192.145.239.48
  192.145.37.43
-192.145.39.56
  192.145.45.196
  192.146.137.18
  192.151.144.234
@@ -47803,18 +47704,17 @@
  192.160.102.168
  192.160.102.169
  192.160.102.170
-192.160.250.230
  192.161.165.180
  192.161.172.215
  192.161.190.171
  192.161.48.61
  192.161.55.6
  192.161.55.68
+192.161.56.56
  192.162.101.35
  192.162.102.44
  192.162.132.51
  192.162.165.23
-192.162.192.148
  192.162.193.243
  192.162.238.211
  192.162.244.36
@@ -47827,6 +47727,7 @@
  192.163.199.254
  192.163.221.191
  192.166.128.1
+192.166.132.159
  192.166.219.198
  192.166.219.200
  192.166.223.155
@@ -47834,9 +47735,9 @@
  192.169.154.40
  192.169.176.66
  192.169.189.120
+192.169.201.116
  192.169.201.143
  192.169.201.24
-192.169.217.153
  192.169.227.134
  192.169.243.124
  192.169.6.101
@@ -47846,32 +47747,35 @@
  192.169.7.120
  192.169.7.152
  192.169.7.80
-192.171.81.120
  192.171.83.115
  192.171.91.57
  192.175.111.212
  192.180.191.44
  192.182.157.119
+192.185.129.72
  192.185.129.96
+192.185.130.170
  192.185.2.172
  192.185.4.62
+192.186.130.130
  192.186.130.134
  192.186.131.26
  192.186.134.116
  192.186.134.153
-192.186.134.158
  192.186.134.53
  192.186.134.60
+192.186.134.62
  192.186.134.92
  192.186.143.127
+192.186.143.16
+192.186.145.115
+192.186.145.30
  192.186.145.58
-192.186.145.62
-192.186.151.56
  192.186.153.235
  192.186.158.242
  192.186.160.182
  192.186.161.201
-192.186.161.227
+192.186.162.27
  192.186.168.230
  192.186.168.238
  192.186.171.134
@@ -47880,18 +47784,16 @@
  192.186.171.237
  192.186.171.28
  192.186.172.112
-192.186.175.188
  192.186.177.16
  192.186.177.248
-192.186.177.30
+192.186.180.128
  192.186.180.134
+192.186.180.146
  192.186.180.151
  192.186.180.252
  192.186.182.46
-192.186.182.47
-192.186.182.56
-192.186.182.60
  192.186.182.73
+192.186.182.75
  192.186.190.148
  192.187.110.198
  192.187.121.46
@@ -47909,21 +47811,21 @@
  192.198.104.85
  192.198.114.129
  192.198.114.142
+192.198.114.179
+192.198.114.180
  192.198.114.184
  192.198.118.166
-192.198.118.177
  192.198.118.178
  192.198.118.180
  192.198.119.20
  192.198.119.52
  192.198.122.244
-192.198.122.247
  192.198.122.248
-192.198.124.164
  192.198.125.142
  192.198.126.11
  192.198.126.154
  192.198.127.148
+192.198.127.21
  192.198.127.28
  192.198.82.51
  192.198.82.57
@@ -47939,26 +47841,30 @@
  192.199.249.78
  192.199.53.131
  192.200.122.226
-192.200.158.181
+192.200.158.142
+192.200.158.153
+192.200.158.233
  192.200.158.246
+192.200.158.89
  192.200.192.2
  192.200.215.162
  192.200.215.90
  192.204.197.190
  192.210.132.155
+192.210.137.187
  192.210.140.199
  192.210.144.5
  192.210.152.26
  192.210.164.251
  192.210.165.87
+192.210.176.17
  192.210.181.231
-192.210.181.244
  192.210.185.104
-192.210.185.116
-192.210.185.117
+192.210.185.113
  192.210.185.125
-192.210.185.193
+192.210.185.126
  192.210.186.147
+192.210.186.156
  192.210.188.137
  192.210.188.164
  192.210.194.179
@@ -47976,8 +47882,8 @@
  192.210.226.106
  192.210.226.125
  192.210.229.116
-192.210.231.101
  192.210.236.38
+192.210.239.10
  192.210.239.115
  192.210.240.152
  192.211.58.74
@@ -47991,27 +47897,29 @@
  192.225.227.43
  192.226.183.184
  192.227.113.71
-192.227.134.71
  192.227.137.250
  192.227.137.251
  192.227.137.42
+192.227.138.100
  192.227.138.105
+192.227.138.106
  192.227.138.110
  192.227.138.117
  192.227.138.125
  192.227.138.126
  192.227.138.244
+192.227.138.68
  192.227.138.88
  192.227.139.234
+192.227.140.156
  192.227.152.253
  192.227.158.103
-192.227.158.180
  192.227.158.221
+192.227.158.224
  192.227.158.230
  192.227.158.238
  192.227.158.239
  192.227.159.102
-192.227.171.56
  192.227.172.251
  192.227.176.61
  192.227.180.108
@@ -48025,16 +47933,20 @@
  192.227.207.84
  192.227.207.90
  192.227.209.213
-192.227.209.227
  192.227.209.228
-192.227.209.241
-192.227.212.233
+192.227.209.232
+192.227.211.48
  192.227.214.146
  192.227.214.92
  192.227.215.147
  192.227.217.122
+192.227.219.215
  192.227.233.8
+192.227.237.106
+192.227.237.2
+192.227.237.85
  192.227.238.209
+192.227.246.40
  192.227.247.172
  192.227.248.222
  192.227.249.187
@@ -48056,9 +47968,11 @@
  192.236.147.67
  192.236.154.89
  192.236.155.130
+192.236.160.138
  192.236.160.24
  192.236.161.206
  192.236.161.98
+192.236.162.246
  192.236.162.32
  192.236.162.48
  192.236.163.200
@@ -48068,7 +47982,6 @@
  192.236.176.44
  192.236.177.142
  192.236.177.39
-192.236.177.40
  192.236.192.114
  192.236.192.170
  192.236.192.73
@@ -48087,8 +48000,9 @@
  192.241.106.86
  192.241.106.95
  192.241.110.54
-192.241.111.3
+192.241.111.12
  192.241.113.192
+192.241.113.207
  192.241.129.176
  192.241.130.65
  192.241.131.150
@@ -48147,11 +48061,13 @@
  192.241.184.220
  192.241.185.120
  192.241.185.214
+192.241.195.30
  192.241.195.43
  192.241.196.148
  192.241.196.201
  192.241.196.22
  192.241.196.238
+192.241.197.146
  192.241.197.245
  192.241.200.176
  192.241.200.243
@@ -48160,14 +48076,10 @@
  192.241.201.227
  192.241.202.169
  192.241.203.105
-192.241.204.148
-192.241.204.160
-192.241.205.39
+192.241.206.208
  192.241.206.246
  192.241.206.48
-192.241.207.138
  192.241.209.101
-192.241.209.229
  192.241.209.46
  192.241.210.14
  192.241.210.224
@@ -48176,31 +48088,27 @@
  192.241.213.38
  192.241.215.116
  192.241.215.124
+192.241.215.131
  192.241.215.189
-192.241.217.230
  192.241.217.239
  192.241.217.60
  192.241.218.151
  192.241.218.69
+192.241.219.158
  192.241.219.168
-192.241.219.178
-192.241.219.62
  192.241.220.155
  192.241.220.183
  192.241.220.227
  192.241.220.25
+192.241.221.148
  192.241.221.186
-192.241.221.77
-192.241.222.134
-192.241.222.168
-192.241.222.251
  192.241.222.89
-192.241.223.210
+192.241.223.115
  192.241.223.211
-192.241.223.228
-192.241.223.68
+192.241.223.35
+192.241.224.157
+192.241.225.100
  192.241.225.203
-192.241.225.48
  192.241.225.55
  192.241.226.82
  192.241.227.59
@@ -48222,21 +48130,21 @@
  192.241.64.114
  192.241.64.245
  192.241.64.249
-192.241.64.252
  192.241.64.3
  192.241.64.30
+192.241.64.91
  192.241.65.35
  192.241.70.54
  192.241.77.173
  192.241.80.139
  192.241.80.150
-192.241.80.17
+192.241.80.170
  192.241.80.173
+192.241.80.174
  192.241.80.197
-192.241.80.21
  192.241.80.254
-192.241.84.112
  192.241.84.117
+192.241.94.202
  192.241.98.88
  192.241.98.93
  192.243.100.114
@@ -48255,7 +48163,6 @@
  192.243.55.137
  192.243.55.138
  192.248.144.91
-192.248.190.183
  192.249.47.172
  192.249.53.67
  192.249.73.222
@@ -48519,12 +48426,14 @@
  192.252.213.182
  192.252.215.2
  192.252.215.5
+192.252.215.6
+192.252.220.90
  192.252.222.38
-192.252.235.84
+192.252.235.78
  192.253.243.25
  192.253.245.222
  192.253.253.15
-192.253.253.19
+192.253.253.48
  192.254.173.31
  192.254.193.145
  192.254.210.74
@@ -48547,13 +48456,11 @@
  192.3.126.42
  192.3.126.47
  192.3.126.52
-192.3.135.17
+192.3.136.144
  192.3.136.149
-192.3.136.158
  192.3.138.122
-192.3.139.150
+192.3.139.145
  192.3.139.56
-192.3.139.71
  192.3.139.89
  192.3.139.90
  192.3.140.202
@@ -48562,11 +48469,10 @@
  192.3.141.139
  192.3.141.157
  192.3.142.83
-192.3.158.132
+192.3.143.171
  192.3.161.156
  192.3.170.110
  192.3.179.196
-192.3.180.215
  192.3.180.251
  192.3.182.124
  192.3.185.210
@@ -48578,27 +48484,26 @@
  192.3.188.97
  192.3.193.251
  192.3.194.169
-192.3.2.83
  192.3.2.85
-192.3.2.89
-192.3.203.133
  192.3.203.158
+192.3.203.183
  192.3.203.188
+192.3.203.191
  192.3.203.55
  192.3.203.61
  192.3.207.170
-192.3.208.103
+192.3.208.190
  192.3.208.68
  192.3.208.72
  192.3.208.90
  192.3.209.168
  192.3.214.5
-192.3.214.57
  192.3.214.58
  192.3.215.206
  192.3.22.50
-192.3.228.57
  192.3.23.41
+192.3.241.5
+192.3.242.147
  192.3.245.103
  192.3.247.112
  192.3.247.119
@@ -48609,8 +48514,8 @@
  192.3.255.169
  192.3.27.185
  192.3.28.114
+192.3.28.238
  192.3.28.245
-192.3.28.36
  192.3.28.39
  192.3.31.212
  192.3.31.213
@@ -48618,15 +48523,13 @@
  192.3.31.220
  192.3.41.116
  192.3.41.172
+192.3.41.3
  192.3.45.185
  192.3.57.141
-192.3.57.158
  192.3.57.192
  192.3.67.106
  192.3.7.118
  192.3.8.178
-192.3.9.207
-192.3.99.28
  192.34.56.82
  192.34.57.210
  192.34.57.220
@@ -48637,15 +48540,12 @@
  192.34.62.193
  192.34.62.208
  192.34.80.176
-192.35.168.16
-192.35.168.64
  192.36.27.4
  192.40.57.240
  192.40.57.59
  192.40.95.121
  192.40.95.185
  192.40.95.186
-192.40.95.192
  192.40.95.211
  192.40.95.217
  192.40.95.220
@@ -48683,20 +48583,21 @@
  192.46.228.131
  192.46.232.37
  192.46.233.8
+192.46.237.23
+192.46.237.29
  192.52.166.9
  192.52.167.130
  192.52.167.145
  192.52.167.219
  192.52.167.228
  192.52.242.27
-192.53.173.14
+192.53.173.42
  192.64.113.72
  192.64.114.214
  192.64.114.83
  192.64.114.84
  192.64.118.132
  192.64.52.124
-192.65.170.15
  192.69.235.189
  192.71.201.87
  192.71.213.69
@@ -48707,7 +48608,7 @@
  192.81.135.190
  192.81.135.30
  192.81.209.190
-192.81.209.250
+192.81.210.142
  192.81.210.179
  192.81.211.68
  192.81.211.71
@@ -48734,9 +48635,11 @@
  192.91.198.155
  192.95.12.175
  192.95.18.190
+192.95.21.244
  192.95.24.39
  192.95.29.218
  192.95.29.97
+192.95.30.137
  192.95.30.185
  192.95.30.59
  192.95.31.71
@@ -48761,7 +48664,6 @@
  192.99.13.29
  192.99.135.207
  192.99.137.85
-192.99.14.132
  192.99.14.159
  192.99.14.187
  192.99.14.189
@@ -48778,20 +48680,25 @@
  192.99.166.42
  192.99.168.9
  192.99.169.223
+192.99.174.111
+192.99.188.171
  192.99.19.154
  192.99.195.48
  192.99.2.41
  192.99.200.213
  192.99.200.69
+192.99.240.77
  192.99.245.135
  192.99.245.80
  192.99.247.102
  192.99.252.90
+192.99.31.122
  192.99.32.109
  192.99.34.142
  192.99.35.135
  192.99.35.149
  192.99.36.177
+192.99.4.179
  192.99.4.59
  192.99.4.63
  192.99.41.136
@@ -48809,8 +48716,7 @@
  192.99.8.102
  192.99.8.157
  192.99.83.47
-192.99.83.52
-192.99.9.119
+192.99.98.209
  192.99.98.86
  1929128.servicesbpd.club
  192mobility0040.info
@@ -48826,13 +48732,10 @@
  193.105.62.11
  193.105.7.24
  193.105.83.6
-193.106.109.180
  193.106.130.249
  193.106.175.103
  193.106.231.145
  193.106.240.225
-193.106.243.238
-193.106.243.24
  193.106.28.8
  193.106.29.2
  193.106.29.98
@@ -48843,13 +48746,13 @@
  193.106.31.42
  193.106.58.51
  193.106.60.145
+193.107.132.228
  193.107.156.70
  193.107.156.73
  193.107.16.111
  193.107.16.183
  193.107.19.203
  193.107.193.43
-193.107.219.80
  193.107.221.176
  193.107.236.167
  193.107.255.62
@@ -48875,12 +48778,12 @@
  193.111.152.64
  193.111.152.71
  193.111.156.2
+193.111.188.111
  193.111.38.178
-193.111.4.133
-193.111.4.140
  193.111.4.157
  193.111.4.168
  193.111.5.182
+193.111.76.194
  193.112.1.26
  193.112.100.26
  193.112.102.52
@@ -48926,6 +48829,7 @@
  193.112.4.12
  193.112.40.110
  193.112.42.13
+193.112.49.125
  193.112.49.216
  193.112.5.66
  193.112.54.76
@@ -48934,27 +48838,28 @@
  193.112.66.187
  193.112.70.95
  193.112.72.251
+193.112.72.37
  193.112.73.244
  193.112.78.90
  193.112.79.20
  193.112.85.35
  193.112.86.231
  193.112.9.233
+193.112.93.94
  193.112.94.225
  193.112.98.79
-193.114.142.226
  193.115.108.30
  193.116.241.161
+193.117.138.126
+193.119.124.111
  193.122.10.91
  193.122.104.122
  193.122.106.37
  193.122.120.19
  193.122.124.119
  193.122.125.64
-193.122.126.244
  193.122.134.181
  193.122.163.242
-193.122.166.29
  193.122.2.165
  193.123.228.215
  193.123.32.230
@@ -49002,14 +48907,11 @@
  193.150.153.32
  193.150.170.204
  193.150.233.115
-193.150.252.38
  193.151.118.207
  193.151.12.117
-193.151.130.115
-193.154.220.35
-193.159.136.169
+193.152.253.190
+193.159.135.159
  193.159.33.122
-193.160.10.242
  193.164.131.14
  193.164.131.223
  193.164.133.75
@@ -49039,7 +48941,11 @@
  193.169.245.78
  193.169.245.81
  193.169.245.87
+193.169.252.10
  193.169.252.142
+193.169.252.3
+193.169.252.66
+193.169.252.7
  193.169.252.8
  193.169.252.81
  193.169.252.82
@@ -49056,6 +48962,7 @@
  193.169.254.235
  193.169.254.63
  193.169.255.0
+193.169.255.207
  193.169.255.230
  193.169.255.231
  193.169.255.232
@@ -49068,12 +48975,6 @@
  193.169.61.162
  193.17.184.250
  193.173.196.50
-193.176.186.108
-193.176.186.145
-193.176.186.218
-193.176.186.238
-193.176.186.41
-193.176.186.51
  193.176.240.194
  193.176.242.137
  193.176.84.120
@@ -49081,19 +48982,19 @@
  193.176.84.122
  193.176.84.128
  193.176.84.129
+193.176.84.189
  193.176.84.83
  193.176.84.88
  193.176.84.90
-193.176.85.109
  193.176.85.112
  193.176.85.82
  193.178.147.11
-193.178.169.221
  193.178.169.252
+193.178.50.49
+193.179.204.46
+193.183.217.2
  193.183.244.183
  193.187.93.23
-193.188.113.175
-193.188.119.78
  193.188.254.67
  193.189.117.189
  193.189.117.243
@@ -49108,8 +49009,9 @@
  193.19.165.222
  193.19.228.212
  193.19.243.246
+193.19.96.152
+193.192.122.65
  193.193.194.194
-193.193.224.170
  193.193.240.34
  193.193.240.36
  193.193.71.178
@@ -49140,8 +49042,11 @@
  193.202.80.29
  193.202.81.191
  193.202.87.216
+193.205.22.181
+193.206.68.115
  193.213.10.205
  193.213.89.72
+193.215.168.206
  193.216.178.70
  193.218.118.100
  193.218.118.116
@@ -49157,15 +49062,14 @@
  193.218.118.62
  193.218.118.90
  193.218.118.95
+193.218.38.169
  193.219.38.56
  193.221.196.130
  193.222.130.14
  193.224.96.3
  193.225.126.2
-193.226.199.110
  193.226.215.224
  193.227.111.34
-193.227.16.160
  193.227.49.81
  193.227.5.230
  193.228.108.122
@@ -49186,7 +49090,6 @@
  193.228.58.90
  193.228.59.17
  193.228.59.215
-193.228.59.239
  193.228.59.80
  193.228.91.105
  193.228.91.109
@@ -49194,10 +49097,10 @@
  193.228.91.119
  193.228.91.123
  193.228.91.124
+193.23.249.137
  193.231.187.33
  193.232.117.129
  193.232.68.70
-193.233.14.18
  193.233.6.156
  193.233.9.167
  193.234.224.132
@@ -49215,22 +49118,18 @@
  193.239.147.103
  193.239.147.110
  193.239.147.125
-193.239.147.139
  193.239.147.148
-193.239.147.160
-193.239.147.195
+193.239.147.165
  193.239.147.208
  193.239.147.213
  193.239.147.22
  193.239.147.221
  193.239.147.226
-193.239.147.227
  193.239.147.229
  193.239.147.32
-193.239.147.51
+193.239.147.5
  193.239.147.52
  193.239.147.60
-193.239.147.62
  193.239.147.66
  193.239.147.84
  193.239.178.44
@@ -49241,11 +49140,10 @@
  193.239.232.102
  193.239.4.3
  193.239.59.225
-193.239.84.122
+193.239.84.125
  193.239.86.247
  193.239.86.248
  193.242.108.63
-193.242.133.24
  193.242.177.105
  193.242.213.18
  193.243.164.24
@@ -49254,10 +49152,12 @@
  193.243.164.60
  193.247.213.196
  193.248.172.203
+193.248.233.176
  193.248.247.215
  193.248.249.253
  193.25.103.173
  193.25.197.129
+193.250.217.164
  193.251.6.236
  193.252.149.16
  193.252.173.80
@@ -49265,7 +49165,6 @@
  193.252.8.76
  193.253.116.163
  193.254.184.188
-193.254.193.85
  193.26.156.69
  193.27.13.180
  193.27.19.92
@@ -49275,7 +49174,6 @@
  193.29.104.90
  193.29.104.99
  193.29.13.84
-193.29.14.105
  193.29.14.132
  193.29.187.214
  193.29.187.218
@@ -49291,6 +49189,7 @@
  193.32.161.77
  193.32.164.23
  193.32.164.27
+193.32.235.184
  193.32.70.105
  193.34.144.138
  193.34.161.137
@@ -49318,14 +49217,14 @@
  193.38.51.25
  193.39.185.214
  193.40.10.82
+193.40.103.45
  193.40.128.185
  193.41.122.18
  193.41.122.34
+193.41.253.100
  193.41.86.136
-193.41.86.147
-193.41.86.150
  193.41.86.164
-193.41.87.171
+193.41.86.176
  193.42.110.30
  193.42.122.25
  193.42.96.108
@@ -49337,7 +49236,6 @@
  193.46.202.3
  193.46.255.14
  193.46.255.17
-193.46.255.44
  193.56.240.213
  193.56.252.231
  193.56.252.250
@@ -49346,29 +49244,34 @@
  193.56.255.131
  193.56.255.179
  193.56.255.180
+193.56.255.212
  193.56.28.0
  193.56.28.119
  193.56.28.122
+193.56.28.160
  193.56.28.177
+193.56.28.182
  193.56.28.184
  193.56.28.218
  193.56.29.104
  193.56.29.118
-193.56.29.123
  193.56.29.127
-193.56.29.138
-193.56.29.150
+193.56.29.137
+193.56.29.22
  193.56.29.25
  193.56.29.251
+193.56.29.32
  193.56.29.36
+193.56.29.44
  193.56.29.45
  193.56.64.51
+193.56.75.141
  193.58.196.212
  193.59.26.243
  193.59.26.248
  193.59.26.46
  193.59.27.83
-193.66.200.162
+193.68.152.102
  193.68.19.34
  193.68.200.227
  193.68.41.17
@@ -49395,9 +49298,9 @@
  193.75.59.136
  193.77.117.97
  193.77.159.82
-193.77.184.149
  193.77.242.110
  193.8.194.96
+193.8.231.193
  193.83.42.124
  193.83.46.194
  193.84.116.22
@@ -49405,12 +49308,12 @@
  193.85.228.178
  193.85.228.182
  193.86.118.16
-193.87.1.94
  193.87.81.18
  193.87.81.20
  193.87.99.18
  193.9.115.115
  193.9.115.116
+193.9.115.117
  193.9.115.118
  193.9.115.119
  193.9.115.120
@@ -49427,9 +49330,9 @@
  193.90.146.39
  193.93.192.223
  193.93.192.73
+193.93.194.231
  193.93.195.137
  193.93.195.232
-193.93.216.63
  193.93.219.102
  193.95.228.13
  193.95.24.114
@@ -49444,9 +49347,10 @@
  194.102.40.134
  194.104.11.78
  194.104.9.120
+194.104.9.135
+194.104.9.204
  194.105.205.42
  194.105.25.25
-194.105.58.135
  194.105.60.210
  194.106.192.6
  194.106.99.119
@@ -49455,7 +49359,6 @@
  194.110.115.204
  194.110.115.211
  194.110.115.230
-194.110.212.4
  194.113.107.233
  194.113.107.80
  194.113.164.180
@@ -49469,10 +49372,10 @@
  194.126.183.171
  194.127.172.92
  194.127.179.119
+194.127.179.176
  194.135.135.69
  194.135.15.6
  194.135.75.74
-194.135.87.3
  194.135.92.96
  194.135.97.126
  194.14.246.205
@@ -49488,7 +49391,6 @@
  194.143.194.107
  194.143.229.6
  194.143.248.145
-194.143.248.160
  194.143.248.168
  194.143.248.179
  194.143.248.46
@@ -49496,20 +49398,17 @@
  194.143.249.103
  194.143.249.115
  194.143.249.118
+194.143.249.147
  194.143.249.229
-194.143.249.232
-194.143.249.249
  194.143.249.65
  194.143.249.90
  194.143.250.139
  194.143.250.32
  194.143.250.60
-194.143.250.86
  194.143.251.14
  194.143.251.180
  194.143.251.183
  194.143.251.186
-194.143.251.210
  194.143.251.236
  194.143.251.244
  194.143.251.40
@@ -49528,10 +49427,7 @@
  194.147.115.80
  194.147.115.95
  194.147.140.101
-194.147.140.102
-194.147.140.103
  194.147.140.107
-194.147.140.108
  194.147.140.150
  194.147.140.151
  194.147.140.153
@@ -49545,21 +49441,19 @@
  194.147.140.27
  194.147.140.31
  194.147.140.32
-194.147.140.40
  194.147.140.42
  194.147.140.50
-194.147.140.66
  194.147.140.68
  194.147.140.69
  194.147.140.70
  194.147.140.85
  194.147.140.86
  194.147.140.87
-194.147.142.226
+194.147.140.88
  194.147.32.101
+194.147.34.66
  194.147.34.74
-194.147.89.116
-194.147.89.118
+194.147.50.0
  194.15.112.174
  194.15.36.10
  194.15.36.102
@@ -49592,65 +49486,51 @@
  194.15.36.96
  194.15.36.97
  194.150.118.7
-194.150.197.205
  194.150.214.114
  194.150.214.119
-194.150.214.120
+194.150.214.122
  194.150.214.123
  194.150.214.126
-194.150.214.132
-194.150.214.133
-194.150.214.135
  194.150.214.136
  194.150.214.138
  194.150.214.140
  194.150.214.142
  194.150.215.101
-194.150.215.137
-194.150.215.148
  194.150.215.150
  194.150.215.152
  194.150.215.154
  194.150.215.220
-194.150.215.222
  194.150.215.224
-194.150.215.226
  194.150.215.227
-194.150.215.228
  194.150.215.23
  194.150.215.230
-194.150.215.231
  194.150.215.233
  194.150.215.234
  194.150.215.235
  194.150.215.236
  194.150.215.237
-194.150.215.243
+194.150.215.244
  194.150.215.66
-194.150.215.82
  194.150.235.100
  194.150.235.101
  194.150.235.102
-194.150.235.104
-194.150.235.105
-194.150.235.109
+194.150.235.103
  194.150.235.110
  194.150.235.113
  194.150.235.115
-194.150.235.116
-194.150.235.117
+194.150.235.125
  194.150.235.127
+194.150.235.128
  194.150.235.129
  194.150.235.130
-194.150.235.131
  194.150.235.132
  194.150.235.133
  194.150.235.135
  194.150.235.24
  194.150.235.87
  194.150.235.91
-194.150.235.94
  194.150.235.95
+194.150.235.99
  194.150.253.204
  194.150.255.200
  194.152.206.103
@@ -49661,10 +49541,11 @@
  194.152.214.252
  194.152.220.157
  194.152.46.59
+194.154.144.61
+194.154.147.233
  194.154.148.69
  194.154.82.74
  194.156.123.56
-194.156.124.131
  194.156.125.181
  194.156.125.216
  194.156.175.144
@@ -49677,17 +49558,15 @@
  194.156.96.206
  194.156.97.147
  194.158.200.244
-194.158.208.75
  194.158.210.79
  194.160.76.5
  194.166.147.195
  194.166.33.176
-194.166.76.180
  194.168.134.206
  194.170.156.9
+194.171.73.163
  194.176.118.175
  194.176.118.247
-194.177.22.81
  194.180.110.10
  194.180.12.97
  194.180.224.10
@@ -49717,6 +49596,7 @@
  194.186.234.162
  194.186.249.22
  194.187.110.38
+194.187.151.237
  194.187.170.102
  194.187.170.106
  194.187.170.109
@@ -49746,24 +49626,24 @@
  194.187.249.76
  194.190.143.48
  194.190.67.75
-194.190.86.5
  194.190.93.136
  194.190.96.114
  194.193.130.91
+194.201.253.190
  194.201.253.5
  194.204.194.11
-194.207.254.77
  194.208.68.180
  194.213.43.166
+194.219.40.94
  194.219.62.23
  194.223.60.210
-194.225.167.210
  194.225.58.214
  194.226.61.18
  194.226.61.26
  194.228.129.189
  194.228.84.10
-194.242.120.213
+194.230.146.36
+194.24.228.27
  194.244.16.53
  194.244.16.58
  194.246.105.27
@@ -49777,18 +49657,19 @@
  194.28.215.201
  194.28.222.1
  194.28.223.242
+194.28.85.46
  194.28.98.75
  194.31.44.203
  194.31.53.108
+194.31.59.16
  194.32.76.204
  194.32.76.210
  194.32.79.210
-194.33.61.83
  194.34.246.183
  194.35.12.125
  194.35.233.158
+194.35.233.67
  194.35.248.23
-194.36.167.37
  194.36.188.112
  194.36.188.12
  194.36.189.177
@@ -49808,19 +49689,23 @@
  194.36.98.75
  194.36.99.80
  194.37.81.243
+194.37.96.200
  194.38.0.163
+194.38.138.6
  194.38.146.73
  194.39.127.40
  194.4.58.192
  194.4.58.215
  194.42.16.25
  194.44.146.181
+194.44.170.202
  194.44.172.114
  194.44.20.22
  194.44.230.115
  194.44.230.122
  194.44.230.135
  194.44.243.186
+194.44.244.134
  194.44.244.187
  194.44.61.82
  194.44.86.243
@@ -49838,9 +49723,11 @@
  194.5.178.148
  194.5.178.182
  194.5.178.92
+194.5.188.193
  194.5.192.228
  194.5.193.149
  194.5.205.176
+194.5.53.69
  194.5.79.166
  194.5.96.60
  194.5.97.131
@@ -49849,7 +49736,6 @@
  194.54.160.248
  194.54.161.139
  194.54.56.99
-194.56.226.21
  194.57.131.114
  194.58.102.111
  194.58.102.137
@@ -49860,6 +49746,8 @@
  194.58.120.3
  194.58.182.73
  194.58.34.70
+194.58.68.13
+194.58.68.218
  194.58.68.241
  194.58.68.90
  194.58.97.39
@@ -49883,8 +49771,6 @@
  194.62.6.156
  194.63.143.79
  194.63.235.156
-194.65.78.82
-194.67.199.76
  194.67.203.67
  194.67.215.180
  194.67.78.235
@@ -49895,7 +49781,6 @@
  194.68.27.32
  194.71.130.93
  194.72.112.130
-194.75.84.25
  194.76.114.114
  194.76.114.140
  194.76.114.158
@@ -49942,23 +49827,23 @@
  194.87.18.147
  194.87.190.89
  194.87.238.60
+194.87.39.109
  194.87.94.145
  194.88.107.222
  194.88.107.53
-194.88.143.38
+194.88.143.37
+194.88.143.42
  194.88.158.17
-194.88.35.194
  194.9.177.10
  194.9.177.13
  194.9.178.16
  194.9.178.17
  194.9.37.74
  194.9.70.248
-194.90.129.117
  194.90.160.133
  194.90.73.231
-194.99.104.162
  194.99.20.29
+194.99.24.247
  194.99.24.59
  195.103.51.22
  195.110.147.194
@@ -49976,7 +49861,6 @@
  195.117.55.171
  195.12.49.210
  195.122.226.164
-195.122.249.6
  195.123.188.186
  195.123.209.106
  195.123.212.86
@@ -49985,21 +49869,20 @@
  195.123.237.110
  195.123.240.236
  195.123.242.97
-195.123.243.163
  195.123.245.175
  195.123.247.26
  195.128.103.127
  195.128.118.44
  195.128.119.233
  195.128.119.244
+195.128.126.36
  195.128.174.132
  195.13.201.98
-195.13.39.130
  195.130.152.71
  195.130.73.229
-195.133.10.164
  195.133.220.18
  195.133.242.20
+195.133.57.33
  195.135.194.8
  195.136.10.1
  195.136.10.253
@@ -50009,7 +49892,7 @@
  195.137.74.2
  195.138.73.54
  195.138.82.198
-195.138.83.218
+195.138.87.163
  195.138.90.121
  195.138.91.220
  195.138.92.152
@@ -50024,6 +49907,7 @@
  195.142.135.246
  195.144.205.25
  195.144.21.161
+195.144.21.185
  195.144.21.219
  195.144.21.56
  195.144.219.155
@@ -50034,8 +49918,8 @@
  195.154.102.122
  195.154.102.211
  195.154.105.60
+195.154.107.28
  195.154.108.163
-195.154.108.229
  195.154.111.146
  195.154.112.154
  195.154.112.155
@@ -50062,6 +49946,7 @@
  195.154.183.162
  195.154.185.109
  195.154.185.20
+195.154.185.7
  195.154.187.115
  195.154.187.6
  195.154.188.9
@@ -50086,8 +49971,8 @@
  195.154.222.113
  195.154.223.131
  195.154.225.16
-195.154.231.79
  195.154.233.102
+195.154.237.166
  195.154.240.184
  195.154.241.208
  195.154.250.133
@@ -50096,8 +49981,9 @@
  195.154.255.110
  195.154.26.167
  195.154.26.189
-195.154.27.24
+195.154.27.215
  195.154.27.27
+195.154.27.3
  195.154.29.215
  195.154.33.70
  195.154.41.150
@@ -50108,7 +49994,6 @@
  195.154.50.29
  195.154.54.229
  195.154.56.253
-195.154.58.0
  195.154.60.148
  195.154.61.206
  195.154.86.19
@@ -50119,7 +50004,6 @@
  195.155.232.37
  195.158.109.248
  195.158.16.22
-195.158.220.36
  195.158.26.238
  195.158.28.62
  195.158.3.117
@@ -50149,13 +50033,12 @@
  195.178.106.145
  195.18.224.6
  195.18.33.130
+195.181.168.175
  195.181.170.225
  195.181.170.69
-195.181.172.69
  195.181.172.80
  195.181.215.65
  195.182.131.101
-195.182.147.208
  195.186.64.163
  195.186.81.204
  195.189.203.152
@@ -50169,7 +50052,7 @@
  195.190.166.35
  195.191.214.118
  195.191.32.134
-195.199.151.131
+195.199.181.193
  195.2.92.155
  195.2.92.46
  195.2.93.50
@@ -50198,6 +50081,7 @@
  195.201.57.62
  195.201.71.60
  195.201.77.196
+195.201.83.120
  195.201.87.244
  195.201.94.146
  195.201.95.119
@@ -50207,7 +50091,6 @@
  195.206.105.217
  195.206.105.22
  195.206.105.27
-195.206.105.37
  195.206.105.42
  195.206.106.186
  195.206.106.73
@@ -50290,7 +50173,6 @@
  195.238.85.13
  195.239.115.106
  195.239.178.110
-195.239.183.246
  195.239.185.251
  195.239.235.134
  195.239.243.84
@@ -50300,13 +50182,16 @@
  195.239.7.18
  195.24.129.234
  195.24.207.199
+195.24.207.221
  195.24.61.7
  195.24.64.162
+195.240.153.82
  195.241.146.206
  195.242.145.147
  195.244.209.70
  195.244.36.206
  195.245.112.235
+195.246.120.102
  195.246.120.131
  195.246.120.14
  195.246.120.143
@@ -50324,13 +50209,13 @@
  195.246.120.172
  195.246.120.174
  195.246.120.177
+195.246.120.51
  195.246.120.74
  195.248.241.135
  195.248.242.249
  195.248.254.43
  195.25.101.25
  195.250.143.182
-195.250.77.147
  195.251.143.108
  195.251.200.71
  195.254.134.10
@@ -50352,7 +50237,6 @@
  195.3.195.8
  195.32.106.250
  195.33.206.179
-195.33.206.195
  195.33.240.222
  195.33.246.1
  195.34.221.33
@@ -50360,6 +50244,7 @@
  195.34.242.131
  195.34.78.110
  195.37.209.9
+195.38.126.214
  195.38.35.58
  195.38.98.224
  195.39.114.210
@@ -50367,14 +50252,12 @@
  195.39.243.9
  195.43.3.231
  195.46.105.233
-195.46.124.94
  195.46.20.146
  195.47.243.254
  195.5.163.212
  195.5.246.162
  195.53.165.150
  195.53.237.122
-195.53.49.11
  195.54.160.155
  195.54.160.20
  195.54.160.250
@@ -50392,10 +50275,10 @@
  195.56.63.4
  195.57.96.56
  195.58.38.146
-195.58.38.47
  195.58.38.55
+195.58.38.57
+195.58.39.213
  195.60.174.123
-195.60.175.54
  195.60.190.235
  195.62.32.174
  195.62.32.218
@@ -50406,24 +50289,23 @@
  195.62.46.140
  195.62.46.141
  195.62.46.142
-195.62.46.183
-195.62.46.187
-195.62.46.194
-195.62.46.195
  195.62.46.197
  195.62.46.246
+195.62.46.4
  195.62.46.92
  195.62.53.253
+195.62.53.96
  195.66.166.43
  195.67.139.54
  195.69.140.147
  195.69.187.6
+195.69.197.7
+195.69.218.198
  195.69.221.198
  195.7.9.141
  195.70.32.203
  195.70.43.234
  195.70.60.100
-195.74.38.129
  195.78.112.235
  195.78.93.28
  195.78.94.193
@@ -50443,9 +50325,6 @@
  195.86.221.44
  195.86.221.45
  195.86.221.46
-195.88.121.102
-195.88.121.112
-195.88.152.78
  195.88.184.186
  195.88.192.42
  195.88.208.35
@@ -50462,6 +50341,7 @@
  195.9.89.70
  195.90.208.146
  195.91.236.212
+195.94.146.45
  195.95.131.211
  195.95.131.214
  195.95.131.215
@@ -50476,11 +50356,9 @@
  196.0.113.10
  196.0.58.214
  196.1.238.162
-196.1.239.82
  196.11.80.154
-196.112.193.89
  196.112.9.69
-196.117.89.69
+196.117.138.236
  196.12.186.34
  196.15.133.177
  196.15.168.146
@@ -50491,33 +50369,25 @@
  196.15.249.151
  196.16.1.193
  196.16.11.189
-196.16.160.231
  196.16.180.82
-196.16.223.214
-196.17.65.102
-196.17.66.225
+196.16.242.62
  196.175.251.17
  196.18.157.252
-196.18.218.1
  196.180.54.59
  196.181.184.191
  196.183.230.199
  196.184.35.117
  196.188.104.50
  196.188.115.241
-196.189.56.41
  196.189.91.162
  196.189.91.166
-196.19.226.4
  196.192.181.235
  196.192.185.189
-196.196.112.48
  196.196.116.85
  196.196.147.155
  196.196.147.167
  196.196.147.205
  196.196.147.219
-196.196.147.22
  196.196.147.232
  196.196.147.236
  196.196.147.254
@@ -50536,7 +50406,6 @@
  196.196.160.231
  196.196.194.80
  196.196.194.98
-196.196.195.12
  196.196.195.42
  196.196.197.29
  196.196.198.109
@@ -50548,20 +50417,19 @@
  196.196.216.174
  196.196.220.249
  196.196.222.6
-196.196.222.80
  196.196.224.136
  196.196.224.150
  196.196.224.163
  196.196.246.128
  196.196.246.198
  196.196.255.209
+196.196.31.32
  196.196.34.126
  196.196.34.153
  196.196.34.229
  196.196.34.247
  196.196.34.51
  196.196.37.96
-196.196.39.162
  196.196.47.106
  196.196.47.195
  196.196.50.13
@@ -50581,27 +50449,27 @@
  196.199.122.55
  196.2.13.12
  196.2.14.250
+196.20.169.175
  196.20.68.81
  196.200.16.88
-196.200.181.2
  196.200.39.105
+196.200.39.184
  196.200.39.80
  196.201.224.30
-196.202.153.170
  196.202.202.197
  196.202.220.95
  196.203.219.138
-196.206.113.48
+196.203.25.97
  196.206.48.117
  196.206.83.31
  196.206.87.210
-196.207.176.177
  196.207.184.14
  196.213.65.166
  196.215.192.62
  196.216.220.196
  196.216.220.204
  196.216.73.90
+196.216.94.189
  196.218.180.49
  196.218.23.67
  196.22.215.233
@@ -50614,11 +50482,9 @@
  196.220.42.100
  196.221.145.196
  196.223.136.65
-196.223.152.78
  196.223.160.242
  196.223.234.136
  196.23.22.27
-196.234.201.91
  196.234.248.157
  196.240.104.104
  196.240.104.189
@@ -50627,7 +50493,6 @@
  196.240.105.111
  196.240.105.165
  196.240.105.242
-196.240.105.246
  196.240.105.61
  196.240.109.103
  196.240.109.160
@@ -50638,16 +50503,16 @@
  196.240.109.246
  196.240.109.83
  196.240.143.108
-196.240.237.127
  196.240.237.212
  196.240.237.217
+196.240.237.252
  196.240.250.173
  196.240.250.200
+196.240.250.201
  196.240.250.214
  196.240.250.237
-196.240.250.3
  196.240.250.35
-196.240.250.81
+196.240.250.67
  196.240.254.102
  196.240.254.11
  196.240.254.115
@@ -50656,44 +50521,42 @@
  196.240.254.192
  196.240.254.219
  196.240.254.221
-196.240.254.252
-196.240.254.47
  196.240.254.52
  196.240.254.53
  196.240.254.55
  196.240.51.168
  196.240.51.33
-196.240.57.156
  196.242.10.100
  196.242.10.111
  196.242.10.116
-196.242.10.131
  196.242.10.179
  196.242.10.198
  196.242.10.222
-196.242.10.233
  196.242.10.68
  196.242.10.81
  196.242.114.125
  196.242.114.146
+196.242.114.159
  196.242.114.18
+196.242.114.78
  196.242.178.104
  196.242.178.135
  196.242.178.152
  196.242.178.167
-196.242.178.183
  196.242.178.19
  196.242.178.216
  196.242.178.237
  196.242.178.242
  196.242.178.25
+196.242.178.55
  196.242.178.73
  196.242.195.168
+196.242.195.183
  196.242.195.187
-196.242.195.207
  196.242.195.213
  196.242.195.225
  196.242.195.241
+196.242.195.43
  196.242.195.83
  196.242.195.94
  196.242.20.124
@@ -50705,11 +50568,13 @@
  196.242.200.154
  196.242.200.169
  196.242.200.18
+196.242.200.41
  196.242.200.66
  196.242.200.74
  196.242.200.92
  196.242.21.220
  196.242.21.79
+196.242.244.35
  196.242.244.40
  196.242.47.13
  196.242.47.169
@@ -50717,33 +50582,29 @@
  196.242.47.200
  196.242.47.230
  196.242.47.45
-196.242.57.105
  196.242.57.125
  196.242.84.106
  196.242.84.108
  196.242.84.177
+196.244.191.110
  196.244.200.17
  196.244.200.173
  196.244.200.180
-196.244.200.185
-196.244.200.239
+196.244.200.252
  196.244.200.92
  196.244.4.161
  196.244.4.165
-196.244.4.202
  196.244.4.224
  196.244.4.240
  196.244.4.53
  196.244.4.82
  196.244.4.93
  196.245.148.89
-196.245.158.72
  196.245.164.172
  196.245.184.144
  196.245.184.160
  196.245.184.225
-196.245.185.127
-196.245.185.156
+196.245.185.144
  196.245.185.196
  196.245.185.2
  196.245.185.201
@@ -50751,43 +50612,44 @@
  196.245.185.37
  196.245.185.97
  196.245.187.162
-196.245.216.191
+196.245.187.237
+196.245.216.64
  196.245.216.74
  196.245.237.169
  196.245.250.163
  196.245.254.125
  196.245.254.182
  196.247.160.73
-196.247.168.35
+196.247.163.86
  196.247.17.202
  196.247.17.237
  196.247.18.166
  196.247.18.20
  196.247.192.128
  196.247.192.210
-196.247.192.239
  196.247.192.74
  196.247.205.173
  196.247.205.222
+196.247.205.3
  196.247.212.84
-196.247.213.169
-196.247.224.65
+196.247.235.203
  196.247.40.169
-196.25.128.70
-196.25.230.69
  196.25.237.218
  196.25.94.134
  196.250.150.244
  196.250.39.65
-196.251.237.2
+196.251.236.96
  196.27.106.112
  196.27.107.173
  196.27.107.231
+196.27.118.90
  196.27.127.170
+196.27.127.61
  196.28.226.33
  196.28.234.66
  196.3.100.45
  196.3.171.145
+196.3.193.177
  196.3.97.34
  196.3.97.70
  196.3.99.197
@@ -50804,11 +50666,11 @@
  196.41.2.166
  196.43.169.12
  196.44.10.207
+196.44.176.55
  196.44.182.183
-196.46.199.64
  196.46.39.53
-196.49.1.16
-196.49.1.6
+196.49.1.25
+196.49.1.5
  196.50.196.82
  196.50.247.254
  196.52.10.12
@@ -50819,25 +50681,21 @@
  196.52.43.52
  196.52.60.21
  196.52.84.80
-196.53.110.148
  196.6.112.70
  196.6.232.32
  196.6.234.140
  196.61.32.34
  196.64.123.64
-196.64.126.227
  196.64.53.255
-196.65.108.83
+196.65.172.183
  196.65.49.20
-196.65.61.129
+196.70.30.117
  196.70.45.116
-196.71.250.48
  196.74.122.57
-196.74.62.12
-196.75.48.242
+196.75.210.252
+196.77.7.202
  196.89.132.135
-196.89.211.129
-196.92.5.195
+196.89.206.130
  196.92.5.240
  19618-dot-n-e-w-me-ss-age-po-rt-al.wl.r.appspot.com
  197.0.68.235
@@ -50846,28 +50704,26 @@
  197.1.6.184
  197.1.94.79
  197.10.98.144
-197.118.243.187
  197.13.2.215
  197.136.142.5
  197.14.199.24
  197.14.216.207
  197.14.82.93
  197.148.24.236
+197.149.121.98
  197.149.128.25
  197.149.148.110
-197.153.10.41
+197.153.11.86
  197.153.13.189
-197.153.20.230
+197.153.28.194
  197.155.193.115
  197.155.194.194
  197.155.200.6
  197.155.6.43
-197.156.139.237
  197.156.234.164
  197.156.248.154
  197.156.65.138
  197.156.92.216
-197.156.93.190
  197.157.17.86
  197.157.219.169
  197.157.253.138
@@ -50876,23 +50732,30 @@
  197.157.255.38
  197.159.0.214
  197.159.12.167
+197.159.195.159
  197.159.23.174
  197.159.3.35
+197.185.100.220
  197.185.101.61
-197.185.110.71
-197.185.114.26
+197.185.105.184
  197.185.97.193
+197.185.97.200
  197.185.98.223
+197.188.146.135
  197.188.149.152
+197.188.165.0
+197.188.165.183
+197.188.165.24
  197.2.143.125
  197.2.148.6
  197.2.156.201
  197.200.145.69
  197.206.139.101
+197.207.35.100
+197.210.10.22
  197.210.114.50
  197.210.114.58
  197.210.120.76
-197.210.120.77
  197.210.124.186
  197.210.135.139
  197.210.150.57
@@ -50901,8 +50764,14 @@
  197.210.181.220
  197.210.191.131
  197.210.217.66
+197.210.226.125
+197.210.226.151
+197.210.226.74
+197.210.227.11
  197.210.246.30
+197.210.55.214
  197.210.8.78
+197.211.195.102
  197.211.209.236
  197.211.238.220
  197.211.238.41
@@ -50913,9 +50782,6 @@
  197.211.39.16
  197.211.45.4
  197.211.57.62
-197.214.118.130
-197.218.84.231
-197.218.84.71
  197.220.169.143
  197.221.151.238
  197.221.158.186
@@ -50931,14 +50797,11 @@
  197.231.198.172
  197.231.202.106
  197.231.221.211
-197.232.12.165
  197.232.21.22
  197.232.26.137
  197.232.36.108
-197.232.36.210
  197.232.41.216
  197.232.47.102
-197.232.53.182
  197.232.55.224
  197.232.68.142
  197.232.76.135
@@ -50977,25 +50840,18 @@
  197.234.13.88
  197.234.13.96
  197.234.179.102
-197.234.221.174
-197.234.245.164
  197.234.35.82
  197.234.48.242
  197.235.10.121
-197.237.111.188
  197.237.137.194
-197.237.137.5
  197.237.151.206
-197.237.174.107
  197.237.90.67
-197.238.44.239
+197.238.39.78
  197.238.91.26
-197.240.20.135
  197.240.209.56
-197.240.23.232
  197.240.76.29
-197.242.0.145
  197.242.114.66
+197.242.144.229
  197.242.147.47
  197.242.203.180
  197.242.203.246
@@ -51004,7 +50860,6 @@
  197.245.100.141
  197.245.161.212
  197.245.174.7
-197.245.18.6
  197.245.230.122
  197.245.25.228
  197.245.30.24
@@ -51019,12 +50874,12 @@
  197.248.190.170
  197.248.2.229
  197.248.20.2
-197.248.23.171
  197.25.182.51
  197.250.103.142
  197.250.61.235
  197.250.8.162
  197.251.183.43
+197.251.202.98
  197.251.240.20
  197.254.115.162
  197.254.29.22
@@ -51049,7 +50904,6 @@
  197.39.210.11
  197.40.158.14
  197.40.196.212
-197.42.42.111
  197.45.163.117
  197.45.47.140
  197.5.145.102
@@ -51064,7 +50918,6 @@
  197.5.145.75
  197.5.145.88
  197.5.145.93
-197.50.135.212
  197.51.182.118
  197.51.184.22
  197.51.225.43
@@ -51073,20 +50926,17 @@
  197.52.93.117
  197.53.135.113
  197.53.218.213
-197.53.76.209
  197.62.235.18
+197.81.132.193
  197.85.185.156
  197.88.32.60
  197.89.103.103
  197.89.153.169
-197.89.153.23
-197.89.153.34
  197.89.223.249
  197.89.40.58
  197.89.59.154
  197.89.73.149
  197.89.73.36
-197.98.172.218
  19725.psdzy.com
  1975365.com
  198.0.198.132
@@ -51107,25 +50957,27 @@
  198.100.155.37
  198.100.158.202
  198.100.159.54
+198.101.242.169
  198.105.117.130
  198.105.117.76
  198.106.189.76
  198.12.103.59
  198.12.108.123
-198.12.108.125
-198.12.110.74
+198.12.108.5
+198.12.108.55
+198.12.108.57
+198.12.118.97
  198.12.120.170
  198.12.121.184
  198.12.123.145
-198.12.123.159
-198.12.153.51
-198.12.156.195
+198.12.125.253
  198.12.224.100
  198.12.227.104
  198.12.248.100
  198.12.249.249
-198.12.64.101
-198.12.64.118
+198.12.250.116
+198.12.250.187
+198.12.64.115
  198.12.66.104
  198.12.66.106
  198.12.66.107
@@ -51139,23 +50991,22 @@
  198.12.72.49
  198.12.76.217
  198.12.76.219
+198.12.80.141
  198.12.80.147
-198.12.80.151
+198.12.80.155
  198.12.80.165
  198.12.80.166
+198.12.80.176
  198.12.80.181
  198.12.83.181
  198.12.84.221
  198.12.86.252
  198.12.87.153
  198.12.97.66
-198.13.33.242
  198.13.33.52
  198.13.33.97
  198.13.34.137
  198.13.37.65
-198.13.39.234
-198.13.42.78
  198.13.49.8
  198.13.53.217
  198.13.57.8
@@ -51171,6 +51022,7 @@
  198.144.121.93
  198.144.141.16
  198.144.145.15
+198.144.149.172
  198.144.149.253
  198.144.149.254
  198.144.158.120
@@ -51192,17 +51044,17 @@
  198.154.113.151
  198.154.60.143
  198.154.63.131
-198.154.81.117
+198.154.81.112
  198.154.81.188
  198.154.81.231
  198.154.81.235
-198.154.81.89
-198.154.81.9
  198.154.82.190
  198.154.99.221
+198.16.58.241
  198.167.136.150
  198.167.140.237
-198.181.163.177
+198.181.163.149
+198.181.163.47
  198.181.43.204
  198.187.30.116
  198.187.31.220
@@ -51219,6 +51071,7 @@
  198.199.113.36
  198.199.114.69
  198.199.115.23
+198.199.116.78
  198.199.117.246
  198.199.119.104
  198.199.120.16
@@ -51236,7 +51089,6 @@
  198.199.66.196
  198.199.66.42
  198.199.67.168
-198.199.67.6
  198.199.68.76
  198.199.70.131
  198.199.70.39
@@ -51249,18 +51101,15 @@
  198.199.80.235
  198.199.80.244
  198.199.81.198
-198.199.82.217
  198.199.83.174
  198.199.83.58
  198.199.85.178
-198.199.87.136
  198.199.89.152
  198.199.89.155
  198.199.89.226
  198.199.91.213
  198.199.91.215
  198.199.91.6
-198.199.93.131
  198.199.94.96
  198.199.95.124
  198.199.96.229
@@ -51279,21 +51128,22 @@
  198.2.209.221
  198.2.217.129
  198.20.163.226
+198.20.163.55
  198.20.164.43
-198.20.167.253
  198.20.168.234
  198.20.168.238
-198.20.168.239
  198.20.168.242
  198.20.168.243
-198.20.172.228
  198.20.172.68
  198.20.172.76
  198.20.172.77
+198.20.172.78
+198.20.174.164
  198.20.175.146
  198.20.176.190
  198.20.176.227
  198.20.179.204
+198.20.179.215
  198.20.179.223
  198.20.180.22
  198.20.182.223
@@ -51339,13 +51189,13 @@
  198.211.102.227
  198.211.104.28
  198.211.105.114
-198.211.106.147
  198.211.107.224
-198.211.107.36
  198.211.108.234
+198.211.108.79
  198.211.110.89
  198.211.113.207
  198.211.114.136
+198.211.115.226
  198.211.115.252
  198.211.116.13
  198.211.116.68
@@ -51372,7 +51222,6 @@
  198.211.99.227
  198.211.99.24
  198.211.99.79
-198.217.120.103
  198.23.137.142
  198.23.145.200
  198.23.145.208
@@ -51387,14 +51236,17 @@
  198.23.173.250
  198.23.174.135
  198.23.174.138
+198.23.174.147
  198.23.174.151
  198.23.174.152
  198.23.174.185
  198.23.174.189
+198.23.174.59
  198.23.176.210
  198.23.182.246
  198.23.197.47
  198.23.197.57
+198.23.197.58
  198.23.200.241
  198.23.201.187
  198.23.203.204
@@ -51403,12 +51255,13 @@
  198.23.210.138
  198.23.212.138
  198.23.212.27
+198.23.212.90
  198.23.213.30
  198.23.213.57
-198.23.217.197
  198.23.217.205
  198.23.217.76
  198.23.217.81
+198.23.217.89
  198.23.221.32
  198.23.227.94
  198.23.228.254
@@ -51416,11 +51269,11 @@
  198.23.235.218
  198.23.236.144
  198.23.238.15
+198.23.238.166
  198.23.238.179
  198.23.238.187
  198.23.238.27
  198.23.238.38
-198.23.238.39
  198.23.239.14
  198.23.240.226
  198.23.240.231
@@ -51430,16 +51283,17 @@
  198.23.60.180
  198.23.71.113
  198.23.71.118
+198.233.134.28
  198.24.131.83
  198.24.149.162
  198.240.116.89
-198.245.49.116
  198.245.49.14
  198.245.49.215
  198.245.49.22
  198.245.50.81
  198.245.51.20
  198.245.53.163
+198.245.53.244
  198.245.60.109
  198.245.60.212
  198.245.60.28
@@ -51447,18 +51301,17 @@
  198.245.62.147
  198.245.62.228
  198.245.62.75
-198.245.66.120
  198.245.67.126
  198.245.67.24
-198.245.67.29
  198.245.67.49
  198.245.72.140
-198.245.72.150
  198.245.72.156
  198.245.72.28
  198.245.75.77
  198.245.76.237
  198.245.76.247
+198.245.76.249
+198.251.70.209
  198.251.80.157
  198.251.80.213
  198.251.83.193
@@ -51472,6 +51325,7 @@
  198.27.123.127
  198.27.66.144
  198.27.66.37
+198.27.67.87
  198.27.68.223
  198.27.68.80
  198.27.70.45
@@ -51496,12 +51350,10 @@
  198.44.161.178
  198.44.66.59
  198.46.132.213
-198.46.138.167
  198.46.138.98
  198.46.144.138
  198.46.145.51
  198.46.149.165
-198.46.160.120
  198.46.160.30
  198.46.166.35
  198.46.168.25
@@ -51509,12 +51361,15 @@
  198.46.172.19
  198.46.172.57
  198.46.172.60
+198.46.173.73
  198.46.178.85
  198.46.193.202
  198.46.194.140
  198.46.198.115
  198.46.199.105
+198.46.201.160
  198.46.201.240
+198.46.201.76
  198.46.202.121
  198.46.203.162
  198.46.205.78
@@ -51529,7 +51384,6 @@
  198.46.214.151
  198.46.214.173
  198.46.214.25
-198.46.214.38
  198.46.214.48
  198.46.214.5
  198.46.223.23
@@ -51562,7 +51416,6 @@
  198.50.177.44
  198.50.179.97
  198.50.180.172
-198.50.180.40
  198.50.182.133
  198.50.183.14
  198.50.186.209
@@ -51578,6 +51431,7 @@
  198.50.234.107
  198.50.234.111
  198.50.240.58
+198.50.245.218
  198.50.251.198
  198.52.100.36
  198.52.119.103
@@ -51588,6 +51442,7 @@
  198.54.112.86
  198.54.112.87
  198.54.113.214
+198.54.121.48
  198.54.123.68
  198.54.128.68
  198.54.132.37
@@ -51607,11 +51462,11 @@
  198.57.247.135
  198.57.56.46
  198.58.10.240
+198.58.10.26
  198.58.10.43
  198.58.102.129
  198.58.107.53
  198.58.11.141
-198.58.11.230
  198.58.112.225
  198.58.115.118
  198.58.120.157
@@ -51724,8 +51579,7 @@
  19858327-dot-sydneyma.appspot.com
  198663092739365.cf
  199.101.127.168
-199.102.104.65
-199.102.106.89
+199.102.107.147
  199.102.224.190
  199.115.101.178
  199.115.117.118
@@ -51737,7 +51591,6 @@
  199.115.96.90
  199.116.113.206
  199.116.114.10
-199.116.117.33
  199.119.139.4
  199.119.74.245
  199.127.62.34
@@ -51752,6 +51605,7 @@
  199.15.233.172
  199.15.233.176
  199.15.250.210
+199.15.89.44
  199.167.138.22
  199.168.100.74
  199.168.102.13
@@ -51770,14 +51624,11 @@
  199.187.124.83
  199.187.211.100
  199.187.211.101
-199.187.211.102
  199.187.211.105
  199.187.211.106
  199.187.211.99
  199.188.100.237
  199.188.103.220
-199.188.103.76
-199.188.121.58
  199.188.204.174
  199.188.204.25
  199.188.204.4
@@ -51792,12 +51643,10 @@
  199.19.224.28
  199.19.224.46
  199.19.224.72
-199.19.225.16
  199.19.225.212
  199.19.226.139
  199.19.226.25
  199.19.226.67
-199.19.72.126
  199.19.75.198
  199.19.76.101
  199.192.102.25
@@ -51805,7 +51654,7 @@
  199.192.18.146
  199.192.18.162
  199.192.20.201
-199.192.211.30
+199.192.23.204
  199.192.24.69
  199.192.25.207
  199.192.27.170
@@ -51813,7 +51662,6 @@
  199.192.28.45
  199.192.29.207
  199.192.31.198
-199.193.6.182
  199.193.99.169
  199.195.144.110
  199.195.192.248
@@ -51852,7 +51700,6 @@
  199.229.250.94
  199.231.184.60
  199.231.185.79
-199.231.188.237
  199.231.189.251
  199.231.189.99
  199.233.246.195
@@ -51866,6 +51713,7 @@
  199.247.249.188
  199.247.29.89
  199.247.3.79
+199.247.4.110
  199.247.4.230
  199.247.4.54
  199.247.5.204
@@ -51953,7 +51801,6 @@
  199.249.230.187
  199.249.230.188
  199.249.230.189
-199.249.230.37
  199.249.230.64
  199.249.230.65
  199.249.230.66
@@ -51986,7 +51833,6 @@
  199.34.90.43
  199.4.18.206
  199.48.147.141
-199.48.92.184
  199.58.86.206
  199.58.86.209
  199.58.86.211
@@ -52027,6 +51873,7 @@
  199.87.154.255
  199.89.54.108
  199.96.83.117
+199.96.83.26
  1990.duckdns.org
  1991ford-mustang-rover-ebay-item235464554423432.nominatedayending.xyz
  199231184302.us-south.cf.appdomain.cloud
@@ -52080,6 +51927,7 @@
  1cd678f6.ngrok.io
  1cdaf644-ad3d-4b5e-9225-8751dbe9c11a.godaddysites.com
  1cerb-canada.info
+1chanel.tv-tovar.in.ua
  1checkapp.000webhostapp.com
  1choicepizzacurry.com
  1cibc.com
@@ -52261,15 +52109,17 @@
  2.112.240.141
  2.113.91.186
  2.114.206.97
+2.12.220.76
  2.12.74.78
-2.121.108.94
  2.123.156.227
  2.123.177.1
-2.123.213.54
  2.132.102.224
  2.132.91.60
+2.133.104.116
  2.133.14.82
  2.133.61.161
+2.133.94.26
+2.134.240.207
  2.135.156.230
  2.136.95.251
  2.137.162.255
@@ -52283,40 +52133,43 @@
  2.139.162.80
  2.139.189.242
  2.139.192.164
-2.139.232.101
  2.139.237.110
  2.139.246.31
  2.139.252.47
  2.139.40.238
  2.139.69.101
-2.142.220.207
+2.142.142.196
+2.142.201.127
+2.142.229.203
  2.144.243.102
-2.15.159.201
  2.15.36.216
-2.152.186.187
  2.152.78.124
  2.153.80.222
  2.154.20.238
-2.177.115.1
-2.177.225.236
  2.178.255.157
  2.179.167.112
  2.181.30.47
-2.183.49.38
  2.183.8.121
-2.194.167.21
+2.194.162.31
  2.196.193.181
  2.200.80.116
  2.200.80.49
+2.200.98.123
+2.200.98.198
+2.200.98.253
  2.201.135.143
-2.203.86.160
+2.201.149.125
+2.201.149.133
+2.201.149.252
+2.201.149.39
+2.201.18.200
  2.204.164.151
  2.205.141.204
-2.205.38.23
+2.205.169.193
+2.205.171.199
  2.206.153.205
  2.206.2.177
-2.207.32.186
-2.217.112.164
+2.206.2.215
  2.217.44.77
  2.217.45.18
  2.220.218.135
@@ -52334,55 +52187,50 @@
  2.232.248.6
  2.232.250.91
  2.233.125.227
-2.233.236.201
  2.234.122.191
  2.237.76.249
  2.238.115.47
-2.238.147.10
  2.238.18.160
-2.24.241.154
+2.247.244.113
  2.247.245.70
-2.247.246.164
  2.25.93.113
-2.27.221.150
-2.28.108.159
+2.28.150.234
+2.28.241.250
  2.3.82.208
  2.31.165.78
  2.32.38.166
  2.34.115.234
+2.34.225.140
  2.35.41.59
-2.36.67.194
  2.37.111.40
-2.37.190.142
  2.37.195.10
  2.38.2.58
  2.38.99.79
-2.39.155.31
  2.39.173.126
  2.39.6.194
  2.40.1.53
  2.40.9.246
  2.42.173.240
-2.44.141.53
  2.44.166.148
  2.45.179.5
  2.45.185.2
  2.45.191.223
+2.45.22.160
  2.47.105.89
  2.47.112.152
  2.49.17.223
-2.49.23.89
+2.49.42.77
  2.4buyuklergazete.com
  2.50.114.246
  2.50.117.52
  2.50.159.186
-2.50.19.133
  2.51.26.64
+2.53.190.83
  2.56.101.114
  2.56.101.149
+2.56.101.86
  2.56.139.208
  2.56.62.137
-2.56.62.165
  2.56.8.123
  2.56.8.13
  2.56.99.194
@@ -52394,47 +52242,46 @@
  2.57.122.18
  2.57.122.186
  2.57.122.196
+2.57.122.21
+2.57.122.22
  2.57.122.223
+2.57.122.26
  2.57.122.34
-2.57.122.97
-2.57.169.155
  2.57.254.182
  2.57.90.33
  2.57.90.35
  2.57.90.37
+2.58.12.104
+2.58.12.127
  2.58.12.151
-2.58.12.182
+2.58.12.158
  2.58.12.217
-2.58.12.37
+2.58.12.229
  2.58.12.43
  2.58.12.68
  2.58.12.74
-2.58.13.105
+2.58.12.79
  2.58.16.86
  2.58.16.89
  2.6.185.246
-2.7.57.26
+2.60.108.176
  2.80.210.156
  2.81.248.167
  2.82.164.10
  2.82.167.249
  2.82.170.124
-2.82.237.96
  2.82.75.215
-2.83.154.248
+2.83.25.26
  2.84.232.100
  2.85.139.83
-2.85.36.184
  2.85.41.217
-2.86.50.254
+2.86.205.82
+2.86.48.242
  2.87.117.153
-2.88.54.87
-2.89.57.227
+2.87.117.37
  2.89.82.192
-2.90.76.181
  2.91.232.21
  2.92.39.39
-2.93.231.213
  2.96.22.155
  2.96.36.182
  2.gabung-grup-whatsapp.getsviip7.com
@@ -52449,10 +52296,10 @@
  20.151.104.2
  20.151.19.163
  20.184.15.116
+20.185.182.146
  20.185.193.185
  20.185.247.149
  20.185.39.51
-20.185.40.20
  20.186.110.157
  20.186.32.122
  20.186.72.33
@@ -52461,12 +52308,10 @@
  20.188.60.188
  20.191.119.145
  20.193.226.163
-20.193.247.162
  20.194.0.93
  20.194.50.237
  20.195.12.50
  20.195.185.154
-20.195.56.109
  20.195.9.25
  20.199.40.61
  20.36.17.7
@@ -52479,30 +52324,34 @@
  20.39.42.134
  20.39.49.74
  20.40.146.61
+20.41.86.164
  20.42.108.200
  20.43.39.32
  20.43.59.45
  20.43.60.99
+20.44.161.74
  20.46.114.59
+20.46.122.238
  20.46.224.110
  20.46.250.169
  20.46.41.35
  20.48.0.101
+20.48.116.177
  20.48.117.1
  20.49.178.57
  20.49.186.22
+20.49.211.100
  20.4buyuklergazete.com
  20.50.114.95
  20.50.132.174
  20.51.200.190
-20.51.229.184
  20.52.133.134
+20.52.134.161
  20.52.152.124
  20.52.152.225
  20.52.40.9
  20.53.160.127
  20.55.23.103
-20.55.6.173
  20.56.90.119
  20.57.10.194
  20.57.168.34
@@ -52510,9 +52359,7 @@
  20.62.40.13
  20.64.0.165
  20.64.157.95
-20.65.160.122
  20.65.160.35
-20.69.234.211
  20.71.39.234
  20.71.60.22
  20.72.208.156
@@ -52523,10 +52370,12 @@
  20.83.29.187
  20.84.41.133
  20.84.56.71
+20.86.17.243
  200-365.net
  200.0.46.50
  200.10.37.138
  200.10.37.33
+200.10.37.5
  200.10.85.251
  200.10.96.157
  200.101.209.240
@@ -52543,8 +52392,9 @@
  200.105.194.242
  200.105.201.198
  200.105.209.170
+200.105.212.130
  200.105.212.35
-200.105.212.96
+200.105.215.18
  200.105.242.58
  200.106.147.35
  200.106.236.138
@@ -52566,7 +52416,6 @@
  200.110.187.74
  200.110.188.187
  200.110.188.188
-200.110.202.226
  200.111.120.180
  200.111.167.170
  200.111.182.6
@@ -52575,6 +52424,7 @@
  200.113.106.18
  200.114.142.40
  200.114.213.233
+200.114.242.209
  200.115.157.211
  200.115.48.82
  200.115.53.225
@@ -52587,6 +52437,7 @@
  200.116.198.140
  200.116.198.160
  200.116.198.177
+200.116.198.222
  200.116.226.210
  200.117.154.107
  200.118.122.6
@@ -52613,8 +52464,9 @@
  200.123.233.170bin.sh
  200.123.233.33bin.sh
  200.124.243.62
-200.124.29.19
  200.124.39.148
+200.125.188.82
+200.125.24.218
  200.125.44.242
  200.127.1.233
  200.127.14.97
@@ -52634,9 +52486,11 @@
  200.140.44.245
  200.140.44.246
  200.141.100.54
+200.141.166.170
  200.141.248.186
  200.142.120.234
  200.142.120.90
+200.142.124.146
  200.142.124.30
  200.142.98.115
  200.146.227.146
@@ -52664,7 +52518,6 @@
  200.158.124.146
  200.159.105.20
  200.159.131.50
-200.159.138.132
  200.159.250.2
  200.161.143.194
  200.162.128.211
@@ -52674,9 +52527,7 @@
  200.165.79.34
  200.167.191.101
  200.169.218.172
-200.169.96.12
  200.17.13.3
-200.171.199.178
  200.171.241.71
  200.174.158.26
  200.174.29.2
@@ -52686,15 +52537,15 @@
  200.178.251.146
  200.18.248.196
  200.180.250.197
+200.180.250.200
  200.182.18.82
  200.185.240.213
  200.186.127.211
  200.187.164.32
  200.188.154.9
-200.188.204.80
  200.19.254.179
-200.192.102.160
  200.192.131.74
+200.192.247.123
  200.195.136.12
  200.195.148.18
  200.195.156.242
@@ -52732,7 +52583,6 @@
  200.212.2.88
  200.212.2.94
  200.215.171.238
-200.216.31.148
  200.216.31.20
  200.216.77.154
  200.217.168.98
@@ -52745,6 +52595,7 @@
  200.218.242.145
  200.218.242.181
  200.218.242.213
+200.218.242.33
  200.218.242.37
  200.218.242.53
  200.218.242.77
@@ -52762,7 +52613,6 @@
  200.222.21.66
  200.223.6.54
  200.225.140.130
-200.225.180.190
  200.225.223.131
  200.228.35.10
  200.228.86.78
@@ -52772,7 +52622,9 @@
  200.232.72.50
  200.233.163.65
  200.233.186.57
+200.233.186.60
  200.233.225.25
+200.236.99.2
  200.237.142.194
  200.238.102.225
  200.24.80.13
@@ -52792,7 +52644,7 @@
  200.243.21.50
  200.248.72.99
  200.252.208.2
-200.252.208.3
+200.26.184.5
  200.26.184.53
  200.27.110.28
  200.27.113.133
@@ -52800,9 +52652,9 @@
  200.27.18.138
  200.27.18.242
  200.27.212.22
-200.29.102.43
  200.29.109.112
  200.29.109.193
+200.29.111.182
  200.29.111.71
  200.29.112.252
  200.29.139.11
@@ -52837,7 +52689,6 @@
  200.40.86.142
  200.41.121.69
  200.41.150.83
-200.41.172.82
  200.41.182.243
  200.41.42.156
  200.41.86.59
@@ -52867,16 +52718,17 @@
  200.52.140.148
  200.52.144.170
  200.52.147.93
-200.52.149.123
  200.52.228.19
+200.52.228.27
  200.52.80.34
  200.53.204.245
-200.53.206.151
  200.53.216.153
  200.53.217.25
  200.54.108.54
  200.54.170.198
  200.54.183.234
+200.54.183.237
+200.54.194.13
  200.54.221.202
  200.54.247.98
  200.54.51.124
@@ -52890,7 +52742,6 @@
  200.56.17.5
  200.56.58.221
  200.56.60.157
-200.56.98.214
  200.57.102.71
  200.57.183.176
  200.57.200.10
@@ -52919,13 +52770,14 @@
  200.66.68.145
  200.66.77.178
  200.68.13.26
-200.68.159.9
+200.68.187.224
  200.68.230.193
  200.68.230.197
  200.68.8.77
  200.68.87.164
  200.69.136.235
  200.69.140.234
+200.69.141.210
  200.69.210.185
  200.69.224.73
  200.69.77.34
@@ -52938,7 +52790,6 @@
  200.7.118.10
  200.7.149.112
  200.7.173.110
-200.7.193.229
  200.7.198.66
  200.7.252.118
  200.7.98.102
@@ -52953,6 +52804,7 @@
  200.71.72.245
  200.71.73.222
  200.71.73.242
+200.73.115.33
  200.73.128.100
  200.73.128.148
  200.73.128.173
@@ -52967,15 +52819,17 @@
  200.73.129.37
  200.73.130.156
  200.73.130.160
+200.73.130.187
  200.73.130.213
  200.73.130.226
  200.73.130.252
+200.73.130.62
  200.73.131.100
  200.73.131.239
  200.73.132.207
  200.73.186.234
  200.74.243.12
-200.75.248.134
+200.75.16.245
  200.75.39.254
  200.75.4.254
  200.75.45.67
@@ -53007,6 +52861,7 @@
  200.82.170.231
  200.82.190.36
  200.83.202.237
+200.84.179.57
  200.85.137.33
  200.85.137.34
  200.85.137.36
@@ -53024,7 +52879,6 @@
  200.85.95.234
  200.87.180.226
  200.87.233.68
-200.87.73.51
  200.88.48.99
  200.89.114.58
  200.89.125.254
@@ -53038,12 +52892,10 @@
  200.89.178.208
  200.89.178.212
  200.89.178.217
-200.89.178.79
  200.89.99.226
-200.9.16.69
  200.90.8.86
  200.90.8.90
-200.90.80.135
+200.90.80.11
  200.91.160.238
  200.91.192.60
  200.91.27.230
@@ -53063,6 +52915,7 @@
  200.98.2.28
  200.98.200.147
  200.98.200.78
+200.98.201.61
  200.98.4.115
  200.98.4.119
  200.98.4.37
@@ -53075,7 +52928,6 @@
  2009-ford-f150.xyz
  2009941992.z13.web.core.windows.net
  2009sanchezsupplicate.com
-201.105.203.3
  201.105.204.12
  201.106.32.171
  201.11.70.28
@@ -53088,17 +52940,16 @@
  201.116.3.194
  201.116.52.104
  201.122.102.21
-201.122.102.89
  201.122.212.15
  201.123.163.110
-201.123.44.91
+201.124.72.36
  201.128.150.225
  201.128.204.26
+201.130.138.95
  201.130.79.47
  201.131.126.17
  201.131.244.44
  201.131.38.208
-201.132.119.254
  201.137.122.65
  201.139.124.30
  201.139.126.118
@@ -53111,26 +52962,24 @@
  201.14.34.47
  201.140.103.33
  201.140.176.114
+201.140.212.49
  201.140.220.50
-201.141.113.142
-201.141.167.249
  201.141.53.87
  201.142.225.244
-201.143.129.19
  201.143.18.174
  201.143.32.82
  201.143.42.91
  201.144.122.243
  201.144.206.244
  201.144.234.22
+201.145.147.14
  201.145.94.17
  201.147.144.89
-201.148.124.18
  201.148.126.202
  201.148.126.38
  201.148.127.209
  201.148.127.57
-201.148.70.185
+201.148.139.53
  201.148.71.65
  201.149.109.190
  201.149.119.133
@@ -53202,9 +53051,9 @@
  201.175.17.129
  201.175.49.254
  201.175.73.218
-201.177.99.124
  201.178.203.71
  201.179.107.218
+201.179.13.6
  201.18.13.154
  201.18.230.230
  201.18.88.150
@@ -53217,7 +53066,6 @@
  201.182.88.93
  201.182.91.15
  201.183.239.5
-201.183.4.129
  201.184.105.242
  201.184.117.138
  201.184.128.134
@@ -53237,7 +53085,6 @@
  201.184.244.186
  201.184.75.210
  201.185.69.28
-201.190.184.22
  201.190.255.89
  201.191.42.39
  201.191.6.103
@@ -53267,22 +53114,20 @@
  201.210.43.5
  201.211.31.45
  201.212.120.187
-201.212.122.162
  201.212.29.93
  201.212.61.66
  201.213.231.77
  201.213.32.59
-201.214.27.239
  201.215.208.78
  201.215.253.114
  201.216.222.155
+201.216.223.78
  201.216.238.41
  201.216.243.145
  201.217.143.51
  201.217.159.155
  201.217.195.226
  201.217.201.178
-201.217.243.149
  201.217.243.150
  201.217.243.253
  201.217.245.229
@@ -53294,6 +53139,7 @@
  201.218.215.106
  201.218.228.226
  201.218.237.98
+201.218.97.142
  201.219.197.138
  201.219.197.50
  201.219.208.42
@@ -53306,12 +53152,11 @@
  201.220.140.6
  201.220.146.177
  201.220.146.245
-201.220.7.131
  201.221.133.86
  201.221.134.74
  201.221.184.254
+201.221.234.244
  201.222.48.42
-201.222.49.238
  201.222.55.238
  201.222.55.93
  201.222.57.21
@@ -53327,7 +53172,6 @@
  201.234.224.223
  201.234.227.221
  201.234.253.3
-201.234.60.82
  201.234.66.133
  201.234.81.181
  201.235.10.215
@@ -53345,19 +53189,22 @@
  201.238.235.11
  201.238.239.51
  201.24.199.23
-201.240.148.59
  201.242.188.99
+201.243.232.126
  201.244.141.167
  201.244.213.9
  201.244.214.162
  201.245.163.176
+201.247.120.170
  201.249.146.101
+201.249.15.219
  201.249.5.50
  201.249.57.132
  201.249.57.5
  201.249.61.60
  201.249.75.13
  201.249.88.38
+201.251.127.123
  201.251.63.208
  201.253.239.42
  201.26.174.39
@@ -53398,14 +53245,14 @@
  201.48.40.153
  201.48.62.65
  201.49.115.117
-201.49.37.133
-201.49.58.234
+201.49.192.220
  201.49.89.221
  201.50.47.169
  201.54.125.53
  201.55.103.34
  201.55.167.12
  201.59.201.92
+201.59.214.82
  201.6.101.122
  201.6.247.90
  201.62.124.201
@@ -53423,7 +53270,6 @@
  201.72.190.101
  201.72.190.98
  201.72.98.130
-201.75.13.14
  201.75.98.147
  201.76.9.56
  201.80.101.2
@@ -53440,6 +53286,7 @@
  201.91.210.130
  201.91.82.155
  201.93.159.234
+201.93.179.118
  201.93.243.154
  201.93.85.140
  201.95.151.221
@@ -53460,6 +53307,7 @@
  202.10.33.102
  202.10.33.98
  202.100.179.144
+202.100.188.108
  202.101.186.218
  202.101.58.115
  202.101.87.61
@@ -53469,28 +53317,26 @@
  202.104.101.27
  202.104.112.217
  202.104.188.147
-202.104.45.54
  202.105.151.181
-202.105.64.121
  202.105.64.236
+202.105.64.63
  202.105.98.210
  202.108.211.135
+202.109.158.139
  202.110.125.135
  202.110.125.188
  202.110.125.199
  202.111.131.236
  202.112.51.45
  202.112.51.84
+202.115.29.234
  202.115.30.115
  202.12.74.243
-202.12.80.74
-202.12.83.141
  202.120.13.51
  202.121.138.74
  202.122.8.50
  202.123.183.188
  202.124.186.208
-202.124.237.111
  202.124.242.10
  202.124.46.100
  202.124.46.102
@@ -53505,7 +53351,6 @@
  202.126.98.42
  202.129.0.27
  202.129.184.10
-202.129.189.58
  202.129.196.98
  202.129.38.3
  202.129.41.94
@@ -53513,7 +53358,6 @@
  202.129.52.172
  202.129.58.130
  202.130.32.19
-202.131.143.159
  202.131.226.102
  202.131.226.52
  202.131.233.202
@@ -53523,20 +53367,18 @@
  202.133.4.49
  202.133.4.53
  202.133.4.57
-202.133.49.235
-202.133.49.238
  202.133.5.194
  202.133.6.69
  202.133.63.9
  202.134.112.39
  202.134.118.151
+202.134.160.145
  202.134.160.168
  202.134.166.1
  202.134.180.50
  202.134.4.210
  202.134.4.211
  202.134.4.216
-202.134.81.254
  202.136.120.62
  202.136.123.254
  202.136.124.38
@@ -53546,6 +53388,8 @@
  202.137.10.179
  202.137.10.180
  202.137.10.182
+202.137.116.126
+202.137.120.8
  202.137.134.190
  202.137.141.11
  202.137.141.98
@@ -53555,14 +53399,10 @@
  202.137.154.31
  202.137.154.62
  202.137.155.142
-202.137.155.148
-202.137.155.171
+202.137.155.193
  202.137.155.212
-202.137.155.22
  202.137.155.84
-202.137.155.94
  202.137.159.132
-202.137.20.53
  202.137.26.10
  202.137.26.12
  202.137.26.4
@@ -53578,30 +53418,33 @@
  202.138.254.154
  202.139.198.187
  202.14.5.165
-202.14.5.177
  202.14.6.131
  202.14.6.147
  202.14.6.156
  202.14.6.186
  202.14.7.173
+202.14.70.89
  202.141.226.124
  202.141.233.166
  202.141.242.3
-202.142.102.195
  202.142.110.103
  202.142.147.162
  202.142.155.146
  202.142.158.114
  202.142.159.204
+202.142.168.86
  202.142.172.10
  202.142.178.114
  202.142.184.166
  202.142.193.72
  202.142.215.25
  202.142.33.20
+202.142.96.241
+202.142.96.247
  202.143.111.42
  202.143.121.245
  202.144.133.140
+202.144.155.241
  202.144.201.129
  202.144.201.130
  202.144.201.132
@@ -53613,7 +53456,6 @@
  202.144.201.34
  202.144.201.36
  202.144.201.38
-202.146.218.45
  202.146.222.249
  202.146.245.156
  202.147.192.134
@@ -53627,7 +53469,6 @@
  202.148.31.171
  202.148.31.172
  202.148.31.174
-202.149.199.194
  202.150.148.218
  202.150.151.85
  202.150.176.100
@@ -53637,6 +53478,8 @@
  202.151.163.10
  202.151.231.71
  202.152.149.26
+202.152.21.213
+202.152.33.132
  202.152.38.74
  202.152.38.76
  202.152.40.28
@@ -53654,11 +53497,13 @@
  202.154.191.58
  202.155.208.243
  202.155.228.207
+202.157.185.111
  202.157.185.117
  202.157.185.167
  202.157.186.10
  202.157.80.107
  202.158.11.92
+202.158.27.51
  202.158.49.138
  202.158.49.140
  202.158.49.141
@@ -53667,6 +53512,7 @@
  202.159.107.137
  202.159.107.209
  202.159.107.97
+202.159.119.238
  202.159.121.145
  202.159.121.209
  202.159.121.225
@@ -53716,9 +53562,10 @@
  202.162.214.250
  202.162.219.10
  202.162.219.12
-202.163.123.119
  202.163.83.16
+202.164.130.1
  202.164.138.103
+202.164.138.104
  202.164.138.116
  202.164.138.124
  202.164.138.132
@@ -53737,18 +53584,22 @@
  202.164.138.205
  202.164.138.215
  202.164.138.220
+202.164.138.222
  202.164.138.223
  202.164.138.225
  202.164.138.232
  202.164.138.240
  202.164.138.249
+202.164.138.252
  202.164.138.34
  202.164.138.36
+202.164.138.4
  202.164.138.41
  202.164.138.44
  202.164.138.50
  202.164.138.56
  202.164.138.6
+202.164.138.61
  202.164.138.63
  202.164.138.64
  202.164.138.70
@@ -53776,6 +53627,7 @@
  202.164.139.160
  202.164.139.163
  202.164.139.167
+202.164.139.171
  202.164.139.174
  202.164.139.177
  202.164.139.179
@@ -53785,7 +53637,6 @@
  202.164.139.195
  202.164.139.196
  202.164.139.199
-202.164.139.2
  202.164.139.21
  202.164.139.211
  202.164.139.212
@@ -53795,6 +53646,7 @@
  202.164.139.221
  202.164.139.222
  202.164.139.229
+202.164.139.230
  202.164.139.233
  202.164.139.235
  202.164.139.247
@@ -53818,8 +53670,6 @@
  202.164.139.96
  202.164.152.229
  202.164.152.233
-202.164.153.43
-202.164.153.80
  202.164.171.178
  202.164.211.116
  202.164.211.118
@@ -53830,7 +53680,6 @@
  202.165.22.185
  202.165.228.161
  202.165.228.225
-202.165.234.139
  202.166.146.58
  202.166.170.43
  202.166.174.218
@@ -53868,14 +53717,12 @@
  202.169.242.166
  202.169.245.10
  202.169.246.55
-202.169.255.6
  202.169.32.138
  202.169.35.90
  202.169.37.126
  202.169.44.140
  202.169.45.20
  202.169.59.118
-202.170.126.200
  202.170.69.12
  202.171.253.105
  202.171.253.74
@@ -53890,13 +53737,13 @@
  202.179.185.130
  202.179.21.58
  202.180.54.211
-202.180.54.97
  202.182.100.165
  202.182.101.14
  202.182.109.112
  202.182.109.94
  202.182.112.26
  202.182.117.2
+202.182.30.222
  202.182.48.86
  202.182.54.186
  202.182.59.188
@@ -53911,11 +53758,12 @@
  202.183.32.182
  202.183.32.185
  202.184.0.102
+202.184.115.116
  202.184.197.236
  202.185.133.253
  202.186.199.15
+202.186.212.229
  202.186.230.87
-202.187.39.135
  202.188.101.106
  202.188.101.4
  202.188.20.123
@@ -53941,7 +53789,6 @@
  202.228.204.204
  202.228.204.224
  202.239.42.192
-202.244.62.18
  202.28.10.20
  202.28.123.198
  202.28.221.106
@@ -53978,9 +53825,8 @@
  202.36.55.19
  202.38.181.171
  202.39.237.188
+202.4.116.52
  202.4.173.49
-202.4.186.102
-202.4.186.49
  202.40.139.165
  202.40.177.94
  202.40.186.157
@@ -53993,6 +53839,7 @@
  202.43.112.78
  202.43.113.78
  202.43.117.134
+202.43.15.252
  202.43.160.142
  202.43.183.158
  202.43.190.11
@@ -54004,13 +53851,12 @@
  202.44.52.78
  202.44.8.48
  202.44.9.1
+202.46.1.74
  202.46.29.76
  202.46.3.22
  202.46.3.26
  202.47.116.107
  202.47.116.121
-202.47.36.63
-202.47.44.27
  202.5.17.28
  202.5.36.215
  202.5.36.232
@@ -54024,7 +53870,7 @@
  202.5.56.71
  202.5.60.106
  202.51.100.33
-202.51.102.153
+202.51.102.17
  202.51.106.161
  202.51.108.17
  202.51.109.209
@@ -54044,13 +53890,13 @@
  202.51.118.81
  202.51.120.22
  202.51.178.126
+202.51.179.11
  202.51.188.170
  202.51.189.134
  202.51.190.36
  202.51.68.134
  202.51.74.123
  202.51.74.38
-202.51.92.120
  202.52.144.68
  202.52.146.71
  202.52.234.236
@@ -54058,13 +53904,14 @@
  202.52.248.210
  202.52.248.254
  202.52.4.151
+202.53.167.144
  202.53.174.17
  202.53.8.82
  202.53.81.178
  202.55.176.12
  202.55.87.45
-202.56.203.226
  202.56.221.30
+202.57.11.126
  202.57.132.74
  202.57.132.76
  202.57.132.78
@@ -54104,11 +53951,11 @@
  202.60.56.230
  202.60.72.107
  202.60.94.104
+202.61.121.212
  202.61.133.32
  202.61.133.80
  202.61.49.52
  202.62.10.250
-202.62.102.209
  202.62.11.106
  202.62.13.72
  202.62.227.168
@@ -54121,7 +53968,6 @@
  202.62.45.17
  202.62.45.53
  202.62.47.184
-202.62.47.24
  202.62.49.120
  202.62.50.81
  202.62.51.25
@@ -54135,10 +53981,13 @@
  202.63.104.89
  202.63.242.135
  202.63.242.20
+202.64.68.201
+202.65.136.190
  202.65.141.228
  202.65.170.174
  202.65.171.67
  202.67.153.114
+202.67.67.191
  202.69.105.18
  202.69.36.45
  202.69.38.230
@@ -54148,17 +53997,16 @@
  202.70.34.82
  202.70.44.195
  202.70.65.229
-202.70.66.146
  202.70.66.85
  202.70.72.217
  202.70.84.201
  202.70.87.193
  202.71.108.26
-202.71.185.90
  202.72.209.3
  202.72.215.162
  202.72.225.17
  202.72.233.18
+202.72.242.141
  202.72.242.242
  202.72.243.198
  202.73.14.205
@@ -54174,14 +54022,14 @@
  202.78.232.138
  202.78.94.70
  202.79.167.65
+202.79.34.109
  202.79.34.167
  202.79.34.178
  202.79.34.242
  202.79.37.14
  202.79.40.97
-202.79.56.168
+202.79.47.122
  202.79.56.90
-202.8.102.18
  202.80.112.81
  202.80.118.90
  202.80.213.188
@@ -54191,7 +54039,6 @@
  202.83.172.218
  202.83.43.125
  202.83.54.167
-202.83.56.41
  202.85.222.190
  202.86.217.90
  202.87.248.134
@@ -54208,8 +54055,10 @@
  202.89.73.94
  202.9.38.20
  202.9.39.139
-202.9.63.29
+202.9.40.29
+202.9.47.25
  202.91.35.253
+202.91.67.38
  202.91.77.33
  202.91.82.81
  202.91.89.129
@@ -54232,8 +54081,8 @@
  202.95.11.253
  202.95.8.227
  202.98.105.168
-202.99.48.128
-202.99.48.151
+202.99.48.142
+202.99.48.183
  2020-attupgrade.weebly.com
  2020-giveaway.com
  2020-updater-secure-pay.com
@@ -54481,7 +54330,7 @@
  2023talep-iadelerim.org
  202983268654sbcglobal.weebly.com
  203.10.58.4
-203.101.183.214
+203.101.183.176
  203.106.164.74
  203.109.113.155
  203.109.75.22
@@ -54503,6 +54352,7 @@
  203.114.75.50
  203.114.75.59
  203.115.131.17
+203.115.73.106
  203.115.73.107
  203.115.73.114
  203.115.73.123
@@ -54524,7 +54374,6 @@
  203.123.125.210
  203.123.32.117
  203.125.29.136
-203.128.242.166
  203.128.67.130
  203.128.71.86
  203.128.72.62
@@ -54544,10 +54393,12 @@
  203.130.255.2
  203.131.229.187
  203.131.252.210
+203.132.92.211
  203.132.94.196
  203.133.132.135
  203.134.194.240
  203.135.20.36
+203.135.209.88
  203.137.195.133
  203.142.221.154
  203.142.34.36
@@ -54557,16 +54408,13 @@
  203.142.70.222
  203.142.76.171
  203.144.133.5
-203.144.233.115
  203.146.127.133
  203.146.208.208
  203.147.62.92
  203.147.78.171
-203.150.113.129
  203.150.113.179
  203.150.113.196
  203.150.113.197
-203.150.157.137
  203.150.157.148
  203.150.157.76
  203.150.225.2
@@ -54589,6 +54437,7 @@
  203.153.25.126
  203.153.28.2
  203.153.99.174
+203.154.243.50
  203.154.75.141
  203.157.152.9
  203.159.249.215
@@ -54618,7 +54467,6 @@
  203.160.63.17
  203.160.63.49
  203.160.63.81
-203.162.120.6
  203.162.123.109
  203.162.13.181
  203.162.130.73
@@ -54632,7 +54480,6 @@
  203.169.225.68
  203.170.115.82
  203.170.193.93
-203.170.58.241
  203.170.59.244
  203.170.66.1
  203.170.66.129
@@ -54645,6 +54492,8 @@
  203.170.66.249
  203.170.66.41
  203.170.66.49
+203.170.67.109
+203.170.67.145
  203.170.67.157
  203.170.67.169
  203.170.67.17
@@ -54670,6 +54519,7 @@
  203.170.68.97
  203.171.21.225
  203.171.31.156
+203.172.158.108
  203.172.162.163
  203.172.64.145
  203.172.76.4
@@ -54677,10 +54527,8 @@
  203.173.94.2
  203.173.94.94
  203.174.13.158
-203.174.191.18
  203.174.47.130
  203.175.162.60
-203.175.72.109
  203.176.135.102
  203.176.135.98
  203.176.176.130
@@ -54702,7 +54550,6 @@
  203.186.187.169
  203.186.54.237
  203.187.186.204
-203.187.228.214
  203.188.242.222
  203.188.246.194
  203.188.248.252
@@ -54716,7 +54563,6 @@
  203.189.156.47
  203.189.235.205
  203.189.88.233
-203.189.89.1
  203.189.89.134
  203.19.88.51
  203.19.88.59
@@ -54724,6 +54570,7 @@
  203.190.113.154
  203.190.116.140
  203.190.117.232
+203.190.12.162
  203.190.14.105
  203.190.148.180
  203.190.34.39
@@ -54733,6 +54580,7 @@
  203.190.55.203
  203.190.55.213
  203.192.219.7
+203.192.243.223
  203.192.25.1
  203.194.21.241
  203.195.130.233
@@ -54761,7 +54609,6 @@
  203.195.214.173
  203.195.224.229
  203.195.245.241
-203.196.19.25
  203.197.88.53
  203.198.207.125
  203.198.246.86
@@ -54779,18 +54626,19 @@
  203.205.137.186
  203.205.137.72
  203.205.21.159
+203.205.27.119
  203.205.29.210
-203.205.32.88
  203.205.35.201
  203.205.37.233
  203.206.167.242
  203.206.205.179
+203.207.52.206
  203.207.52.38
+203.207.54.34
  203.207.57.222
  203.208.65.96
  203.209.190.154
  203.209.190.202
-203.210.131.235
  203.210.149.193
  203.210.232.44
  203.210.84.83
@@ -54806,7 +54654,12 @@
  203.217.169.217
  203.217.173.206
  203.217.176.244
-203.217.56.33
+203.218.156.243
+203.218.166.182
+203.218.207.72
+203.218.4.80
+203.218.51.123
+203.218.85.231
  203.219.101.156
  203.219.151.169
  203.219.178.237
@@ -54847,15 +54700,16 @@
  203.25.159.3
  203.250.190.91
  203.251.225.101
-203.252.224.156
  203.252.90.80
  203.253.25.15
  203.255.228.8
  203.3.118.149
  203.30.95.15
+203.40.182.71
  203.41.236.130
  203.43.95.165
  203.45.171.181
+203.45.198.216
  203.46.223.176
  203.51.27.108
  203.56.191.129
@@ -54895,7 +54749,7 @@
  203.80.190.162
  203.80.190.242
  203.80.191.18
-203.81.237.19
+203.81.241.81
  203.81.75.37
  203.81.83.212
  203.81.87.186
@@ -54908,7 +54762,6 @@
  203.83.189.126
  203.83.234.158
  203.86.7.110
-203.88.133.98
  203.90.61.133
  203.91.116.58
  203.91.118.71
@@ -54916,10 +54769,12 @@
  203.91.121.71
  203.92.47.40
  203.93.19.36
+203.93.209.7
  203.93.6.28
  203.94.24.114
  203.94.243.59
  203.95.193.100
+203.95.212.41
  203.95.7.164
  203.97.30.12
  203.98.76.100
@@ -54928,7 +54783,6 @@
  203.99.131.218
  203.99.131.241
  203.99.157.126
-203.99.174.222
  203.99.177.143
  203.99.62.158
  203102102682672-dot-vui-egd-lhs.appspot.com
@@ -54947,7 +54801,6 @@
  204.11.58.151
  204.11.59.175
  204.111.241.195
-204.111.241.7
  204.12.124.138
  204.12.206.90
  204.12.207.91
@@ -54965,6 +54818,7 @@
  204.13.201.163
  204.13.239.221
  204.132.129.234
+204.137.134.12
  204.14.245.176
  204.145.94.123
  204.145.94.154
@@ -55007,11 +54861,11 @@
  204.232.208.15
  204.236.129.29
  204.236.201.180
-204.236.65.101
  204.237.122.45
  204.244.227.25
  204.27.60.147
  204.44.101.146
+204.44.71.174
  204.44.71.206
  204.44.75.20
  204.44.75.200
@@ -55054,6 +54908,8 @@
  20449959931.z13.web.core.windows.net
  205.134.182.106
  205.134.255.225
+205.141.197.38
+205.144.212.237
  205.157.156.10
  205.158.57.2
  205.164.3.143
@@ -55083,12 +54939,11 @@
  205.185.118.62
  205.185.120.173
  205.185.120.206
-205.185.121.126
+205.185.121.222
  205.185.121.236
  205.185.122.246
  205.185.122.89
  205.185.123.19
-205.185.123.76
  205.185.124.200
  205.185.125.104
  205.185.125.189
@@ -55100,26 +54955,28 @@
  205.185.127.217
  205.185.127.35
  205.185.127.67
+205.185.193.14
+205.185.209.106
  205.185.209.221
-205.185.209.245
  205.185.209.69
-205.185.209.99
  205.185.214.139
-205.185.223.160
+205.185.214.55
+205.185.222.225
  205.185.223.172
-205.185.223.36
+205.185.223.55
+205.185.223.72
  205.186.131.199
  205.186.132.245
  205.186.152.130
  205.186.166.172
  205.186.176.33
+205.201.49.132
  205.206.227.110
  205.209.160.130
  205.209.173.8
  205.209.183.209
  205.209.97.120
  205.213.89.2
-205.234.152.106
  205.234.159.186
  205.234.184.42
  205.234.198.191
@@ -55128,6 +54985,7 @@
  205.234.252.183
  205.234.55.26
  205.234.58.228
+205.237.93.16
  205.244.148.43
  205.247.175.71
  205.247.175.77
@@ -55138,14 +54996,12 @@
  205.251.131.33
  205.251.133.146
  205.251.148.122
-205.251.148.82
  205.251.148.90
  205.251.148.98
  205.251.150.146
  205.251.150.170
  205.251.150.210
  205.251.153.228
-205.251.154.202
  2050391180620948717180.us-south.cf.appdomain.cloud
  205539.cc
  205630.cc
@@ -55153,9 +55009,11 @@
  206.123.139.182
  206.123.139.194
  206.123.139.199
+206.123.139.208
  206.123.139.226
  206.123.139.233
  206.123.139.237
+206.123.139.241
  206.123.139.251
  206.123.153.8
  206.123.226.244
@@ -55192,9 +55050,7 @@
  206.189.101.245
  206.189.101.68
  206.189.101.80
-206.189.102.142
  206.189.102.195
-206.189.102.39
  206.189.102.8
  206.189.103.1
  206.189.103.148
@@ -55206,6 +55062,7 @@
  206.189.105.215
  206.189.105.229
  206.189.106.122
+206.189.106.193
  206.189.106.249
  206.189.107.177
  206.189.107.216
@@ -55221,16 +55078,14 @@
  206.189.110.77
  206.189.111.208
  206.189.111.9
-206.189.112.113
  206.189.113.118
+206.189.113.210
  206.189.115.231
-206.189.115.6
  206.189.117.49
  206.189.118.168
  206.189.119.230
  206.189.119.255
  206.189.12.13
-206.189.120.169
  206.189.121.234
  206.189.122.104
  206.189.122.115
@@ -55259,11 +55114,11 @@
  206.189.147.137
  206.189.147.45
  206.189.147.87
-206.189.15.220
  206.189.15.78
  206.189.151.151
  206.189.151.16
  206.189.151.26
+206.189.153.148
  206.189.153.222
  206.189.154.19
  206.189.154.38
@@ -55277,6 +55132,7 @@
  206.189.162.136
  206.189.162.99
  206.189.165.77
+206.189.166.89
  206.189.167.164
  206.189.168.8
  206.189.169.6
@@ -55290,7 +55146,6 @@
  206.189.173.185
  206.189.173.188
  206.189.174.127
-206.189.178.171
  206.189.179.136
  206.189.179.30
  206.189.18.129
@@ -55321,7 +55176,6 @@
  206.189.200.8
  206.189.204.111
  206.189.205.248
-206.189.206.213
  206.189.207.90
  206.189.208.7
  206.189.208.80
@@ -55333,7 +55187,6 @@
  206.189.214.165
  206.189.216.37
  206.189.217.165
-206.189.217.21
  206.189.217.82
  206.189.22.132
  206.189.22.34
@@ -55357,18 +55210,18 @@
  206.189.233.23
  206.189.234.114
  206.189.234.238
-206.189.235.21
  206.189.235.68
  206.189.237.94
  206.189.238.137
  206.189.238.171
  206.189.238.208
  206.189.238.213
+206.189.24.121
  206.189.24.190
  206.189.24.222
+206.189.24.27
  206.189.25.102
  206.189.26.219
-206.189.26.82
  206.189.27.201
  206.189.3.176
  206.189.30.133
@@ -55390,9 +55243,7 @@
  206.189.46.85
  206.189.47.166
  206.189.47.179
-206.189.48.12
  206.189.50.208
-206.189.51.134
  206.189.51.168
  206.189.52.170
  206.189.57.241
@@ -55434,9 +55285,9 @@
  206.189.98.152
  206.189.99.191
  206.189.99.34
-206.189.99.40
  206.192.226.90
  206.195.148.73
+206.195.86.74
  206.196.108.34
  206.196.145.143
  206.198.196.82
@@ -55444,9 +55295,7 @@
  206.212.255.154
  206.214.143.126
  206.214.217.188
-206.217.128.131
  206.217.128.132
-206.217.128.137
  206.217.129.93
  206.217.130.148
  206.217.134.181
@@ -55461,39 +55310,44 @@
  206.225.95.33
  206.248.174.129
  206.248.184.127
-206.252.192.13
+206.251.179.2
+206.251.220.82
+206.252.192.12
  206.252.192.14
  206.252.192.5
  206.252.192.6
  206.252.192.8
-206.252.217.198
  206.253.224.74
  206.253.226.7
-206.255.51.10
  206.29.180.76
  206.31.242.26
+206.41.168.128
  206.41.168.142
  206.41.168.193
  206.41.168.236
  206.41.168.241
+206.41.173.196
+206.41.173.250
  206.41.173.6
  206.41.174.116
  206.41.174.144
-206.41.175.105
+206.41.175.125
+206.41.175.150
  206.41.175.153
+206.41.175.16
  206.41.175.165
  206.41.175.205
  206.41.175.207
  206.41.175.235
  206.41.175.247
  206.41.175.28
-206.41.175.47
-206.41.176.229
+206.41.175.91
  206.41.177.236
  206.41.177.24
  206.41.178.213
  206.41.178.248
  206.41.179.27
+206.41.184.11
  206.41.184.185
  206.41.184.251
  206.41.184.57
@@ -55523,18 +55377,17 @@
  206.81.1.200
  206.81.10.215
  206.81.11.129
-206.81.12.141
  206.81.13.189
  206.81.15.85
  206.81.18.165
  206.81.18.183
  206.81.22.33
  206.81.23.203
-206.81.24.119
  206.81.24.91
  206.81.25.12
  206.81.25.250
  206.81.26.14
+206.81.27.29
  206.81.28.114
  206.81.6.142
  2063696-dot-n-e-w-me-ss-age-po-rt-al.wl.r.appspot.com
@@ -55546,7 +55399,6 @@
  207.118.104.63
  207.118.107.110
  207.118.107.35
-207.118.107.67
  207.118.108.150
  207.118.109.74
  207.118.112.194
@@ -55564,45 +55416,20 @@
  207.118.154.22
  207.118.169.225
  207.118.169.77
-207.118.180.111
  207.118.180.160
  207.118.180.166
-207.118.180.205
  207.118.180.243
  207.118.180.31
  207.118.180.58
  207.118.181.119
-207.118.183.211
-207.118.183.232
  207.118.70.96
-207.119.132.209
  207.119.133.206
-207.119.145.250
  207.119.148.253
-207.119.172.126
-207.119.172.180
-207.119.181.154
-207.119.181.162
  207.119.181.247
  207.119.181.248
-207.119.182.210
-207.119.182.247
-207.119.182.43
-207.119.183.110
-207.119.183.155
-207.119.183.19
-207.119.183.251
-207.119.188.153
-207.119.190.109
-207.119.190.130
-207.119.190.14
-207.119.190.186
-207.119.193.114
  207.119.193.134
  207.119.193.178
  207.119.193.99
-207.119.194.35
-207.119.196.153
  207.126.164.52
  207.134.179.108
  207.134.8.242
@@ -55625,6 +55452,7 @@
  207.148.124.20
  207.148.126.117
  207.148.19.136
+207.148.21.198
  207.148.23.160
  207.148.26.182
  207.148.30.112
@@ -55642,7 +55470,6 @@
  207.148.97.0
  207.148.98.111
  207.150.188.54
-207.154.194.217
  207.154.195.134
  207.154.196.1
  207.154.196.105
@@ -55650,10 +55477,8 @@
  207.154.202.134
  207.154.202.225
  207.154.204.20
-207.154.205.83
  207.154.205.86
  207.154.206.60
-207.154.207.138
  207.154.207.214
  207.154.208.77
  207.154.210.99
@@ -55700,14 +55525,13 @@
  207.162.219.29
  207.164.119.31
  207.174.213.181
-207.177.157.5
  207.180.195.154
  207.180.196.191
  207.180.202.254
  207.180.205.117
-207.180.205.126
  207.180.207.205
  207.180.208.251
+207.180.213.44
  207.180.217.42
  207.180.223.239
  207.180.223.68
@@ -55717,6 +55541,7 @@
  207.180.231.214
  207.180.234.123
  207.180.239.154
+207.180.241.2
  207.180.244.165
  207.180.248.85
  207.180.250.228
@@ -55724,9 +55549,7 @@
  207.182.137.218
  207.182.154.178
  207.188.41.2
-207.191.165.8
  207.191.186.10
-207.191.249.191
  207.191.26.202
  207.191.38.230
  207.194.255.18
@@ -55741,18 +55564,19 @@
  207.204.64.97
  207.204.85.90
  207.210.125.155
+207.210.239.222
  207.210.78.125
  207.210.84.226
  207.213.245.215
  207.218.200.0
  207.218.237.146
  207.219.199.101
-207.224.104.33
  207.224.66.144
  207.224.9.50
  207.225.37.164
  207.228.240.76
  207.230.100.87
+207.230.104.219
  207.235.124.166
  207.237.108.28
  207.241.227.38
@@ -55766,6 +55590,7 @@
  207.242.7.91
  207.243.204.30
  207.244.109.182
+207.244.117.134
  207.244.117.87
  207.244.118.42
  207.244.119.153
@@ -55783,9 +55608,7 @@
  207.244.234.115
  207.244.239.187
  207.244.240.40
-207.244.247.246
  207.244.251.210
-207.244.251.52
  207.244.252.148
  207.244.252.245
  207.244.68.199
@@ -55801,7 +55624,6 @@
  207.246.240.118
  207.246.240.119
  207.246.240.122
-207.246.240.124
  207.246.249.193
  207.246.249.195
  207.246.249.196
@@ -55818,10 +55640,11 @@
  207.246.95.21
  207.246.95.32
  207.248.245.235
+207.251.84.210
  207.254.73.148
  207.255.193.47
+207.29.218.5
  207.30.108.162
-207.30.207.4
  207.30.28.244
  207.30.28.246
  207.38.90.177
@@ -55923,6 +55746,7 @@
  207.46.13.97
  207.46.13.98
  207.46.13.99
+207.46.132.127
  207.46.145.19
  207.46.227.197
  207.5.112.195
@@ -55939,15 +55763,13 @@
  207.96.214.166
  207.96.90.42
  207.97.174.134
-207.98.139.14
  207.99.28.140
  2072.ch
  20759379-1808-4ca1-8f3a-3923cb555671.htmlcomponentservice.com
  20760220.snapchatprime.com
  208.100.170.91
-208.100.177.17
+208.100.26.230
  208.100.26.233
-208.100.26.235
  208.100.26.236
  208.100.26.243
  208.100.26.244
@@ -55967,7 +55789,6 @@
  208.109.11.34
  208.109.12.104
  208.109.12.211
-208.109.13.144
  208.109.13.208
  208.109.14.122
  208.109.18.128
@@ -55976,6 +55797,7 @@
  208.109.190.141
  208.109.209.94
  208.109.248.165
+208.109.26.209
  208.109.53.185
  208.109.8.153
  208.109.8.97
@@ -55984,7 +55806,6 @@
  208.110.85.188
  208.110.93.52
  208.110.99.105
-208.111.86.99
  208.112.122.108
  208.113.130.13
  208.113.130.87
@@ -56004,11 +55825,14 @@
  208.113.153.1
  208.113.153.115
  208.113.153.12
+208.113.153.144
  208.113.153.176
  208.113.153.184
  208.113.153.203
  208.113.153.211
+208.113.153.22
  208.113.153.222
+208.113.153.240
  208.113.153.40
  208.113.153.67
  208.113.153.99
@@ -56062,14 +55886,12 @@
  208.138.24.254
  208.138.36.46
  208.163.148.41
-208.163.153.205
-208.163.153.210
  208.163.155.125
-208.163.180.163
  208.163.181.237
  208.163.39.218
  208.167.242.170
  208.167.245.245
+208.167.249.154
  208.167.254.247
  208.176.53.58
  208.180.145.73
@@ -56103,7 +55925,6 @@
  208.64.33.175
  208.64.33.176
  208.64.33.178
-208.64.33.190
  208.64.33.191
  208.64.33.192
  208.64.68.228
@@ -56127,6 +55948,7 @@
  208.70.79.113
  208.71.173.207
  208.71.173.74
+208.73.156.62
  208.73.205.14
  208.73.21.13
  208.74.205.40
@@ -56138,6 +55960,7 @@
  208.80.28.208
  208.81.1.105
  208.81.126.169
+208.81.58.120
  208.82.115.230
  208.83.204.215
  208.84.155.69
@@ -56163,9 +55986,6 @@
  208.92.211.82
  208.93.231.240
  208.95.0.18
-208.95.73.26
-208.96.134.162
-208.96.134.210
  208.96.137.130
  208.96.138.190
  208.97.188.13
@@ -56179,15 +55999,19 @@
  209.105.239.88
  209.105.243.145
  209.105.243.164
-209.107.196.75
-209.107.196.94
+209.107.196.11
+209.107.196.195
  209.107.204.103
  209.107.204.63
+209.107.210.188
  209.107.210.194
  209.107.210.48
+209.107.210.54
  209.107.210.55
  209.107.214.195
-209.107.216.251
+209.107.216.103
+209.107.216.154
+209.107.216.193
  209.107.216.80
  209.11.246.11
  209.118.108.196
@@ -56208,7 +56032,6 @@
  209.126.2.126
  209.126.4.134
  209.126.76.205
-209.127.143.132
  209.127.17.234
  209.127.17.242
  209.127.178.46
@@ -56222,13 +56045,13 @@
  209.13.96.171
  209.13.96.172
  209.131.236.105
-209.133.212.93
  209.140.29.226
  209.141.33.226
  209.141.34.220
  209.141.34.42
  209.141.34.95
  209.141.35.155
+209.141.35.205
  209.141.35.81
  209.141.36.139
  209.141.36.246
@@ -56239,10 +56062,10 @@
  209.141.38.192
  209.141.39.209
  209.141.39.226
+209.141.40.190
  209.141.40.46
  209.141.41.103
  209.141.41.186
-209.141.41.202
  209.141.41.207
  209.141.41.225
  209.141.41.45
@@ -56256,6 +56079,7 @@
  209.141.45.135
  209.141.45.189
  209.141.45.212
+209.141.45.68
  209.141.46.152
  209.141.46.241
  209.141.46.38
@@ -56271,6 +56095,7 @@
  209.141.51.218
  209.141.52.28
  209.141.53.10
+209.141.53.142
  209.141.53.20
  209.141.53.219
  209.141.53.73
@@ -56309,11 +56134,12 @@
  209.145.87.30bin.sh
  209.15.236.190
  209.150.240.94
-209.150.243.16
-209.150.243.59
-209.150.246.96
+209.150.241.97
+209.150.242.174
+209.150.246.143
  209.150.250.246
  209.150.251.221
+209.150.251.96
  209.150.254.25
  209.150.255.11
  209.150.60.107
@@ -56326,6 +56152,8 @@
  209.16.78.27
  209.160.54.26
  209.160.64.61
+209.160.72.40
+209.163.117.175
  209.163.117.86
  209.163.118.125
  209.163.160.253
@@ -56339,13 +56167,10 @@
  209.177.86.21
  209.177.86.22
  209.181.137.169
-209.181.233.7
-209.181.251.166
  209.182.202.96
  209.182.219.176
  209.182.219.37
  209.182.237.99
-209.188.109.21
  209.188.18.218
  209.188.18.44
  209.188.18.45
@@ -56368,9 +56193,9 @@
  209.200.44.215
  209.201.63.135
  209.203.130.25
+209.203.130.59
  209.203.22.217
  209.206.108.87
-209.206.166.53
  209.208.72.217
  209.212.33.99
  209.213.199.16
@@ -56404,6 +56229,7 @@
  209.226.213.92
  209.23.122.132
  209.232.198.8
+209.234.253.37
  209.235.136.115
  209.235.136.116
  209.236.117.207
@@ -56437,7 +56263,7 @@
  209.250.254.163
  209.250.255.60
  209.250.255.66
-209.251.20.51
+209.251.22.169
  209.31.182.178
  209.33.120.130
  209.41.180.93
@@ -56455,13 +56281,13 @@
  209.54.34.231
  209.54.34.249
  209.54.43.204
-209.54.47.201
  209.54.47.204
-209.54.51.40
  209.54.60.159
+209.58.129.99
  209.58.149.116
  209.58.149.66
  209.58.152.105
+209.58.152.17
  209.58.152.55
  209.58.157.136
  209.58.157.35
@@ -56473,6 +56299,7 @@
  209.59.166.114
  209.59.186.242
  209.59.199.129
+209.59.229.52
  209.59.234.151
  209.6.145.252
  209.6.39.175
@@ -56545,6 +56372,7 @@
  209.97.163.175
  209.97.165.196
  209.97.166.94
+209.97.167.137
  209.97.168.21
  209.97.168.52
  209.97.169.33
@@ -56565,7 +56393,6 @@
  209.97.183.120
  209.97.183.188
  209.97.183.28
-209.97.185.219
  209.97.186.179
  209.97.186.48
  209.97.188.25
@@ -56576,17 +56403,17 @@
  209.97.212.185
  209.99.129.155
  209.99.131.137
-209.99.131.142
  209.99.131.146
  209.99.131.157
  209.99.131.168
  209.99.131.209
+209.99.131.253
  209.99.131.55
+209.99.132.121
  209.99.132.168
  209.99.132.176
  209.99.132.238
  209.99.132.49
-209.99.132.5
  209.99.132.56
  209.99.132.70
  209.99.132.73
@@ -56597,6 +56424,7 @@
  209.99.134.109
  209.99.134.112
  209.99.134.113
+209.99.134.123
  209.99.134.127
  209.99.134.139
  209.99.134.174
@@ -56604,7 +56432,6 @@
  209.99.134.225
  209.99.134.237
  209.99.134.28
-209.99.134.33
  209.99.134.35
  209.99.134.88
  209.99.134.91
@@ -56628,12 +56455,15 @@
  209.99.168.240
  209.99.168.244
  209.99.168.44
+209.99.168.85
  209.99.169.103
  209.99.169.105
+209.99.169.11
  209.99.169.69
  209.99.172.138
  209.99.175.105
  209.99.175.14
+209.99.175.155
  209.99.175.18
  209.99.175.237
  209.99.175.240
@@ -56665,8 +56495,8 @@
  210.1.225.79
  210.1.226.124
  210.1.82.194
+210.10.205.158
  210.10.208.238
-210.101.70.131
  210.104.112.207
  210.105.193.15
  210.105.193.8
@@ -56685,11 +56515,10 @@
  210.118.170.11
  210.12.168.79
  210.12.27.226
+210.12.42.211
  210.12.71.170
  210.121.223.61
-210.123.250.250
  210.124.149.19
-210.125.92.58
  210.126.4.142
  210.127.209.27
  210.127.209.30
@@ -56698,9 +56527,7 @@
  210.127.253.247
  210.13.110.60
  210.13.110.61
-210.138.23.102
  210.14.107.43
-210.14.110.50
  210.14.142.85
  210.14.69.76
  210.14.73.172
@@ -56717,7 +56544,6 @@
  210.16.180.231
  210.16.187.206
  210.16.188.124
-210.16.189.4
  210.16.189.87
  210.16.84.102
  210.16.84.182
@@ -56726,22 +56552,23 @@
  210.16.85.98
  210.165.156.91
  210.166.214.192
+210.166.230.64
+210.166.232.185
  210.176.41.225
  210.177.164.45
  210.177.211.117
  210.177.243.102
+210.178.60.32
  210.178.88.171bin.sh
  210.178.94.227
  210.179.11.208
  210.179.177.167
  210.179.211.175
  210.179.220.92
-210.179.67.203
  210.180.237.212
  210.182.148.126
  210.182.169.25
  210.182.169.26
-210.182.73.142
  210.183.102.85
  210.183.21.48
  210.183.46.232
@@ -56749,10 +56576,8 @@
  210.183.89.229
  210.186.148.113
  210.186.247.84
-210.186.92.113
  210.186.96.159
  210.187.189.107
-210.187.229.123
  210.188.218.41
  210.19.212.234
  210.190.64.68
@@ -56765,18 +56590,20 @@
  210.2.64.112
  210.200.161.132
  210.201.139.189
-210.203.193.247
+210.203.193.235
  210.205.6.107
  210.205.6.171
  210.205.6.233
  210.205.8.250
+210.206.24.238
  210.206.92.137
  210.209.125.65
+210.209.157.227
+210.209.198.32
  210.209.89.74
  210.209.93.90
  210.21.221.156
  210.21.226.2
-210.210.117.95
  210.210.136.147
  210.211.111.85
  210.211.116.204
@@ -56789,7 +56616,8 @@
  210.211.99.195
  210.212.172.182
  210.212.237.67
-210.212.253.226
+210.212.250.39
+210.212.250.45
  210.212.253.227
  210.212.29.215
  210.212.68.213
@@ -56802,13 +56630,16 @@
  210.220.150.170
  210.221.124.147
  210.221.154.117
+210.222.183.233
  210.222.25.166
  210.222.86.19
  210.223.141.74
  210.236.46.245
  210.240.163.95
  210.242.153.168
+210.245.102.197
  210.245.110.9
+210.245.32.158
  210.245.51.1
  210.245.51.14
  210.245.51.15
@@ -56834,6 +56665,7 @@
  210.246.240.254
  210.246.240.42
  210.246.243.70
+210.246.63.34
  210.246.63.55
  210.251.213.165
  210.251.214.133
@@ -56846,17 +56678,17 @@
  210.4.96.73
  210.4.97.107
  210.44.232.126
+210.45.175.98
  210.48.139.228
  210.48.204.118
  210.48.204.134
+210.48.204.86
  210.48.4.48
  210.5.172.6
  210.5.85.150
  210.51.10.243
-210.51.10.246
  210.51.13.174
  210.51.174.189
-210.53.66.230
  210.54.37.190
  210.54.39.238
  210.55.186.173
@@ -56880,15 +56712,18 @@
  210.57.219.131
  210.57.219.135
  210.57.228.128
+210.57.237.181
  210.57.237.70
  210.59.98.106
  210.6.150.39
  210.61.216.66
  210.61.28.106
  210.61.47.79
+210.65.47.133
  210.66.100.173
  210.66.16.184
  210.68.245.55
+210.68.57.201
  210.7.13.235
  210.71.198.62
  210.71.232.236
@@ -56899,8 +56734,7 @@
  210.89.176.166
  210.9.47.154
  210.90.238.37
-210.90.244.123
-210.91.141.73
+210.91.184.176
  210.92.18.165
  210.92.18.168
  210.92.18.169
@@ -56912,6 +56746,8 @@
  210676-dot-n-e-w-me-ss-age-po-rt-al.wl.r.appspot.com
  2109f.com
  210sadivorce.com
+211.1.230.194
+211.100.34.96
  211.101.18.158
  211.101.61.231
  211.103.172.114
@@ -56919,8 +56755,8 @@
  211.104.160.202
  211.104.242.52
  211.105.145.212
+211.105.223.132
  211.105.40.71
-211.107.14.238
  211.108.51.122
  211.108.69.103
  211.110.125.62
@@ -56965,15 +56801,14 @@
  211.144.221.226
  211.144.68.45
  211.144.69.249
-211.149.152.250
  211.149.253.204
  211.152.33.24
  211.155.225.104
  211.159.146.141
  211.159.148.181
-211.159.149.29
  211.159.153.62
  211.159.154.136
+211.159.154.77
  211.159.160.173
  211.159.165.137
  211.159.168.145
@@ -56983,9 +56818,9 @@
  211.159.186.152
  211.159.219.162
  211.161.60.21
-211.168.108.124
  211.170.28.251
  211.170.61.184
+211.171.166.248
  211.171.42.5
  211.172.225.50
  211.173.58.253
@@ -56998,7 +56833,7 @@
  211.184.131.136bin.sh
  211.184.187.129
  211.184.32.25
-211.186.132.162
+211.186.222.193
  211.187.132.204
  211.189.18.242
  211.189.18.73
@@ -57016,6 +56851,7 @@
  211.198.174.72
  211.198.180.137
  211.198.184.230
+211.198.193.131
  211.198.240.52
  211.198.90.77bin.sh
  211.199.153.194
@@ -57025,22 +56861,25 @@
  211.20.154.102
  211.20.154.167
  211.20.176.82
-211.20.181.113
  211.20.238.33
  211.200.160.239
+211.200.178.178
  211.202.2.220
  211.203.180.144
  211.204.215.157
  211.204.215.157bin.sh
  211.206.120.187
  211.206.124.179
+211.21.101.155
  211.21.104.173
  211.21.120.163
  211.21.92.211
+211.210.219.71
  211.210.3.214
  211.210.93.93
  211.214.161.205
  211.215.18.93
+211.216.184.53
  211.218.105.101
  211.218.126.236
  211.218.192.149
@@ -57059,29 +56898,27 @@
  211.220.63.141
  211.220.63.148
  211.221.138.199
+211.221.155.6
  211.221.32.117
  211.222.69.222
+211.222.75.109
  211.223.201.177
  211.223.205.250
  211.224.221.25
  211.227.96.15
  211.229.107.60
  211.229.19.45
-211.229.212.130
  211.229.236.149
  211.229.30.62
  211.229.64.61
-211.23.105.226
  211.23.87.106
  211.230.156.161
-211.230.71.151
  211.233.11.27
  211.233.16.217
  211.233.16.218
  211.233.38.165
  211.233.50.192
  211.233.56.228
-211.233.58.19
  211.233.69.41
  211.234.106.119
  211.234.119.189
@@ -57100,6 +56937,7 @@
  211.24.95.49
  211.241.177.69
  211.242.110.197
+211.243.175.203
  211.243.86.210
  211.244.168.32
  211.244.45.196
@@ -57111,6 +56949,7 @@
  211.251.234.192
  211.251.239.72
  211.251.250.7
+211.252.125.216
  211.252.87.42
  211.253.10.96
  211.253.129.225
@@ -57124,10 +56963,10 @@
  211.255.32.134
  211.255.32.19
  211.26.10.49
-211.26.11.87
  211.26.187.128
-211.27.130.168
+211.32.122.110
  211.34.150.102
+211.34.73.200
  211.35.66.57
  211.35.66.61
  211.35.67.133
@@ -57145,12 +56984,16 @@
  211.38.132.37
  211.38.193.69
  211.39.130.176
+211.4.62.225
  211.40.53.149
  211.40.68.132
+211.42.248.113
+211.43.167.107
  211.43.196.32
  211.43.206.220
  211.43.8.168
  211.45.247.122
+211.46.45.19
  211.47.102.51
  211.47.118.102
  211.47.237.17
@@ -57168,17 +57011,20 @@
  211.5.245.2
  211.50.170.252
  211.51.210.171
+211.51.8.101
+211.53.38.150
  211.55.116.245
  211.55.116.245bin.sh
+211.55.21.142
  211.56.15.42
  211.56.15.44
  211.56.15.46
  211.57.194.141
  211.63.60.50
  211.63.71.72
+211.75.141.112
  211.75.169.23
  211.9.254.66
-211.91.56.93
  211.95.27.50
  211.95.47.166
  21112.com
@@ -57190,7 +57036,7 @@
  212.102.118.90
  212.102.35.106
  212.102.36.166
-212.102.36.21
+212.102.37.211
  212.102.39.136
  212.102.49.251
  212.102.52.201
@@ -57200,7 +57046,6 @@
  212.103.61.157
  212.103.61.160
  212.104.224.133
-212.104.237.62
  212.106.32.113
  212.107.231.86
  212.107.233.222
@@ -57218,12 +57063,14 @@
  212.109.198.157
  212.109.213.11
  212.109.213.12
+212.109.221.73
  212.109.39.180
  212.110.20.141
  212.111.40.56
  212.111.9.245
  212.112.113.235
  212.112.124.123
+212.112.97.242
  212.112.97.27
  212.112.98.98
  212.113.35.162
@@ -57235,6 +57082,7 @@
  212.115.233.78
  212.115.234.82
  212.115.236.87
+212.115.49.229
  212.115.49.239
  212.116.65.244
  212.117.165.14
@@ -57252,7 +57100,6 @@
  212.12.20.34
  212.12.31.69
  212.12.52.231
-212.120.186.39
  212.122.187.209
  212.124.114.242
  212.124.160.4
@@ -57264,13 +57111,13 @@
  212.126.127.50
  212.126.97.83
  212.127.89.62
+212.129.0.128
  212.129.1.25
  212.129.147.227
  212.129.152.27
  212.129.16.22
  212.129.179.53
  212.129.18.107
-212.129.24.108
  212.129.24.79
  212.129.242.171
  212.129.245.90
@@ -57280,10 +57127,8 @@
  212.129.255.123
  212.129.27.74
  212.129.29.139
-212.129.30.249
  212.129.34.117
  212.129.35.213
-212.129.39.76
  212.129.46.40
  212.129.47.122
  212.129.49.38
@@ -57292,29 +57137,33 @@
  212.129.53.188
  212.129.55.0
  212.129.56.216
+212.129.63.196
  212.129.9.233
  212.13.49.186
+212.14.101.97
  212.14.163.206
  212.142.104.138
-212.142.121.168
  212.142.134.150
  212.143.219.98
  212.143.230.27
  212.145.192.205
+212.146.241.36
  212.146.44.91
-212.149.202.12
  212.149.208.228
  212.15.184.190
  212.154.250.21
  212.154.58.105
  212.154.62.34
  212.154.83.106
+212.154.94.45
+212.156.115.58
  212.156.136.114
  212.156.138.238
  212.156.17.218
  212.156.217.202
  212.156.230.10
  212.156.55.34
+212.156.58.46
  212.156.59.70
  212.156.86.130
  212.156.91.38
@@ -57329,6 +57178,7 @@
  212.162.151.144
  212.166.68.146
  212.168.31.17
+212.17.102.75
  212.17.24.79
  212.170.207.29
  212.172.38.61
@@ -57360,16 +57210,15 @@
  212.199.29.155
  212.199.61.51
  212.2.5.120
+212.20.42.38
  212.20.73.70
  212.200.146.50
  212.200.18.194
  212.200.217.80
  212.200.236.42
-212.200.32.75
  212.200.89.254
  212.205.112.162
  212.205.76.250
-212.21.148.127
  212.21.66.6
  212.22.66.106
  212.22.70.65
@@ -57394,6 +57243,7 @@
  212.227.39.1
  212.227.53.240
  212.227.54.144
+212.230.117.134
  212.230.140.125
  212.230.156.238
  212.230.159.248
@@ -57405,9 +57255,9 @@
  212.233.213.29
  212.233.216.133
  212.233.218.5
+212.233.244.196
  212.234.12.71
  212.235.111.111
-212.235.2.197
  212.235.5.188
  212.235.53.129
  212.237.0.244
@@ -57433,11 +57283,13 @@
  212.237.54.93
  212.237.7.173
  212.237.9.62
+212.237.98.212
  212.24.47.68
  212.241.14.104
  212.241.70.213
  212.247.113.115
  212.247.59.121
+212.248.1.50
  212.248.32.74
  212.25.15.128
  212.25.25.41
@@ -57451,7 +57303,6 @@
  212.28.84.105
  212.3.105.11
  212.3.109.7
-212.3.142.238
  212.3.146.80
  212.3.188.171
  212.3.205.85
@@ -57477,6 +57328,8 @@
  212.38.169.85
  212.4.57.179
  212.4.57.180
+212.41.210.78
+212.42.103.185
  212.42.113.250
  212.42.116.29
  212.42.117.207
@@ -57484,6 +57337,8 @@
  212.42.199.112
  212.42.99.22
  212.42.99.32
+212.43.108.36
+212.45.80.35
  212.46.255.78
  212.47.137.231
  212.47.142.100
@@ -57524,23 +57379,19 @@
  212.51.159.132
  212.52.131.9
  212.54.110.231
+212.55.94.210
  212.56.194.238
  212.56.202.198
  212.56.203.114
  212.56.211.138
-212.58.103.17
-212.58.121.36
  212.58.200.126
  212.58.202.70
  212.59.11.66
  212.59.11.71
  212.59.30.110
  212.59.6.16
-212.60.21.179
  212.60.21.26
  212.60.5.220
-212.62.210.101
-212.62.210.174
  212.63.206.39
  212.64.1.170
  212.64.1.42
@@ -57552,7 +57403,6 @@
  212.64.198.41
  212.64.21.149
  212.64.23.30
-212.64.25.106
  212.64.27.53
  212.64.29.136
  212.64.3.194
@@ -57563,6 +57413,7 @@
  212.64.49.70
  212.64.5.28
  212.64.55.229
+212.64.59.184
  212.64.60.50
  212.64.65.2
  212.64.66.135
@@ -57595,9 +57446,10 @@
  212.69.218.47
  212.69.37.29
  212.7.20.104
-212.70.149.54
+212.7.204.246
  212.70.149.71
  212.70.149.85
+212.70.149.99
  212.71.233.31
  212.71.237.140
  212.71.238.147
@@ -57617,22 +57469,20 @@
  212.73.61.21
  212.73.68.156
  212.73.69.6
-212.75.232.147
+212.77.154.49
  212.79.169.50
+212.8.107.29
  212.8.189.20
  212.8.189.28
  212.8.244.242
-212.8.246.61
  212.8.246.62
  212.8.249.103
  212.8.250.141
  212.80.219.11
  212.80.219.37
+212.80.86.215
  212.81.208.102
-212.81.36.14
-212.81.38.105
-212.81.39.142
-212.81.39.221
+212.81.36.30
  212.83.129.80
  212.83.133.41
  212.83.133.63
@@ -57668,13 +57518,10 @@
  212.83.58.219
  212.83.58.231
  212.83.82.230
-212.83.93.54
  212.86.114.74
  212.86.32.106
-212.86.32.19
  212.89.173.216
  212.9.185.194
-212.90.126.58
  212.90.166.34
  212.90.167.90
  212.90.168.150
@@ -57693,7 +57540,7 @@
  212.92.123.55
  212.92.204.54
  212.92.23.235
-212.93.114.241
+212.93.114.45
  212.95.110.30
  212.95.137.19
  212.95.142.64
@@ -57704,7 +57551,6 @@
  212.97.48.5
  212.98.171.75
  212.98.171.91
-212.98.190.22
  212.98.97.152
  212.99.226.35
  2122159.cloudcommercepro.com
@@ -57714,19 +57560,20 @@
  213.1.216.201
  213.10.100.182
  213.10.181.49
+213.100.193.216
  213.100.212.187
  213.101.151.4
  213.102.68.48
-213.103.130.58
  213.103.131.79
+213.103.141.57
+213.103.143.3
  213.105.29.14
-213.108.134.182
-213.108.162.199
  213.108.162.202
  213.108.18.34
  213.108.200.11
  213.108.248.127
  213.108.249.127
+213.108.5.224
  213.109.160.48
  213.109.235.231
  213.109.238.204
@@ -57735,11 +57582,13 @@
  213.111.197.180
  213.111.197.81
  213.111.77.182
+213.113.117.38
  213.113.250.106
  213.115.224.65
  213.115.254.197
  213.119.69.240
  213.119.76.102
+213.123.141.104
  213.123.237.152
  213.123.60.59
  213.124.126.26
@@ -57750,6 +57599,7 @@
  213.127.189.18
  213.129.34.100
  213.129.99.10
+213.131.7.103
  213.133.100.200
  213.133.81.2
  213.134.192.13
@@ -57771,10 +57621,8 @@
  213.136.87.165
  213.136.89.190
  213.136.94.142
-213.137.71.229
  213.138.77.238
  213.139.210.209
-213.14.112.92
  213.14.25.65
  213.14.25.66
  213.14.25.68
@@ -57790,12 +57638,14 @@
  213.141.157.220
  213.141.41.178
  213.141.47.155
+213.142.150.18
  213.142.156.82
  213.142.185.1
  213.142.206.146
  213.142.21.51
  213.142.218.226
  213.144.135.202
+213.144.147.16
  213.144.156.27
  213.144.157.36
  213.145.110.75
@@ -57804,7 +57654,6 @@
  213.148.199.23
  213.149.103.132
  213.149.171.218
-213.149.176.210
  213.149.190.193
  213.149.61.163
  213.149.62.82
@@ -57817,7 +57666,7 @@
  213.154.0.120
  213.154.2.42
  213.154.3.102
-213.154.70.102
+213.155.114.205
  213.155.3.216
  213.158.29.179
  213.159.200.3
@@ -57833,13 +57682,14 @@
  213.162.112.80
  213.162.22.190
  213.163.113.59
-213.163.115.1
+213.163.114.126
+213.163.115.11
  213.163.115.30
  213.163.116.132
  213.163.116.192
+213.163.118.144
  213.163.118.187
-213.163.119.73
-213.163.126.104
+213.163.118.227
  213.163.127.107
  213.163.181.33
  213.163.73.106
@@ -57857,19 +57707,20 @@
  213.164.204.89
  213.164.204.90
  213.164.204.94
-213.165.171.173
  213.165.238.253
  213.165.242.22
  213.165.246.66
  213.166.69.123
  213.166.69.147
+213.166.69.182
  213.166.69.70
+213.166.77.144
  213.166.78.141
  213.166.78.179
  213.166.78.189
-213.166.78.223
  213.166.79.140
-213.166.79.24
+213.166.79.176
+213.166.79.53
  213.168.187.27
  213.168.190.59
  213.168.210.76
@@ -57886,17 +57737,15 @@
  213.172.91.53
  213.173.75.243
  213.173.80.3
-213.173.93.228
  213.174.0.72
  213.174.123.194
  213.174.156.71
  213.174.156.72
-213.175.161.181
  213.175.197.156
  213.175.215.160
  213.175.221.110
  213.175.62.19
-213.176.111.177
+213.175.69.114
  213.176.36.147
  213.176.36.42
  213.176.60.74
@@ -57908,12 +57757,10 @@
  213.178.28.118
  213.178.39.170
  213.178.42.83
-213.178.45.77
  213.180.31.149
  213.180.70.138
  213.180.89.75
  213.182.138.224
-213.182.243.90
  213.183.48.211
  213.183.53.250
  213.183.56.121
@@ -57938,6 +57785,7 @@
  213.190.100.135
  213.190.50.166
  213.192.25.241
+213.192.31.241
  213.193.19.21
  213.193.24.55
  213.193.42.1
@@ -57945,13 +57793,14 @@
  213.193.89.242
  213.194.140.128
  213.194.149.28
+213.194.168.204
  213.194.173.90
  213.194.99.235
  213.194.99.250
  213.195.100.90
+213.195.111.70
  213.195.112.248
  213.195.112.74
-213.197.148.230
  213.200.221.94
  213.202.208.226
  213.202.212.78
@@ -57961,12 +57810,15 @@
  213.203.138.236
  213.204.125.240
  213.204.125.89
+213.205.240.170
  213.206.249.181
  213.206.91.61
  213.207.37.214
  213.207.92.226
  213.208.191.82
+213.209.125.212
  213.210.67.186
+213.213.201.76
  213.215.0.122
  213.215.123.33
  213.215.123.54
@@ -57984,7 +57836,6 @@
  213.219.210.178
  213.219.210.180
  213.219.210.182
-213.22.63.71
  213.220.197.76
  213.222.187.138
  213.222.34.200
@@ -58003,20 +57854,18 @@
  213.229.86.240
  213.23.12.149
  213.230.107.202
+213.230.108.52
  213.230.110.107
  213.230.110.39
-213.230.121.113
-213.230.127.137
  213.230.127.141
-213.230.127.143
-213.230.40.80
  213.230.67.32
  213.230.69.33
+213.230.71.0
  213.230.77.13
+213.230.85.65
  213.230.96.243
  213.231.21.109
-213.232.123.184
-213.232.193.53
+213.232.87.96
  213.233.57.134
  213.234.0.242
  213.234.119.4
@@ -58025,9 +57874,7 @@
  213.234.252.110
  213.234.252.254
  213.234.31.22
-213.236.4.129
  213.238.182.236
-213.238.6.241
  213.238.8.11
  213.239.196.9
  213.239.199.150
@@ -58047,7 +57894,7 @@
  213.239.218.54
  213.239.220.183
  213.239.232.113
-213.241.53.122
+213.240.218.15
  213.241.94.243
  213.241.94.246
  213.243.151.242
@@ -58071,6 +57918,7 @@
  213.252.247.233
  213.252.247.69
  213.253.214.229
+213.254.106.160
  213.254.212.186
  213.26.225.134
  213.27.152.15
@@ -58090,6 +57938,7 @@
  213.32.253.145
  213.32.253.150
  213.32.254.240
+213.32.27.198
  213.32.30.227
  213.32.31.108
  213.32.32.23
@@ -58098,6 +57947,7 @@
  213.32.47.9
  213.32.63.123
  213.32.63.93
+213.32.71.196
  213.32.77.242
  213.32.78.219
  213.32.83.233
@@ -58110,7 +57960,6 @@
  213.35.152.193
  213.35.152.198
  213.35.233.247
-213.37.138.11
  213.37.205.33
  213.37.5.133
  213.39.55.13
@@ -58118,6 +57967,7 @@
  213.42.28.185
  213.42.95.134
  213.45.175.155
+213.46.79.217
  213.46.85.185
  213.47.111.35
  213.47.114.114
@@ -58130,11 +57980,11 @@
  213.5.17.18
  213.5.67.223
  213.50.164.53
+213.50.196.138
  213.52.129.250
  213.52.74.198
-213.55.90.5
+213.55.85.42
  213.56.166.35
-213.57.123.148
  213.58.202.70
  213.6.101.174
  213.6.107.222
@@ -58169,17 +58019,16 @@
  213.60.210.202
  213.60.215.167
  213.61.149.100
-213.61.215.54
  213.61.220.144
-213.61.89.51
+213.64.191.148
+213.65.146.39
  213.66.116.248
-213.67.79.18
+213.67.185.149
  213.7.192.126
  213.7.196.26
-213.7.208.27
+213.7.71.236
  213.7.96.25
  213.79.101.98
-213.79.122.108
  213.80.121.150
  213.80.166.5
  213.80.225.40
@@ -58220,13 +58069,13 @@
  213.86.4.51
  213.87.101.176
  213.87.197.25
+213.87.225.9
  213.87.245.215
-213.87.87.173
  213.89.131.35
  213.89.131.53
-213.89.33.215
  213.91.187.242
  213.91.202.230
+213.91.211.148
  213.91.221.54
  213.91.244.58
  213.91.247.55
@@ -58237,6 +58086,8 @@
  213.92.255.223
  213.93.145.183
  213.93.176.58
+213.94.53.124
+213.94.55.1
  213.94.59.246
  213.94.61.17
  213.95.149.22
@@ -58251,9 +58102,12 @@
  215b401f60fafd39ce86a7109ac71ed0.icu
  215betasus.com
  216-information.com
+216.10.242.176
  216.10.242.97
  216.10.245.150
  216.10.247.146
+216.10.251.112
+216.10.36.147
  216.104.15.130
  216.104.37.122
  216.104.40.170
@@ -58266,6 +58120,7 @@
  216.115.227.160
  216.117.136.95
  216.118.233.138
+216.12.164.110
  216.120.237.30
  216.121.123.115
  216.121.63.153
@@ -58282,12 +58137,11 @@
  216.138.32.4
  216.138.34.116
  216.14.115.231
-216.14.148.200
  216.14.148.217
  216.14.150.143
-216.14.150.212
  216.14.152.239
-216.14.157.236
+216.14.155.140
+216.14.155.40
  216.143.116.8
  216.144.120.16
  216.144.243.34
@@ -59068,11 +58922,11 @@
  216.151.138.99
  216.151.163.114
  216.151.180.135
+216.151.180.159
+216.151.180.190
  216.151.183.112
-216.151.183.190
-216.151.183.22
-216.151.183.28
  216.151.183.88
+216.152.167.21
  216.152.249.0
  216.152.249.1
  216.152.249.10
@@ -59586,6 +59440,7 @@
  216.152.252.98
  216.152.252.99
  216.154.201.132
+216.155.131.162
  216.155.151.198
  216.155.90.238
  216.157.21.35
@@ -59596,14 +59451,14 @@
  216.158.232.133
  216.158.93.104
  216.158.93.106
+216.16.175.86
  216.160.123.107
-216.160.139.196
  216.160.204.10
  216.161.155.26
  216.161.214.11
-216.163.201.29
  216.164.16.190
  216.164.192.25
+216.164.252.78
  216.167.162.37
  216.168.195.253
  216.168.37.169
@@ -59632,8 +59487,7 @@
  216.177.193.90
  216.18.178.238
  216.18.201.130
-216.18.204.202
-216.18.204.214
+216.18.205.181
  216.18.22.198
  216.18.231.50
  216.18.242.55
@@ -59651,7 +59505,6 @@
  216.180.117.68
  216.180.117.96
  216.183.177.131
-216.183.222.135
  216.183.40.209
  216.183.40.225
  216.183.40.241
@@ -59671,7 +59524,6 @@
  216.191.44.121
  216.193.128.54
  216.196.140.205
-216.196.251.42
  216.199.232.112
  216.20.131.111
  216.200.166.188
@@ -59715,6 +59567,7 @@
  216.24.85.65
  216.24.85.65bin.sh
  216.24.85.75
+216.24.93.146
  216.241.50.74
  216.244.65.10
  216.244.65.11
@@ -59738,6 +59591,7 @@
  216.246.49.197
  216.246.98.68
  216.250.252.9
+216.250.253.203
  216.250.96.132
  216.250.97.10
  216.250.97.150
@@ -59791,7 +59645,6 @@
  216.74.255.182
  216.74.32.109
  216.75.37.196
-216.75.60.208
  216.8.128.72
  216.80.102.155
  216.82.243.88
@@ -59806,11 +59659,9 @@
  216.85.161.243
  216.86.153.114
  216.86.154.215
-216.93.219.145
  216.96.59.210
  216.97.107.154
  216.97.65.6
-216.98.215.164
  216.98.66.25
  216.98.66.25bin.sh
  216.98.80.5
@@ -59834,6 +59685,7 @@
  217.103.94.158
  217.104.121.248
  217.104.75.11
+217.104.91.86
  217.106.225.134
  217.106.32.209
  217.107.194.5
@@ -59872,13 +59724,12 @@
  217.121.153.209
  217.123.170.239
  217.123.190.54
-217.124.143.189
  217.126.115.60
  217.126.50.212
-217.127.133.214
  217.128.133.129
  217.128.8.98
  217.129.142.250
+217.129.202.239
  217.13.106.14
  217.13.107.26
  217.13.201.233
@@ -59889,6 +59740,7 @@
  217.13.221.247
  217.131.182.240
  217.131.2.232
+217.132.172.104
  217.133.12.80
  217.133.138.66
  217.133.23.120
@@ -59900,11 +59752,8 @@
  217.138.197.60
  217.138.202.42
  217.138.205.162
-217.138.207.172
-217.138.221.251
-217.138.221.252
+217.138.219.138
  217.138.222.84
-217.138.252.221
  217.139.12.181
  217.14.7.228
  217.14.7.228bin.sh
@@ -59915,6 +59764,7 @@
  217.146.27.52
  217.146.27.53
  217.146.76.212
+217.146.82.137
  217.147.1.128
  217.147.165.79
  217.147.169.244
@@ -59936,7 +59786,6 @@
  217.150.85.242
  217.150.87.242
  217.155.13.97
-217.155.55.187
  217.155.64.107
  217.16.18.219
  217.160.107.189
@@ -59952,7 +59801,6 @@
  217.160.249.114
  217.160.250.141
  217.160.254.33
-217.160.42.15
  217.160.45.238
  217.160.59.241
  217.160.59.64
@@ -59961,6 +59809,7 @@
  217.163.11.111
  217.163.28.231
  217.165.219.219
+217.165.61.110
  217.168.76.230
  217.168.76.77
  217.169.210.130
@@ -59983,11 +59832,11 @@
  217.170.85.222
  217.171.62.42
  217.171.66.171
-217.172.122.10
-217.172.122.12
-217.172.122.14
-217.172.122.16
-217.172.122.4
+217.172.122.11
+217.172.122.15
+217.172.122.17
+217.172.122.18
+217.172.122.5
  217.172.179.138
  217.172.179.75
  217.172.186.250
@@ -59995,7 +59844,8 @@
  217.172.244.9
  217.174.177.139
  217.174.248.162
-217.174.249.31
+217.175.112.83
+217.175.218.243
  217.18.237.76
  217.182.103.201
  217.182.120.32
@@ -60005,8 +59855,10 @@
  217.182.138.31
  217.182.138.4
  217.182.138.8
+217.182.140.117
  217.182.141.253
  217.182.142.251
+217.182.16.9
  217.182.168.115
  217.182.169.68
  217.182.170.138
@@ -60019,6 +59871,7 @@
  217.182.175.112
  217.182.175.78
  217.182.192.217
+217.182.193.49
  217.182.197.93
  217.182.198.173
  217.182.198.228
@@ -60026,9 +59879,11 @@
  217.182.205.27
  217.182.205.77
  217.182.217.24
+217.182.217.249
  217.182.225.67
  217.182.23.55
  217.182.245.0
+217.182.250.191
  217.182.253.249
  217.182.27.217
  217.182.30.160
@@ -60058,7 +59913,6 @@
  217.196.64.12
  217.196.67.61
  217.197.160.186
-217.197.244.11
  217.197.244.186
  217.197.244.238
  217.197.244.98
@@ -60079,25 +59933,21 @@
  217.21.125.180
  217.21.193.74
  217.21.54.173
-217.211.101.29
+217.211.126.157
  217.216.106.107
-217.217.215.28
  217.218.233.164
-217.219.129.32
  217.22.141.61
  217.22.35.227
  217.22.60.25
-217.224.114.22
  217.224.126.229
-217.225.113.179
  217.225.96.104
  217.226.112.17
-217.226.123.233
+217.226.182.248
  217.229.153.55
  217.229.154.143
-217.229.158.226
+217.229.159.248
+217.229.49.77
  217.229.53.11
-217.229.54.240
  217.23.12.100
  217.23.12.47
  217.23.3.171
@@ -60110,43 +59960,44 @@
  217.23.8.80
  217.23.81.223
  217.230.216.68
-217.230.217.136
+217.230.223.48
+217.230.50.32
+217.232.159.224
  217.233.46.138
  217.237.112.101
-217.238.157.168
  217.24.18.226
  217.24.240.68
  217.24.72.52
  217.244.140.227
-217.245.85.49
-217.246.226.128
-217.248.93.160
+217.245.84.159
+217.245.89.201
+217.246.227.62
  217.25.113.79
-217.25.172.97
  217.25.198.133
  217.25.221.60
  217.25.25.246
  217.25.31.20
-217.250.120.42
-217.251.140.244
+217.25.40.254
  217.251.77.248
-217.252.205.136
-217.253.131.184
+217.252.118.50
  217.26.163.82
  217.26.47.10
  217.27.193.106
  217.27.219.14
+217.27.45.222
  217.28.145.58
  217.29.126.136
  217.29.18.206
+217.29.185.34
  217.29.28.199
-217.30.205.149
  217.31.48.13
  217.31.48.30
  217.31.58.188
  217.32.179.89
+217.34.51.231
  217.35.78.204
  217.35.82.250
+217.39.183.41
  217.40.96.250
  217.44.165.111
  217.44.196.189
@@ -60165,7 +60016,6 @@
  217.61.19.109
  217.61.61.60
  217.61.63.228
-217.64.108.66
  217.64.109.231
  217.64.113.195
  217.64.133.220
@@ -60175,7 +60025,6 @@
  217.64.47.138
  217.65.6.12
  217.66.106.216
-217.66.156.116
  217.67.182.170
  217.69.13.110
  217.69.133.4
@@ -60188,6 +60037,7 @@
  217.69.9.142
  217.7.247.90
  217.70.150.8
+217.70.186.133
  217.70.191.85
  217.70.30.101
  217.70.32.9
@@ -60214,7 +60064,6 @@
  217.79.184.243
  217.79.184.43
  217.79.189.139
-217.79.197.5
  217.79.3.94
  217.8.117.10
  217.8.117.132
@@ -60232,22 +60081,23 @@
  217.8.117.77
  217.8.117.79
  217.8.117.89
-217.81.10.39
+217.81.14.62
  217.81.21.173
  217.81.4.1
-217.84.160.154
+217.84.165.102
  217.84.168.74
-217.84.171.86
-217.84.173.122
  217.86.210.82
  217.87.216.66
  217.91.139.4
  217.91.215.177
+217.91.38.70
  217.92.44.164
  217.92.55.246
  217.95.160.149
  217538-dot-n-e-w-me-ss-age-po-rt-al.wl.r.appspot.com
  218.101.202.186
+218.102.151.70
+218.102.159.165
  218.102.202.137
  218.102.219.29
  218.104.153.60
@@ -60265,16 +60115,19 @@
  218.109.145.152
  218.11.10.252
  218.11.88.78
+218.111.88.185
  218.12.167.69
+218.13.170.51
+218.13.183.138
  218.14.109.42
  218.14.208.90
-218.144.62.85
  218.144.69.224
  218.145.29.142
  218.146.20.61
  218.148.103.136
  218.149.128.186
  218.150.128.4
+218.150.169.247
  218.150.243.158
  218.150.38.156
  218.150.85.170
@@ -60288,16 +60141,20 @@
  218.156.226.141
  218.156.26.85
  218.157.166.40
-218.158.113.135
  218.158.113.142
  218.158.113.142bin.sh
  218.158.113.154
  218.158.57.21
+218.159.34.213
  218.16.204.227
+218.161.36.89
  218.161.39.151
  218.161.42.248
+218.161.62.145
  218.164.16.44
+218.166.24.206
  218.166.36.57
+218.166.96.95
  218.17.185.162
  218.17.185.223
  218.17.192.195
@@ -60312,21 +60169,21 @@
  218.188.39.51
  218.188.39.59
  218.189.19.30
-218.19.169.211
  218.192.12.166
  218.197.16.152
  218.2.106.125
-218.2.31.34
  218.2.53.161
  218.20.124.113
  218.20.124.25
+218.20.32.158
  218.20.33.241
  218.200.149.181
  218.201.133.86
+218.202.143.68
  218.203.206.137
+218.204.93.37
  218.205.108.186
  218.206.233.198
-218.207.116.33
  218.207.126.155
  218.207.20.109
  218.208.209.217
@@ -60355,21 +60212,22 @@
  218.21.240.24
  218.21.78.35
  218.212.209.196
-218.212.22.250
  218.213.137.21
+218.214.216.149
  218.215.243.65
  218.217.114.239
  218.219.238.62
  218.22.127.176
  218.22.190.174
+218.22.214.142
  218.22.27.14
  218.22.36.135
-218.221.207.116
  218.227.171.11
  218.232.109.160
  218.234.165.18
  218.234.19.79
  218.234.21.178
+218.235.113.249
  218.236.113.49
  218.237.180.126
  218.237.253.167
@@ -60377,7 +60235,6 @@
  218.238.2.226
  218.24.16.198
  218.24.163.221
-218.240.159.110
  218.241.234.48
  218.242.33.29
  218.245.1.169
@@ -60386,14 +60243,19 @@
  218.248.116.142
  218.248.13.51
  218.248.232.24
+218.248.29.19
  218.248.64.239
-218.249.168.10
  218.249.45.162
+218.25.130.220
  218.25.140.72
  218.25.161.226
+218.250.117.226
  218.250.134.9
+218.250.17.19
  218.250.224.35
+218.250.99.249
  218.253.251.163
+218.253.251.69
  218.255.136.110
  218.255.198.254
  218.255.226.166
@@ -60409,9 +60271,9 @@
  218.28.160.174
  218.28.238.162
  218.28.83.106
+218.28.83.123
  218.29.128.195
-218.29.139.3
-218.29.16.11
+218.29.142.214
  218.29.188.139
  218.29.188.169
  218.29.196.186
@@ -60443,6 +60305,7 @@
  218.38.34.19
  218.38.56.83
  218.39.130.113
+218.39.65.152
  218.39.91.20
  218.4.159.46
  218.4.234.74
@@ -60451,14 +60314,15 @@
  218.5.74.92
  218.50.52.241
  218.51.205.132
+218.52.228.218
  218.53.89.239
  218.54.123.239
  218.54.149.67
+218.54.175.51
  218.55.227.145
  218.56.11.181
  218.56.11.236
  218.56.160.82
-218.56.221.108
  218.56.226.68
  218.56.71.164
  218.56.93.129
@@ -60466,13 +60330,13 @@
  218.57.118.56
  218.57.213.9
  218.57.236.23
-218.57.237.243
  218.57.41.180
  218.57.51.87
  218.57.51.87bin.sh
  218.57.55.87
  218.57.81.236
  218.57.87.42
+218.58.104.202
  218.58.194.162
  218.58.83.60
  218.58.96.189
@@ -60483,6 +60347,7 @@
  218.59.14.132
  218.59.193.14
  218.59.20.144
+218.59.235.30
  218.59.46.158
  218.59.48.183
  218.59.98.138bin.sh
@@ -60499,22 +60364,22 @@
  218.64.69.79
  218.65.219.119
  218.65.221.24
+218.65.30.61
  218.65.6.37
-218.66.50.65
  218.66.67.27
  218.67.219.129
  218.68.0.42
  218.69.91.84
-218.7.171.91
  218.70.148.133
  218.70.66.187
  218.71.141.62
  218.72.204.204
+218.73.134.191
+218.73.135.235
  218.73.60.118
  218.75.110.41
  218.75.110.51
  218.75.121.74
-218.75.132.59
  218.75.156.247
  218.75.190.215
  218.75.210.46
@@ -60523,25 +60388,29 @@
  218.75.69.50
  218.75.72.82
  218.75.77.92
+218.75.78.82
  218.76.101.25
-218.76.215.4
  218.76.223.50
+218.76.30.193
  218.76.52.120
  218.76.69.43
+218.77.108.48
  218.77.43.152
+218.77.88.36
  218.78.209.1
  218.78.209.241
+218.78.21.74
  218.78.46.81
+218.78.50.164
  218.78.54.80
-218.79.133.21
  218.8.251.187
+218.80.103.81
  218.82.136.117
  218.86.155.143
  218.86.31.67
  218.86.87.171
  218.88.205.172
  218.88.205.62
-218.88.87.100
  218.89.138.115
  218.89.222.16
  218.89.222.178
@@ -60574,16 +60443,18 @@
  218.92.0.204
  218.92.0.205
  218.92.0.206
-218.92.0.210
  218.92.0.211
  218.92.0.247
  218.92.0.248
+218.92.150.130
+218.92.150.134
  218.92.161.154
  218.92.173.58
  218.92.175.102
  218.92.192.170
  218.93.119.90
  218.93.12.178
+218.93.124.18
  218.93.172.55
  218.93.198.218
  218.93.208.150
@@ -60597,6 +60468,7 @@
  218.95.175.166
  218.95.182.38
  218.95.37.66
+218.95.97.208
  218270aa6e0294fb7a7a4f77229e10301cd5aec3.info
  218711.com
  218847280326116-dot-wetransfer-auth-file334.appspot.com
@@ -60610,107 +60482,112 @@
  219.119.136.54
  219.121.0.60
  219.131.193.180
-219.133.156.240
  219.133.159.57
+219.134.216.73
  219.135.209.164
  219.135.97.82
+219.136.190.49
  219.136.249.151
  219.137.113.226
+219.137.170.118
  219.137.170.177
  219.137.170.218
+219.137.170.48
+219.137.170.89
  219.137.65.242
  219.137.72.94
  219.139.115.27
  219.139.191.129
  219.140.127.71
-219.140.53.229
+219.140.21.1
  219.141.231.161
-219.143.141.162
-219.143.142.15
-219.143.142.246
-219.143.143.80
  219.143.171.36
  219.143.38.232
  219.144.67.60
  219.144.82.202
+219.145.118.23
+219.145.20.78
  219.146.127.6
-219.146.83.58
+219.146.247.146
  219.147.112.150
  219.147.25.6
  219.147.74.48
+219.147.99.190
+219.148.140.3
  219.148.31.135
  219.150.218.49
+219.150.93.157
+219.151.151.202
  219.151.151.35
  219.151.155.197
  219.151.248.79
  219.151.9.139
  219.152.168.133
  219.152.169.167
-219.152.170.95
+219.152.170.58
  219.153.100.153
  219.153.110.218
  219.153.20.224
  219.153.33.234
  219.154.102.109
+219.154.109.187
  219.154.111.240
-219.154.112.20
-219.154.153.207
  219.154.160.74
  219.154.182.255
-219.154.189.97
  219.154.81.151
+219.155.102.133
  219.155.13.243
-219.155.169.231
+219.155.14.92
+219.155.172.110
  219.155.173.103
  219.155.173.132
-219.155.208.145
-219.155.208.211
+219.155.20.190
  219.155.210.213
  219.155.215.80
+219.155.217.195
  219.155.22.224
  219.155.23.198
+219.155.29.225
+219.155.31.127
  219.155.38.49
+219.155.65.9
  219.155.69.108
  219.155.85.100
  219.155.96.191
  219.155.99.73
-219.156.107.98
-219.156.179.158
+219.156.174.195
  219.156.18.9
  219.156.188.241
-219.156.20.101
+219.156.243.151
  219.156.56.167
+219.156.64.38
  219.156.65.27
  219.156.77.236
-219.156.77.94
  219.156.90.161
-219.157.133.208
  219.157.134.45
  219.157.134.51
+219.157.153.126
  219.157.168.233
  219.157.170.222
  219.157.171.27
-219.157.179.166
-219.157.181.127
+219.157.18.129
  219.157.214.236
  219.157.215.139
  219.157.215.31
  219.157.215.70
-219.157.215.99
  219.157.218.126
  219.157.221.183
  219.157.23.3
  219.157.235.93
  219.157.251.29
+219.157.254.204
+219.157.26.96
  219.157.28.172
-219.157.31.22
  219.157.32.51
  219.157.32.53
-219.157.33.112
+219.157.33.187
  219.157.36.105
-219.157.51.173
  219.157.54.231
-219.157.64.155
  219.233.217.123
  219.234.8.165
  219.235.3.182
@@ -60730,21 +60607,34 @@
  219.69.110.49
  219.70.215.34
  219.71.216.49
-219.73.126.11
+219.73.52.214
+219.74.140.102
  219.75.104.67
-219.76.191.29
  219.76.192.202
  219.76.200.27
-219.77.186.28
+219.77.230.240
+219.78.0.165
+219.78.186.156
+219.78.249.2
+219.78.26.55
+219.78.64.204
+219.78.72.36
+219.78.73.87
+219.79.107.66
+219.79.116.100
+219.79.223.69
+219.79.232.167
+219.79.76.50
  219.80.133.57
  219.83.125.35
-219.84.106.91
+219.83.34.178
  219.84.234.73
  219.84.236.108
  219.84.28.244
  219.85.145.194
  219.85.145.194bin.sh
  219.85.156.111
+219.85.163.10
  219.85.169.224
  219.85.187.131
  219.85.56.111
@@ -60754,14 +60644,12 @@
  219.91.250.40
  219.91.255.179
  219.92.13.25
-219.92.142.134
  219.92.154.116
  219.92.228.222
+219.92.235.93
  219.92.59.93
  219.92.6.185
  219.93.110.60
-219.93.121.46
-219.93.214.77
  219.93.6.6
  219.94.128.174
  219.94.194.248
@@ -60781,22 +60669,19 @@
  220-365.net
  220.102.13.27
  220.110.145.21
-220.110.145.22
  220.116.55.86
  220.116.55.86bin.sh
  220.117.28.85
+220.117.71.33
  220.118.168.155
  220.120.106.254
  220.120.15.27
-220.120.40.5
  220.121.112.170
  220.121.37.66
  220.122.177.223
  220.122.253.188
  220.123.121.81
  220.123.122.250bin.sh
-220.123.14.232
-220.123.159.167
  220.123.235.22
  220.123.235.58
  220.123.239.163
@@ -60821,17 +60706,17 @@
  220.132.75.140
  220.132.86.14
  220.132.86.21
+220.133.130.29
  220.133.209.253
  220.133.230.106
  220.133.39.61
  220.133.95.68
-220.134.131.218
+220.134.114.163
  220.134.38.32
-220.135.165.38
  220.135.2.247
  220.135.81.163
-220.136.78.160
  220.136.99.25
+220.142.97.129
  220.143.161.233
  220.143.192.220
  220.143.70.100
@@ -60842,7 +60727,7 @@
  220.158.216.139
  220.158.216.15
  220.158.226.71
-220.161.101.247
+220.162.165.191
  220.164.118.16
  220.164.161.201
  220.164.2.110
@@ -60855,17 +60740,19 @@
  220.168.240.227
  220.168.52.245
  220.169.127.172
+220.170.89.89
  220.171.104.130
  220.171.93.62
  220.173.160.221
  220.173.160.221bin.sh
-220.176.52.217
  220.177.92.227
  220.178.120.74
  220.178.171.184
  220.178.63.110
  220.179.231.212
+220.179.231.250
  220.180.107.193
+220.180.112.208
  220.180.119.192
  220.180.192.152
  220.180.192.77
@@ -60874,9 +60761,9 @@
  220.185.195.156
  220.185.198.208
  220.185.215.165
+220.189.116.116
  220.189.116.236
  220.191.237.75
-220.194.237.2
  220.194.248.144
  220.194.59.89
  220.196.1.142
@@ -60884,21 +60771,25 @@
  220.210.140.71
  220.211.115.214
  220.225.126.55
+220.225.7.81
  220.225.87.129
  220.226.103.254
  220.226.188.32
  220.230.121.57
  220.231.127.7
  220.233.149.34
+220.233.178.199
  220.233.36.24
-220.235.155.24
  220.235.165.210
  220.235.203.64
  220.245.124.14
-220.245.142.216
  220.245.198.194
  220.245.40.9
-220.246.66.166
+220.246.147.251
+220.246.153.187
+220.246.205.235
+220.246.217.217
+220.246.37.182
  220.247.166.135
  220.247.174.12
  220.247.174.202
@@ -60909,7 +60800,6 @@
  220.248.188.75
  220.248.95.178
  220.249.103.43
-220.249.103.44
  220.250.50.90
  220.253.85.119
  220.255.1.162
@@ -60929,6 +60819,7 @@
  220.76.223.169
  220.77.117.160
  220.77.117.160bin.sh
+220.77.184.119
  220.77.23.6
  220.77.23.6bin.sh
  220.77.251.94
@@ -60938,18 +60829,22 @@
  220.79.131.182
  220.79.34.109
  220.80.108.150
-220.80.127.44
+220.80.219.126
  220.80.72.187
+220.81.113.77
  220.81.118.211
  220.81.142.161
  220.81.200.65
+220.82.104.216
  220.84.179.125
+220.84.248.58
  220.84.76.77
  220.85.144.136
  220.85.144.169
  220.85.155.210
  220.85.233.146
  220.86.227.220
+220.86.254.138
  220.86.29.35
  220.87.123.110
  220.87.94.21
@@ -60957,7 +60852,6 @@
  220.88.1.208
  220.89.71.36
  220.92.137.31
-220.94.233.133
  220.94.66.153bin.sh
  220.94.87.179
  220betasus.com
@@ -60979,7 +60873,6 @@
  221.10.141.8
  221.118.117.219
  221.120.189.209
-221.120.41.229
  221.120.98.49
  221.120.99.241
  221.121.12.238
@@ -61002,6 +60895,8 @@
  221.122.93.227
  221.125.114.70
  221.126.244.72
+221.127.125.183
+221.13.150.212
  221.130.59.248
  221.131.136.10
  221.131.165.124
@@ -61017,10 +60912,11 @@
  221.139.3.168
  221.139.50.13
  221.14.106.221
+221.14.122.131
  221.14.122.28
-221.14.123.250
+221.14.123.124
  221.14.152.158
-221.14.182.206
+221.14.176.189
  221.14.7.241
  221.140.24.8
  221.141.1.113
@@ -61033,6 +60929,7 @@
  221.143.40.39
  221.143.48.143
  221.143.48.34
+221.144.178.226
  221.145.202.130
  221.146.36.121
  221.146.77.90
@@ -61041,30 +60938,27 @@
  221.148.123.67
  221.148.45.168
  221.15.11.116
+221.15.124.180
  221.15.145.158
-221.15.156.43
-221.15.159.84
-221.15.170.90
+221.15.153.213
+221.15.171.114
  221.15.176.96
  221.15.196.210
  221.15.197.135
  221.15.198.237
+221.15.214.105
  221.15.216.89
  221.15.217.67
  221.15.22.0
  221.15.22.137
  221.15.22.26
  221.15.224.195
-221.15.233.48
  221.15.235.221
-221.15.254.235
-221.15.3.111
  221.15.4.174
+221.15.54.151
  221.15.54.162
  221.15.6.110
-221.15.86.149
  221.150.198.65
-221.150.22.201
  221.150.43.110
  221.151.207.173
  221.151.26.232
@@ -61078,7 +60972,7 @@
  221.158.33.23
  221.159.237.189
  221.159.237.189bin.sh
-221.159.47.113
+221.160.115.22
  221.160.129.2
  221.160.177.112
  221.160.177.153
@@ -61091,10 +60985,11 @@
  221.160.206.90
  221.161.195.249
  221.161.31.8
+221.163.127.100
  221.164.117.211
  221.164.122.198
+221.164.199.163
  221.164.211.139bin.sh
-221.164.219.233
  221.165.13.155
  221.166.237.100
  221.166.250.205
@@ -61120,7 +61015,7 @@
  221.192.241.97
  221.192.244.242
  221.194.102.131
-221.195.109.174
+221.195.1.201
  221.195.73.68
  221.195.73.86
  221.196.121.179
@@ -61129,8 +61024,10 @@
  221.2.35.78
  221.200.110.249
  221.200.120.93
+221.201.48.229
  221.202.168.254
  221.203.169.50
+221.208.97.251
  221.209.17.222
  221.210.211.102
  221.210.211.11
@@ -61187,8 +61084,10 @@
  221.215.82.167
  221.215.82.87
  221.216.136.193
+221.216.136.252
  221.216.137.238
  221.216.139.62
+221.216.143.89
  221.216.205.26
  221.216.95.120
  221.218.12.117
@@ -61197,19 +61096,14 @@
  221.224.213.156
  221.224.28.51
  221.224.41.219
-221.225.100.232
-221.225.100.25
+221.224.53.20
+221.224.71.226
  221.225.126.183
  221.225.126.185
-221.225.126.209
-221.225.126.77
  221.225.129.63
-221.225.143.107
-221.225.161.31
-221.225.194.205
-221.225.222.107
  221.225.68.161
  221.225.70.116
+221.225.81.86
  221.225.82.74
  221.225.83.45
  221.226.105.66
@@ -61217,12 +61111,12 @@
  221.226.39.202
  221.226.48.102
  221.226.94.218
+221.227.109.159
  221.227.125.75
  221.228.109.146
  221.229.144.191
  221.229.190.64
  221.229.199.103
-221.229.218.50
  221.229.223.2
  221.229.247.179
  221.229.252.98
@@ -61232,25 +61126,28 @@
  221.231.72.66
  221.231.9.138
  221.232.158.106
+221.232.59.199
  221.233.213.82
  221.234.216.96
  221.235.184.101
-221.235.184.110
  221.235.72.170
  221.235.77.157
  221.237.189.26
+221.237.30.13
  221.239.206.120
  221.239.48.197
+221.243.222.154
  221.3.105.164
-221.3.110.150
  221.3.112.125
  221.3.27.182
  221.3.32.216
  221.3.66.153
  221.3.68.16
+221.3.77.21
  221.3.87.204
  221.3.89.189
  221.4.133.52
+221.4.197.154
  221.4.63.84
  221.5.31.159
  221.5.80.66
@@ -61266,6 +61163,7 @@
  221.7.59.167
  221.8.31.27
  221.8.38.131
+221.8.57.100
  221102.us-south.cf.appdomain.cloud
  2214756-39975-dot-bles05.wn.r.appspot.com
  221496844.embeddedsw.org
@@ -61276,28 +61174,29 @@
  222.101.161.15
  222.101.206.56
  222.102.125.183
+222.104.137.106
  222.104.247.109
  222.104.247.109bin.sh
-222.104.252.232
  222.105.26.35
  222.105.42.227
  222.107.145.100
  222.107.156.227
-222.108.131.122
  222.108.213.43
-222.109.246.33
+222.109.210.184
  222.109.26.50
+222.109.38.237
  222.110.147.61
  222.112.186.86
-222.112.206.112
  222.112.220.12
  222.113.184.193
+222.114.200.160
  222.114.229.121
  222.117.124.136
+222.117.172.3
  222.117.176.100
-222.118.197.51
  222.119.28.7
  222.119.53.151
+222.120.14.39
  222.122.141.47
  222.122.157.111
  222.122.161.125
@@ -61318,6 +61217,7 @@
  222.124.155.106
  222.124.170.66
  222.124.200.250
+222.124.215.227
  222.124.30.138
  222.124.7.150
  222.126.154.49
@@ -61334,20 +61234,18 @@
  222.128.6.99
  222.128.60.162
  222.128.9.235
-222.132.58.160
  222.133.103.160
  222.133.119.184
+222.133.26.118
  222.133.64.104
-222.134.30.205
  222.134.91.170
  222.135.117.139
+222.135.12.64
  222.135.131.48
+222.136.123.156
  222.136.212.112
-222.136.218.238
-222.136.231.243
-222.136.37.4
  222.137.0.44
-222.137.106.234
+222.137.103.180
  222.137.120.141
  222.137.120.233
  222.137.120.37
@@ -61356,8 +61254,6 @@
  222.137.122.142
  222.137.122.238
  222.137.122.90
-222.137.129.218
-222.137.136.102
  222.137.136.116
  222.137.136.35
  222.137.138.152
@@ -61371,67 +61267,67 @@
  222.137.139.188
  222.137.139.4
  222.137.148.213
-222.137.150.50
-222.137.158.147
-222.137.163.49
-222.137.167.246
-222.137.167.40
-222.137.180.204
+222.137.149.56
+222.137.159.232
+222.137.173.228
  222.137.187.213
-222.137.205.18
+222.137.21.23
  222.137.210.116
-222.137.212.73
  222.137.215.197
  222.137.215.83
-222.137.221.230
-222.137.234.87
+222.137.220.17
+222.137.234.208
+222.137.24.130
  222.137.5.200
  222.137.5.44
-222.137.74.98
+222.137.53.114
  222.137.9.222
-222.137.97.19
+222.137.98.60
  222.138.103.185
+222.138.161.94
+222.138.164.241
  222.138.174.120
  222.138.174.182
  222.138.180.34
  222.138.181.119
  222.138.181.232
+222.138.184.155
  222.138.190.135
  222.138.191.105
-222.138.201.162
  222.138.201.98
+222.138.215.224
  222.138.224.2
  222.138.233.201
-222.138.238.23
  222.138.96.76
-222.139.15.54
  222.139.209.19
  222.139.224.153
  222.139.245.70
  222.139.28.84
-222.140.12.220
-222.140.157.64
-222.140.163.141
+222.139.49.189
+222.140.128.40
  222.140.17.30
-222.140.19.120
  222.140.19.172
  222.140.196.137
-222.140.201.119
+222.140.35.29
  222.140.72.174
-222.141.143.10
-222.141.46.53
+222.141.136.217
+222.141.44.4
+222.141.46.94
+222.141.47.217
  222.141.73.80
  222.141.87.50
  222.142.113.51
+222.142.175.55
+222.142.185.16
  222.142.211.190
  222.142.223.3
+222.142.228.125
  222.153.114.73
  222.153.142.227
  222.153.237.227
-222.153.239.145
  222.161.223.147
-222.161.241.78
  222.161.26.253
+222.162.149.184
  222.165.194.67
  222.165.194.68
  222.165.221.12
@@ -61439,32 +61335,27 @@
  222.165.223.138
  222.165.223.140
  222.165.234.147
-222.166.150.41
  222.168.18.227
  222.168.185.223
-222.168.44.140
  222.169.185.226
  222.169.185.239
  222.169.185.242
  222.169.19.101
  222.169.19.236
  222.170.63.27
-222.173.12.58
  222.173.140.158
  222.173.242.30
-222.173.28.194
  222.173.82.126
  222.173.98.198
  222.174.213.178
  222.174.213.180
+222.174.9.21
  222.175.223.74
-222.175.50.2
+222.175.5.114
  222.175.62.130
  222.179.205.14
-222.179.205.193
  222.180.208.14
  222.180.209.146
-222.180.250.42
  222.184.14.90
  222.184.254.170
  222.184.67.179
@@ -61477,7 +61368,6 @@
  222.185.161.210
  222.185.18.129
  222.185.19.206
-222.185.197.195
  222.185.199.202
  222.185.231.246
  222.185.235.186
@@ -61488,7 +61378,6 @@
  222.185.73.210
  222.185.85.228
  222.186.13.91
-222.186.150.130
  222.186.160.114
  222.186.21.147
  222.186.24.192
@@ -61499,6 +61388,7 @@
  222.186.33.6
  222.186.34.200
  222.186.64.233
+222.186.68.153
  222.187.1.163
  222.187.157.54
  222.187.159.166
@@ -61519,6 +61409,7 @@
  222.187.239.31
  222.187.239.51
  222.188.131.220
+222.188.136.170
  222.188.136.8
  222.188.185.101
  222.188.190.206
@@ -61527,14 +61418,11 @@
  222.188.243.195
  222.188.243.225
  222.188.255.95
-222.189.163.82
  222.190.110.196
-222.190.241.150
  222.190.254.130
-222.191.176.137
-222.191.176.226
  222.191.234.30
  222.191.243.187
+222.199.207.250
  222.199.52.3
  222.206.231.192
  222.208.0.197
@@ -61543,20 +61431,21 @@
  222.208.3.115
  222.209.232.60
  222.209.85.197
+222.211.72.66
  222.211.90.83
+222.213.62.183
  222.214.218.37
  222.214.223.63
-222.214.50.42
  222.215.50.156
-222.216.40.82
  222.217.65.112
  222.217.68.17
+222.218.17.45
+222.221.36.120
  222.222.185.242
  222.222.31.70
  222.222.33.226
  222.223.162.77
  222.223.203.3
-222.223.56.116
  222.224.232.162
  222.230.139.49
  222.231.1.69
@@ -61592,20 +61481,22 @@
  222.244.139.132
  222.244.146.232
  222.244.199.9
-222.246.38.14
  222.246.38.198
-222.247.55.148
  222.249.173.170
  222.249.234.100
  222.252.148.134
  222.252.156.61
  222.252.205.139
+222.252.243.47
  222.252.25.168
  222.252.27.212
+222.252.27.54
  222.252.30.29
  222.252.98.12
  222.254.230.89
  222.254.34.129
+222.254.60.183
+222.255.11.97
  222.255.115.237
  222.58.151.67
  222.64.159.53
@@ -61618,7 +61509,6 @@
  222.73.129.15
  222.73.17.7
  222.73.215.81
-222.73.22.8
  222.73.44.37
  222.73.62.184
  222.74.13.26
@@ -61632,13 +61522,12 @@
  222.74.50.141
  222.74.73.202
  222.75.1.197
-222.77.205.208
-222.77.231.144
+222.75.12.150
  222.78.194.173
  222.80.132.148
  222.80.148.4
  222.80.170.172
-222.80.39.41
+222.80.39.39
  222.80.56.3
  222.80.61.181
  222.80.62.200
@@ -61653,6 +61542,7 @@
  222.81.31.104
  222.82.213.123
  222.82.214.218
+222.82.246.162
  222.83.120.226
  222.83.120.227
  222.83.120.228
@@ -61665,12 +61555,11 @@
  222.83.53.212
  222.83.68.37
  222.83.71.235
-222.84.117.30
+222.84.117.144
  222.86.205.92
  222.87.177.3
-222.87.198.58
+222.87.198.108
  222.87.198.63
-222.87.198.78
  222.88.236.236
  222.88.64.94
  222.89.107.167
@@ -61683,11 +61572,13 @@
  222.91.97.134
  222.92.139.158
  222.92.194.25
-222.92.47.203
-222.93.156.102
+222.93.174.126
  222.96.155.188
  222.96.156.84
  222.96.237.2
+222.96.85.49
+222.96.85.65
+222.96.85.98
  222.97.15.209
  222.98.173.216
  222.98.64.136
@@ -61701,24 +61592,28 @@
  223.100.140.10
  223.100.166.3
  223.100.167.105
-223.100.178.128
  223.111.150.234
  223.113.4.109
  223.130.29.240
  223.149.162.179
  223.149.184.31
-223.149.202.115
+223.149.20.212
  223.149.202.17
+223.149.245.197
  223.15.14.29
-223.150.72.62
  223.151.228.249
  223.152.129.113
+223.154.43.71
+223.154.80.145
  223.154.80.169
  223.154.80.173
  223.154.81.219
  223.154.81.58
-223.159.28.91
+223.16.159.190
+223.16.200.251
  223.16.229.241
+223.16.34.10
+223.16.50.146
  223.165.241.9
  223.165.243.161
  223.165.243.209
@@ -61727,55 +61622,63 @@
  223.166.13.23
  223.166.5.238
  223.167.5.210
+223.17.106.89
+223.17.108.212
  223.17.120.140
+223.17.162.183
  223.17.215.76
-223.17.6.161
+223.17.31.199
+223.17.35.62
  223.17.82.196
  223.171.46.146
  223.18.248.95
+223.18.252.237
  223.18.5.147
+223.18.53.158
+223.18.7.221
+223.188.155.179
  223.188.159.107
  223.19.191.30
+223.19.53.163
+223.19.55.12
+223.19.8.234
  223.190.3.216
  223.191.34.173
  223.196.67.195
  223.197.125.10
  223.197.151.55
-223.197.152.137
  223.197.175.91
  223.197.185.60
  223.197.186.7
-223.197.187.238
  223.197.188.206
  223.197.193.131
  223.197.242.160
  223.197.56.102
-223.199.21.214
  223.199.21.89
-223.199.24.219
-223.199.29.91
  223.204.246.106
-223.205.216.210
+223.205.161.63
  223.205.218.20
  223.205.219.165
  223.205.224.154
-223.205.243.171
+223.205.225.199
+223.205.242.151
  223.205.95.247
+223.206.1.240
  223.206.128.216
-223.206.222.145
-223.206.222.32
+223.206.140.131
  223.206.225.175
  223.206.226.0
  223.206.232.92
+223.206.234.85
  223.206.237.184
  223.206.243.39
  223.206.245.229
-223.206.246.1
+223.206.250.170
  223.206.34.251
-223.206.90.122
  223.207.224.168
  223.207.244.55
  223.210.16.146
+223.212.210.25
  223.212.225.68
  223.212.234.84
  223.212.5.29
@@ -61787,12 +61690,21 @@
  223.214.70.154
  223.215.19.165
  223.215.6.143
+223.215.6.144
+223.215.6.16
+223.215.6.167
+223.215.6.181
+223.215.6.190
+223.215.6.193
  223.215.6.197
-223.215.6.199
-223.215.6.201
  223.215.6.204
+223.215.6.245
+223.215.6.252
+223.215.6.254
  223.215.6.66
  223.215.6.75
+223.215.7.109
+223.215.7.110
  223.215.7.232
  223.215.7.51
  223.215.7.74
@@ -61806,65 +61718,67 @@
  223.223.176.184
  223.223.192.230
  223.223.194.101
-223.226.105.133
  223.226.117.191
  223.226.241.202
-223.228.234.125
-223.230.135.133
-223.230.136.200
+223.230.128.121
  223.235.134.98
  223.235.14.155
  223.238.174.69
  223.240.104.222
-223.240.208.191
  223.240.209.214
  223.240.209.221
  223.240.65.72
  223.240.71.236
-223.241.100.186
-223.241.116.119
  223.241.116.155
-223.241.116.166
-223.241.116.191
-223.241.116.242
-223.241.116.92
+223.241.116.176
+223.241.116.31
  223.241.117.102
+223.241.117.146
+223.241.117.185
  223.241.117.195
+223.241.117.91
+223.241.117.98
  223.241.118.117
+223.241.118.118
  223.241.118.192
  223.241.118.206
-223.241.118.232
+223.241.118.238
+223.241.118.35
+223.241.118.59
+223.241.119.119
+223.241.119.143
  223.241.119.40
-223.241.119.57
  223.241.197.102
  223.241.247.214
-223.241.78.22
-223.241.78.227
-223.241.79.63
-223.241.79.73
-223.242.20.67
-223.242.228.152
-223.242.228.241
-223.242.229.131
-223.242.229.148
+223.241.78.11
+223.241.79.69
+223.242.229.167
  223.242.229.179
+223.242.229.20
+223.242.229.29
  223.243.75.160
-223.244.100.4
+223.244.100.19
+223.244.100.30
+223.244.100.8
+223.244.101.167
  223.244.96.151
  223.244.96.207
  223.244.96.23
+223.244.96.37
+223.244.97.110
  223.244.97.161
  223.245.212.24
  223.245.212.248
-223.245.213.166
-223.245.213.168
-223.245.213.203
-223.245.213.235
+223.245.212.78
+223.245.215.6
  223.247.130.195
+223.247.149.130
  223.247.153.244
+223.247.154.172
  223.247.156.49
  223.247.185.150
  223.247.188.145
+223.247.194.119
  223.247.194.43
  223.247.207.75
  223.247.218.112
@@ -61884,16 +61798,13 @@
  223.31.191.50
  223.4.66.84
  223.68.190.130
-223.71.127.194
  223.71.150.228
  223.71.150.229
+223.71.39.2
  223.71.66.101
  223.72.104.53
-223.72.91.5
-223.73.84.129
-223.75.248.174
+223.78.111.39
  223.80.100.87
-223.82.1.9
  223.83.193.54
  223.83.193.58
  223.83.203.67
@@ -61910,6 +61821,7 @@
  223.93.185.204
  223.93.188.234
  223.94.44.161
+223.99.1.242
  223.99.170.130
  22334444.com
  224001.selcdn.ru
@@ -61943,6 +61855,7 @@
  23.101.112.231
  23.101.124.74
  23.101.139.240
+23.101.143.68
  23.101.164.210
  23.101.187.252
  23.101.188.151
@@ -61956,7 +61869,6 @@
  23.102.153.172
  23.102.155.128
  23.102.182.181
-23.102.59.231
  23.102.68.69
  23.104.158.15
  23.104.158.58
@@ -61978,6 +61890,7 @@
  23.105.207.225
  23.105.213.174
  23.105.214.228
+23.105.215.254
  23.105.220.10
  23.105.221.34
  23.105.231.117
@@ -61997,10 +61910,10 @@
  23.107.13.123
  23.108.15.160
  23.108.2.101
-23.108.2.3
+23.108.2.16
  23.108.233.126
+23.108.233.191
  23.108.233.97
-23.108.4.11
  23.108.45.216
  23.108.47.194
  23.108.47.201
@@ -62019,7 +61932,6 @@
  23.114.235.154
  23.117.249.218
  23.119.126.20
-23.119.149.203
  23.120.182.115
  23.120.182.123
  23.120.182.124
@@ -62080,17 +61992,16 @@
  23.145.80.104
  23.146.144.91
  23.146.240.230
+23.146.240.26
  23.146.241.14
+23.146.242.148
  23.148.145.235
-23.148.145.238
  23.148.145.240
-23.148.145.241
  23.152.0.123
  23.152.0.162
  23.152.0.207
  23.152.0.210
  23.152.0.96
-23.152.32.242
  23.154.160.216
  23.154.160.223
  23.16.214.154
@@ -62134,19 +62045,23 @@
  23.226.1.76
  23.226.1.83
  23.226.136.153
+23.226.166.120
  23.226.181.91
  23.226.90.172
  23.227.196.121
  23.227.196.126
  23.227.196.209
  23.227.196.210
+23.227.199.70
  23.227.199.80
+23.227.201.135
  23.227.201.165
  23.227.207.140
+23.227.207.163
  23.227.207.253
-23.227.38.32
  23.228.114.34
  23.228.125.180
+23.228.141.124
  23.228.192.206
  23.228.209.216
  23.228.232.67
@@ -62158,17 +62073,21 @@
  23.229.10.103
  23.229.109.117
  23.229.114.59
+23.229.125.16
+23.229.13.223
  23.229.14.228
  23.229.14.231
-23.229.25.81
  23.229.25.97
-23.229.26.235
+23.229.27.198
  23.229.34.190
-23.229.34.230
  23.229.34.233
  23.229.34.234
  23.229.34.84
  23.229.35.10
+23.229.35.110
+23.229.35.15
+23.229.35.227
+23.229.35.229
  23.229.35.44
  23.229.35.78
  23.229.35.84
@@ -62178,12 +62097,16 @@
  23.229.5.66
  23.229.53.198
  23.229.55.153
-23.229.55.173
+23.229.57.147
  23.229.57.159
  23.229.57.248
  23.229.58.169
+23.229.58.227
  23.229.58.230
+23.229.58.235
+23.229.58.236
  23.229.58.24
+23.229.58.25
  23.229.70.172
  23.229.73.152
  23.229.73.158
@@ -62191,13 +62114,12 @@
  23.229.73.219
  23.229.73.78
  23.229.74.77
-23.229.75.22
  23.229.76.68
  23.229.79.163
  23.229.88.161
  23.229.88.178
  23.229.88.183
-23.229.89.93
+23.229.92.182
  23.23.181.36
  23.23.185.97
  23.23.208.27
@@ -62214,17 +62136,12 @@
  23.231.13.228
  23.231.13.235
  23.231.15.122
-23.231.15.159
-23.231.15.172
  23.231.15.2
  23.231.15.233
  23.231.15.68
-23.231.15.82
  23.231.32.101
  23.231.32.103
-23.231.32.129
  23.231.32.135
-23.231.32.140
  23.231.32.150
  23.231.32.157
  23.231.32.163
@@ -62242,13 +62159,12 @@
  23.231.37.110
  23.231.39.141
  23.231.39.160
-23.231.39.18
  23.231.39.220
  23.231.39.221
+23.231.39.35
  23.231.39.91
  23.233.107.21
  23.233.2.30
-23.233.36.204
  23.235.199.28
  23.235.221.57
  23.235.227.124
@@ -62256,55 +62172,58 @@
  23.236.126.45
  23.236.131.160
  23.236.132.122
-23.236.148.49
  23.236.148.80
  23.236.152.42
  23.236.156.115
  23.236.156.121
+23.236.156.206
+23.236.168.198
  23.236.181.34
-23.236.183.24
  23.236.188.17
+23.236.208.121
  23.236.210.158
  23.236.210.196
-23.236.210.219
+23.236.210.217
  23.236.221.203
  23.236.221.248
+23.236.221.33
  23.236.221.46
-23.236.221.58
-23.236.221.59
  23.236.221.93
  23.236.223.169
  23.236.223.19
-23.236.223.191
  23.236.223.203
  23.236.223.25
  23.236.223.32
  23.236.223.34
-23.236.223.45
  23.236.223.7
+23.236.228.201
  23.236.228.207
  23.236.228.70
-23.236.229.14
+23.236.228.73
+23.236.229.122
+23.236.229.125
  23.236.229.211
  23.236.229.232
  23.236.229.244
+23.236.229.58
+23.236.229.92
  23.236.230.34
  23.236.231.49
+23.236.232.174
  23.236.232.196
  23.236.232.218
+23.236.232.50
  23.236.238.24
-23.236.249.235
  23.236.49.71
  23.236.53.163
  23.236.57.243
  23.236.57.37
  23.236.75.202
  23.236.76.84
-23.237.137.10
+23.237.190.18
  23.237.4.26
  23.238.18.148
  23.238.187.66
-23.238.217.7
  23.238.231.229
  23.238.48.248
  23.239.1.96
@@ -62320,6 +62239,7 @@
  23.239.7.183
  23.239.9.69
  23.24.213.121
+23.241.138.186
  23.242.167.128
  23.242.56.125
  23.246.247.42
@@ -62333,9 +62253,6 @@
  23.247.42.143
  23.247.42.144
  23.247.5.46
-23.247.55.246
-23.247.57.105
-23.247.85.144
  23.247.97.117
  23.248.234.35
  23.249.162.26
@@ -62348,44 +62265,44 @@
  23.250.10.50
  23.250.108.156
  23.250.108.167
-23.250.108.170
  23.250.109.1
  23.250.109.7
  23.250.110.59
+23.250.118.12
  23.250.118.15
  23.250.118.24
  23.250.118.67
-23.250.16.107
-23.250.16.19
  23.250.16.22
  23.250.16.28
  23.250.26.118
  23.250.26.124
+23.250.26.200
  23.250.26.22
  23.250.26.35
  23.250.26.40
  23.250.30.180
+23.250.30.76
  23.250.39.62
  23.250.42.180
  23.250.42.199
  23.250.44.135
  23.250.44.155
-23.250.44.212
  23.250.44.223
  23.250.44.230
  23.250.44.239
  23.250.49.169
  23.250.49.206
  23.250.52.180
+23.250.53.62
  23.250.53.94
  23.250.54.178
  23.250.55.178
  23.250.56.224
  23.250.94.154
+23.250.94.234
  23.251.149.109
  23.251.32.80
  23.251.55.234
-23.251.84.245
  23.251.86.72
  23.252.107.194
  23.252.170.124
@@ -62402,7 +62319,6 @@
  23.253.76.87
  23.253.90.246
  23.253.94.80
-23.254.10.202
  23.254.11.169
  23.254.12.189
  23.254.12.94
@@ -62419,9 +62335,10 @@
  23.254.167.102
  23.254.167.112
  23.254.17.11
+23.254.17.33
  23.254.17.59
-23.254.17.77
  23.254.17.85
+23.254.18.117
  23.254.18.25
  23.254.18.98
  23.254.2.26
@@ -62441,6 +62358,7 @@
  23.254.224.102
  23.254.224.186
  23.254.225.130
+23.254.225.216
  23.254.226.235
  23.254.226.60
  23.254.227.105
@@ -62456,29 +62374,27 @@
  23.254.253.127
  23.254.4.111
  23.254.4.38
+23.254.4.50
  23.254.4.54
-23.254.4.61
  23.254.46.41
  23.254.47.141
-23.254.47.153
+23.254.47.151
  23.254.47.157
-23.254.47.158
  23.254.47.98
  23.254.5.121
  23.254.5.44
-23.254.55.187
+23.254.56.222
  23.254.56.40
  23.254.56.41
  23.254.56.43
-23.254.56.59
+23.254.56.65
  23.254.6.55
-23.254.68.49
  23.254.82.113
-23.254.82.64
+23.254.82.123
+23.254.82.225
  23.254.82.85
  23.254.82.87
  23.254.82.91
-23.254.83.61
  23.254.89.142
  23.27.194.42
  23.27.194.43
@@ -62493,16 +62409,14 @@
  23.4.43.27
  23.4buyuklergazete.com
  23.80.147.25
-23.80.149.10
-23.80.149.193
-23.80.149.4
-23.80.149.84
  23.80.97.102
  23.80.97.174
  23.81.140.40
  23.81.179.102
  23.81.229.115
-23.81.229.206
+23.81.229.20
+23.81.229.233
+23.81.230.145
  23.81.231.2
  23.81.232.111
  23.81.232.47
@@ -62510,12 +62424,9 @@
  23.81.246.166
  23.81.246.83
  23.81.27.114
-23.81.63.198
  23.82.105.86
-23.82.110.174
-23.82.110.195
-23.82.110.25
-23.82.110.49
+23.82.110.191
+23.82.110.78
  23.82.184.253
  23.82.28.105
  23.82.28.31
@@ -62523,13 +62434,16 @@
  23.82.28.51
  23.82.28.69
  23.82.29.118
+23.82.29.133
  23.82.29.213
+23.82.29.250
  23.82.29.51
  23.82.29.58
+23.82.29.90
  23.82.44.69
  23.82.80.196
-23.82.80.198
  23.82.80.42
+23.82.81.185
  23.83.133.250
  23.83.134.109
  23.83.179.241
@@ -62552,15 +62466,13 @@
  23.90.28.51
  23.90.29.142
  23.90.29.176
-23.90.29.210
+23.90.29.182
+23.90.29.247
  23.90.29.52
  23.90.29.97
  23.90.30.105
  23.90.30.127
-23.90.30.140
-23.90.30.145
  23.90.30.146
-23.90.30.205
  23.90.30.23
  23.90.30.243
  23.90.30.25
@@ -62570,7 +62482,9 @@
  23.90.40.205
  23.90.40.22
  23.90.40.254
+23.90.40.63
  23.90.40.81
+23.90.40.86
  23.90.40.89
  23.90.40.9
  23.90.42.107
@@ -62580,7 +62494,6 @@
  23.90.43.243
  23.90.43.27
  23.91.66.183
-23.91.70.67
  23.92.127.10
  23.92.127.34
  23.92.127.42
@@ -62599,10 +62512,10 @@
  23.94.108.99
  23.94.123.242
  23.94.151.245
-23.94.154.239
  23.94.154.252
  23.94.154.41
  23.94.158.75
+23.94.158.93
  23.94.166.22
  23.94.168.176
  23.94.17.200
@@ -62612,9 +62525,7 @@
  23.94.177.146
  23.94.177.148
  23.94.177.166
-23.94.178.221
  23.94.179.44
-23.94.182.158
  23.94.182.197
  23.94.182.222
  23.94.184.167
@@ -62626,13 +62537,12 @@
  23.94.190.119
  23.94.191.234
  23.94.20.159
-23.94.20.177
  23.94.20.234
  23.94.20.236
-23.94.20.238
  23.94.204.102
  23.94.204.119
  23.94.204.216
+23.94.204.232
  23.94.221.128
  23.94.230.218
  23.94.230.251
@@ -62650,7 +62560,6 @@
  23.94.62.134
  23.94.66.125
  23.94.7.144
-23.94.7.189
  23.94.75.149
  23.94.75.156
  23.94.75.187
@@ -62665,6 +62574,7 @@
  23.95.105.244
  23.95.105.251
  23.95.107.126
+23.95.109.219
  23.95.11.48
  23.95.112.62
  23.95.117.72
@@ -62672,14 +62582,11 @@
  23.95.12.210
  23.95.13.131
  23.95.182.150
-23.95.182.184
  23.95.182.62
-23.95.185.143
  23.95.185.219
-23.95.185.222
  23.95.186.183
-23.95.188.184
  23.95.188.189
+23.95.192.30
  23.95.197.215
  23.95.204.27
  23.95.204.41
@@ -62690,12 +62597,9 @@
  23.95.226.107
  23.95.226.153
  23.95.231.200
-23.95.237.123
-23.95.237.34
  23.95.239.195
  23.95.239.201
  23.95.42.230
-23.95.7.104
  23.95.81.36
  23.95.81.57
  23.95.89.71
@@ -62707,8 +62611,7 @@
  23.95.9.165
  23.95.91.3
  23.95.97.187
-23.96.1.142
-23.96.192.61
+23.95.97.229
  23.96.38.43
  23.96.53.62
  23.96.54.209
@@ -62730,6 +62633,7 @@
  23.99.219.238
  23.99.221.5
  23.99.7.13
+23.99.97.154
  230-365.net
  2311046.carpicsediting.com
  23124234.smtpmouse.com
@@ -62751,6 +62655,7 @@
  2345gfds23456.weebly.com
  23467346145.bid
  23490.vochtblog.be
+234dssdf6f.ddns.net
  234market.com
  235-365.net
  23557812.weebly.com
@@ -62780,10 +62685,12 @@
  24-rw-in-ak-llc.net
  24.0.114.228
  24.1.228.202
+24.1.4.115
  24.102.91.203
  24.103.166.34
  24.104.69.250
  24.105.202.216
+24.106.144.34
  24.106.221.230
  24.106.226.216
  24.107.23.133
@@ -62791,7 +62698,6 @@
  24.11.124.75
  24.11.203.133
  24.111.39.66
-24.111.45.203
  24.113.10.158
  24.113.13.233
  24.113.133.84
@@ -62813,6 +62719,7 @@
  24.116.231.202
  24.116.246.9
  24.118.165.35
+24.119.191.38
  24.12.184.19
  24.12.204.206
  24.121.219.54
@@ -62833,27 +62740,31 @@
  24.131.39.65
  24.132.182.110
  24.132.27.107
+24.133.120.241
  24.133.200.89
  24.133.228.243
-24.133.8.28
+24.133.69.83
  24.134.12.73
  24.134.42.229
  24.134.57.101
  24.134.6.165
  24.135.207.56
  24.137.76.62
+24.138.85.103
  24.139.143.210
  24.139.143.226
  24.139.244.238
-24.139.87.44
  24.14.211.163
  24.141.166.152
  24.141.96.166
+24.142.134.235
  24.142.165.126
+24.142.62.114
  24.143.75.66
  24.143.76.121
  24.148.98.177
  24.150.70.164
+24.152.36.85
  24.153.190.114
  24.153.41.161
  24.154.48.59
@@ -62864,8 +62775,7 @@
  24.158.25.98
  24.16.108.181
  24.16.43.77
-24.16.67.20
-24.160.107.78
+24.16.9.192
  24.160.150.173
  24.161.18.241
  24.162.17.74
@@ -62875,7 +62785,6 @@
  24.167.96.213
  24.169.68.19
  24.17.248.42
-24.17.95.47
  24.172.34.114
  24.172.79.6
  24.172.82.94
@@ -62887,10 +62796,10 @@
  24.177.183.220
  24.178.90.49
  24.179.13.119
+24.180.55.125
  24.181.205.134
  24.181.78.243
  24.182.61.109
-24.182.72.11
  24.184.0.146
  24.184.1.41
  24.185.157.190
@@ -62906,11 +62815,11 @@
  24.193.189.125
  24.193.239.107
  24.193.76.156
+24.194.230.212
  24.196.138.163
  24.196.146.193
  24.196.49.98
  24.196.88.234
-24.197.127.59
  24.198.88.96
  24.2.117.135
  24.2.150.131
@@ -62925,25 +62834,30 @@
  24.205.144.72
  24.205.197.249
  24.205.215.192
-24.207.45.12
  24.209.165.116
  24.21.176.186
  24.21.229.157
  24.212.228.134
+24.212.51.227
  24.212.51.61
  24.212.64.36
  24.214.210.83
  24.214.72.152
  24.215.81.255
+24.215.82.23
  24.217.140.142
+24.217.203.200
  24.217.251.48
  24.218.126.94
  24.219.210.105
  24.22.122.39
+24.22.209.129
  24.220.176.108
  24.220.5.235
+24.221.19.31
  24.221.197.241
  24.222.131.233
+24.222.249.36
  24.222.43.8
  24.226.68.134
  24.227.190.78
@@ -62952,7 +62866,6 @@
  24.23.133.203
  24.23.226.178
  24.230.124.78
-24.230.133.253
  24.231.68.53
  24.231.70.85
  24.231.88.85
@@ -62971,8 +62884,7 @@
  24.237.101.250
  24.237.70.53
  24.24.150.168
-24.240.169.94
-24.240.96.140
+24.24.214.142
  24.241.102.26
  24.241.120.163
  24.241.64.42
@@ -62981,7 +62893,7 @@
  24.245.100.212
  24.245.121.47
  24.245.126.32
-24.245.85.51
+24.247.223.183
  24.247.31.87
  24.248.207.7
  24.248.44.90
@@ -62992,7 +62904,9 @@
  24.249.199.12
  24.249.199.14
  24.249.199.4
+24.249.204.50
  24.249.51.124
+24.251.26.78
  24.252.1.231
  24.252.140.29
  24.253.146.50
@@ -63000,7 +62914,7 @@
  24.253.9.24
  24.254.38.127
  24.255.192.211
-24.29.205.226
+24.26.156.42
  24.3.111.215
  24.30.124.181
  24.31.15.232
@@ -63026,10 +62940,9 @@
  24.43.21.186
  24.43.32.186
  24.43.99.75
-24.47.90.156
+24.46.201.28
  24.48.12.36
  24.4buyuklergazete.com
-24.50.144.134
  24.51.148.43
  24.51.219.223
  24.52.230.239
@@ -63051,7 +62964,6 @@
  24.64.72.174
  24.64.86.246
  24.66.35.226
-24.68.251.130
  24.68.94.168
  24.69.65.8
  24.69.81.154
@@ -63061,8 +62973,8 @@
  24.87.71.106
  24.89.140.190
  24.9.249.108
-24.9.61.200
  24.90.175.188
+24.90.51.88
  24.92.157.192
  24.92.187.245
  24.92.187.5
@@ -63181,7 +63093,6 @@
  26buofa26.bankofamericaslpemr.com
  26coder.net
  26v.cn
-27.0.158.183
  27.1.245.16
  27.1.245.16bin.sh
  27.1.245.33
@@ -63191,6 +63102,7 @@
  27.102.127.39
  27.102.128.36
  27.102.129.105
+27.102.136.67
  27.102.66.168
  27.102.66.169
  27.102.66.170
@@ -63209,22 +63121,19 @@
  27.106.114.226
  27.106.12.218
  27.106.18.218
-27.106.25.54
-27.106.30.106
  27.106.50.233
  27.106.84.186
  27.109.116.171
  27.109.153.99
+27.109.213.142
  27.11.212.90
  27.110.223.98
  27.111.29.180
  27.111.35.13
  27.111.44.196
-27.115.240.120
+27.115.124.6
  27.115.50.114
-27.116.16.118
  27.116.18.155
-27.116.51.115
  27.116.51.119
  27.116.51.178
  27.116.51.181
@@ -63233,7 +63142,6 @@
  27.116.51.92
  27.117.105.125
  27.117.105.125bin.sh
-27.119.131.220
  27.119.87.30
  27.120.143.127
  27.122.56.147
@@ -63244,6 +63152,7 @@
  27.123.171.65
  27.123.213.170
  27.123.213.172
+27.123.255.249
  27.123.255.82
  27.123.3.138
  27.123.3.140
@@ -63259,7 +63168,7 @@
  27.128.168.13
  27.128.168.225
  27.128.173.81
-27.128.196.70
+27.128.204.79
  27.128.236.189
  27.128.241.203
  27.128.244.13
@@ -63270,7 +63179,7 @@
  27.142.132.247
  27.142.245.128
  27.145.130.154
-27.145.185.37
+27.145.177.13
  27.145.29.173
  27.145.29.22
  27.145.29.7
@@ -63281,12 +63190,15 @@
  27.147.179.232
  27.147.183.49
  27.147.190.202
+27.147.201.40
+27.147.206.199
  27.147.209.215
  27.147.210.180
  27.147.210.35
  27.147.217.194
  27.147.217.86
  27.147.225.202
+27.147.238.119
  27.147.40.128
  27.148.165.23
  27.148.190.100
@@ -63294,23 +63206,27 @@
  27.150.170.26
  27.150.175.28
  27.150.182.230
-27.150.195.160
  27.150.22.155
  27.152.73.62
-27.153.142.44
  27.153.181.253
  27.153.181.31
  27.153.183.244
+27.153.229.2
  27.153.254.70
  27.154.225.186
  27.154.242.142
  27.154.32.202
  27.154.34.146
  27.154.59.202
+27.154.7.79
  27.155.101.173
  27.155.101.197
  27.155.101.232
  27.155.101.233
+27.155.221.189
+27.155.221.91
+27.155.222.133
+27.155.222.67
  27.155.223.215
  27.155.83.174
  27.155.97.12
@@ -63318,9 +63234,10 @@
  27.156.2.251
  27.156.4.179
  27.156.6.147
+27.156.72.167
  27.156.73.110
-27.156.73.167
-27.158.140.251
+27.157.247.208
+27.157.247.216
  27.158.161.91
  27.159.72.85
  27.17.3.90
@@ -63329,11 +63246,10 @@
  27.184.51.126
  27.184.51.133
  27.184.51.89
-27.184.53.114
+27.184.55.152
  27.184.55.201
  27.185.12.20
  27.187.248.122
-27.187.249.10
  27.187.249.249
  27.187.249.35
  27.187.250.127
@@ -63349,13 +63265,12 @@
  27.193.201.33
  27.193.21.217bin.sh
  27.193.215.70
-27.193.231.228
  27.193.250.240bin.sh
  27.193.253.146
+27.193.38.131
  27.193.79.25
  27.193.86.150
  27.193.89.119
-27.194.112.202
  27.194.113.114
  27.194.129.92
  27.194.134.4
@@ -63373,7 +63288,6 @@
  27.194.36.216
  27.194.85.173
  27.194.95.196
-27.197.149.195
  27.197.18.73
  27.197.19.215
  27.197.20.55
@@ -63383,6 +63297,7 @@
  27.197.24.175
  27.197.39.53
  27.197.83.147
+27.197.88.150
  27.198.115.85
  27.198.138.129
  27.198.33.255
@@ -63390,17 +63305,17 @@
  27.198.84.114
  27.199.192.250
  27.199.198.206
-27.199.79.91
  27.199.83.249
  27.2.141.162
+27.2.39.68
  27.2.7.59
  27.200.1.139
+27.200.1.39
  27.200.105.117
  27.201.110.238
  27.201.118.119
  27.201.118.95
  27.201.152.202
-27.201.183.197
  27.201.187.70
  27.201.191.126
  27.201.205.12
@@ -63430,7 +63345,6 @@
  27.203.25.103
  27.203.25.103bin.sh
  27.203.252.231
-27.203.26.11
  27.203.4.188
  27.203.42.58
  27.203.5.143
@@ -63448,23 +63362,25 @@
  27.206.108.54
  27.206.115.235
  27.206.176.55
+27.206.177.144
  27.206.177.218
  27.206.179.175
-27.206.181.66
+27.206.183.101
  27.206.183.144
  27.206.184.56
+27.206.194.234
  27.206.195.225
  27.206.220.118
  27.206.250.17
  27.206.40.134
  27.206.66.103
+27.206.72.114
+27.206.72.158
+27.206.73.109
  27.206.75.182
  27.206.76.173
-27.206.77.14
-27.206.77.210
-27.206.78.11
+27.206.77.209
  27.206.78.213
-27.206.79.72
  27.207.12.223
  27.207.180.42
  27.207.180.93
@@ -63477,7 +63393,6 @@
  27.207.54.110
  27.207.8.238
  27.207.86.225
-27.207.90.244
  27.208.11.250
  27.208.13.253
  27.208.145.149
@@ -63489,7 +63404,6 @@
  27.208.200.128
  27.208.205.154
  27.208.21.167
-27.208.229.223
  27.208.233.154
  27.208.237.238
  27.208.31.92
@@ -63503,13 +63417,16 @@
  27.209.202.251
  27.209.207.163
  27.209.212.48
+27.209.247.111
  27.209.73.23
+27.21.168.195
  27.210.110.103
  27.210.114.170bin.sh
  27.210.131.117
  27.210.147.237
  27.210.173.204
  27.210.180.206
+27.210.227.98
  27.210.236.134
  27.210.246.189
  27.210.255.236
@@ -63521,7 +63438,6 @@
  27.210.82.136
  27.211.62.203
  27.213.103.160
-27.213.105.17
  27.213.121.229
  27.213.137.14
  27.213.148.166
@@ -63532,42 +63448,44 @@
  27.213.244.152
  27.213.252.208
  27.213.255.202
+27.213.6.56
  27.213.6.59
  27.213.66.238
  27.213.84.41
  27.213.95.75
+27.215.113.145
+27.215.113.69
  27.215.122.212
  27.215.140.240
  27.215.146.216
  27.215.148.27
  27.215.168.123
+27.215.169.152
  27.215.169.154
-27.215.169.193
-27.215.169.23
-27.215.169.80
+27.215.171.167
  27.215.171.190
+27.215.171.223
+27.215.171.29
+27.215.171.76
  27.215.171.91
  27.215.176.224
  27.215.190.172
-27.215.193.160
+27.215.193.227
  27.215.198.1
-27.215.198.198
-27.215.198.57
+27.215.198.149
+27.215.198.156
+27.215.198.72
  27.215.208.107
  27.215.224.48
  27.215.228.144
  27.215.228.253
  27.215.232.194
  27.215.242.62
-27.215.245.139
  27.215.245.220
-27.215.245.84
  27.215.35.102
  27.215.54.234
-27.215.58.130
-27.215.58.132
+27.215.57.43
  27.215.61.73
-27.215.68.28
  27.215.68.87
  27.215.83.51
  27.215.83.51bin.sh
@@ -63578,7 +63496,6 @@
  27.216.123.241
  27.216.129.117
  27.216.139.138
-27.216.164.121
  27.216.174.156
  27.216.186.136
  27.216.214.166
@@ -63593,8 +63510,10 @@
  27.217.136.68bin.sh
  27.217.138.46
  27.217.139.169
-27.217.152.229
+27.217.152.233
  27.217.155.141
+27.217.18.222
+27.217.2.173
  27.217.209.89
  27.217.211.45
  27.217.213.201
@@ -63607,7 +63526,7 @@
  27.217.59.27
  27.217.83.17
  27.218.187.213
-27.218.59.170
+27.218.207.114
  27.219.124.153
  27.219.125.139
  27.219.126.249
@@ -63622,15 +63541,20 @@
  27.219.254.146
  27.219.26.194
  27.219.3.5
-27.219.44.141
  27.219.67.178
  27.220.120.114
-27.220.121.193
-27.220.122.120
-27.220.122.176
-27.220.122.85
+27.220.120.126
+27.220.122.111
+27.220.123.169
+27.220.123.78
  27.220.125.253
+27.220.126.206
+27.220.126.81
+27.220.127.228
+27.220.127.91
  27.220.158.71
+27.220.162.246
+27.220.163.215
  27.220.171.86
  27.220.180.229
  27.220.206.236
@@ -63638,22 +63562,18 @@
  27.220.248.79
  27.220.41.209
  27.220.45.41
-27.220.48.11
  27.220.48.41
  27.220.50.197
-27.220.51.40
  27.220.52.84
-27.220.53.131
-27.220.55.248
  27.220.55.91
  27.220.82.226
+27.220.82.239
  27.220.89.7
  27.220.94.247
  27.221.18.26
  27.221.18.27
  27.222.142.26
  27.222.143.116
-27.222.150.57
  27.222.242.112
  27.222.54.39
  27.222.76.194
@@ -63672,7 +63592,8 @@
  27.24.28.134
  27.24.29.111bin.sh
  27.24.29.251bin.sh
-27.24.30.46
+27.24.29.86
+27.242.73.127
  27.254.150.77
  27.254.153.20
  27.254.206.238
@@ -63685,6 +63606,8 @@
  27.255.75.157
  27.255.75.17
  27.255.75.4
+27.255.75.5
+27.255.75.7
  27.255.75.8
  27.255.75.9
  27.255.77.182
@@ -63700,13 +63623,15 @@
  27.3.254.131
  27.3.41.234
  27.3.84.224
+27.30.18.99
  27.32.42.128
  27.33.129.161
  27.33.129.173
+27.33.247.28
  27.34.161.42
  27.34.19.1
  27.34.20.87
-27.34.25.56
+27.34.4.41
  27.35.100.245
  27.35.104.17
  27.35.105.206
@@ -63735,29 +63660,30 @@
  27.38.61.67
  27.38.61.85
  27.38.61.86
-27.38.82.1
-27.4.113.16
  27.4.148.144
-27.41.10.253
+27.41.143.142
  27.41.157.5
  27.41.158.204
  27.41.179.202
  27.41.181.181
  27.41.182.169
-27.41.185.83
  27.41.187.171
  27.41.204.88
  27.41.206.175
+27.41.217.209
  27.41.218.40
+27.41.232.238
+27.41.234.26
+27.41.36.86
+27.41.90.242
  27.42.168.46
+27.43.104.174
  27.43.187.171
  27.44.198.181
-27.45.250.130
+27.46.10.125
  27.5.112.81
  27.5.32.191
-27.5.40.32
  27.5.40.9
-27.5.45.206
  27.5.45.52
  27.50.138.172
  27.50.160.35
@@ -63768,32 +63694,28 @@
  27.50.63.18
  27.54.118.235
  27.54.166.212
+27.54.188.139
  27.54.253.177
-27.58.19.182
+27.56.169.139
+27.58.157.78
  27.6.104.60bin.sh
  27.6.207.11
  27.6.30.211
-27.60.62.18
  27.61.39.180
  27.62.191.231
  27.64.10.102
  27.66.198.168
-27.66.46.35
  27.69.189.171
  27.69.243.179
  27.69.243.216
  27.7.143.136
-27.7.67.64
  27.70.134.169
-27.71.106.203
-27.71.109.83
-27.71.122.108
+27.71.120.34
  27.71.227.142
-27.71.228.25
  27.71.231.25
  27.71.238.208
  27.71.54.248
-27.71.72.7
+27.71.83.34
  27.71.84.174
  27.71.85.180
  27.72.109.15
@@ -63804,7 +63726,6 @@
  27.72.25.157
  27.72.29.159
  27.72.61.48
-27.72.72.201
  27.72.72.224
  27.72.72.228
  27.72.72.48
@@ -63813,15 +63734,17 @@
  27.74.247.135
  27.74.247.140
  27.76.12.50
-27.76.149.185
  27.76.255.125
-27.76.60.129
  27.77.50.214
  27.78.27.110
  27.78.89.96
  27.79.166.181
+27.79.175.246
  27.8.235.240
  27.8.244.92
+27.97.228.118
+27.97.43.12
+27.97.65.124
  272101.com
  27353.join78.ga
  2746.31cf4fdae.com
@@ -63850,6 +63773,7 @@
  282ad2f69246c193188bc1c249e87e06.accesscam.org
  283.31cf4fdae.com
  28337748.kiloouno.com
+2834321.mediaspace.kaltura.com
  2855.31cf4fdae.com
  286.cool
  2869847-dot-n-e-w-me-ss-age-po-rt-al.wl.r.appspot.com
@@ -63885,6 +63809,7 @@
  2a7619be102970422.temporary.link
  2a7a73baac3098202.temporary.link
  2adsfcaccrcvrypg.xyz
+2amaz2k3y3sygvtpcfsi3yodqe-adwhj77lcyoafdy-www-paypal-com.translate.goog
  2asdasdasdsad.tegacxvl.com
  2axaconnect.com
  2b04fb920faa3df7d1d07b243b6fe99a-dot-dbenitonline.ey.r.appspot.com
@@ -64048,6 +63973,7 @@
  2zonasegurabeta-viabcp-beta-com.cf
  3-1-5.co.uk
  3-138-182-226.cprapid.com
+3-a.uth-secured.co.uk
  3-bill-help.com
  3-bill-uk.com
  3-billing-uk.com
@@ -64084,12 +64010,15 @@
  3-verify.network
  3.0.102.38
  3.0.115.255
+3.0.142.22
+3.0.150.47
  3.0.167.250
  3.0.97.94
  3.1.101.22
  3.1.201.76
  3.10.5.123
  3.10.70.38
+3.101.78.68
  3.104.54.134
  3.11.152.239
  3.11.235.44
@@ -64105,10 +64034,12 @@
  3.114.77.240
  3.115.12.116
  3.115.245.111
+3.12.36.54
  3.120.112.0
  3.120.148.145
  3.120.172.249
  3.120.207.223
+3.120.32.207
  3.120.37.138
  3.120.99.93
  3.121.203.169
@@ -64117,9 +64048,9 @@
  3.122.247.28
  3.122.59.101
  3.123.222.19
-3.123.236.170
  3.123.254.92
  3.123.28.195
+3.124.123.198
  3.124.202.18
  3.124.38.47
  3.124.63.44
@@ -64132,7 +64063,6 @@
  3.128.106.107
  3.128.143.118
  3.128.212.89
-3.129.189.54
  3.129.216.175
  3.129.59.243
  3.13.162.167
@@ -64141,21 +64071,27 @@
  3.132.39.66
  3.133.119.53
  3.133.86.139
+3.133.99.3
  3.134.245.141
  3.134.81.24
  3.134.91.16
  3.134.99.115
  3.135.154.33
  3.135.212.203
-3.135.219.183
-3.137.156.237
+3.135.65.10
+3.136.140.191
+3.136.193.210
  3.137.162.194
+3.137.175.232
  3.138.143.215
-3.138.199.134
  3.138.199.220
+3.139.102.141
+3.139.31.202
  3.14.12.223
  3.14.163.152
  3.14.168.201
+3.140.240.160
+3.141.18.2
  3.15.0.83
  3.15.140.156
  3.15.201.209
@@ -64164,6 +64100,7 @@
  3.16.118.136
  3.16.128.12
  3.16.129.75
+3.16.165.220
  3.16.165.53
  3.16.69.121
  3.17.10.247
@@ -64173,12 +64110,12 @@
  3.17.213.129
  3.17.27.175
  3.17.57.130
-3.17.59.205
  3.17.61.84
  3.18.101.80
  3.18.107.11
  3.18.213.211
  3.19.227.221
+3.19.28.110
  3.19.30.176
  3.19.55.113
  3.19.56.156
@@ -64194,6 +64131,7 @@
  3.211.51.136
  3.219.58.63
  3.22.0.212
+3.22.169.72
  3.22.198.63
  3.22.25.171
  3.22.98.50
@@ -64202,7 +64140,6 @@
  3.221.155.232
  3.222.213.197
  3.227.11.183
-3.227.92.44
  3.228.87.114
  3.229.23.232
  3.23.128.147
@@ -64226,14 +64163,16 @@
  3.26.64.196
  3.34.133.144
  3.34.179.142
+3.34.181.76
  3.34.189.221
  3.34.4.73
+3.35.4.62
  3.35.40.175
  3.6.206.209
  3.6.63.172
+3.6.64.127
  3.64.210.146
  3.64.93.67
-3.7.156.92
  3.7.190.231
  3.8.101.127
  3.8.12.221
@@ -64242,17 +64181,17 @@
  3.8.29.239
  3.8.38.104
  3.8.68.2
+3.80.53.128
  3.81.208.241
  3.81.67.195
  3.81.94.209
  3.82.58.104
-3.83.12.105
  3.83.190.102
  3.83.239.210
  3.83.8.0
  3.84.141.230
-3.84.242.97
  3.84.27.209
+3.84.87.184
  3.85.210.189
  3.86.193.206
  3.87.158.26
@@ -64265,12 +64204,13 @@
  3.90.83.73
  3.91.229.155
  3.91.30.36
+3.91.84.153
  3.92.233.209
  3.92.37.118
  3.93.244.52
  3.94.249.60
  3.94.96.136
-3.96.248.82
+3.95.230.95
  3.change-my-billing-details.com
  3.empirecores.com
  3.gucac.com
@@ -64330,9 +64270,8 @@
  31-31-199-49.ovz.vps.regruhosting.ru
  31.0.1.198
  31.0.122.79
+31.0.127.75
  31.0.32.125
-31.0.47.240
-31.0.59.119
  31.10.110.132
  31.10.148.224
  31.10.15.182
@@ -64347,23 +64286,27 @@
  31.13.195.82
  31.130.203.168
  31.130.222.129
+31.131.131.66
  31.131.20.185
  31.131.21.132
  31.131.22.48
  31.131.249.220
+31.131.67.14
  31.131.69.14
+31.132.107.86
  31.132.134.191
  31.132.17.56
  31.132.220.2
  31.132.69.165
  31.133.12.48
  31.133.57.134
-31.133.64.131
  31.134.121.208
  31.134.121.223
  31.134.125.80
+31.134.190.220
  31.135.77.117
  31.135.91.9
+31.135.93.56
  31.14.136.210
  31.14.138.8
  31.14.201.156
@@ -64383,6 +64326,7 @@
  31.146.212.241
  31.146.212.252
  31.146.212.74
+31.146.219.30
  31.146.227.134
  31.146.229.140
  31.146.229.169
@@ -64403,13 +64347,13 @@
  31.15.212.80
  31.15.88.72
  31.15.89.51
-31.150.153.59
-31.150.163.148
+31.150.155.73
+31.150.170.198
  31.150.206.213
  31.153.101.140
  31.155.124.6
+31.155.185.164
  31.16.108.215
-31.16.156.3
  31.16.176.69
  31.16.185.139
  31.16.217.18
@@ -64435,15 +64379,15 @@
  31.166.109.73
  31.166.247.86
  31.167.39.164
-31.167.47.178
  31.168.168.167
  31.168.184.59
  31.168.216.101
  31.168.249.37
  31.168.69.220
+31.168.94.16
  31.169.87.170
-31.17.207.18
  31.17.249.196
+31.17.251.225
  31.17.70.80
  31.170.123.8
  31.170.160.90
@@ -64456,7 +64400,7 @@
  31.170.62.237
  31.170.62.238
  31.170.86.245
-31.171.155.12
+31.171.152.138
  31.171.155.6
  31.171.155.8
  31.171.155.9
@@ -64465,6 +64409,7 @@
  31.172.105.144
  31.172.248.10
  31.173.0.249
+31.173.120.137
  31.173.13.190
  31.173.138.204
  31.173.161.183
@@ -64472,8 +64417,6 @@
  31.173.48.61
  31.173.8.214
  31.173.81.35
-31.173.83.132
-31.173.84.98
  31.173.94.93
  31.176.142.119
  31.176.186.124
@@ -64488,8 +64431,12 @@
  31.18.112.153
  31.18.117.156
  31.18.253.151
+31.18.38.68
  31.180.130.102
-31.181.153.30
+31.180.141.239
+31.180.149.168
+31.180.196.37
+31.181.241.82
  31.182.12.3
  31.182.13.17
  31.184.195.114
@@ -64498,11 +64445,11 @@
  31.184.198.75
  31.184.199.114
  31.184.208.141
-31.184.218.187
  31.184.218.3
  31.184.224.90
  31.184.233.106
  31.184.234.145
+31.184.254.151
  31.185.104.19
  31.185.104.21
  31.185.167.195
@@ -64519,18 +64466,19 @@
  31.193.124.70
  31.195.76.3
  31.20.124.13
+31.20.193.52
  31.201.13.250
  31.201.236.49
  31.201.50.78
  31.202.101.40
+31.202.221.49
  31.202.30.118
-31.202.78.141
  31.203.250.221
+31.204.128.22
  31.204.155.160
  31.204.180.44
-31.205.46.17
-31.206.13.45
  31.206.201.205
+31.206.205.196
  31.206.38.40
  31.206.38.46
  31.206.38.48
@@ -64544,7 +64492,7 @@
  31.207.44.34
  31.207.47.33
  31.207.47.34
-31.208.179.154
+31.208.173.175
  31.208.27.85
  31.208.87.18
  31.209.104.231
@@ -64568,7 +64516,7 @@
  31.214.157.247
  31.214.157.73
  31.215.104.26
-31.217.19.51
+31.215.211.73
  31.217.222.168
  31.220.0.186
  31.220.0.202
@@ -64620,16 +64568,15 @@
  31.220.63.23
  31.221.95.5
  31.222.129.14
-31.222.6.58
+31.222.6.61
  31.222.6.65
-31.222.7.51
-31.222.7.57
  31.222.7.59
-31.223.135.215
-31.223.135.225
+31.222.8.98
+31.223.135.117
  31.223.34.234
  31.223.34.237
  31.223.34.238
+31.223.78.178
  31.23.49.70
  31.24.176.249
  31.24.205.70
@@ -64638,6 +64585,7 @@
  31.25.136.18
  31.25.241.224
  31.27.177.84
+31.27.245.188
  31.27.35.138
  31.27.59.105
  31.28.10.74
@@ -64646,7 +64594,6 @@
  31.28.163.53
  31.28.163.54
  31.28.163.61
-31.28.201.61
  31.28.241.117
  31.28.27.44
  31.28.99.25
@@ -64657,8 +64604,8 @@
  31.3.242.140
  31.30.168.73
  31.30.173.221
+31.31.116.63
  31.31.117.195
-31.31.117.96
  31.31.216.170
  31.31.26.43
  31.31.6.158
@@ -64668,24 +64615,24 @@
  31.31.77.83
  31.32.16.198
  31.32.208.250
-31.4.245.180
+31.4.247.111
+31.4.247.193
  31.40.1.60
  31.40.135.67
  31.40.209.166
  31.40.209.245
  31.40.252.160
  31.40.252.17
+31.40.252.170
  31.40.252.176
  31.40.252.42
  31.40.255.17
-31.40.48.112
  31.41.11.10
  31.41.112.80
  31.41.15.19
  31.41.154.125
  31.41.225.205
  31.41.47.37
-31.41.64.212
  31.41.8.139
  31.41.89.237
  31.41.92.154
@@ -64693,12 +64640,13 @@
  31.42.176.17
  31.42.177.43
  31.42.177.97
+31.42.185.152
  31.42.188.74
  31.42.254.24
  31.42.254.25
  31.43.1.75
  31.43.140.190
-31.43.180.68
+31.43.2.93
  31.43.218.102
  31.43.33.56
  31.43.63.70
@@ -64706,7 +64654,6 @@
  31.44.12.233
  31.44.161.205
  31.44.184.50
-31.45.149.11
  31.45.240.114
  31.45.240.154
  31.46.181.11
@@ -64717,10 +64664,12 @@
  31.47.240.130
  31.47.252.50
  31.47.55.138
-31.48.77.196
  31.48.9.90
-31.57.22.113
+31.5.229.137
+31.50.102.48
+31.50.110.232
  31.6.71.218
+31.63.191.7
  31.7.185.28
  31.7.3.57
  31.7.59.204
@@ -64766,6 +64715,7 @@
  32456yh543dd8305d3b0d52a2616-dot-intelligent-arc-294422.df.r.appspot.com
  32574.dyamm.com
  3264.url.7878j.com
+32792.prolocksmithwinterpark.com
  328356563.com
  328365536.com
  328536536.com
@@ -64817,6 +64767,7 @@
  34-95-4-206.cprapid.com
  34.101.136.173
  34.101.146.165
+34.101.168.5
  34.101.174.207
  34.101.190.172
  34.101.198.58
@@ -64833,10 +64784,10 @@
  34.121.185.46
  34.121.204.80
  34.121.220.45
-34.121.82.140
-34.122.146.197
  34.122.190.7
+34.122.25.140
  34.122.32.203
+34.123.125.116
  34.123.157.13
  34.123.160.251
  34.123.178.160
@@ -64862,6 +64813,7 @@
  34.198.110.128
  34.198.253.38
  34.198.95.186
+34.199.4.24
  34.200.215.95
  34.200.218.138
  34.200.233.232
@@ -64873,7 +64825,6 @@
  34.201.209.180
  34.201.223.136
  34.201.223.144
-34.201.223.187
  34.201.223.195
  34.201.223.223
  34.201.223.252
@@ -64893,7 +64844,6 @@
  34.203.227.207
  34.203.239.67
  34.203.28.190
-34.203.37.48
  34.204.104.219
  34.204.17.170
  34.205.142.211
@@ -64986,10 +64936,10 @@
  34.212.29.94
  34.212.83.125
  34.212.97.17
+34.213.118.195
  34.213.173.227
  34.213.252.209
  34.213.28.109
-34.213.38.137
  34.213.40.173
  34.213.65.251
  34.213.80.109
@@ -65138,7 +65088,6 @@
  34.231.176.154
  34.231.21.96
  34.232.106.159
-34.232.120.177
  34.232.63.88
  34.234.149.96
  34.234.208.165
@@ -65165,6 +65114,7 @@
  34.236.55.223
  34.236.86.59
  34.237.15.134
+34.237.242.35.bc.googleusercontent.com
  34.237.243.198
  34.237.4.205
  34.238.124.208
@@ -65200,6 +65150,7 @@
  34.241.77.13
  34.241.82.99
  34.241.83.86
+34.241.85.182
  34.241.94.237
  34.242.100.60
  34.242.19.91
@@ -65275,16 +65226,16 @@
  34.254.199.136
  34.255.158.175
  34.255.9.223
-34.64.122.40
+34.64.218.102
  34.65.10.107
+34.65.100.97
  34.65.180.129
  34.65.228.232
-34.65.27.58
-34.66.182.89
+34.66.240.115
  34.67.175.232
-34.67.186.17
  34.67.224.244
  34.67.51.20
+34.67.54.240
  34.68.165.103
  34.68.180.110
  34.68.243.140
@@ -65294,17 +65245,20 @@
  34.70.138.19
  34.70.140.130
  34.70.196.248
+34.70.214.156
  34.70.217.179
  34.70.30.23
  34.70.49.158
  34.71.174.184
  34.71.206.168
  34.71.207.96
+34.72.11.142
+34.72.111.38
  34.72.156.130
  34.72.163.246
-34.72.42.133
  34.72.85.73
  34.73.101.96
+34.73.237.110
  34.73.71.43
  34.74.206.146
  34.74.46.5
@@ -65318,13 +65272,14 @@
  34.78.103.223
  34.78.159.18
  34.78.177.247
+34.78.214.60
  34.78.246.254
  34.80.1.221
  34.80.134.68
-34.80.223.251
  34.80.90.118
  34.82.170.246
  34.82.203.253
+34.82.27.159
  34.83.105.8
  34.83.137.52
  34.83.215.245
@@ -65333,9 +65288,10 @@
  34.84.157.244
  34.86.197.196
  34.86.235.185
+34.86.43.217
  34.86.80.233
  34.87.117.102
-34.87.119.164
+34.87.12.145
  34.87.126.179
  34.87.140.178
  34.87.160.10
@@ -65355,13 +65311,17 @@
  34.92.16.146
  34.92.29.25
  34.92.44.200
+34.92.7.225
  34.93.177.66
+34.93.185.190
  34.93.204.215
  34.94.107.142
  34.94.148.132
+34.94.154.237
  34.94.29.47
  34.94.93.161
  34.95.208.185
+34.95.209.45
  34.96.107.204
  34.96.155.97
  34.96.167.190
@@ -65402,15 +65362,14 @@
  349579567459589.com
  3499.000webhostapp.com
  34e127b2acf56a344457e1537dce906d-dot-w-opqwerrr.appspot.com
-34eee.info
  34er.website
  34f4562df4465167edf0129a857529f7f11dd75f.info
  35-23-4532-34.com
  35-40konkatsu.net
  35.0.127.52
  35.129.213.177
+35.133.212.250
  35.134.154.26
-35.134.24.125
  35.137.236.32
  35.142.207.246
  35.143.99.174
@@ -65420,6 +65379,7 @@
  35.153.54.53
  35.154.183.151
  35.154.255.215
+35.154.35.109
  35.154.62.240
  35.155.151.151
  35.155.204.42
@@ -65448,7 +65408,6 @@
  35.157.66.43
  35.158.109.213
  35.158.169.39
-35.158.170.112
  35.158.185.217
  35.158.226.16
  35.158.237.165
@@ -65666,7 +65625,6 @@
  35.180.103.8
  35.180.129.212
  35.180.135.246
-35.180.147.121
  35.180.197.156
  35.180.209.30
  35.180.215.26
@@ -65711,6 +65669,7 @@
  35.183.46.130
  35.183.52.94
  35.183.60.188
+35.183.60.98
  35.183.61.192
  35.184.116.118
  35.184.117.117
@@ -65726,6 +65685,7 @@
  35.184.193.43
  35.184.207.37
  35.184.219.126
+35.184.248.86
  35.184.77.189
  35.184.83.249
  35.184.84.4
@@ -65765,8 +65725,6 @@
  35.188.26.12
  35.188.27.88
  35.188.29.36
-35.188.32.173
-35.188.36.116
  35.188.36.185
  35.188.47.144
  35.188.49.176
@@ -65780,13 +65738,13 @@
  35.189.8.149
  35.189.84.191
  35.190.165.76
-35.190.196.200
  35.192.113.118
  35.192.131.204
  35.192.132.255
  35.192.133.155
  35.192.16.224
  35.192.178.18
+35.192.183.39
  35.192.219.160
  35.192.230.214
  35.192.34.85
@@ -65821,12 +65779,12 @@
  35.194.88.203
  35.195.129.175
  35.195.165.193
-35.195.193.119
  35.195.231.183
  35.195.234.115
  35.195.238.142
  35.195.25.89
  35.195.30.252
+35.195.54.236
  35.195.64.76
  35.196.154.26
  35.196.182.146
@@ -65844,7 +65802,6 @@
  35.197.147.209
  35.197.151.149
  35.197.227.71
-35.197.232.64
  35.197.3.12
  35.197.32.194
  35.197.41.227
@@ -65860,7 +65817,6 @@
  35.199.38.2
  35.199.40.199
  35.199.41.83
-35.199.51.184
  35.199.84.117
  35.199.93.228
  35.199.97.42
@@ -65878,15 +65834,18 @@
  35.202.188.178
  35.202.198.13
  35.202.200.129
+35.202.25.83
  35.202.253.241
  35.202.72.149
  35.202.74.190
+35.202.99.202
+35.203.28.188
  35.203.4.36
  35.203.68.135
  35.204.191.150
  35.204.2.48
  35.204.31.217
-35.205.146.69
+35.205.187.126
  35.205.22.29
  35.207.65.42
  35.208.78.118
@@ -65895,13 +65854,11 @@
  35.209.51.212
  35.209.9.189
  35.211.2.103
+35.212.221.120
  35.213.164.234
  35.213.18.190
  35.213.188.104
  35.214.175.59
-35.214.175.81
-35.214.194.197
-35.214.229.53
  35.216.73.53
  35.220.147.109
  35.220.155.26
@@ -65917,6 +65874,7 @@
  35.221.247.203
  35.221.34.129
  35.221.82.156
+35.222.10.93
  35.222.103.143
  35.222.19.183
  35.223.101.235
@@ -65926,6 +65884,7 @@
  35.223.255.227
  35.224.1.26
  35.224.107.234
+35.224.124.158
  35.224.132.48
  35.224.144.160
  35.224.160.36
@@ -65944,19 +65903,19 @@
  35.225.181.213
  35.225.191.140
  35.225.3.195
-35.225.71.1
  35.225.94.95
  35.226.120.32
  35.226.14.224
  35.226.172.128
  35.226.204.126
-35.226.225.177
  35.226.232.224
+35.226.241.164
  35.226.50.174
  35.226.8.173
  35.226.81.181
  35.227.169.57
  35.227.181.98
+35.227.184.124
  35.227.19.67
  35.227.47.98
  35.227.56.24
@@ -65965,10 +65924,10 @@
  35.227.77.27
  35.228.169.211
  35.228.212.136
+35.228.72.151
  35.229.108.202
  35.229.113.53
  35.229.126.239
-35.229.134.23
  35.229.139.80
  35.229.148.33
  35.229.218.182
@@ -65988,23 +65947,21 @@
  35.231.20.10
  35.231.217.24
  35.231.223.140
-35.231.234.221
  35.231.88.244
  35.231.89.204
  35.232.18.41
  35.232.203.106
  35.232.213.202
  35.232.228.59
-35.232.249.55
  35.232.5.209
  35.232.52.162
-35.233.122.217
  35.233.226.183
  35.233.235.80
  35.234.123.96
  35.234.152.236
  35.234.57.250
  35.235.93.109
+35.235.96.109
  35.236.125.18
  35.236.139.60
  35.236.147.87
@@ -66014,6 +65971,7 @@
  35.236.199.75
  35.236.203.52
  35.236.207.14
+35.236.246.14
  35.236.39.99
  35.236.57.66
  35.236.69.54
@@ -66075,6 +66033,7 @@
  35.247.116.139
  35.247.170.234
  35.247.175.47
+35.247.229.33
  35.72.109.56
  350450-dot-n-e-w-me-ss-age-po-rt-al.wl.r.appspot.com
  352773.com
@@ -66106,7 +66065,6 @@
  36.107.233.232
  36.107.235.83
  36.107.236.145
-36.107.239.93
  36.107.26.26
  36.109.133.37
  36.109.134.42
@@ -66119,17 +66077,18 @@
  36.110.231.213
  36.110.239.4
  36.110.27.122
-36.111.150.124
  36.112.104.194
+36.112.128.193
  36.112.128.203
  36.112.130.101
  36.112.133.190
+36.112.134.215
  36.112.156.173
  36.112.172.125
  36.112.99.178
-36.129.11.4
  36.133.112.61
  36.133.116.82
+36.133.217.172
  36.133.235.242
  36.133.236.160
  36.133.239.242
@@ -66139,7 +66098,6 @@
  36.133.37.9
  36.133.44.246
  36.134.102.146
-36.134.142.70
  36.134.203.156
  36.134.217.175
  36.134.217.48
@@ -66149,13 +66107,13 @@
  36.134.72.246
  36.134.75.128
  36.152.142.45
-36.152.232.94
  36.152.38.149
  36.152.69.210
  36.153.189.66
  36.153.231.18
  36.154.110.46
  36.154.37.158
+36.155.109.122
  36.155.109.127
  36.155.113.199
  36.155.113.40
@@ -66164,8 +66122,10 @@
  36.155.9.133
  36.155.9.139
  36.156.141.156
+36.156.145.168
  36.156.151.54
  36.156.152.226
+36.156.152.80
  36.156.154.154
  36.156.154.218
  36.156.156.150
@@ -66173,22 +66133,22 @@
  36.22.178.114
  36.22.187.34
  36.224.112.95
-36.226.236.104
+36.227.163.17
  36.227.170.236
  36.227.171.220
  36.227.175.141
  36.229.7.108
  36.230.24.26
-36.230.39.154
  36.231.201.150
  36.231.69.25
  36.231.95.42
  36.234.180.56
  36.236.156.204
  36.236.204.134
+36.239.119.126
  36.239.145.176
+36.239.6.195
  36.24.160.33
-36.24.236.64
  36.248.105.221
  36.248.133.245
  36.248.153.3
@@ -66198,12 +66158,14 @@
  36.248.168.165
  36.248.211.71
  36.25.228.115
+36.25.229.73
  36.25.230.150
  36.25.243.251
  36.25.243.51
  36.250.203.94
  36.250.229.115
  36.250.229.84
+36.250.229.92
  36.250.5.117
  36.251.157.225
  36.251.18.18
@@ -66214,9 +66176,12 @@
  36.255.104.17
  36.255.104.9
  36.255.156.126
+36.255.156.78
  36.255.211.1
  36.255.243.52
+36.255.46.22
  36.255.61.190
+36.255.63.98
  36.255.85.227
  36.255.85.232
  36.255.86.114
@@ -66237,7 +66202,6 @@
  36.26.194.61
  36.26.194.83
  36.26.210.57
-36.26.68.41
  36.26.84.45
  36.27.208.157
  36.32.110.7
@@ -66247,11 +66211,13 @@
  36.32.88.251
  36.33.132.206
  36.33.138.140
+36.33.138.19
  36.33.140.232
  36.33.140.248
  36.33.22.82
  36.33.226.229
  36.34.150.235
+36.34.181.116
  36.34.234.122
  36.35.160.188
  36.35.160.240
@@ -66274,6 +66240,8 @@
  36.37.177.186
  36.37.180.59
  36.37.183.214
+36.37.209.208
+36.37.227.253
  36.37.242.67
  36.37.73.245
  36.37.74.60
@@ -66281,20 +66249,19 @@
  36.37.98.113
  36.39.18.226
  36.43.65.41
+36.46.135.38
  36.48.166.159
  36.49.159.15
  36.49.92.138
+36.49.92.152
  36.5.22.211
-36.5.23.95
  36.55.230.146
-36.6.140.127
  36.65.131.67
-36.65.16.90
  36.65.166.171
  36.65.211.253
+36.65.253.14
  36.65.68.7
  36.65.95.66
-36.66.102.107
  36.66.107.219
  36.66.114.249
  36.66.125.221
@@ -66321,6 +66288,7 @@
  36.66.216.81
  36.66.216.82
  36.66.231.113
+36.66.235.70
  36.66.242.146
  36.66.242.148
  36.66.243.115
@@ -66346,7 +66314,6 @@
  36.67.123.187
  36.67.128.145
  36.67.153.58
-36.67.158.49
  36.67.16.253
  36.67.163.146
  36.67.168.117
@@ -66366,7 +66333,6 @@
  36.67.231.95
  36.67.233.227
  36.67.236.57
-36.67.237.146
  36.67.237.147
  36.67.24.109
  36.67.240.73
@@ -66386,7 +66352,6 @@
  36.67.63.239
  36.67.63.29
  36.67.66.100
-36.67.66.202
  36.67.7.33
  36.67.70.186
  36.67.71.67
@@ -66398,65 +66363,59 @@
  36.67.89.179
  36.67.93.209
  36.67.93.210
+36.67.98.158
  36.68.100.181
-36.68.117.87
  36.68.128.31
  36.68.14.147
-36.68.15.127
  36.68.20.18
-36.68.217.61
-36.68.222.33
-36.68.223.118
-36.68.223.135
+36.68.221.132
  36.68.24.83
  36.68.56.204
  36.68.63.166
  36.69.222.223
  36.69.5.72
-36.69.8.250
  36.7.159.17
  36.7.159.60
-36.7.175.86
-36.7.64.144
  36.7.69.56
  36.7.87.126
-36.70.159.170
  36.70.26.19
  36.71.139.206
+36.71.140.249
+36.71.142.250
  36.71.233.80
  36.71.235.183
-36.71.237.100
  36.71.239.243
  36.72.120.235
  36.72.134.47
  36.72.14.69
  36.72.155.201
-36.72.160.202
  36.72.184.179
  36.72.184.87
-36.72.212.103
-36.72.219.57
  36.72.236.35
  36.72.57.115
  36.72.81.83
  36.72.83.149
+36.73.126.208
  36.73.22.199
  36.73.228.80
  36.73.255.180
  36.73.30.43
+36.73.33.10
  36.74.109.204
  36.74.144.83
  36.74.145.47
  36.74.148.66
  36.74.27.23
+36.74.40.136
+36.74.42.4
+36.74.45.44
+36.74.45.94
  36.74.75.31
  36.75.158.65
  36.75.172.91
  36.75.210.221
  36.75.212.60
-36.76.140.245
-36.76.171.245
-36.76.245.243
+36.75.227.72
  36.76.89.130
  36.77.109.97
  36.77.173.189
@@ -66465,9 +66424,10 @@
  36.77.37.115
  36.77.45.165
  36.77.51.217
-36.77.60.194
+36.77.95.150
  36.77.95.203
  36.77.95.230
+36.77.95.252
  36.78.100.20
  36.78.210.176
  36.79.187.32
@@ -66476,21 +66436,25 @@
  36.79.216.169
  36.79.250.63
  36.79.31.45
-36.79.43.69
  36.79.47.144
+36.79.49.80
  36.80.125.115
  36.80.132.58
  36.80.176.152
-36.80.194.0
  36.80.202.102
+36.80.212.76
+36.80.218.196
  36.80.34.225
  36.80.36.57
  36.80.48.9
  36.80.94.109
  36.81.10.216
+36.81.10.27
  36.81.151.56
+36.81.198.168
  36.81.248.17
  36.81.255.22
+36.81.3.145
  36.81.9.24
  36.82.106.238
  36.82.144.35
@@ -66499,7 +66463,6 @@
  36.83.178.235
  36.83.20.111
  36.83.22.176
-36.83.23.138
  36.83.23.169
  36.83.237.106
  36.83.24.101
@@ -66507,14 +66470,12 @@
  36.84.100.165
  36.84.100.210
  36.84.100.230
-36.84.19.140
  36.84.59.53
  36.84.80.31
  36.85.11.154
  36.85.136.97
  36.85.247.86
  36.85.64.19
-36.85.78.194
  36.85.91.95
  36.88.120.43
  36.88.241.60
@@ -66540,10 +66501,12 @@
  36.89.180.181
  36.89.180.29
  36.89.181.85
+36.89.182.193
  36.89.182.225
  36.89.182.3
  36.89.182.85
  36.89.183.209
+36.89.183.241
  36.89.183.253
  36.89.183.77
  36.89.187.193
@@ -66571,6 +66534,7 @@
  36.89.240.9
  36.89.243.187
  36.89.246.187
+36.89.248.125
  36.89.25.220
  36.89.27.235
  36.89.27.253
@@ -66597,35 +66561,36 @@
  36.90.123.123
  36.90.123.171
  36.90.123.173
-36.90.16.131
+36.90.153.59
  36.90.163.79
-36.90.171.205
+36.90.172.135
  36.90.173.228
+36.90.179.149
  36.90.18.246
  36.90.182.236
+36.90.19.199
  36.90.208.223
  36.90.27.53
-36.90.3.150
  36.90.41.226
  36.90.41.29
  36.90.41.30
  36.90.41.51
  36.90.42.84
  36.90.43.171
-36.90.43.36
  36.90.48.243
  36.90.50.245
  36.90.51.174
  36.90.56.63
  36.90.60.25
  36.90.60.89
+36.90.61.239
  36.90.61.75
-36.90.62.135
  36.90.62.17
  36.90.62.85
  36.90.62.91
  36.90.63.148
  36.90.63.243
+36.90.63.9
  36.90.9.219
  36.90.90.12
  36.91.119.221
@@ -66639,13 +66604,16 @@
  36.91.207.65
  36.91.218.130
  36.91.36.155
+36.91.38.31
  36.91.44.183
  36.91.45.10
  36.91.48.186
  36.91.54.25
+36.92.1.31
  36.92.10.95
  36.92.109.147
  36.92.111.143
+36.92.114.106
  36.92.125.37
  36.92.147.99
  36.92.170.89
@@ -66675,8 +66643,8 @@
  36.94.12.210
  36.94.13.57
  36.94.130.176
-36.94.130.178
  36.94.137.167
+36.94.164.249
  36.94.167.167
  36.94.180.155
  36.94.185.202
@@ -66684,7 +66652,6 @@
  36.94.23.91
  36.94.230.199
  36.94.35.217
-36.94.37.66
  36.94.43.124
  36.94.43.130
  36.94.43.131
@@ -66696,9 +66663,11 @@
  36.94.81.71
  36.94.82.147
  36.94.87.19
+36.95.23.89
  36.96.12.49
  36.96.184.215
  36.99.160.161
+36.99.163.230
  36.99.164.90
  36.99.165.71
  36.99.168.93
@@ -66708,6 +66677,7 @@
  36.99.40.139
  36.99.41.29
  36.99.44.70
+36.99.45.42
  36.99.46.128
  360.lcy2zzx.pw
  360925443516409-dot-wetransfer-auth-file333.appspot.com
@@ -66715,6 +66685,7 @@
  360dhw.net
  360digest.beyondb-school.com
  360dogprof.com
+360down7.miiyun.cn
  360focustz.com
  360hang.online
  360imageworks.com
@@ -66980,13 +66951,12 @@
  37-a-life-ft.com
  37.1.200.82
  37.1.205.81
-37.1.206.161
  37.1.218.71
  37.1.221.118
+37.104.107.38
  37.104.36.62
  37.104.64.3
  37.106.63.27
-37.107.176.8
  37.107.67.177
  37.109.3.250
  37.110.147.1
@@ -67012,7 +66982,7 @@
  37.115.61.166
  37.117.110.208
  37.119.87.215
-37.120.133.141
+37.120.133.135
  37.120.133.209
  37.120.140.134
  37.120.140.158
@@ -67020,17 +66990,17 @@
  37.120.140.242
  37.120.143.174
  37.120.143.60
-37.120.144.233
  37.120.145.154
  37.120.146.26
-37.120.148.182
+37.120.152.104
+37.120.152.110
  37.120.153.27
  37.120.153.47
  37.120.153.92
+37.120.155.103
  37.120.155.106
  37.120.155.108
  37.120.155.110
-37.120.155.179
  37.120.156.36
  37.120.169.116
  37.120.171.27
@@ -67038,8 +67008,8 @@
  37.120.187.205
  37.120.187.97
  37.120.192.154
-37.120.193.185
  37.120.193.231
+37.120.193.252
  37.120.200.100
  37.120.200.102
  37.120.200.104
@@ -67050,7 +67020,7 @@
  37.120.200.110
  37.120.200.99
  37.120.203.131
-37.120.204.140
+37.120.204.212
  37.120.217.11
  37.120.217.52
  37.120.218.106
@@ -67059,6 +67029,7 @@
  37.120.218.115
  37.120.218.120
  37.120.218.124
+37.120.218.22
  37.120.218.88
  37.120.218.90
  37.120.222.132
@@ -67070,12 +67041,9 @@
  37.120.239.103
  37.120.239.150
  37.120.239.152
-37.120.239.83
-37.122.164.102
-37.123.181.184
+37.122.178.2
  37.128.107.98
  37.128.224.246
-37.130.202.92
  37.130.227.133
  37.131.164.102
  37.131.164.124
@@ -67086,19 +67054,17 @@
  37.131.165.19
  37.131.166.251
  37.131.196.63
-37.131.30.210
  37.133.129.0
-37.134.169.5
  37.134.238.244
  37.134.66.201
  37.135.50.64
  37.135.51.160
-37.135.51.245
  37.135.76.52
+37.138.201.126
+37.138.203.206
  37.139.0.44
  37.139.1.197
  37.139.102.73
-37.139.112.40
  37.139.15.140
  37.139.15.159
  37.139.15.205
@@ -67112,6 +67078,7 @@
  37.139.2.242
  37.139.2.57
  37.139.2.66
+37.139.20.147
  37.139.20.94
  37.139.21.140
  37.139.21.175
@@ -67135,7 +67102,9 @@
  37.14.209.192
  37.140.197.159
  37.140.198.91
+37.140.34.98
  37.142.10.95
+37.142.11.39
  37.142.41.226
  37.142.89.38
  37.143.116.43
@@ -67147,24 +67116,25 @@
  37.147.174.213
  37.147.62.27
  37.15.210.176
+37.151.150.140
  37.152.163.35
  37.152.176.65
  37.152.180.201
+37.152.180.245
  37.152.182.65
  37.152.183.18
  37.152.183.210
  37.152.183.32
-37.153.138.206
  37.153.174.190
  37.157.184.9
  37.157.193.84
  37.157.212.109
  37.157.253.35
+37.159.11.95
  37.159.208.218
  37.159.78.94
-37.165.10.17
-37.165.6.121
-37.168.136.106
+37.162.179.129
+37.163.161.28
  37.17.12.32
  37.17.12.33
  37.17.16.61
@@ -67178,14 +67148,15 @@
  37.17.237.44
  37.17.38.196
  37.17.56.44
+37.17.72.50
  37.17.9.140
  37.17.9.28
  37.171.176.18
  37.179.206.158
-37.179.47.18
+37.182.181.163
  37.183.188.131
+37.186.120.26
  37.186.249.90
-37.186.46.110
  37.187.0.20
  37.187.100.150
  37.187.100.50
@@ -67210,6 +67181,7 @@
  37.187.127.114
  37.187.129.166
  37.187.130.92
+37.187.132.113
  37.187.132.31
  37.187.132.5
  37.187.134.111
@@ -67224,7 +67196,6 @@
  37.187.16.30
  37.187.162.238
  37.187.168.141
-37.187.171.105
  37.187.174.201
  37.187.174.55
  37.187.180.74
@@ -67241,6 +67212,7 @@
  37.187.21.81
  37.187.22.60
  37.187.23.106
+37.187.252.148
  37.187.28.194
  37.187.3.112
  37.187.34.191
@@ -67260,18 +67232,22 @@
  37.187.7.95
  37.187.72.193
  37.187.74.109
+37.187.74.197
  37.187.75.16
  37.187.78.196
  37.187.78.70
  37.187.79.227
+37.187.8.52
  37.187.80.217
+37.187.91.7
  37.187.94.86
  37.187.95.218
  37.187.96.183
  37.187.96.95
  37.187.97.80
-37.191.197.157
  37.191.243.119
+37.191.26.87
+37.191.78.17
  37.192.137.50
  37.192.194.50
  37.193.125.103
@@ -67279,27 +67255,26 @@
  37.193.91.79
  37.195.209.169
  37.196.26.48
-37.20.210.185
+37.20.151.10
  37.20.91.54
  37.200.21.114
  37.200.77.123
  37.201.118.103
  37.201.132.240
  37.203.236.29
-37.204.29.184
  37.205.10.140
  37.205.14.137
  37.205.8.78
  37.205.81.41
+37.205.87.120
  37.205.9.252
  37.208.66.130
  37.209.12.181
  37.209.81.220
  37.21.72.58
-37.21.96.40
-37.211.156.141
  37.211.19.161
  37.212.138.205
+37.212.141.53
  37.212.182.90
  37.212.224.179
  37.212.252.97
@@ -67317,6 +67292,7 @@
  37.218.245.25
  37.220.109.238
  37.220.129.69
+37.220.134.187
  37.220.22.106
  37.220.22.131
  37.220.31.119
@@ -67333,9 +67309,7 @@
  37.221.198.57
  37.221.204.206
  37.221.209.222
-37.223.26.30
-37.225.45.98
-37.228.107.253
+37.221.215.46
  37.228.129.2
  37.228.129.5
  37.228.241.125
@@ -67344,7 +67318,9 @@
  37.228.94.219
  37.229.196.220
  37.229.197.172
+37.229.209.77
  37.229.82.103
+37.230.101.204
  37.230.99.119
  37.232.34.201
  37.232.4.12
@@ -67369,15 +67345,17 @@
  37.237.65.43
  37.238.130.50
  37.238.130.84
+37.238.42.21
  37.239.46.2
  37.239.46.26
-37.239.88.91
+37.24.167.190
  37.24.199.68
  37.24.240.15
  37.24.38.254
  37.247.111.141
  37.247.209.179
-37.248.158.34
+37.248.153.34
+37.248.157.22
  37.252.11.91
  37.252.15.13
  37.252.15.241
@@ -67396,6 +67374,7 @@
  37.252.91.95
  37.255.134.170
  37.255.134.63
+37.255.134.67
  37.26.136.181
  37.26.136.224
  37.26.2.122
@@ -67406,7 +67385,6 @@
  37.29.106.202
  37.29.116.46
  37.29.35.190
-37.30.50.162
  37.32.44.1
  37.34.180.172
  37.34.208.91
@@ -67414,19 +67392,18 @@
  37.35.233.224
  37.38.107.151
  37.38.226.148
-37.38.7.112
  37.39.242.19
  37.4.227.227
-37.41.47.82
+37.41.107.28
  37.43.170.27
  37.44.137.205
  37.44.238.35
  37.44.252.176
-37.44.253.189
  37.44.253.24
  37.44.253.67
  37.46.118.107
  37.46.129.215
+37.46.150.128
  37.46.150.13
  37.46.150.14
  37.46.150.142
@@ -67439,8 +67416,13 @@
  37.46.150.243
  37.46.150.39
  37.46.150.40
+37.46.150.47
+37.46.150.61
+37.46.150.65
  37.46.150.85
+37.46.150.92
  37.46.73.5
+37.47.238.122
  37.47.4.173
  37.48.103.228
  37.48.105.203
@@ -67491,22 +67473,22 @@
  37.49.224.98
  37.49.225.110
  37.49.225.118
-37.49.225.121
+37.49.225.134
  37.49.225.136
  37.49.225.137
  37.49.225.138
  37.49.225.139
-37.49.225.140
  37.49.225.15
+37.49.225.151
  37.49.225.156
  37.49.225.165
+37.49.225.173
  37.49.225.174
  37.49.225.175
  37.49.225.178
  37.49.225.18
-37.49.225.186
+37.49.225.182
  37.49.225.188
-37.49.225.189
  37.49.225.19
  37.49.225.194
  37.49.225.196
@@ -67514,6 +67496,7 @@
  37.49.225.201
  37.49.225.219
  37.49.225.233
+37.49.225.238
  37.49.225.245
  37.49.225.26
  37.49.225.28
@@ -67571,10 +67554,10 @@
  37.49.226.88
  37.49.226.99
  37.49.229.191
+37.49.229.202
  37.49.230.102
  37.49.230.103
  37.49.230.128
-37.49.230.130
  37.49.230.131
  37.49.230.133
  37.49.230.141
@@ -67585,6 +67568,7 @@
  37.49.230.167
  37.49.230.169
  37.49.230.17
+37.49.230.177
  37.49.230.180
  37.49.230.190
  37.49.230.200
@@ -67612,16 +67596,16 @@
  37.49.231.37
  37.49.231.62
  37.49.48.46
-37.5.254.48
+37.52.132.242
  37.53.91.78
  37.53.93.198
-37.54.51.106
+37.54.74.41
  37.55.204.18
  37.55.85.239
+37.55.91.161
  37.57.0.198
  37.57.119.90
  37.57.12.231
-37.57.130.244
  37.57.147.41
  37.57.15.43
  37.57.161.102
@@ -67644,7 +67628,6 @@
  37.57.89.52
  37.58.122.114
  37.58.150.203
-37.58.59.216
  37.58.75.46
  37.59.106.38
  37.59.109.58
@@ -67655,10 +67638,11 @@
  37.59.200.29
  37.59.200.31
  37.59.205.11
-37.59.210.216
  37.59.215.22
  37.59.223.107
+37.59.255.42
  37.59.31.135
+37.59.35.50
  37.59.36.210
  37.59.37.210
  37.59.38.74
@@ -67700,9 +67684,9 @@
  37.61.219.34
  37.61.219.53
  37.70.131.107
+37.72.172.10
  37.72.175.160
  37.72.175.206
-37.72.186.105
  37.72.186.111
  37.72.186.114
  37.72.186.135
@@ -67710,28 +67694,23 @@
  37.72.186.190
  37.72.186.227
  37.72.186.228
-37.72.186.233
-37.72.186.245
  37.72.186.79
  37.72.190.109
  37.73.66.253
-37.75.131.172
  37.75.135.161
  37.75.81.120
  37.76.130.168
  37.76.140.252
-37.76.185.147
  37.76.189.219
  37.76.234.230
  37.76.39.187
-37.76.8.55
  37.77.105.130
+37.77.128.162
  37.78.245.107
  37.79.139.125
  37.79.16.230
  37.79.255.195
  37.79.30.245
-37.8.124.26
  37.8.133.59
  37.8.29.228
  37.85.104.125
@@ -67746,12 +67725,12 @@
  37.9.169.5
  37.9.192.204
  37.97.139.116
+37.97.185.158
  37.97.186.98
  37.97.190.174
  37.97.191.18
  37.97.249.17
  37.97.78.136
-37.98.154.154
  37.98.196.42
  37.98.226.11
  37.98.231.2
@@ -67878,6 +67857,7 @@
  38.100.21.68
  38.100.21.78
  38.102.69.70
+38.104.95.242
  38.109.195.42
  38.111.114.155
  38.121.60.2
@@ -67891,8 +67871,10 @@
  38.130.75.20
  38.130.75.38
  38.130.75.49
+38.131.157.83
  38.132.118.133
  38.132.124.147
+38.132.99.207
  38.132.99.208
  38.133.198.128
  38.133.200.94
@@ -67903,7 +67885,7 @@
  38.145.201.162
  38.145.201.41
  38.145.88.155
-38.17.54.173
+38.145.99.202
  38.242.12.100
  38.242.21.27
  38.29.147.15
@@ -67922,6 +67904,7 @@
  38.72.132.208
  38.73.238.134
  38.73.238.138
+38.87.196.86
  38.87.234.241
  38.87.234.242
  38.87.54.162
@@ -67946,56 +67929,69 @@
  387431298338020-dot-wetransfer-auth-file-343.appspot.com
  3874785889389894589-secondary.z6.web.core.windows.net
  389276365.com
+38946331430463-4936436463chase.com
  38963.xc.liaochuo.com
  38f1d44f1a954bd72362716c792b3cf7-dot-dbenitonline.ey.r.appspot.com
  38seventeen.com
  39-a-life-ft.com
+39.100.12.245
  39.100.124.232
+39.100.149.197
+39.100.156.81
+39.100.202.158
  39.100.210.12
-39.100.230.223
+39.100.227.126
+39.100.230.115
  39.100.231.125
  39.100.234.46
-39.100.33.222
  39.100.36.150
  39.100.37.39
  39.101.136.226
-39.101.142.197
+39.101.192.128
  39.101.206.20
+39.101.206.82
  39.101.207.5
+39.101.211.79
+39.101.219.25
+39.102.67.244
  39.103.139.6
+39.104.114.87
  39.104.118.116
  39.104.77.51
  39.104.81.231
-39.104.82.5
  39.105.125.201
-39.105.129.219
+39.105.135.74
  39.105.136.217
  39.105.181.131
  39.105.192.77
  39.105.46.101
+39.105.76.21
  39.105.85.40
  39.105.92.8
+39.106.104.101
+39.106.110.71
  39.106.116.165
  39.106.13.134
  39.106.150.224
+39.106.160.255
+39.106.203.150
  39.106.223.134
  39.106.223.207
  39.106.229.113
  39.106.44.66
  39.106.7.117
-39.106.74.141
  39.106.9.88
-39.106.97.156
  39.107.234.140
  39.107.236.42
+39.107.250.245
  39.107.98.215
  39.108.104.226
  39.108.123.4
  39.108.141.158
  39.108.167.47
  39.108.224.10
-39.108.224.94
  39.108.3.76
+39.108.49.78
  39.108.68.237
  39.108.8.217
  39.109.104.27
@@ -68008,6 +68004,7 @@
  39.109.122.173
  39.109.123.18
  39.109.125.99
+39.109.126.223
  39.109.127.162
  39.109.127.81
  39.109.17.201
@@ -68023,54 +68020,59 @@
  39.109.6.102
  39.109.7.232
  39.109.7.6
-39.114.137.102
+39.113.245.254
  39.115.133.87
  39.115.19.1
  39.118.131.76
  39.118.216.192
+39.123.24.145
  39.126.16.29
  39.137.107.98
  39.137.69.10
  39.137.69.7
+39.152.147.236
+39.152.64.73
+39.155.208.70
  39.155.234.74
-39.170.50.16
+39.164.99.60
  39.175.68.187
  39.183.132.49
+39.184.128.207
+39.32.117.144
  39.32.71.197
  39.33.170.49
  39.33.51.17
  39.33.82.7
-39.34.222.130
  39.34.226.168
-39.35.96.127
-39.36.102.206
-39.36.141.205
+39.36.15.63
  39.36.151.207
+39.36.236.43
+39.36.255.108
  39.37.188.157
+39.37.214.46
  39.40.46.147
-39.40.84.60
  39.41.178.207
+39.41.187.16
+39.41.237.47
  39.41.62.241
-39.41.76.59
  39.42.35.2
-39.43.154.170
+39.42.47.107
+39.42.72.75
+39.42.93.10
+39.43.98.182
  39.45.177.195
  39.46.13.102
-39.46.50.24
-39.48.10.76
-39.48.112.118
+39.48.178.57
+39.49.85.107
  39.50.107.75
-39.50.189.104
  39.50.194.161
+39.50.64.131
  39.50.97.132
-39.51.79.14
  39.52.132.110
  39.53.119.195
  39.53.126.151
  39.53.129.101
  39.57.108.23
-39.57.138.131
-39.57.179.237
  39.59.75.185
  39.63.7.181
  39.64.1.57
@@ -68099,16 +68101,13 @@
  39.67.104.83
  39.67.199.5
  39.67.205.45
-39.67.88.115
  39.68.11.133
  39.68.154.55
  39.68.157.34
-39.68.185.91
  39.68.37.250
  39.69.115.100
  39.69.127.21
  39.72.13.11
-39.72.130.233
  39.72.167.202
  39.73.1.187
  39.73.109.191
@@ -68122,7 +68121,6 @@
  39.73.169.24
  39.73.17.175
  39.73.177.4
-39.73.183.14
  39.73.184.119
  39.73.217.43
  39.73.242.210
@@ -68155,6 +68153,7 @@
  39.77.106.17
  39.77.110.170
  39.77.115.171
+39.77.118.146
  39.77.121.252
  39.77.164.158
  39.77.166.66
@@ -68162,11 +68161,13 @@
  39.77.242.231
  39.77.37.106
  39.79.113.113
+39.79.121.80
  39.79.146.109
  39.79.147.75
  39.79.147.85
  39.79.148.223
  39.79.149.166
+39.79.150.106
  39.79.185.120
  39.79.185.120bin.sh
  39.79.217.51
@@ -68190,17 +68191,15 @@
  39.80.82.15
  39.80.83.114
  39.81.139.3
-39.81.144.184
-39.81.149.192
  39.81.181.142
  39.81.189.207
  39.81.238.18
  39.81.24.199
  39.81.25.141
  39.81.29.100
-39.81.29.182
  39.81.29.243
  39.81.46.255
+39.81.59.31
  39.81.70.239
  39.82.249.12
  39.82.30.18
@@ -68223,23 +68222,26 @@
  39.86.13.0
  39.86.235.120
  39.86.239.185
+39.86.248.97
+39.86.249.115
  39.86.249.146
  39.86.39.137
  39.86.39.219
+39.86.58.13
  39.86.6.226
  39.86.62.165
  39.86.62.244
  39.86.63.244
  39.86.65.119
+39.86.65.142
  39.86.66.16
-39.86.66.196
  39.86.76.213
  39.86.82.189
  39.86.82.31
  39.86.83.30
  39.87.237.182
  39.87.60.188
-39.87.69.253
+39.87.63.65
  39.87.84.12
  39.87.93.54
  39.87.98.115
@@ -68279,33 +68281,45 @@
  39.89.237.220
  39.89.30.218
  39.89.60.81
-39.90.143.109
  39.90.143.135
  39.90.143.151
-39.90.143.154
+39.90.143.153
+39.90.143.157
+39.90.143.24
+39.90.143.28
+39.90.143.81
  39.90.152.43
  39.90.154.220
  39.90.159.141
  39.90.159.54bin.sh
-39.90.169.217
-39.90.169.234
  39.90.169.236
  39.90.169.249
  39.90.169.3
-39.96.175.55
+39.90.169.34
+39.90.169.75
+39.90.174.114
+39.90.174.12
+39.90.174.134
  39.96.202.234
+39.96.21.32
  39.96.32.187
  39.96.82.217
+39.97.107.254
  39.97.109.91
  39.97.219.148
+39.97.227.108
  39.97.227.7
  39.97.231.198
  39.97.244.212
-39.98.172.174
+39.97.252.78
+39.98.145.243
+39.98.177.60
+39.98.196.213
+39.98.216.243
  39.98.244.128
-39.98.245.32
  39.99.184.203
  39.99.198.78
+39.99.220.129
  39.99.232.25
  39.99.237.209
  39006.xc.05cg.com
@@ -68441,6 +68455,7 @@
  3jsilver.com
  3kbuortfa3k.bankofamericaslpemr.com
  3legsresources.com
+3login-secure.com
  3login.app
  3login.help
  3lqov.weblium.site
@@ -68557,6 +68572,7 @@
  40.113.206.182
  40.113.238.202
  40.113.74.50
+40.113.99.245
  40.114.104.42
  40.114.107.245
  40.114.110.198
@@ -68577,18 +68593,16 @@
  40.117.117.228
  40.117.133.229
  40.117.149.213
-40.117.150.55
  40.117.180.167
  40.117.191.139
  40.117.192.99
  40.117.231.90
  40.117.252.39
  40.117.46.166
-40.117.73.175
-40.117.74.160
-40.117.82.33
+40.117.61.235
  40.117.97.67
  40.118.133.199
+40.118.15.126
  40.118.168.204
  40.118.172.113
  40.118.205.218
@@ -68631,18 +68645,19 @@
  40.127.166.7
  40.127.172.225
  40.127.177.193
-40.127.181.173
-40.127.186.244
+40.127.190.5
  40.127.2.180
  40.127.200.73
  40.131.87.38
  40.132.242.226
+40.142.181.217
  40.68.255.214
  40.68.97.6
  40.69.155.91
  40.69.74.25
  40.69.91.131
  40.69.96.123
+40.69.99.254
  40.70.12.248
  40.70.189.4
  40.70.72.10
@@ -68662,26 +68677,28 @@
  40.73.35.39
  40.73.59.55
  40.73.67.85
+40.73.77.193
  40.73.77.249
  40.73.79.203
  40.74.112.227
+40.74.123.234
  40.74.139.130
  40.74.231.133
  40.74.235.156
  40.74.65.232
  40.74.78.199
-40.74.78.211
  40.74.80.66
  40.74.82.225
  40.75.117.244
  40.75.67.235
  40.76.0.90
  40.76.197.155
+40.76.20.119
  40.76.201.251
  40.76.21.137
  40.76.222.119
  40.76.24.2
-40.76.244.141
+40.76.246.9
  40.76.44.230
  40.76.59.137
  40.76.74.198
@@ -68774,6 +68791,7 @@
  40.83.181.2
  40.83.190.122
  40.83.211.252
+40.83.72.81
  40.83.89.19
  40.84.137.248
  40.84.139.252
@@ -68781,14 +68799,12 @@
  40.84.157.119
  40.84.216.97
  40.84.225.234
-40.85.123.110
  40.85.160.135
  40.85.162.35
  40.85.186.102
  40.85.202.11
  40.85.205.219
  40.85.252.223
-40.86.162.123
  40.86.218.34
  40.86.219.220
  40.86.223.44
@@ -68806,6 +68822,7 @@
  40.89.159.38
  40.89.177.197
  40.90.160.83
+40.90.202.114
  4000095599.com
  400517034274668-dot-charming-sky-2700.appspot.com
  4006261166.com
@@ -68838,26 +68855,29 @@
  41.110.141.3
  41.111.123.99
  41.111.130.125
+41.111.132.33
  41.111.166.162
+41.113.179.200
  41.114.150.57
+41.13.112.133
  41.130.62.64
  41.138.241.106
  41.138.54.13
-41.139.138.221
+41.139.206.99
  41.139.223.242
  41.139.9.47
+41.140.183.87
  41.140.31.106
-41.141.156.223
+41.141.182.171
  41.141.220.3
+41.142.229.132
  41.142.232.133
  41.142.240.200
  41.142.248.91
-41.142.5.54
  41.143.149.21
  41.143.19.50
  41.143.249.57
  41.143.249.60
-41.143.68.211
  41.144.86.169
  41.144.86.180
  41.157.45.240
@@ -68865,6 +68885,7 @@
  41.160.100.204
  41.160.114.37
  41.160.143.99
+41.160.238.202
  41.160.252.116
  41.160.40.2
  41.160.48.202
@@ -68874,11 +68895,13 @@
  41.162.107.130
  41.162.125.226
  41.162.186.2
+41.162.52.11
  41.162.57.82
  41.162.92.66
  41.162.94.52
  41.164.24.243
  41.164.247.186
+41.169.11.210
  41.169.123.37
  41.169.139.2
  41.169.143.211
@@ -68890,7 +68913,6 @@
  41.169.79.166
  41.170.12.92
  41.170.4.42
-41.174.78.145
  41.175.155.78
  41.178.1.18
  41.180.4.117
@@ -68901,16 +68923,16 @@
  41.180.82.158
  41.180.96.110
  41.180.98.70
+41.181.207.139
+41.182.130.42
+41.182.133.186
+41.182.135.17
+41.182.135.246
+41.182.191.206
  41.182.218.115
  41.185.28.84
  41.185.29.128
  41.185.8.170
-41.188.104.58
-41.188.104.68
-41.188.105.152
-41.188.105.194
-41.188.105.213
-41.188.105.220
  41.188.124.50
  41.188.46.17
  41.188.5.110
@@ -68928,7 +68950,6 @@
  41.190.92.84
  41.190.95.20
  41.190.95.92
-41.191.205.121
  41.191.222.26
  41.191.71.250
  41.193.12.50
@@ -68937,7 +68958,6 @@
  41.193.5.52
  41.193.55.190
  41.194.37.106
-41.204.238.34
  41.204.7.74
  41.205.13.126
  41.206.11.44
@@ -68948,18 +68968,20 @@
  41.207.251.194
  41.207.252.122
  41.208.150.114
+41.210.10.219
  41.210.140.35
  41.210.161.114
  41.210.171.146
  41.211.122.81
  41.211.125.59
+41.212.108.99
  41.212.121.138
  41.213.13.146
  41.213.13.154
+41.214.32.212
  41.215.10.6
  41.215.100.83
  41.215.142.32
-41.215.147.90
  41.215.33.186
  41.215.37.230
  41.215.39.25
@@ -68972,13 +68994,14 @@
  41.215.79.182
  41.215.84.170
  41.215.95.113
+41.216.102.178
+41.216.108.235
  41.216.148.55
  41.216.173.222
  41.216.177.127
  41.216.177.99
  41.216.225.250
  41.216.229.10
-41.216.96.3
  41.217.216.17
  41.217.216.45
  41.217.217.60
@@ -68987,14 +69010,18 @@
  41.217.219.49
  41.217.219.53
  41.217.242.11
+41.217.64.82
+41.217.81.228
  41.217.84.224
  41.218.116.38
+41.218.196.105
  41.218.225.173
  41.218.253.127
  41.220.115.83
  41.220.119.246
  41.220.128.3
-41.220.239.194
+41.220.211.166
+41.220.27.114
  41.221.158.186
  41.221.168.167
  41.221.194.223
@@ -69011,6 +69038,8 @@
  41.223.4.155
  41.225.17.53
  41.225.186.80
+41.225.239.204
+41.225.33.201
  41.225.99.33
  41.226.11.252
  41.226.25.4
@@ -69022,18 +69051,21 @@
  41.226.60.138
  41.227.119.223
  41.227.25.145
-41.228.195.20
+41.227.80.104
+41.228.162.9
  41.230.0.41
  41.230.104.255
  41.230.14.107
  41.230.230.113
  41.230.30.215
  41.230.31.58
-41.230.4.33
  41.231.46.249
  41.231.53.25
+41.231.58.46
  41.234.31.238
-41.237.252.136
+41.234.66.53
+41.235.70.84
+41.236.31.21
  41.238.150.56
  41.238.200.222
  41.242.117.242
@@ -69046,19 +69078,22 @@
  41.248.133.186
  41.248.62.160
  41.249.0.227
-41.249.152.130
  41.249.212.74
  41.249.250.209
+41.249.251.2
+41.250.202.8
+41.250.68.162
  41.250.96.149
  41.251.106.8
  41.251.195.2
-41.253.95.183
  41.254.41.230
  41.254.44.62
+41.32.134.38
  41.32.213.239
  41.32.99.224
  41.33.13.26
  41.33.212.68
+41.33.231.194
  41.33.66.227
  41.33.66.228
  41.33.66.241
@@ -69069,29 +69104,26 @@
  41.33.66.250
  41.33.66.254
  41.34.244.224
+41.35.213.41
  41.38.18.230
-41.38.44.75
  41.39.153.4
  41.40.69.175
  41.41.70.190
-41.41.98.243
-41.42.166.91
  41.43.140.210
  41.43.77.105
-41.46.43.138
+41.46.1.197
  41.57.109.74
-41.58.86.52
+41.58.228.77
  41.59.200.33
  41.59.254.170
-41.60.121.22
  41.60.200.34
  41.60.216.119
  41.60.216.148
  41.60.216.153
+41.60.216.54
  41.60.218.10
  41.60.220.84
  41.60.233.192
-41.60.235.165
  41.60.236.145
  41.60.237.98
  41.60.239.11
@@ -69099,20 +69131,20 @@
  41.63.0.133
  41.63.0.41
  41.63.1.38
+41.63.1.39
+41.63.1.40
  41.65.111.226
  41.65.146.38
-41.66.203.141
-41.66.203.29
  41.67.48.101
  41.67.48.110
  41.67.48.71
-41.70.205.33
  41.71.119.195
  41.71.24.141
  41.71.24.148
  41.71.24.150
  41.71.24.152
  41.71.24.161
+41.71.24.167
  41.71.24.179
  41.71.24.181
  41.72.203.182
@@ -69131,6 +69163,7 @@
  41.75.123.49
  41.75.123.8
  41.75.126.50
+41.75.190.24
  41.76.110.74
  41.76.117.194
  41.76.157.202
@@ -69175,10 +69208,10 @@
  41.79.82.46
  41.80.233.27
  41.80.243.186
+41.82.10.54
  41.82.188.213
  41.82.83.76
  41.83.109.15
-41.84.135.22
  41.84.147.218
  41.84.193.18
  41.85.189.66
@@ -69189,7 +69222,6 @@
  41.86.18.152
  41.86.18.174
  41.86.18.20
-41.86.18.201
  41.86.18.202
  41.86.18.204
  41.86.18.207
@@ -69198,14 +69230,11 @@
  41.86.19.200
  41.86.19.205
  41.86.19.206
-41.86.21.14
  41.86.21.23
  41.86.21.27
  41.86.21.28
  41.86.21.44
  41.86.21.59
-41.86.21.60
-41.86.21.61
  41.86.21.62
  41.86.21.9
  41.86.46.245
@@ -69224,20 +69253,16 @@
  41.90.61.1
  41.92.116.168
  41.92.123.88
-41.92.26.125
  41.92.30.44
  41.92.9.6
  41.93.155.17
  41.93.32.132
  41.93.32.135
  41.93.47.69
-41.96.13.195
-41.96.187.236
-41.96.21.146
-41.96.48.32
-41.96.9.236
+41.95.43.8
+41.96.82.253
  41.97.210.41
-41.98.7.108
+41.98.28.82
  41.98.84.239
  4117570-dot-n-e-w-me-ss-age-po-rt-al.wl.r.appspot.com
  413bd12fe0.nxcli.net
@@ -69248,19 +69273,18 @@
  41d976d239e293e20374502f2b2e7b67-dot-online-validation-sevice.ey.r.appspot.com
  41fde.codesandbox.io
  41r73tlc.gmz.cc
-42.111.131.206
  42.112.16.74
  42.112.209.164
+42.112.210.32
  42.112.26.30
  42.112.30.70
  42.112.87.166
-42.112.95.125
-42.112.99.188
  42.113.120.214
-42.113.185.168
  42.114.121.237
  42.114.246.120
  42.115.10.67
+42.115.126.120
+42.115.162.228
  42.115.25.55
  42.115.33.152
  42.115.46.181
@@ -69272,6 +69296,7 @@
  42.116.18.180
  42.116.82.122
  42.117.49.20
+42.118.112.138
  42.118.135.243
  42.118.214.167
  42.118.242.189
@@ -69279,11 +69304,9 @@
  42.118.5.225
  42.119.148.75
  42.119.152.170
-42.119.18.201
  42.119.228.192
-42.119.239.21
+42.119.252.181
  42.119.252.183
-42.153.149.75
  42.157.3.138
  42.159.10.142
  42.159.142.14
@@ -69294,20 +69317,15 @@
  42.159.80.91
  42.159.86.108
  42.177.128.140
-42.177.52.245
  42.177.53.44
  42.177.53.99
-42.177.54.128
  42.177.55.47
-42.178.192.157
-42.178.192.223
+42.178.193.9
  42.178.194.139
+42.178.194.23
  42.178.205.97
-42.179.172.190
-42.179.172.58
-42.179.173.231
  42.180.206.145
-42.188.122.230
+42.191.228.135
  42.192.100.189
  42.192.116.178
  42.192.117.41
@@ -69315,12 +69333,10 @@
  42.192.123.234
  42.192.125.145
  42.192.125.230
-42.192.127.114
  42.192.127.194
  42.192.128.166
  42.192.128.191
  42.192.130.153
-42.192.130.231
  42.192.130.52
  42.192.132.127
  42.192.132.171
@@ -69338,14 +69354,11 @@
  42.192.147.125
  42.192.147.137
  42.192.147.231
-42.192.148.16
-42.192.148.163
  42.192.150.73
  42.192.151.83
  42.192.152.63
  42.192.152.72
  42.192.154.179
-42.192.155.135
  42.192.157.3
  42.192.157.41
  42.192.16.24
@@ -69373,11 +69386,11 @@
  42.192.205.184
  42.192.205.33
  42.192.21.140
+42.192.219.234
  42.192.220.171
  42.192.220.183
  42.192.221.34
  42.192.223.129
-42.192.223.137
  42.192.223.241
  42.192.226.249
  42.192.228.144
@@ -69385,7 +69398,9 @@
  42.192.23.131
  42.192.232.148
  42.192.233.228
+42.192.234.117
  42.192.234.33
+42.192.234.71
  42.192.234.75
  42.192.234.76
  42.192.235.102
@@ -69406,11 +69421,9 @@
  42.192.47.27
  42.192.50.24
  42.192.51.95
-42.192.52.209
  42.192.54.145
  42.192.55.156
  42.192.55.219
-42.192.55.241
  42.192.60.130
  42.192.7.200
  42.192.75.240
@@ -69450,39 +69463,41 @@
  42.192.95.148
  42.192.95.15
  42.192.95.184
-42.192.96.35
  42.192.97.77
  42.192.99.30
  42.193.1.170
  42.193.10.136
  42.193.10.176
+42.193.10.240
  42.193.101.204
+42.193.102.205
  42.193.102.218
  42.193.103.166
  42.193.105.158
+42.193.105.249
  42.193.106.209
  42.193.108.100
-42.193.108.181
  42.193.110.36
  42.193.111.246
  42.193.112.207
+42.193.115.68
  42.193.116.130
  42.193.116.37
  42.193.117.168
  42.193.119.119
  42.193.119.53
  42.193.124.203
-42.193.127.186
  42.193.13.122
  42.193.141.218
  42.193.148.230
+42.193.150.222
  42.193.152.59
  42.193.169.88
  42.193.172.5
+42.193.175.188
  42.193.175.249
  42.193.177.107
  42.193.177.243
-42.193.178.248
  42.193.180.85
  42.193.181.178
  42.193.181.249
@@ -69490,6 +69505,7 @@
  42.193.185.126
  42.193.187.28
  42.193.2.29
+42.193.36.153
  42.193.40.237
  42.193.48.177
  42.193.5.242
@@ -69530,6 +69546,7 @@
  42.194.184.92
  42.194.190.16
  42.194.194.237
+42.194.198.187
  42.194.203.226
  42.194.204.140
  42.194.206.209
@@ -69547,14 +69564,16 @@
  42.194.223.139
  42.194.233.141
  42.194.238.91
-42.2.59.92
+42.2.132.179
+42.2.193.28
+42.2.20.57
+42.2.218.94
+42.2.75.69
  42.200.109.74
  42.200.142.209
  42.200.149.223
  42.200.155.72
-42.200.173.99
  42.200.196.30
-42.200.198.115
  42.200.200.146
  42.200.202.87
  42.200.206.225
@@ -69565,111 +69584,113 @@
  42.200.66.164
  42.200.78.78
  42.200.80.42
-42.201.145.146
  42.201.208.178
  42.201.228.83
  42.202.96.81
  42.224.0.162
  42.224.122.152
+42.224.123.31
  42.224.13.30
-42.224.138.197
+42.224.145.194
  42.224.152.166
  42.224.174.218
  42.224.177.237
-42.224.178.130
  42.224.180.248
-42.224.212.226
-42.224.222.172
+42.224.237.225
  42.224.24.74
-42.224.255.156
+42.224.240.181
+42.224.246.118
+42.224.28.49
+42.224.44.97
  42.224.53.200
-42.224.65.105
+42.224.54.111
+42.224.60.14
+42.224.68.69
  42.224.69.218
  42.224.70.21
+42.224.77.13
  42.224.98.101
-42.225.173.207
+42.225.201.193
+42.225.205.65
  42.225.243.90
-42.225.4.124
-42.225.53.198
+42.225.33.15
+42.226.73.61
+42.227.114.217
  42.227.121.217
  42.227.126.54
-42.227.154.164
+42.227.162.207
  42.227.167.104
  42.227.172.211
  42.227.184.249
  42.227.184.46
+42.227.195.147
  42.227.22.174
+42.227.221.27
+42.227.249.234
  42.227.25.126
-42.228.123.188
+42.228.120.134
  42.228.124.84
-42.228.201.149
+42.228.126.202
+42.228.232.40
+42.228.234.28
  42.228.237.138
  42.228.247.152
+42.228.40.225
  42.228.43.26
+42.228.45.158
  42.228.45.24
  42.228.47.6
  42.228.59.226
  42.228.72.43
-42.228.73.11
-42.228.74.17
-42.228.79.141
  42.228.79.60
  42.228.80.137
-42.228.94.101
-42.229.196.95
-42.229.215.154
+42.229.154.133
  42.230.1.68
-42.230.126.43
  42.230.128.243
  42.230.142.79
-42.230.145.30
-42.230.17.93
-42.230.195.86
+42.230.184.41
+42.230.184.56
+42.230.189.91
+42.230.25.216
  42.230.27.134
-42.230.41.175
  42.230.43.23
  42.230.50.192
  42.230.62.207
-42.230.95.210
+42.230.7.65
  42.231.111.173
  42.231.161.220
-42.231.168.79
  42.231.169.126
-42.231.175.42
+42.231.216.108
  42.231.42.217
-42.231.47.109
-42.231.89.129
  42.232.100.48
  42.232.101.226
  42.232.116.200
-42.232.170.8
-42.232.228.127
-42.232.233.91
+42.232.236.250
  42.232.238.209
  42.232.239.137
-42.232.72.221
-42.232.76.211
-42.233.106.15
-42.233.125.63
+42.232.72.51
+42.233.123.1
  42.233.232.229
  42.233.232.93
  42.233.254.41
  42.233.32.16
-42.234.107.53
+42.233.95.245
+42.234.164.228
  42.234.186.167
  42.234.220.153
+42.234.236.199
  42.234.236.206
-42.235.114.54
  42.235.121.87
-42.235.123.99
+42.235.14.241
+42.235.144.41
  42.235.156.137
-42.235.158.56
+42.235.166.95
  42.235.20.211
  42.235.57.48
  42.235.88.20
-42.235.91.43
-42.235.98.239
+42.235.93.208
  42.236.160.189
+42.236.161.178
  42.236.161.183
  42.236.161.43
  42.236.212.143
@@ -69682,46 +69703,45 @@
  42.236.223.79
  42.236.255.14
  42.237.162.39
-42.237.163.221
  42.237.163.253
  42.237.164.187
  42.237.197.58
-42.237.21.186
  42.237.40.112
-42.237.51.35
-42.237.7.193
+42.238.189.226
  42.238.227.207
  42.238.231.157
  42.238.5.149
-42.238.60.24
  42.239.145.30
-42.239.160.125
+42.239.15.160
+42.239.153.174
+42.239.162.204
+42.239.165.83
  42.239.181.224
-42.239.188.214
  42.239.193.119
  42.239.194.204
+42.239.198.187
+42.239.204.198
+42.239.205.185
  42.239.239.71
  42.239.246.63
-42.239.252.198
+42.239.248.99
+42.239.249.58
+42.239.249.81
  42.239.96.222
+42.240.133.39
  42.248.77.136
  42.248.78.142
  42.248.78.144
  42.248.78.56
  42.3.139.170
-42.3.181.116
-42.48.240.245
-42.5.100.169
+42.3.166.84
  42.5.100.243
+42.5.102.175
+42.5.102.176
  42.5.103.178
  42.5.103.211
-42.5.103.64
  42.5.149.140
-42.5.149.85
-42.5.149.89
-42.5.150.240
-42.5.150.85
-42.5.151.211
+42.5.151.92
  42.5.171.48
  42.5.72.136
  42.51.173.18
@@ -69732,35 +69752,28 @@
  42.51.60.60
  42.51.66.113
  42.52.164.27
-42.52.171.195
-42.52.171.39
-42.52.180.67
  42.54.233.49
+42.55.19.69
  42.55.21.126
-42.57.121.129
  42.57.87.171
  42.58.119.2
  42.59.204.103
-42.59.38.95
-42.59.50.237
  42.59.51.210
-42.59.51.224
  42.59.51.36
-42.59.53.36
  42.61.196.24
-42.63.24.226
  42.63.69.165
  42.84.44.120
-42.84.46.61
-42.86.84.134
-42.87.224.53
-42.87.49.162
-42.87.49.173
+42.86.85.204
  42.87.76.172
-42.98.216.236
+42.98.156.82
+42.98.168.29
+42.98.179.232
+42.98.221.148
  42.98.245.118
  42.98.38.92
+42.98.47.120
  42.99.116.139
+42.99.180.135
  420365365.com
  420marijuanalist.com
  420weeds.us
@@ -69781,7 +69794,6 @@
  42ec77ecb9e159e516146845f9bb06ba.icu
  43.128.20.17
  43.128.28.120
-43.128.3.136
  43.224.10.13
  43.224.10.19
  43.224.10.23
@@ -69789,22 +69801,20 @@
  43.224.10.26
  43.224.10.30
  43.224.10.32
+43.224.10.33
  43.224.10.35
  43.224.10.36
-43.224.10.37
  43.224.10.39
  43.224.10.42
  43.224.10.44
  43.224.10.46
  43.224.10.48
-43.224.116.18
  43.224.116.242
  43.224.117.202
  43.224.118.46
  43.224.128.110
  43.224.130.146
  43.224.181.117
-43.224.183.207
  43.224.234.88
  43.224.248.159
  43.224.248.183
@@ -69812,10 +69822,8 @@
  43.224.248.78
  43.224.249.46
  43.224.249.53
-43.224.3.255
  43.224.8.116
  43.224.8.124
-43.224.8.125
  43.224.8.14
  43.225.150.154
  43.225.150.209
@@ -69832,17 +69840,18 @@
  43.225.22.87
  43.225.38.82
  43.225.55.182
-43.225.60.221
  43.225.62.107
  43.225.67.181
-43.225.67.35
+43.225.67.39
  43.226.12.241
  43.226.144.175
+43.226.144.61
  43.226.144.63
  43.226.144.80
  43.226.145.11
  43.226.147.142
  43.226.147.160
+43.226.147.226
  43.226.147.23
  43.226.147.4
  43.226.148.239
@@ -69856,8 +69865,6 @@
  43.226.32.12
  43.226.33.22
  43.226.40.176
-43.226.51.234
-43.226.51.42
  43.226.53.29
  43.226.69.100
  43.226.69.103
@@ -69866,7 +69873,6 @@
  43.227.131.167
  43.227.135.214
  43.227.253.247
-43.228.108.120
  43.228.117.242
  43.228.117.54
  43.228.126.114
@@ -69881,20 +69887,17 @@
  43.229.208.190
  43.229.227.162
  43.229.252.184
+43.229.252.45
  43.229.55.61
  43.229.62.133
  43.229.72.220
  43.229.73.195
  43.229.73.203
-43.229.73.208
  43.229.73.210
-43.229.73.215
-43.229.73.220
-43.229.73.228
+43.229.73.216
  43.229.73.229
  43.229.73.231
  43.229.73.233
-43.229.73.234
  43.229.73.235
  43.229.73.236
  43.229.73.239
@@ -69913,22 +69916,25 @@
  43.230.89.54
  43.231.129.193
  43.231.129.211
-43.231.20.250
  43.231.56.113
+43.231.56.222
  43.231.56.52
-43.231.60.226
+43.231.69.218
  43.231.76.1
  43.231.76.105
  43.231.76.113
+43.231.76.117
  43.231.76.121
  43.231.76.129
  43.231.76.145
  43.231.76.149
  43.231.76.157
+43.231.76.161
  43.231.76.169
  43.231.76.173
  43.231.76.177
  43.231.76.185
+43.231.76.189
  43.231.76.193
  43.231.76.209
  43.231.76.213
@@ -69944,14 +69950,17 @@
  43.231.76.77
  43.231.76.89
  43.231.76.97
+43.231.77.1
  43.231.77.101
  43.231.77.117
  43.231.77.17
+43.231.77.21
  43.231.77.25
  43.231.77.37
  43.231.77.45
  43.231.77.49
  43.231.77.53
+43.231.77.57
  43.231.77.65
  43.231.77.81
  43.231.77.89
@@ -69968,11 +69977,12 @@
  43.231.78.61
  43.231.78.73
  43.231.78.85
+43.231.78.89
  43.231.78.9
  43.231.79.1
  43.231.79.13
  43.231.79.33
-43.231.79.9
+43.239.152.237
  43.239.207.24
  43.239.67.110
  43.239.75.102
@@ -69986,6 +69996,7 @@
  43.240.13.4
  43.240.14.222
  43.240.226.28
+43.240.246.198
  43.240.6.97
  43.240.66.46
  43.240.74.145
@@ -70014,6 +70025,8 @@
  43.243.204.134
  43.243.207.242
  43.243.87.144
+43.245.131.197
+43.245.131.219
  43.245.184.150
  43.245.185.66
  43.245.192.126
@@ -70021,14 +70034,14 @@
  43.245.202.13
  43.245.202.15
  43.245.216.238
-43.245.86.18
+43.245.61.213
  43.245.94.226
  43.246.139.245
  43.246.139.246
  43.246.139.33
  43.247.12.110
  43.247.14.122
-43.248.18.222
+43.247.17.178
  43.248.20.111
  43.248.20.149
  43.248.24.122
@@ -70042,9 +70055,9 @@
  43.248.9.100
  43.249.113.235
  43.249.113.236
+43.249.113.243
  43.249.205.169
  43.249.228.61
-43.249.228.99
  43.249.52.100
  43.249.65.56
  43.249.83.11
@@ -70056,12 +70069,12 @@
  43.250.241.132
  43.250.80.117
  43.250.81.202
-43.250.81.254
  43.250.81.59
  43.251.104.46
  43.251.159.144
  43.251.16.143
  43.251.17.39
+43.251.171.201
  43.251.172.13
  43.251.214.14
  43.251.214.54
@@ -70077,8 +70090,6 @@
  43.252.18.140
  43.252.183.66
  43.252.194.30
-43.252.220.61
-43.252.220.93
  43.252.221.143
  43.252.221.15
  43.252.221.9
@@ -70103,9 +70114,9 @@
  43.254.43.122
  43.254.53.78
  43.254.59.210
-43.255.135.193
  43.255.140.133
  43.255.140.38
+43.255.141.191
  43.255.152.16
  43.255.217.186
  43.255.228.150
@@ -70136,7 +70147,6 @@
  43e9b590ddd1d64b8ec8252e97214649ea9c160a.info
  43essentialsfood.com
  43sd.org
-44.192.49.16
  440440688980429-dot-wetransfer-auth-file-344.appspot.com
  440grandbetting.com
  441-365.net
@@ -70160,10 +70170,9 @@
  45-156-22-109.cprapid.com
  45-76-47-204.plesk.page
  45.10.164.219
-45.10.166.109
+45.10.165.27
  45.10.172.90
  45.10.232.104
-45.10.232.105
  45.10.232.111
  45.10.232.123
  45.10.232.141
@@ -70173,16 +70182,15 @@
  45.10.232.159
  45.10.232.56
  45.10.232.57
+45.10.232.62
  45.10.232.74
  45.10.232.75
  45.10.232.80
  45.10.232.86
  45.10.232.87
-45.10.236.199
+45.10.232.98
  45.10.237.109
-45.10.238.183
  45.10.239.141
-45.10.239.50
  45.10.239.62
  45.10.24.137
  45.10.24.197
@@ -70206,7 +70214,6 @@
  45.112.56.142
  45.112.57.230
  45.113.1.94
-45.113.153.229
  45.113.238.30
  45.113.32.180
  45.113.67.66
@@ -70233,12 +70240,13 @@
  45.115.60.197
  45.115.62.131
  45.115.63.78
+45.115.89.50
  45.116.112.22
  45.116.14.20
  45.116.162.37
  45.116.2.17
+45.116.229.85
  45.116.233.32
-45.116.243.59
  45.116.3.249
  45.116.44.253
  45.116.76.177
@@ -70258,10 +70266,8 @@
  45.117.102.194
  45.117.102.201
  45.117.102.238
+45.117.168.152
  45.117.171.182
-45.117.183.124
-45.117.228.153
-45.117.228.65
  45.117.228.81
  45.117.228.85
  45.117.228.89
@@ -70290,10 +70296,10 @@
  45.118.144.77
  45.118.145.223
  45.118.151.85
-45.118.159.68
  45.118.32.90
  45.118.35.69
  45.119.126.59
+45.119.13.100
  45.119.203.170
  45.119.212.14
  45.119.212.150
@@ -70307,6 +70313,7 @@
  45.119.82.132
  45.119.82.251
  45.119.83.164
+45.119.83.60
  45.119.83.68
  45.119.84.149
  45.119.84.18
@@ -70324,12 +70331,10 @@
  45.12.212.200
  45.12.215.204
  45.12.215.243
-45.12.223.135
  45.120.119.55
  45.120.162.120
-45.120.42.66
  45.120.49.124
-45.120.49.14
+45.120.49.129
  45.120.49.150
  45.120.49.212
  45.120.49.88
@@ -70362,12 +70367,10 @@
  45.123.25.74
  45.123.25.9
  45.123.26.146
-45.123.41.66
  45.123.43.138
  45.123.8.165
  45.124.113.6
  45.124.144.116
-45.124.146.15
  45.124.169.26
  45.124.171.145
  45.124.171.146
@@ -70393,11 +70396,10 @@
  45.125.245.89
  45.125.245.91
  45.125.63.46
+45.125.65.105
  45.125.65.112
  45.125.65.118
  45.125.65.45
-45.126.11.143
-45.126.11.253
  45.126.124.242
  45.126.168.69
  45.126.168.81
@@ -70405,8 +70407,11 @@
  45.126.169.185
  45.126.169.193
  45.126.169.233
+45.126.8.19
  45.127.133.61
  45.127.205.72
+45.127.232.85
+45.127.46.96
  45.127.96.175
  45.127.97.67
  45.128.133.242
@@ -70415,13 +70420,12 @@
  45.129.166.40
  45.129.180.214
  45.129.2.45
+45.129.56.151
  45.129.56.200
  45.129.96.49
  45.13.228.136
-45.13.228.142
  45.13.228.44
  45.13.228.52
-45.13.229.59
  45.13.230.131
  45.13.230.196
  45.13.230.201
@@ -70441,17 +70445,18 @@
  45.130.255.231
  45.130.255.24
  45.130.255.241
+45.130.255.252
+45.130.255.62
  45.130.60.117
  45.130.97.187
  45.131.108.198
  45.131.172.33
-45.131.174.78
  45.131.179.20
  45.131.186.189
  45.131.47.106
  45.132.105.43
  45.132.115.233
-45.132.129.237
+45.132.184.199
  45.132.185.204
  45.132.187.62
  45.132.194.10
@@ -70462,11 +70467,9 @@
  45.132.226.151
  45.132.227.135
  45.132.242.49
-45.132.88.34
  45.133.107.130
  45.133.107.161
  45.133.119.138
-45.133.180.253
  45.133.180.94
  45.133.193.72
  45.133.203.192
@@ -70475,21 +70478,17 @@
  45.133.9.60
  45.134.145.138
  45.134.172.24
-45.134.184.210
-45.134.184.23
  45.134.187.150
-45.134.187.218
  45.134.187.25
-45.134.187.46
  45.134.187.54
  45.134.203.209
  45.134.22.2
+45.134.225.179
+45.134.26.89
+45.134.27.4
  45.135.118.144
-45.135.186.101
-45.135.187.115
  45.135.187.139
-45.135.187.3
-45.135.32.210
+45.135.187.165
  45.135.33.161
  45.135.4.143
  45.135.50.170
@@ -70506,12 +70505,15 @@
  45.138.48.24
  45.138.72.205
  45.138.97.46
+45.139.188.106
  45.139.202.103
  45.139.203.134
  45.139.236.14
  45.139.236.5
  45.14.148.105
+45.14.148.234
  45.14.148.96
+45.14.149.215
  45.14.150.19
  45.14.150.29
  45.14.151.249
@@ -70544,25 +70546,22 @@
  45.140.168.138
  45.140.169.30
  45.140.170.187
-45.140.18.216
  45.140.206.181
+45.140.53.62
  45.141.156.25
  45.141.156.27
  45.141.156.66
  45.141.156.68
  45.141.157.123
  45.141.159.63
-45.141.176.240
-45.141.176.50
-45.141.176.94
  45.141.59.178
  45.141.84.10
  45.141.84.126
  45.141.84.184
  45.141.84.57
-45.142.114.152
  45.142.120.55
  45.142.124.128
+45.142.137.194
  45.142.178.142
  45.143.200.38
  45.143.220.125
@@ -70584,13 +70583,15 @@
  45.143.223.7
  45.144.136.187
  45.144.30.41
+45.144.33.34
  45.144.65.49
  45.144.65.55
  45.144.66.221
-45.145.119.38
  45.145.125.90
  45.145.128.113
-45.145.185.0
+45.145.128.77
+45.145.129.49
+45.145.185.100
  45.145.185.111
  45.145.185.120
  45.145.185.133
@@ -70607,25 +70608,25 @@
  45.145.185.26
  45.145.185.31
  45.145.185.36
+45.145.185.56
  45.145.185.74
  45.145.185.75
  45.145.185.94
  45.145.32.226
+45.145.55.159
  45.145.56.88
  45.145.56.92
  45.146.15.24
  45.146.164.106
  45.146.164.188
  45.146.165.171
-45.146.165.183
  45.146.165.32
  45.146.167.63
  45.146.168.173
-45.146.55.152
  45.146.55.225
  45.147.192.201
  45.147.192.87
-45.147.193.121
+45.147.195.219
  45.147.198.62
  45.147.199.33
  45.147.228.245
@@ -70658,12 +70659,16 @@
  45.148.122.161
  45.148.124.169
  45.148.125.242
+45.148.126.118
  45.148.234.189
+45.148.235.87
  45.148.4.36
+45.148.4.5
  45.149.131.202
  45.149.16.120
  45.149.77.27
  45.149.78.128
+45.149.78.45
  45.149.83.208
  45.15.143.129
  45.15.143.198
@@ -70676,6 +70681,7 @@
  45.15.25.93
  45.15.250.92
  45.15.61.233
+45.15.63.23
  45.150.66.158
  45.150.66.226
  45.150.66.243
@@ -70685,7 +70691,7 @@
  45.151.167.10
  45.151.28.36
  45.152.180.20
-45.152.183.12
+45.152.181.20
  45.152.198.246
  45.152.198.253
  45.152.198.48
@@ -70698,6 +70704,7 @@
  45.152.202.138
  45.152.202.68
  45.152.202.79
+45.152.208.63
  45.153.157.117
  45.153.157.247
  45.153.157.94
@@ -70718,20 +70725,29 @@
  45.153.160.140
  45.153.160.2
  45.153.187.110
+45.153.203.11
  45.153.203.119
+45.153.203.124
  45.153.203.129
+45.153.203.134
  45.153.203.136
  45.153.203.141
-45.153.203.144
+45.153.203.149
  45.153.203.172
-45.153.203.187
  45.153.203.192
  45.153.203.214
  45.153.203.218
+45.153.203.219
  45.153.203.240
+45.153.203.32
  45.153.203.33
+45.153.203.37
+45.153.203.44
  45.153.203.52
+45.153.203.54
+45.153.203.8
  45.153.217.164
+45.153.217.185
  45.153.217.95
  45.154.1.68
  45.154.1.71
@@ -70763,7 +70779,6 @@
  45.155.157.239
  45.155.205.108
  45.155.205.249
-45.155.205.78
  45.155.205.86
  45.155.205.87
  45.156.185.186
@@ -70788,6 +70803,7 @@
  45.161.81.10
  45.161.81.8
  45.162.140.109
+45.162.146.187
  45.162.225.82
  45.162.228.53
  45.162.4.175
@@ -70800,22 +70816,21 @@
  45.163.200.2
  45.163.200.9
  45.163.203.1
+45.163.41.253
  45.164.140.130
  45.164.140.133
  45.164.140.152
-45.164.221.106
  45.164.247.136
-45.165.129.80
  45.165.152.26
+45.165.168.43
  45.165.215.19
-45.165.66.123
+45.165.5.88
  45.165.68.2
  45.165.68.5
  45.166.113.110
  45.166.186.239
  45.166.34.193
  45.166.34.196
-45.166.34.215
  45.166.34.216
  45.166.35.17
  45.166.35.22
@@ -70823,21 +70838,20 @@
  45.166.35.67
  45.166.35.71
  45.166.35.73
-45.166.35.74
-45.166.35.77
-45.166.35.78
+45.166.35.75
+45.166.35.79
  45.166.35.81
  45.166.35.84
  45.166.35.86
  45.166.35.90
  45.166.35.94
+45.167.178.73
  45.167.205.83
  45.167.205.84
  45.167.220.135
  45.167.36.35
  45.167.36.41
-45.167.36.49
-45.168.15.104
+45.167.57.78
  45.168.15.122
  45.168.15.127
  45.168.15.132
@@ -70848,11 +70862,9 @@
  45.168.15.231
  45.168.15.233
  45.168.15.234
-45.168.15.65
  45.168.15.72
  45.168.168.9
  45.168.34.225
-45.168.7.187
  45.168.74.6
  45.169.172.2
  45.169.196.17
@@ -70864,23 +70876,17 @@
  45.169.24.6
  45.169.64.208
  45.169.98.242
-45.170.100.13
-45.170.114.157
  45.170.14.19
  45.171.144.37
  45.171.144.39
-45.172.108.60
-45.172.108.63
-45.172.108.65
  45.172.108.66
+45.172.108.69
  45.172.108.70
  45.172.108.72
-45.172.108.75
  45.172.108.76
-45.172.108.79
-45.172.108.80
  45.172.108.85
  45.172.108.87
+45.172.108.88
  45.172.124.76
  45.172.133.0
  45.172.133.218
@@ -70888,12 +70894,10 @@
  45.172.212.246
  45.172.83.254
  45.173.140.128
-45.173.167.137
  45.173.18.8
  45.173.28.1
  45.173.72.9
  45.173.88.33
-45.174.240.110
  45.175.176.128
  45.175.179.182
  45.175.179.229
@@ -70902,23 +70906,21 @@
  45.175.182.169
  45.175.182.191
  45.175.32.216
-45.176.108.212
  45.176.109.240
  45.176.109.28bin.sh
  45.176.110.121
  45.176.110.199
  45.176.111.14
-45.176.111.50
+45.176.111.143
+45.176.111.57
  45.176.208.50
  45.177.109.244
-45.177.110.1
  45.177.223.2
  45.177.233.106
  45.178.141.20
  45.178.180.224
  45.179.165.161
  45.179.24.234
-45.180.211.113
  45.181.164.21
  45.181.180.6
  45.181.222.193
@@ -70926,19 +70928,16 @@
  45.181.228.211
  45.181.228.212
  45.181.228.214
-45.181.228.216
  45.181.228.218
  45.181.228.220
-45.181.228.223
  45.181.229.209
  45.181.229.23
  45.181.47.1
  45.182.145.195
-45.182.17.251
-45.182.44.127
  45.183.192.14
  45.183.193.1
  45.183.40.9
+45.183.64.157
  45.184.172.233
  45.184.180.2
  45.184.189.127
@@ -70959,7 +70958,6 @@
  45.186.209.3
  45.187.137.26
  45.187.145.246
-45.187.93.26
  45.188.82.131
  45.189.12.186
  45.189.184.40
@@ -70986,6 +70984,7 @@
  45.195.177.32
  45.199.13.17
  45.201.132.205
+45.201.134.202
  45.201.175.222
  45.201.199.221
  45.201.209.44
@@ -70993,12 +70992,12 @@
  45.221.77.82
  45.224.169.42
  45.224.170.155
-45.224.171.79
  45.224.173.254
  45.224.197.137
  45.224.22.26
  45.224.41.140
  45.224.41.22
+45.225.195.67
  45.225.226.21
  45.225.90.118
  45.225.92.93
@@ -71011,8 +71010,6 @@
  45.227.159.7
  45.227.254.241
  45.227.254.245
-45.227.97.207
-45.228.137.6
  45.228.138.18
  45.228.16.1
  45.228.4.54
@@ -71058,6 +71055,7 @@
  45.229.54.48
  45.229.54.49
  45.229.54.55
+45.229.54.7
  45.229.54.70
  45.229.54.78
  45.229.54.83
@@ -71071,7 +71069,6 @@
  45.229.55.18
  45.229.55.22
  45.229.55.24
-45.229.55.25
  45.229.55.33
  45.229.55.48
  45.229.55.50
@@ -71098,11 +71095,11 @@
  45.231.213.110
  45.231.29.109
  45.231.31.38
-45.231.61.227
  45.232.226.102
  45.232.226.137
  45.232.226.158
  45.232.226.78
+45.232.244.5
  45.232.249.62
  45.232.39.189
  45.232.64.17
@@ -71111,8 +71108,8 @@
  45.232.73.46bin.sh
  45.232.73.83
  45.232.75.253
-45.233.159.224
  45.233.169.14
+45.233.172.53
  45.233.48.18
  45.233.76.160
  45.233.78.128
@@ -71121,15 +71118,16 @@
  45.233.95.106
  45.234.148.0
  45.234.148.1
-45.234.200.18
  45.234.212.234
  45.234.248.146
+45.234.248.154
  45.234.248.66
  45.234.63.30
  45.234.67.76
  45.235.110.153
-45.235.110.67
+45.235.110.66
  45.235.120.65
+45.235.21.230
  45.235.34.16
  45.235.5.227
  45.235.6.136
@@ -71137,6 +71135,8 @@
  45.236.120.241
  45.236.129.243
  45.236.146.130
+45.236.149.24
+45.236.149.37
  45.236.15.205
  45.236.152.121
  45.236.152.99
@@ -71145,7 +71145,6 @@
  45.236.170.9
  45.236.171.76
  45.236.171.81
-45.236.175.1
  45.236.72.244
  45.236.84.126
  45.237.140.13
@@ -71155,7 +71154,6 @@
  45.237.168.185
  45.237.168.204
  45.237.168.218
-45.237.168.237
  45.237.168.246
  45.237.168.247
  45.237.168.31
@@ -71166,21 +71164,18 @@
  45.237.182.98
  45.237.200.204
  45.237.93.250
-45.238.123.223
  45.238.208.6
  45.238.23.82
  45.238.252.74
  45.238.37.177
-45.239.108.23
  45.239.84.133
-45.239.85.28
  45.240.88.16
  45.240.88.186
  45.240.88.197
  45.240.88.20
  45.240.88.35
  45.240.88.36
-45.243.111.75
+45.241.186.234
  45.247.150.190
  45.248.138.210
  45.248.139.140
@@ -71206,19 +71201,19 @@
  45.249.79.105
  45.249.79.185
  45.249.79.190
+45.25.89.251
  45.250.170.183
  45.250.225.177
  45.250.226.136
  45.250.226.56
-45.250.244.218
+45.250.239.25
  45.250.246.122
-45.250.26.78
  45.250.65.188
  45.251.136.184
  45.251.240.125
  45.251.240.197
+45.251.39.58
  45.252.189.120
-45.252.189.141
  45.252.189.144
  45.252.189.189
  45.252.189.197
@@ -71239,15 +71234,12 @@
  45.32.104.138
  45.32.104.199
  45.32.104.30
-45.32.106.217
  45.32.109.115
  45.32.111.57
-45.32.114.39
  45.32.114.82
  45.32.115.227
  45.32.115.39
  45.32.116.44
-45.32.117.102
  45.32.117.192
  45.32.119.194
  45.32.122.152
@@ -71294,7 +71286,6 @@
  45.32.229.60
  45.32.231.244
  45.32.232.25
-45.32.235.219
  45.32.238.156
  45.32.238.86
  45.32.24.34
@@ -71384,17 +71375,14 @@
  45.35.86.118
  45.36.184.6
  45.4.158.22
-45.4.187.43
  45.4.237.72
  45.4.254.82
-45.4.3.85
  45.4.5.221
  45.4.51.68
  45.4.55.10
  45.4.85.152
  45.4.85.76
  45.40.130.40
-45.40.136.39
  45.40.166.142
  45.40.166.144
  45.40.192.155
@@ -71408,7 +71396,6 @@
  45.41.180.24
  45.43.18.171
  45.43.18.215
-45.43.18.23
  45.43.27.71
  45.46.162.85
  45.48.168.16
@@ -71427,6 +71414,8 @@
  45.5.209.14
  45.5.240.4
  45.50.46.221
+45.51.45.220
+45.51.96.181
  45.55.1.145
  45.55.105.105
  45.55.11.138
@@ -71538,6 +71527,7 @@
  45.55.41.131
  45.55.41.77
  45.55.41.87
+45.55.45.112
  45.55.48.192
  45.55.48.63
  45.55.49.45
@@ -71579,7 +71569,6 @@
  45.56.126.93
  45.56.127.75
  45.56.137.70
-45.56.137.8
  45.56.150.132
  45.56.150.17
  45.56.150.73
@@ -71598,14 +71587,14 @@
  45.57.144.28
  45.57.147.59
  45.57.153.13
+45.57.153.22
  45.57.163.219
  45.57.165.199
-45.57.165.203
-45.57.165.210
  45.57.216.120
  45.57.216.65
  45.57.216.78
  45.57.218.203
+45.57.220.234
  45.57.220.236
  45.57.220.238
  45.57.220.243
@@ -71614,8 +71603,6 @@
  45.57.247.164
  45.57.252.153
  45.57.253.176
-45.57.254.61
-45.58.102.90
  45.58.126.138
  45.58.32.46
  45.58.52.17
@@ -71633,7 +71620,6 @@
  45.6.229.224
  45.6.231.106
  45.6.37.241
-45.6.56.54
  45.6.92.131
  45.61.136.14
  45.61.136.31
@@ -71652,13 +71638,10 @@
  45.61.163.6
  45.61.163.7
  45.61.165.16
-45.61.165.211
  45.61.166.33
-45.61.166.59
  45.61.166.67
  45.61.166.88
  45.61.166.95
-45.61.169.96
  45.61.51.150
  45.62.102.128
  45.62.102.27
@@ -71702,7 +71685,6 @@
  45.63.67.46
  45.63.67.77
  45.63.70.117
-45.63.70.167
  45.63.74.94
  45.63.77.5
  45.63.8.105
@@ -71710,11 +71692,11 @@
  45.63.89.95
  45.63.90.233
  45.63.96.246
+45.63.97.220
  45.64.1.215
  45.64.112.184
  45.64.112.78
  45.64.122.210
-45.64.134.198
  45.64.139.126
  45.64.160.53
  45.64.186.122
@@ -71753,7 +71735,6 @@
  45.67.212.210
  45.67.212.26
  45.67.212.55
-45.67.213.72
  45.67.228.196
  45.67.230.130
  45.67.230.58
@@ -71768,7 +71749,6 @@
  45.7.177.192
  45.7.177.195
  45.7.177.196
-45.7.177.197
  45.7.177.198
  45.7.177.200
  45.7.177.204
@@ -71804,7 +71784,6 @@
  45.7.179.201
  45.7.196.77
  45.7.198.155
-45.7.200.27
  45.7.205.103
  45.7.208.1
  45.7.224.143
@@ -71846,8 +71825,6 @@
  45.71.160.114
  45.71.195.150
  45.71.244.2
-45.71.58.130
-45.71.66.212
  45.71.80.129
  45.71.81.3
  45.72.0.140
@@ -71859,21 +71836,20 @@
  45.72.26.14
  45.72.3.143
  45.72.35.254
-45.72.51.210
  45.72.55.115
  45.72.61.148
  45.72.67.18
  45.72.67.54
  45.72.67.55
+45.72.67.76
  45.72.67.79
+45.72.67.90
  45.72.7.197
  45.72.71.180
  45.72.71.208
  45.72.71.211
  45.72.71.214
-45.72.73.23
  45.72.74.62
-45.73.150.238
  45.74.102.117
  45.74.22.154
  45.74.22.17
@@ -71975,6 +71951,7 @@
  45.76.61.23
  45.76.61.33
  45.76.61.59
+45.76.64.243
  45.76.66.113
  45.76.7.51
  45.76.74.88
@@ -71990,6 +71967,7 @@
  45.77.106.13
  45.77.106.55
  45.77.115.191
+45.77.115.251
  45.77.126.200
  45.77.127.42
  45.77.13.250
@@ -72010,7 +71988,6 @@
  45.77.172.132
  45.77.172.72
  45.77.175.135
-45.77.178.69
  45.77.18.237
  45.77.181.137
  45.77.182.189
@@ -72031,12 +72008,12 @@
  45.77.229.156
  45.77.23.209
  45.77.233.6
-45.77.237.13
  45.77.237.44
  45.77.239.36
  45.77.24.175
  45.77.24.247
  45.77.24.57
+45.77.242.108
  45.77.243.33
  45.77.248.150
  45.77.26.160
@@ -72056,6 +72033,7 @@
  45.77.52.143
  45.77.52.163
  45.77.53.135
+45.77.55.140
  45.77.55.83
  45.77.57.86
  45.77.59.208
@@ -72072,6 +72050,7 @@
  45.78.19.206
  45.78.19.3
  45.78.247.15
+45.78.38.184
  45.78.45.82
  45.78.58.136
  45.78.7.222
@@ -72097,6 +72076,7 @@
  45.79.125.42
  45.79.126.240
  45.79.133.137
+45.79.137.249
  45.79.142.52
  45.79.142.60
  45.79.143.105
@@ -72142,6 +72122,7 @@
  45.79.221.201
  45.79.222.251
  45.79.223.169
+45.79.226.106
  45.79.37.121
  45.79.37.122
  45.79.4.75
@@ -72151,6 +72132,7 @@
  45.79.70.229
  45.79.72.132
  45.79.73.97
+45.79.76.236
  45.79.77.44
  45.79.78.5
  45.79.80.173
@@ -72163,14 +72145,10 @@
  45.79.95.107
  45.79.95.154
  45.79.99.208
-45.8.134.15
-45.8.134.32
-45.8.134.39
  45.8.134.48
-45.80.104.223
+45.80.104.131
  45.80.104.235
  45.80.104.86
-45.80.105.217
  45.80.105.73
  45.80.148.33
  45.80.149.68
@@ -72178,39 +72156,32 @@
  45.80.153.178
  45.80.153.199
  45.80.182.233
-45.80.210.102
-45.80.210.184
-45.80.210.209
-45.80.210.32
-45.80.210.64
-45.80.45.75
  45.80.64.142
  45.80.64.230
  45.80.64.246
-45.80.91.96
  45.81.136.140
  45.81.136.69
+45.81.136.83
  45.81.139.48
  45.81.226.17
  45.81.226.57
  45.81.233.139
  45.81.235.31
-45.81.4.198
  45.81.4.26
-45.81.4.37
-45.81.4.4
  45.81.7.68
  45.82.120.107
  45.82.120.55
  45.82.120.76
  45.82.121.228
+45.82.122.100
  45.82.137.35
  45.82.139.34
  45.82.178.54
-45.82.198.40
+45.82.72.128
  45.82.72.92
  45.82.83.216
  45.83.220.185
+45.83.48.150
  45.83.91.134
  45.83.91.90
  45.84.196.100
@@ -72257,10 +72228,13 @@
  45.84.196.88
  45.84.196.89
  45.84.196.99
+45.84.42.80
  45.84.58.151
  45.85.0.98
  45.85.219.74
+45.85.48.58
  45.85.85.9
+45.86.15.120
  45.86.15.127
  45.86.15.132
  45.86.15.137
@@ -72310,7 +72284,6 @@
  45.89.16.45
  45.89.173.98
  45.89.175.56
-45.89.175.68
  45.89.233.98
  45.9.122.225
  45.9.122.253
@@ -72328,7 +72301,6 @@
  45.9.188.239
  45.90.109.15
  45.90.141.44
-45.90.188.142
  45.90.222.161
  45.90.222.43
  45.90.226.12
@@ -72342,8 +72314,7 @@
  45.92.33.4
  45.92.43.12
  45.93.201.193
-45.94.234.170
-45.94.234.196
+45.94.141.58
  45.94.235.137
  45.94.235.158
  45.94.235.17
@@ -72352,8 +72323,8 @@
  45.94.235.239
  45.94.235.82
  45.94.47.243
-45.95.119.120
  45.95.119.238
+45.95.119.45
  45.95.119.48
  45.95.119.49
  45.95.168.102
@@ -72461,6 +72432,7 @@
  45.95.168.97
  45.95.169.2
  45.95.169.208
+45.95.169.213
  45.95.169.227
  45.95.169.229
  45.95.169.232
@@ -72470,6 +72442,7 @@
  45.95.169.238
  45.95.169.249
  45.95.169.254
+45.95.169.255
  45.95.169.6
  45.95.169.7
  45.95.184.121
@@ -72479,12 +72452,12 @@
  45.95.31.116
  45.95.39.123
  45.95.39.220
-45.95.39.7
  45.95.39.84
  45.95.55.110
  45.95.55.58
  45.95.55.69
  45.95.64.55
+45.95.96.187
  451cb6f0c987036eae512441aed22cf6-dot-tomberera.appspot.com
  452578956.000webhostapp.com
  452901.com
@@ -72518,12 +72491,14 @@
  45tges3.icu
  45tuyr.site
  46.0.203.99
+46.0.205.248
+46.0.48.90
  46.10.180.39
  46.10.199.90
  46.10.221.163
-46.100.157.135
  46.100.249.100
  46.100.5.132
+46.100.58.5
  46.100.74.74
  46.101.0.138
  46.101.0.212
@@ -72545,11 +72520,11 @@
  46.101.117.167
  46.101.127.55
  46.101.128.55
-46.101.129.207
  46.101.13.178
  46.101.130.218
  46.101.131.239
  46.101.131.85
+46.101.132.88
  46.101.134.144
  46.101.134.178
  46.101.136.69
@@ -72562,10 +72537,13 @@
  46.101.144.252
  46.101.144.52
  46.101.145.97
+46.101.146.6
  46.101.149.23
+46.101.150.9
  46.101.151.167
  46.101.152.58
  46.101.153.160
+46.101.156.38
  46.101.156.49
  46.101.158.114
  46.101.160.59
@@ -72573,13 +72551,14 @@
  46.101.164.5
  46.101.166.176
  46.101.166.93
-46.101.167.134
  46.101.168.149
  46.101.168.186
  46.101.168.62
  46.101.169.56
  46.101.17.224
+46.101.170.63
  46.101.170.78
+46.101.171.103
  46.101.173.231
  46.101.173.66
  46.101.173.84
@@ -72635,14 +72614,13 @@
  46.101.221.87
  46.101.223.195
  46.101.224.184
-46.101.228.241
+46.101.224.54
  46.101.228.29
  46.101.23.47
  46.101.23.51
  46.101.231.229
  46.101.234.245
  46.101.236.48
-46.101.237.148
  46.101.237.216
  46.101.238.40
  46.101.239.108
@@ -72666,27 +72644,27 @@
  46.101.253.249
  46.101.254.193
  46.101.254.194
+46.101.26.108
  46.101.27.223
+46.101.28.212
  46.101.29.76
  46.101.3.206
  46.101.3.224
  46.101.30.163
-46.101.33.233
+46.101.31.59
+46.101.34.102
  46.101.36.168
  46.101.36.169
-46.101.36.205
  46.101.38.113
  46.101.38.170
  46.101.38.59
  46.101.38.84
-46.101.39.229
  46.101.4.101
  46.101.4.230
  46.101.40.21
  46.101.41.99
  46.101.42.36
  46.101.43.129
-46.101.44.22
  46.101.5.100
  46.101.50.116
  46.101.51.103
@@ -72694,10 +72672,7 @@
  46.101.53.154
  46.101.53.190
  46.101.54.195
-46.101.57.51
  46.101.58.37
-46.101.6.244
-46.101.60.127
  46.101.61.207
  46.101.61.36
  46.101.63.134
@@ -72716,17 +72691,17 @@
  46.101.83.196
  46.101.84.227
  46.101.85.82
+46.101.86.246
  46.101.87.133
  46.101.9.89
  46.101.90.205
-46.101.94.141
+46.101.95.65
  46.101.97.5
  46.101.99.74
  46.101.99.84
  46.102.130.230
  46.102.152.201
  46.102.245.174
-46.102.31.98
  46.102.97.90
  46.103.41.211
  46.105.100.149
@@ -72768,6 +72743,7 @@
  46.105.29.160
  46.105.31.249
  46.105.32.34
+46.105.45.118
  46.105.46.162
  46.105.56.193
  46.105.6.199
@@ -72786,10 +72762,10 @@
  46.107.230.156
  46.107.238.30
  46.108.136.27
-46.109.99.184
+46.109.32.138
  46.11.178.213
-46.114.0.49
  46.114.147.184
+46.114.4.47
  46.114.6.238
  46.118.112.135
  46.118.114.118
@@ -72801,6 +72777,7 @@
  46.118.157.120
  46.118.158.197
  46.118.179.214
+46.118.26.87
  46.119.112.23
  46.119.113.162
  46.119.115.106
@@ -72810,40 +72787,36 @@
  46.119.172.146
  46.119.172.173
  46.119.174.102
-46.119.177.127
  46.119.180.141
  46.119.183.132
  46.119.190.168
+46.119.76.220
  46.121.210.238
-46.121.81.221
  46.124.168.155
-46.126.139.2
  46.126.205.128
  46.126.224.37
  46.126.236.2
  46.127.117.25
  46.127.28.156
  46.128.222.158
-46.128.241.69
  46.128.41.9
  46.128.92.113
  46.13.11.82
-46.13.142.169
  46.132.185.169
+46.136.242.191
  46.137.102.36
  46.137.138.142
  46.137.197.94
-46.138.187.57
+46.138.18.241
  46.139.105.181
-46.140.93.98
  46.141.95.133
  46.142.123.65
-46.142.124.253
-46.142.7.168
+46.142.124.195
+46.142.169.222
+46.142.50.155
+46.142.50.37
  46.143.184.209
-46.146.110.119
  46.146.136.8
-46.146.16.214
  46.146.20.23
  46.146.203.124
  46.146.209.132
@@ -72852,18 +72825,19 @@
  46.146.218.79
  46.146.244.97
  46.146.248.89
+46.146.95.7
  46.147.132.50
  46.147.220.38
  46.147.222.111
  46.148.18.122
  46.148.20.25
  46.148.206.226
-46.148.79.10
  46.148.89.19
  46.149.113.2
-46.149.233.190
  46.149.86.51
+46.150.160.90
  46.150.170.10
+46.150.173.75
  46.150.23.93
  46.150.73.151
  46.150.76.25
@@ -72890,7 +72864,6 @@
  46.161.61.24
  46.161.61.30
  46.161.61.33
-46.161.62.139
  46.161.62.194
  46.161.62.198
  46.161.62.200
@@ -72935,6 +72908,7 @@
  46.161.63.153
  46.161.63.156
  46.161.63.157
+46.161.63.158
  46.161.63.16
  46.161.63.162
  46.161.63.168
@@ -72995,13 +72969,11 @@
  46.161.63.91
  46.161.63.92
  46.161.63.97
-46.161.82.250
  46.161.83.143
  46.161.9.15
  46.161.9.6
  46.161.9.8
  46.162.19.58
-46.163.140.6
  46.163.144.228
  46.163.76.40
  46.164.143.82
@@ -73034,10 +73006,10 @@
  46.166.143.104
  46.166.148.160
  46.166.148.177
-46.166.148.218
  46.166.151.116
  46.166.151.160
  46.166.160.48
+46.166.161.100
  46.166.161.130
  46.166.161.135
  46.166.161.145
@@ -73069,6 +73041,7 @@
  46.167.244.6
  46.167.78.153
  46.17.252.134
+46.17.42.156
  46.17.99.143
  46.171.110.250
  46.171.163.10
@@ -73083,7 +73056,6 @@
  46.172.69.163
  46.172.69.76
  46.172.84.203
-46.173.105.151
  46.173.191.124
  46.173.191.94
  46.173.35.229
@@ -73106,7 +73078,6 @@
  46.18.76.4
  46.180.141.150
  46.180.156.230
-46.180.38.105
  46.181.102.77
  46.181.29.197
  46.182.111.80
@@ -73120,7 +73091,7 @@
  46.182.230.59
  46.182.5.30
  46.182.5.40
-46.182.7.35
+46.183.103.8
  46.183.135.131
  46.183.135.74
  46.183.216.142
@@ -73133,6 +73104,7 @@
  46.183.219.66
  46.183.219.72
  46.183.220.117
+46.183.220.14
  46.183.221.148
  46.183.221.149
  46.183.221.156
@@ -73148,14 +73120,13 @@
  46.183.66.210
  46.185.117.92
  46.185.129.185
-46.185.50.242
+46.185.138.163
+46.185.50.196
  46.185.50.66
  46.185.51.14
  46.185.51.159
+46.185.51.173
  46.185.51.219
-46.185.51.34
-46.185.51.64
-46.187.162.116
  46.188.10.187
  46.188.109.21
  46.188.15.6
@@ -73163,7 +73134,6 @@
  46.188.26.70
  46.188.30.118
  46.188.30.248
-46.188.44.82
  46.188.48.90
  46.188.53.61
  46.188.6.118
@@ -73177,25 +73147,20 @@
  46.19.141.86
  46.19.143.133
  46.19.35.176
-46.190.37.59
+46.19.46.135
  46.190.43.220
-46.190.89.210
-46.191.168.224
  46.191.232.222
  46.193.1.25
  46.194.38.187
  46.194.44.245
+46.196.154.194
  46.20.2.220
  46.20.2.222
  46.20.203.254
  46.20.59.11
  46.20.93.83
-46.200.154.198
  46.201.5.174
-46.204.17.183
  46.204.50.191
-46.204.52.15
-46.209.230.13
  46.209.48.36
  46.209.63.177
  46.21.111.219
@@ -73203,43 +73168,36 @@
  46.21.147.142
  46.21.147.61
  46.21.153.16
-46.21.198.186
  46.21.250.205
  46.21.250.219
  46.21.250.76
-46.21.250.85
-46.21.55.3
-46.211.51.19
-46.212.127.178
+46.210.23.18
+46.212.110.127
  46.214.161.163
+46.214.27.4
  46.216.11.214
+46.216.255.225
  46.216.54.244
  46.216.59.142
-46.217.144.67
-46.217.160.187
-46.217.18.15
-46.217.53.159
  46.217.72.150
  46.217.72.6
  46.218.155.194
  46.218.7.227
  46.219.112.33
  46.219.120.59
-46.219.205.213
-46.219.226.178
  46.22.173.131
+46.22.249.148
  46.22.49.41
  46.221.19.138
  46.221.230.68
  46.221.46.81
  46.221.52.246
  46.221.61.60
-46.223.106.166
-46.223.163.220
  46.223.42.171
  46.223.85.111
  46.225.105.29
  46.225.119.60
+46.225.124.124
  46.225.240.122
  46.225.241.19
  46.225.242.179
@@ -73249,6 +73207,7 @@
  46.226.111.23
  46.226.18.135
  46.227.155.71
+46.227.158.173
  46.227.159.51
  46.227.162.98
  46.227.36.1
@@ -73283,7 +73242,6 @@
  46.227.39.1
  46.227.39.2
  46.228.93.242
-46.229.127.161
  46.229.165.141
  46.229.165.142
  46.229.168.129
@@ -73327,9 +73285,9 @@
  46.229.224.194
  46.229.238.187
  46.229.67.198
+46.23.184.111
  46.23.199.41
  46.23.42.113
-46.23.72.21
  46.23.74.181
  46.23.87.218
  46.232.132.249
@@ -73337,14 +73295,14 @@
  46.232.176.45
  46.232.249.138
  46.232.251.191
+46.233.234.65
+46.235.14.11
  46.235.53.26
  46.237.253.139
  46.238.0.102
-46.238.164.110
  46.24.148.191
  46.24.87.236
  46.240.128.82
-46.240.142.190
  46.240.151.166
  46.241.120.230
  46.241.254.167
@@ -73364,23 +73322,21 @@
  46.243.220.115
  46.243.220.120
  46.243.236.115
+46.243.237.28
  46.243.68.16
-46.243.87.224
+46.244.230.116
+46.244.233.188
+46.244.29.10
  46.245.222.203
  46.246.123.133
  46.246.123.151
-46.246.3.199
-46.246.3.200
  46.246.3.254
  46.246.40.179
-46.246.6.4
  46.246.61.185
  46.246.77.55
-46.246.84.17
  46.246.94.204
  46.249.114.178
  46.249.199.7
-46.249.33.63
  46.249.38.194
  46.249.59.113
  46.249.62.250
@@ -73416,7 +73372,6 @@
  46.29.11.254
  46.29.116.3
  46.29.116.6
-46.29.160.237
  46.29.161.214
  46.29.164.31
  46.29.166.105
@@ -73426,13 +73381,15 @@
  46.29.249.166
  46.29.249.195
  46.29.249.34
+46.29.249.64
  46.29.250.186
  46.29.252.105
  46.29.252.110
  46.29.252.62
  46.29.254.246
-46.29.255.62
+46.29.77.134
  46.29.79.57
+46.29.9.46
  46.30.189.41
  46.31.146.90
  46.32.229.152
@@ -73447,14 +73404,13 @@
  46.33.33.25
  46.33.33.72
  46.33.33.89
-46.33.59.30
  46.34.153.66
  46.35.184.187
+46.35.248.160
  46.35.249.189
  46.36.132.68
  46.36.220.44
  46.36.27.120
-46.36.29.168
  46.36.70.144
  46.37.31.195
  46.37.80.159
@@ -73504,6 +73460,7 @@
  46.4.71.70
  46.4.72.118
  46.4.78.148
+46.4.85.84
  46.4.87.105
  46.4.87.133
  46.4.88.46
@@ -73514,6 +73471,7 @@
  46.4.98.117
  46.40.127.164
  46.40.27.7
+46.40.53.94
  46.40.54.73
  46.41.103.230
  46.41.151.206
@@ -73528,7 +73486,6 @@
  46.45.146.65
  46.45.15.200
  46.45.229.159
-46.46.42.77
  46.47.255.194
  46.47.80.188bin.sh
  46.49.127.47
@@ -73546,40 +73503,39 @@
  46.53.195.177
  46.53.242.212
  46.55.25.191
-46.56.215.77
  46.59.12.86
-46.59.146.225
  46.59.243.225
+46.59.35.117
  46.59.40.91
  46.59.65.88
  46.59.68.165
  46.59.69.54
  46.59.94.142
-46.6.13.115
+46.6.15.129
  46.6.8.128
  46.6.8.135
  46.61.1.184
  46.61.12.116
  46.61.21.66
  46.61.247.131
+46.61.50.30
  46.62.144.80
  46.63.118.148
  46.63.71.13
  46.63.81.195
+46.66.171.41
  46.69.170.181
  46.7.75.126
  46.70.196.97
  46.71.185.6
  46.71.98.234
-46.72.28.239
  46.73.33.253
  46.75.47.111
  46.8.11.121
-46.8.110.52
+46.8.110.225
  46.8.111.242
  46.8.155.111
  46.8.159.147
-46.8.174.116
  46.8.179.104
  46.8.212.217
  46.8.243.235
@@ -73589,7 +73545,6 @@
  46.8.33.160
  46.8.33.166
  46.8.33.168
-46.8.33.176
  46.8.33.180
  46.8.33.182
  46.8.33.184
@@ -73613,18 +73568,14 @@
  46.83.72.164
  46.83.73.54
  46.83.77.136
-46.83.94.248
  46.85.141.162
  46.86.9.48
-46.87.215.202
-46.88.163.116
-46.88.179.19
+46.88.167.102
  46.91.120.206
  46.92.121.178
-46.92.17.217
-46.93.80.112
  46.93.86.250
  46.93.99.39
+46.97.15.181
  46.98.127.20
  46.98.247.18
  46.99.133.169
@@ -73660,55 +73611,58 @@
  46buofa46.bankofamericaslpemr.com
  46buortfa46.bankofamericaslpemr.com
  46w46.com
+47.100.1.79
  47.100.101.130
  47.100.106.114
+47.100.107.125
  47.100.120.52
+47.100.137.252
  47.100.162.210
-47.100.19.78
  47.100.192.146
  47.100.212.103
  47.100.241.66
  47.100.244.87
+47.100.32.89
  47.100.58.167
-47.101.138.183
+47.100.76.169
+47.100.85.212
  47.101.145.185
  47.101.151.15
  47.101.190.190
-47.101.207.137
  47.101.212.77
  47.101.221.222
  47.101.36.129
+47.102.122.175
  47.102.145.130
  47.102.149.147
  47.102.193.203
  47.102.216.176
-47.102.221.32
  47.103.1.49
  47.103.24.120
  47.103.28.140
-47.103.91.169
  47.104.128.186
  47.104.151.39
  47.104.156.239
+47.104.174.198
+47.104.178.158
  47.104.187.4
  47.104.189.181
-47.104.191.32
  47.104.222.64
  47.104.28.174
  47.104.68.172
  47.104.79.149
  47.104.90.58
  47.105.100.191
+47.105.127.151
  47.105.138.189
-47.105.163.206
-47.105.46.255
-47.105.57.172
+47.105.206.192
+47.105.36.69
  47.105.61.202
  47.105.64.53
+47.105.96.190
  47.106.124.179
  47.106.161.182
  47.106.192.167
-47.106.195.186
  47.106.197.184
  47.106.198.217
  47.106.221.116
@@ -73716,23 +73670,30 @@
  47.106.59.75
  47.106.82.115
  47.106.84.72
+47.107.126.179
  47.107.133.109
  47.107.134.197
  47.107.144.13
  47.107.147.168
+47.107.150.206
+47.107.164.148
  47.107.169.136
+47.107.174.142
  47.107.174.243
  47.107.175.190
-47.107.231.92
+47.107.225.127
+47.107.226.161
  47.107.244.98
+47.107.53.126
  47.107.61.8
  47.107.70.252
  47.107.85.50
-47.107.92.175
  47.108.140.54
  47.108.143.117
  47.108.150.129
+47.108.151.26
  47.108.156.129
+47.108.164.68
  47.108.165.147
  47.108.21.116
  47.108.24.191
@@ -73749,50 +73710,42 @@
  47.108.78.200
  47.108.81.144
  47.108.93.71
-47.110.47.42
-47.110.61.9
-47.110.68.112
+47.110.145.202
  47.110.92.146
  47.111.14.20
  47.111.153.111
  47.111.156.72
  47.111.188.220
-47.111.93.51
-47.112.116.126
+47.111.251.232
  47.112.122.216
  47.112.127.188
  47.112.144.63
  47.112.231.143
-47.112.33.108
  47.113.108.107
  47.113.95.224
  47.113.97.212
-47.114.140.112
+47.114.103.210
  47.114.147.234
-47.114.164.177
-47.114.59.102
  47.115.146.83
+47.115.164.134
  47.115.52.118
  47.115.53.163
-47.12.55.24
+47.12.253.76
  47.133.35.13
  47.144.81.151
  47.145.218.59
  47.146.117.214
  47.148.15.13
-47.149.0.75
  47.149.32.120
  47.149.41.240
  47.149.87.175
  47.15.179.28
-47.151.206.46
  47.152.159.183
  47.153.167.86
  47.153.183.211
  47.156.145.43
  47.156.24.46
  47.156.70.145
-47.157.128.177
  47.157.181.214
  47.157.232.199
  47.157.42.116
@@ -73808,17 +73761,15 @@
  47.180.212.134
  47.180.63.37
  47.180.96.157
-47.184.143.49
+47.184.146.164
  47.184.177.235
  47.184.198.212
  47.184.48.254
  47.185.21.126
-47.186.29.88
  47.187.24.137
  47.187.241.113
  47.187.41.132
  47.187.7.210
-47.187.86.160
  47.188.43.153
  47.189.241.52
  47.190.132.213
@@ -73829,13 +73780,14 @@
  47.198.194.179
  47.198.209.213
  47.20.185.84
+47.200.105.5
  47.201.6.134
  47.203.61.229
  47.203.92.216
  47.203.93.167
  47.206.115.7
  47.208.246.213
-47.208.3.188
+47.208.80.114
  47.21.41.254
  47.22.1.162
  47.22.48.146
@@ -73845,16 +73797,18 @@
  47.223.138.176
  47.223.167.153
  47.225.11.69
+47.225.29.154
  47.225.35.250
+47.227.69.152
  47.233.36.224
-47.233.66.26
  47.24.35.36
  47.240.230.87
  47.240.33.132
  47.240.41.43
+47.240.61.178
+47.241.0.210
  47.241.104.189
  47.241.106.223
-47.241.109.98
  47.241.116.84
  47.241.15.42
  47.241.16.172
@@ -73862,12 +73816,9 @@
  47.241.28.63
  47.241.29.204
  47.241.29.56
-47.241.34.42
-47.241.36.77
  47.241.39.178
  47.241.62.245
  47.241.63.196
-47.241.7.56
  47.241.70.0
  47.241.71.88
  47.241.76.21
@@ -73889,6 +73840,7 @@
  47.242.63.115
  47.242.67.241
  47.242.70.209
+47.242.78.34
  47.242.87.227
  47.242.9.50
  47.244.1.172
@@ -73899,6 +73851,7 @@
  47.244.151.211
  47.244.166.23
  47.244.175.167
+47.244.177.113
  47.244.184.204
  47.244.19.14
  47.244.191.212
@@ -73914,9 +73867,9 @@
  47.244.52.99
  47.244.57.253
  47.244.9.128
+47.245.130.117
  47.245.25.87
  47.245.28.126
-47.245.32.64
  47.245.34.77
  47.245.35.107
  47.245.35.30
@@ -73924,9 +73877,9 @@
  47.245.52.169
  47.245.52.209
  47.245.54.201
-47.245.56.216
+47.245.6.241
  47.247.103.161
-47.25.66.141
+47.25.183.35
  47.250.40.25
  47.251.7.70
  47.251.8.182
@@ -73946,6 +73899,7 @@
  47.254.145.104
  47.254.151.241
  47.254.170.214
+47.254.172.160
  47.254.172.215
  47.254.173.103
  47.254.173.87
@@ -73966,27 +73920,27 @@
  47.254.238.145
  47.254.238.227
  47.254.238.40
-47.254.240.95
  47.254.242.97
+47.254.243.29
  47.254.244.211
  47.254.246.155
-47.254.28.96
  47.254.29.128
-47.254.30.1
  47.254.47.87
-47.254.69.184
  47.254.73.32
  47.254.77.228
  47.254.93.177
  47.254.94.183
  47.254.95.196
  47.26.14.216
+47.27.232.96
+47.29.232.25
+47.29.91.65
+47.30.244.155
  47.32.64.201
+47.33.110.178
  47.33.161.231
  47.33.209.88
  47.36.140.164
-47.36.191.90
-47.39.10.36
  47.39.181.56
  47.39.207.183
  47.42.105.24
@@ -74002,14 +73956,15 @@
  47.52.193.158
  47.52.201.10
  47.52.204.241
-47.52.209.162
  47.52.211.53
  47.52.227.166
  47.52.231.140
  47.52.232.24
+47.52.239.42
  47.52.28.179
  47.52.38.232
  47.52.39.76
+47.52.57.16
  47.52.59.139
  47.52.61.250
  47.52.68.110
@@ -74021,28 +73976,31 @@
  47.56.192.209
  47.56.231.218
  47.56.251.168
-47.57.115.80
+47.57.101.134
+47.57.115.91
  47.57.118.147
-47.57.119.3
+47.57.121.39
  47.57.123.59
-47.57.124.168
+47.57.124.227
  47.57.124.44
-47.57.124.92
  47.57.125.209
+47.57.125.85
  47.57.125.89
-47.57.126.100
-47.57.144.76
-47.57.145.11
+47.57.126.94
+47.57.127.209
  47.57.152.25
  47.57.162.76
  47.57.235.121
  47.57.24.165
-47.57.71.136
+47.58.165.195
  47.6.125.73
  47.6.15.79
+47.6.253.254
  47.6.64.179
  47.61.20.130
-47.62.87.158
+47.63.39.238
+47.7.188.98
+47.7.233.96
  47.74.153.88
  47.74.17.225
  47.74.175.100
@@ -74056,6 +74014,7 @@
  47.74.234.121
  47.74.234.252
  47.74.240.108
+47.74.241.200
  47.74.242.64
  47.74.35.128
  47.74.35.143
@@ -74070,13 +74029,13 @@
  47.74.84.115
  47.74.84.218
  47.74.9.23
-47.75.1.243
  47.75.100.63
  47.75.107.1
  47.75.11.94
  47.75.116.211
  47.75.130.202
  47.75.14.219
+47.75.14.41
  47.75.15.2
  47.75.151.154
  47.75.154.176
@@ -74089,9 +74048,9 @@
  47.75.202.172
  47.75.204.149
  47.75.204.212
-47.75.216.136
  47.75.253.127
  47.75.37.35
+47.75.42.203
  47.75.48.133
  47.75.52.4
  47.75.55.181
@@ -74099,11 +74058,15 @@
  47.75.7.170
  47.75.90.57
  47.88.100.201
+47.88.104.193
  47.88.168.99
  47.88.220.246
+47.88.228.246
  47.88.245.100
  47.88.25.248
  47.88.28.221
+47.88.50.157
+47.88.54.50
  47.88.76.141
  47.88.79.207
  47.88.84.125
@@ -74117,7 +74080,6 @@
  47.89.191.37
  47.89.21.168
  47.89.246.51
-47.89.46.67
  47.89.49.161
  47.89.8.91
  47.90.0.38
@@ -74137,9 +74099,9 @@
  47.91.17.45
  47.91.178.158
  47.91.185.206
-47.91.19.156
  47.91.196.15
  47.91.206.207
+47.91.215.113
  47.91.228.50
  47.91.239.118
  47.91.246.186
@@ -74151,34 +74113,43 @@
  47.91.89.32
  47.91.92.101
  47.91.92.228
+47.92.109.48
  47.92.137.121
-47.92.166.137
+47.92.204.190
  47.92.204.240
  47.92.212.252
+47.92.226.6
  47.92.228.155
  47.92.245.97
  47.92.38.51
+47.92.54.132
  47.92.78.176
-47.92.84.235
  47.92.90.12
  47.92.94.125
-47.93.129.209
+47.93.112.4
+47.93.149.252
+47.93.150.93
  47.93.173.17
  47.93.198.131
+47.93.207.58
  47.93.230.171
+47.93.231.205
  47.93.247.22
  47.93.4.61
  47.93.96.145
-47.93.97.47
+47.94.1.121
  47.94.100.182
+47.94.104.165
  47.94.111.103
-47.94.19.128
+47.94.194.39
  47.94.196.118
  47.94.200.124
-47.94.214.174
+47.94.229.32
+47.94.233.182
  47.94.242.18
  47.94.243.77
  47.94.41.69
+47.94.6.172
  47.94.89.87
  47.95.12.84
  47.95.143.14
@@ -74187,31 +74158,37 @@
  47.95.211.213
  47.95.213.15
  47.95.215.4
+47.95.223.118
  47.95.223.18
  47.95.32.92
  47.95.39.204
-47.96.104.219
  47.96.111.238
  47.96.119.168
  47.96.123.190
  47.96.148.248
+47.96.148.67
+47.96.180.94
+47.96.41.44
  47.96.5.37
+47.96.80.168
  47.96.84.84
  47.97.117.129
+47.97.119.237
+47.97.154.202
  47.97.173.229
  47.97.204.57
+47.97.90.220
  47.98.114.56
-47.98.121.240
+47.98.116.160
  47.98.132.161
  47.98.138.84
  47.98.154.150
-47.98.160.174
  47.98.170.47
-47.98.191.11
  47.98.192.141
-47.98.62.173
  47.99.158.238
+47.99.172.164
  47.99.206.133
+47.99.207.56
  47.99.65.77
  470365365.com
  4715.3190cfdae.com
@@ -74273,7 +74250,6 @@
  49.115.195.47
  49.115.198.166
  49.115.203.30
-49.115.73.151
  49.115.97.206
  49.115.98.124
  49.116.182.64
@@ -74298,7 +74274,9 @@
  49.12.100.57
  49.12.11.16
  49.12.126.6
+49.12.15.53
  49.12.163.214
+49.12.2.178
  49.12.32.67
  49.12.4.194
  49.12.47.176
@@ -74311,13 +74289,11 @@
  49.12.85.232
  49.12.98.122
  49.128.181.229
-49.130.83.125
  49.135.36.233
  49.135.38.139
-49.135.38.62
-49.14.110.32
+49.142.162.113
  49.142.180.230
-49.142.74.124
+49.142.208.139
  49.142.94.79
  49.143.0.215
  49.143.32.36
@@ -74326,40 +74302,45 @@
  49.143.32.92
  49.144.7.160
  49.145.105.98
-49.145.224.91
  49.145.226.213
  49.145.237.154
  49.145.32.243
  49.145.66.194
+49.145.76.94
+49.146.45.218
  49.146.64.207
  49.147.16.4
-49.149.140.97
  49.149.45.236
-49.149.70.152
  49.150.228.59
+49.150.70.215
  49.151.49.196
+49.156.120.247
+49.156.121.62
  49.156.151.242
  49.156.152.113
  49.156.32.6
  49.156.35.22
  49.156.44.138
+49.156.45.169
  49.156.45.181
  49.156.45.227
  49.156.47.162
  49.156.47.61
  49.159.114.200
+49.159.158.23
+49.159.20.121
+49.165.8.112
  49.166.166.65
+49.166.222.154
  49.176.146.35
  49.176.168.68
  49.176.217.40
  49.187.233.217
  49.195.105.206
  49.204.77.190
-49.204.92.82
  49.205.182.134
  49.205.216.183
-49.205.243.193
-49.205.245.84
+49.205.249.66
  49.205.78.25
  49.206.121.76
  49.206.16.156
@@ -74367,11 +74348,11 @@
  49.206.228.138
  49.206.229.219
  49.206.244.236
+49.206.244.54
  49.206.3.229
+49.206.33.1
  49.206.57.123
-49.207.128.221
-49.207.134.164
-49.207.139.8
+49.207.131.59
  49.207.140.81
  49.207.177.234
  49.207.216.209
@@ -74379,17 +74360,15 @@
  49.212.151.222
  49.212.179.58
  49.212.34.94
+49.213.167.250
  49.228.123.228
-49.228.152.124
-49.228.161.233
  49.228.237.222
  49.228.243.88
-49.228.27.6
  49.228.49.53
+49.228.50.115
  49.228.61.130
  49.229.69.4
  49.231.0.178
-49.231.241.11
  49.232.100.132
  49.232.100.177
  49.232.101.33
@@ -74398,7 +74377,6 @@
  49.232.105.118
  49.232.106.184
  49.232.109.242
-49.232.109.72
  49.232.11.17
  49.232.111.165
  49.232.112.204
@@ -74439,7 +74417,6 @@
  49.232.151.215
  49.232.153.128
  49.232.157.216
-49.232.157.78
  49.232.157.80
  49.232.16.47
  49.232.160.106
@@ -74458,11 +74435,9 @@
  49.232.172.23
  49.232.174.142
  49.232.174.152
-49.232.174.23
  49.232.175.137
  49.232.18.108
  49.232.191.178
-49.232.191.230
  49.232.191.67
  49.232.192.75
  49.232.192.91
@@ -74472,6 +74447,7 @@
  49.232.197.54
  49.232.198.139
  49.232.20.208
+49.232.200.247
  49.232.201.238
  49.232.202.58
  49.232.204.241
@@ -74486,7 +74462,6 @@
  49.232.212.5
  49.232.213.20
  49.232.214.91
-49.232.215.196
  49.232.216.161
  49.232.218.129
  49.232.221.213
@@ -74498,6 +74473,7 @@
  49.232.229.126
  49.232.23.20
  49.232.234.56
+49.232.247.107
  49.232.25.135
  49.232.25.179
  49.232.250.57
@@ -74520,10 +74496,10 @@
  49.232.56.88
  49.232.58.114
  49.232.62.214
+49.232.65.138
  49.232.67.184
  49.232.67.94
  49.232.69.16
-49.232.69.23
  49.232.71.199
  49.232.72.13
  49.232.75.193
@@ -74541,6 +74517,7 @@
  49.233.105.223
  49.233.105.246
  49.233.105.63
+49.233.107.234
  49.233.11.118
  49.233.117.199
  49.233.119.93
@@ -74626,7 +74603,6 @@
  49.233.84.191
  49.233.85.167
  49.233.90.175
-49.233.91.148
  49.234.100.133
  49.234.100.169
  49.234.100.95
@@ -74639,8 +74615,10 @@
  49.234.111.57
  49.234.111.90
  49.234.114.62
+49.234.115.236
  49.234.116.74
  49.234.117.66
+49.234.119.42
  49.234.12.233
  49.234.123.171
  49.234.123.41
@@ -74663,8 +74641,11 @@
  49.234.18.158
  49.234.181.60
  49.234.182.99
+49.234.201.237
  49.234.208.233
+49.234.208.46
  49.234.209.124
+49.234.209.4
  49.234.21.219
  49.234.214.156
  49.234.214.72
@@ -74675,10 +74656,12 @@
  49.234.219.31
  49.234.220.78
  49.234.221.197
+49.234.223.241
  49.234.223.86
  49.234.224.108
  49.234.224.210
  49.234.224.88
+49.234.225.74
  49.234.227.17
  49.234.227.202
  49.234.228.195
@@ -74695,7 +74678,10 @@
  49.234.30.206
  49.234.30.242
  49.234.32.74
+49.234.33.229
+49.234.33.248
  49.234.37.144
+49.234.37.186
  49.234.37.38
  49.234.38.42
  49.234.4.252
@@ -74716,6 +74702,7 @@
  49.234.57.117
  49.234.58.191
  49.234.59.246
+49.234.60.79
  49.234.62.183
  49.234.62.38
  49.234.64.13
@@ -74727,12 +74714,10 @@
  49.234.78.216
  49.234.79.129
  49.234.80.135
-49.234.80.208
  49.234.82.156
  49.234.84.58
  49.234.89.233
  49.234.9.92
-49.234.91.78
  49.234.92.108
  49.234.94.59
  49.234.96.30
@@ -74740,13 +74725,14 @@
  49.234.98.207
  49.234.98.56
  49.234.99.246
-49.235.100.147
  49.235.101.138
  49.235.103.191
+49.235.103.232
  49.235.104.204
  49.235.107.161
  49.235.107.186
  49.235.108.122
+49.235.109.216
  49.235.11.137
  49.235.110.143
  49.235.111.221
@@ -74773,7 +74759,6 @@
  49.235.167.59
  49.235.169.74
  49.235.172.41
-49.235.173.198
  49.235.175.12
  49.235.179.234
  49.235.181.51
@@ -74788,7 +74773,6 @@
  49.235.221.66
  49.235.226.192
  49.235.227.17
-49.235.230.123
  49.235.232.69
  49.235.24.60
  49.235.240.143
@@ -74798,7 +74782,6 @@
  49.235.251.162
  49.235.251.43
  49.235.252.45
-49.235.254.16
  49.235.28.96
  49.235.29.185
  49.235.33.85
@@ -74814,7 +74797,6 @@
  49.235.65.127
  49.235.66.183
  49.235.68.79
-49.235.70.90
  49.235.70.92
  49.235.72.247
  49.235.72.35
@@ -74822,6 +74804,7 @@
  49.235.73.82
  49.235.74.192
  49.235.74.226
+49.235.74.86
  49.235.76.225
  49.235.77.193
  49.235.77.44
@@ -74842,10 +74825,7 @@
  49.236.195.183
  49.236.195.39
  49.238.142.12
-49.238.192.42
  49.243.9.118
-49.246.65.251
-49.246.68.220
  49.247.135.55
  49.247.204.78
  49.247.208.185
@@ -74853,49 +74833,44 @@
  49.247.213.18
  49.247.213.58
  49.247.215.43
-49.247.25.100
  49.248.109.74
  49.248.110.66
+49.248.219.186
  49.248.32.110
  49.249.237.226
  49.249.239.198
  49.251.18.81
  49.255.35.114
  49.255.93.10
-49.34.190.31
+49.34.144.231
  49.36.126.235
  49.36.137.28
-49.36.139.195
+49.36.141.50
  49.36.145.145
-49.36.146.44
+49.36.153.28
  49.36.243.24
  49.36.243.82
-49.36.37.14
  49.36.41.197
-49.36.41.2
  49.36.41.228
  49.36.6.64
  49.37.149.184
  49.37.149.33
  49.37.158.246
-49.37.167.93
  49.37.181.253
-49.37.190.242
-49.37.82.29
+49.4.124.89
  49.4.31.138
  49.48.112.172
-49.48.116.226
-49.48.127.233
  49.48.14.129
  49.48.141.220
  49.48.32.144
  49.48.32.16
+49.48.94.196
  49.49.238.103
+49.49.242.230
  49.49.242.64
  49.49.244.68
  49.49.247.10
  49.49.36.210
-49.5.12.152
  49.50.105.62
  49.50.107.221
  49.50.164.24
@@ -74922,6 +74897,7 @@
  49.51.90.173
  49.64.127.211
  49.64.238.238
+49.64.63.16
  49.64.71.212
  49.68.123.52
  49.68.124.248
@@ -74982,7 +74958,11 @@
  49.68.83.240
  49.7.14.184
  49.7.59.187
+49.70.106.240
  49.70.106.4
+49.70.107.141
+49.70.107.155
+49.70.107.156
  49.70.119.0
  49.70.123.252
  49.70.127.10
@@ -74996,7 +74976,6 @@
  49.70.235.234
  49.70.34.196
  49.70.34.61
-49.70.64.175
  49.70.80.76
  49.70.89.243
  49.70.95.248
@@ -75004,15 +74983,17 @@
  49.72.212.22
  49.72.240.79
  49.72.46.247
+49.73.106.191
+49.73.185.182
  49.73.229.148
  49.73.235.149
-49.73.244.78
-49.73.4.100
-49.73.4.176
+49.73.4.252
  49.73.4.32
+49.73.7.221
  49.74.54.214
  49.75.141.99
-49.75.58.39
+49.75.194.151
+49.75.59.242
  49.80.122.175
  49.81.100.163
  49.81.103.62
@@ -75055,13 +75036,12 @@
  49.82.234.243
  49.82.249.71
  49.82.252.63
-49.82.33.99
  49.83.196.177
+49.83.88.99
  49.84.113.238
  49.84.125.254
  49.84.127.92
  49.84.227.18
-49.85.162.210
  49.85.179.209
  49.85.179.51
  49.85.216.52
@@ -75075,12 +75055,13 @@
  49.88.112.112
  49.88.112.113
  49.88.112.114
+49.88.112.115
  49.88.112.116
  49.88.112.117
-49.88.112.118
  49.88.112.4
  49.88.112.60
  49.88.112.65
+49.88.112.67
  49.88.112.68
  49.88.112.69
  49.88.112.71
@@ -75089,11 +75070,10 @@
  49.88.112.75
  49.88.112.77
  49.88.149.184
-49.88.151.172
+49.88.173.246
  49.88.185.144
-49.88.226.121
+49.88.223.228
  49.88.65.238
-49.88.66.19
  49.89.103.106
  49.89.109.147
  49.89.115.124
@@ -75103,6 +75083,9 @@
  49.89.138.120
  49.89.139.161
  49.89.139.226
+49.89.156.53
+49.89.157.42
+49.89.157.98
  49.89.184.116
  49.89.187.193
  49.89.189.26
@@ -75122,6 +75105,7 @@
  49.89.64.24
  49.89.65.245
  49.89.68.212
+49.89.77.168
  49.89.77.183
  49.89.80.45
  49.89.89.54
@@ -75294,6 +75278,7 @@
  5.1.53.46
  5.10.18.42
  5.10.206.195
+5.10.45.187
  5.10.68.248
  5.10.76.30
  5.100.228.206
@@ -75303,7 +75288,6 @@
  5.101.123.24
  5.101.151.106
  5.101.174.40
-5.101.197.161
  5.101.221.238
  5.101.77.153
  5.101.98.71
@@ -75315,24 +75299,24 @@
  5.102.205.76
  5.102.58.41
  5.103.137.146
-5.103.158.202
  5.104.105.194
  5.104.105.209
  5.104.105.211
  5.104.105.223
  5.104.105.241
  5.104.105.247
+5.104.236.42
  5.106.1.251
-5.106.204.134
-5.110.102.204
-5.115.10.30
  5.12.14.1
+5.120.60.176
  5.125.143.54
  5.128.100.109
  5.128.87.126
  5.133.11.116
  5.133.11.117
+5.133.11.118
  5.133.11.119
+5.133.152.242
  5.133.24.117
  5.133.27.107
  5.133.28.19
@@ -75341,9 +75325,8 @@
  5.135.129.180
  5.135.14.247
  5.135.140.215
-5.135.154.75
+5.135.15.12
  5.135.156.68
-5.135.159.65
  5.135.16.122
  5.135.160.228
  5.135.166.43
@@ -75366,12 +75349,12 @@
  5.135.189.124
  5.135.199.2
  5.135.199.29
-5.135.20.176
  5.135.23.3
  5.135.232.8
  5.135.237.216
-5.135.238.238
+5.135.238.219
  5.135.239.80
+5.135.244.250
  5.135.34.152
  5.135.58.124
  5.135.72.184
@@ -75380,10 +75363,11 @@
  5.137.191.107
  5.137.207.227
  5.137.220.207
+5.138.138.31
  5.138.154.12
  5.138.40.224
-5.139.67.212
  5.14.14.58
+5.140.165.94
  5.140.212.175
  5.140.68.171
  5.140.71.44
@@ -75392,7 +75376,7 @@
  5.141.244.97
  5.141.81.106
  5.141.86.233
-5.142.114.39
+5.144.126.142
  5.144.130.12
  5.144.176.130
  5.144.176.194
@@ -75412,11 +75396,11 @@
  5.15.229.176
  5.15.8.16
  5.150.209.181
+5.150.213.40
  5.150.230.8
  5.150.239.205
  5.150.240.82
  5.150.248.150
-5.150.249.254
  5.150.65.228
  5.152.0.210
  5.152.158.4
@@ -75432,18 +75416,16 @@
  5.153.233.19
  5.153.233.42
  5.153.234.154
-5.153.237.130
  5.153.238.103
  5.153.54.179
-5.155.217.127
+5.154.174.47
  5.157.0.125
  5.157.0.133
-5.157.14.217
  5.157.14.242
+5.157.17.29
  5.157.17.30
  5.157.17.62
  5.157.19.2
-5.157.19.42
  5.157.19.85
  5.157.24.116
  5.157.24.118
@@ -75452,13 +75434,12 @@
  5.157.24.235
  5.157.24.239
  5.157.24.24
-5.157.27.201
-5.157.27.242
-5.157.27.97
-5.157.28.248
+5.157.27.125
+5.157.29.165
  5.157.29.47
  5.157.32.159
  5.157.32.162
+5.157.32.230
  5.157.32.26
  5.157.32.30
  5.157.32.39
@@ -75466,16 +75447,13 @@
  5.157.33.209
  5.157.38.42
  5.157.5.18
+5.157.52.78
  5.157.55.112
-5.157.55.12
  5.157.55.131
  5.157.55.134
-5.157.55.156
-5.157.55.163
  5.157.55.196
-5.157.55.200
-5.157.55.216
  5.157.55.5
+5.157.56.141
  5.157.56.216
  5.157.56.244
  5.157.59.205
@@ -75483,7 +75461,6 @@
  5.157.60.132
  5.157.62.220
  5.157.7.35
-5.157.8.102
  5.157.8.177
  5.157.8.33
  5.157.8.57
@@ -75506,22 +75483,19 @@
  5.164.192.176
  5.164.193.239
  5.164.194.137
+5.164.194.141
  5.164.197.115
+5.164.197.137
  5.164.200.148
  5.164.211.84
  5.164.218.230
  5.164.235.84
  5.164.250.121
-5.164.6.236
  5.165.2.223
  5.165.254.146
  5.165.66.212
  5.165.73.230
  5.165.74.114
-5.166.169.200
-5.166.200.71
-5.166.206.50
-5.166.207.121
  5.166.233.3
  5.166.47.194
  5.166.56.250
@@ -75530,6 +75504,7 @@
  5.167.114.138
  5.167.34.60
  5.167.50.213
+5.167.51.141
  5.167.64.0
  5.167.64.1
  5.167.64.10
@@ -77581,16 +77556,13 @@
  5.17.128.214
  5.17.89.13
  5.170.5.220
-5.171.235.131
-5.172.255.110
-5.172.255.113
-5.172.255.142
-5.172.255.38
-5.172.255.51
-5.172.255.71
+5.172.239.179
+5.173.129.172
+5.173.245.98
  5.173.56.17
  5.173.80.35
  5.175.225.107
+5.175.40.62
  5.177.238.80
  5.178.135.226
  5.178.193.43
@@ -77599,16 +77571,20 @@
  5.178.68.221
  5.18.242.204
  5.18.246.203
-5.180.220.101
+5.180.107.194
+5.180.211.73
+5.180.220.124
  5.180.220.190
-5.180.221.53
-5.180.243.189
+5.180.220.238
+5.180.220.35
+5.180.220.46
+5.180.221.47
+5.180.221.60
  5.180.244.21
  5.180.244.213
  5.180.244.25
  5.180.245.234
  5.180.246.181
-5.180.62.127
  5.181.158.236
  5.181.4.201
  5.181.4.247
@@ -77625,20 +77601,21 @@
  5.182.211.238
  5.182.26.126
  5.182.26.129
-5.182.32.161
  5.183.130.29
  5.183.14.139
  5.183.212.79
  5.183.255.19
+5.183.29.164
  5.183.92.103
-5.183.92.115
  5.183.92.122
  5.183.92.127
  5.183.92.133
  5.183.92.139
  5.183.92.158
+5.183.92.181
  5.183.92.199
  5.183.92.20
+5.183.92.205
  5.183.92.25
  5.183.92.31
  5.183.92.32
@@ -77658,7 +77635,6 @@
  5.183.94.22
  5.183.94.51
  5.183.94.62
-5.183.94.70
  5.185.27.13
  5.185.66.236
  5.186.60.13
@@ -77676,13 +77652,11 @@
  5.188.206.0
  5.188.206.2
  5.188.206.205
-5.188.206.3
  5.188.206.4
-5.188.206.5
+5.188.206.6
  5.188.210.10
  5.188.210.16
  5.188.210.18
-5.188.210.242
  5.188.210.31
  5.188.210.41
  5.188.210.47
@@ -77718,15 +77692,14 @@
  5.188.62.214
  5.188.62.24
  5.188.62.76
-5.188.84.147
  5.188.84.15
  5.188.84.183
  5.188.84.186
  5.188.84.219
+5.188.84.220
  5.188.84.230
  5.188.84.24
  5.188.84.250
-5.188.84.65
  5.188.84.9
  5.188.9.76
  5.189.118.25
@@ -77746,21 +77719,18 @@
  5.189.150.245
  5.189.153.172
  5.189.154.139
-5.189.157.183
  5.189.159.167
  5.189.161.160
  5.189.162.177
  5.189.163.73
  5.189.166.193
  5.189.168.53
-5.189.171.135
  5.189.171.179
  5.189.173.197
  5.189.176.196
  5.189.178.42
  5.189.181.56
  5.189.181.66
-5.189.183.72
  5.189.184.249
  5.189.186.191
  5.189.187.219
@@ -77771,16 +77741,18 @@
  5.189.201.64
  5.189.239.157
  5.189.239.249
+5.189.62.96
  5.19.140.86
  5.19.144.26
  5.19.164.33
+5.190.141.131
+5.190.217.229
  5.190.235.209
  5.190.81.133
  5.192.37.120
  5.194.151.150
  5.195.10.162
  5.195.10.174
-5.195.248.112
  5.196.1.148
  5.196.102.86
  5.196.148.255
@@ -77799,7 +77771,6 @@
  5.196.29.108
  5.196.29.8
  5.196.35.138
-5.196.4.47
  5.196.59.57
  5.196.63.119
  5.196.64.61
@@ -77820,7 +77791,10 @@
  5.196.81.99
  5.196.88.214
  5.196.90.58
+5.196.92.240
+5.196.94.68
  5.196.95.80
+5.197.233.171
  5.199.130.127
  5.199.130.188
  5.199.130.65
@@ -77838,6 +77812,8 @@
  5.2.67.21
  5.2.69.13
  5.2.69.14
+5.2.69.15
+5.2.69.21
  5.2.69.5
  5.2.69.6
  5.2.69.7
@@ -77863,36 +77839,33 @@
  5.200.57.60
  5.200.85.197
  5.202.112.26
-5.202.149.3
-5.202.45.117
+5.202.45.105
  5.202.45.135
  5.202.45.152
+5.202.45.164
  5.202.45.166
-5.202.45.189
+5.202.45.178
  5.202.45.217
  5.202.45.22
-5.202.45.31
-5.202.45.55
+5.202.45.242
  5.202.46.1
  5.202.46.101
  5.202.46.109
  5.202.46.113
-5.202.46.13
-5.202.46.144
  5.202.46.154
  5.202.46.157
  5.202.46.166
+5.202.46.172
  5.202.46.174
  5.202.46.177
  5.202.46.179
  5.202.46.196
  5.202.46.212
  5.202.46.220
-5.202.46.232
-5.202.46.24
  5.202.46.250
-5.202.46.253
  5.202.46.36
+5.202.46.40
+5.202.46.44
  5.202.46.53
  5.202.46.79
  5.202.46.82
@@ -77904,17 +77877,15 @@
  5.202.47.133
  5.202.47.14
  5.202.47.148
-5.202.47.16
  5.202.47.162
  5.202.47.164
  5.202.47.169
-5.202.47.170
  5.202.47.19
  5.202.47.195
  5.202.47.206
  5.202.47.217
-5.202.47.218
  5.202.47.229
+5.202.47.250
  5.202.47.32
  5.202.47.35
  5.202.47.37
@@ -77926,6 +77897,7 @@
  5.202.47.68
  5.202.47.73
  5.202.47.91
+5.206.2.138
  5.206.224.138
  5.206.224.171
  5.206.224.216
@@ -77948,21 +77920,20 @@
  5.206.88.106
  5.22.154.50
  5.225.220.76
+5.225.79.202
  5.226.138.3
-5.226.142.169
  5.226.70.68
  5.228.232.101
  5.228.57.189
  5.23.102.194
  5.23.103.98
  5.23.51.101
+5.23.52.97
  5.230.22.248
-5.230.67.154
-5.230.67.155
-5.231.88.18
  5.232.180.221
-5.239.148.34
-5.248.164.210
+5.234.165.88
+5.239.77.32
+5.248.109.86
  5.248.19.91
  5.248.225.172
  5.248.241.239
@@ -77970,8 +77941,8 @@
  5.249.147.91
  5.249.148.162
  5.249.226.168
+5.25.147.190
  5.25.158.102
-5.250.158.246
  5.251.49.142
  5.252.192.168
  5.252.192.170
@@ -77980,18 +77951,20 @@
  5.252.194.137
  5.252.194.29
  5.252.69.21
-5.252.94.233
  5.253.18.191
  5.253.204.11
  5.253.204.116
  5.253.204.131
  5.253.204.14
+5.253.204.19
  5.253.204.21
+5.253.204.24
  5.253.204.25
  5.253.204.28
  5.253.204.29
  5.253.204.39
  5.253.204.4
+5.253.204.5
  5.253.204.6
  5.253.204.7
  5.253.204.8
@@ -78002,7 +77975,6 @@
  5.253.24.93
  5.253.25.217
  5.253.25.44
-5.253.25.53
  5.253.86.13
  5.253.86.183
  5.254.101.226
@@ -78027,9 +77999,9 @@
  5.255.81.155
  5.255.86.110
  5.255.91.73
-5.26.165.231
  5.26.165.7
  5.26.71.207
+5.29.205.230
  5.3.129.219
  5.3.129.243
  5.3.147.137
@@ -78037,17 +78009,18 @@
  5.3.217.140
  5.3.218.15
  5.3.219.159
+5.3.219.16
  5.3.219.205
  5.3.222.77
  5.3.223.202
  5.3.233.248
  5.3.234.223
  5.3.6.82
+5.32.118.42
  5.32.134.226
  5.34.158.102
  5.34.178.126
  5.34.180.177
-5.34.180.192
  5.34.181.13
  5.34.181.17
  5.34.183.136
@@ -78070,6 +78043,7 @@
  5.39.24.170
  5.39.24.175
  5.39.31.209
+5.39.5.14
  5.39.5.5
  5.39.64.29
  5.39.64.46
@@ -78081,29 +78055,26 @@
  5.39.77.167
  5.39.78.212
  5.39.83.33
-5.39.84.56
  5.39.85.81
  5.39.86.52
  5.39.87.36
  5.39.88.60
  5.39.90.110
+5.39.90.80
  5.39.91.110
  5.39.91.73
  5.39.94.46
  5.39.95.38
  5.39.97.155
-5.40.64.180
-5.41.75.122
-5.42.130.216
  5.42.246.46
  5.44.169.215
+5.44.194.132
+5.44.196.72
  5.44.25.146
-5.44.40.223
  5.45.104.77
  5.45.110.20
  5.45.124.42
  5.45.179.174
-5.45.207.101
  5.45.38.178
  5.45.74.24
  5.45.84.166
@@ -78112,7 +78083,6 @@
  5.50.31.171
  5.53.118.82
  5.53.142.228
-5.53.242.4
  5.55.221.137
  5.55.253.99
  5.56.132.177
@@ -78134,15 +78104,17 @@
  5.58.8.4
  5.58.9.231
  5.58.95.179
+5.58.98.253
  5.59.136.226
  5.59.141.152
  5.59.143.43
  5.59.145.129
  5.59.35.26
  5.61.50.213
+5.61.59.5
  5.62.1.79
-5.62.19.44
  5.62.19.68
+5.62.20.16
  5.62.37.16
  5.62.39.232
  5.62.39.37
@@ -78150,9 +78122,7 @@
  5.62.43.60
  5.62.43.61
  5.62.57.37
-5.62.58.215
  5.62.59.17
-5.62.60.154
  5.62.60.157
  5.62.60.158
  5.62.60.159
@@ -78174,6 +78144,7 @@
  5.71.186.2
  5.71.188.204
  5.76.148.235
+5.76.50.110
  5.77.35.249
  5.79.105.33
  5.79.109.46
@@ -78228,8 +78199,8 @@
  5.8.47.251
  5.8.51.104
  5.8.88.75
+5.80.97.36
  5.81.125.138
-5.82.144.92
  5.83.104.130
  5.83.104.133
  5.83.104.136
@@ -78259,22 +78230,21 @@
  5.83.104.250
  5.83.104.253
  5.83.160.128
-5.83.160.93
  5.83.161.153
  5.83.161.68
  5.83.162.160
-5.83.162.22
  5.83.163.164
  5.83.45.138
  5.88.114.66
  5.88.135.45
-5.88.179.37
+5.88.168.152
  5.9.104.23
  5.9.105.49
  5.9.105.53
  5.9.106.213
  5.9.107.14
  5.9.11.198
+5.9.110.227
  5.9.110.254
  5.9.110.50
  5.9.111.70
@@ -78322,7 +78292,6 @@
  5.9.23.6
  5.9.233.203
  5.9.239.131
-5.9.242.178
  5.9.244.157
  5.9.247.73
  5.9.28.190
@@ -78370,26 +78339,35 @@
  5.9.9.26
  5.9.93.204
  5.9.94.237
+5.9.97.200
  5.9.98.178
  5.9.99.120
-5.90.211.50
+5.90.1.104
+5.90.11.134
+5.90.216.36
  5.90.219.39
-5.91.0.30
+5.90.4.18
+5.90.81.37
  5.91.13.61
+5.91.19.237
+5.91.5.4
  5.95.182.160
  5.aba.vg
  5.top4top.io
  5.zxczj.top
  50-87-224-50.unifiedlayer.com
  50.0.51.253
+50.101.142.52
  50.101.225.138
  50.107.49.234
  50.112.39.196
  50.112.66.163
+50.115.168.140
  50.115.171.79
  50.115.172.155
  50.115.173.126
  50.115.173.131
+50.115.174.102
  50.115.174.103
  50.115.174.105
  50.115.174.106
@@ -78400,6 +78378,7 @@
  50.116.111.59
  50.116.16.87
  50.116.18.107
+50.116.18.161
  50.116.18.198
  50.116.26.72
  50.116.3.218
@@ -78462,6 +78441,7 @@
  50.190.114.109
  50.190.114.154
  50.190.116.150
+50.192.170.190
  50.192.195.69
  50.192.203.171
  50.192.49.195
@@ -78469,6 +78449,7 @@
  50.193.143.41
  50.193.143.42
  50.193.202.81
+50.195.128.188
  50.195.197.105
  50.195.7.180
  50.196.105.87
@@ -78495,6 +78476,7 @@
  50.21.189.146
  50.210.227.201
  50.211.156.251
+50.212.167.214
  50.212.170.27
  50.22.0.250
  50.22.163.2
@@ -78507,14 +78489,12 @@
  50.23.69.44
  50.23.76.241
  50.230.160.35
-50.233.228.147
  50.233.42.98
  50.235.28.146
  50.235.92.14
  50.235.92.65
  50.236.148.246
  50.236.148.254
-50.236.218.78
  50.236.77.190
  50.237.206.138
  50.237.206.174
@@ -78545,9 +78525,11 @@
  50.248.238.238
  50.248.41.235
  50.248.97.141
+50.250.250.74
  50.250.34.229
  50.250.56.129
  50.250.75.153
+50.251.216.225
  50.251.216.228
  50.251.228.93
  50.251.29.57
@@ -78559,12 +78541,10 @@
  50.255.183.165
  50.255.64.233
  50.26.216.137
-50.27.9.17
  50.28.1.43
  50.28.105.15
  50.28.18.205
  50.28.33.173
-50.28.40.153
  50.28.51.143
  50.28.59.10
  50.28.84.148
@@ -78579,20 +78559,19 @@
  50.3.177.106
  50.3.177.72
  50.3.177.76
-50.3.192.171
  50.3.192.67
+50.3.197.138
  50.3.74.72
  50.3.79.135
  50.3.79.25
  50.3.83.161
-50.3.84.110
+50.3.84.240
  50.3.88.194
  50.3.89.128
  50.3.89.14
  50.3.89.94
  50.3.89.98
  50.30.37.150
-50.30.42.50
  50.30.93.94
  50.31.10.228
  50.31.146.37
@@ -78612,6 +78591,7 @@
  50.38.32.215
  50.39.132.235
  50.39.215.118
+50.4.44.10
  50.4.46.52
  50.45.232.189
  50.5.46.195
@@ -78650,7 +78630,6 @@
  50.62.208.86
  50.62.22.112
  50.62.30.145
-50.62.30.223
  50.62.30.5
  50.62.35.16
  50.63.12.201
@@ -78674,20 +78653,16 @@
  50.72.107.51
  50.72.45.183
  50.73.92.26
-50.74.133.181
  50.74.77.54
  50.75.168.170
-50.75.244.58
  50.75.7.82
  50.77.133.114
  50.77.8.169
  50.80.224.218
  50.80.235.239
  50.82.157.158
-50.82.86.98
  50.84.12.108
  50.84.210.194
-50.84.96.146
  50.87.144.115
  50.87.144.158
  50.87.144.23
@@ -78701,7 +78676,7 @@
  50.89.49.131
  50.90.3.116
  50.91.114.38
-50.92.107.95
+50.92.84.153
  50.97.138.113
  50.97.149.160
  50.98.187.238
@@ -78752,6 +78727,7 @@
  51.11.245.169
  51.116.180.169
  51.116.180.53
+51.124.24.40
  51.13.65.199
  51.132.52.203
  51.136.17.77
@@ -78761,14 +78737,11 @@
  51.140.185.84
  51.140.48.231
  51.140.67.211
-51.140.98.44
  51.141.161.253
  51.141.167.27
  51.141.79.141
  51.141.97.253
  51.144.106.161
-51.144.41.54
-51.144.72.113
  51.144.73.114
  51.148.153.60
  51.148.160.195
@@ -78776,12 +78749,10 @@
  51.15.10.18
  51.15.106.26
  51.15.11.24
-51.15.111.33
  51.15.113.84
  51.15.114.74
  51.15.118.15
  51.15.124.1
-51.15.125.252
  51.15.133.6
  51.15.135.121
  51.15.136.191
@@ -78835,14 +78806,12 @@
  51.15.224.0
  51.15.225.216
  51.15.229.144
-51.15.229.7
  51.15.23.154
  51.15.232.87
  51.15.233.253
  51.15.233.75
  51.15.234.207
  51.15.235.211
-51.15.240.1
  51.15.248.110
  51.15.254.2
  51.15.34.228
@@ -78870,7 +78839,6 @@
  51.15.58.219
  51.15.59.15
  51.15.59.9
-51.15.60.77
  51.15.61.6
  51.15.63.229
  51.15.63.43
@@ -78883,10 +78851,8 @@
  51.15.71.147
  51.15.71.53
  51.15.74.233
-51.15.74.63
  51.15.76.119
  51.15.76.81
-51.15.78.74
  51.15.79.107
  51.15.79.163
  51.15.80.14
@@ -78899,6 +78865,7 @@
  51.15.95.161
  51.15.99.182
  51.15.99.240
+51.154.126.177
  51.154.131.18
  51.154.136.60
  51.154.14.19
@@ -78931,18 +78898,15 @@
  51.158.172.165
  51.158.175.21
  51.158.180.179
-51.158.182.236
  51.158.184.190
  51.158.185.32
  51.158.186.242
-51.158.189.0
  51.158.190.194
  51.158.23.2
  51.158.28.129
  51.158.29.101
  51.158.64.175
  51.158.65.150
-51.158.66.199
  51.158.66.95
  51.158.67.190
  51.158.68.110
@@ -78951,15 +78915,12 @@
  51.158.68.68
  51.158.70.82
  51.158.71.240
-51.158.75.119
  51.158.76.106
  51.158.97.165
  51.158.98.121
  51.158.99.51
-51.159.139.77
  51.159.177.52
  51.159.19.12
-51.159.2.240
  51.159.24.172
  51.159.29.5
  51.159.30.99
@@ -78971,8 +78932,8 @@
  51.159.56.204
  51.159.56.35
  51.159.57.218
-51.159.58.154
-51.159.58.156
+51.159.58.158
+51.159.67.148
  51.159.67.165
  51.159.67.187
  51.159.70.147
@@ -78982,11 +78943,14 @@
  51.159.94.210
  51.161.10.20
  51.161.104.180
+51.161.105.193
  51.161.115.135
  51.161.116.175
  51.161.31.128
  51.161.31.150
  51.161.32.211
+51.161.33.227
+51.161.34.111
  51.161.36.145
  51.161.43.235
  51.161.52.46
@@ -78999,23 +78963,25 @@
  51.161.82.98
  51.161.84.86
  51.161.9.155
+51.171.216.249
+51.171.246.148
  51.174.206.76
  51.174.28.217
  51.174.45.216
  51.174.76.107
  51.175.152.204
  51.178.137.106
-51.178.138.1
  51.178.139.115
  51.178.139.41
  51.178.142.175
  51.178.143.70
-51.178.152.200
  51.178.161.32
  51.178.17.63
  51.178.182.104
+51.178.182.70
  51.178.184.225
  51.178.200.219
+51.178.201.137
  51.178.218.163
  51.178.225.200
  51.178.24.61
@@ -79035,6 +79001,7 @@
  51.178.47.46
  51.178.49.77
  51.178.50.174
+51.178.51.190
  51.178.52.245
  51.178.53.233
  51.178.60.145
@@ -79043,13 +79010,10 @@
  51.178.80.229
  51.178.81.75
  51.178.83.144
-51.178.83.28
  51.178.85.114
  51.178.86.137
-51.178.86.220
  51.178.86.97
  51.178.87.42
-51.195.10.28
  51.195.101.173
  51.195.103.249
  51.195.103.56
@@ -79066,28 +79030,46 @@
  51.195.137.109
  51.195.139.169
  51.195.139.30
+51.195.146.169
  51.195.148.139
-51.195.148.74
  51.195.150.222
  51.195.166.160
  51.195.166.162
  51.195.166.164
  51.195.188.98
  51.195.195.169
+51.195.195.170
+51.195.195.171
  51.195.200.181
  51.195.200.211
  51.195.202.145
  51.195.202.57
  51.195.203.247
  51.195.203.41
+51.195.205.224
  51.195.205.225
+51.195.205.226
+51.195.205.230
+51.195.205.231
+51.195.205.232
+51.195.205.235
+51.195.205.239
+51.195.206.192
+51.195.206.194
+51.195.206.195
+51.195.207.173
+51.195.207.175
+51.195.213.224
  51.195.213.225
+51.195.213.227
+51.195.219.254
  51.195.32.4
  51.195.4.41
  51.195.42.226
  51.195.42.58
  51.195.43.245
  51.195.44.11
+51.195.47.79
  51.195.53.140
  51.195.6.99
  51.195.91.241
@@ -79108,6 +79090,7 @@
  51.210.14.124
  51.210.14.162
  51.210.148.31
+51.210.149.64
  51.210.15.107
  51.210.151.134
  51.210.159.130
@@ -79175,20 +79158,19 @@
  51.210.47.1
  51.210.5.171
  51.210.61.169
-51.210.7.166
  51.210.80.127
  51.210.83.190
  51.210.9.70
  51.210.96.169
  51.210.97.105
  51.210.98.10
+51.211.103.147
  51.211.6.22
  51.211.79.252
  51.222.0.40
  51.222.111.6
  51.222.121.169
  51.222.131.216
-51.222.134.53
  51.222.136.216
  51.222.136.229
  51.222.137.51
@@ -79196,7 +79178,8 @@
  51.222.14.28
  51.222.14.78
  51.222.15.164
-51.222.150.79
+51.222.150.64
+51.222.169.30
  51.222.19.123
  51.222.24.132
  51.222.24.155
@@ -79206,12 +79189,13 @@
  51.222.26.189
  51.222.29.216
  51.222.29.39
-51.222.31.106
  51.222.31.74
  51.222.37.67
  51.222.39.226
+51.222.39.237
  51.222.40.156
  51.222.56.152
+51.222.9.32
  51.223.71.13
  51.254.100.220
  51.254.100.56
@@ -79271,7 +79255,6 @@
  51.254.47.231
  51.254.48.93
  51.254.63.223
-51.254.78.246
  51.254.83.239
  51.254.83.80
  51.254.97.192
@@ -79304,7 +79287,6 @@
  51.255.205.172
  51.255.207.29
  51.255.207.3
-51.255.28.53
  51.255.35.41
  51.255.36.85
  51.255.36.88
@@ -79322,18 +79304,19 @@
  51.255.69.109
  51.255.75.16
  51.255.76.71
+51.255.80.230
  51.255.85.180
  51.255.85.26
  51.255.87.121
+51.255.91.64
  51.255.95.82
-51.37.116.111
+51.37.68.108
  51.38.101.119
  51.38.103.163
  51.38.124.206
  51.38.128.30
  51.38.129.120
  51.38.129.49
-51.38.134.114
  51.38.134.203
  51.38.135.250
  51.38.144.116
@@ -79397,9 +79380,9 @@
  51.38.89.97
  51.38.93.189
  51.38.93.190
-51.38.99.136
  51.39.189.65
  51.5.147.178
+51.52.208.150
  51.6.146.148
  51.6.164.145
  51.68.11.211
@@ -79409,7 +79392,6 @@
  51.68.123.192
  51.68.136.26
  51.68.137.63
-51.68.140.234
  51.68.141.141
  51.68.141.240
  51.68.143.201
@@ -79436,7 +79418,7 @@
  51.68.215.178
  51.68.215.249
  51.68.219.117
-51.68.224.53
+51.68.222.90
  51.68.226.153
  51.68.226.27
  51.68.226.87
@@ -79449,7 +79431,6 @@
  51.68.36.57
  51.68.44.13
  51.68.44.154
-51.68.46.222
  51.68.47.146
  51.68.47.66
  51.68.5.187
@@ -79462,7 +79443,6 @@
  51.68.83.78
  51.68.85.93
  51.68.86.247
-51.68.88.100
  51.68.88.26
  51.68.89.100
  51.68.90.171
@@ -79489,6 +79469,7 @@
  51.75.147.40
  51.75.147.43
  51.75.147.44
+51.75.147.82
  51.75.149.207
  51.75.153.238
  51.75.16.138
@@ -79507,19 +79488,18 @@
  51.75.205.10
  51.75.209.226
  51.75.210.192
+51.75.222.161
  51.75.23.183
  51.75.23.214
  51.75.24.200
  51.75.240.227
  51.75.242.135
-51.75.246.176
  51.75.247.232
  51.75.255.250
  51.75.28.25
  51.75.33.122
  51.75.33.127
  51.75.36.90
-51.75.39.125
  51.75.5.52
  51.75.52.118
  51.75.53.141
@@ -79533,7 +79513,6 @@
  51.75.70.109
  51.75.70.205
  51.75.71.111
-51.75.72.185
  51.75.73.100
  51.75.73.185
  51.75.74.179
@@ -79554,8 +79533,10 @@
  51.77.108.33
  51.77.109.98
  51.77.11.93
+51.77.11.94
  51.77.112.168
  51.77.117.99
+51.77.121.98
  51.77.121.99
  51.77.135.89
  51.77.140.110
@@ -79586,6 +79567,7 @@
  51.77.201.87
  51.77.202.125
  51.77.202.151
+51.77.213.160
  51.77.213.174
  51.77.214.118
  51.77.215.0
@@ -79599,9 +79581,11 @@
  51.77.230.131
  51.77.230.49
  51.77.231.236
+51.77.239.25
  51.77.242.176
  51.77.244.29
  51.77.245.98
+51.77.247.43
  51.77.249.201
  51.77.39.255
  51.77.52.201
@@ -79616,27 +79600,28 @@
  51.77.94.244
  51.77.95.120
  51.79.111.220
+51.79.140.161
  51.79.141.100
  51.79.142.211
  51.79.143.68
-51.79.145.154
-51.79.145.176
  51.79.146.107
  51.79.147.177
+51.79.157.254
+51.79.158.206
+51.79.159.176
  51.79.159.229
  51.79.164.102
  51.79.164.156
  51.79.173.166
  51.79.176.221
-51.79.192.244
  51.79.205.193
-51.79.205.198
  51.79.206.29
  51.79.224.74
  51.79.25.250
  51.79.38.73
  51.79.42.147
  51.79.44.52
+51.79.46.0
  51.79.49.178
  51.79.50.10
  51.79.51.246
@@ -79668,7 +79653,8 @@
  51.81.0.103
  51.81.118.2
  51.81.122.147
-51.81.122.148
+51.81.122.149
+51.81.122.150
  51.81.139.96
  51.81.139.97
  51.81.168.229
@@ -79688,12 +79674,13 @@
  51.81.29.60
  51.81.31.167
  51.81.31.168
-51.81.31.170
  51.81.31.172
  51.81.31.61
  51.81.31.62
  51.81.31.64
  51.81.31.66
+51.81.36.0
+51.81.41.0
  51.81.43.48
  51.81.43.50
  51.81.46.170
@@ -79728,7 +79715,6 @@
  51.83.134.17
  51.83.134.39
  51.83.165.102
-51.83.165.104
  51.83.166.166
  51.83.166.167
  51.83.171.11
@@ -79754,6 +79740,7 @@
  51.83.188.222
  51.83.188.223
  51.83.189.0
+51.83.193.220
  51.83.200.164
  51.83.200.176
  51.83.200.179
@@ -79783,26 +79770,27 @@
  51.83.72.194
  51.83.72.208
  51.83.72.58
-51.83.73.243
  51.83.73.57
  51.83.74.126
  51.83.74.203
  51.83.74.86
  51.83.77.224
-51.83.96.154
  51.83.97.245
  51.83.98.104
  51.83.99.227
  51.89.1.56
+51.89.1.60
  51.89.10.253
  51.89.100.108
  51.89.103.161
+51.89.108.150
  51.89.115.248
  51.89.119.120
  51.89.119.154
  51.89.125.119
  51.89.13.174
  51.89.136.104
+51.89.142.30
  51.89.148.69
  51.89.153.65
  51.89.153.76
@@ -79816,6 +79804,7 @@
  51.89.204.10
  51.89.205.182
  51.89.207.113
+51.89.207.118
  51.89.213.95
  51.89.22.75
  51.89.22.95
@@ -79823,10 +79812,8 @@
  51.89.228.61
  51.89.23.175
  51.89.235.94
-51.89.240.129
  51.89.252.167
  51.89.36.180
-51.89.4.140
  51.89.40.32
  51.89.41.53
  51.89.42.147
@@ -79858,6 +79845,7 @@
  51.91.123.235
  51.91.123.98
  51.91.125.195
+51.91.127.200
  51.91.127.201
  51.91.140.218
  51.91.157.255
@@ -79866,7 +79854,6 @@
  51.91.185.74
  51.91.189.201
  51.91.197.151
-51.91.202.52
  51.91.204.85
  51.91.212.159
  51.91.229.147
@@ -79880,6 +79867,7 @@
  51.91.66.183
  51.91.66.27
  51.91.67.153
+51.91.76.214
  51.91.76.3
  51.91.77.103
  51.91.78.233
@@ -79970,10 +79958,12 @@
  52.11.70.207
  52.11.74.157
  52.11.87.3
+52.116.199.85
  52.116.200.122
  52.117.13.17
  52.12.94.219
  52.125.140.0
+52.128.147.240
  52.128.228.101
  52.128.240.42
  52.128.56.98
@@ -79982,8 +79972,6 @@
  52.130.75.32
  52.130.78.186
  52.130.93.83
-52.136.248.110
-52.136.253.134
  52.137.86.125
  52.138.0.111
  52.138.144.107
@@ -80006,7 +79994,6 @@
  52.14.209.188
  52.14.21.16
  52.14.220.123
-52.14.221.59
  52.14.53.142
  52.14.78.244
  52.14.87.72
@@ -80018,17 +80005,18 @@
  52.142.3.140
  52.143.64.116
  52.144.114.197
+52.144.44.158
  52.144.70.194
  52.144.86.82
  52.144.89.31
  52.146.13.204
-52.146.32.220
  52.146.46.244
-52.149.147.160
  52.149.152.236
  52.149.180.228
+52.149.209.126
  52.15.103.61
  52.15.105.94
+52.15.111.162
  52.15.115.119
  52.15.138.15
  52.15.140.203
@@ -80040,6 +80028,7 @@
  52.15.212.3
  52.15.215.225
  52.15.229.145
+52.15.239.122
  52.15.40.164
  52.15.51.23
  52.15.65.61
@@ -80047,7 +80036,6 @@
  52.15.87.18
  52.15.98.118
  52.151.117.83
-52.151.81.108
  52.152.130.178
  52.152.140.14
  52.152.142.12
@@ -80108,6 +80096,7 @@
  52.168.87.27
  52.168.90.133
  52.169.122.231
+52.169.140.126
  52.169.184.206
  52.169.224.12
  52.169.231.15
@@ -80131,7 +80120,6 @@
  52.17.98.211
  52.170.1.130
  52.170.2.8
-52.170.248.124
  52.170.44.161
  52.170.72.140
  52.171.198.169
@@ -80206,16 +80194,15 @@
  52.187.34.156
  52.187.34.233
  52.187.56.107
-52.187.58.97
  52.188.0.112
  52.188.110.228
  52.188.113.116
  52.188.116.120
  52.188.121.92
+52.188.123.245
  52.188.147.170
  52.188.153.36
  52.188.172.62
-52.188.4.109
  52.188.68.29
  52.188.69.174
  52.188.9.234
@@ -80240,12 +80227,14 @@
  52.193.194.19
  52.193.61.55
  52.193.93.213
+52.194.111.32
  52.194.241.193
  52.194.245.139
  52.194.247.32
  52.194.254.127
  52.195.1.72
  52.195.16.107
+52.196.1.52
  52.196.172.79
  52.196.77.240
  52.197.138.23
@@ -80259,8 +80248,10 @@
  52.2.152.40
  52.2.32.57
  52.2.45.196
+52.2.90.237
  52.20.250.185
  52.20.46.101
+52.20.7.202
  52.201.120.146
  52.201.156.205
  52.201.168.117
@@ -80376,6 +80367,7 @@
  52.221.190.254
  52.221.196.86
  52.221.196.94
+52.221.199.197
  52.221.203.250
  52.221.207.95
  52.221.209.153
@@ -80396,6 +80388,7 @@
  52.224.126.72
  52.224.164.31
  52.224.176.178
+52.224.177.51
  52.224.221.90
  52.224.240.91
  52.224.66.246
@@ -80405,7 +80398,6 @@
  52.229.159.234
  52.229.175.183
  52.229.206.131
-52.229.95.38
  52.23.132.187
  52.23.170.11
  52.23.226.138
@@ -80419,13 +80411,14 @@
  52.231.155.199
  52.231.166.244
  52.231.167.166
-52.231.192.21
  52.231.198.195
  52.231.200.39
  52.231.26.86
+52.231.73.247
  52.231.92.23
  52.232.246.85
  52.233.45.15
+52.233.67.119
  52.234.224.154
  52.235.42.75
  52.236.32.160
@@ -80442,14 +80435,15 @@
  52.24.94.73
  52.240.53.155
  52.240.55.118
-52.240.57.41
  52.241.142.136
  52.242.28.253
  52.242.91.130
  52.243.62.67
+52.246.178.21
  52.247.113.177
  52.247.194.12
  52.247.203.36
+52.249.197.80
  52.249.217.193
  52.249.251.173
  52.25.100.167
@@ -80517,9 +80511,11 @@
  52.29.51.234
  52.29.86.104
  52.3.127.144
+52.3.143.179
  52.3.146.92
  52.3.177.50
  52.3.186.199
+52.3.227.251
  52.3.231.255
  52.3.98.85
  52.30.100.41
@@ -80574,6 +80570,7 @@
  52.34.119.26
  52.34.13.150
  52.34.135.199
+52.34.137.180
  52.34.147.246
  52.34.148.221
  52.34.148.96
@@ -80598,6 +80595,7 @@
  52.36.16.60
  52.36.18.181
  52.36.194.134
+52.36.230.33
  52.36.236.124
  52.36.243.154
  52.36.244.122
@@ -80618,7 +80616,6 @@
  52.37.230.66
  52.37.42.139
  52.37.97.86
-52.38.13.23
  52.38.142.222
  52.38.222.222
  52.38.223.245
@@ -80832,11 +80829,9 @@
  52.63.174.209
  52.64.105.31
  52.64.199.219
-52.64.20.252
  52.64.208.82
  52.65.123.63
  52.65.15.196
-52.66.13.9
  52.66.220.143
  52.66.255.129
  52.68.166.44
@@ -80856,8 +80851,9 @@
  52.71.251.115
  52.71.61.52
  52.72.143.118
+52.72.44.88
  52.73.119.192
-52.73.221.89
+52.73.13.30
  52.73.45.110
  52.73.70.149
  52.74.126.15
@@ -80880,8 +80876,8 @@
  52.78.217.59
  52.78.241.165
  52.78.27.230
-52.78.43.216
  52.78.60.35
+52.79.158.242
  52.79.171.244
  52.79.202.234
  52.8.15.50
@@ -81079,6 +81075,7 @@
  54.152.80.39
  54.153.10.226
  54.153.104.98
+54.153.106.234
  54.153.117.15
  54.153.120.224
  54.153.214.107
@@ -81148,13 +81145,14 @@
  54.164.59.149
  54.164.74.19
  54.164.92.255
-54.165.14.55
  54.165.194.150
  54.165.194.22
+54.165.221.210
  54.165.78.72
  54.165.81.162
  54.165.89.112
  54.165.99.78
+54.166.17.133
  54.166.241.147
  54.166.49.162
  54.166.54.31
@@ -81164,7 +81162,6 @@
  54.167.249.28
  54.167.83.168
  54.168.144.78
-54.168.174.194
  54.168.212.227
  54.168.99.233
  54.169.118.237
@@ -81186,6 +81183,7 @@
  54.171.179.206
  54.171.46.235
  54.171.61.6
+54.171.62.133
  54.172.111.119
  54.172.112.27
  54.172.137.215
@@ -81226,7 +81224,6 @@
  54.174.32.161
  54.174.83.249
  54.175.103.155
-54.175.125.240
  54.175.125.245
  54.175.125.247
  54.175.125.249
@@ -81249,12 +81246,13 @@
  54.178.182.46
  54.178.207.38
  54.178.91.246
+54.179.130.50
  54.179.160.149
  54.179.181.4
+54.179.195.125
  54.179.216.166
  54.179.60.243
  54.179.63.15
-54.180.114.195
  54.180.143.88
  54.180.79.30
  54.183.113.171
@@ -81271,7 +81269,6 @@
  54.183.187.60
  54.183.188.22
  54.183.206.25
-54.183.230.101
  54.183.31.190
  54.183.99.239
  54.184.174.227
@@ -81327,10 +81324,12 @@
  54.193.7.84
  54.193.96.134
  54.194.142.210
+54.194.178.129
  54.194.221.120
  54.194.231.180
  54.194.64.98
  54.194.68.240
+54.195.17.62
  54.195.180.44
  54.196.105.254
  54.196.18.156
@@ -81408,8 +81407,8 @@
  54.202.77.226
  54.202.87.254
  54.203.102.18
+54.203.153.235
  54.204.146.92
-54.204.157.224
  54.204.177.248
  54.204.179.224
  54.204.20.190
@@ -81428,6 +81427,7 @@
  54.206.217.88
  54.207.103.100
  54.207.112.141
+54.207.39.48
  54.207.83.217
  54.208.103.167
  54.208.251.126
@@ -81459,7 +81459,6 @@
  54.213.152.11
  54.213.169.129
  54.213.173.231
-54.213.200.136
  54.213.227.131
  54.213.244.36
  54.213.57.174
@@ -81480,7 +81479,6 @@
  54.215.117.219
  54.215.19.78
  54.215.229.110
-54.216.191.170
  54.218.10.179
  54.218.109.56
  54.218.129.154
@@ -81515,6 +81513,7 @@
  54.221.84.53
  54.222.161.1
  54.222.181.198
+54.223.108.245
  54.223.58.22
  54.224.128.129
  54.224.130.89
@@ -81555,7 +81554,6 @@
  54.234.208.63
  54.234.251.167
  54.234.255.239
-54.234.33.136
  54.234.38.217
  54.234.63.235
  54.235.20.153
@@ -81589,7 +81587,6 @@
  54.238.209.99
  54.238.229.227
  54.241.9.72
-54.242.128.95
  54.242.177.136
  54.242.226.101
  54.242.3.69
@@ -81633,7 +81630,6 @@
  54.249.206.111
  54.249.59.190
  54.250.245.105
-54.250.248.123
  54.250.87.247
  54.251.134.94
  54.251.145.112
@@ -81665,7 +81661,6 @@
  54.36.112.254
  54.36.117.1
  54.36.120.120
-54.36.148.62
  54.36.165.192
  54.36.165.239
  54.36.165.34
@@ -81680,12 +81675,12 @@
  54.36.241.186
  54.36.244.151
  54.36.246.17
-54.36.246.232
  54.36.4.19
  54.36.42.250
  54.36.61.64
  54.36.62.114
  54.36.62.47
+54.36.89.34
  54.37.11.58
  54.37.115.244
  54.37.131.204
@@ -81694,7 +81689,6 @@
  54.37.143.192
  54.37.156.188
  54.37.16.241
-54.37.163.131
  54.37.172.138
  54.37.19.104
  54.37.19.108
@@ -81704,6 +81698,7 @@
  54.37.19.81
  54.37.194.21
  54.37.194.43
+54.37.198.243
  54.37.204.99
  54.37.209.37
  54.37.224.163
@@ -81766,6 +81761,7 @@
  54.38.241.162
  54.38.243.187
  54.38.243.189
+54.38.253.1
  54.38.33.178
  54.38.36.210
  54.38.48.225
@@ -81774,21 +81770,21 @@
  54.38.56.106
  54.38.56.79
  54.38.61.50
+54.38.65.125
  54.38.65.215
  54.38.65.55
  54.38.81.231
  54.38.82.57
  54.38.92.35
-54.38.92.66
  54.39.133.203
  54.39.145.123
+54.39.16.153
  54.39.16.73
-54.39.175.230
  54.39.18.49
-54.39.182.250
  54.39.2.124
  54.39.202.218
  54.39.22.116
+54.39.22.135
  54.39.226.183
  54.39.235.201
  54.39.243.49
@@ -81807,6 +81803,7 @@
  54.66.33.50
  54.67.20.148
  54.67.33.184
+54.67.81.247
  54.68.135.82
  54.68.152.243
  54.68.199.31
@@ -81843,6 +81840,7 @@
  54.77.210.148
  54.77.216.217
  54.77.40.88
+54.77.94.146
  54.78.234.202
  54.79.63.236
  54.79.77.88
@@ -81863,6 +81861,7 @@
  54.83.140.45
  54.83.149.13
  54.83.207.248
+54.83.238.35
  54.84.134.79
  54.84.146.120
  54.84.175.38
@@ -81888,7 +81887,6 @@
  54.87.139.109
  54.87.176.205
  54.87.177.220
-54.87.244.162
  54.87.250.249
  54.87.80.90
  54.87.90.203
@@ -82010,11 +82008,10 @@
  57bofa75.bofa0serivceb.com
  57d3e30e.duckdns.org
  57vd9.app.link
+58.0.44.137
  58.0.74.253
-58.11.29.4
  58.11.31.89
  58.11.57.98
-58.11.59.161
  58.115.174.4
  58.120.227.139
  58.120.27.153
@@ -82046,14 +82043,20 @@
  58.147.187.38
  58.149.49.186
  58.149.52.124
-58.150.192.131
  58.150.99.144
  58.152.101.185
-58.152.59.179
+58.152.139.241
+58.152.149.204
+58.152.59.197
+58.153.109.143
  58.153.112.168
-58.153.255.89
+58.153.235.43
+58.153.248.241
+58.153.63.164
+58.153.67.72
  58.158.0.86
  58.16.113.121
+58.16.204.238
  58.16.83.221
  58.162.143.57
  58.162.218.151
@@ -82077,15 +82080,17 @@
  58.19.149.225
  58.19.42.140
  58.20.108.76
+58.20.227.69
  58.20.30.77
  58.20.54.143
  58.208.135.180
-58.208.172.112
+58.208.171.32
  58.208.172.129
  58.208.172.211
  58.208.180.12
+58.208.54.179
  58.208.54.59
-58.209.158.106
+58.209.174.226
  58.209.192.146
  58.209.239.23
  58.209.252.192
@@ -82098,6 +82103,8 @@
  58.212.197.15
  58.212.59.53
  58.213.116.170
+58.213.151.122
+58.213.157.226
  58.213.84.234
  58.213.89.10
  58.214.36.86
@@ -82118,12 +82125,11 @@
  58.218.5.3
  58.219.224.139
  58.219.227.184
-58.219.61.231
-58.219.61.232
  58.22.132.50
  58.22.210.164
  58.22.212.107
  58.22.7.73
+58.22.93.20
  58.220.10.149
  58.220.10.210
  58.220.24.75
@@ -82137,6 +82143,7 @@
  58.220.95.84
  58.220.95.86
  58.220.95.90
+58.221.101.182
  58.221.176.123
  58.221.204.114
  58.221.62.191
@@ -82150,7 +82157,6 @@
  58.222.20.220
  58.222.223.142
  58.223.21.35
-58.224.118.241
  58.225.132.20
  58.225.75.151
  58.226.129.29
@@ -82160,6 +82166,7 @@
  58.227.251.3
  58.229.114.170
  58.229.157.178
+58.229.184.242
  58.229.194.122bfac0332.moe
  58.229.208.158
  58.229.240.81
@@ -82172,6 +82179,7 @@
  58.230.147.230
  58.231.127.70
  58.233.240.94
+58.234.250.211
  58.236.160.218
  58.236.77.157
  58.237.125.4
@@ -82184,6 +82192,7 @@
  58.240.148.13bin.sh
  58.240.155.223
  58.240.78.202
+58.240.9.47
  58.242.169.14
  58.242.197.25
  58.242.59.139
@@ -82218,36 +82227,40 @@
  58.247.111.70
  58.247.38.96
  58.247.51.194
+58.248.116.50
+58.248.118.45
+58.248.140.57
  58.248.142.0
-58.248.143.244
+58.248.142.189
+58.248.142.223
+58.248.143.123
  58.248.144.87
+58.248.144.95
  58.248.193.122
  58.248.193.14
  58.248.193.172
  58.248.193.23
  58.248.193.59
-58.248.193.91
-58.248.76.107
-58.248.79.75
-58.248.82.74
-58.248.83.196
-58.249.18.50
-58.249.77.44
-58.249.80.118
-58.249.80.133
+58.248.76.171
+58.249.72.124
+58.249.73.23
+58.249.75.19
+58.249.80.188
  58.249.80.245
-58.249.83.151
-58.249.89.54
+58.249.83.164
+58.249.91.98
  58.250.169.130
  58.250.176.94
  58.250.194.121
+58.252.16.236
  58.252.17.191
  58.252.2.236
-58.253.110.145
  58.254.220.116
+58.255.133.239
  58.255.134.138
+58.255.134.20
+58.255.140.62
  58.255.43.200
-58.255.81.31
  58.26.11.15
  58.27.17.165
  58.27.215.3
@@ -82256,47 +82269,48 @@
  58.27.95.2
  58.30.76.243
  58.32.35.229
+58.33.0.210
+58.33.102.12
+58.33.16.2
  58.33.160.139
  58.33.174.203
  58.33.197.82
  58.33.242.2
-58.33.242.3
  58.33.35.82
  58.33.45.30
  58.33.49.196
  58.33.84.251
+58.34.34.252
  58.40.124.174
  58.40.15.138
  58.42.204.53
-58.42.245.153
  58.47.177.161
-58.47.59.191
+58.47.76.98
  58.48.168.166
-58.48.227.123
  58.49.116.78
  58.49.76.100
  58.49.94.213
  58.50.135.68
-58.50.220.232
  58.52.179.215
-58.52.198.77
  58.53.128.61
  58.56.132.10
  58.56.140.62
-58.56.32.238
+58.56.181.62
  58.56.40.210
  58.56.85.242
  58.57.15.29
  58.57.4.238
  58.58.213.55
  58.58.58.114
+58.58.71.218
  58.59.17.74
  58.60.10.10
+58.62.115.108
+58.62.115.13
  58.62.18.194
  58.62.40.216
-58.63.216.222
-58.63.37.178
  58.63.37.19
+58.63.37.47
  58.64.129.15
  58.64.178.77
  58.64.188.26
@@ -82305,8 +82319,11 @@
  58.64.204.170
  58.65.136.170
  58.65.145.126
+58.65.145.16
  58.65.167.165
+58.65.223.1
  58.69.161.161
+58.69.63.58
  58.69.69.46
  58.69.87.58
  58.71.15.10
@@ -82315,9 +82332,11 @@
  58.71.72.50
  58.75.126.235
  58.76.180.71
-58.8.17.21
  58.8.174.125
+58.8.179.21
+58.8.180.185
  58.8.2.250
+58.8.4.90
  58.8.45.76
  58.82.170.50
  58.82.212.192
@@ -82325,7 +82344,6 @@
  58.82.248.148
  58.82.248.161
  58.83.227.150
-58.84.110.69
  58.84.14.157
  58.84.31.113
  58.84.31.129
@@ -82348,6 +82366,7 @@
  58.84.31.57
  58.84.31.65
  58.84.31.77
+58.84.31.81
  58.84.31.97
  58.87.106.15
  58.87.106.85
@@ -82364,6 +82383,7 @@
  58.87.65.87
  58.87.66.82
  58.87.67.126
+58.87.67.226
  58.87.69.15
  58.87.71.16
  58.87.72.225
@@ -82379,14 +82399,15 @@
  58.87.94.75
  58.9.182.62
  58.9.99.67
+58.96.148.37
  58.96.175.218
  58.96.50.39
  58.97.201.45
-58.97.205.164
  58.97.206.33
  58.97.214.5
  58.97.215.240
  58.97.221.184
+58.97.230.105
  58.97.72.83
  58.97.8.10
  581073-dot-n-e-w-me-ss-age-po-rt-al.wl.r.appspot.com
@@ -82419,10 +82440,11 @@
  59.100.12.173
  59.102.148.151
  59.102.43.21
+59.103.109.243
  59.103.114.112
-59.103.122.85
-59.103.142.29
+59.103.125.27
  59.103.164.174
+59.103.34.4
  59.103.96.64
  59.106.141.147
  59.106.171.70
@@ -82433,7 +82455,6 @@
  59.110.12.12
  59.110.12.129
  59.110.153.239
-59.110.212.206
  59.110.229.239
  59.110.50.141
  59.110.54.10
@@ -82444,6 +82465,7 @@
  59.111.95.152
  59.115.123.50
  59.115.52.103
+59.120.20.133
  59.120.227.134
  59.120.5.154
  59.124.170.48
@@ -82458,7 +82480,6 @@
  59.124.74.56
  59.124.93.169
  59.125.123.129
-59.125.206.67
  59.125.214.115
  59.125.28.51
  59.125.31.24
@@ -82468,13 +82489,14 @@
  59.126.51.197
  59.127.152.203
  59.127.168.43
-59.127.238.44
  59.127.27.243
  59.128.66.213
  59.128.66.213bin.sh
  59.13.125.142
  59.145.111.67
+59.145.146.166
  59.145.221.103
+59.147.60.251
  59.148.18.42
  59.15.18.223
  59.15.18.223bin.sh
@@ -82486,7 +82508,6 @@
  59.151.231.113
  59.151.239.36
  59.151.244.11
-59.151.246.125
  59.151.247.12
  59.151.47.42
  59.152.104.54
@@ -82502,7 +82523,6 @@
  59.153.121.190
  59.153.17.186
  59.153.18.90
-59.153.235.61
  59.153.83.170
  59.153.84.253
  59.154.237.20
@@ -82520,7 +82540,6 @@
  59.175.86.246
  59.177.37.32
  59.178.75.235
-59.178.77.108
  59.181.106.18
  59.181.122.64bin.sh
  59.186.106.20
@@ -82532,11 +82551,11 @@
  59.19.150.135
  59.19.29.102
  59.2.207.18
+59.2.64.221
  59.20.252.136
  59.20.40.127
  59.21.138.173
  59.21.150.93
-59.21.215.194
  59.21.235.119
  59.23.168.115
  59.23.168.115bin.sh
@@ -82544,7 +82563,6 @@
  59.23.215.80
  59.23.24.187
  59.24.1.84
-59.24.133.197
  59.24.49.35
  59.25.142.68
  59.25.6.100
@@ -82552,7 +82570,7 @@
  59.26.218.228
  59.27.134.193
  59.27.95.144
-59.28.189.172
+59.28.134.242
  59.28.44.229
  59.29.227.55
  59.29.245.151
@@ -82561,25 +82579,21 @@
  59.3.28.131
  59.3.93.107
  59.3.94.190
-59.30.100.200
  59.30.12.254
  59.31.90.206
-59.32.97.110
-59.34.233.229
  59.35.20.141
-59.35.95.107
  59.36.136.238
-59.36.172.8
-59.36.174.144
  59.36.178.98
  59.36.210.233
  59.36.73.94
  59.36.75.227
  59.36.78.217
+59.37.131.61
  59.37.22.82
  59.37.47.26
  59.39.183.34
  59.39.63.54
+59.4.176.72
  59.4.98.61
  59.40.79.227
  59.41.131.168
@@ -82590,15 +82604,13 @@
  59.42.100.116
  59.42.100.123
  59.42.100.185
-59.42.100.83
-59.42.207.60
  59.42.37.19
-59.42.37.212
+59.42.38.57
  59.44.47.106
+59.45.142.12
  59.45.235.136
  59.46.116.117
  59.46.136.140
-59.46.136.141
  59.46.145.250
  59.46.169.194
  59.47.67.146
@@ -82607,92 +82619,83 @@
  59.5.120.183
  59.5.230.140bin.sh
  59.53.183.198
-59.55.36.121
+59.55.36.3
  59.55.38.111
-59.55.38.155
+59.55.38.242
  59.55.38.40
  59.55.39.62
  59.55.39.80
+59.55.5.73
  59.56.106.103
  59.56.126.143
+59.56.168.206
  59.56.99.130
  59.57.83.94
  59.58.139.126
+59.59.147.135
  59.6.180.232
-59.61.207.6
+59.60.122.48
+59.60.54.51
+59.60.77.119
+59.62.108.92
  59.63.189.107
  59.63.212.100
  59.63.225.99
  59.63.230.46
-59.63.52.138
-59.63.97.201
  59.7.108.122
  59.7.75.190
  59.7.91.13
  59.72.109.90
  59.72.114.79
  59.72.122.148
-59.72.61.219
  59.8.125.188
  59.8.23.172
  59.83.222.82
  59.83.229.119
  59.88.9.115
  59.89.108.81
-59.9.243.192
+59.89.240.221
+59.89.242.223
  59.9.77.181
  59.90.30.197
  59.90.52.6
-59.90.53.129
+59.90.53.79
  59.90.55.63
  59.91.122.1
  59.91.122.57
+59.92.117.203
  59.92.176.163
  59.92.177.61
-59.92.182.212
-59.92.182.46
-59.92.183.183
-59.92.217.75
-59.92.219.51
-59.92.5.201
+59.92.177.65
+59.92.178.143
+59.92.180.134
+59.92.182.133
+59.92.218.163
+59.92.218.221
  59.92.69.22
-59.92.85.231
-59.93.16.198
-59.93.17.133
-59.93.19.248
-59.93.22.131
-59.93.22.50
+59.93.16.238
+59.93.19.108
+59.93.22.133
+59.94.180.107
+59.94.180.11
  59.95.101.212
-59.95.172.41
-59.96.25.25
-59.96.26.25
+59.96.24.11
+59.96.26.221
  59.96.26.32
-59.96.37.141
+59.96.38.207
  59.96.38.82
-59.96.39.1
-59.97.168.185
-59.97.169.36
  59.97.172.134
-59.97.172.156
  59.97.172.5
-59.97.173.33
-59.97.174.126
-59.97.175.25
+59.97.173.86
+59.97.174.137
+59.97.175.48
  59.98.144.143
  59.99.138.78
  59.99.139.190
-59.99.139.251
-59.99.140.214
-59.99.141.128
-59.99.141.138
-59.99.190.187
-59.99.40.108
-59.99.41.168
-59.99.41.28
-59.99.45.79
-59.99.93.206
-59.99.94.196
-59.99.95.1
+59.99.143.96
+59.99.93.181
+59.99.94.188
+59.99.94.194
  590466-dot-n-e-w-me-ss-age-po-rt-al.wl.r.appspot.com
  5918062d-fb42-4707-b098-e2c266e14d95.htmlpasta.com
  591860.playcode.io
@@ -82752,7 +82755,6 @@
  5efe5f2734d61adc1bcc1b5bf754704e.icu
  5eplaye.com
  5eta5jd58hb4.top
-5evpi.app.link
  5f1b65864cf03.site123.me
  5f282d795dbb0.965d32.info-card.ga
  5f2917d4296575e977c283afb14fbbaa-dot-dbenitonline.ey.r.appspot.com
@@ -82823,6 +82825,7 @@
  6.ldayl.com
  60.1.146.86
  60.10.193.68
+60.10.85.95
  60.107.184.133
  60.109.35.100
  60.113.117.109
@@ -82835,10 +82838,10 @@
  60.132.121.224
  60.14.48.221
  60.15.67.178
+60.15.67.2
  60.16.102.75
  60.16.253.43
  60.161.13.44
-60.161.187.161
  60.162.123.120
  60.162.178.183
  60.162.183.254
@@ -82849,91 +82852,115 @@
  60.164.205.176
  60.165.219.14
  60.165.254.21
+60.165.96.125
  60.166.120.220
  60.166.121.192
-60.166.121.218
-60.166.158.148
-60.166.71.163
+60.167.102.121
+60.167.102.129
  60.167.102.15
  60.167.102.182
  60.167.102.67
-60.167.102.70
-60.167.103.216
-60.167.103.230
-60.167.103.30
+60.167.103.16
+60.167.103.20
+60.167.103.211
+60.167.103.221
+60.167.103.239
+60.167.103.32
  60.167.103.57
-60.167.132.113
  60.167.132.168
-60.167.132.176
-60.167.132.229
-60.167.132.237
-60.167.132.34
-60.167.132.70
-60.167.132.80
+60.167.132.206
+60.167.132.94
+60.167.133.137
+60.167.133.185
  60.167.133.204
-60.167.133.230
-60.167.134.240
-60.167.134.242
+60.167.133.41
+60.167.134.134
+60.167.134.15
+60.167.134.151
+60.167.134.176
+60.167.134.181
+60.167.134.239
+60.167.134.31
  60.167.134.37
  60.167.134.50
-60.167.135.150
-60.167.135.208
+60.167.135.185
+60.167.135.239
  60.167.135.50
  60.167.135.6
  60.167.135.69
-60.167.135.70
  60.167.20.110
  60.167.20.166
  60.167.20.177
-60.167.20.198
-60.167.20.212
+60.167.20.181
+60.167.20.223
  60.167.20.224
+60.167.20.33
+60.167.20.49
  60.167.21.218
+60.167.21.52
  60.167.21.60
+60.167.21.78
+60.167.21.84
+60.167.22.117
+60.167.22.118
+60.167.22.119
  60.167.22.124
+60.167.22.140
+60.167.22.144
  60.167.22.151
-60.167.22.200
+60.167.22.169
+60.167.22.210
+60.167.22.222
  60.167.22.225
+60.167.22.246
  60.167.22.46
-60.167.23.104
-60.167.23.7
-60.168.150.42
-60.168.206.252
+60.167.23.102
+60.167.23.135
+60.167.23.236
+60.167.23.6
+60.168.133.132
+60.168.206.141
+60.168.207.137
  60.168.207.155
  60.168.207.156
-60.168.207.167
  60.168.207.198
+60.168.207.228
  60.168.40.138
  60.168.40.232
+60.168.40.85
+60.168.41.208
  60.168.80.149
+60.168.80.178
  60.168.81.157
+60.168.81.190
  60.168.81.220
-60.168.81.79
+60.168.81.241
+60.168.81.63
  60.168.81.91
  60.169.149.137
  60.169.69.101
  60.169.75.164
  60.170.101.25
-60.170.162.110
+60.170.111.51
  60.170.166.72
  60.170.189.102
  60.170.255.63
-60.170.96.126
-60.171.163.115
+60.171.148.74
  60.171.17.185
  60.171.208.199
  60.173.116.25
-60.173.161.143
-60.174.118.80
+60.173.46.37
  60.174.234.57
  60.174.242.172
  60.174.72.198
  60.175.124.27
+60.175.86.157
  60.176.78.75
  60.177.122.250
  60.177.245.70
  60.178.10.55
  60.183.3.161
+60.184.174.164
  60.184.95.135
  60.185.135.205
  60.185.159.249
@@ -82943,7 +82970,7 @@
  60.190.132.206
  60.190.163.182
  60.190.250.120
-60.190.6.134
+60.190.37.155
  60.191.11.241
  60.191.116.76
  60.191.119.124
@@ -82957,9 +82984,10 @@
  60.196.69.234
  60.199.154.4
  60.199.174.62
+60.199.174.66
  60.199.223.196
  60.2.137.170
-60.2.78.67
+60.2.94.154
  60.20.128.152
  60.20.219.146
  60.205.114.50
@@ -82984,11 +83012,9 @@
  60.209.57.205
  60.209.8.48
  60.21.145.66
-60.21.199.211
  60.21.84.216
  60.210.104.22
  60.210.40.210
-60.211.110.207
  60.211.110.32
  60.211.13.220
  60.211.15.170
@@ -83011,22 +83037,20 @@
  60.212.153.164
  60.212.180.197
  60.212.24.148
-60.212.251.238
  60.212.255.155
  60.212.26.164
  60.212.28.254
  60.212.34.200
-60.213.108.223
  60.213.121.185
  60.213.171.219
  60.213.177.63
  60.213.56.225
  60.213.83.55
  60.213.88.124
+60.214.225.95
  60.214.239.108
  60.214.33.185
  60.214.34.129
-60.214.49.118
  60.214.55.159
  60.214.93.166
  60.215.161.69
@@ -83037,23 +83061,22 @@
  60.215.203.48
  60.215.34.189
  60.216.101.46
-60.217.108.132
  60.217.120.44
  60.217.181.25
  60.217.64.237
-60.217.72.12
  60.220.185.149
  60.220.185.199
+60.220.185.22
  60.220.185.35
  60.220.185.61
  60.220.185.64
  60.220.185.90
+60.220.23.158
  60.221.225.136
+60.221.59.90
  60.222.233.208
  60.223.239.134
-60.223.248.87
  60.223.92.13
-60.225.52.198
  60.228.245.111
  60.235.183.70
  60.235.237.58
@@ -83061,6 +83084,7 @@
  60.237.91.10
  60.24.124.52
  60.24.72.131
+60.240.101.223
  60.240.204.46
  60.240.255.231
  60.241.231.114
@@ -83069,12 +83093,12 @@
  60.243.149.14
  60.244.109.18
  60.246.171.51
+60.246.191.215
  60.246.65.138
  60.246.65.140
  60.246.7.4
  60.247.103.41
  60.247.27.157
-60.247.92.186
  60.248.131.75
  60.248.199.194
  60.248.2.163
@@ -83082,14 +83106,12 @@
  60.249.214.243
  60.249.217.225
  60.249.82.121
-60.249.94.193
  60.250.159.191
  60.250.164.169
  60.250.50.235
  60.250.77.209
  60.250.94.62
  60.250.94.66
-60.251.109.18
  60.251.129.61
  60.251.133.227
  60.251.136.127
@@ -83102,6 +83124,7 @@
  60.253.62.43
  60.253.8.65
  60.253.8.81
+60.254.0.96
  60.254.16.200
  60.254.18.153
  60.254.18.161
@@ -83111,7 +83134,7 @@
  60.26.15.125
  60.26.191.190
  60.26.230.19
-60.27.119.187
+60.26.255.68
  60.28.243.10
  60.28.60.49
  60.3.208.37
@@ -83119,12 +83142,13 @@
  60.48.1.149
  60.48.249.38
  60.49.0.221
-60.49.120.88
-60.50.142.146
+60.49.71.213
+60.50.141.139
  60.50.16.200
  60.50.52.199
  60.50.99.134
  60.51.111.99
+60.51.112.177
  60.51.170.105
  60.51.228.233
  60.51.36.129
@@ -83133,9 +83157,11 @@
  60.52.84.101
  60.53.126.184
  60.53.203.3
+60.54.100.131
  60.54.13.96
  60.54.218.124
-60.54.86.241
+60.54.89.90
+60.6.203.73
  60.6.209.7
  60.6.223.191
  60.7.132.44
@@ -83169,7 +83195,6 @@
  61.100.186.87
  61.100.5.136
  61.102.42.5
-61.106.203.224
  61.107.72.165
  61.109.159.126
  61.109.164.150
@@ -83179,8 +83204,8 @@
  61.118.35.94
  61.12.67.133
  61.12.82.102
+61.129.101.28
  61.129.112.168
-61.132.171.16
  61.132.225.82
  61.132.46.219
  61.132.52.29
@@ -83195,19 +83220,21 @@
  61.133.232.254
  61.133.77.176
  61.135.136.184
+61.135.136.185
  61.135.155.82
-61.136.101.166
  61.136.144.41
  61.136.163.183
  61.136.163.245
  61.136.163.246
  61.136.184.75
  61.136.79.36
+61.136.81.156
  61.139.105.163
  61.14.228.134
-61.14.228.170
  61.140.127.77
  61.140.13.161
+61.140.169.220
+61.140.169.71
  61.140.62.28
  61.141.21.34
  61.141.224.191
@@ -83215,13 +83242,13 @@
  61.141.227.159
  61.141.235.103
  61.141.64.121
-61.141.87.48
  61.142.245.82
-61.142.25.138
  61.142.72.150
  61.144.44.186
  61.144.96.117
+61.144.96.197
  61.144.97.217
+61.144.97.225
  61.145.182.27
  61.145.185.121
  61.146.108.150
@@ -83238,14 +83265,14 @@
  61.150.114.203
  61.150.115.117
  61.150.76.240
+61.150.88.22
  61.152.116.107
  61.152.122.166
-61.152.154.84
  61.152.197.148
+61.152.197.28
  61.152.93.170
  61.153.2.133
  61.153.224.158
-61.153.251.150
  61.154.164.241
  61.155.0.253
  61.155.106.101
@@ -83257,6 +83284,7 @@
  61.155.209.51
  61.155.217.77
  61.155.218.120
+61.155.233.227
  61.155.233.234
  61.156.119.128
  61.156.208.53
@@ -83266,6 +83294,7 @@
  61.157.18.2
  61.158.114.188
  61.158.187.85
+61.159.128.228
  61.160.195.115
  61.160.196.102
  61.160.210.223
@@ -83282,16 +83311,19 @@
  61.162.168.8bin.sh
  61.162.55.42
  61.163.136.104bin.sh
-61.163.137.29
-61.163.148.40
+61.163.136.15
+61.163.136.95
  61.163.156.160
  61.163.170.1
+61.163.70.50
  61.164.145.8
  61.164.248.135
  61.164.34.4
  61.164.41.76
+61.164.47.132
  61.164.96.98
  61.165.32.222
+61.166.198.131
  61.166.55.153
  61.168.139.52
  61.168.222.143
@@ -83299,10 +83331,12 @@
  61.173.90.224
  61.174.171.62
  61.174.212.58
+61.174.238.101
  61.174.9.146
  61.177.125.242
  61.177.144.130
  61.177.172.104
+61.177.172.107
  61.177.172.13
  61.177.173.10
  61.177.173.11
@@ -83312,6 +83346,7 @@
  61.177.173.15
  61.177.173.16
  61.177.173.17
+61.177.173.18
  61.177.173.19
  61.177.173.2
  61.177.173.21
@@ -83319,8 +83354,6 @@
  61.177.173.23
  61.177.173.25
  61.177.173.27
-61.177.173.31
-61.177.173.33
  61.177.173.7
  61.177.173.8
  61.177.173.9
@@ -83340,11 +83373,10 @@
  61.180.65.16
  61.181.14.196
  61.181.80.253
-61.182.226.42
  61.182.227.245
-61.182.57.161
+61.183.139.155
  61.183.15.9
-61.183.216.118
+61.183.204.210
  61.183.41.108
  61.183.41.38
  61.184.115.28
@@ -83355,8 +83387,10 @@
  61.185.114.130
  61.185.59.174
  61.186.136.36
+61.188.18.141
  61.188.220.206
  61.19.123.178
+61.19.124.38
  61.19.125.2
  61.19.127.228
  61.19.145.66
@@ -83369,9 +83403,10 @@
  61.19.255.69
  61.19.40.50
  61.19.65.30
+61.19.69.26
+61.19.72.50
  61.190.172.2
  61.190.91.66
-61.191.215.141
  61.191.55.33
  61.191.85.0
  61.192.73.253
@@ -83382,8 +83417,6 @@
  61.216.131.31
  61.216.24.30
  61.216.28.103
-61.216.39.166
-61.216.43.102
  61.216.43.72
  61.218.122.198
  61.218.36.21
@@ -83401,10 +83434,13 @@
  61.230.170.34
  61.232.0.130
  61.238.103.233
+61.238.40.3
+61.238.74.23
  61.239.162.198
  61.239.214.81
  61.241.170.149
  61.241.170.161
+61.241.170.184
  61.241.170.204
  61.241.170.205
  61.241.170.21
@@ -83412,7 +83448,6 @@
  61.241.170.50
  61.241.171.170
  61.242.169.92
-61.242.54.113
  61.242.54.124
  61.242.54.128
  61.242.54.144
@@ -83420,6 +83455,7 @@
  61.242.54.159
  61.242.54.194
  61.242.54.2
+61.242.54.202
  61.242.54.215
  61.242.54.216
  61.242.54.218
@@ -83435,12 +83471,12 @@
  61.242.54.86
  61.242.54.93
  61.243.11.180
+61.243.4.168
  61.244.107.60
  61.244.144.186
  61.244.186.33
  61.244.70.248
  61.244.80.223
-61.245.169.154
  61.246.38.248
  61.246.39.159
  61.247.178.158
@@ -83452,12 +83488,14 @@
  61.250.92.26
  61.254.broadband2.iol.cz
  61.28.116.83
+61.29.96.146
  61.3.124.147
-61.3.126.133
-61.3.127.44
-61.3.148.194
+61.3.148.132
+61.3.150.46
+61.3.19.100
  61.32.154.211
  61.32.231.155
+61.32.6.30
  61.33.108.252
  61.35.43.168
  61.37.212.83
@@ -83467,71 +83505,60 @@
  61.40.132.10
  61.41.45.83
  61.41.9.213
-61.43.118.230
  61.47.220.169
  61.47.61.97
  61.47.7.71
  61.48.169.6
-61.49.177.29
  61.49.59.22
  61.5.11.190
  61.5.18.90
-61.5.33.230
-61.5.98.119
  61.51.111.187
  61.51.18.235
  61.52.100.125
  61.52.101.233
  61.52.101.78
-61.52.102.58
-61.52.103.251
  61.52.11.87
  61.52.128.79
-61.52.13.140
  61.52.131.12
-61.52.157.159
  61.52.158.213
  61.52.159.16
+61.52.164.6
  61.52.176.30
-61.52.178.11
  61.52.193.136
  61.52.199.10
  61.52.212.132
-61.52.246.6
+61.52.213.198
  61.52.28.107
  61.52.28.126
  61.52.28.79
-61.52.29.208
  61.52.30.236
-61.52.32.66
+61.52.32.35
  61.52.43.138
  61.52.5.128
-61.52.73.229
-61.52.74.37
-61.52.76.174
  61.52.9.207
  61.52.97.233
  61.52.98.12
  61.52.98.151
  61.52.98.32bin.sh
-61.53.102.209
+61.52.99.104
+61.52.99.59
  61.53.11.91
  61.53.119.67
-61.53.150.120
-61.53.221.104
+61.53.149.17
  61.53.241.13
-61.53.57.236
  61.53.72.40
+61.53.73.158
+61.53.90.89
+61.53.91.18
  61.53.96.12
-61.54.194.75
-61.54.198.224
+61.54.240.99
  61.54.243.75
  61.54.248.217
  61.54.249.180
  61.54.40.78
+61.54.43.167
  61.54.43.28
-61.54.56.200
-61.54.77.124
+61.54.70.120
  61.54.78.161
  61.55.141.11
  61.55.199.29
@@ -83543,6 +83570,10 @@
  61.6.127.188
  61.6.147.172
  61.6.235.228
+61.6.238.44
+61.6.239.175
+61.6.239.218
+61.6.239.61
  61.6.247.92
  61.6.30.199
  61.6.37.23
@@ -83556,20 +83587,18 @@
  61.62.24.204bin.sh
  61.63.128.120
  61.65.172.121
-61.66.218.14
  61.67.240.189
-61.7.132.152
+61.68.93.155
  61.7.132.4
-61.7.132.44
  61.7.138.225
  61.7.138.27
  61.7.141.34
  61.7.142.39
-61.7.144.177
  61.7.146.7
  61.7.147.29
  61.7.167.53
  61.7.183.113
+61.7.183.243
  61.7.183.70
  61.7.184.110
  61.7.184.145
@@ -83579,8 +83608,8 @@
  61.7.235.211
  61.7.241.34
  61.70.104.46
+61.70.132.86
  61.70.255.60
-61.72.177.33
  61.72.211.28
  61.72.255.26
  61.72.60.196
@@ -83588,8 +83617,8 @@
  61.74.246.120
  61.76.134.35
  61.76.169.138
-61.77.102.160
-61.78.166.21
+61.76.19.180
+61.76.19.206
  61.78.210.199bin.sh
  61.78.62.22
  61.78.78.108
@@ -83615,6 +83644,7 @@
  61.85.224.42
  61.9.48.102
  61.90.160.204
+61.90.27.165
  61.90.29.248
  61.91.183.86
  61.91.235.226
@@ -83622,11 +83652,12 @@
  61.91.79.40
  61.91.80.107
  61.92.120.41
-61.92.148.114
  61.92.3.197
+61.92.39.24
  61.93.107.87
  61.93.186.125
  61.93.240.170
+61.93.70.125
  61.94.159.87
  61.94.243.76
  61.95.233.61
@@ -83656,7 +83687,6 @@
  61z39.cn
  62.1.147.90
  62.101.254.191
-62.101.88.180
  62.102.148.154
  62.102.148.185
  62.102.148.68
@@ -83686,7 +83716,6 @@
  62.109.2.52
  62.109.26.224
  62.109.31.192
-62.11.72.247
  62.11.75.223
  62.11.78.31
  62.112.11.116
@@ -83694,8 +83723,8 @@
  62.112.11.238
  62.112.194.132
  62.112.9.142
-62.113.11.109
  62.113.115.88
+62.113.14.6
  62.113.196.48
  62.113.238.135
  62.113.238.136
@@ -83710,12 +83739,12 @@
  62.119.24.133
  62.12.108.163
  62.12.108.36
+62.12.72.92
  62.122.195.162
  62.122.201.170
  62.122.201.241
  62.122.201.246
  62.13.193.206
-62.131.72.96
  62.133.130.122
  62.133.162.51
  62.133.174.247
@@ -83731,6 +83760,7 @@
  62.138.145.62
  62.138.16.231
  62.138.162.12
+62.138.19.36
  62.138.2.243
  62.138.206.160
  62.14.231.138
@@ -83738,20 +83768,20 @@
  62.140.23.192
  62.140.247.10
  62.140.252.72
-62.141.125.126
  62.141.44.19
  62.141.45.90
  62.141.47.10
  62.141.50.135
  62.141.66.110
-62.143.161.88
+62.143.168.255
  62.143.39.246
  62.143.85.253
+62.148.142.202
  62.149.118.150
  62.149.143.141
  62.149.175.39
  62.149.193.35
-62.149.20.62
+62.149.20.61
  62.149.202.3
  62.149.29.56
  62.149.5.18
@@ -83759,7 +83789,8 @@
  62.149.7.165
  62.149.7.169
  62.149.7.173
-62.150.170.62
+62.15.32.87
+62.152.183.4
  62.152.58.16
  62.153.103.153
  62.153.89.22
@@ -83772,8 +83803,10 @@
  62.165.211.114
  62.165.223.197
  62.168.57.109
+62.169.198.18
  62.169.204.8
  62.169.236.36
+62.170.5.87
  62.171.129.32
  62.171.132.71
  62.171.133.27
@@ -83783,7 +83816,6 @@
  62.171.142.179
  62.171.144.155
  62.171.145.148
-62.171.145.232
  62.171.152.105
  62.171.154.12
  62.171.154.196
@@ -83795,8 +83827,8 @@
  62.171.161.47
  62.171.162.84
  62.171.164.69
+62.171.168.182
  62.171.170.82
-62.171.171.8
  62.171.172.104
  62.171.173.123
  62.171.174.192
@@ -83813,13 +83845,11 @@
  62.173.149.24
  62.173.154.183
  62.173.166.68
-62.175.49.128
  62.176.1.194
  62.176.12.111
  62.176.5.93
  62.178.137.113
  62.178.138.46
-62.178.30.111
  62.182.114.164
  62.182.124.205
  62.182.124.206
@@ -83840,17 +83870,19 @@
  62.195.75.40
  62.195.9.55
  62.195.95.229
+62.197.112.195
  62.197.208.36
+62.197.222.24
  62.197.233.247
  62.2.98.55
-62.20.79.211
+62.20.175.83
  62.201.210.134
  62.201.218.18
  62.201.221.26
  62.201.233.59
  62.201.253.66
  62.201.254.44
-62.205.248.22
+62.205.169.74
  62.210.10.247
  62.210.100.139
  62.210.103.45
@@ -83860,7 +83892,6 @@
  62.210.107.201
  62.210.107.45
  62.210.108.225
-62.210.111.15
  62.210.111.42
  62.210.111.45
  62.210.113.143
@@ -83879,7 +83910,6 @@
  62.210.137.165
  62.210.139.243
  62.210.139.92
-62.210.140.97
  62.210.141.185
  62.210.141.227
  62.210.141.58
@@ -83889,7 +83919,6 @@
  62.210.148.246
  62.210.148.247
  62.210.148.87
-62.210.149.41
  62.210.149.68
  62.210.152.87
  62.210.152.90
@@ -83926,6 +83955,7 @@
  62.210.207.8
  62.210.209.245
  62.210.209.94
+62.210.215.3
  62.210.217.35
  62.210.243.247
  62.210.244.229
@@ -83942,6 +83972,7 @@
  62.210.5.92
  62.210.6.223
  62.210.6.33
+62.210.6.93
  62.210.69.173
  62.210.69.176
  62.210.69.211
@@ -83949,6 +83980,7 @@
  62.210.71.120
  62.210.72.181
  62.210.73.11
+62.210.75.68
  62.210.77.52
  62.210.78.60
  62.210.80.2
@@ -83956,9 +83988,11 @@
  62.210.80.46
  62.210.80.66
  62.210.80.68
+62.210.80.79
  62.210.82.105
  62.210.82.173
  62.210.83.122
+62.210.83.193
  62.210.83.241
  62.210.83.87
  62.210.83.88
@@ -83966,6 +84000,7 @@
  62.210.90.118
  62.210.91.17
  62.210.91.20
+62.210.91.62
  62.210.94.159
  62.210.97.48
  62.210.99.100
@@ -83978,19 +84013,20 @@
  62.213.97.6
  62.214.252.110
  62.214.252.15
+62.214.252.87
  62.215.127.73
  62.216.81.175
  62.216.93.204
+62.219.138.44
  62.219.194.210
  62.221.121.185
-62.221.209.84
  62.221.77.251
-62.225.141.158
-62.227.99.34
+62.228.116.231
  62.228.152.100
  62.228.205.38
  62.23.15.92
  62.231.245.5
+62.232.216.220
  62.232.8.82
  62.233.37.237
  62.233.57.200
@@ -84012,6 +84048,7 @@
  62.234.130.87
  62.234.134.153
  62.234.137.128
+62.234.137.26
  62.234.138.98
  62.234.139.201
  62.234.146.45
@@ -84029,7 +84066,6 @@
  62.234.20.135
  62.234.20.222
  62.234.20.26
-62.234.208.153
  62.234.21.198
  62.234.213.198
  62.234.217.203
@@ -84044,7 +84080,6 @@
  62.234.4.228
  62.234.41.136
  62.234.42.165
-62.234.53.130
  62.234.55.197
  62.234.58.195
  62.234.59.200
@@ -84067,7 +84102,6 @@
  62.234.94.65
  62.234.97.207
  62.234.99.30
-62.238.12.157
  62.238.161.92
  62.239.8.236
  62.24.109.77
@@ -84078,17 +84112,16 @@
  62.24.78.2
  62.240.157.54
  62.240.2.41
-62.240.24.102
+62.240.28.14
  62.240.4.4
  62.244.140.12
  62.244.20.38
  62.245.152.33
-62.250.161.145
  62.250.183.59
-62.250.200.133
  62.251.102.242
  62.251.109.216
  62.251.109.38
+62.251.111.209
  62.251.54.163
  62.251.78.171
  62.253.169.206
@@ -84114,7 +84147,6 @@
  62.33.207.98
  62.33.7.81
  62.37.211.7
-62.38.159.104
  62.38.75.208
  62.4.10.153
  62.4.14.183
@@ -84122,17 +84154,16 @@
  62.4.14.206
  62.4.16.167
  62.4.18.68
+62.4.21.134
  62.4.21.231
  62.4.23.127
+62.4.29.88
  62.4.55.104
-62.4.55.234
  62.4.60.50
  62.44.70.253
  62.44.82.61
-62.45.5.125
  62.45.96.7
  62.46.235.82
-62.46.28.85
  62.56.250.68
  62.57.185.15
  62.57.196.222
@@ -84140,6 +84171,7 @@
  62.6.237.182
  62.63.157.106
  62.63.249.166
+62.65.106.117
  62.67.212.41
  62.67.235.148
  62.67.235.70
@@ -84148,8 +84180,6 @@
  62.68.246.27
  62.73.127.10
  62.73.127.98
-62.74.110.143
-62.74.113.134
  62.74.153.118
  62.75.139.29
  62.75.141.82
@@ -84162,8 +84192,8 @@
  62.75.204.249
  62.75.207.124
  62.75.216.136
-62.75.217.161
  62.75.222.59
+62.75.223.158
  62.75.223.94
  62.76.133.180
  62.76.94.9
@@ -84172,7 +84202,6 @@
  62.77.173.85
  62.77.55.23
  62.78.92.35
-62.80.189.30
  62.80.227.49
  62.80.235.224
  62.81.76.18
@@ -84181,15 +84210,17 @@
  62.83.142.14
  62.83.78.94
  62.84.75.50
+62.85.13.157
+62.85.43.155
  62.85.77.116
-62.87.116.90
  62.87.151.132
  62.87.151.138
  62.87.151.186
  62.89.28.108
  62.90.165.236
  62.90.175.115
-62.91.20.222
+62.90.82.99
+62.92.48.242
  62.94.148.111
  62.94.153.133
  62.94.193.216
@@ -84269,6 +84300,7 @@
  63.143.32.126
  63.143.38.226
  63.143.45.19
+63.143.57.26
  63.143.98.254
  63.143.98.57
  63.145.54.201
@@ -84286,33 +84318,12 @@
  63.152.15.167
  63.152.23.64
  63.152.34.205
-63.152.56.224
-63.152.90.163
-63.153.146.141
  63.153.165.143
-63.153.178.14
  63.153.241.58
  63.155.133.153
  63.155.38.175
-63.155.4.235
  63.155.64.87
-63.155.72.189
  63.155.93.9
-63.168.169.172
-63.168.169.173
-63.168.169.174
-63.168.169.175
-63.168.169.208
-63.168.169.209
-63.168.169.210
-63.168.169.211
-63.168.169.44
-63.168.169.45
-63.168.169.46
-63.168.169.80
-63.168.169.81
-63.168.169.82
-63.168.169.83
  63.170.254.21
  63.199.35.6
  63.220.1.43
@@ -84322,22 +84333,15 @@
  63.224.37.22
  63.224.37.3
  63.225.38.15
-63.225.82.246
-63.225.84.105
-63.225.84.55
  63.226.58.155
  63.227.116.162
  63.227.147.118
  63.228.117.99
  63.229.211.84
  63.229.213.235
-63.229.213.237
  63.229.214.20
-63.229.222.115
  63.229.223.55
  63.231.132.28
-63.231.148.56
-63.234.49.48
  63.235.160.54
  63.240.155.81
  63.243.252.246
@@ -84359,7 +84363,7 @@
  63.249.96.19
  63.250.32.183
  63.250.32.184
-63.250.32.241
+63.250.32.243
  63.250.32.76
  63.250.33.127
  63.250.36.100
@@ -84377,20 +84381,11 @@
  63.32.35.79
  63.32.57.156
  63.33.204.91
-63.41.225.61
-63.41.36.219
+63.40.244.214
+63.41.36.220
  63.41.9.210
  63.80.184.72
-63.81.82.127
-63.81.82.128
-63.81.82.129
-63.81.82.130
-63.81.82.131
-63.81.82.138
-63.81.82.139
-63.81.82.141
-63.81.82.142
-63.81.82.145
+63.81.82.10
  63.81.82.146
  63.81.82.147
  63.81.82.148
@@ -84399,26 +84394,27 @@
  63.81.82.151
  63.81.82.152
  63.81.82.153
-63.81.82.16
-63.81.82.18
+63.81.82.154
+63.81.82.155
+63.81.82.157
+63.81.82.158
+63.81.82.159
+63.81.82.160
  63.81.82.19
  63.81.82.20
-63.81.82.21
  63.81.82.22
  63.81.82.24
  63.81.82.25
  63.81.82.26
  63.81.82.27
-63.81.82.37
-63.81.82.38
-63.81.82.39
+63.81.82.29
+63.81.82.30
  63.81.82.40
-63.81.82.41
  63.81.82.42
+63.81.82.43
  63.81.82.44
  63.81.82.45
  63.81.82.46
-63.81.82.47
  63.81.82.48
  63.81.82.49
  63.81.82.5
@@ -84426,16 +84422,9 @@
  63.81.82.51
  63.81.82.52
  63.81.82.53
+63.81.82.55
  63.81.82.6
-63.81.82.63
-63.81.82.64
-63.81.82.65
-63.81.82.66
-63.81.82.67
-63.81.82.68
-63.81.82.69
  63.81.82.7
-63.81.82.70
  63.81.82.71
  63.81.82.72
  63.81.82.73
@@ -84444,7 +84433,15 @@
  63.81.82.76
  63.81.82.77
  63.81.82.78
-63.81.95.132
+63.81.82.79
+63.81.82.8
+63.81.82.80
+63.81.82.81
+63.81.82.82
+63.81.82.83
+63.81.82.84
+63.81.82.86
+63.81.82.9
  63.88.57.202
  630068-dot-n-e-w-me-ss-age-po-rt-al.wl.r.appspot.com
  630124578416503-dot-wah-cgo-lsb.appspot.com
@@ -84483,15 +84480,16 @@
  64.113.32.29
  64.118.84.7
  64.119.192.170
-64.119.195.128
  64.119.197.115
  64.119.213.61
+64.119.27.247
  64.120.239.130
  64.120.51.146
  64.124.100.52
  64.128.143.65
  64.128.143.70
  64.13.225.150
+64.130.168.92
  64.130.171.107
  64.130.215.121
  64.134.167.232
@@ -84511,17 +84509,12 @@
  64.140.150.169
  64.140.169.42
  64.141.19.180
-64.145.76.110
  64.145.76.158
  64.145.76.57
-64.145.79.10
-64.145.79.151
-64.145.79.171
-64.145.79.177
-64.145.93.43
-64.145.94.118
-64.145.94.16
-64.145.94.99
+64.145.79.225
+64.145.93.145
+64.145.94.129
+64.145.94.81
  64.147.114.20
  64.147.19.186
  64.147.6.186
@@ -84547,24 +84540,25 @@
  64.180.6.192
  64.180.80.127
  64.182.235.13
-64.183.100.166
+64.183.168.162
  64.183.185.42
  64.183.73.122
  64.185.14.18
  64.187.169.230
+64.187.175.226
  64.187.217.234
-64.187.226.101
  64.187.99.130
-64.188.140.160
  64.188.19.107
  64.188.30.226
  64.188.44.114
  64.189.249.37
+64.190.95.59
  64.20.36.237
  64.20.49.154
  64.20.52.116
  64.20.53.82
  64.20.56.222
+64.201.107.232
  64.201.134.235
  64.202.102.218
  64.202.161.41
@@ -84572,10 +84566,12 @@
  64.202.184.249
  64.202.186.227
  64.202.187.246
+64.202.188.161
  64.202.188.205
  64.202.189.14
  64.202.189.187
  64.203.116.27
+64.203.250.92
  64.207.144.30
  64.207.152.81
  64.207.184.67
@@ -84588,6 +84584,7 @@
  64.225.100.133
  64.225.100.21
  64.225.101.141
+64.225.101.223
  64.225.105.132
  64.225.106.237
  64.225.106.52
@@ -84601,13 +84598,15 @@
  64.225.119.100
  64.225.119.164
  64.225.121.105
+64.225.124.42
  64.225.125.7
+64.225.14.15
  64.225.15.202
  64.225.18.167
  64.225.19.231
  64.225.25.111
+64.225.25.130
  64.225.25.59
-64.225.26.75
  64.225.27.83
  64.225.3.204
  64.225.30.67
@@ -84617,11 +84616,13 @@
  64.225.47.15
  64.225.51.115
  64.225.51.21
+64.225.51.46
  64.225.52.66
  64.225.53.142
  64.225.53.232
  64.225.53.31
  64.225.56.47
+64.225.58.1
  64.225.58.183
  64.225.58.70
  64.225.59.27
@@ -84645,7 +84646,6 @@
  64.227.107.151
  64.227.109.20
  64.227.111.127
-64.227.113.150
  64.227.113.211
  64.227.113.76
  64.227.113.94
@@ -84682,12 +84682,15 @@
  64.227.126.101
  64.227.126.250
  64.227.126.81
+64.227.127.100
  64.227.13.158
  64.227.13.20
+64.227.14.6
  64.227.15.172
  64.227.2.136
  64.227.2.138
  64.227.2.152
+64.227.2.2
  64.227.20.83
  64.227.24.158
  64.227.24.39
@@ -84699,8 +84702,8 @@
  64.227.31.182
  64.227.31.81
  64.227.33.176
-64.227.33.185
  64.227.33.30
+64.227.34.196
  64.227.35.148
  64.227.35.175
  64.227.35.222
@@ -84711,15 +84714,14 @@
  64.227.41.21
  64.227.43.134
  64.227.43.248
-64.227.46.1
  64.227.46.160
  64.227.46.5
  64.227.46.80
  64.227.47.1
  64.227.5.37
  64.227.50.225
+64.227.53.63
  64.227.57.139
-64.227.59.68
  64.227.67.106
  64.227.7.99
  64.227.71.34
@@ -84728,6 +84730,7 @@
  64.227.8.206
  64.227.81.135
  64.227.84.163
+64.227.97.116
  64.227.97.247
  64.231.23.193
  64.232.166.231
@@ -84744,12 +84747,14 @@
  64.235.204.98
  64.235.211.78
  64.235.243.55
+64.235.38.47
  64.235.90.126
  64.237.49.68
  64.239.69.157
  64.244.93.96
  64.25.215.250
  64.250.112.70
+64.255.151.202
  64.27.10.80
  64.29.146.185
  64.31.10.194
@@ -84768,7 +84773,6 @@
  64.34.177.222
  64.34.216.190
  64.34.65.10
-64.35.197.71
  64.37.48.28
  64.37.49.129
  64.38.225.100
@@ -84780,16 +84784,15 @@
  64.4.98.235
  64.40.250.5
  64.42.183.66
-64.43.19.130
  64.44.133.131
  64.44.40.66
  64.44.48.105
-64.44.48.12
  64.44.48.180
  64.44.48.216
  64.46.4.160
  64.46.6.37
  64.50.161.60
+64.52.30.76
  64.52.85.184
  64.52.85.67
  64.53.14.211
@@ -84807,13 +84810,12 @@
  64.62.251.26
  64.62.252.163
  64.64.104.10
-64.64.117.147
  64.64.121.92
+64.64.121.93
  64.64.227.224
  64.64.239.39
  64.66.18.213
  64.68.224.190
-64.68.224.2
  64.69.57.110
  64.69.57.119
  64.69.57.127
@@ -84918,7 +84920,6 @@
  64.74.160.251
  64.74.215.158
  64.74.215.59
-64.74.216.91
  64.76.23.57
  64.77.235.166
  64.78.51.167
@@ -84926,6 +84927,7 @@
  64.79.100.23
  64.79.100.51
  64.79.104.40
+64.79.120.18
  64.79.50.35
  64.79.65.89
  64.79.85.205
@@ -84953,11 +84955,12 @@
  64.91.248.243
  64.91.254.11
  64.91.4.131
-64.91.64.242
  64.91.68.149
  64.92.112.118
  64.94.210.112
-64.94.211.6
+64.94.211.117
+64.94.211.253
+64.94.211.64
  64.95.102.36
  64.95.98.10
  64.95.98.11
@@ -84985,67 +84988,53 @@
  649552219977630-dot-aql-rkl-evh.appspot.com
  64afe3595b5d8be9d60b91dae8c8bac4c1d83d72.info
  64bcf0cbd205160fc348d46e26baa31239b47dfa.info
+64ghhffhhgfgfddgdnewomoihustleds1ooshuooooooooooo.s3.us-east-2.amazonaws.com
  65.0.151.255
  65.0.151.33
+65.0.173.107
  65.0.227.231
+65.0.32.109
  65.1.1.150
  65.1.109.124
  65.1.109.42
+65.1.25.234
  65.1.33.239
  65.1.89.200
-65.101.247.26
  65.101.247.82
  65.101.247.83
-65.102.11.110
  65.102.11.51
-65.102.186.78
-65.102.79.95
  65.107.59.68
  65.111.119.55
  65.111.165.14
  65.111.165.192
  65.111.173.161
-65.111.181.65
  65.127.65.2
  65.128.144.23
  65.128.223.138
-65.129.11.185
  65.129.117.94
  65.129.136.168
-65.129.158.215
  65.129.18.196
  65.129.209.87
  65.129.218.5
  65.129.3.230
  65.129.6.83
-65.129.69.251
-65.129.76.167
  65.129.86.15
  65.130.33.85
  65.130.39.119
  65.130.39.18
-65.131.146.161
-65.131.162.129
  65.131.19.40
  65.131.20.190
  65.131.205.231
  65.131.218.250
  65.131.218.42
-65.131.219.192
-65.131.222.37
  65.131.223.237
  65.131.225.160
  65.131.227.180
-65.131.227.67
  65.131.233.85
-65.131.237.206
  65.131.241.74
  65.131.242.211
  65.131.245.180
  65.131.246.54
-65.131.249.113
-65.131.57.165
-65.131.89.143
  65.131.95.134
  65.151.177.93
  65.151.188.94
@@ -85057,8 +85046,7 @@
  65.172.242.225
  65.172.242.249
  65.172.242.82
-65.18.114.254
-65.18.115.51
+65.18.121.212
  65.18.157.227
  65.18.192.85
  65.18.192.91
@@ -85080,11 +85068,11 @@
  65.196.87.161
  65.207.141.196
  65.207.23.201
+65.21.0.95
  65.21.1.190
  65.21.2.132
  65.21.2.254
  65.21.4.6
-65.21.5.216
  65.21.6.96
  65.210.27.132
  65.214.67.49
@@ -85093,6 +85081,7 @@
  65.24.37.71
  65.24.54.99
  65.25.114.133
+65.25.215.121
  65.254.32.98
  65.254.51.178
  65.255.209.18
@@ -85108,6 +85097,7 @@
  65.32.168.171
  65.34.50.151
  65.35.192.46
+65.35.54.84
  65.35.61.255
  65.36.62.20
  65.36.83.142
@@ -85116,7 +85106,6 @@
  65.38.2.184
  65.38.71.6
  65.41.155.160
-65.41.180.56
  65.41.191.64
  65.41.75.21
  65.49.132.179
@@ -85151,7 +85140,6 @@
  65.60.53.122
  65.61.221.151
  65.64.8.59
-65.74.28.94
  65.75.128.151
  65.78.4.234
  65.78.98.124
@@ -85160,10 +85148,13 @@
  65.79.205.104
  65.88.123.136
  65.90.11.55
+65.92.74.134
+65.93.25.232
  65.94.25.216
  65.96.153.214
  65.96.155.167
  65.96.186.179
+65.96.255.15
  65.99.201.38
  65.99.242.18
  650flwersinsta.000webhostapp.com
@@ -85209,7 +85200,6 @@
  66.11.230.202
  66.11.240.250
  66.110.114.178
-66.110.228.60
  66.110.255.228
  66.111.39.40
  66.111.41.200
@@ -85223,6 +85213,7 @@
  66.112.218.78
  66.113.225.195
  66.114.33.90
+66.115.173.164
  66.115.173.18
  66.117.3.211
  66.117.5.64
@@ -85239,9 +85230,9 @@
  66.135.227.182
  66.135.34.113
  66.135.79.25
+66.143.231.89
  66.146.162.21
  66.146.193.33
-66.146.239.19
  66.147.240.188
  66.147.244.189
  66.147.244.216
@@ -85259,10 +85250,10 @@
  66.154.105.123
  66.154.111.232
  66.154.112.136
+66.154.123.139
  66.154.125.164
  66.160.128.215
  66.160.134.3
-66.160.140.179
  66.160.144.159
  66.160.201.15
  66.163.184.246
@@ -85273,9 +85264,9 @@
  66.171.167.212
  66.172.110.160
  66.172.8.101
-66.172.99.210
  66.173.15.222
  66.175.122.228
+66.175.208.207
  66.175.208.248
  66.175.210.140
  66.175.210.54
@@ -85291,12 +85282,11 @@
  66.18.172.21
  66.18.4.147
  66.18.66.193
-66.181.166.123
+66.181.177.190
  66.181.178.169
  66.181.180.208
  66.181.94.150
  66.183.0.205
-66.183.20.254
  66.186.10.67
  66.191.121.190
  66.192.70.36
@@ -85317,7 +85307,6 @@
  66.203.207.67
  66.203.208.244
  66.205.135.34
-66.205.88.64
  66.206.13.51
  66.206.50.244
  66.206.52.5
@@ -85343,7 +85332,6 @@
  66.216.127.211
  66.220.247.9
  66.222.252.124
-66.225.195.238
  66.225.198.218
  66.225.231.58
  66.225.232.52
@@ -85365,6 +85353,7 @@
  66.228.60.135
  66.229.161.86
  66.23.192.47
+66.23.252.226
  66.230.192.172
  66.230.213.52
  66.230.230.230
@@ -85379,6 +85368,7 @@
  66.240.192.138
  66.240.219.146
  66.240.231.154
+66.240.236.119
  66.240.237.155
  66.240.237.172
  66.243.251.45
@@ -85428,7 +85418,6 @@
  66.42.224.229
  66.42.38.146
  66.42.43.136
-66.42.44.43
  66.42.51.1
  66.42.53.154
  66.42.58.34
@@ -85440,7 +85429,6 @@
  66.42.99.216
  66.44.117.52
  66.44.14.135
-66.44.52.23
  66.45.248.245
  66.45.251.148
  66.45.255.91
@@ -85453,11 +85441,11 @@
  66.56.83.203
  66.57.108.14
  66.57.6.23
-66.58.227.28
  66.61.94.36
  66.63.165.7
-66.65.126.132
-66.65.171.93
+66.65.14.225
+66.65.15.115
+66.66.243.113
  66.68.187.140
  66.69.127.115
  66.69.20.214
@@ -85490,15 +85478,14 @@
  66.71.253.10
  66.74.7.197
  66.76.58.60
+66.79.120.131
  66.79.163.22
  66.8.170.54
  66.8.203.16
  66.82.22.79
  66.84.18.202
-66.84.37.154
  66.84.9.244
  66.84.95.6
-66.85.133.188
  66.85.147.16
  66.85.149.114
  66.85.157.104
@@ -85508,14 +85495,11 @@
  66.85.47.62
  66.86.130.127
  66.86.132.132
-66.86.133.206
  66.86.134.39
  66.86.40.184
  66.86.41.27
-66.86.42.93
  66.86.43.232
  66.86.43.26
-66.86.47.58
  66.90.118.42
  66.90.255.99
  66.91.139.2
@@ -85529,6 +85513,7 @@
  66.98.115.108
  66.98.117.24
  66.98.118.13
+66.98.119.116
  66.98.121.192
  66.98.126.203
  66.98.45.242
@@ -85555,25 +85540,18 @@
  67.0.200.148
  67.0.30.116
  67.0.69.110
-67.0.75.43
-67.0.83.24
  67.1.116.108
-67.1.118.21
-67.1.13.6
-67.1.136.75
  67.1.164.85
  67.1.23.222
  67.1.238.105
-67.1.44.82
  67.10.231.39
  67.10.61.12
  67.107.13.158
  67.107.8.13
  67.107.89.60
  67.11.139.67
-67.11.6.124
+67.11.175.104
  67.134.17.67
-67.140.176.219
  67.149.131.49
  67.149.208.37
  67.149.32.99
@@ -85583,7 +85561,6 @@
  67.159.26.127
  67.159.3.18
  67.161.14.41
-67.161.68.71
  67.161.93.197
  67.162.140.70
  67.163.129.15
@@ -85597,21 +85574,21 @@
  67.167.104.190
  67.168.223.110
  67.168.56.253
-67.169.119.230
  67.170.122.121
  67.170.72.219
  67.171.183.11
  67.172.145.70
  67.172.158.135
  67.173.5.122
-67.174.12.246
  67.174.205.218
  67.176.234.230
+67.176.235.114
  67.180.251.161
  67.185.19.126
  67.186.197.78
  67.187.238.121
  67.188.102.44
+67.188.105.86
  67.189.75.141
  67.19.107.26
  67.19.118.186
@@ -85640,18 +85617,16 @@
  67.198.140.87
  67.198.140.89
  67.198.140.92
-67.198.205.4
  67.198.228.99
  67.199.146.71
  67.199.68.195
  67.2.240.121
-67.2.69.207
  67.2.74.63
  67.2.9.226
  67.20.174.54
  67.20.61.70
  67.201.11.53
-67.201.61.149
+67.202.0.62
  67.202.202.202
  67.202.75.242
  67.204.1.222
@@ -85669,6 +85644,7 @@
  67.205.134.170
  67.205.137.177
  67.205.138.198
+67.205.138.7
  67.205.139.170
  67.205.140.101
  67.205.140.87
@@ -85677,7 +85653,6 @@
  67.205.145.123
  67.205.146.12
  67.205.146.211
-67.205.147.66
  67.205.148.90
  67.205.150.14
  67.205.150.155
@@ -85685,7 +85660,6 @@
  67.205.150.64
  67.205.151.47
  67.205.152.40
-67.205.153.12
  67.205.154.115
  67.205.154.55
  67.205.157.2
@@ -85711,6 +85685,7 @@
  67.205.179.170
  67.205.181.229
  67.205.181.52
+67.205.182.253
  67.205.183.125
  67.205.186.76
  67.205.186.83
@@ -85755,14 +85730,15 @@
  67.207.93.165
  67.207.93.228
  67.207.94.180
+67.207.95.230
  67.208.195.20
-67.209.114.160
-67.209.127.211
  67.209.176.31
  67.209.185.210
  67.209.185.37
  67.209.189.242
  67.209.190.12
+67.209.248.43
+67.209.79.254
  67.209.93.170
  67.210.228.203
  67.211.129.161
@@ -85779,6 +85755,7 @@
  67.213.201.172
  67.213.212.11
  67.213.212.12
+67.213.212.15
  67.213.212.16
  67.213.75.205
  67.213.82.137
@@ -85809,7 +85786,6 @@
  67.218.147.191
  67.218.155.13
  67.218.157.224
-67.218.237.213
  67.218.4.178
  67.219.113.49
  67.219.34.51
@@ -85817,7 +85793,6 @@
  67.22.223.9
  67.220.144.83
  67.220.144.90
-67.220.57.181
  67.221.105.148
  67.222.1.40
  67.222.10.47
@@ -85832,6 +85807,7 @@
  67.225.179.64
  67.225.196.53
  67.225.244.34
+67.225.31.100
  67.227.134.140
  67.227.167.130
  67.227.193.174
@@ -85892,67 +85868,36 @@
  67.229.93.50
  67.229.97.227
  67.23.244.96
+67.230.173.18
  67.230.190.2
  67.230.191.205
  67.231.16.205
-67.232.11.1
-67.232.114.153
-67.232.121.115
-67.232.127.102
-67.232.127.89
  67.232.183.91
  67.232.187.190
  67.232.190.120
  67.232.191.226
-67.232.196.95
  67.232.197.140
-67.232.200.170
-67.232.202.234
  67.232.204.54
  67.232.59.114
-67.232.82.211
-67.232.88.33
-67.232.89.245
  67.232.94.54
  67.233.108.174
-67.233.110.80
  67.233.115.56
-67.233.126.186
  67.233.128.250
-67.233.130.193
  67.233.132.217
  67.233.139.122
  67.233.139.151
-67.233.139.8
  67.233.144.67
-67.233.155.111
  67.233.155.131
  67.233.158.210
-67.233.160.247
  67.233.165.10
-67.233.165.64
-67.233.177.110
-67.233.177.214
-67.233.178.188
  67.233.18.9
  67.233.183.39
-67.233.188.200
-67.233.189.193
  67.233.189.224
-67.233.190.206
-67.233.191.190
-67.233.60.112
  67.233.63.199
-67.233.65.43
  67.233.67.144
-67.233.73.227
  67.233.75.223
-67.233.77.162
  67.233.79.194
-67.233.80.132
  67.233.80.73
-67.233.84.29
-67.233.87.19
  67.233.87.57
  67.234.103.103
  67.234.117.8
@@ -85964,75 +85909,45 @@
  67.234.16.134
  67.234.171.5
  67.234.172.76
-67.234.179.23
-67.234.18.85
-67.234.184.202
  67.234.184.66
  67.234.186.126
-67.234.186.168
  67.234.186.210
  67.234.187.179
  67.234.189.36
-67.234.2.27
-67.234.20.69
-67.234.227.79
-67.234.26.200
  67.234.26.52
  67.234.31.177
-67.234.34.145
  67.234.35.47
  67.234.38.47
-67.234.39.23
  67.234.40.53
-67.234.42.214
  67.234.44.101
  67.234.44.67
  67.234.47.124
  67.234.47.189
-67.234.48.154
  67.234.48.190
  67.234.49.73
-67.234.49.9
-67.234.5.213
-67.234.5.56
  67.234.50.233
-67.234.54.5
  67.234.64.154
  67.234.77.109
  67.234.96.140
-67.235.128.201
-67.235.130.196
  67.235.132.226
  67.235.135.239
  67.235.135.60
  67.235.137.169
-67.235.140.68
-67.235.141.218
  67.235.15.135
-67.235.193.88
-67.235.194.68
-67.235.195.233
  67.235.197.121
  67.235.197.136
  67.235.197.171
  67.235.2.203
-67.235.201.64
  67.235.206.144
  67.235.213.139
-67.235.216.141
  67.235.220.220
-67.235.222.11
  67.235.223.95
-67.235.229.217
-67.235.234.209
  67.235.3.43
-67.235.33.0
  67.235.36.153
  67.235.5.25
  67.235.68.95
  67.235.99.253
  67.236.12.127
-67.236.14.86
  67.236.33.56
  67.236.35.89
  67.237.19.149
@@ -86042,124 +85957,87 @@
  67.237.24.39
  67.237.24.46
  67.237.54.112
-67.237.57.21
  67.237.85.134
  67.238.128.69
  67.238.129.108
  67.238.130.181
-67.238.130.193
-67.238.136.200
  67.238.137.176
  67.238.139.250
-67.238.141.99
  67.238.142.36
  67.238.142.52
  67.238.147.94
  67.238.148.225
-67.238.149.165
-67.238.151.165
  67.238.155.88
-67.238.159.211
-67.238.162.42
  67.238.163.6
  67.238.163.76
  67.238.166.9
  67.238.169.160
  67.238.170.94
  67.238.172.87
-67.238.172.89
  67.238.173.97
  67.239.132.176
-67.239.134.177
-67.239.168.237
  67.239.182.157
  67.240.254.142
  67.241.150.89
+67.243.233.2
  67.245.47.152
-67.246.181.19
  67.247.22.17
+67.248.125.125
  67.248.223.85
  67.249.107.195
-67.249.11.197
+67.249.189.74
  67.249.6.123
-67.250.191.201
  67.251.64.168
  67.253.174.70
  67.253.203.141
  67.253.72.119
-67.254.185.74
  67.255.253.25
  67.29.139.234
-67.3.105.15
  67.3.152.92
  67.3.19.102
-67.3.5.1
  67.4.0.72
-67.4.101.68
  67.4.102.115
  67.4.102.49
-67.4.102.62
  67.4.104.118
  67.4.104.202
  67.4.11.203
  67.4.169.128
-67.4.17.27
  67.4.23.177
-67.4.24.83
-67.4.29.249
  67.4.36.53
  67.4.37.189
  67.4.39.9
  67.4.41.10
-67.4.41.79
  67.4.43.98
  67.4.45.108
  67.4.48.41
  67.4.50.182
-67.4.50.25
  67.4.50.64
  67.4.51.35
-67.4.52.240
  67.4.53.181
-67.4.55.183
  67.4.56.53
  67.4.58.11
  67.4.60.185
-67.4.68.64
-67.4.70.224
  67.4.70.242
-67.4.72.199
  67.4.75.123
-67.4.75.192
  67.4.78.166
  67.4.82.135
  67.4.87.68
-67.4.9.184
  67.4.91.139
-67.4.92.234
-67.4.93.102
-67.4.99.143
  67.40.148.193
  67.41.8.71
-67.42.12.246
  67.42.148.155
  67.42.151.2
  67.42.156.21
  67.42.157.140
  67.42.197.20
-67.42.220.203
-67.42.79.235
+67.43.224.131
  67.43.224.136
  67.43.224.142
-67.43.7.162
+67.43.245.15
  67.48.50.126
-67.5.0.131
-67.5.1.167
-67.5.21.46
+67.5.102.190
  67.5.28.164
-67.5.5.8
-67.5.9.74
-67.52.10.10
+67.52.125.58
  67.52.127.114
  67.52.228.149
  67.53.72.130
@@ -86170,48 +86048,37 @@
  67.59.151.227
  67.59.156.163
  67.6.102.46
-67.6.125.71
-67.6.126.56
-67.6.138.140
  67.6.140.204
  67.6.157.21
  67.6.175.44
  67.6.178.167
  67.6.22.5
-67.6.23.117
  67.6.30.147
  67.6.52.243
-67.6.61.56
  67.6.66.58
  67.6.73.241
-67.6.83.13
-67.6.90.40
  67.6.97.130
  67.6.99.195
  67.60.137.219
+67.63.94.101
  67.68.28.206
-67.69.76.108
  67.69.76.20
  67.7.102.182
  67.7.103.108
  67.7.115.167
  67.7.2.99
  67.7.24.57
-67.7.26.36
  67.7.27.133
  67.7.30.181
  67.7.37.146
  67.7.43.99
  67.7.50.159
  67.7.52.28
-67.7.58.107
  67.7.59.127
  67.7.60.1
  67.7.62.98
  67.7.64.101
-67.7.83.103
  67.7.98.181
-67.7.99.213
  67.70.146.48
  67.70.18.29
  67.71.223.61
@@ -86219,16 +86086,14 @@
  67.75.2.39
  67.76.169.131
  67.76.39.94
-67.77.221.240
  67.78.143.182
  67.78.156.22
  67.78.45.14
-67.79.105.174
-67.79.221.52
  67.79.44.82
  67.80.164.152
  67.83.49.234
  67.87.112.54
+67.87.170.242
  67.9.74.121
  67.9.74.122
  67.9.74.123
@@ -86253,8 +86118,8 @@
  67ytfffyt.ddns.net
  68.0.185.136
  68.0.230.118
+68.1.191.25
  68.1.44.111
-68.1.44.179
  68.10.137.56
  68.10.18.22
  68.101.62.26
@@ -86263,7 +86128,6 @@
  68.102.92.85
  68.103.208.195
  68.104.31.94
-68.104.65.149
  68.105.142.50
  68.105.210.206
  68.105.215.189
@@ -86273,8 +86137,10 @@
  68.108.234.217
  68.109.233.150
  68.109.71.148
+68.11.84.244
  68.111.3.250
  68.113.97.155
+68.114.122.106
  68.114.203.159
  68.114.229.171
  68.114.239.201
@@ -86282,11 +86148,15 @@
  68.116.125.55
  68.116.41.6
  68.116.72.158
+68.119.130.141
  68.119.137.39
  68.119.215.85
  68.12.162.94
-68.130.210.244
+68.125.100.6
+68.130.210.246
+68.130.210.247
  68.131.72.9
+68.132.130.227
  68.132.136.198
  68.132.64.146
  68.133.75.203
@@ -86297,7 +86167,6 @@
  68.145.134.63
  68.145.170.102
  68.146.113.243
-68.147.85.188
  68.15.151.20
  68.15.4.29
  68.150.197.122
@@ -86314,7 +86183,6 @@
  68.169.40.75
  68.169.43.232
  68.169.51.212
-68.170.255.80
  68.170.36.100
  68.171.103.75
  68.171.131.137
@@ -86323,6 +86191,7 @@
  68.171.217.98
  68.171.65.230
  68.172.243.146
+68.173.185.108
  68.174.15.223
  68.178.103.180
  68.178.128.89
@@ -86368,6 +86237,7 @@
  68.183.10.136
  68.183.10.147
  68.183.10.152
+68.183.10.186
  68.183.100.198
  68.183.102.214
  68.183.105.114
@@ -86376,13 +86246,13 @@
  68.183.110.244
  68.183.110.49
  68.183.112.185
-68.183.113.40
  68.183.115.108
  68.183.117.96
  68.183.119.240
  68.183.119.69
  68.183.12.127
  68.183.12.232
+68.183.12.33
  68.183.12.80
  68.183.120.172
  68.183.120.233
@@ -86409,6 +86279,7 @@
  68.183.14.180
  68.183.14.29
  68.183.140.19
+68.183.142.142
  68.183.143.192
  68.183.144.104
  68.183.145.59
@@ -86428,7 +86299,6 @@
  68.183.169.251
  68.183.170.114
  68.183.177.229
-68.183.177.78
  68.183.178.162
  68.183.178.26
  68.183.179.184
@@ -86441,6 +86311,7 @@
  68.183.182.100
  68.183.184.174
  68.183.186.142
+68.183.186.192
  68.183.186.231
  68.183.186.232
  68.183.186.29
@@ -86453,10 +86324,8 @@
  68.183.191.39
  68.183.191.42
  68.183.192.26
-68.183.193.237
  68.183.203.140
  68.183.203.160
-68.183.205.7
  68.183.207.62
  68.183.208.248
  68.183.209.46
@@ -86464,6 +86333,7 @@
  68.183.212.10
  68.183.215.125
  68.183.216.148
+68.183.216.35
  68.183.217.193
  68.183.218.177
  68.183.219.135
@@ -86472,9 +86342,7 @@
  68.183.22.85
  68.183.221.115
  68.183.221.177
-68.183.222.219
  68.183.223.8
-68.183.224.75
  68.183.227.145
  68.183.227.87
  68.183.229.218
@@ -86490,15 +86358,12 @@
  68.183.237.8
  68.183.240.19
  68.183.27.89
-68.183.27.97
  68.183.28.137
  68.183.29.78
  68.183.30.64
  68.183.31.114
  68.183.32.207
-68.183.35.156
  68.183.35.255
-68.183.36.245
  68.183.38.145
  68.183.38.181
  68.183.4.2
@@ -86521,29 +86386,29 @@
  68.183.66.107
  68.183.66.233
  68.183.66.44
+68.183.67.182
  68.183.68.148
+68.183.7.12
+68.183.7.13
  68.183.70.124
  68.183.71.48
  68.183.75.56
  68.183.77.225
  68.183.77.79
  68.183.78.119
+68.183.79.179
  68.183.8.155
  68.183.8.162
  68.183.8.176
-68.183.8.48
  68.183.81.191
  68.183.82.97
  68.183.83.51
-68.183.84.93
  68.183.86.159
  68.183.86.86
  68.183.88.186
  68.183.9.150
  68.183.9.172
  68.183.9.183
-68.183.9.26
-68.183.9.45
  68.183.92.52
  68.183.94.63
  68.183.97.163
@@ -86559,22 +86424,25 @@
  68.188.63.149
  68.189.184.40
  68.190.212.219
+68.190.214.200
  68.192.74.5
+68.192.81.18
  68.194.85.201
  68.197.33.124
  68.199.157.183
  68.199.159.147
  68.2.104.20
  68.202.18.250
-68.203.22.176
  68.203.9.66
+68.203.96.32
+68.204.106.148
  68.206.25.169
+68.21.169.217
  68.222.218.18
  68.224.249.74
  68.224.6.232
  68.226.217.54
  68.228.184.215
-68.228.215.87
  68.231.7.169
  68.233.22.64
  68.233.33.2
@@ -86583,7 +86451,6 @@
  68.255.156.146
  68.32.78.64
  68.33.169.217
-68.33.90.77
  68.36.135.131
  68.37.91.129
  68.38.190.34
@@ -86600,21 +86467,23 @@
  68.45.38.98
  68.47.41.211
  68.48.131.251
-68.48.240.245
  68.49.1.133
  68.49.10.92
  68.49.83.73
  68.5.173.208
  68.5.37.81
+68.5.92.56
  68.50.46.131
+68.51.161.195
+68.53.128.162
  68.53.195.9
  68.54.100.49
  68.55.218.198
  68.56.160.219
  68.56.203.112
  68.6.208.62
+68.60.137.176
  68.60.2.57
-68.61.132.238
  68.62.245.148
  68.64.168.226
  68.64.168.250
@@ -86636,6 +86505,7 @@
  68.7.42.133
  68.7.42.238
  68.71.133.101
+68.71.249.154
  68.72.80.161
  68.73.117.66
  68.73.49.153
@@ -86723,6 +86593,7 @@
  69.119.31.84
  69.119.85.43
  69.12.28.148
+69.12.66.198
  69.12.66.200
  69.12.66.212
  69.12.66.224
@@ -86734,24 +86605,25 @@
  69.12.75.6
  69.12.80.84
  69.12.84.122
-69.12.85.195
  69.12.88.100
  69.12.88.102
  69.12.88.72
  69.12.90.242
  69.123.21.235
  69.123.245.151
+69.123.67.79
  69.124.231.110
-69.127.102.42
  69.128.36.109
  69.13.196.47
  69.130.201.27
+69.130.207.107
  69.130.218.32
+69.130.241.146
  69.137.140.197
  69.137.195.210
  69.138.110.95
  69.138.189.201
-69.139.69.253
+69.138.226.99
  69.139.90.144
  69.14.117.119
  69.14.145.75
@@ -86762,9 +86634,6 @@
  69.141.15.174
  69.143.214.211
  69.144.106.122
-69.144.99.178
-69.146.151.248
-69.148.169.102
  69.15.68.38
  69.150.120.253
  69.157.101.95
@@ -86772,8 +86641,8 @@
  69.158.55.140
  69.16.231.139
  69.16.252.128
+69.160.250.225
  69.160.38.10
-69.160.8.49
  69.160.96.34
  69.161.195.183
  69.162.105.66
@@ -86857,6 +86726,7 @@
  69.163.165.67
  69.163.165.72
  69.163.165.91
+69.163.165.99
  69.163.166.122
  69.163.166.136
  69.163.166.143
@@ -86869,16 +86739,19 @@
  69.163.167.128
  69.163.167.130
  69.163.167.161
+69.163.167.176
  69.163.167.18
  69.163.169.133
  69.163.178.140
  69.163.179.6
+69.163.239.171
  69.163.248.109
  69.163.33.84
  69.163.35.211
  69.164.145.131
  69.164.194.14
  69.164.195.21
+69.164.196.19
  69.164.196.239
  69.164.199.133
  69.164.201.75
@@ -86908,9 +86781,6 @@
  69.171.78.120
  69.171.78.223
  69.172.165.196
-69.172.232.162
-69.172.232.204
-69.172.78.5
  69.172.87.212
  69.173.184.128
  69.174.245.163
@@ -86920,16 +86790,15 @@
  69.175.29.26
  69.175.44.42
  69.175.49.230
-69.175.71.236
  69.175.83.34
  69.176.145.227
  69.176.89.143
  69.176.89.147
  69.176.89.205
-69.176.89.78
+69.176.89.211
+69.176.89.217
  69.178.49.209
  69.179.0.113
-69.179.128.95
  69.179.129.210
  69.179.131.92
  69.179.229.104
@@ -86963,7 +86832,6 @@
  69.197.189.44
  69.197.189.51
  69.197.32.119
-69.198.152.110
  69.199.44.59
  69.2.244.202
  69.20.153.109
@@ -86974,7 +86842,6 @@
  69.20.94.72
  69.20.94.74
  69.20.94.76
-69.202.156.199
  69.209.23.72
  69.21.245.58
  69.210.185.1
@@ -86994,24 +86861,17 @@
  69.245.71.26
  69.246.26.72
  69.247.161.87
-69.247.80.252
  69.248.146.7
  69.249.137.104
  69.25.236.60
  69.251.93.167
  69.253.71.17
  69.254.146.8
-69.29.154.133
-69.29.208.30
-69.29.210.19
-69.29.210.192
  69.29.211.10
-69.29.249.180
  69.29.250.163
  69.29.77.198
  69.29.77.91
  69.29.78.107
-69.29.79.246
  69.29.87.180
  69.29.87.24
  69.30.198.178
@@ -87056,10 +86916,15 @@
  69.4.32.137
  69.4.88.119
  69.4.88.120
+69.4.88.135
+69.4.88.137
+69.4.88.138
  69.4.88.141
  69.4.89.118
+69.4.89.121
  69.4.89.125
  69.4.90.20
+69.4.90.31
  69.4.94.101
  69.4.94.142
  69.41.0.45
@@ -87070,7 +86935,7 @@
  69.50.181.85
  69.51.24.27
  69.51.24.28
-69.51.66.99
+69.55.142.28
  69.55.202.185
  69.55.234.74
  69.55.35.193
@@ -87083,6 +86948,7 @@
  69.58.178.58
  69.58.178.59
  69.58.2.53
+69.58.4.110
  69.58.6.49
  69.58.6.53
  69.59.18.113
@@ -87094,7 +86960,6 @@
  69.60.36.32
  69.61.200.104
  69.61.8.226
-69.62.250.93
  69.63.16.6
  69.63.170.74
  69.63.73.171
@@ -87107,14 +86972,13 @@
  69.64.46.86
  69.64.51.154
  69.64.51.250
-69.64.54.201
  69.64.57.208
  69.64.62.4
  69.64.67.68
  69.65.3.168
  69.65.65.178
-69.68.208.142
  69.69.213.3
+69.70.17.210
  69.70.59.54
  69.70.75.46
  69.72.169.233
@@ -87124,12 +86988,10 @@
  69.73.133.224
  69.73.144.112
  69.73.28.41
-69.73.37.168
+69.75.133.122
  69.75.175.229
  69.79.194.9
-69.80.26.10
  69.84.240.11
-69.84.77.7
  69.85.223.162
  69.85.70.37
  69.85.92.129
@@ -87140,39 +87002,38 @@
  69.90.135.132
  69.90.185.10
  69.92.102.44
+69.92.132.198
  69.92.67.36
  69.94.114.50
  69.94.12.235
  69.94.125.100
+69.94.147.102
  69.94.147.11
+69.94.147.110
  69.94.147.12
-69.94.147.121
-69.94.147.124
  69.94.147.125
  69.94.147.126
  69.94.147.128
  69.94.147.129
  69.94.147.13
+69.94.147.130
  69.94.147.132
  69.94.147.133
  69.94.147.134
  69.94.147.135
-69.94.147.136
-69.94.147.137
-69.94.147.138
-69.94.147.139
+69.94.147.14
  69.94.147.140
  69.94.147.141
  69.94.147.142
  69.94.147.143
  69.94.147.144
  69.94.147.145
-69.94.147.153
+69.94.147.146
+69.94.147.147
+69.94.147.148
+69.94.147.15
  69.94.147.154
  69.94.147.155
-69.94.147.157
-69.94.147.158
-69.94.147.159
  69.94.147.160
  69.94.147.161
  69.94.147.162
@@ -87180,70 +87041,48 @@
  69.94.147.164
  69.94.147.165
  69.94.147.166
+69.94.147.168
+69.94.147.174
+69.94.147.175
  69.94.147.182
-69.94.147.183
-69.94.147.184
-69.94.147.185
-69.94.147.186
-69.94.147.187
-69.94.147.188
  69.94.147.189
  69.94.147.190
  69.94.147.191
  69.94.147.192
  69.94.147.194
-69.94.147.25
-69.94.147.26
-69.94.147.27
-69.94.147.28
+69.94.147.195
  69.94.147.29
  69.94.147.31
  69.94.147.32
  69.94.147.33
  69.94.147.34
-69.94.147.45
-69.94.147.54
-69.94.147.55
-69.94.147.56
-69.94.147.57
-69.94.147.58
-69.94.147.6
  69.94.147.60
  69.94.147.61
  69.94.147.62
  69.94.147.63
-69.94.147.70
-69.94.147.71
-69.94.147.72
-69.94.147.73
-69.94.147.74
+69.94.147.64
+69.94.147.65
  69.94.147.75
  69.94.147.76
  69.94.147.77
  69.94.147.78
  69.94.147.79
-69.94.147.8
  69.94.147.9
-69.94.147.91
-69.94.147.93
-69.94.147.94
-69.94.147.95
  69.94.147.97
  69.94.147.98
  69.94.147.99
+69.94.152.154
  69.94.152.155
-69.94.152.156
-69.94.152.157
-69.94.152.158
-69.94.152.160
-69.94.152.161
-69.94.152.162
  69.94.152.164
  69.94.152.165
  69.94.152.166
  69.94.152.167
  69.94.152.168
  69.94.152.169
+69.94.152.170
+69.94.152.171
+69.94.152.172
+69.94.152.173
  69.94.27.169
  69348.psdzy.com
  693bst.com
@@ -87288,6 +87127,7 @@
  6fy7tg8y96f87tr.xyz
  6gbofag6.bofa0serivceb.com
  6gsdlmpym.com
+6hhymaxeqmv5w5xyogt2tyl33e--www-paypal-com.translate.goog
  6hj6.work
  6hu.xyz
  6i4sgyjduiahyyg.e8273.pro
@@ -87324,7 +87164,6 @@
  7-medya.com
  7.r2dd.com
  70-40-210-173.unifiedlayer.com
-70.105.169.98
  70.106.150.91
  70.106.193.69
  70.106.219.40
@@ -87332,21 +87171,20 @@
  70.110.160.224
  70.110.26.52
  70.112.169.157
-70.112.72.204
  70.113.86.177
  70.114.59.237
  70.115.61.60
  70.117.70.82
-70.118.85.42
  70.120.122.59
  70.120.24.242
  70.121.172.89
  70.121.219.224
+70.122.12.238
  70.123.116.221
  70.123.125.237
  70.124.169.33
-70.124.47.233
  70.126.196.23
+70.126.48.208
  70.127.155.33
  70.127.209.1
  70.127.96.78
@@ -87355,16 +87193,15 @@
  70.15.242.21
  70.16.157.162
  70.164.0.233
-70.165.64.203
  70.165.65.233
  70.166.167.33
-70.166.167.42
-70.166.167.59
+70.166.167.35
  70.166.204.38
  70.168.249.154
  70.168.249.162
  70.168.249.163
  70.168.249.164
+70.168.37.221
  70.169.129.246
  70.169.149.231
  70.169.150.122
@@ -87372,6 +87209,7 @@
  70.169.70.90
  70.171.130.61
  70.171.21.170
+70.172.186.37
  70.172.73.188
  70.173.251.218
  70.176.86.132
@@ -87401,7 +87239,6 @@
  70.24.190.204
  70.24.194.185
  70.25.91.58
-70.31.218.11
  70.32.0.110
  70.32.115.157
  70.32.78.87
@@ -87427,40 +87264,29 @@
  70.37.50.171
  70.37.66.168
  70.37.75.157
+70.39.113.222
  70.39.150.82
  70.40.210.173
  70.40.213.248
  70.41.17.40
+70.41.17.58
  70.42.131.170
  70.45.133.188
  70.45.228.96
  70.45.30.28
  70.48.238.90
  70.50.149.250
+70.50.53.117
  70.51.18.100
-70.51.88.170
  70.53.185.165
  70.54.172.241
  70.55.114.218
  70.56.192.108
-70.56.192.93
-70.57.100.30
  70.57.107.201
-70.57.108.242
-70.57.243.205
  70.57.81.70
-70.57.83.248
-70.57.86.218
  70.57.88.37
-70.57.89.45
  70.57.90.200
-70.57.93.108
-70.57.94.209
-70.57.97.29
-70.58.196.199
  70.58.203.135
-70.58.205.147
-70.58.23.206
  70.59.123.25
  70.59.162.204
  70.59.236.241
@@ -87471,7 +87297,6 @@
  70.63.170.86
  70.63.80.180
  70.64.48.41
-70.65.161.48
  70.65.175.221
  70.66.139.68
  70.66.166.100
@@ -87481,10 +87306,12 @@
  70.71.148.228
  70.71.236.58
  70.73.151.8
+70.73.168.190
  70.73.96.184
  70.77.92.203
  70.80.14.169
  70.81.37.76
+70.82.42.233
  70.82.75.118
  70.83.106.82
  70.84.177.170
@@ -87509,7 +87336,6 @@
  70.92.245.226
  70.93.129.118
  70.95.127.0
-70.95.132.222
  70.95.18.30
  70.95.8.84
  70.98.34.131
@@ -87530,35 +87356,24 @@
  70cmdbu92cds598.sted.cc
  70efbf02d17896982d2d1d0d249d51e2-dot-oo0-987.appspot.com
  70vimq4rswsc.talagaremix.com
-71.0.147.17
  71.0.151.141
  71.0.171.165
  71.0.190.224
  71.0.208.186
-71.0.209.46
-71.0.210.110
-71.0.213.204
  71.0.213.99
  71.0.70.163
-71.1.112.37
  71.1.114.191
-71.1.144.144
  71.1.151.251
  71.1.152.198
  71.1.153.29
-71.1.157.112
-71.1.157.215
-71.1.204.250
  71.1.233.105
-71.1.244.118
-71.1.249.152
-71.1.27.159
  71.100.48.61
  71.100.77.227
  71.105.116.2
  71.105.155.204
  71.105.44.45
  71.11.74.114
+71.11.99.207
  71.112.212.196
  71.12.234.138
  71.12.45.108
@@ -87567,6 +87382,7 @@
  71.126.181.208
  71.127.156.63
  71.13.105.122
+71.13.61.241
  71.13.87.122
  71.13.92.62
  71.136.142.246
@@ -87587,6 +87403,7 @@
  71.183.205.122
  71.183.251.75
  71.185.31.91
+71.187.229.73
  71.189.180.111
  71.189.24.112
  71.189.47.10
@@ -87597,110 +87414,72 @@
  71.19.157.74
  71.19.217.243
  71.190.219.156
-71.190.65.106
  71.191.207.62
  71.191.75.67
  71.194.108.170
-71.195.102.243
  71.196.47.185
  71.197.211.156
+71.198.191.17
  71.198.208.72
-71.198.249.110
-71.199.18.225
-71.2.120.138
  71.2.127.59
  71.2.149.237
-71.2.150.252
  71.2.154.126
  71.2.165.110
-71.2.247.124
  71.2.78.49
  71.2.83.201
  71.200.89.21
  71.205.226.44
  71.208.0.104
-71.208.1.230
  71.208.105.32
  71.208.109.42
-71.208.11.47
-71.208.115.43
  71.208.12.25
-71.208.120.33
  71.208.121.246
-71.208.125.61
  71.208.137.138
  71.208.137.225
  71.208.138.19
  71.208.14.121
-71.208.14.148
-71.208.144.183
  71.208.148.77
  71.208.150.99
  71.208.153.128
-71.208.155.129
-71.208.155.135
  71.208.158.79
-71.208.159.51
  71.208.164.11
  71.208.168.97
-71.208.18.61
  71.208.181.55
  71.208.184.143
-71.208.19.166
-71.208.190.122
  71.208.190.173
-71.208.196.167
  71.208.196.96
-71.208.197.194
-71.208.198.252
  71.208.200.180
  71.208.208.131
-71.208.212.116
  71.208.215.104
-71.208.215.59
-71.208.219.84
  71.208.221.143
  71.208.222.153
-71.208.223.151
  71.208.225.251
  71.208.232.198
-71.208.233.156
  71.208.241.12
  71.208.243.201
  71.208.248.108
  71.208.25.136
-71.208.250.156
  71.208.251.116
  71.208.253.103
-71.208.255.103
  71.208.255.130
-71.208.26.96
  71.208.29.110
  71.208.29.73
  71.208.33.152
-71.208.36.94
  71.208.38.2
  71.208.41.156
  71.208.49.101
  71.208.52.8
-71.208.53.190
  71.208.57.55
  71.208.58.232
-71.208.60.207
  71.208.63.90
  71.208.68.11
  71.208.68.19
  71.208.69.164
  71.208.75.226
  71.208.76.221
-71.208.84.204
-71.208.9.114
  71.208.9.191
  71.208.95.17
  71.208.97.47
-71.208.98.158
-71.209.107.133
-71.209.11.111
  71.209.123.165
  71.209.14.97
  71.209.16.26
@@ -87708,98 +87487,53 @@
  71.209.195.17
  71.209.195.210
  71.209.2.138
-71.209.208.172
  71.209.208.174
  71.209.227.126
  71.209.236.36
  71.209.24.125
  71.209.24.76
-71.209.243.181
-71.209.250.103
-71.209.27.148
  71.209.33.111
-71.209.39.27
-71.209.4.152
  71.209.5.24
  71.209.77.191
-71.209.77.41
-71.209.79.119
  71.209.8.160
-71.209.83.23
-71.209.84.148
  71.209.87.236
  71.209.91.183
  71.209.91.242
  71.209.92.247
-71.209.93.252
  71.209.93.52
  71.209.94.62
  71.209.95.221
-71.209.95.83
-71.210.10.217
-71.210.100.231
  71.210.100.239
-71.210.107.184
-71.210.108.239
-71.210.109.10
  71.210.11.43
-71.210.111.125
  71.210.111.92
  71.210.114.163
-71.210.114.170
-71.210.115.36
  71.210.133.206
-71.210.135.16
-71.210.135.210
  71.210.135.90
-71.210.136.25
-71.210.136.47
  71.210.136.70
-71.210.137.190
  71.210.146.244
-71.210.148.233
-71.210.150.31
-71.210.151.126
  71.210.151.181
-71.210.152.4
  71.210.157.115
  71.210.158.181
-71.210.163.135
-71.210.165.58
  71.210.166.233
-71.210.171.144
  71.210.171.165
-71.210.173.75
  71.210.174.104
-71.210.174.85
-71.210.178.33
  71.210.181.137
  71.210.186.212
-71.210.186.42
-71.210.187.129
  71.210.187.145
-71.210.187.37
  71.210.192.84
  71.210.193.92
-71.210.194.73
-71.210.195.70
  71.210.199.163
-71.210.199.252
-71.210.201.111
  71.210.202.240
-71.210.22.204
  71.210.228.145
  71.210.228.24
  71.210.23.56
  71.210.231.216
  71.210.232.218
  71.210.237.161
-71.210.238.160
  71.210.241.124
  71.210.242.222
  71.210.243.50
  71.210.245.42
-71.210.246.171
  71.210.246.41
  71.210.246.93
  71.210.247.188
@@ -87808,168 +87542,107 @@
  71.210.255.242
  71.210.29.67
  71.210.32.50
-71.210.44.144
  71.210.44.227
  71.210.49.168
  71.210.50.222
  71.210.50.7
  71.210.51.171
-71.210.54.153
  71.210.56.178
-71.210.57.210
  71.210.57.236
-71.210.67.230
-71.210.67.7
  71.210.77.25
  71.210.8.242
-71.210.81.1
  71.210.84.41
  71.210.84.68
  71.210.86.220
  71.210.86.53
-71.210.9.150
-71.210.92.112
  71.210.92.93
  71.210.93.36
  71.210.97.1
  71.210.99.233
  71.210.99.65
-71.211.139.90
-71.211.17.20
-71.211.18.82
-71.211.20.249
  71.211.230.194
  71.211.37.35
  71.211.39.104
  71.211.39.144
  71.211.64.140
-71.211.71.60
  71.211.75.115
-71.212.147.34
  71.212.156.138
-71.212.25.198
  71.213.100.170
-71.213.105.73
-71.213.106.101
  71.213.106.103
-71.213.107.189
  71.213.108.33
  71.213.110.193
-71.213.111.11
  71.213.111.21
-71.213.111.34
  71.213.111.61
  71.213.115.227
  71.213.116.200
  71.213.117.120
  71.213.117.158
-71.213.117.31
  71.213.118.163
-71.213.119.233
  71.213.120.182
-71.213.120.84
  71.213.122.162
-71.213.122.212
  71.213.124.224
  71.213.125.8
  71.213.126.21
  71.213.127.91
-71.213.13.137
  71.213.136.166
  71.213.140.231
  71.213.141.244
-71.213.141.248
-71.213.143.174
  71.213.146.149
  71.213.149.135
  71.213.149.244
  71.213.151.253
  71.213.156.179
  71.213.160.101
-71.213.162.64
-71.213.165.9
-71.213.166.104
  71.213.17.3
  71.213.171.73
  71.213.171.86
  71.213.172.134
  71.213.172.220
  71.213.172.76
-71.213.178.30
  71.213.181.121
  71.213.184.101
-71.213.184.237
  71.213.185.61
  71.213.186.56
  71.213.191.77
  71.213.193.154
  71.213.195.215
-71.213.198.115
  71.213.199.175
-71.213.200.211
-71.213.201.108
-71.213.204.81
  71.213.208.129
  71.213.21.204
  71.213.211.243
-71.213.212.249
-71.213.213.62
-71.213.214.115
  71.213.214.150
  71.213.214.238
-71.213.215.232
  71.213.215.233
  71.213.216.121
-71.213.216.252
  71.213.219.156
-71.213.221.99
  71.213.222.37
  71.213.223.113
-71.213.225.23
  71.213.226.108
-71.213.228.188
  71.213.228.87
  71.213.229.95
-71.213.230.11
  71.213.231.190
-71.213.231.65
  71.213.232.80
  71.213.233.107
  71.213.236.109
  71.213.237.223
-71.213.239.245
  71.213.241.14
-71.213.244.169
  71.213.28.6
  71.213.29.126
  71.213.29.20
-71.213.31.224
-71.213.31.77
-71.213.33.138
-71.213.34.130
  71.213.37.126
  71.213.39.35
-71.213.46.46
  71.213.47.113
  71.213.51.91
-71.213.57.225
  71.213.58.204
  71.213.58.206
  71.213.58.81
  71.213.59.115
-71.213.60.157
  71.213.60.177
  71.213.62.161
-71.213.62.197
  71.213.65.246
  71.213.66.41
-71.213.67.158
  71.213.72.59
-71.213.76.70
  71.213.77.30
-71.213.82.241
-71.213.84.168
-71.213.84.232
  71.213.86.233
  71.213.86.3
  71.213.88.128
@@ -87980,127 +87653,75 @@
  71.213.95.18
  71.213.95.200
  71.213.96.134
-71.213.96.247
  71.213.96.3
  71.213.97.143
  71.213.99.121
  71.214.100.204
-71.214.103.134
-71.214.104.82
  71.214.108.188
-71.214.108.247
  71.214.109.140
-71.214.110.195
-71.214.110.7
  71.214.117.75
  71.214.123.186
  71.214.124.52
  71.214.124.73
  71.214.126.195
-71.214.126.86
  71.214.127.147
  71.214.128.6
  71.214.13.223
  71.214.134.218
-71.214.140.165
-71.214.146.93
  71.214.15.208
  71.214.150.197
  71.214.159.92
-71.214.161.242
  71.214.161.79
  71.214.162.220
-71.214.165.244
-71.214.169.195
-71.214.17.252
  71.214.170.125
  71.214.171.27
-71.214.173.70
-71.214.179.251
-71.214.180.24
-71.214.183.147
-71.214.185.110
-71.214.186.22
-71.214.188.36
  71.214.19.35
  71.214.194.132
-71.214.201.124
-71.214.202.188
-71.214.202.217
-71.214.206.208
  71.214.242.113
  71.214.245.69
  71.214.250.226
-71.214.29.48
-71.214.30.161
  71.214.46.87
-71.214.48.18
  71.214.48.31
  71.214.53.208
  71.214.56.152
  71.214.59.235
-71.214.60.243
  71.214.62.135
  71.214.62.95
-71.214.64.152
  71.214.64.167
  71.214.65.22
  71.214.66.132
  71.214.68.233
  71.214.7.44
-71.214.71.99
  71.214.77.169
  71.214.80.27
-71.214.81.72
  71.214.84.141
  71.214.85.45
  71.214.86.202
  71.214.92.154
-71.214.92.5
  71.214.96.111
  71.214.97.215
-71.215.10.15
  71.215.101.83
-71.215.102.211
  71.215.102.253
-71.215.110.156
-71.215.111.135
  71.215.111.38
  71.215.111.69
-71.215.113.142
-71.215.114.145
  71.215.118.177
-71.215.119.54
  71.215.145.104
-71.215.145.70
  71.215.147.191
-71.215.148.98
-71.215.149.111
  71.215.150.139
  71.215.163.65
-71.215.164.250
  71.215.166.2
-71.215.168.163
-71.215.169.122
-71.215.175.129
  71.215.18.163
  71.215.185.20
  71.215.192.19
-71.215.192.250
-71.215.198.160
-71.215.20.11
  71.215.200.52
  71.215.201.252
  71.215.202.132
  71.215.202.154
-71.215.206.130
  71.215.207.202
  71.215.207.208
  71.215.209.202
  71.215.209.217
-71.215.210.214
  71.215.212.212
-71.215.213.140
  71.215.214.139
  71.215.218.249
  71.215.220.111
@@ -88109,211 +87730,120 @@
  71.215.223.184
  71.215.238.238
  71.215.24.3
-71.215.240.144
-71.215.240.2
-71.215.242.252
-71.215.242.45
-71.215.243.17
-71.215.243.237
  71.215.244.245
  71.215.245.156
  71.215.245.193
-71.215.28.33
-71.215.34.230
-71.215.35.79
  71.215.37.57
  71.215.43.251
  71.215.47.182
-71.215.5.207
  71.215.50.150
  71.215.52.162
-71.215.58.241
-71.215.64.141
  71.215.64.85
-71.215.65.11
  71.215.65.252
-71.215.71.48
  71.215.74.20
  71.215.79.153
  71.215.8.209
-71.215.80.17
  71.215.82.22
  71.215.82.89
  71.215.83.202
  71.215.89.241
-71.217.104.29
  71.217.104.93
  71.217.108.155
  71.217.108.71
-71.217.11.189
  71.217.11.7
  71.217.119.51
-71.217.123.55
-71.217.127.249
  71.217.128.44
-71.217.129.183
-71.217.129.61
-71.217.130.135
-71.217.130.236
  71.217.14.192
-71.217.14.43
  71.217.140.138
  71.217.141.179
-71.217.144.7
  71.217.146.246
  71.217.147.119
  71.217.148.215
-71.217.150.204
  71.217.151.103
-71.217.155.222
  71.217.16.249
  71.217.162.166
-71.217.162.62
  71.217.165.159
  71.217.166.13
-71.217.166.14
  71.217.166.172
  71.217.167.42
-71.217.172.178
-71.217.173.144
  71.217.174.190
-71.217.176.34
  71.217.179.36
  71.217.180.7
  71.217.181.200
  71.217.182.138
  71.217.184.177
-71.217.188.26
-71.217.195.217
-71.217.198.36
  71.217.204.251
-71.217.204.64
-71.217.205.162
-71.217.205.186
-71.217.209.162
  71.217.210.158
-71.217.211.76
-71.217.213.244
  71.217.215.27
-71.217.221.117
  71.217.222.43
-71.217.3.20
  71.217.35.117
-71.217.37.209
  71.217.37.39
  71.217.4.14
-71.217.42.202
-71.217.44.201
-71.217.45.180
  71.217.45.202
  71.217.47.231
-71.217.51.50
-71.217.52.242
  71.217.54.10
  71.217.54.195
-71.217.56.208
-71.217.57.66
-71.217.63.124
  71.217.65.166
-71.217.65.5
  71.217.65.81
-71.217.77.51
  71.217.78.80
  71.217.81.120
-71.217.81.215
  71.217.82.76
  71.217.83.84
-71.217.85.50
  71.217.86.8
-71.217.87.193
  71.217.90.82
  71.217.91.226
  71.217.93.37
  71.217.99.253
-71.218.100.170
  71.218.111.69
+71.218.118.238
+71.218.123.198
  71.218.124.164
  71.218.169.111
  71.218.21.12
-71.218.224.175
  71.218.242.159
-71.218.248.157
-71.218.255.40
-71.218.77.104
-71.219.1.198
-71.219.104.22
-71.219.106.244
-71.219.107.16
-71.219.108.175
  71.219.108.33
-71.219.114.84
  71.219.115.25
  71.219.119.197
  71.219.123.128
  71.219.125.148
-71.219.128.228
-71.219.130.220
-71.219.132.250
  71.219.136.185
-71.219.137.178
  71.219.139.207
  71.219.142.35
-71.219.149.70
  71.219.150.143
  71.219.154.83
-71.219.155.23
-71.219.156.164
  71.219.160.108
-71.219.160.187
  71.219.160.207
  71.219.163.180
  71.219.166.137
  71.219.166.161
  71.219.167.125
-71.219.172.113
-71.219.173.18
-71.219.175.220
  71.219.176.163
  71.219.178.183
-71.219.180.32
  71.219.182.60
-71.219.183.151
  71.219.184.91
  71.219.187.115
  71.219.19.246
  71.219.191.21
  71.219.192.164
-71.219.192.188
-71.219.194.48
  71.219.201.68
  71.219.201.99
  71.219.210.177
  71.219.210.82
  71.219.213.38
  71.219.214.120
-71.219.214.211
-71.219.217.177
-71.219.217.32
-71.219.221.143
  71.219.221.58
  71.219.225.206
  71.219.226.225
  71.219.226.43
-71.219.228.244
  71.219.229.17
-71.219.23.149
-71.219.230.180
  71.219.231.146
-71.219.231.202
  71.219.232.152
-71.219.234.217
  71.219.236.233
  71.219.26.18
  71.219.31.44
  71.219.33.161
  71.219.36.64
  71.219.38.83
-71.219.4.177
  71.219.42.100
  71.219.42.199
  71.219.44.12
@@ -88323,7 +87853,6 @@
  71.219.59.201
  71.219.59.239
  71.219.62.164
-71.219.68.27
  71.219.69.115
  71.219.69.38
  71.219.70.162
@@ -88331,185 +87860,105 @@
  71.219.77.48
  71.219.78.9
  71.219.79.130
-71.219.79.91
-71.219.79.96
  71.219.83.125
-71.219.83.53
-71.219.85.100
  71.219.87.204
  71.219.87.216
  71.219.88.89
  71.219.89.56
  71.219.91.192
-71.219.92.145
  71.219.92.147
-71.219.92.248
  71.219.93.203
  71.219.94.12
  71.219.96.248
-71.219.99.83
-71.220.13.76
  71.220.130.54
  71.220.131.203
  71.220.133.82
  71.220.136.165
-71.220.139.31
  71.220.14.248
-71.220.146.50
  71.220.15.163
  71.220.152.11
-71.220.158.40
  71.220.161.151
  71.220.165.38
  71.220.166.100
-71.220.169.33
  71.220.172.169
  71.220.177.129
-71.220.178.15
  71.220.183.133
  71.220.187.187
-71.220.189.68
  71.220.192.147
-71.220.192.163
  71.220.192.43
  71.220.195.7
-71.220.201.251
  71.220.202.194
-71.220.205.20
-71.220.205.48
-71.220.206.64
-71.220.206.83
  71.220.207.179
-71.220.210.6
  71.220.213.194
-71.220.213.20
-71.220.215.141
-71.220.215.62
  71.220.216.164
  71.220.219.114
-71.220.219.125
  71.220.28.249
  71.220.34.30
-71.220.37.166
-71.220.40.95
  71.220.41.181
  71.220.42.135
-71.220.42.53
-71.220.45.95
  71.220.46.161
-71.220.49.85
  71.220.52.209
  71.220.55.79
  71.220.60.123
-71.220.61.27
  71.221.0.111
  71.221.0.72
  71.221.1.71
-71.221.101.231
  71.221.102.191
  71.221.103.195
-71.221.106.127
-71.221.109.211
-71.221.110.197
-71.221.112.193
-71.221.118.34
-71.221.12.245
-71.221.121.143
  71.221.123.68
  71.221.124.154
-71.221.126.150
-71.221.126.170
  71.221.126.213
  71.221.126.245
-71.221.127.230
-71.221.128.172
  71.221.129.189
-71.221.13.153
  71.221.134.147
  71.221.141.56
-71.221.146.235
-71.221.149.38
-71.221.150.128
-71.221.152.234
-71.221.157.62
  71.221.160.175
-71.221.161.29
-71.221.161.7
  71.221.162.62
  71.221.168.155
  71.221.168.249
  71.221.169.29
-71.221.169.61
-71.221.175.54
-71.221.180.235
-71.221.180.39
  71.221.180.7
  71.221.185.176
  71.221.186.164
-71.221.186.175
  71.221.189.197
  71.221.19.162
-71.221.190.91
-71.221.192.170
  71.221.194.183
  71.221.198.130
  71.221.2.218
-71.221.200.133
  71.221.204.51
  71.221.212.48
  71.221.214.109
-71.221.215.139
-71.221.220.157
  71.221.223.89
-71.221.231.149
-71.221.238.185
-71.221.25.224
-71.221.251.66
  71.221.30.67
  71.221.32.53
  71.221.36.16
-71.221.40.182
  71.221.40.197
-71.221.44.18
  71.221.47.75
  71.221.5.83
  71.221.71.179
-71.221.78.106
  71.221.78.155
-71.221.79.82
  71.221.79.9
  71.221.8.211
-71.221.80.107
  71.221.85.163
  71.221.86.93
  71.221.89.124
  71.221.89.31
-71.221.91.152
  71.221.92.10
  71.221.95.18
-71.221.97.95
  71.221.98.36
-71.222.0.188
  71.222.128.244
  71.222.134.123
-71.222.134.98
  71.222.139.173
  71.222.14.46
-71.222.141.180
  71.222.142.143
-71.222.143.188
  71.222.145.10
  71.222.147.34
  71.222.148.179
  71.222.149.178
  71.222.151.19
-71.222.157.99
  71.222.158.2
-71.222.158.24
  71.222.16.130
-71.222.161.124
  71.222.162.177
-71.222.162.190
  71.222.165.192
  71.222.167.148
  71.222.168.202
@@ -88517,41 +87966,27 @@
  71.222.172.90
  71.222.175.121
  71.222.179.21
-71.222.182.36
  71.222.182.96
  71.222.184.169
  71.222.187.62
-71.222.188.144
  71.222.19.234
-71.222.193.173
-71.222.195.252
  71.222.199.47
  71.222.20.165
-71.222.208.198
-71.222.21.167
  71.222.212.55
  71.222.213.90
-71.222.214.119
  71.222.220.74
  71.222.221.6
  71.222.222.132
  71.222.226.244
-71.222.229.206
  71.222.229.251
  71.222.23.190
-71.222.234.223
  71.222.234.73
-71.222.235.190
  71.222.236.138
-71.222.236.167
  71.222.25.184
  71.222.26.158
  71.222.26.182
-71.222.30.215
  71.222.32.184
  71.222.34.171
-71.222.36.99
-71.222.51.138
  71.222.51.241
  71.222.54.60
  71.222.56.107
@@ -88562,7 +87997,6 @@
  71.222.69.248
  71.222.70.162
  71.222.77.167
-71.222.78.192
  71.222.79.179
  71.222.8.178
  71.222.83.44
@@ -88570,27 +88004,18 @@
  71.222.86.223
  71.222.86.229
  71.222.87.222
-71.222.87.27
  71.222.88.144
-71.222.88.35
  71.222.88.73
-71.222.89.183
-71.222.91.54
  71.223.117.197
  71.223.186.212
  71.223.189.213
  71.223.2.56
  71.223.25.165
-71.223.253.77
-71.223.255.233
-71.223.87.122
  71.223.94.156
-71.223.98.49
  71.227.242.72
  71.231.145.228
  71.232.228.138
  71.232.26.19
-71.234.93.198
  71.234.94.158
  71.235.124.243
  71.235.32.236
@@ -88608,39 +88033,22 @@
  71.255.235.140
  71.255.255.151
  71.28.168.11
-71.3.106.174
  71.3.192.116
  71.3.193.206
-71.3.196.94
-71.3.75.202
-71.3.75.248
-71.3.77.107
  71.3.96.201
-71.31.147.183
-71.32.138.59
-71.32.142.168
-71.32.142.172
-71.32.144.175
  71.32.144.46
  71.32.147.6
  71.32.154.140
  71.32.156.139
-71.32.158.171
  71.32.160.241
  71.32.165.135
-71.32.166.215
  71.32.167.79
  71.32.168.92
-71.32.173.14
-71.32.180.169
  71.32.81.92
  71.32.90.58
  71.32.92.34
-71.32.95.115
  71.32.95.46
  71.33.138.57
-71.33.152.47
-71.33.210.81
  71.33.232.126
  71.34.192.10
  71.34.192.219
@@ -88648,16 +88056,12 @@
  71.34.197.73
  71.34.201.51
  71.34.202.46
-71.34.203.123
  71.34.205.169
-71.34.206.105
  71.34.206.143
  71.34.210.22
  71.34.210.27
  71.34.210.40
-71.34.210.92
  71.34.213.39
-71.34.221.218
  71.34.224.87
  71.34.233.230
  71.34.28.16
@@ -88665,69 +88069,41 @@
  71.36.10.231
  71.36.103.204
  71.36.127.50
-71.36.206.34
  71.36.6.185
-71.37.0.108
  71.37.138.97
  71.37.15.59
  71.37.207.116
  71.38.101.224
-71.38.107.176
-71.38.108.94
-71.38.109.232
-71.38.112.24
  71.38.113.158
-71.38.115.182
  71.38.116.181
-71.38.116.189
-71.38.117.177
-71.38.118.135
-71.38.129.78
  71.38.135.178
  71.38.139.135
-71.38.14.87
  71.38.148.39
  71.38.15.19
  71.38.153.146
  71.38.159.95
-71.38.162.59
  71.38.187.113
  71.38.189.197
-71.38.201.191
-71.38.201.95
  71.38.205.25
  71.38.208.78
  71.38.212.60
-71.38.218.195
  71.38.220.147
  71.38.225.161
-71.38.226.231
-71.38.227.14
  71.38.236.104
-71.38.237.169
  71.38.24.30
  71.38.246.127
-71.38.250.32
  71.38.251.141
  71.38.252.14
  71.38.253.148
-71.38.28.136
  71.38.28.237
-71.38.29.100
  71.38.3.117
  71.38.33.79
-71.38.43.252
  71.38.44.132
  71.38.49.136
-71.38.5.6
-71.38.53.116
  71.38.57.147
-71.38.58.121
  71.38.63.59
  71.38.70.191
  71.38.72.228
-71.38.73.60
-71.38.76.180
  71.38.90.235
  71.40.162.211
  71.40.28.250
@@ -88739,106 +88115,68 @@
  71.42.187.121
  71.43.112.11
  71.43.118.162
-71.44.81.13
  71.47.133.58
-71.48.60.32
  71.49.116.179
  71.49.156.134
  71.49.156.86
-71.49.175.164
  71.49.180.36
  71.49.186.245
-71.49.232.153
-71.49.232.168
  71.49.233.13
  71.49.233.58
  71.49.239.239
-71.50.110.114
  71.50.120.8
  71.50.129.62
  71.50.132.89
  71.50.133.240
  71.50.151.225
-71.50.152.215
  71.50.198.175
-71.50.199.105
-71.50.201.103
  71.50.220.30
-71.50.221.58
  71.50.221.82
  71.50.23.58
-71.50.24.188
-71.50.26.231
  71.50.31.38
  71.50.39.120
  71.50.55.171
-71.50.60.148
  71.50.72.222
  71.50.74.222
  71.50.76.127
  71.50.97.18
  71.50.97.37
-71.51.100.82
-71.51.163.71
-71.51.164.129
-71.51.174.80
  71.51.175.110
  71.51.185.58
  71.51.187.246
  71.51.188.151
  71.51.190.70
-71.51.216.147
  71.51.216.219
  71.51.65.216
  71.51.70.132
  71.51.73.221
-71.51.96.210
  71.52.106.153
-71.52.108.99
-71.52.109.66
  71.52.111.251
-71.52.17.23
  71.52.20.58
  71.52.21.243
-71.52.29.196
  71.52.31.126
-71.52.55.140
  71.52.55.197
  71.53.140.102
-71.53.147.10
  71.53.153.119
  71.53.154.129
-71.54.128.140
-71.54.130.63
  71.54.132.95
  71.54.133.203
  71.54.142.205
  71.54.154.127
  71.54.160.133
-71.54.160.54
-71.54.163.4
-71.54.169.192
  71.54.171.244
-71.54.174.137
-71.54.174.153
  71.54.188.54
-71.54.22.157
  71.54.22.235
-71.54.34.235
  71.54.45.208
  71.54.49.134
-71.54.57.39
  71.54.62.22
-71.55.107.164
  71.55.109.181
-71.55.148.8
  71.55.149.101
-71.55.74.62
-71.55.75.48
  71.56.235.108
  71.57.180.213
  71.57.223.114
  71.57.241.246
+71.58.109.127
  71.58.141.172
  71.59.28.167
  71.6.135.131
@@ -88846,18 +88184,17 @@
  71.6.146.185
  71.6.146.186
  71.6.158.166
-71.6.165.200
+71.6.167.142
  71.6.167.197
  71.6.199.23
-71.60.115.35
  71.60.192.20
  71.60.4.237
  71.62.115.217
  71.63.10.44
+71.63.116.146
  71.67.79.42
  71.70.16.54
  71.70.23.99
-71.71.187.216
  71.72.140.136
  71.72.196.159
  71.73.5.169
@@ -88871,12 +88208,12 @@
  71.85.183.137
  71.85.218.231
  71.86.81.122
-71.87.253.7
  71.88.207.47
+71.89.209.212
  71.9.137.56
  71.9.244.35
+71.9.246.122
  71.92.202.13
-71.92.39.138
  71.93.148.59
  71.93.27.91
  71.94.198.62
@@ -88900,34 +88237,30 @@
  72.11.148.154
  72.11.166.13
  72.128.6.3
+72.132.120.206
  72.133.177.119
  72.134.205.184
  72.134.81.111
  72.135.224.85
  72.135.232.168
+72.139.15.126
  72.139.68.174
  72.14.164.83
  72.14.179.215
  72.14.181.222
  72.14.184.118
  72.14.186.84
-72.14.187.172
  72.14.190.72
  72.14.191.154
  72.143.15.82
  72.15.247.113
-72.160.105.254
  72.160.107.52
-72.160.123.232
-72.160.153.184
  72.160.155.197
-72.160.156.145
  72.160.156.27
  72.160.161.180
  72.160.165.221
  72.160.165.84
  72.160.167.189
-72.160.167.211
  72.160.17.46
  72.160.200.175
  72.160.9.177
@@ -88936,17 +88269,10 @@
  72.161.12.229
  72.161.14.197
  72.161.178.215
-72.161.179.226
  72.161.2.246
-72.161.249.126
-72.161.250.214
-72.161.252.231
  72.161.252.35
-72.161.252.46
  72.161.254.243
-72.161.255.13
  72.161.49.212
-72.161.51.94
  72.167.113.216
  72.167.131.155
  72.167.161.46
@@ -88965,8 +88291,9 @@
  72.17.22.30
  72.17.54.54
  72.173.14.215
-72.174.13.151
+72.173.26.247
  72.174.254.198
+72.176.92.126
  72.177.87.97
  72.18.130.41
  72.182.43.135
@@ -88978,14 +88305,13 @@
  72.189.135.139
  72.189.179.92
  72.189.57.105
-72.19.13.89
  72.191.113.27
-72.191.246.173
+72.192.162.178
  72.193.250.108
  72.194.159.49
  72.194.243.15
+72.194.27.13
  72.195.114.169
-72.195.114.171
  72.195.114.184
  72.195.158.184
  72.195.34.41
@@ -88996,9 +88322,9 @@
  72.198.29.30
  72.20.137.133
  72.200.218.136
-72.202.235.214
  72.202.236.62
  72.203.86.47
+72.207.116.186
  72.207.181.23
  72.208.58.240
  72.208.58.48
@@ -89007,66 +88333,51 @@
  72.210.252.137
  72.210.252.143
  72.210.252.145
+72.210.252.146
  72.210.252.148
-72.210.252.149
-72.210.252.154
  72.210.252.155
  72.212.63.101
-72.212.63.107
  72.212.63.110
  72.212.63.120
  72.212.63.99
+72.213.148.150
  72.213.167.55
  72.216.141.76
-72.216.25.39
-72.217.158.194
  72.217.158.197
  72.217.158.199
-72.217.158.202
-72.217.158.204
-72.217.158.206
+72.217.158.208
  72.217.158.210
  72.217.158.215
  72.218.206.7
  72.219.108.221
  72.22.247.189
+72.220.27.151
  72.221.164.34
-72.221.164.36
-72.221.164.39
  72.221.164.41
  72.221.164.42
-72.221.164.45
-72.221.164.47
  72.221.164.48
-72.221.164.51
  72.221.164.57
  72.221.164.58
-72.221.172.205
+72.221.164.61
  72.221.196.135
  72.221.196.137
  72.221.196.149
-72.221.196.150
-72.221.196.152
  72.221.232.137
-72.221.232.139
-72.221.232.142
-72.221.232.145
+72.221.232.140
+72.221.232.141
  72.221.232.146
  72.221.232.147
  72.221.232.153
  72.222.130.133
-72.223.168.67
-72.223.168.78
+72.223.168.90
  72.223.90.121
  72.224.193.17
-72.225.127.36
  72.225.198.139
-72.225.59.76
  72.225.7.80
  72.226.15.212
  72.227.102.196
+72.228.142.55
  72.229.52.101
-72.229.9.202
  72.230.237.11
  72.231.228.32
  72.231.243.181
@@ -89077,6 +88388,7 @@
  72.234.182.39
  72.235.210.171
  72.235.210.174
+72.235.27.197
  72.237.117.105
  72.237.117.106
  72.237.117.107
@@ -89088,9 +88400,11 @@
  72.237.117.71
  72.237.117.81
  72.237.117.86
+72.238.111.254
  72.238.18.57
  72.238.229.21
  72.239.229.208
+72.24.107.47
  72.24.196.138
  72.24.91.196
  72.240.123.84
@@ -89103,25 +88417,21 @@
  72.249.235.194
  72.249.235.201
  72.249.236.228
-72.249.51.52
  72.250.153.47
  72.250.184.57
  72.250.42.191
  72.251.234.218
  72.251.243.50
-72.252.122.34
  72.252.200.146
-72.252.200.67
  72.252.203.180
-72.252.215.82
  72.252.224.155
-72.252.32.48
  72.252.4.146
  72.252.4.165
  72.252.4.181
  72.252.4.194
  72.252.4.57
  72.255.43.118
+72.255.54.241
  72.27.43.111
  72.27.5.3
  72.28.240.148
@@ -89167,7 +88477,6 @@
  72.52.255.82
  72.52.87.47
  72.53.134.182
-72.53.198.116
  72.65.62.50
  72.68.122.233
  72.68.165.91
@@ -89177,7 +88486,6 @@
  72.69.99.47
  72.74.145.225
  72.74.160.36
-72.74.19.226
  72.74.34.120
  72.76.221.220
  72.76.243.86
@@ -89196,7 +88504,6 @@
  72.9.110.70
  72.9.226.190
  72.9.231.226
-72.90.201.50
  72.90.235.219
  72.90.235.219bin.sh
  72.90.89.108
@@ -89234,12 +88541,10 @@
  72dpi.co.il
  72l.saniketaoci.com
  73.0.216.24
-73.10.229.253
  73.10.75.50
  73.107.123.214
  73.108.160.71
  73.108.242.248
-73.109.122.79
  73.11.153.150
  73.110.180.147
  73.111.221.162
@@ -89249,7 +88554,6 @@
  73.115.11.109
  73.116.193.136
  73.117.1.162
-73.118.113.245
  73.119.190.120
  73.119.255.56
  73.119.50.38
@@ -89259,50 +88563,54 @@
  73.122.225.213
  73.128.186.71
  73.13.104.201
-73.131.166.70
  73.131.78.250
-73.134.23.142
  73.138.75.151
  73.140.125.230
+73.140.14.193
+73.140.142.112
  73.147.128.137
-73.147.198.220
  73.148.23.198
-73.149.150.108
-73.150.145.210
  73.151.119.162
  73.158.127.66
  73.159.243.249
+73.162.121.160
  73.162.222.154
  73.162.253.94
+73.164.174.146
  73.165.187.57
  73.166.86.108
+73.167.115.2
  73.167.2.179
  73.168.170.206
  73.168.19.79
+73.168.253.81
  73.170.134.121
  73.170.188.50
  73.170.66.172
  73.171.139.42
  73.175.16.198
+73.177.64.108
  73.181.212.48
  73.184.146.247
  73.184.77.174
  73.185.1.77
  73.185.17.0
+73.187.102.50
  73.187.5.119
  73.188.232.19
  73.189.163.2
  73.189.164.139
  73.189.248.47
  73.19.95.114
-73.192.213.22
  73.194.41.55
+73.197.215.95
  73.199.65.2
  73.20.76.159
  73.200.123.136
  73.202.118.127
  73.202.219.27
-73.203.165.164
+73.202.32.6
+73.204.216.103
  73.205.112.214
  73.206.244.166
  73.207.112.3
@@ -89311,23 +88619,22 @@
  73.209.207.211
  73.209.24.166
  73.209.24.30
+73.210.116.50
  73.211.134.215
  73.213.130.141
  73.213.160.205
  73.213.26.179
  73.215.97.122
-73.22.140.45
  73.22.40.11
  73.221.214.78
  73.221.249.191
-73.221.31.21
  73.222.156.213
  73.223.184.49
  73.225.8.164
-73.226.170.80
  73.226.220.90
+73.227.129.159
+73.228.154.233
  73.229.153.51
-73.23.75.11
  73.230.167.70
  73.231.178.3
  73.231.235.175
@@ -89338,34 +88645,39 @@
  73.239.11.159
  73.239.197.175
  73.239.221.165
-73.24.35.153
  73.240.62.20
  73.243.176.4
  73.243.193.73
  73.243.243.50
  73.246.103.38
-73.246.199.79
  73.247.16.170
+73.248.92.92
  73.25.249.109
-73.250.231.88
  73.251.84.166
  73.254.255.81
+73.255.112.210
  73.255.236.146
  73.26.138.42
-73.29.37.188
+73.27.112.138
  73.3.250.179
  73.31.14.186
  73.32.108.199
-73.34.192.237
  73.34.216.45
  73.35.60.4
+73.38.213.196
+73.41.219.15
  73.41.70.128
+73.42.199.192
  73.43.26.125
+73.43.86.177
  73.43.98.10
+73.44.167.34
  73.45.212.48
  73.45.37.120
  73.46.218.63
  73.48.128.26
+73.48.200.230
+73.49.97.191
  73.5.2.12
  73.50.110.56
  73.51.245.209
@@ -89385,8 +88697,8 @@
  73.69.213.87
  73.7.135.222
  73.72.150.179
+73.72.159.60
  73.72.178.177
-73.72.62.223
  73.73.137.44
  73.73.230.131
  73.75.107.58
@@ -89395,18 +88707,14 @@
  73.78.197.165
  73.79.253.167
  73.8.77.18
-73.82.37.183
  73.83.103.79
-73.83.150.162
  73.83.172.90
  73.84.152.17
  73.84.156.242
  73.85.21.193
  73.88.233.108
  73.89.52.125
-73.9.6.93
  73.90.205.30
-73.91.217.27
  73.92.81.86
  73.93.252.130
  73.93.56.34
@@ -89415,9 +88723,11 @@
  73.96.30.69
  73.97.164.59
  73.97.177.193
+73.97.84.142
  73.98.109.141
  73.98.227.247
  73.98.59.159
+73.99.1.17
  7302321canadainc.com
  730857112247343118.weebly.com
  732930-dot-n-e-w-me-ss-age-po-rt-al.wl.r.appspot.com
@@ -89449,6 +88759,7 @@
  74.115.50.111
  74.116.59.195
  74.116.59.8
+74.117.157.163
  74.117.183.84
  74.117.61.66
  74.118.137.119
@@ -89456,11 +88767,14 @@
  74.118.156.131
  74.118.192.251
  74.119.193.112
+74.120.14.31
+74.120.14.37
  74.120.14.38
  74.120.14.40
  74.120.14.53
  74.120.14.54
  74.120.14.55
+74.120.14.56
  74.120.170.183
  74.120.172.232
  74.120.173.145
@@ -89473,31 +88787,30 @@
  74.122.129.104
  74.123.21.22
  74.123.23.40
-74.124.161.80
  74.124.198.60
  74.124.214.119
  74.124.219.29
-74.127.124.143
+74.124.36.162
+74.126.178.104
  74.128.121.17
  74.129.23.72
  74.130.83.133
  74.132.146.137
  74.132.148.190
-74.132.224.130
  74.132.5.81
  74.133.100.74
  74.133.89.164
-74.134.58.22
  74.135.120.91
  74.137.220.142
+74.137.224.27
  74.142.232.241
  74.15.64.117
  74.192.32.213
-74.193.32.28
+74.195.125.157
  74.195.162.252
  74.196.219.52
-74.196.252.42
  74.197.249.124
+74.197.9.92
  74.199.111.243
  74.199.84.77
  74.200.208.146
@@ -89519,6 +88832,7 @@
  74.207.230.187
  74.207.231.80
  74.207.237.96
+74.207.249.108
  74.207.249.55
  74.208.10.47
  74.208.100.240
@@ -89526,7 +88840,7 @@
  74.208.105.217
  74.208.123.225
  74.208.13.22
-74.208.130.209
+74.208.130.102
  74.208.173.53
  74.208.173.91
  74.208.194.89
@@ -89540,7 +88854,6 @@
  74.208.73.49
  74.208.75.201
  74.208.80.107
-74.208.81.73
  74.209.192.67
  74.209.192.68
  74.209.192.69
@@ -89571,9 +88884,6 @@
  74.3.104.66
  74.3.134.234
  74.3.160.18
-74.4.178.63
-74.4.242.227
-74.4.243.235
  74.4.248.59
  74.4.255.96
  74.40.205.197
@@ -89582,8 +88892,6 @@
  74.5.135.47
  74.5.158.102
  74.5.159.15
-74.5.159.62
-74.50.125.19
  74.50.51.115
  74.50.85.15
  74.50.85.59
@@ -89600,7 +88908,6 @@
  74.55.73.74
  74.55.90.82
  74.56.229.191
-74.57.129.218
  74.57.99.81
  74.58.215.226
  74.58.7.11
@@ -89615,12 +88922,11 @@
  74.63.221.49
  74.67.2.120
  74.67.240.204
+74.67.72.241
  74.68.134.165
  74.7.84.106
  74.70.21.65
-74.71.15.170
  74.71.226.69
-74.72.4.203
  74.75.117.254
  74.77.90.160
  74.78.144.106
@@ -89645,11 +88951,11 @@
  74.85.157.198
  74.85.220.46
  74.85.45.254
+74.91.125.117
  74.91.23.194
  74.91.24.186
  74.91.28.228
  74.92.155.101
-74.92.249.41
  74.93.207.217
  74.93.91.129
  74.94.194.3
@@ -89676,16 +88982,15 @@
  74fghggh.chinasaletopbuynowsale.com
  75.101.111.132
  75.101.224.25
-75.102.27.237
  75.102.39.180
  75.103.51.202
  75.103.66.4
+75.108.21.14
  75.109.111.18
  75.109.248.175
  75.11.8.111
  75.110.141.18
  75.111.125.131
-75.111.20.166
  75.111.77.22
  75.112.160.49
  75.112.74.197
@@ -89693,6 +88998,7 @@
  75.114.235.105
  75.118.171.124
  75.118.181.246
+75.118.190.14
  75.118.243.0
  75.119.200.10
  75.119.200.100
@@ -89710,13 +89016,17 @@
  75.119.202.116
  75.119.202.122
  75.119.202.128
+75.119.202.13
  75.119.202.130
+75.119.202.155
+75.119.202.158
  75.119.202.17
  75.119.202.170
  75.119.202.177
  75.119.202.191
  75.119.202.194
  75.119.202.197
+75.119.202.207
  75.119.202.208
  75.119.202.251
  75.119.202.31
@@ -89744,6 +89054,7 @@
  75.119.204.3
  75.119.204.68
  75.119.205.12
+75.119.205.128
  75.119.205.175
  75.119.205.176
  75.119.205.206
@@ -89758,24 +89069,14 @@
  75.119.207.139
  75.119.215.210
  75.120.122.89
-75.120.13.39
  75.120.14.224
  75.120.174.21
-75.120.2.232
  75.120.255.198
  75.120.4.57
-75.120.5.59
-75.120.80.11
-75.120.9.124
  75.121.128.147
-75.121.13.227
-75.121.132.178
-75.121.135.104
-75.121.135.177
  75.121.15.56
  75.121.51.50
  75.121.69.141
-75.121.9.220
  75.125.130.122
  75.125.138.114
  75.125.198.218
@@ -89809,98 +89110,70 @@
  75.133.50.105
  75.133.96.235
  75.134.150.171
+75.135.209.186
  75.136.121.230
  75.136.38.142
  75.137.245.125
  75.139.38.211
  75.140.162.212
  75.140.35.198
-75.140.51.106
-75.140.97.161
+75.141.149.30
  75.142.211.18
  75.143.100.75
  75.143.230.73
  75.143.60.23
  75.145.243.13
  75.148.122.49
-75.148.82.177
  75.148.91.168
  75.149.127.65
  75.149.226.102
  75.150.192.33
  75.150.62.125
-75.151.156.33
  75.151.156.34
  75.151.213.85
  75.152.105.88
  75.152.21.54
  75.152.54.232
  75.154.127.9
+75.156.2.9
  75.157.151.52
  75.157.199.24
  75.158.39.231
  75.159.162.115
  75.16.168.140
-75.161.154.179
  75.161.193.234
  75.161.224.245
  75.161.252.253
-75.162.112.93
  75.162.121.154
  75.162.139.130
-75.162.14.16
-75.162.163.140
  75.162.197.233
  75.162.22.26
  75.162.249.25
-75.163.16.206
  75.163.162.186
  75.163.193.13
  75.163.21.225
-75.163.23.72
-75.163.25.241
  75.163.28.219
  75.163.28.97
-75.163.44.174
  75.163.46.100
  75.164.130.231
  75.164.151.45
-75.164.173.39
  75.164.37.57
  75.164.94.131
  75.164.98.255
  75.165.105.23
-75.165.115.140
  75.165.115.228
  75.165.119.247
  75.165.120.214
  75.165.121.20
  75.165.123.168
-75.165.125.34
-75.165.128.34
-75.165.129.41
-75.165.131.34
-75.165.139.231
-75.165.140.217
-75.165.148.205
  75.165.150.18
  75.165.151.20
-75.165.153.50
-75.165.154.18
-75.165.159.173
-75.165.160.178
-75.165.160.75
  75.165.167.219
  75.165.168.180
  75.165.169.243
-75.165.17.198
-75.165.170.191
  75.165.172.213
-75.165.174.96
-75.165.180.213
  75.165.182.84
  75.165.186.39
-75.165.187.52
  75.165.192.6
  75.165.198.135
  75.165.199.31
@@ -89915,210 +89188,116 @@
  75.165.40.121
  75.165.44.137
  75.165.54.2
-75.165.57.139
-75.165.58.47
-75.165.67.17
-75.165.69.80
-75.165.70.195
  75.165.73.101
-75.165.78.178
  75.165.79.12
  75.165.98.217
  75.165.99.226
-75.166.138.178
  75.166.146.236
  75.166.181.24
-75.166.192.181
-75.166.198.14
-75.166.71.236
-75.166.77.49
  75.166.80.164
-75.166.88.193
-75.166.97.64
  75.167.174.135
  75.167.179.199
-75.167.184.194
  75.167.191.201
-75.167.201.79
-75.167.203.227
-75.167.204.255
  75.167.246.173
-75.167.99.153
-75.168.125.169
  75.168.211.206
-75.168.221.59
-75.168.4.111
  75.169.110.215
  75.169.13.18
-75.169.137.77
  75.169.167.93
  75.169.179.182
  75.170.100.60
  75.170.105.182
-75.170.106.213
-75.170.110.175
  75.170.111.132
  75.170.112.50
  75.170.113.79
  75.170.115.153
  75.170.117.12
-75.170.119.191
  75.170.12.125
-75.170.125.180
-75.170.126.41
  75.170.126.67
  75.170.132.195
  75.170.136.211
-75.170.136.218
-75.170.137.103
  75.170.140.125
  75.170.142.83
-75.170.143.128
  75.170.143.249
  75.170.143.90
-75.170.144.117
  75.170.144.77
-75.170.148.177
  75.170.152.53
  75.170.152.61
  75.170.154.104
  75.170.154.223
  75.170.155.131
  75.170.156.67
-75.170.158.13
  75.170.158.135
-75.170.162.230
-75.170.17.31
-75.170.198.71
-75.170.204.12
-75.170.204.214
-75.170.205.98
  75.170.212.179
-75.170.215.183
-75.170.218.66
  75.170.221.117
  75.170.221.15
  75.170.221.155
-75.170.224.4
-75.170.228.223
-75.170.229.123
  75.170.230.176
-75.170.230.250
  75.170.231.19
  75.170.232.232
-75.170.233.111
  75.170.233.149
  75.170.235.116
-75.170.237.201
  75.170.237.89
  75.170.239.108
-75.170.240.252
-75.170.245.188
  75.170.247.126
-75.170.248.142
-75.170.249.148
  75.170.25.145
-75.170.250.208
  75.170.26.96
-75.170.28.83
  75.170.3.160
-75.170.3.246
  75.170.30.248
-75.170.33.43
-75.170.34.119
  75.170.38.138
-75.170.41.81
  75.170.42.117
-75.170.42.51
-75.170.43.215
-75.170.46.83
-75.170.48.250
-75.170.49.36
  75.170.50.185
-75.170.52.161
-75.170.52.92
  75.170.56.104
-75.170.56.153
  75.170.58.87
-75.170.59.81
  75.170.60.121
  75.170.61.208
-75.170.61.252
-75.170.63.247
  75.170.64.118
-75.170.7.15
-75.170.77.80
  75.170.84.156
  75.170.9.199
-75.170.93.78
  75.170.98.183
  75.170.98.58
  75.171.42.202
  75.172.114.142
-75.172.35.255
  75.173.89.139
-75.173.92.190
  75.174.138.112
-75.174.151.142
-75.174.248.249
  75.174.90.252
-75.175.102.38
  75.175.104.30
-75.175.112.195
-75.175.113.27
  75.175.114.4
  75.175.116.163
  75.175.121.80
  75.175.122.191
  75.175.125.193
-75.175.126.213
  75.175.129.92
  75.175.137.248
  75.175.138.163
  75.175.138.208
  75.175.138.33
-75.175.139.167
  75.175.140.43
  75.175.146.215
  75.175.147.73
-75.175.148.215
  75.175.197.100
  75.175.199.36
-75.175.199.45
  75.175.2.246
  75.175.203.230
  75.175.203.41
-75.175.203.50
  75.175.204.196
  75.175.208.141
-75.175.210.2
-75.175.211.130
  75.175.212.155
-75.175.214.42
-75.175.214.7
  75.175.216.192
  75.175.216.229
  75.175.66.150
-75.175.66.159
  75.175.67.87
  75.175.73.139
  75.175.73.250
  75.175.73.41
-75.175.74.88
-75.175.80.20
-75.175.82.141
-75.175.82.215
  75.175.82.245
  75.175.88.151
-75.175.92.11
-75.175.93.207
-75.175.99.144
  75.177.207.146
  75.178.122.172
  75.178.137.155
  75.181.139.49
  75.182.136.95
  75.183.15.12
+75.185.217.66
  75.186.96.124
  75.187.166.56
  75.188.38.166
@@ -90131,19 +89310,18 @@
  75.40.139.204
  75.40.189.179
  75.46.43.6
-75.51.231.135
  75.51.34.205
-75.51.96.147
  75.55.97.119
  75.58.62.223
  75.6.179.214
  75.65.31.8
  75.65.6.212
  75.67.227.208
-75.67.42.137
  75.68.45.136
+75.70.181.65
  75.71.161.216
  75.71.41.239
+75.72.214.200
  75.73.90.226
  75.74.7.227
  75.75.235.117
@@ -90151,17 +89329,15 @@
  75.75.235.171
  75.75.235.209
  75.76.185.211
-75.76.94.123
-75.80.103.195
  75.80.124.4
  75.80.148.244
  75.81.226.4
+75.82.3.224
  75.83.12.11
  75.83.186.62
  75.83.23.4
  75.83.230.2
  75.83.253.194
-75.84.167.25
  75.85.186.143
  75.86.10.139
  75.86.142.122
@@ -90172,7 +89348,6 @@
  75.98.36.146
  75.99.123.26
  75.99.13.123
-75.99.69.186
  7520.ca
  7521550a119fe3171a82df8e0644d569e796b36b.info
  752f7b76.ngrok.io
@@ -90205,15 +89380,10 @@
  76.0.171.229
  76.0.176.22
  76.0.178.197
-76.0.18.64
  76.0.19.168
  76.0.19.196
  76.0.21.150
-76.0.25.117
  76.0.27.104
-76.0.27.112
-76.0.27.180
-76.0.28.188
  76.0.29.77
  76.0.3.97
  76.0.32.238
@@ -90224,12 +89394,9 @@
  76.0.6.35
  76.0.65.207
  76.1.100.84
-76.1.101.202
  76.1.102.185
-76.1.102.246
  76.1.161.64
  76.1.167.53
-76.1.169.11
  76.1.169.197
  76.1.180.6
  76.10.157.54
@@ -90245,11 +89412,9 @@
  76.11.31.208
  76.11.44.237
  76.112.56.76
-76.114.12.136
  76.12.191.16
  76.12.235.47
  76.120.75.139
-76.121.186.244
  76.121.70.69
  76.122.185.244
  76.123.215.252
@@ -90264,6 +89429,7 @@
  76.14.185.177
  76.14.186.147
  76.14.190.57
+76.14.57.203
  76.15.23.177
  76.15.31.11
  76.15.97.41
@@ -90276,9 +89442,7 @@
  76.167.150.16
  76.167.150.74
  76.168.54.203
-76.169.148.47
  76.169.192.24
-76.169.31.165
  76.170.160.205
  76.171.141.83
  76.172.36.158
@@ -90296,25 +89460,26 @@
  76.183.211.188
  76.186.123.165
  76.186.73.35
+76.187.56.23
  76.188.24.162
-76.2.178.44
  76.2.180.214
-76.2.187.133
  76.2.23.216
-76.2.241.144
  76.2.246.90
  76.2.40.112
  76.2.45.215
  76.20.234.224
  76.20.63.24
+76.202.249.36
  76.204.247.110
  76.214.9.223
  76.216.16.130
+76.217.201.137
  76.218.14.139
  76.226.243.142
  76.23.24.168
  76.23.58.234
  76.230.156.129
+76.233.86.30
  76.240.162.156
  76.250.150.193
  76.253.0.85
@@ -90333,41 +89498,23 @@
  76.3.38.169
  76.3.4.132
  76.3.40.17
-76.4.17.151
+76.30.62.156
  76.4.193.24
  76.4.217.78
  76.4.221.241
  76.4.222.190
-76.4.241.198
-76.4.243.227
-76.4.244.250
-76.4.252.59
-76.4.253.168
-76.4.253.184
  76.4.253.232
  76.5.0.163
  76.5.104.146
  76.5.111.160
  76.5.117.239
  76.5.119.196
-76.5.125.100
-76.5.129.180
  76.5.135.244
-76.5.181.89
-76.5.49.245
-76.6.101.26
-76.6.137.232
  76.6.137.93
-76.6.140.200
  76.6.149.214
  76.6.155.5
  76.6.212.182
-76.6.213.232
-76.6.23.145
  76.6.251.28
-76.6.31.55
-76.6.65.182
-76.6.75.248
  76.64.106.82
  76.64.171.51
  76.65.215.21
@@ -90375,35 +89522,26 @@
  76.7.101.187
  76.7.107.181
  76.7.128.243
-76.7.155.201
-76.7.158.172
  76.7.159.157
  76.7.159.64
-76.7.188.226
  76.7.19.129
  76.7.19.53
  76.7.198.24
  76.7.20.236
  76.7.201.156
-76.7.206.147
  76.7.25.158
  76.7.26.157
  76.7.27.118
-76.7.28.187
-76.7.29.130
-76.7.96.78
  76.72.254.222
  76.74.170.209
  76.76.105.218
  76.76.252.217
  76.76.83.23
-76.77.116.142
  76.79.75.82
  76.8.60.53
  76.80.210.138
  76.85.128.198
  76.86.245.17
-76.87.177.124
  76.87.58.38
  76.88.107.25
  76.88.117.240
@@ -90442,16 +89580,14 @@
  76wzxjp.com
  77.0.136.37
  77.0.193.48
-77.0.196.30
-77.1.104.224
-77.1.220.22
+77.1.226.170
+77.1.4.87
  77.1.49.135
-77.1.54.38
  77.10.124.156
+77.10.138.81
  77.10.47.31
  77.101.132.253
  77.105.87.97
-77.107.185.209
  77.107.49.205
  77.107.60.227
  77.107.87.51
@@ -90464,13 +89600,10 @@
  77.109.173.12
  77.109.177.12
  77.109.191.149
-77.11.230.85
  77.111.187.221
-77.112.99.195
  77.119.128.158
  77.119.229.106
  77.12.69.249
-77.120.103.130
  77.120.113.64
  77.120.113.69
  77.120.116.85
@@ -90478,43 +89611,43 @@
  77.120.122.114
  77.120.122.15
  77.120.122.22
-77.120.137.143
  77.120.163.103
  77.120.26.102
  77.120.93.135
+77.121.214.100
  77.121.5.131
+77.121.92.243
  77.122.226.14
  77.122.57.126
  77.122.62.166
  77.123.20.173
  77.124.100.143
+77.124.12.19
  77.124.23.142
  77.124.34.180
  77.124.40.189
-77.124.51.184
  77.124.66.130
  77.125.100.228
-77.125.37.195
  77.125.5.174
  77.125.56.53
  77.126.68.90
  77.126.76.254
  77.126.78.13
  77.127.20.38
+77.129.180.169
+77.13.78.96
  77.130.135.14
  77.131.79.51
  77.132.207.157
  77.134.101.172
  77.134.172.81
  77.137.149.172
-77.137.152.182
-77.137.153.101
-77.137.158.77
  77.138.170.206
  77.140.201.98
  77.149.219.24
  77.156.242.132
  77.158.71.118
+77.159.149.71
  77.160.194.161
  77.161.42.100
  77.162.104.62
@@ -90523,8 +89656,6 @@
  77.163.136.136
  77.165.178.216
  77.165.60.53
-77.166.83.167
-77.167.166.211
  77.167.245.239
  77.169.131.80
  77.169.19.45
@@ -90536,28 +89667,27 @@
  77.179.129.42
  77.179.152.193
  77.179.228.155
-77.179.36.199
  77.179.37.175
-77.180.130.34
-77.181.186.134
+77.180.33.27
+77.181.185.69
  77.182.168.83
  77.182.213.130
-77.182.39.255
-77.182.67.106
-77.183.37.93
+77.182.33.156
+77.191.169.38
  77.191.178.134
+77.191.22.81
+77.191.36.76
  77.195.143.45
  77.199.87.64
-77.2.49.71
  77.2.57.232
  77.2.9.228
-77.2.92.131
+77.20.138.135
  77.20.160.72
-77.20.203.141
  77.20.206.1
  77.20.252.230
+77.201.24.88
+77.209.207.222
  77.21.117.91
-77.21.135.159
  77.21.95.28
  77.210.12.152
  77.211.170.149
@@ -90583,6 +89713,9 @@
  77.221.151.178
  77.221.220.133
  77.221.52.77
+77.222.107.170
+77.222.107.65
+77.222.107.9
  77.222.109.219
  77.222.113.248
  77.222.139.57
@@ -90598,11 +89731,12 @@
  77.227.2.64
  77.227.28.157
  77.228.211.139
-77.229.249.36
  77.229.250.136
  77.23.232.238
-77.230.117.92
+77.230.116.119
+77.231.73.221
  77.232.134.106
+77.232.150.107
  77.232.167.200
  77.232.186.2
  77.232.72.10
@@ -90634,7 +89768,6 @@
  77.243.181.86
  77.243.183.120
  77.243.183.80
-77.243.19.44
  77.243.191.18
  77.243.191.19
  77.243.191.20
@@ -90643,27 +89776,34 @@
  77.243.191.36
  77.243.191.44
  77.243.191.45
-77.243.26.119
+77.243.27.240
  77.243.51.53
  77.244.211.39
  77.244.26.125
  77.244.42.178
  77.245.101.254
-77.245.105.165
  77.245.112.48
  77.245.76.93
+77.245.96.210
  77.246.144.215
  77.246.191.192
-77.246.27.250
  77.247.110.101
  77.247.110.102
+77.247.110.103
  77.247.110.109
+77.247.110.110
  77.247.110.12
  77.247.110.121
+77.247.110.122
  77.247.110.124
  77.247.110.125
  77.247.110.126
+77.247.110.129
+77.247.110.130
+77.247.110.131
  77.247.110.132
+77.247.110.141
+77.247.110.142
  77.247.110.148
  77.247.110.15
  77.247.111.98
@@ -90687,28 +89827,27 @@
  77.250.60.51
  77.250.67.102
  77.251.174.25
-77.251.235.248
  77.27.123.197
-77.27.55.59
-77.28.195.5
  77.28.198.226
  77.28.255.80
  77.28.55.242
-77.28.66.13
  77.28.91.152
  77.28.96.196
  77.28.96.206
+77.28.97.34
  77.29.138.113
+77.3.139.1
  77.3.156.97
  77.3.53.22
-77.30.176.164
  77.31.161.222
+77.34.109.134
  77.34.202.46
  77.34.228.206
-77.35.241.128
-77.35.242.237
+77.35.229.164
  77.35.63.202
+77.37.131.164
  77.37.131.73
+77.37.136.168
  77.37.138.239
  77.37.140.231
  77.37.152.104
@@ -90720,15 +89859,15 @@
  77.37.208.119
  77.37.236.10
  77.37.240.23
-77.38.129.128
-77.38.203.201
+77.37.246.176
  77.38.21.239
  77.38.42.145
-77.38.6.129
  77.39.11.78
  77.39.117.115
+77.39.117.226
  77.39.8.64
  77.40.123.115
+77.40.14.235
  77.40.160.37
  77.40.160.38
  77.40.160.39
@@ -90744,11 +89883,10 @@
  77.40.160.51
  77.40.160.52
  77.40.178.236
+77.40.2.117
  77.40.3.237
-77.40.61.37
-77.40.62.148
  77.40.62.15
-77.40.87.176
+77.40.74.25
  77.43.1.226
  77.43.174.46
  77.43.65.44
@@ -90764,9 +89902,10 @@
  77.52.178.235
  77.53.228.168
  77.53.53.196
+77.54.203.174
  77.54.207.17
-77.55.208.64
  77.55.211.77
+77.55.217.138
  77.55.217.154
  77.56.105.35
  77.56.110.153
@@ -90779,35 +89918,35 @@
  77.57.53.115
  77.58.124.151
  77.58.58.11
+77.6.154.86
  77.6.220.34
  77.64.136.174
  77.64.162.212
  77.64.234.44
  77.65.105.116
+77.65.50.118
  77.66.1.97
  77.66.214.80
  77.67.55.219
  77.68.114.124
  77.68.115.33
+77.68.118.144
  77.68.17.126
-77.68.17.246
  77.68.24.178
-77.68.25.21
  77.68.25.77
  77.68.62.77
  77.68.82.58
  77.68.86.20
  77.68.9.178
  77.69.130.127
-77.69.166.208
  77.69.23.183
+77.7.75.27
  77.70.16.245
  77.70.29.86
  77.70.35.87
  77.72.131.141
  77.72.144.197
  77.72.144.198
-77.72.24.58
  77.72.71.66
  77.72.83.192
  77.73.69.101
@@ -90818,6 +89957,7 @@
  77.73.70.28
  77.74.78.80
  77.75.161.167
+77.75.6.34
  77.75.76.160
  77.75.76.161
  77.75.76.162
@@ -90867,6 +90007,7 @@
  77.75.79.95
  77.76.151.206
  77.76.151.72
+77.76.37.123
  77.77.222.146
  77.78.11.235
  77.78.23.108
@@ -90877,7 +90018,7 @@
  77.79.246.81
  77.79.85.236
  77.79.93.3
-77.8.8.172
+77.8.237.207
  77.81.100.88
  77.81.139.35
  77.81.139.36
@@ -90889,7 +90030,6 @@
  77.81.139.46
  77.81.142.101
  77.81.247.72
-77.81.6.149
  77.81.6.201
  77.81.7.90
  77.82.234.28
@@ -90902,16 +90042,15 @@
  77.83.247.32
  77.83.247.58
  77.83.247.70
-77.83.85.152
  77.83.86.145
  77.83.86.174
+77.83.86.232
  77.85.169.149
  77.85.169.19
  77.85.203.98
  77.85.204.149
  77.85.211.16
  77.85.238.130
-77.86.44.119
  77.87.196.119
  77.87.75.12
  77.88.47.14
@@ -90924,16 +90063,15 @@
  77.89.248.157
  77.89.251.138
  77.9.124.107
-77.9.53.6
  77.90.136.129
  77.91.201.31
-77.91.44.81
  77.91.60.90
  77.91.82.105
  77.92.132.179
  77.92.144.239
  77.92.53.7
  77.92.83.100
+77.93.126.12
  77.93.208.64
  77.93.223.9
  77.93.235.34
@@ -90944,6 +90082,7 @@
  77.93.63.114
  77.94.112.234
  77.94.250.178
+77.94.97.178
  77.95.141.193
  77.95.167.127
  77.95.225.77
@@ -90987,13 +90126,12 @@
  77options.com
  77rv.net
  77st.net
-78.0.123.73
  78.0.27.83
-78.1.14.174
-78.101.178.165
+78.0.8.155
+78.1.77.93
  78.102.136.61
  78.102.65.189
-78.106.176.208
+78.106.165.154
  78.107.240.57
  78.108.102.3
  78.108.102.8
@@ -91005,7 +90143,9 @@
  78.108.38.156
  78.108.38.158
  78.108.89.240
+78.109.102.1
  78.109.211.3
+78.11.108.68
  78.11.32.28
  78.11.32.3
  78.11.69.3
@@ -91025,15 +90165,16 @@
  78.118.107.248
  78.118.96.201
  78.119.180.62
-78.120.229.130
  78.121.142.111
  78.122.127.148
  78.122.204.216
-78.122.95.84
-78.124.136.16
  78.127.40.110
+78.128.113.0
+78.128.113.66
  78.128.113.67
+78.128.113.68
  78.128.114.111
+78.128.2.114
  78.129.143.154
  78.129.148.77
  78.129.152.232
@@ -91044,14 +90185,12 @@
  78.129.221.31
  78.129.226.8
  78.129.250.17
-78.129.57.32
-78.129.97.219
  78.130.147.170
  78.130.170.67
-78.130.46.68
  78.131.52.120
-78.131.56.9
  78.131.58.83
+78.132.16.236
+78.132.28.51
  78.132.45.20
  78.132.54.45
  78.133.163.190
@@ -91065,6 +90204,7 @@
  78.136.30.118
  78.137.168.192
  78.137.2.109
+78.137.39.85
  78.138.129.104
  78.138.157.26
  78.138.187.231
@@ -91091,14 +90231,14 @@
  78.143.96.35
  78.150.112.143
  78.151.161.24
-78.153.146.222
+78.153.199.245
  78.153.4.122
  78.154.167.68
  78.154.176.154
  78.154.180.12
-78.154.212.27
  78.155.205.102
  78.155.85.67
+78.157.254.58
  78.157.28.15
  78.157.28.26
  78.157.28.35
@@ -91109,7 +90249,6 @@
  78.157.91.120
  78.158.10.192
  78.158.11.226
-78.158.160.137
  78.159.100.106
  78.159.103.53
  78.159.108.204
@@ -91120,7 +90259,6 @@
  78.159.99.85
  78.161.106.142
  78.161.131.121
-78.163.101.55
  78.164.67.9
  78.165.109.230
  78.165.74.162
@@ -91153,15 +90291,14 @@
  78.180.155.1
  78.180.157.169
  78.181.103.113
-78.182.147.66
  78.182.254.231
-78.185.127.224
+78.183.3.202
  78.185.176.236
-78.186.104.233
  78.186.109.7
  78.186.111.109
  78.186.112.235
  78.186.133.164
+78.186.2.84
  78.186.216.101
  78.186.216.216
  78.186.238.58
@@ -91170,7 +90307,6 @@
  78.187.100.171
  78.187.133.26
  78.187.137.194
-78.187.144.164
  78.187.156.31
  78.187.199.31
  78.187.220.150
@@ -91179,6 +90315,7 @@
  78.187.42.96
  78.187.46.204
  78.187.59.175
+78.187.64.199
  78.188.106.235
  78.188.119.253
  78.188.168.64
@@ -91197,17 +90334,15 @@
  78.189.190.196
  78.189.25.224
  78.189.64.42
-78.189.90.149
  78.19.121.195
+78.190.144.18
  78.190.251.194
-78.190.27.229
  78.191.246.237
  78.192.18.48
  78.192.184.102
  78.193.74.165
  78.194.158.141
  78.2.121.111
-78.2.82.217
  78.20.135.129
  78.20.168.99
  78.20.192.90
@@ -91223,11 +90358,10 @@
  78.22.149.120
  78.22.235.128
  78.220.111.71
+78.220.153.155
  78.23.204.168
  78.23.46.93
  78.232.152.36
-78.234.14.85
-78.237.118.103
  78.237.208.26
  78.24.101.86
  78.24.111.198
@@ -91237,14 +90371,12 @@
  78.25.112.42
  78.25.120.105
  78.25.32.182
-78.250.155.236
  78.250.215.133
  78.26.151.247
  78.26.204.179
  78.26.26.146
  78.27.139.13
  78.28.214.74
-78.29.176.180
  78.29.32.35
  78.29.42.10
  78.29.8.10
@@ -91254,7 +90386,6 @@
  78.31.66.3
  78.32.108.122
  78.32.157.222
-78.35.110.10
  78.35.120.245
  78.35.250.110
  78.35.251.85
@@ -91267,7 +90398,6 @@
  78.38.122.249
  78.38.123.110
  78.38.150.103
-78.38.176.120
  78.38.189.249
  78.40.180.217
  78.40.180.45
@@ -91329,24 +90459,21 @@
  78.47.41.177
  78.47.50.83
  78.47.61.83
+78.47.86.162
  78.47.87.196
  78.47.95.230
-78.49.89.63
-78.54.107.168
-78.54.18.37
-78.54.200.250
-78.54.213.100
-78.54.76.35
-78.54.80.19
+78.54.132.152
+78.54.6.65
+78.55.109.41
+78.55.189.39
+78.55.42.6
  78.56.201.4
  78.57.227.227
-78.57.25.141
  78.58.17.84
  78.6.228.32
  78.60.130.181
  78.60.163.106
  78.60.203.75
-78.61.187.91
  78.62.186.157
  78.62.214.242
  78.63.194.215
@@ -91375,18 +90502,23 @@
  78.8.231.62
  78.80.179.178
  78.81.245.153
-78.82.203.247
+78.82.230.104
  78.83.103.4
  78.83.199.235
  78.83.242.229
  78.83.53.171
+78.84.120.128
  78.84.137.90
  78.84.174.53
  78.84.189.214
  78.84.22.156
+78.84.40.118
  78.84.54.254
  78.85.177.7
+78.85.20.134
  78.85.210.13
+78.85.4.216
+78.85.5.105
  78.88.229.104
  78.9.110.94
  78.90.136.18
@@ -91395,16 +90527,16 @@
  78.90.78.210
  78.90.81.184
  78.90.91.220
+78.92.190.171
  78.92.254.169
  78.92.254.9
  78.94.124.10
-78.94.190.191
-78.94.240.180
+78.94.186.133
  78.94.31.171
-78.95.196.173
+78.96.131.64
  78.96.144.101
+78.96.145.227
  78.96.227.218
-78.97.6.117
  78.99.117.207
  7803000.com
  78111.com
@@ -91430,6 +90562,7 @@
  78ij.xyz
  78mcp.com
  78ug45egfdy089l095d.top
+79.1.234.208
  79.10.148.140
  79.10.198.229
  79.10.82.174
@@ -91438,7 +90571,6 @@
  79.101.1.25
  79.101.106.74
  79.101.150.134
-79.101.181.195
  79.101.40.114
  79.101.45.94
  79.101.55.161
@@ -91452,7 +90584,6 @@
  79.106.131.105
  79.106.14.13
  79.106.15.98
-79.106.156.181
  79.106.165.238
  79.106.165.30
  79.106.166.154
@@ -91465,8 +90596,7 @@
  79.106.34.6
  79.106.34.9
  79.106.35.138
-79.106.35.20
-79.106.35.58
+79.106.35.59
  79.106.35.60
  79.106.35.62
  79.106.35.82
@@ -91481,7 +90611,6 @@
  79.11.222.106
  79.110.112.210
  79.110.17.21
-79.110.17.84
  79.110.201.49
  79.110.28.104
  79.110.28.119
@@ -91490,6 +90619,7 @@
  79.110.28.133
  79.110.28.135
  79.110.28.141
+79.110.28.148
  79.110.28.152
  79.110.28.154
  79.110.28.155
@@ -91535,23 +90665,26 @@
  79.110.28.93
  79.110.52.252
  79.111.13.155
+79.111.196.219
  79.111.20.69
+79.112.125.76
+79.112.194.25
  79.113.109.118
+79.113.206.10
  79.113.9.122
-79.114.13.103
  79.114.151.6
  79.114.75.198
-79.115.132.215
  79.116.28.250
  79.117.93.38
  79.118.179.194
-79.118.214.95
  79.120.11.154
  79.120.118.82
  79.120.177.106
+79.120.3.122
  79.120.54.174
  79.120.70.47
  79.121.103.71
+79.121.113.69
  79.124.23.9
  79.124.62.182
  79.124.62.250
@@ -91565,15 +90698,15 @@
  79.125.163.225
  79.125.183.146
  79.125.4.162
-79.126.114.238
+79.126.114.202
  79.126.76.32
  79.127.115.53
  79.127.124.131
  79.127.56.186
  79.127.57.43
+79.129.108.121
  79.129.117.118
  79.129.135.116
-79.129.166.1
  79.129.22.230
  79.129.29.237
  79.129.6.235
@@ -91585,11 +90718,15 @@
  79.132.201.148
  79.132.201.225
  79.132.201.229
+79.132.202.121
  79.132.203.208
  79.132.205.34
+79.133.133.220
  79.133.200.146
+79.133.58.179
  79.133.6.236
  79.134.173.69
+79.134.32.203
  79.134.7.134
  79.134.78.218
  79.134.99.112
@@ -91598,6 +90735,7 @@
  79.136.1.46
  79.136.30.33
  79.136.31.253
+79.136.44.59
  79.136.64.176
  79.136.70.159
  79.137.1.129
@@ -91606,7 +90744,6 @@
  79.137.115.56
  79.137.20.253
  79.137.222.49
-79.137.254.51
  79.137.28.159
  79.137.32.121
  79.137.32.182
@@ -91644,7 +90781,7 @@
  79.138.10.72
  79.138.98.31
  79.14.154.4
-79.140.123.189
+79.140.150.146
  79.140.150.22
  79.140.167.238
  79.140.228.6
@@ -91674,28 +90811,30 @@
  79.143.87.240
  79.143.87.241
  79.144.210.241
-79.146.116.98
+79.145.65.208
  79.146.37.89
-79.147.174.172
+79.147.174.188
  79.148.135.185
+79.148.149.168
  79.148.158.152
  79.148.238.69
  79.148.44.211
-79.149.60.42
  79.150.168.125
  79.150.204.56
  79.150.214.31
+79.150.22.159
  79.152.40.63
  79.154.14.4
  79.155.8.95
  79.158.182.231
-79.159.138.37
  79.159.151.216
  79.160.166.61
  79.161.183.55
  79.161.252.14
  79.164.171.32
  79.164.176.68
+79.164.240.96
+79.164.79.155
  79.165.225.234
  79.168.204.180
  79.168.231.184
@@ -91706,8 +90845,10 @@
  79.171.13.166
  79.171.13.182
  79.172.102.4
+79.172.111.174
  79.172.193.32
  79.172.201.60
+79.172.237.6
  79.173.124.177
  79.174.187.54
  79.174.191.1
@@ -91715,96 +90856,84 @@
  79.174.24.172
  79.174.72.78
  79.175.125.210
+79.175.176.52
  79.175.42.244
  79.175.57.77
-79.175.64.92
-79.176.200.65
  79.177.26.177
  79.177.56.239
  79.178.211.152
  79.178.60.44
  79.179.122.203
  79.179.29.102
-79.18.195.86
  79.181.20.138
  79.181.83.16
-79.183.206.228
-79.183.33.43
  79.184.174.202
+79.184.224.111
  79.184.38.118
-79.185.112.85
+79.184.42.75
  79.187.129.5
-79.188.104.97
  79.188.20.242
  79.188.246.2
  79.188.40.187
  79.188.68.89
-79.189.19.46
  79.189.62.218
+79.190.228.149
  79.191.101.184
-79.193.113.168
  79.193.122.208
-79.193.157.51
-79.195.66.89
+79.193.155.86
+79.195.28.145
  79.195.67.89
  79.196.13.90
  79.196.73.183
+79.199.228.49
  79.200.187.177
-79.200.191.24
-79.202.173.48
-79.202.174.73
-79.202.175.114
-79.203.105.244
  79.203.141.76
  79.207.249.149
  79.208.208.50
  79.209.70.131
+79.209.78.103
+79.209.79.115
  79.21.45.9
+79.210.161.230
+79.210.161.77
+79.210.174.171
  79.210.31.103
  79.210.79.246
+79.214.122.209
  79.217.21.51
-79.218.130.44
  79.218.139.86
-79.220.185.61
+79.219.17.93
+79.22.35.79
  79.220.221.138
-79.221.45.74
  79.222.61.208
-79.223.1.104
  79.224.189.22
  79.225.110.81
-79.225.99.140
+79.225.91.253
  79.226.154.59
  79.227.117.216
-79.233.100.114
-79.233.160.104
+79.229.194.155
+79.233.174.100
  79.233.175.164
-79.235.245.79
-79.236.253.51
  79.244.122.142
-79.246.119.20
  79.25.112.10
  79.26.42.103
  79.27.107.176
  79.27.214.141
  79.27.230.169
-79.32.11.185
  79.32.198.231
-79.36.193.122
  79.36.223.91
  79.37.147.206
  79.41.123.117
-79.42.242.251
-79.43.156.91
+79.41.175.162
+79.41.198.165
  79.43.221.23
  79.44.68.40
  79.49.78.176
  79.5.1.73
  79.51.114.27
-79.51.29.11
+79.51.54.134
  79.52.83.157
-79.53.169.228
  79.53.213.67
-79.53.61.76
  79.53.68.140
  79.54.115.243
  79.54.128.123
@@ -91813,7 +90942,6 @@
  79.58.45.55
  79.61.191.231
  79.63.131.98
-79.66.167.30
  79.66.66.18
  79.67.137.168
  79.68.124.66
@@ -91821,21 +90949,23 @@
  79.7.158.208
  79.7.218.151
  79.73.9.69
-79.74.127.68
-79.76.86.66
+79.76.78.166
  79.77.133.30
  79.77.33.131
  79.77.48.143
  79.77.7.225
+79.77.89.196
  79.81.217.156
-79.82.253.50
  79.9.102.153
  79.9.171.88
+79.9.21.146
+79.9.88.185
  79.96.175.83
  79.96.218.84
  79.96.33.43
  79.96.73.102
  79.97.177.78
+79.97.247.60
  79.98.1.32
  79.98.105.138
  79.98.133.14
@@ -91843,7 +90973,6 @@
  79.98.23.9
  79.98.24.39
  79.98.30.37
-79.99.188.17
  79.99.188.50
  79.99.188.51
  79.99.188.52
@@ -91970,18 +91099,19 @@
  8.12.16.78
  8.12.161.82
  8.129.172.40
-8.129.42.36
-8.129.88.42
-8.133.191.41
-8.134.9.86
+8.129.179.159
+8.129.189.234
+8.129.210.222
  8.135.28.152
+8.136.129.198
  8.14.146.83
  8.15.224.120
  8.208.101.38
-8.208.28.167
+8.208.102.116
  8.208.76.238
  8.208.80.253
  8.208.82.107
+8.208.83.77
  8.208.99.12
  8.209.217.201
  8.209.71.217
@@ -91997,12 +91127,14 @@
  8.210.101.132
  8.210.129.196
  8.210.141.183
+8.210.146.161
  8.210.148.132
  8.210.162.171
  8.210.170.138
  8.210.18.56
  8.210.194.45
  8.210.203.247
+8.210.206.62
  8.210.212.28
  8.210.214.87
  8.210.217.170
@@ -92018,9 +91150,11 @@
  8.22.68.28
  8.242.208.167
  8.242.208.170
+8.242.215.90
  8.25.234.58
  8.26.191.44
  8.28.16.254
+8.30.103.159
  8.33.7.95
  8.34.30.253
  8.38.147.28
@@ -92029,8 +91163,9 @@
  8.38.89.152
  8.4.9.137
  8.40.143.51
-8.43.41.230
-8.44.147.146
+8.43.40.20
+8.43.41.165
+8.43.41.74
  8.81.199.35.bc.googleusercontent.com
  8.9.31.101
  8.9.40.245
@@ -92048,25 +91183,23 @@
  80.101.146.172
  80.101.82.203
  80.101.91.75
-80.102.132.70
  80.102.214.209
  80.102.22.14
  80.102.50.2
-80.104.148.153
  80.106.228.1
  80.106.247.145
  80.106.59.35
  80.107.117.210
+80.107.16.17
  80.107.71.76
  80.108.14.34
  80.108.17.214
  80.108.210.64
-80.108.52.102
  80.108.82.95
-80.108.95.9
  80.109.153.122
  80.109.75.19
  80.11.234.73
+80.11.253.8
  80.110.119.55
  80.110.126.186
  80.110.188.114
@@ -92077,41 +91210,44 @@
  80.114.3.91
  80.114.89.7
  80.115.166.124
-80.117.21.144
  80.119.237.244
  80.12.91.114
  80.120.152.38
  80.120.248.141
  80.120.248.142
  80.120.248.151
+80.120.85.138
  80.122.92.78
  80.123.143.202
  80.123.162.21
  80.127.116.96
-80.128.149.235
  80.128.155.214
+80.128.158.106
+80.13.222.26
  80.131.238.237
-80.131.75.241
  80.131.76.184
  80.132.118.89
+80.132.121.171
+80.132.126.147
  80.132.189.180
  80.132.237.193
-80.132.99.64
  80.133.32.79
+80.133.40.208
  80.134.175.57
  80.134.203.210
-80.135.117.223
+80.134.27.25
  80.135.123.44
  80.135.127.156
  80.136.51.176
  80.136.52.153
  80.137.175.16
  80.138.162.38
-80.14.168.37
  80.14.187.157
  80.14.255.118
  80.144.105.140
+80.145.74.113
  80.147.82.165
+80.148.21.66
  80.15.100.37
  80.15.14.46
  80.15.195.37
@@ -92128,20 +91264,18 @@
  80.179.149.111
  80.179.42.40
  80.179.42.44
-80.179.57.193
  80.183.80.215
-80.183.87.174
  80.184.121.23
  80.184.88.50
  80.187.112.69
  80.187.120.117
-80.187.96.144
+80.187.82.142
  80.187.96.179
-80.187.96.197
  80.188.204.250
  80.188.239.106
  80.189.197.11
  80.189.41.54
+80.19.177.242
  80.190.188.74
  80.191.133.175
  80.191.169.66
@@ -92152,14 +91286,13 @@
  80.191.174.220
  80.195.57.97
  80.197.127.115
+80.20.133.206
  80.200.58.215
  80.201.24.160
  80.201.85.82
-80.203.124.21
  80.208.230.170
  80.209.229.151
  80.209.231.126
-80.210.107.112
  80.210.75.35
  80.211.102.87
  80.211.11.250
@@ -92200,7 +91333,6 @@
  80.211.75.205
  80.211.89.87
  80.211.99.98
-80.212.91.169
  80.213.212.137
  80.213.245.240
  80.216.100.169
@@ -92210,7 +91342,6 @@
  80.22.165.54
  80.227.134.221
  80.227.174.18
-80.227.184.6
  80.229.116.110
  80.229.139.205
  80.229.14.115
@@ -92226,7 +91357,6 @@
  80.235.235.74
  80.237.159.104
  80.237.2.74
-80.237.75.2
  80.237.79.29
  80.238.124.193
  80.238.125.164
@@ -92243,7 +91373,6 @@
  80.240.254.139
  80.241.209.102
  80.241.210.218
-80.241.211.131
  80.241.211.241
  80.241.211.57
  80.241.212.139
@@ -92282,8 +91411,8 @@
  80.247.164.121
  80.247.76.181
  80.248.225.150
+80.249.1.140
  80.249.131.9
-80.249.147.43
  80.249.163.34
  80.249.176.206
  80.25.87.49
@@ -92292,16 +91421,15 @@
  80.250.82.41
  80.251.153.208
  80.251.153.33
-80.251.153.35
+80.251.219.111
  80.251.55.158
  80.252.133.26
-80.253.246.82
+80.253.213.9
  80.253.29.58
  80.253.92.129
  80.253.94.252
  80.254.102.78
  80.254.126.33
-80.254.165.132
  80.254.48.93
  80.255.192.237
  80.255.3.106
@@ -92323,7 +91451,6 @@
  80.3.41.245
  80.31.166.90
  80.31.198.49
-80.31.203.185
  80.31.238.123
  80.31.246.103
  80.31.48.94
@@ -92339,7 +91466,10 @@
  80.48.183.166
  80.48.255.145
  80.48.255.154
+80.49.135.130
+80.51.153.15
  80.52.169.233
+80.52.226.6
  80.52.60.214
  80.53.156.62
  80.53.244.214
@@ -92348,20 +91478,17 @@
  80.53.57.146
  80.55.101.146
  80.55.96.118
-80.6.52.130
  80.60.120.119
  80.60.135.139
+80.62.116.194
  80.63.106.83
  80.63.106.90
  80.64.172.68
  80.64.77.58
-80.64.80.239
  80.65.23.139
  80.65.28.57
-80.65.75.244
  80.66.146.84
  80.66.150.238
-80.66.202.86
  80.67.172.162
  80.67.250.21
  80.67.26.40
@@ -92373,7 +91500,6 @@
  80.68.2.74
  80.68.76.178
  80.68.97.165
-80.7.217.130
  80.70.17.209
  80.70.17.225
  80.70.17.245
@@ -92394,7 +91520,7 @@
  80.70.22.185
  80.70.22.187
  80.70.22.188
-80.70.22.191
+80.70.22.190
  80.70.22.206
  80.70.22.213
  80.70.22.219
@@ -92429,25 +91555,30 @@
  80.73.13.219
  80.73.84.106
  80.73.87.202
+80.73.89.109
+80.74.149.13
  80.75.17.227
  80.75.17.228
+80.75.17.230
+80.75.25.144
  80.76.195.26
  80.76.236.66
  80.76.55.26
  80.76.80.108
  80.77.155.83
+80.77.42.143
  80.78.22.150
  80.78.22.229
  80.78.240.191
  80.78.248.25
  80.78.255.243
  80.78.65.187
+80.78.74.133
  80.78.75.59
  80.78.77.114
  80.78.79.69
  80.79.114.34
  80.79.116.131
-80.79.116.134
  80.79.116.136
  80.79.116.137
  80.79.158.29
@@ -92463,13 +91594,12 @@
  80.80.167.246
  80.80.167.249
  80.80.171.100
-80.80.228.6
  80.80.234.140
  80.81.232.131
+80.81.232.149
  80.82.147.1
  80.82.147.2
  80.82.147.4
-80.82.184.72
  80.82.208.58
  80.82.215.152
  80.82.51.45
@@ -92526,6 +91656,7 @@
  80.87.201.55
  80.87.33.2
  80.87.39.94
+80.88.110.112
  80.88.119.243
  80.88.17.39
  80.88.172.227
@@ -92537,6 +91668,7 @@
  80.89.156.216
  80.89.224.44
  80.90.228.170
+80.90.82.70
  80.90.86.237
  80.91.118.61
  80.91.125.99
@@ -92550,6 +91682,7 @@
  80.92.29.23
  80.92.84.168
  80.93.124.148
+80.93.130.50
  80.93.213.246
  80.93.217.42
  80.93.220.21
@@ -92559,6 +91692,7 @@
  80.96.150.171
  80.98.185.104
  80.98.249.181
+80.99.192.156
  80.99.219.100
  8004print.com
  800emailsupport.com
@@ -92588,7 +91722,7 @@
  80wlg02q6h.sted.cc
  80yuanma.com
  81.0.198.25
-81.0.33.249
+81.0.49.120
  81.0.79.105
  81.0.93.106
  81.1.209.77
@@ -92596,9 +91730,7 @@
  81.10.112.12
  81.10.2.58
  81.10.227.233
-81.101.140.104
  81.102.123.39
-81.102.50.57
  81.105.178.194
  81.109.203.182
  81.110.170.57
@@ -92606,18 +91738,14 @@
  81.111.112.45
  81.111.43.114
  81.117.225.245
-81.12.119.164
-81.12.119.166
  81.12.119.169
-81.12.119.171
  81.12.119.172
-81.12.119.189
  81.12.13.152
  81.12.169.126
  81.12.169.254
  81.12.224.61
-81.12.29.205
-81.13.228.45
+81.12.28.185
+81.12.28.226
  81.130.146.18
  81.130.234.235
  81.130.70.67
@@ -92626,14 +91754,11 @@
  81.134.179.184
  81.137.6.81
  81.138.20.196
-81.14.224.187
  81.140.243.139
  81.141.0.112
  81.141.23.54
  81.144.138.34
-81.145.194.114
  81.146.56.66
-81.151.58.254
  81.156.142.165
  81.156.25.143
  81.159.167.6
@@ -92642,6 +91767,7 @@
  81.16.33.33
  81.16.9.2
  81.16.9.222
+81.161.142.153
  81.161.226.4
  81.161.61.110
  81.161.61.130
@@ -92652,13 +91778,15 @@
  81.161.63.251
  81.161.63.253
  81.161.63.254
-81.162.114.98
  81.162.243.249
  81.162.57.134
+81.163.25.22
  81.163.254.104
+81.163.254.107
  81.163.36.139
  81.163.36.210
  81.163.42.46
+81.163.53.77
  81.163.57.147
  81.163.62.221
  81.163.80.146
@@ -92681,6 +91809,7 @@
  81.169.245.54
  81.169.248.38
  81.17.131.61
+81.17.150.22
  81.17.16.111
  81.17.16.122
  81.17.16.122zeros6x.sh
@@ -92700,6 +91829,7 @@
  81.17.94.50
  81.170.143.123
  81.170.150.236
+81.170.85.55
  81.171.12.44
  81.171.22.143
  81.171.29.146
@@ -92711,6 +91841,7 @@
  81.174.11.227
  81.174.246.185
  81.174.65.27
+81.175.193.59
  81.175.28.110
  81.175.71.121
  81.176.229.202
@@ -92718,6 +91849,7 @@
  81.177.135.25
  81.177.136.51
  81.177.170.90
+81.177.211.160
  81.177.73.10
  81.177.73.17
  81.177.73.29
@@ -92742,7 +91874,6 @@
  81.180.68.232
  81.182.0.90
  81.182.12.7
-81.182.159.168
  81.182.187.3
  81.182.217.13
  81.182.220.204
@@ -92760,12 +91891,12 @@
  81.186.148.72
  81.187.171.182
  81.187.221.177
+81.187.245.48
  81.19.215.118
  81.19.220.103
  81.19.220.40
  81.19.3.16
  81.191.40.58
-81.192.103.84
  81.192.106.3
  81.192.184.214
  81.192.188.112
@@ -92778,12 +91909,13 @@
  81.197.110.223
  81.198.116.76
  81.198.119.241
-81.198.26.157
+81.198.142.13
  81.198.27.236
  81.198.79.162
  81.198.79.164
  81.198.79.168
  81.198.79.174
+81.198.97.46
  81.199.16.33
  81.2.103.237
  81.2.105.67
@@ -92812,13 +91944,15 @@
  81.21.67.202
  81.21.79.214
  81.21.86.97
+81.211.103.162
  81.211.68.14
  81.212.163.230
+81.213.183.164
  81.214.120.216
-81.214.155.165
  81.214.253.80
  81.214.254.203
  81.214.39.214
+81.215.200.22
  81.215.230.173
  81.217.229.79
  81.218.127.187
@@ -92834,7 +91968,6 @@
  81.224.44.164
  81.226.160.5
  81.226.179.58
-81.227.114.224
  81.227.171.215
  81.228.169.206
  81.229.89.161
@@ -92854,11 +91987,15 @@
  81.24.88.123
  81.242.91.23
  81.243.223.62
-81.245.163.86
+81.244.177.79
+81.245.173.127
  81.246.177.106
+81.247.173.162
  81.248.104.172
  81.25.120.224
  81.25.229.123
+81.250.147.230
+81.252.170.75
  81.254.90.197
  81.255.105.165
  81.27.79.18
@@ -92868,6 +92005,7 @@
  81.29.211.35
  81.29.245.164
  81.3.154.235
+81.3.179.83
  81.30.162.28
  81.30.164.221
  81.30.176.30
@@ -92883,13 +92021,13 @@
  81.31.241.194
  81.31.241.198
  81.31.251.171
-81.33.159.19
  81.33.4.214
  81.34.18.81
  81.35.46.72
  81.35.67.42
  81.36.14.52
  81.36.42.178
+81.37.106.193
  81.37.191.194
  81.39.151.62
  81.39.193.51
@@ -92897,20 +92035,19 @@
  81.4.102.200
  81.4.102.69
  81.4.105.175
+81.4.110.153
  81.4.110.236
  81.4.127.228
  81.4.150.202
  81.43.169.242
  81.43.98.133
-81.44.85.93
+81.44.85.51
  81.47.161.135
  81.49.27.21
  81.5.103.14
-81.5.112.19
  81.53.19.56
  81.56.94.102
  81.57.217.41
-81.6.39.241
  81.6.43.167
  81.67.74.231
  81.68.101.116
@@ -92959,7 +92096,6 @@
  81.68.163.114
  81.68.163.129
  81.68.165.205
-81.68.165.34
  81.68.166.245
  81.68.167.79
  81.68.169.2
@@ -92979,7 +92115,6 @@
  81.68.191.219
  81.68.192.169
  81.68.193.31
-81.68.197.106
  81.68.197.197
  81.68.199.77
  81.68.200.73
@@ -93015,6 +92150,7 @@
  81.68.237.243
  81.68.238.7
  81.68.242.191
+81.68.242.25
  81.68.242.64
  81.68.243.13
  81.68.243.185
@@ -93077,14 +92213,15 @@
  81.69.185.250
  81.69.19.79
  81.69.197.21
+81.69.203.128
  81.69.21.163
  81.69.218.137
  81.69.219.130
  81.69.220.225
  81.69.226.44
  81.69.228.153
-81.69.229.30
  81.69.230.208
+81.69.233.249
  81.69.242.112
  81.69.242.16
  81.69.242.220
@@ -93097,13 +92234,12 @@
  81.69.248.82
  81.69.249.10
  81.69.25.239
+81.69.250.222
  81.69.250.247
  81.69.251.177
  81.69.251.208
  81.69.251.46
  81.69.251.89
-81.69.252.108
-81.69.253.146
  81.69.253.29
  81.69.255.167
  81.69.255.211
@@ -93111,7 +92247,6 @@
  81.69.26.154
  81.69.26.23
  81.69.27.130
-81.69.29.171
  81.69.29.78
  81.69.3.109
  81.69.3.227
@@ -93138,7 +92273,6 @@
  81.69.58.73
  81.69.59.23
  81.69.59.85
-81.69.7.105
  81.69.7.163
  81.69.8.18
  81.69.97.151
@@ -93147,11 +92281,11 @@
  81.7.17.202
  81.70.10.77
  81.70.102.35
-81.70.103.48
  81.70.105.82
  81.70.11.106
  81.70.13.198
  81.70.134.173
+81.70.134.54
  81.70.143.188
  81.70.144.143
  81.70.145.250
@@ -93166,7 +92300,6 @@
  81.70.152.225
  81.70.153.243
  81.70.154.62
-81.70.155.151
  81.70.155.157
  81.70.155.219
  81.70.155.63
@@ -93184,16 +92317,17 @@
  81.70.162.235
  81.70.163.127
  81.70.163.249
+81.70.164.157
  81.70.166.116
  81.70.166.61
  81.70.167.241
  81.70.168.239
  81.70.168.63
  81.70.168.69
-81.70.169.150
  81.70.169.178
  81.70.17.83
  81.70.170.184
+81.70.172.100
  81.70.173.185
  81.70.174.192
  81.70.175.139
@@ -93227,9 +92361,7 @@
  81.70.200.121
  81.70.200.133
  81.70.200.137
-81.70.201.139
  81.70.201.53
-81.70.202.237
  81.70.203.235
  81.70.203.246
  81.70.203.81
@@ -93263,7 +92395,6 @@
  81.70.233.94
  81.70.236.203
  81.70.240.53
-81.70.25.150
  81.70.25.19
  81.70.3.190
  81.70.31.196
@@ -93277,8 +92408,10 @@
  81.70.42.95
  81.70.43.103
  81.70.43.144
+81.70.43.97
  81.70.46.31
  81.70.48.45
+81.70.48.66
  81.70.56.215
  81.70.57.192
  81.70.7.32
@@ -93328,6 +92461,7 @@
  81.71.35.59
  81.71.37.37
  81.71.37.86
+81.71.38.138
  81.71.38.43
  81.71.42.147
  81.71.44.172
@@ -93343,8 +92477,8 @@
  81.71.83.218
  81.71.84.128
  81.71.85.116
+81.71.91.140
  81.71.91.18
-81.71.92.155
  81.71.93.57
  81.82.201.5
  81.82.211.25
@@ -93375,6 +92509,8 @@
  81.89.215.146
  81.89.48.239
  81.90.188.81
+81.90.246.94
+81.91.151.94
  81.91.179.184
  81.91.208.8
  81.91.219.98
@@ -93382,6 +92518,7 @@
  81.92.207.106
  81.92.207.82
  81.92.207.99
+81.92.253.21
  81.93.218.200
  81.93.240.199
  81.93.240.46
@@ -93432,16 +92569,18 @@
  82.1.4.99
  82.10.188.54
  82.10.220.141
+82.101.220.208
+82.102.107.189
+82.102.126.20
  82.102.16.195
  82.102.18.251
  82.102.21.214
  82.102.27.10
  82.102.27.118
-82.102.46.13
+82.102.82.58
  82.103.116.126
  82.103.118.42
  82.103.70.227
-82.114.115.194
  82.114.118.42
  82.114.248.25
  82.114.70.2
@@ -93457,11 +92596,10 @@
  82.115.215.102
  82.115.215.106
  82.115.215.155
-82.115.215.201
  82.115.215.238
-82.115.215.250
  82.115.215.78
  82.115.215.90
+82.115.215.91
  82.116.32.13
  82.116.79.5
  82.117.166.77
@@ -93479,11 +92617,10 @@
  82.118.242.108
  82.118.242.25
  82.118.242.76
-82.119.116.114
-82.124.198.234
+82.120.17.143
  82.125.183.73
-82.127.178.45
  82.127.213.38
+82.127.250.182
  82.127.38.115
  82.127.74.162
  82.128.141.82bin.sh
@@ -93493,8 +92630,6 @@
  82.131.191.213
  82.131.244.234
  82.131.245.72
-82.132.220.179
-82.132.240.68
  82.135.136.132
  82.135.148.201
  82.135.174.3
@@ -93506,11 +92641,11 @@
  82.137.224.193
  82.137.231.9
  82.137.244.28
-82.137.244.46
  82.137.244.59
  82.137.245.41
  82.137.250.156
  82.139.146.190
+82.14.35.51
  82.140.113.229
  82.140.128.25
  82.140.43.210
@@ -93521,7 +92656,6 @@
  82.142.147.34
  82.142.87.2
  82.144.207.116
-82.144.223.5
  82.144.83.152
  82.145.43.153
  82.146.38.254
@@ -93554,6 +92688,7 @@
  82.148.19.98
  82.148.25.100
  82.148.25.99
+82.149.178.171
  82.15.170.194
  82.150.140.40
  82.151.113.56
@@ -93564,20 +92699,22 @@
  82.151.35.130
  82.155.122.211
  82.155.28.72
+82.156.101.171
  82.156.102.157
  82.156.105.48
+82.156.106.92
  82.156.110.165
  82.156.113.222
-82.156.116.87
  82.156.118.163
  82.156.22.146
  82.156.23.113
  82.156.42.16
  82.156.42.233
  82.156.43.193
+82.156.64.181
  82.156.67.62
+82.156.67.68
  82.156.68.34
-82.156.71.203
  82.156.71.80
  82.156.72.254
  82.156.76.106
@@ -93589,14 +92726,13 @@
  82.156.86.198
  82.156.97.113
  82.156.97.165
-82.156.97.216
  82.156.99.230
+82.158.219.109
  82.159.109.89
  82.16.128.254
  82.160.215.7
  82.161.200.117
  82.161.48.16
-82.162.48.84
  82.165.100.150
  82.165.117.133
  82.165.124.25
@@ -93622,10 +92758,14 @@
  82.165.80.32
  82.166.143.97
  82.166.152.154
+82.166.158.79
+82.166.20.141
+82.166.30.82
  82.166.62.243
  82.173.62.58
  82.174.85.179
  82.176.164.40
+82.176.197.232
  82.177.176.1
  82.177.176.24
  82.177.87.98
@@ -93633,13 +92773,13 @@
  82.18.174.241
  82.181.218.229
  82.181.91.236
+82.183.31.22
  82.192.80.204
  82.192.81.160
  82.192.88.11
-82.193.100.83
  82.193.102.228
  82.193.103.110
-82.193.113.114
+82.193.109.93
  82.193.145.123
  82.193.15.3
  82.193.151.66
@@ -93664,6 +92804,8 @@
  82.196.15.59
  82.196.15.9
  82.196.2.49
+82.196.3.36
+82.196.5.194
  82.196.5.221
  82.196.5.23
  82.196.5.251
@@ -93672,13 +92814,16 @@
  82.197.204.14
  82.197.214.197
  82.197.215.125
+82.197.218.174
  82.199.102.10
  82.20.219.70
  82.20.251.200
  82.200.160.178
  82.200.164.184
+82.200.188.70
  82.200.205.30
  82.200.226.226
+82.200.237.222
  82.200.36.54
  82.200.55.38
  82.200.65.218
@@ -93695,8 +92840,9 @@
  82.202.68.231
  82.202.99.217
  82.204.141.94
+82.204.153.146
  82.206.222.21
-82.207.213.175
+82.207.197.166
  82.207.56.202
  82.207.57.10
  82.207.59.154
@@ -93708,18 +92854,21 @@
  82.208.173.16
  82.208.187.16
  82.208.72.210
+82.208.99.54
  82.209.118.57
+82.209.158.116
  82.209.166.126
  82.209.166.34
  82.209.206.126
  82.209.216.156
  82.209.219.244
  82.21.164.47
+82.211.2.72
  82.211.24.37
  82.211.31.210
+82.211.50.139
  82.211.55.115
  82.211.57.141
-82.211.57.149
  82.211.57.213
  82.211.57.220
  82.211.57.231
@@ -93728,22 +92877,18 @@
  82.211.58.14
  82.211.58.8
  82.211.9.123
-82.211.9.129
-82.211.9.155
  82.211.9.232
  82.211.9.34
  82.211.9.46
  82.211.9.72
  82.211.9.77
  82.213.224.115
-82.213.247.245
  82.213.78.2
  82.216.110.29
  82.217.127.4
  82.217.194.145
  82.22.210.17
  82.22.211.81
-82.22.96.157
  82.221.100.229
  82.221.102.177
  82.221.102.181
@@ -93784,11 +92929,8 @@
  82.223.11.124
  82.223.120.84
  82.223.14.245
-82.223.16.107
-82.223.190.10
  82.223.198.224
-82.223.3.52
-82.223.48.218
+82.223.77.225
  82.225.49.121
  82.237.252.9
  82.239.200.118
@@ -93796,42 +92938,35 @@
  82.242.45.193
  82.248.146.79
  82.248.206.76
-82.252.128.212
+82.252.133.112
  82.252.152.203
  82.255.203.175
  82.28.153.95
  82.28.186.158
  82.3.220.15
-82.30.239.112
  82.33.148.31
-82.33.73.159
  82.36.29.37
  82.37.141.166
-82.37.149.147
  82.37.31.3
  82.38.182.164
  82.39.166.139
  82.39.38.172
  82.39.55.136
-82.42.3.164
+82.4.243.183
  82.45.166.85
  82.46.89.252
  82.48.39.246
  82.5.222.144
  82.5.67.222
-82.56.14.104
-82.56.165.9
-82.56.181.7
+82.51.148.169
+82.58.102.194
  82.59.139.136
  82.59.139.141
-82.6.131.202
  82.6.139.142
  82.6.33.11
  82.60.7.40
-82.61.41.254
  82.62.153.15
  82.62.194.13
-82.63.54.34
  82.64.117.122
  82.64.150.50
  82.64.165.77
@@ -93849,8 +92984,6 @@
  82.64.32.76
  82.64.45.205
  82.64.49.27
-82.64.57.228
-82.64.69.52
  82.65.108.248
  82.65.115.199
  82.65.117.46
@@ -93859,7 +92992,6 @@
  82.65.143.234
  82.65.152.184
  82.65.165.177
-82.65.173.229
  82.65.173.65
  82.65.190.68
  82.65.200.58
@@ -93875,12 +93007,14 @@
  82.65.33.15
  82.65.37.166
  82.65.42.106
+82.65.81.223
  82.65.83.32
  82.66.234.57
+82.67.171.69
  82.67.234.103
  82.67.68.28
  82.68.49.227
-82.69.14.207
+82.69.119.77
  82.71.23.33
  82.71.47.216
  82.72.154.55
@@ -93891,11 +93025,12 @@
  82.76.135.94
  82.77.136.160
  82.77.136.63
-82.77.170.72
+82.77.237.30
  82.77.248.198
  82.77.55.46
  82.78.179.117
-82.78.27.18
+82.78.21.21
+82.79.154.145
  82.79.215.78
  82.79.232.120
  82.79.35.110
@@ -93905,14 +93040,13 @@
  82.80.249.159
  82.81.102.84
  82.81.19.42
-82.81.242.21
  82.81.246.96
  82.81.29.194
  82.81.4.57
  82.81.44.166
  82.81.98.51
  82.9.0.112
-82.9.37.206
+82.9.200.28
  82.94.216.148
  82.94.228.100
  82.94.35.199
@@ -93930,6 +93064,7 @@
  82.99.220.224
  82.99.229.115
  82.99.232.18
+82.99.244.4
  8200msc.com
  8203her928h7e4dd8305d3b0d52a2616-dot-polynomial-sum-287816.df.r.appspot.com
  820820.salamapetrochemical.com
@@ -93965,7 +93100,6 @@
  83.102.180.27
  83.103.147.110
  83.103.150.72
-83.103.179.156
  83.103.195.167
  83.103.195.183
  83.103.206.56
@@ -93973,19 +93107,15 @@
  83.103.72.130
  83.11.160.187
  83.11.43.209
-83.11.89.140
  83.110.103.16
-83.110.104.244
  83.110.212.140
  83.110.213.199
  83.110.223.58
  83.110.225.215
-83.12.153.149
  83.12.171.68
  83.12.198.38
  83.12.244.50
-83.128.173.97
-83.128.197.217
+83.128.142.204
  83.128.49.155
  83.13.118.130
  83.13.19.85
@@ -93995,8 +93125,7 @@
  83.13.74.14
  83.133.121.137
  83.133.127.251
-83.135.104.182
-83.135.133.221
+83.135.148.171
  83.135.194.106
  83.135.194.222
  83.135.194.33
@@ -94005,12 +93134,12 @@
  83.135.195.214
  83.135.200.167
  83.135.201.21
-83.135.202.211
+83.135.201.64
  83.135.203.184
-83.135.205.224
  83.135.205.72
-83.135.69.176
+83.135.66.114
  83.135.84.90
+83.135.87.149
  83.136.123.228
  83.136.126.153
  83.136.176.64
@@ -94033,9 +93162,9 @@
  83.143.24.27
  83.143.26.34
  83.143.31.254
-83.143.36.215
  83.144.117.139
  83.145.138.21
+83.146.70.223
  83.147.152.1
  83.147.153.226
  83.148.241.222
@@ -94053,6 +93182,8 @@
  83.151.238.65
  83.16.100.218
  83.160.81.177
+83.161.127.154
+83.161.145.204
  83.161.157.200
  83.161.158.205
  83.161.192.36
@@ -94088,6 +93219,7 @@
  83.169.20.144
  83.169.208.218
  83.169.21.32
+83.169.248.32
  83.169.28.96
  83.169.33.157
  83.169.35.150
@@ -94098,9 +93230,12 @@
  83.170.115.42
  83.170.193.178
  83.170.200.34
+83.171.107.51
  83.171.114.92
  83.171.252.97
+83.171.253.129
  83.171.255.224
+83.171.255.247
  83.171.98.129
  83.171.98.32
  83.171.98.47
@@ -94108,11 +93243,13 @@
  83.172.111.167
  83.172.144.31
  83.172.144.67
+83.172.72.187
  83.174.218.83
  83.174.233.94
  83.174.237.211
  83.175.111.138
  83.175.166.234
+83.177.191.37
  83.179.24.51
  83.18.149.38
  83.18.190.64
@@ -94120,17 +93257,17 @@
  83.19.99.66
  83.190.104.97
  83.191.163.133
+83.191.166.214
  83.197.36.53
  83.198.144.132
  83.198.252.101
  83.2.189.66
  83.20.207.43
  83.20.226.224
-83.20.255.54
-83.20.42.160
  83.202.231.25
+83.209.113.80
  83.209.121.104
-83.209.158.227
+83.209.169.43
  83.211.162.198
  83.212.102.225
  83.212.111.202
@@ -94155,13 +93292,17 @@
  83.221.163.157
  83.221.175.184
  83.221.195.72
+83.221.210.21
  83.221.210.233
  83.221.211.116
+83.221.215.66
  83.221.75.201
  83.222.138.85
  83.222.178.177
  83.222.5.124
+83.226.167.48
  83.226.184.109
+83.226.233.154
  83.227.81.9
  83.227.95.134
  83.228.102.154
@@ -94172,6 +93313,7 @@
  83.231.34.133
  83.231.34.192
  83.233.30.201
+83.233.6.239
  83.233.72.144
  83.233.72.172
  83.233.72.174
@@ -94190,33 +93332,41 @@
  83.24.27.184
  83.240.242.218
  83.240.245.242
+83.242.251.36
  83.242.96.21
  83.242.96.22
  83.243.191.199
  83.243.253.96
  83.243.58.180
  83.244.54.230
-83.246.142.133
+83.246.147.10
  83.248.66.194
+83.249.98.58
  83.25.14.196
  83.250.140.254
-83.250.16.225
  83.250.201.128
  83.250.61.217
+83.250.7.127
+83.252.11.47
  83.252.9.37
+83.253.187.226
  83.253.241.45
+83.254.120.241
  83.254.224.91
-83.26.108.253
+83.255.92.196
+83.26.38.199
  83.27.138.11
-83.29.10.66
+83.31.213.195
+83.31.30.44
  83.32.190.120
  83.34.61.11
+83.36.201.231
  83.37.158.47
  83.37.215.129
  83.37.216.102
  83.38.230.129
  83.4.52.121
-83.4.65.123
+83.40.35.113
  83.41.72.126
  83.43.240.214
  83.43.53.115
@@ -94228,22 +93378,24 @@
  83.54.187.21
  83.55.0.232
  83.55.196.112
+83.56.58.210
  83.6.146.196
  83.6.159.151
-83.6.198.178
+83.6.199.225
  83.60.154.199
  83.61.23.152
  83.63.222.247
  83.64.132.254
  83.67.163.187
+83.68.224.57
  83.68.251.177
  83.69.125.126
  83.69.237.89
  83.69.90.191
+83.7.29.96
  83.70.212.143
  83.76.247.40
  83.78.237.223
-83.81.12.30
  83.82.161.243
  83.82.82.199
  83.83.155.43
@@ -94252,15 +93404,16 @@
  83.85.29.35
  83.85.9.236
  83.85.97.52
-83.86.221.71
  83.86.39.14
  83.9.114.193
+83.9.161.192
  83.96.205.72
  83.96.213.63
  83.97.106.21
  83.97.108.73
  83.97.111.202
  83.97.20.133
+83.97.20.34
  83.97.20.90
  83.97.23.101
  83.98.136.17
@@ -94269,12 +93422,9 @@
  83.99.245.20
  83.99.247.25
  83.99.83.184
+83.99.83.186
  83.99.83.188
-83.99.83.189
-83.99.83.190
-83.99.83.191
  83.99.83.195
-83.99.83.196
  83.99.92.108
  83010624-96-20190711114544.webstarterz.com
  8304153-89850-dot-bles05.wn.r.appspot.com
@@ -94294,7 +93444,6 @@
  839393.ml
  83buortfa83.bankofamericaslpemr.com
  84.0.154.245
-84.0.180.40
  84.0.201.127
  84.0.211.148
  84.0.247.189
@@ -94312,6 +93461,7 @@
  84.106.37.98
  84.107.72.15
  84.110.106.22
+84.110.53.156
  84.112.42.60
  84.112.47.232
  84.112.60.16
@@ -94322,50 +93472,50 @@
  84.115.141.72
  84.118.161.63
  84.118.211.112
-84.119.235.21
+84.118.239.130
  84.120.107.50
-84.121.207.229
  84.122.212.34
-84.124.254.94
+84.123.231.183
+84.124.234.58
+84.125.244.72
  84.126.137.181
-84.127.26.66
  84.127.40.16
+84.127.61.69
+84.128.86.207
  84.129.126.74
-84.129.210.139
  84.129.222.78
+84.130.69.149
  84.130.72.233
  84.135.18.4
  84.136.139.50
  84.137.2.177
-84.137.26.151
+84.137.24.212
  84.137.9.40
  84.138.63.113
  84.140.144.150
-84.140.150.223
+84.140.147.156
  84.140.151.208
  84.140.220.92
+84.141.40.218
  84.142.209.121
-84.142.217.253
  84.145.76.125
-84.146.61.70
-84.148.210.171
+84.148.209.138
  84.148.217.82
  84.15.106.3
  84.15.112.80
  84.15.156.185
  84.15.160.174
-84.15.191.253
  84.15.209.197
-84.150.32.75
-84.151.91.133
-84.154.240.140
+84.151.172.4
  84.16.244.139
  84.16.248.172
+84.160.56.89
  84.161.193.33
-84.164.203.157
-84.164.49.125
-84.166.213.193
+84.164.162.72
+84.164.197.240
+84.166.211.19
  84.166.219.93
+84.167.1.194
  84.17.15.2
  84.17.28.178
  84.17.35.52
@@ -94373,7 +93523,6 @@
  84.17.39.163
  84.17.39.182
  84.17.46.179
-84.17.47.47
  84.17.48.104
  84.17.48.72
  84.17.49.199
@@ -94388,7 +93537,6 @@
  84.17.51.214
  84.17.51.217
  84.17.51.22
-84.17.51.236
  84.17.51.239
  84.17.51.32
  84.17.51.33
@@ -94414,22 +93562,24 @@
  84.17.60.133
  84.17.60.215
  84.17.61.225
-84.17.62.200
+84.170.121.158
  84.170.235.227
  84.171.154.217
+84.171.159.125
  84.174.99.105
  84.178.184.121
  84.181.21.192
  84.182.182.183
-84.184.87.193
+84.182.243.106
+84.182.254.89
+84.184.86.109
  84.185.59.173
  84.188.107.111
-84.188.89.241
+84.188.109.181
  84.19.170.249
  84.19.178.210
  84.190.141.143
  84.192.145.209
-84.195.163.186
  84.198.45.125
  84.199.237.190
  84.2.226.70
@@ -94448,23 +93598,24 @@
  84.204.144.174
  84.204.40.154
  84.205.15.25
+84.205.24.161
  84.205.47.232
  84.208.207.98
  84.209.1.53
  84.209.139.0
  84.209.31.168
  84.209.48.106
-84.21.188.11
-84.21.188.215
  84.21.188.230
-84.21.188.36
+84.21.188.30
  84.212.145.24
  84.212.251.204
  84.213.12.57
+84.213.231.184
+84.214.150.146
  84.214.54.186
  84.215.127.179
  84.216.51.36
-84.216.52.213
+84.217.32.10
  84.217.82.227
  84.22.114.15
  84.22.116.140
@@ -94472,13 +93623,14 @@
  84.22.198.26
  84.22.35.142
  84.22.35.35
-84.22.36.55
  84.22.46.26
  84.22.59.50
  84.22.59.74
  84.22.63.122
  84.220.138.7
+84.220.218.122
  84.220.25.49
+84.221.213.138
  84.224.154.24
  84.224.46.220
  84.226.245.96
@@ -94508,12 +93660,15 @@
  84.236.35.189
  84.236.6.226
  84.237.171.180
+84.237.199.225
  84.237.202.32
  84.237.7.249
+84.238.112.42
+84.238.35.180
  84.239.39.142
  84.239.39.89
+84.24.213.8
  84.240.26.123
-84.240.50.167
  84.240.9.6
  84.242.139.108
  84.242.183.146
@@ -94531,14 +93686,18 @@
  84.247.48.59
  84.247.48.62
  84.247.50.248
+84.247.50.250
+84.247.51.62
+84.248.97.121
  84.25.47.230
  84.250.13.190
+84.252.11.134
  84.252.129.0
-84.252.55.24
  84.252.95.214
  84.252.95.223
  84.253.244.156
  84.254.90.125
+84.255.131.87
  84.255.185.73
  84.255.194.237
  84.255.203.218
@@ -94548,15 +93707,16 @@
  84.255.249.179
  84.26.119.35
  84.26.183.82
+84.26.224.212
  84.26.232.111
  84.3.59.133
  84.30.178.241
  84.33.1.71
  84.33.109.107
-84.33.120.184
  84.33.2.70
  84.33.37.150
  84.33.39.233
+84.33.54.157
  84.33.6.9
  84.38.134.198
  84.38.184.216
@@ -94572,6 +93732,7 @@
  84.42.224.146
  84.42.253.252
  84.42.33.178
+84.42.4.170
  84.42.62.141
  84.42.96.48
  84.43.106.153
@@ -94593,6 +93754,7 @@
  84.51.56.123
  84.51.56.69
  84.52.108.218
+84.52.110.36
  84.52.115.101
  84.52.179.75
  84.52.53.11
@@ -94613,15 +93775,19 @@
  84.54.58.84
  84.55.70.80
  84.57.171.70
-84.61.186.15
+84.58.248.222
+84.58.27.65
+84.58.27.89
+84.60.34.240
+84.61.118.239
  84.61.40.68
-84.61.57.176
  84.63.136.83
  84.63.171.4
  84.63.47.23
-84.63.52.119
+84.63.47.7
  84.64.12.228
  84.66.135.188
+84.68.73.21
  84.69.165.177
  84.7.96.195
  84.70.190.37
@@ -94631,7 +93797,7 @@
  84.73.17.41
  84.74.119.202
  84.75.176.24
-84.75.176.25
+84.75.71.19
  84.77.198.66
  84.80.110.196
  84.80.143.197
@@ -94640,11 +93806,10 @@
  84.85.15.179
  84.85.227.8
  84.86.187.224
-84.91.131.216
+84.90.138.151
  84.91.143.99
  84.92.24.249
  84.92.92.247
-84.95.87.84
  840215.servicesbpd.club
  840e4d67.ngrok.io
  841365365.com
@@ -94657,6 +93822,7 @@
  8444665-dot-n-e-w-me-ss-age-po-rt-al.wl.r.appspot.com
  8449nohate.org
  8450378-dot-n-e-w-me-ss-age-po-rt-al.wl.r.appspot.com
+84512-property-for-sale.com
  845d4fea7156900557dde946b026039a-dot-dbenitonline.ey.r.appspot.com
  8470103.servicesbpd.club
  8472240b7ae4bd2f2d688f6fd9591377fa3bebbc.info
@@ -94686,31 +93852,31 @@
  85.10.24.40
  85.10.248.121
  85.10.53.90
-85.10.56.138
  85.100.122.211
-85.100.126.91
  85.101.118.60
  85.101.119.249
  85.102.76.165
  85.104.59.244
  85.105.111.166
  85.105.156.8
+85.105.2.42
+85.105.200.80
  85.105.205.77
  85.105.219.98
  85.105.239.184
  85.105.243.229
  85.105.4.244
  85.105.83.125
-85.106.101.135
  85.106.8.102
  85.109.127.48
  85.109.152.199
+85.109.20.120
  85.109.43.176
  85.109.58.221
  85.109.58.222
  85.109.82.114
-85.110.23.152
  85.111.12.199
+85.111.74.140
  85.112.76.58
  85.112.87.115
  85.112.87.116
@@ -94727,9 +93893,12 @@
  85.114.135.126
  85.114.140.127
  85.114.141.60
+85.114.221.74
  85.114.38.206
  85.114.96.154
  85.114.98.50
+85.115.130.101
+85.115.173.98
  85.116.120.106
  85.116.125.149
  85.117.56.103
@@ -94739,6 +93908,7 @@
  85.117.61.186
  85.117.62.202
  85.117.63.98
+85.118.107.12
  85.119.108.134
  85.119.154.60
  85.119.80.219
@@ -94758,17 +93928,14 @@
  85.13.237.23
  85.130.101.189
  85.131.107.137
-85.132.102.86
  85.132.29.134
  85.132.37.196
  85.132.9.46
  85.132.96.242
  85.133.143.35
+85.133.183.66
  85.135.75.57
  85.135.95.218
-85.138.240.40
-85.138.83.193
-85.139.48.93
  85.14.122.191
  85.14.79.26
  85.142.45.77
@@ -94776,14 +93943,11 @@
  85.143.210.193
  85.143.213.2
  85.143.214.43
-85.143.228.29
-85.143.228.46
+85.143.228.167
  85.143.228.49
  85.143.228.71
-85.143.228.74
  85.143.228.8
  85.143.229.39
-85.143.229.74
  85.143.254.20
  85.144.28.175
  85.146.16.131
@@ -94793,13 +93957,12 @@
  85.15.179.171
  85.15.179.235
  85.15.179.236
-85.15.190.89
  85.15.200.145
-85.15.245.88
  85.152.144.6
  85.152.162.105
  85.152.174.56
  85.158.181.41
+85.159.165.167
  85.159.178.172
  85.159.218.246
  85.159.237.71
@@ -94812,12 +93975,11 @@
  85.163.224.168
  85.163.53.75
  85.164.4.99
+85.165.67.95
  85.165.8.86
  85.166.127.166
  85.166.202.44
-85.166.212.215
  85.168.117.191
-85.169.208.117
  85.17.111.125
  85.17.131.134
  85.17.131.145
@@ -94840,16 +94002,15 @@
  85.172.107.1
  85.172.12.245
  85.172.170.146
-85.172.189.189
+85.172.39.174
  85.172.98.94
  85.173.165.36
-85.173.201.175
  85.173.23.161
  85.174.64.127
  85.175.101.19
  85.175.171.169
-85.175.216.32
  85.175.227.126
+85.175.31.241
  85.175.4.251
  85.175.5.6
  85.175.97.16
@@ -94860,14 +94021,14 @@
  85.18.117.101
  85.18.236.229
  85.184.138.108
+85.184.144.112
  85.184.191.57
  85.185.116.150
  85.185.152.146
  85.185.152.148
  85.185.152.155
-85.185.159.74
+85.185.159.75
  85.185.161.139
-85.185.221.164
  85.187.158.15
  85.187.17.39
  85.187.224.90
@@ -94875,7 +94036,6 @@
  85.187.245.10
  85.187.247.58
  85.187.255.6
-85.187.49.153
  85.190.0.5
  85.190.2.200
  85.190.2.205
@@ -94883,7 +94043,6 @@
  85.191.214.236
  85.192.133.13
  85.192.191.6
-85.193.194.12
  85.194.238.131
  85.195.207.28
  85.195.219.162
@@ -94891,6 +94050,7 @@
  85.195.234.244
  85.195.251.11
  85.195.54.110
+85.195.87.183
  85.195.92.173
  85.196.136.1
  85.196.136.13
@@ -94899,7 +94059,6 @@
  85.196.136.9
  85.196.183.162
  85.196.25.2
-85.197.187.22
  85.197.58.28
  85.198.142.186
  85.198.185.26
@@ -94914,6 +94073,7 @@
  85.202.194.17
  85.202.195.175
  85.202.195.191
+85.202.195.235
  85.202.195.92
  85.202.229.205
  85.203.44.244
@@ -94922,6 +94082,7 @@
  85.204.116.139
  85.204.116.216
  85.204.116.68
+85.204.116.77
  85.204.231.216
  85.204.246.107
  85.204.246.138
@@ -94940,19 +94101,19 @@
  85.208.184.63
  85.208.185.212
  85.208.209.178
-85.208.209.223
  85.208.210.25
  85.208.210.70
  85.208.211.121
  85.208.213.114
  85.208.22.162
+85.208.22.163
  85.208.71.18
  85.208.71.20
  85.208.76.1
  85.208.76.2
  85.208.85.15
-85.208.85.203
  85.208.86.224
+85.208.87.152
  85.208.87.183
  85.208.87.84
  85.208.87.96
@@ -94963,11 +94124,10 @@
  85.21.200.26
  85.21.63.219
  85.212.115.18
+85.212.160.254
  85.212.188.119
-85.212.206.124
  85.214.103.48
  85.214.108.223
-85.214.112.79
  85.214.123.127
  85.214.134.8
  85.214.136.156
@@ -94980,7 +94140,6 @@
  85.214.158.15
  85.214.166.228
  85.214.169.87
-85.214.170.193
  85.214.185.51
  85.214.187.13
  85.214.20.76
@@ -94988,13 +94147,11 @@
  85.214.204.63
  85.214.205.220
  85.214.220.236
-85.214.222.91
  85.214.237.36
  85.214.238.67
  85.214.240.9
  85.214.242.199
  85.214.244.174
-85.214.248.63
  85.214.25.136
  85.214.26.7
  85.214.28.226
@@ -95012,6 +94169,7 @@
  85.214.88.96
  85.214.89.154
  85.214.93.64
+85.214.94.28
  85.214.97.248
  85.215.9.88
  85.215.92.224
@@ -95022,9 +94180,7 @@
  85.217.170.105
  85.217.192.39
  85.217.235.8
-85.218.39.138
  85.220.190.246
-85.220.201.155
  85.220.41.204
  85.220.85.26
  85.221.149.27
@@ -95032,41 +94188,37 @@
  85.222.178.208
  85.222.206.142
  85.222.69.218
+85.223.157.204
  85.223.214.130
+85.224.186.6
  85.225.145.83
-85.225.34.80
  85.226.123.6
  85.226.181.87
-85.226.58.192
-85.226.91.61
  85.227.130.147
+85.227.169.29
  85.228.216.200
  85.228.232.171
  85.228.41.27
-85.228.64.188
+85.23.154.79
  85.23.51.254bin.sh
  85.23.7.190
  85.232.198.84
  85.232.244.35
-85.233.39.151
-85.234.106.219
-85.234.106.5
+85.233.255.46
  85.234.117.151
  85.234.126.107
  85.234.143.94
  85.234.145.132
+85.234.175.172
  85.235.190.138
  85.235.49.231
  85.235.66.147
-85.235.82.215
  85.236.168.22
  85.236.25.18
  85.237.166.165
  85.237.200.111
-85.237.200.125
  85.237.200.145
  85.237.200.160
-85.237.200.177
  85.237.200.180
  85.237.200.224
  85.237.200.240
@@ -95089,7 +94241,6 @@
  85.238.167.170
  85.238.168.253
  85.238.184.237
-85.238.96.46
  85.238.97.20
  85.239.121.168
  85.239.35.124
@@ -95099,28 +94250,21 @@
  85.241.106.203
  85.241.129.2
  85.241.221.170
-85.241.39.182
-85.242.18.95
  85.242.213.159
-85.243.134.107
  85.243.48.9
  85.243.5.44
  85.244.234.165
-85.245.19.44
  85.245.204.149
  85.245.26.67
  85.246.168.252
-85.246.177.170
  85.246.78.192
  85.247.0.210
  85.247.109.182
  85.248.6.41
-85.249.168.159
  85.249.197.163
  85.249.197.193
  85.249.42.42
  85.25.104.144
-85.25.104.145
  85.25.118.22
  85.25.138.55
  85.25.149.246
@@ -95141,10 +94285,10 @@
  85.254.72.26
  85.254.72.27
  85.26.199.81
-85.28.180.9
  85.28.234.127
  85.29.130.90
  85.29.147.222
+85.30.198.53
  85.30.215.48
  85.30.248.210
  85.31.112.191
@@ -95166,6 +94310,7 @@
  85.70.156.209
  85.70.97.59
  85.71.26.28
+85.71.35.47
  85.71.91.38
  85.72.32.44
  85.73.62.160
@@ -95174,8 +94319,6 @@
  85.75.17.172
  85.75.228.53
  85.76.129.231
-85.76.142.58
-85.8.114.235
  85.84.202.75
  85.85.165.25
  85.9.3.35
@@ -95183,6 +94326,8 @@
  85.90.105.201
  85.90.158.198
  85.90.163.235
+85.90.245.123
+85.90.247.155
  85.90.247.215
  85.90.247.9
  85.92.108.211
@@ -95195,12 +94340,16 @@
  85.92.59.59
  85.93.20.70
  85.93.218.204
+85.93.96.18
  85.94.178.144
  85.94.201.138
  85.94.33.242
  85.95.167.186
+85.95.168.203
+85.95.201.178
  85.95.219.206
  85.96.175.237
+85.96.176.172
  85.97.148.176
  85.97.204.234
  85.99.227.200
@@ -95223,11 +94372,9 @@
  85ew7g8weg786we41658g4ew8gew7ge8w7ew87g8ew7gew87gew.monster
  85szv.com
  86-club.tw
-86.0.185.53
  86.0.196.72
  86.0.33.192
  86.1.97.242
-86.100.176.8
  86.100.63.127
  86.101.128.189
  86.101.129.2
@@ -95235,11 +94382,11 @@
  86.101.129.225
  86.101.129.233
  86.101.153.177
-86.101.154.208
+86.101.153.68
+86.101.153.87
  86.101.155.220
  86.101.159.121
  86.101.224.233
-86.103.11.25
  86.104.15.20
  86.104.177.150
  86.104.18.51
@@ -95258,8 +94405,6 @@
  86.105.183.117
  86.105.183.170
  86.105.183.181
-86.105.183.204
-86.105.183.220
  86.105.183.227
  86.105.183.250
  86.105.183.254
@@ -95273,10 +94418,8 @@
  86.106.74.244
  86.106.74.247
  86.106.74.248
-86.106.74.251
  86.106.92.23
  86.107.187.54
-86.107.57.178
  86.109.105.151
  86.109.165.202
  86.109.170.199
@@ -95287,46 +94430,41 @@
  86.110.233.81
  86.110.240.166
  86.110.27.165
-86.111.136.187
  86.111.144.10
  86.111.146.250
  86.12.101.206
  86.120.157.254
  86.120.224.37
-86.120.237.134
  86.120.79.84
-86.121.68.69
  86.122.170.50
-86.123.166.109
  86.123.188.209
+86.124.220.140
  86.124.230.115
  86.124.249.9
  86.125.112.230
  86.125.169.47
  86.125.205.28
  86.125.209.97
+86.125.60.216
  86.125.92.56
+86.125.95.38
  86.126.4.131
-86.127.140.29
  86.127.182.40
  86.127.76.91
  86.129.70.105
  86.130.229.7
-86.130.64.84
  86.131.168.226
  86.131.48.49
  86.132.208.148
-86.133.220.15
-86.137.132.124
-86.139.28.169
-86.14.224.105
+86.137.132.63
  86.14.39.167
  86.141.123.144
  86.144.181.215
  86.145.179.255
-86.152.232.48
  86.153.223.4
  86.159.154.192
+86.16.194.177
+86.16.246.240
  86.160.82.214
  86.163.78.37
  86.165.30.176
@@ -95334,38 +94472,40 @@
  86.166.230.54
  86.169.186.53
  86.171.169.166
-86.171.25.112
+86.171.68.1
  86.171.79.176
  86.172.40.22
  86.173.62.115
  86.174.211.246
  86.174.38.254
-86.176.149.139
  86.177.237.106
  86.178.199.96
+86.18.174.102
+86.182.140.101
  86.184.190.186
+86.185.134.142
  86.185.154.182
  86.188.246.2
  86.188.250.209
  86.19.105.25
-86.19.38.127
  86.192.106.7
-86.192.20.87
  86.193.209.93
  86.196.103.38
+86.196.118.20
+86.200.65.194
  86.200.83.221
-86.21.115.71
-86.213.182.67
+86.210.40.135
  86.22.221.170
+86.225.124.88
  86.23.4.8
  86.235.60.20
  86.235.76.174
  86.236.55.45
  86.237.171.201
  86.238.208.11
-86.238.26.127
-86.24.104.62
+86.238.209.1
  86.24.173.237
+86.24.188.35
  86.24.190.158
  86.243.75.250
  86.250.160.150
@@ -95374,7 +94514,6 @@
  86.31.163.247
  86.31.177.60
  86.34.157.3
-86.34.172.50
  86.34.197.6
  86.34.55.5
  86.38.10.57
@@ -95391,19 +94530,17 @@
  86.57.181.122
  86.57.216.191
  86.57.216.23
-86.57.236.67
-86.57.237.53
  86.58.17.44
-86.58.206.100
  86.59.171.179
  86.60.179.136
  86.62.120.68
  86.62.240.101
+86.71.47.104
  86.76.7.132
+86.80.62.114
  86.83.88.212
  86.84.198.19
  86.87.32.31
-86.87.50.81
  86.87.72.98
  86.88.120.250
  86.89.210.69
@@ -95411,7 +94548,9 @@
  86.90.111.125
  86.90.134.145
  86.92.137.53
+86.94.73.194
  86.95.8.249
+86.97.212.197
  86.98.72.177
  86.99.17.120
  860259.com
@@ -95441,13 +94580,12 @@
  86mld.com
  87.1.105.75
  87.1.117.208
-87.1.142.13
-87.10.154.206
  87.101.121.151
  87.101.94.67
  87.102.56.37
  87.103.120.250
  87.103.126.98
+87.103.172.19
  87.103.174.109
  87.103.174.147
  87.103.175.22
@@ -95468,6 +94606,7 @@
  87.106.181.84
  87.106.189.77
  87.106.205.195
+87.106.205.91
  87.106.210.109
  87.106.210.178
  87.106.225.180
@@ -95481,13 +94620,13 @@
  87.106.89.36
  87.106.94.225
  87.107.132.61
-87.107.159.189
+87.110.144.251
  87.110.181.30
  87.110.188.59
+87.110.43.92
  87.110.60.124
  87.113.182.83
  87.116.150.29
-87.116.160.206
  87.116.181.252
  87.117.1.169
  87.117.19.29
@@ -95498,12 +94637,13 @@
  87.117.234.172
  87.117.234.186
  87.117.234.195
-87.117.25.246
  87.117.250.15
  87.117.51.253
  87.117.55.97
  87.117.56.75
+87.117.57.58
  87.117.58.202
+87.118.106.6
  87.118.108.204
  87.118.110.27
  87.118.116.103
@@ -95520,6 +94660,7 @@
  87.118.92.43
  87.118.96.154
  87.119.168.217
+87.119.232.41
  87.120.179.74
  87.120.246.53
  87.120.254.114
@@ -95527,7 +94668,6 @@
  87.120.37.79
  87.120.55.114
  87.120.6.218
-87.120.64.117
  87.120.8.5
  87.121.37.156
  87.121.49.238
@@ -95536,29 +94676,30 @@
  87.121.77.130
  87.121.77.67
  87.122.119.165
-87.122.220.12
+87.122.214.150
  87.122.251.21
-87.123.100.155
+87.123.101.193
  87.123.109.183
-87.123.160.254
-87.123.165.147
+87.123.170.109
  87.123.34.92
  87.123.40.129
  87.123.44.154
  87.123.45.138
  87.123.46.212
  87.123.50.220
+87.123.54.69
  87.123.64.39
  87.123.65.143
  87.123.66.183
+87.123.73.252
  87.123.73.51
+87.123.74.144
  87.123.75.138
  87.124.164.13
  87.124.164.14
  87.125.107.232
  87.126.64.193
  87.132.201.1
-87.134.118.237
  87.134.172.12
  87.138.108.161
  87.139.127.162
@@ -95568,21 +94709,22 @@
  87.14.81.46
  87.140.60.37
  87.143.119.146
+87.143.155.101
  87.144.15.40
+87.144.183.83
  87.146.254.112
  87.147.73.14
-87.150.61.74
+87.150.48.222
  87.151.11.111
  87.154.116.82
  87.154.124.18
+87.154.124.20
  87.154.168.43
  87.154.171.107
-87.155.34.211
  87.157.254.120
-87.159.172.118
  87.16.72.110
-87.162.232.190
  87.166.39.228
+87.166.47.94
  87.169.126.200
  87.17.164.169
  87.17.218.205
@@ -95590,32 +94732,37 @@
  87.170.34.35
  87.171.245.133
  87.172.249.11
+87.173.86.15
  87.174.164.119
-87.174.166.111
-87.174.171.135
+87.174.165.234
  87.174.172.218
+87.175.81.160
  87.175.82.219
+87.176.29.58
  87.179.74.186
  87.180.254.178
  87.181.191.66
  87.182.230.93
+87.183.139.69
  87.183.239.168
+87.183.239.2
  87.183.239.5
  87.184.100.184
  87.187.144.72
  87.187.155.63
  87.187.159.136
  87.188.125.211
+87.19.145.56
  87.193.48.235
  87.196.184.69
  87.196.54.175
  87.196.63.49
-87.196.7.0
  87.197.124.169
  87.197.137.223
+87.197.159.227
  87.197.163.118
  87.20.225.113
-87.20.240.2
+87.203.115.116
  87.204.102.195
  87.204.220.68
  87.204.52.10
@@ -95624,7 +94771,6 @@
  87.206.227.194
  87.207.29.236
  87.208.56.229
-87.21.125.48
  87.21.245.127
  87.21.56.111
  87.210.254.220
@@ -95638,9 +94784,11 @@
  87.218.217.38
  87.220.10.45
  87.220.212.62
+87.224.252.70
  87.225.104.117
  87.225.104.160
-87.225.108.2
+87.225.106.195
+87.225.61.50
  87.225.91.214
  87.227.140.10
  87.228.211.216
@@ -95660,9 +94808,10 @@
  87.236.212.87
  87.237.120.219
  87.237.234.187
+87.237.238.185
  87.238.96.18
+87.240.53.245
  87.241.1.186
-87.241.165.79
  87.241.249.59
  87.241.44.41
  87.241.56.181
@@ -95671,6 +94820,8 @@
  87.244.111.91
  87.244.181.136
  87.244.182.241
+87.244.4.93
+87.244.5.174
  87.245.163.250
  87.245.163.252
  87.245.170.253
@@ -95679,25 +94830,23 @@
  87.246.7.0
  87.246.7.100
  87.246.7.101
-87.246.7.102
  87.246.7.103
  87.246.7.104
  87.246.7.106
  87.246.7.107
  87.246.7.109
  87.246.7.111
-87.246.7.113
  87.246.7.114
  87.246.7.115
  87.246.7.116
  87.246.7.117
-87.246.7.118
  87.246.7.119
  87.246.7.120
  87.246.7.134
  87.246.7.135
  87.246.7.136
  87.246.7.137
+87.246.7.143
  87.246.7.167
  87.246.7.168
  87.246.7.169
@@ -95711,6 +94860,7 @@
  87.246.7.180
  87.246.7.182
  87.246.7.183
+87.246.7.184
  87.246.7.185
  87.246.7.186
  87.246.7.187
@@ -95720,13 +94870,13 @@
  87.246.7.210
  87.246.7.226
  87.246.7.242
+87.246.7.35
  87.246.7.37
  87.246.7.39
  87.246.7.40
  87.246.7.42
  87.246.7.44
  87.246.7.45
-87.246.7.47
  87.246.7.49
  87.246.7.50
  87.246.7.53
@@ -95736,18 +94886,21 @@
  87.246.7.61
  87.246.7.98
  87.246.7.99
+87.247.102.142
  87.247.19.126
  87.247.3.234
  87.248.171.235
  87.248.182.115
+87.248.19.119
  87.249.22.114
  87.251.122.178
  87.251.228.114
  87.251.64.186
  87.251.7.114
+87.251.7.139
  87.251.7.148
  87.251.7.154
-87.251.7.253
+87.251.7.217
  87.251.7.28
  87.251.7.34
  87.251.7.35
@@ -95756,15 +94909,16 @@
  87.251.7.85
  87.251.7.88
  87.251.76.122
-87.251.77.206
-87.251.86.135
-87.251.86.180
  87.251.86.253
+87.251.87.48
+87.251.87.49
  87.252.100.28
+87.252.166.51
  87.252.183.184
+87.252.226.79
  87.253.135.238
+87.253.92.160
  87.254.138.170
-87.254.146.153
  87.255.13.217
  87.255.193.50
  87.255.4.21
@@ -95781,6 +94935,7 @@
  87.64.166.201
  87.65.195.214
  87.65.203.65
+87.67.124.181
  87.75.105.186
  87.76.11.57
  87.76.253.7
@@ -95788,17 +94943,14 @@
  87.76.34.28
  87.76.34.38
  87.76.35.193
-87.76.35.54
  87.79.184.155
  87.79.254.225
  87.79.94.221
  87.8.167.188
-87.80.110.235
  87.81.219.92
-87.88.164.50
-87.92.246.148
  87.95.219.163
  87.97.155.156
+87.97.230.91
  87.98.143.87
  87.98.147.181
  87.98.152.173
@@ -95856,27 +95008,25 @@
  87n3t-m3m45.net
  87n3t-m3m50.com
  88.1.169.91
-88.1.28.162
  88.10.126.6
  88.100.162.153
  88.102.13.246
  88.103.230.210
-88.105.42.184
  88.105.84.130
-88.111.86.173
  88.114.100.214
+88.114.214.162
  88.115.110.150
  88.115.212.192
+88.117.52.28
  88.118.131.30
-88.118.136.51
  88.119.128.181
  88.119.17.56
  88.119.170.150
-88.119.175.175
  88.119.197.200
  88.119.220.136
  88.119.254.139
  88.119.49.66
+88.12.14.233
  88.12.19.206
  88.12.37.13
  88.12.49.249
@@ -95884,24 +95034,24 @@
  88.120.105.119
  88.122.140.238
  88.123.113.38
+88.123.15.59
  88.126.90.220
  88.129.130.198
  88.129.235.44
  88.129.253.94
  88.129.28.55
  88.129.82.123
-88.13.202.187
  88.13.9.239
-88.130.159.97
-88.130.50.130
-88.130.77.119
-88.130.8.91
+88.130.134.80
+88.130.14.245
+88.130.218.249
  88.132.194.239bin.sh
  88.132.217.184
  88.132.66.26
  88.134.142.63
  88.134.143.96
  88.134.149.7
+88.134.49.94
  88.134.51.48
  88.135.210.179
  88.135.39.143
@@ -95913,9 +95063,9 @@
  88.135.41.2
  88.135.41.28
  88.135.41.4
+88.135.42.121
  88.135.42.145
  88.135.42.166
-88.135.42.169
  88.135.42.188
  88.135.42.225
  88.135.42.239
@@ -95930,9 +95080,9 @@
  88.135.45.6
  88.135.45.77
  88.135.45.87
-88.137.185.214
  88.138.29.218
  88.138.88.184
+88.139.160.251
  88.14.225.24
  88.14.26.46
  88.142.221.215
@@ -95963,26 +95113,21 @@
  88.151.243.106
  88.153.216.102
  88.153.35.32
-88.156.131.242
-88.156.137.64
+88.156.206.147
  88.156.97.210
+88.157.229.58
  88.159.128.67
  88.159.132.102
  88.160.255.81
-88.161.72.68
  88.162.54.93
  88.163.190.153
+88.164.34.184
  88.165.141.219
  88.165.81.34
  88.17.11.126
  88.17.219.138
-88.17.242.217
-88.17.244.179
-88.17.54.72
  88.17.55.240
  88.17.88.100
-88.18.188.158
-88.19.163.238
  88.19.38.191
  88.19.48.237
  88.190.155.48
@@ -96058,38 +95203,40 @@
  88.204.158.106
  88.204.193.3
  88.206.111.62
+88.206.71.141
  88.206.92.37
  88.207.108.231
-88.207.111.67
+88.207.125.203
  88.208.205.79
  88.208.220.105
  88.208.228.139
+88.208.228.45
  88.208.252.204
  88.208.3.195
  88.208.57.212
-88.208.82.20
  88.208.89.236
  88.208.89.237
  88.208.89.238
  88.21.152.174
  88.210.15.24
+88.212.190.179
  88.212.201.94
  88.212.3.30
  88.212.44.33
  88.213.214.254
  88.213.215.15
  88.214.11.71
-88.214.236.235
  88.214.57.95
  88.215.177.224
  88.215.2.29
  88.215.98.229
  88.216.6.222
+88.217.114.67
  88.217.117.24
  88.217.121.29
-88.217.124.145
  88.217.172.165
  88.217.181.215
+88.217.39.111
  88.217.45.138
  88.218.16.118
  88.218.16.151
@@ -96112,30 +95259,39 @@
  88.218.227.123
  88.218.227.129
  88.218.227.162
+88.218.227.201
  88.218.227.87
+88.218.46.152
  88.218.65.124
+88.218.65.68
  88.218.66.111
  88.218.66.136
-88.218.66.49
+88.218.66.148
  88.218.66.79
  88.218.67.129
+88.218.67.187
+88.218.67.21
  88.218.67.228
  88.218.67.245
  88.218.92.124
+88.22.116.57
+88.22.82.94
  88.220.179.195
  88.220.43.198
  88.226.96.242
  88.227.171.93
+88.228.20.29
  88.228.68.5
  88.230.178.51
-88.230.6.227
-88.231.127.46
+88.230.49.16
+88.230.65.43
  88.233.186.65
  88.236.163.250
  88.236.187.82
  88.238.8.17
  88.240.15.82
  88.242.64.60
+88.245.209.171
  88.247.10.31
  88.247.138.7
  88.247.143.224
@@ -96150,6 +95306,7 @@
  88.247.96.19
  88.248.186.196
  88.248.23.216
+88.248.51.139
  88.248.55.136
  88.249.120.205
  88.249.125.146
@@ -96160,7 +95317,6 @@
  88.250.223.190
  88.250.226.26
  88.252.242.152
-88.253.13.218
  88.253.211.221
  88.255.102.114
  88.255.102.119
@@ -96188,20 +95344,23 @@
  88.26.174.12
  88.26.181.16
  88.26.202.180
+88.26.234.59
  88.26.34.89
  88.27.20.192
  88.39.235.66
+88.4.183.118
  88.5.20.125
  88.58.209.2
+88.68.171.213
  88.7.137.57
  88.7.199.145
-88.71.112.149
  88.72.175.175
  88.73.13.238
+88.73.183.219
+88.76.222.1
  88.78.137.199
  88.8.137.122
  88.80.148.234
-88.80.187.100
  88.80.189.129
  88.80.20.35
  88.80.20.86
@@ -96213,22 +95372,21 @@
  88.85.97.150
  88.86.125.50
  88.86.243.241
+88.86.250.122
  88.87.72.134
  88.87.72.72
  88.87.74.87
  88.87.84.17
  88.87.85.103
  88.88.105.184
+88.88.123.50
  88.88.130.173
-88.89.36.219
  88.89.52.144
  88.9.178.174
-88.98.232.53
  88.98.235.134
  88.98.237.182
  88.98.240.31
  88.98.88.158
-88.99.10.248
  88.99.104.135
  88.99.109.66
  88.99.115.156
@@ -96236,8 +95394,8 @@
  88.99.124.205
  88.99.125.6
  88.99.134.46
-88.99.134.61
  88.99.144.209
+88.99.145.163
  88.99.149.100
  88.99.149.188
  88.99.150.13
@@ -96254,7 +95412,6 @@
  88.99.61.123
  88.99.80.123
  88.99.81.114
-88.99.82.169
  88.99.82.23
  88.99.85.229
  88.99.93.80
@@ -96303,7 +95460,6 @@
  89.100.165.138
  89.102.198.78
  89.103.236.146
-89.103.242.24
  89.103.245.224
  89.105.158.245
  89.105.194.236
@@ -96315,7 +95471,6 @@
  89.106.109.230
  89.106.109.50
  89.106.251.163
-89.107.197.118
  89.107.231.237
  89.108.118.7
  89.108.119.5
@@ -96325,7 +95480,6 @@
  89.108.154.123
  89.108.64.184
  89.108.64.216
-89.108.64.73
  89.108.66.169
  89.108.66.251
  89.108.67.182
@@ -96339,6 +95493,7 @@
  89.111.132.208
  89.111.132.97
  89.111.176.102
+89.111.247.160
  89.111.33.220
  89.111.33.221
  89.111.33.223
@@ -96347,19 +95502,19 @@
  89.113.84.51
  89.114.237.38
  89.115.120.43
-89.12.69.9
  89.120.146.186
  89.120.156.28
  89.120.17.179
  89.122.186.71
  89.123.12.95
  89.128.49.77
-89.128.94.80
-89.129.57.166
+89.130.181.130
  89.130.250.155
+89.130.59.225
  89.132.116.240
  89.132.118.246
  89.132.175.246
+89.132.181.198
  89.132.207.82
  89.133.10.60
  89.133.103.216
@@ -96375,16 +95530,20 @@
  89.135.176.129
  89.136.120.205
  89.136.31.222
+89.136.5.95
  89.137.11.41
  89.137.231.63
  89.137.246.181
  89.139.16.100
  89.14.146.210
+89.14.208.120
  89.14.46.177
+89.140.72.189
  89.141.67.231
  89.142.131.74
  89.142.77.30
  89.143.198.104
+89.143.37.154
  89.143.84.56
  89.144.12.17
  89.144.25.172
@@ -96405,7 +95564,6 @@
  89.148.18.12
  89.149.12.188
  89.149.235.45
-89.149.85.84
  89.151.134.157
  89.151.135.90
  89.151.83.58
@@ -96441,20 +95599,16 @@
  89.163.251.59
  89.163.255.78
  89.164.225.197
-89.164.241.225
  89.165.207.164
-89.165.70.69
-89.166.159.181
  89.166.209.80
  89.166.47.198
-89.169.44.36
  89.17.133.240
  89.17.151.213
  89.17.51.234
  89.17.54.18
  89.171.129.58
  89.171.190.107
-89.172.13.177
+89.172.167.40
  89.172.172.211
  89.173.20.134
  89.173.237.42
@@ -96462,24 +95616,26 @@
  89.174.71.111
  89.175.29.126
  89.176.190.207
-89.176.46.51
  89.177.34.147
  89.178.167.26
-89.178.206.10
+89.178.202.149
  89.179.126.155
  89.179.244.69
  89.179.41.211
  89.18.136.217
  89.18.168.135
  89.18.27.192
+89.180.224.122
  89.182.103.162
  89.184.152.198
  89.184.74.45
+89.185.2.137
  89.185.231.103
  89.185.4.68
  89.185.93.190
  89.186.5.146
  89.187.142.208
+89.187.161.176
  89.187.168.132
  89.187.168.134
  89.187.168.139
@@ -96495,14 +95651,15 @@
  89.187.168.176
  89.187.168.177
  89.187.168.178
+89.187.168.179
  89.187.168.180
  89.187.168.182
  89.187.173.130
-89.187.177.100
  89.187.177.102
  89.187.177.105
  89.187.177.107
  89.187.177.108
+89.187.177.72
  89.187.177.85
  89.187.177.90
  89.187.177.91
@@ -96512,11 +95669,14 @@
  89.187.177.95
  89.187.177.97
  89.187.177.98
+89.187.189.240
  89.187.201.70
+89.188.110.196
  89.188.117.71
  89.188.124.145
  89.189.172.88
  89.189.174.121
+89.189.181.161
  89.189.191.51
  89.189.222.150
  89.189.223.236
@@ -96526,39 +95686,31 @@
  89.19.7.152
  89.190.110.12
  89.190.120.116
-89.190.156.35
  89.190.156.37
  89.190.156.52
  89.190.165.4
  89.190.19.162
-89.191.226.48
  89.191.228.105
  89.191.228.116
  89.191.229.232
-89.20.102.147
+89.191.96.167
  89.20.135.204
  89.200.137.67
-89.201.119.101
  89.201.145.59
  89.201.185.187
+89.201.192.101
  89.201.192.134
  89.201.192.193
  89.201.192.33
-89.201.192.48
  89.201.192.79
  89.201.193.123
-89.201.193.130
-89.201.193.220
  89.201.194.103
  89.201.194.106
  89.201.195.172
  89.201.195.240
  89.201.195.27
-89.201.195.46
-89.201.86.53
  89.202.127.4
-89.204.153.211
-89.204.154.51
+89.205.109.108
  89.205.35.133
  89.205.87.153
  89.207.68.158
@@ -96570,12 +95722,11 @@
  89.208.35.79
  89.211.223.6
  89.212.160.214
-89.212.202.200
+89.212.176.12
  89.212.218.58
  89.212.9.96
  89.212.90.179
  89.215.55.124
-89.215.68.186
  89.216.102.123
  89.216.104.9
  89.216.122.92
@@ -96588,21 +95739,22 @@
  89.216.48.230
  89.216.99.102
  89.216.99.183
-89.217.102.30
  89.218.11.2
  89.218.133.170
  89.218.169.122
-89.218.205.82
  89.218.5.106
  89.218.5.108
+89.218.5.109
  89.218.5.110
  89.218.72.51
-89.218.81.106
+89.218.86.60
+89.218.86.62
  89.219.16.149
  89.219.211.62
  89.22.17.62
  89.22.183.153
  89.22.187.111
+89.22.207.78
  89.22.249.241
  89.22.254.55
  89.22.66.2
@@ -96614,31 +95766,31 @@
  89.221.250.9
  89.222.132.31
  89.223.24.86
-89.223.30.182
  89.223.31.237
  89.223.47.219
+89.223.80.30
  89.223.89.122
-89.223.92.117
-89.223.92.152
  89.223.92.30
  89.225.231.164
  89.225.231.165
+89.229.97.207
  89.23.194.174
  89.23.196.60
  89.23.230.189
  89.230.96.42
-89.231.148.199
  89.231.32.193
  89.231.66.155
  89.232.192.40
  89.232.37.103
  89.232.44.249
  89.233.183.64
+89.234.114.37
  89.234.157.254
  89.234.17.115
  89.234.17.116
  89.234.198.99
  89.234.211.142
+89.234.235.64
  89.234.38.66
  89.234.61.218
  89.234.67.10
@@ -96649,7 +95801,6 @@
  89.236.17.108
  89.236.239.25
  89.237.113.144
-89.237.194.179
  89.237.32.129
  89.237.32.161
  89.237.32.177
@@ -96694,38 +95845,39 @@
  89.24.119.126
  89.24.221.82
  89.24.76.185
-89.244.124.165
+89.244.126.5
  89.244.185.186
-89.244.187.193
-89.244.208.114
  89.244.212.47
+89.244.217.79
  89.244.222.58
-89.244.79.65
+89.244.234.248
  89.244.79.77
  89.245.0.72
-89.245.161.252
-89.245.161.51
-89.245.162.82
-89.245.163.108
-89.245.240.148
+89.245.11.102
+89.245.12.231
+89.245.161.248
  89.245.245.137
-89.245.247.145
  89.245.248.98
+89.245.32.150
+89.245.32.47
+89.245.36.142
+89.245.36.190
  89.245.80.14
  89.245.82.20
  89.245.83.134
  89.245.87.191
  89.245.90.116
+89.245.92.215
+89.246.116.96
  89.246.117.231
  89.246.118.33
  89.246.24.248
  89.247.1.166
-89.247.11.209
-89.247.13.188
+89.247.254.38
  89.247.40.34
+89.247.9.79
  89.248.111.164
  89.248.160.132
-89.248.160.135
  89.248.160.192
  89.248.160.215
  89.248.160.217
@@ -96738,8 +95890,6 @@
  89.248.166.183
  89.248.167.131
  89.248.167.133
-89.248.168.108
-89.248.168.112
  89.248.168.171
  89.248.168.188
  89.248.168.204
@@ -96766,18 +95916,19 @@
  89.248.172.200
  89.248.172.53
  89.248.172.65
+89.248.174.3
  89.248.174.31
  89.248.174.4
  89.248.174.46
  89.248.240.57
  89.248.243.200
+89.248.244.180
  89.248.244.182
  89.249.244.111
  89.249.247.209
  89.249.255.152
  89.249.49.118
  89.249.49.120
-89.249.65.108
  89.249.65.191
  89.25.21.170
  89.25.23.210
@@ -96798,6 +95949,7 @@
  89.253.225.14
  89.253.247.144
  89.255.60.4
+89.255.71.12
  89.26.241.141
  89.27.175.95
  89.27.62.27
@@ -96812,18 +95964,17 @@
  89.29.100.240
  89.29.213.33
  89.29.222.252
-89.3.26.46
  89.3.84.24
  89.30.96.166
  89.31.126.216
  89.31.140.14
  89.31.140.28
+89.31.189.206
  89.31.46.208
  89.31.57.5
  89.32.150.160
  89.32.204.210
  89.32.227.230
-89.32.249.21
  89.32.41.79
  89.33.192.112
  89.33.25.104
@@ -96833,6 +95984,7 @@
  89.34.111.122
  89.34.16.212
  89.34.16.7
+89.34.17.7
  89.34.208.216
  89.34.208.223
  89.34.26.129
@@ -96843,9 +95995,9 @@
  89.34.27.57
  89.34.96.62
  89.34.96.63
+89.35.138.51
  89.35.178.108
  89.35.249.139
-89.35.249.167
  89.35.249.169
  89.35.249.18
  89.35.249.203
@@ -96853,6 +96005,7 @@
  89.35.249.246
  89.35.249.25
  89.35.249.67
+89.35.250.199
  89.35.31.171
  89.35.34.96
  89.35.39.60
@@ -96893,7 +96046,6 @@
  89.39.106.94
  89.39.108.202
  89.39.174.13
-89.39.25.2
  89.40.113.141
  89.40.113.161
  89.40.114.11
@@ -96902,8 +96054,9 @@
  89.40.13.238
  89.40.142.176
  89.40.143.228
+89.40.183.217
+89.40.2.5
  89.40.217.40
-89.40.246.6
  89.40.48.186
  89.40.53.35
  89.40.9.189
@@ -96925,19 +96078,17 @@
  89.44.103.58
  89.44.205.133
  89.44.205.149
-89.44.205.166
  89.44.205.228
  89.44.205.247
  89.44.205.36
  89.44.205.45
-89.44.205.96
-89.44.247.130
  89.44.247.148
  89.44.247.168
  89.44.247.193
  89.44.247.50
  89.44.247.51
  89.44.247.68
+89.44.9.213
  89.45.193.69
  89.45.226.116
  89.45.67.54
@@ -96956,26 +96107,19 @@
  89.47.28.165
  89.56.148.84
  89.56.21.82
-89.64.11.78
  89.64.117.38
-89.64.13.108
-89.64.190.248
  89.64.39.142
  89.64.51.148
-89.64.58.121
-89.64.64.232
  89.65.244.169
-89.65.52.189
  89.66.169.254
-89.66.186.198
  89.69.179.180
  89.69.254.27
-89.7.203.104
  89.70.85.189
  89.72.212.205
  89.72.3.129
  89.74.28.203
  89.77.143.246
+89.78.5.56
  89.79.205.207
  89.79.48.213
  89.81.13.10
@@ -96983,9 +96127,7 @@
  89.95.83.154
  89.96.255.77
  89.97.218.142
-89.98.222.12
  89.98.241.10
-89.99.78.9
  890409eb44d3f3f1a1e568ff2c1c2179acec4748.info
  890765678.weebly.com
  890814.com
@@ -97092,28 +96234,24 @@
  9-29.com
  9-35.xyz
  90.1.71.162
+90.103.154.172
  90.104.116.167
  90.110.214.212
  90.110.30.206
-90.113.121.209
  90.113.49.199
-90.116.132.248
  90.125.146.210
  90.126.42.245
  90.131.47.201
-90.131.47.246
  90.139.34.57
+90.142.55.243
  90.146.153.21
  90.146.16.34
  90.146.219.186
-90.146.46.192
-90.148.235.137
+90.150.180.66
  90.150.52.45
  90.150.87.79
  90.151.180.215
  90.151.38.251
-90.153.31.107
-90.153.33.83
  90.155.167.227
  90.156.153.161
  90.156.196.18
@@ -97139,36 +96277,37 @@
  90.183.152.178
  90.183.158.50
  90.185.249.111
+90.186.227.131
  90.187.22.113
  90.187.222.89
+90.187.60.105
  90.187.75.113
  90.188.10.59
  90.188.21.217
-90.188.22.185
  90.188.236.43
+90.188.248.246
  90.188.255.142
  90.188.35.190
+90.189.110.236
  90.189.143.94
  90.189.167.93
  90.189.172.54
  90.190.253.254
  90.191.220.38
-90.193.82.176
  90.193.87.151
-90.194.129.206
  90.197.42.77
  90.204.41.78
  90.205.189.200
-90.208.233.217
  90.208.97.104
  90.210.144.198
  90.210.67.1
-90.214.158.37
+90.214.214.226
+90.216.51.226
  90.217.58.1
+90.219.90.187
  90.22.128.98
  90.22.228.208
  90.220.213.10
-90.220.51.169
  90.224.117.204
  90.224.203.97
  90.224.222.108
@@ -97179,39 +96318,36 @@
  90.227.1.125
  90.227.130.6
  90.23.198.2
+90.235.180.222
+90.24.36.7
  90.246.222.207
+90.250.163.55
  90.251.238.108
-90.251.26.158
  90.252.8.140
  90.253.1.164
  90.254.242.138
  90.27.153.190
+90.27.35.249
  90.3.50.161
  90.34.246.35
  90.43.8.88
  90.45.66.58
+90.46.38.235
  90.49.95.3
-90.50.224.150
  90.51.18.170
  90.51.20.22
-90.63.251.1
-90.64.164.45
-90.66.173.253
  90.66.196.239
-90.71.158.63
  90.71.236.70
+90.71.38.63
+90.73.210.192
  90.74.52.246
-90.75.242.11
  90.76.107.69
-90.78.229.103
  90.84.224.46
  90.84.242.139
  90.84.89.54
  90.88.254.120
  90.90.48.242
  90.90.51.29
-90.92.204.79
-90.95.26.134
  900800.com
  900990099009kk.000webhostapp.com
  900emtrtme00.com
@@ -97239,7 +96375,9 @@
  90a6903b-75ff-445e-893e-c69d2807dd96.htmlcomponentservice.com
  90f4uopj34.win
  90secondwebsitebuilder.com
-91.1.23.151
+91.1.28.92
+91.1.93.78
+91.10.204.190
  91.102.117.212
  91.102.200.88
  91.102.224.50
@@ -97249,6 +96387,7 @@
  91.103.196.170
  91.103.31.155
  91.103.31.45
+91.105.127.148
  91.105.135.113
  91.105.135.181
  91.105.152.168
@@ -97257,10 +96396,40 @@
  91.106.188.229
  91.106.193.72
  91.106.199.101
+91.106.43.65
+91.106.43.66
+91.106.43.67
+91.106.43.68
+91.106.43.69
+91.106.43.70
+91.106.43.71
+91.106.43.72
+91.106.43.73
+91.106.43.74
+91.106.43.75
+91.106.43.76
+91.106.43.77
+91.106.43.78
+91.106.43.79
+91.106.43.80
+91.106.43.81
+91.106.43.82
+91.106.43.83
+91.106.43.84
+91.106.43.85
+91.106.43.86
+91.106.43.87
+91.106.43.88
+91.106.43.89
+91.106.43.90
+91.106.43.91
+91.106.43.92
+91.106.43.93
+91.106.43.94
  91.107.26.202
-91.107.6.115
-91.108.145.202
-91.108.156.74
+91.108.136.72
+91.108.137.53
+91.108.140.223
  91.108.177.51
  91.108.178.222
  91.108.178.229
@@ -97269,7 +96438,7 @@
  91.109.26.72
  91.109.3.188
  91.109.5.170
-91.11.204.85
+91.11.116.90
  91.110.154.247
  91.113.116.176
  91.116.14.228
@@ -97302,6 +96471,7 @@
  91.121.133.13
  91.121.133.162
  91.121.133.211
+91.121.135.25
  91.121.14.107
  91.121.141.219
  91.121.142.210
@@ -97313,11 +96483,13 @@
  91.121.154.73
  91.121.155.175
  91.121.156.211
+91.121.156.27
  91.121.159.201
  91.121.16.117
  91.121.162.189
  91.121.162.198
  91.121.163.195
+91.121.165.170
  91.121.169.157
  91.121.169.194
  91.121.173.98
@@ -97335,6 +96507,7 @@
  91.121.191.85
  91.121.195.164
  91.121.205.83
+91.121.208.114
  91.121.210.168
  91.121.210.23
  91.121.211.34
@@ -97370,7 +96543,7 @@
  91.121.79.180
  91.121.79.94
  91.121.79.95
-91.121.79.98
+91.121.81.113
  91.121.81.55
  91.121.82.64
  91.121.83.134
@@ -97384,31 +96557,36 @@
  91.121.89.135
  91.121.89.189
  91.121.89.20
+91.121.89.79
  91.121.9.61
  91.121.90.166
  91.121.91.137
+91.121.91.160
  91.121.91.82
  91.121.92.17
  91.121.97.170
  91.122.159.193
  91.122.193.80
  91.122.198.128
-91.122.215.21
  91.122.46.120
  91.122.97.161
-91.124.208.160
-91.124.231.184
+91.126.167.150
  91.126.18.130
  91.126.191.163
  91.126.191.175
  91.126.191.182
-91.126.201.54
+91.126.194.54
  91.126.205.61
-91.126.206.51
-91.126.228.35
+91.126.231.19
+91.126.231.92
  91.126.234.159
+91.126.236.231
  91.126.47.49
+91.126.58.202
+91.126.75.42
+91.126.95.110
  91.132.1.139
+91.132.138.156
  91.132.138.44
  91.132.138.54
  91.132.138.58
@@ -97424,20 +96602,25 @@
  91.134.13.250
  91.134.133.251
  91.134.134.58
+91.134.135.95
  91.134.138.46
  91.134.140.84
  91.134.143.172
  91.134.145.129
  91.134.145.202
+91.134.147.249
  91.134.151.29
  91.134.157.246
  91.134.172.23
+91.134.173.189
  91.134.180.0
+91.134.201.59
  91.134.207.16
  91.134.209.116
  91.134.221.168
  91.134.231.96
  91.134.238.155
+91.134.238.179
  91.134.242.199
  91.134.242.66
  91.134.248.230
@@ -97453,28 +96636,22 @@
  91.135.242.203
  91.136.134.71
  91.137.140.89
-91.137.158.73
  91.138.184.109
  91.139.1.158
  91.139.107.122
  91.139.140.18
-91.139.206.178
-91.139.51.50
-91.140.26.145
-91.140.88.99
-91.141.0.38
  91.142.174.224
  91.142.209.68
-91.142.211.120
-91.142.215.223
  91.143.46.78
  91.144.142.125
  91.144.142.19
+91.144.147.160
  91.144.147.248
  91.144.150.207
  91.144.153.140
  91.144.20.198
  91.144.30.172
+91.146.75.211
  91.147.210.86
  91.147.232.98
  91.147.235.65
@@ -97483,7 +96660,6 @@
  91.148.120.226
  91.148.141.210
  91.148.147.73
-91.149.139.198
  91.149.157.145
  91.149.225.120
  91.15.75.156
@@ -97495,22 +96671,25 @@
  91.150.189.122
  91.150.77.57
  91.150.77.58
+91.150.79.20
  91.152.120.228
  91.152.21.215
  91.152.8.173
  91.155.2.97
+91.155.25.9
  91.159.105.216
  91.159.158.36
+91.160.170.145
  91.160.19.34
  91.163.206.48
-91.165.8.201
  91.168.145.151
  91.168.183.65
+91.170.183.204
  91.170.222.34
  91.173.12.250
+91.174.162.196
  91.178.80.255
  91.179.33.55
-91.18.240.161
  91.18.249.139
  91.180.81.15
  91.181.235.31
@@ -97518,31 +96697,28 @@
  91.183.53.241
  91.183.81.82
  91.184.52.3
-91.184.80.70
-91.185.194.71
+91.184.68.35
  91.185.226.136
  91.185.236.236
  91.185.236.239
  91.185.236.24
  91.185.40.251
-91.185.57.227
  91.185.57.55
  91.186.8.91
  91.186.9.53
  91.186.9.54
  91.187.113.205
  91.187.195.222
-91.187.200.139
  91.187.80.246
  91.187.89.18
  91.188.124.225
  91.188.124.232
-91.188.244.204
  91.188.247.53
  91.188.247.66
  91.189.123.230
  91.189.181.22
  91.189.201.70
+91.189.217.23
  91.191.173.120
  91.191.209.82
  91.191.209.83
@@ -97583,6 +96759,7 @@
  91.192.214.204
  91.192.219.39
  91.192.24.202
+91.192.25.72
  91.192.4.91
  91.192.6.43
  91.193.102.77
@@ -97602,7 +96779,6 @@
  91.195.124.11
  91.195.124.9
  91.195.192.38
-91.195.255.228
  91.196.100.93
  91.196.50.33
  91.196.70.11
@@ -97613,9 +96789,9 @@
  91.197.145.90
  91.197.234.187
  91.198.220.225
-91.199.42.196
  91.2.173.53
  91.20.177.182
+91.20.183.240
  91.200.114.216
  91.200.114.243
  91.200.12.58
@@ -97627,6 +96803,7 @@
  91.200.242.167
  91.201.240.101
  91.201.243.41
+91.202.240.208
  91.202.47.176
  91.203.114.71
  91.203.136.162
@@ -97710,12 +96887,10 @@
  91.210.47.85
  91.211.117.19
  91.211.172.104
-91.211.195.27
  91.211.246.105
  91.211.247.105
  91.211.248.35
  91.211.251.42
-91.211.251.76
  91.211.3.110
  91.211.3.111
  91.211.88.52
@@ -97723,8 +96898,12 @@
  91.212.127.100
  91.212.150.200
  91.212.150.241
+91.212.150.4
  91.213.119.246
  91.213.197.15
+91.213.46.214
+91.213.50.212
+91.214.124.197
  91.214.124.206
  91.214.130.253
  91.214.179.39
@@ -97760,8 +96939,6 @@
  91.216.93.71
  91.217.202.174
  91.217.42.3
-91.217.76.111
-91.217.81.155
  91.217.82.148
  91.217.83.61
  91.218.114.4
@@ -97769,10 +96946,10 @@
  91.218.127.142
  91.218.160.153
  91.218.163.74
-91.218.202.22
  91.218.203.59
-91.218.66.136
+91.219.166.205
  91.219.171.97
+91.219.212.221
  91.219.236.61
  91.219.237.22
  91.219.237.59
@@ -97780,11 +96957,9 @@
  91.219.25.232
  91.219.29.55
  91.219.88.121
-91.22.73.162
+91.22.75.238
  91.22.79.16
-91.220.163.10
  91.220.163.130
-91.220.230.52
  91.221.108.181
  91.221.108.182
  91.221.252.18
@@ -97796,24 +96971,27 @@
  91.222.239.30
  91.222.239.54
  91.222.239.82
-91.222.251.121
  91.222.92.128
  91.223.136.228
  91.223.212.208
  91.223.32.102
-91.223.6.209
+91.223.67.81
+91.223.67.82
+91.223.67.84
+91.223.67.85
  91.224.178.94
  91.224.20.71
  91.224.22.88
+91.224.44.72
  91.224.59.14
  91.224.98.206
-91.225.163.253
  91.225.190.77
  91.225.208.83
  91.225.208.84
  91.225.208.85
  91.225.208.87
  91.225.226.39
+91.225.77.52
  91.226.140.54
  91.226.192.8
  91.226.212.131
@@ -97840,6 +97018,7 @@
  91.230.199.174
  91.230.25.200
  91.231.127.89
+91.231.196.170
  91.231.213.51
  91.231.70.61
  91.232.105.116
@@ -97857,7 +97036,7 @@
  91.234.127.222
  91.234.154.107
  91.234.195.227
-91.234.25.132
+91.234.3.247
  91.234.33.206
  91.234.60.94
  91.234.62.161
@@ -97865,6 +97044,7 @@
  91.234.62.165
  91.234.62.167
  91.234.62.173
+91.234.62.180
  91.234.62.182
  91.234.62.186
  91.234.62.187
@@ -97885,7 +97065,6 @@
  91.235.244.205
  91.235.254.255
  91.235.255.7
-91.235.69.191
  91.236.7.126
  91.236.74.121
  91.237.121.11
@@ -97916,12 +97095,15 @@
  91.241.19.223
  91.241.19.42
  91.241.19.60
+91.241.191.217
  91.241.194.245
  91.241.226.233
  91.242.136.103
  91.243.100.9
  91.243.175.249
  91.243.188.158
+91.243.191.194
+91.243.45.153
  91.243.45.39
  91.243.45.40
  91.243.80.144
@@ -97930,59 +97112,59 @@
  91.244.181.85
  91.244.217.177
  91.244.253.66
-91.244.72.134
+91.244.61.137
  91.244.73.243
  91.244.76.191
-91.245.226.165
-91.245.34.95
  91.245.37.125
  91.246.213.100
  91.246.213.104
  91.246.3.21
-91.246.66.40
+91.246.64.70
+91.246.64.81
+91.246.72.207
+91.246.73.155
+91.246.73.3
  91.247.250.215
+91.248.118.164
+91.248.168.162
  91.248.32.171
-91.250.13.36
  91.250.242.12
+91.250.26.87
  91.250.6.108
  91.250.83.53
-91.3.64.9
+91.3.169.45
  91.3.73.251
-91.3.74.81
+91.3.74.66
  91.32.38.198
  91.33.30.252
-91.34.80.25
-91.34.82.247
-91.34.87.59
+91.33.99.160
  91.34.88.246
  91.34.95.157
-91.35.30.153
+91.35.160.158
+91.35.167.62
+91.35.17.212
+91.35.25.129
  91.37.223.62
  91.39.177.42
  91.40.166.170
-91.43.144.27
  91.44.225.23
  91.46.219.36
  91.46.47.216
  91.50.247.237
  91.51.53.26
  91.53.49.84
-91.54.159.125
  91.55.17.22
+91.55.22.159
+91.55.31.213
  91.56.57.156
  91.58.134.30
  91.59.154.33
-91.61.143.99
-91.62.49.36
-91.62.63.40
-91.64.100.37
-91.64.151.53
+91.64.100.35
  91.64.78.4
  91.65.157.200
  91.65.70.241
  91.66.171.108
  91.67.240.32
-91.67.41.128
  91.72.171.138
  91.72.179.214
  91.73.131.254
@@ -97996,35 +97178,32 @@
  91.78.79.250
  91.79.34.169
  91.82.179.166
+91.82.188.185
  91.82.40.118
  91.82.41.200
  91.82.42.2
  91.82.46.25
  91.83.227.122
  91.83.227.153
-91.83.227.43
-91.83.227.76
-91.83.92.27
  91.83.93.103
  91.83.93.105
  91.83.93.124
  91.87.153.218
-91.87.96.138
  91.89.125.223
  91.89.13.186
  91.89.23.63
  91.90.122.136
  91.90.122.137
-91.90.122.144
  91.90.122.145
  91.90.123.101
+91.90.123.156
+91.90.123.92
  91.90.36.174
  91.92.109.43
  91.92.115.210
  91.92.180.45
  91.92.191.134
  91.92.34.112
-91.92.34.146
  91.92.34.21
  91.92.34.252
  91.92.34.34
@@ -98037,6 +97216,7 @@
  91.92.80.25
  91.93.132.210
  91.93.140.179
+91.93.163.189
  91.93.170.220
  91.93.3.85
  91.93.63.187
@@ -98044,17 +97224,16 @@
  91.93.73.148
  91.93.97.106
  91.96.168.93
-91.97.150.52
-91.97.37.49
+91.96.227.140
  91.98.108.189
  91.98.132.189
  91.98.136.68
-91.98.149.207
  91.98.26.62
  91.98.32.223
  91.98.33.136
  91.98.34.37
  91.98.35.140
+91.98.45.145
  91.98.59.117
  91.98.6.127
  91.98.63.7
@@ -98106,20 +97285,18 @@
  92.111.156.14
  92.114.35.161
  92.114.75.210
+92.115.102.133
  92.115.134.57
-92.115.210.186
-92.116.144.32
-92.116.152.79
+92.116.146.132
  92.116.160.43
  92.116.180.166
-92.116.42.116
  92.117.120.155
-92.117.238.176
+92.117.238.190
  92.117.255.193
-92.117.43.140
  92.117.54.93
-92.118.161.1
+92.117.61.46
  92.118.161.53
+92.118.161.9
  92.118.190.105
  92.118.208.10
  92.118.208.136
@@ -98135,6 +97312,7 @@
  92.118.211.218
  92.118.211.225
  92.118.211.238
+92.118.211.79
  92.118.211.9
  92.118.221.206
  92.118.27.173
@@ -98146,18 +97324,19 @@
  92.119.159.40
  92.119.16.200
  92.119.229.194
+92.119.236.98
  92.124.139.1
  92.124.148.142
-92.124.153.76
  92.126.210.21
-92.127.33.127
-92.127.39.175
+92.126.212.205
  92.130.187.57
+92.137.141.251
  92.142.77.26
  92.145.71.231
  92.145.79.141
  92.148.27.8
  92.151.73.171
+92.152.87.120
  92.154.50.234
  92.154.89.19
  92.154.95.109
@@ -98166,27 +97345,39 @@
  92.157.97.148
  92.176.82.83
  92.18.38.240
-92.184.102.125
+92.184.100.190
+92.184.100.247
+92.184.100.97
+92.184.102.161
  92.184.102.178
-92.184.102.244
  92.184.102.50
  92.184.102.82
-92.184.105.200
+92.184.104.163
+92.184.104.206
+92.184.105.141
  92.184.105.208
-92.184.107.96
+92.184.105.6
+92.184.107.105
+92.184.107.84
  92.184.108.130
-92.184.108.233
-92.184.112.105
-92.184.112.120
+92.184.108.95
+92.184.112.107
+92.184.112.142
  92.184.112.150
-92.184.112.233
-92.184.112.50
-92.184.112.62
-92.184.112.92
+92.184.112.181
+92.184.112.231
+92.184.112.4
+92.184.112.88
  92.184.116.124
-92.184.116.147
-92.184.116.206
+92.184.116.129
+92.184.124.0
+92.184.124.10
+92.184.124.106
+92.184.124.138
  92.184.124.23
+92.184.124.41
+92.184.124.7
+92.184.124.77
  92.187.228.47
  92.187.245.121
  92.189.70.224
@@ -98196,9 +97387,9 @@
  92.190.177.39
  92.191.4.221
  92.192.102.49
-92.193.150.211
+92.193.187.211
  92.193.245.114
-92.194.164.50
+92.194.89.255
  92.195.52.66
  92.2.66.72
  92.20.12.134
@@ -98206,12 +97397,12 @@
  92.20.74.204
  92.20.8.10
  92.20.86.49
-92.200.87.12
+92.200.74.28
+92.200.90.140
  92.201.12.49
  92.201.32.32
  92.202.108.163
  92.204.132.78
-92.204.132.8
  92.204.163.66
  92.204.174.134
  92.206.212.180
@@ -98228,9 +97419,12 @@
  92.208.127.72
  92.208.204.145
  92.208.207.192
+92.209.102.33
  92.217.71.124
+92.219.151.94
  92.219.94.145
  92.22.60.74
+92.220.10.100
  92.220.163.15
  92.221.141.145
  92.221.163.194
@@ -98252,7 +97446,6 @@
  92.222.221.49
  92.222.64.148
  92.222.64.195
-92.222.68.106
  92.222.72.234
  92.222.74.255
  92.222.75.80
@@ -98274,7 +97467,7 @@
  92.223.93.145
  92.225.43.130
  92.231.44.2
-92.232.183.38
+92.232.126.138
  92.232.198.59
  92.236.123.94
  92.236.71.145
@@ -98282,6 +97475,7 @@
  92.237.242.79
  92.238.170.6
  92.238.234.158
+92.239.208.75
  92.239.241.47
  92.24.51.238
  92.240.143.117
@@ -98304,24 +97498,23 @@
  92.242.214.203
  92.242.234.6
  92.242.240.34
-92.242.254.14
  92.242.254.2
  92.242.254.53
  92.242.254.6
  92.242.255.11
  92.242.255.50
+92.242.255.55
  92.242.62.123
  92.243.0.38
  92.243.1.246
  92.243.13.72
  92.243.15.162
  92.243.21.182
+92.243.8.133
  92.243.84.187
-92.244.247.37
  92.244.36.73
  92.244.99.229
  92.245.175.165
-92.246.20.200
  92.246.84.133
  92.246.84.195
  92.247.11.242
@@ -98363,7 +97556,6 @@
  92.247.127.89
  92.247.142.182
  92.247.151.174
-92.247.157.3
  92.247.169.43
  92.247.2.26
  92.247.23.162
@@ -98376,10 +97568,12 @@
  92.249.136.75
  92.249.143.44
  92.249.219.47
+92.251.6.43
  92.252.185.162
  92.252.241.11
  92.252.241.202
  92.253.144.180
+92.253.250.243
  92.255.164.166
  92.255.170.159
  92.255.174.56
@@ -98396,19 +97590,16 @@
  92.27.142.29
  92.27.205.3
  92.27.26.140
-92.28.130.16
  92.31.218.173
  92.32.243.126
  92.33.157.21
-92.33.160.122
  92.33.191.207
+92.33.194.82
  92.33.230.156
  92.34.210.135
+92.34.48.227
  92.35.66.140
  92.35.94.126
-92.36.161.63
-92.36.169.26
-92.37.2.182
  92.37.238.232
  92.37.254.196
  92.38.128.47
@@ -98429,21 +97620,9 @@
  92.40.169.224
  92.40.169.225
  92.40.169.227
-92.40.184.225
-92.40.184.228
-92.40.184.230
-92.40.184.231
-92.40.184.235
-92.40.185.186
-92.40.185.187
-92.40.185.192
-92.40.185.194
-92.40.185.202
-92.40.185.204
  92.42.110.214
  92.42.255.218
  92.42.37.141
-92.42.46.132
  92.42.47.188
  92.42.8.20
  92.42.8.22
@@ -98451,6 +97630,7 @@
  92.43.165.73
  92.43.20.29
  92.43.29.162
+92.43.80.169
  92.45.165.20
  92.45.19.5
  92.45.51.207
@@ -98467,6 +97647,7 @@
  92.47.198.254
  92.47.62.134
  92.48.124.21
+92.49.160.25
  92.49.188.150
  92.49.214.237
  92.49.71.172
@@ -98478,11 +97659,11 @@
  92.51.73.14
  92.51.78.66
  92.51.89.126
+92.52.185.84
  92.52.186.123
  92.52.204.23
  92.53.111.240
  92.53.119.193
-92.53.44.117
  92.53.64.166
  92.53.64.203
  92.53.89.123
@@ -98495,6 +97676,7 @@
  92.61.102.252
  92.61.114.103
  92.62.139.103
+92.62.18.244
  92.62.196.66
  92.62.69.19
  92.62.73.73
@@ -98502,14 +97684,10 @@
  92.63.168.227
  92.63.192.231
  92.63.192.96
-92.63.196.13
  92.63.197.153
  92.63.197.190
  92.63.197.55
-92.63.197.58
  92.63.197.60
-92.63.197.83
-92.63.197.86
  92.63.199.9
  92.63.203.197
  92.63.87.10
@@ -98532,11 +97710,10 @@
  92.8.85.159
  92.80.191.78
  92.80.217.82
-92.80.252.69
  92.81.133.135
+92.81.137.9
  92.81.222.217
  92.83.41.98
-92.84.116.40
  92.84.56.10
  92.85.169.16
  92.86.10.42
@@ -98555,6 +97732,7 @@
  92.96.172.185
  92.97.241.244
  92.98.243.43
+92.98.7.153
  92.99.208.52
  9201mobiliref032.com
  920365365.com
@@ -98586,26 +97764,32 @@
  93.100.232.11
  93.103.12.195
  93.103.130.169
+93.103.235.133
  93.103.252.236
  93.103.94.40
-93.104.124.117
-93.104.178.153
  93.104.184.168
+93.104.186.45
  93.104.210.119
  93.104.210.230
  93.104.210.29
  93.104.213.162
  93.105.177.15
  93.107.153.162
+93.108.195.234
  93.108.242.140
+93.108.63.50
  93.109.215.46
  93.112.131.238
  93.113.110.87
  93.113.111.100
+93.113.111.193
  93.113.131.116
  93.113.131.129
  93.113.206.62
  93.113.49.1
+93.114.184.56
+93.114.184.8
+93.114.234.242
  93.114.235.168
  93.114.41.133
  93.114.44.253
@@ -98619,7 +97803,10 @@
  93.115.0.93
  93.115.1.195
  93.115.138.250
+93.115.152.116
+93.115.199.194
  93.115.20.130
+93.115.240.26
  93.115.241.194
  93.115.26.162
  93.115.26.171
@@ -98636,19 +97823,18 @@
  93.115.97.17
  93.116.201.15
  93.116.226.60
+93.116.45.219
  93.116.57.4
  93.116.83.126
  93.117.72.27
-93.118.109.57
  93.118.72.92
  93.118.74.237
  93.119.123.233
-93.119.36.120
  93.123.16.216
  93.123.180.164
  93.123.73.123
+93.124.100.174
  93.124.107.247
-93.124.15.205
  93.124.48.45
  93.125.1.208
  93.125.107.48
@@ -98662,24 +97848,26 @@
  93.125.99.40
  93.125.99.69
  93.126.124.29
+93.126.126.51
  93.126.60.99
  93.126.94.192
+93.126.95.196
  93.126.98.242
  93.127.145.162
  93.127.145.40
+93.133.175.42
  93.135.125.5
-93.136.172.184
-93.137.113.109
-93.137.183.88
-93.137.246.108
+93.137.100.165
+93.137.107.116
  93.138.139.135
+93.138.144.187
+93.138.153.202
+93.138.161.187
  93.138.187.10
  93.141.175.161
-93.141.3.154
  93.142.150.3
-93.142.151.52
-93.143.223.216
  93.143.96.185
+93.144.155.211
  93.145.164.6
  93.145.61.6
  93.146.143.191
@@ -98689,32 +97877,29 @@
  93.147.129.222
  93.147.141.5
  93.147.212.206
-93.147.83.98
+93.148.17.233
  93.148.231.30
+93.148.65.249
+93.148.99.83
  93.149.12.2
  93.149.120.214
+93.149.180.144
  93.149.233.109
-93.151.187.72
-93.151.198.32
  93.153.238.202
  93.153.95.186
  93.155.164.41
-93.155.194.69
  93.156.165.186
  93.157.163.66
  93.157.62.102
  93.157.62.58
-93.157.63.235
  93.158.202.231
  93.158.211.196
  93.158.216.52
  93.158.228.230
  93.159.141.165
-93.159.141.166
  93.159.169.190
  93.159.215.241
  93.167.67.69
-93.168.216.131
  93.168.247.201
  93.170.113.159
  93.170.123.200
@@ -98725,7 +97910,6 @@
  93.170.175.201
  93.170.53.188
  93.171.205.34
-93.171.212.63
  93.172.212.252
  93.174.0.17
  93.174.0.38
@@ -98761,19 +97945,17 @@
  93.174.95.47
  93.174.95.64
  93.174.95.81
-93.175.103.118
  93.175.234.1
-93.176.129.97
-93.176.146.171
+93.176.150.13
  93.176.162.51
-93.176.177.105
  93.176.191.192
  93.176.84.35
  93.176.84.45
-93.177.116.172
+93.177.103.30
  93.177.116.75
  93.177.117.41
-93.177.82.226
+93.177.175.140
+93.177.73.194
  93.178.200.122
  93.179.102.31
  93.179.197.152
@@ -98824,13 +98006,18 @@
  93.190.58.4
  93.190.93.165
  93.196.103.122
+93.197.36.201
  93.201.115.123
  93.201.236.52
-93.202.129.239
+93.202.134.175
  93.203.35.140
+93.209.178.75
  93.209.186.81
  93.21.224.154
-93.214.162.183
+93.210.170.39
+93.210.6.5
+93.212.245.8
+93.214.171.170
  93.214.171.18
  93.22.37.164
  93.222.192.185
@@ -98840,21 +98027,23 @@
  93.224.119.12
  93.224.54.2
  93.226.29.199
+93.228.70.60
  93.228.80.212
  93.23.196.55
-93.234.50.73
+93.230.210.16
+93.230.210.3
+93.233.231.248
  93.235.111.80
  93.236.71.228
  93.243.24.237
  93.25.118.228
+93.254.30.201
  93.254.58.170
  93.255.124.134
-93.255.154.62
+93.255.59.116
  93.28.211.232
-93.34.234.61
-93.34.236.88
-93.34.81.161
-93.35.183.241
+93.31.12.115
+93.34.119.83
  93.35.186.155
  93.35.225.23
  93.36.187.37
@@ -98863,10 +98052,8 @@
  93.38.127.179
  93.38.127.199
  93.38.51.15
-93.38.66.199
  93.39.27.225
  93.41.111.122
-93.41.118.124
  93.41.193.212
  93.42.196.218
  93.42.224.202
@@ -98876,10 +98063,10 @@
  93.43.223.61
  93.43.231.1
  93.46.156.218
-93.48.252.102
  93.48.88.51
  93.49.164.197
  93.5.133.202
+93.50.125.249
  93.50.177.66
  93.51.120.148
  93.51.199.110
@@ -98889,10 +98076,8 @@
  93.54.116.118
  93.55.176.74
  93.55.242.131
-93.56.201.69
  93.57.249.8
  93.57.81.162
-93.6.153.174
  93.61.137.226
  93.61.137.46
  93.62.153.202
@@ -98901,11 +98086,9 @@
  93.63.75.62
  93.64.183.162
  93.67.138.66
-93.67.25.112
  93.69.7.20
-93.70.254.31
  93.71.204.162
-93.72.149.200
+93.72.48.8
  93.73.157.229
  93.73.75.213
  93.74.111.222
@@ -98917,23 +98100,26 @@
  93.75.190.194
  93.75.197.17
  93.75.48.211
+93.76.71.130
  93.77.135.27
-93.77.239.137
  93.77.71.235
+93.78.131.9
+93.78.171.4
+93.79.151.94
  93.79.162.18
  93.80.130.220
  93.81.252.222
  93.81.9.28
  93.82.220.150
-93.82.79.22
  93.83.108.58
  93.83.126.93
+93.84.111.7
  93.85.132.194
  93.86.206.139
  93.86.49.105
-93.86.63.73
  93.86.68.186
  93.87.123.245
+93.87.130.200
  93.87.17.1
  93.87.28.158
  93.87.44.167
@@ -98953,14 +98139,12 @@
  93.90.207.46
  93.90.73.137
  93.91.112.247
-93.91.127.50
  93.91.146.30
  93.91.197.147
  93.92.138.193
  93.92.176.141
  93.92.205.180
  93.92.248.23
-93.93.246.97
  93.93.46.180
  93.93.71.228
  93.95.100.163
@@ -98968,6 +98152,7 @@
  93.95.102.81
  93.95.217.45
  93.95.88.3
+93.99.13.46
  93.99.153.113
  93.99.176.84
  93.99.53.201
@@ -99012,7 +98197,6 @@
  94.102.49.168
  94.102.49.169
  94.102.49.175
-94.102.49.190
  94.102.49.193
  94.102.49.210
  94.102.49.211
@@ -99026,6 +98210,7 @@
  94.102.5.32
  94.102.50.56
  94.102.51.155
+94.102.51.218
  94.102.51.22
  94.102.51.231
  94.102.51.238
@@ -99047,10 +98232,11 @@
  94.102.63.52
  94.102.63.74
  94.102.8.112
-94.103.12.151
  94.103.120.173
-94.103.122.210
  94.103.94.13
+94.104.37.186
+94.106.214.115
+94.110.203.27
  94.110.64.122
  94.110.96.59
  94.112.121.49
@@ -99060,11 +98246,10 @@
  94.112.72.244
  94.113.115.219
  94.113.116.24
-94.113.223.21
  94.114.122.116
  94.114.158.146
+94.114.249.193
  94.114.61.26
-94.123.157.231
  94.124.155.186
  94.124.18.3
  94.124.193.242
@@ -99100,8 +98285,6 @@
  94.130.181.152
  94.130.20.181
  94.130.207.177
-94.130.214.218
-94.130.219.230
  94.130.220.87
  94.130.222.174
  94.130.35.227
@@ -99116,15 +98299,12 @@
  94.130.9.125
  94.131.14.10
  94.131.14.19
+94.131.202.209
  94.131.219.3
  94.131.219.88
  94.131.241.14
-94.133.67.241
  94.134.0.33
-94.134.159.169
-94.134.179.250
  94.134.3.8
-94.134.81.88
  94.136.138.142
  94.136.154.49
  94.136.154.53
@@ -99162,11 +98342,11 @@
  94.140.125.235
  94.140.189.83
  94.140.208.190
-94.140.242.221
  94.140.249.235
  94.141.117.1
  94.141.169.44bin.sh
  94.141.20.80
+94.141.230.10
  94.141.233.66
  94.142.130.61
  94.142.15.133
@@ -99178,7 +98358,6 @@
  94.142.245.124
  94.143.43.230
  94.143.83.203
-94.152.206.40
  94.152.214.74
  94.153.157.18
  94.153.169.22
@@ -99221,7 +98400,6 @@
  94.155.33.83
  94.155.33.84
  94.155.33.85
-94.155.33.88
  94.156.128.114
  94.156.128.69
  94.156.128.72
@@ -99247,6 +98425,7 @@
  94.16.105.121
  94.16.105.228
  94.16.108.102
+94.16.108.113
  94.16.108.223
  94.16.109.84
  94.16.120.18
@@ -99260,13 +98439,13 @@
  94.176.235.169
  94.177.161.160
  94.177.171.51
-94.177.179.243
  94.177.183.28
  94.177.189.119
  94.177.190.156
  94.177.199.78
  94.177.204.145
  94.177.207.151
+94.177.218.220
  94.177.232.252
  94.177.236.107
  94.177.236.48
@@ -99281,6 +98460,7 @@
  94.179.133.22
  94.179.135.230
  94.18.231.202
+94.180.106.94
  94.180.246.38
  94.180.247.20
  94.180.249.187
@@ -99288,6 +98468,8 @@
  94.181.181.120
  94.181.33.149
  94.181.44.79
+94.181.46.141
+94.181.46.72
  94.181.47.232
  94.181.51.252
  94.182.197.202
@@ -99304,7 +98486,6 @@
  94.189.195.125
  94.19.128.204
  94.19.132.255
-94.19.162.175
  94.19.19.222
  94.19.211.204
  94.19.242.99
@@ -99312,6 +98493,7 @@
  94.19.7.55
  94.19.73.106
  94.190.177.213
+94.190.187.104
  94.190.76.239
  94.191.107.157
  94.191.122.43
@@ -99330,6 +98512,7 @@
  94.198.195.42
  94.198.215.22
  94.198.240.26
+94.198.41.88
  94.198.51.119
  94.198.96.3
  94.199.151.22
@@ -99356,11 +98539,14 @@
  94.208.33.68
  94.208.76.184
  94.209.17.157
+94.209.236.51
  94.21.118.140
  94.21.155.91
+94.21.207.136
  94.21.65.190
  94.210.171.120
  94.211.17.129
+94.211.34.244
  94.212.219.138
  94.213.107.137
  94.218.22.239
@@ -99369,7 +98555,6 @@
  94.221.20.3
  94.224.179.119
  94.224.187.205
-94.226.118.211
  94.227.107.190
  94.227.40.54
  94.228.10.70
@@ -99379,7 +98564,11 @@
  94.228.214.5
  94.228.215.83
  94.228.4.249
+94.228.85.129
+94.228.85.166
+94.228.90.140
  94.229.161.60
+94.23.0.85
  94.23.1.8
  94.23.11.114
  94.23.11.6
@@ -99402,6 +98591,7 @@
  94.23.214.15
  94.23.216.33
  94.23.220.214
+94.23.222.84
  94.23.229.64
  94.23.236.143
  94.23.237.171
@@ -99411,11 +98601,13 @@
  94.23.250.222
  94.23.254.205
  94.23.26.146
+94.23.30.216
  94.23.33.22
  94.23.36.11
  94.23.4.47
  94.23.40.27
  94.23.44.120
+94.23.45.15
  94.23.45.86
  94.23.51.183
  94.23.69.61
@@ -99432,16 +98624,16 @@
  94.231.216.105
  94.231.216.63
  94.231.253.18
+94.231.35.132
  94.231.80.100
  94.232.11.178
  94.232.126.225
  94.232.200.144
+94.232.41.147
  94.232.46.40
-94.232.70.75
  94.236.153.194
  94.236.154.169
  94.236.154.243
-94.236.161.149
  94.236.182.92
  94.236.23.242
  94.237.124.184
@@ -99471,21 +98663,23 @@
  94.242.62.76
  94.243.140.162
  94.243.219.122
-94.244.42.70
+94.244.134.107
+94.244.28.246
  94.244.97.244
  94.247.134.77
  94.247.241.70
  94.25.104.250
  94.25.145.189
-94.25.169.2
+94.25.171.81
  94.25.228.74
+94.25.234.204
  94.250.248.75
  94.250.254.147
  94.250.82.27
  94.253.15.25
  94.253.159.94
+94.253.195.210
  94.253.237.25
-94.253.243.119
  94.254.97.68
  94.255.221.36
  94.26.142.10
@@ -99493,11 +98687,13 @@
  94.26.18.144
  94.26.49.71
  94.27.183.226
+94.27.217.223
  94.27.222.78
+94.27.225.36
  94.28.31.99
+94.30.97.245
  94.31.100.251
  94.31.100.50
-94.32.243.132
  94.32.66.15
  94.34.224.165
  94.40.127.166
@@ -99527,6 +98723,7 @@
  94.52.112.227
  94.53.0.116
  94.53.120.109
+94.53.134.174
  94.53.83.30
  94.55.126.2
  94.57.252.133
@@ -99544,26 +98741,19 @@
  94.62.201.87
  94.62.203.232
  94.63.114.4
-94.63.70.207
-94.64.192.208
+94.64.199.1
  94.64.82.87
  94.65.56.190
  94.65.60.196
-94.66.58.42
  94.66.80.40
  94.66.80.74
  94.67.207.203
-94.67.81.247
  94.68.26.30
  94.68.71.230
-94.69.130.183
-94.69.226.48
  94.72.143.26
  94.72.158.1
  94.72.158.129
  94.73.204.145
-94.73.205.1
-94.73.239.124
  94.74.124.248
  94.74.142.147
  94.74.162.25
@@ -99575,13 +98765,14 @@
  94.75.246.151
  94.75.253.76
  94.75.253.85
-94.75.76.10
+94.75.67.229
  94.75.95.148
  94.75.98.91
  94.76.247.61
  94.76.92.10
  94.79.4.53
  94.79.54.195
+94.79.55.192
  94.96.24.9
  94.96.96.242
  94.98.60.183
@@ -99607,6 +98798,7 @@
  945177698f0e38b29bce2c9afc3b3795-dot-dbenitonline.ey.r.appspot.com
  945365365.com
  94599e605eb6d4b3b67b5cdd34cffd36.icu
+9471730618634546.eu-gb.cf.appdomain.cloud
  948-365.net
  948522.blob.core.windows.net
  949111-dot-n-e-w-me-ss-age-po-rt-al.wl.r.appspot.com
@@ -99618,10 +98810,10 @@
  95.0.206.218
  95.0.206.62
  95.0.219.196
-95.0.219.230
  95.0.219.245
  95.0.219.251
  95.0.37.74
+95.0.64.61
  95.0.66.109
  95.0.66.43
  95.0.66.82
@@ -99630,7 +98822,6 @@
  95.10.237.9
  95.103.114.15
  95.104.114.50
-95.104.194.16
  95.104.54.227
  95.105.177.157
  95.105.184.58
@@ -99655,45 +98846,38 @@
  95.110.224.30
  95.110.226.93
  95.110.234.93
-95.110.70.97
  95.111.128.185
  95.111.128.43
  95.111.197.91
-95.111.226.195
-95.111.227.164
  95.111.234.125
  95.111.235.189
  95.111.236.142
  95.111.242.223
-95.111.242.42
  95.111.244.99
  95.111.245.205
  95.111.246.151
  95.111.248.110
  95.111.253.205
  95.111.254.160
-95.111.47.121
-95.112.133.89
-95.112.219.108
-95.116.155.42
-95.117.102.232
-95.117.93.192
+95.112.247.5
+95.115.114.33
+95.115.96.194
+95.118.27.85
  95.118.60.72
-95.120.220.254
  95.122.154.149
  95.122.97.103
-95.126.58.42
  95.128.142.76
  95.128.144.1
-95.128.164.91
  95.128.168.227
  95.128.43.164
  95.128.43.213
  95.128.63.245
+95.129.145.169
  95.129.46.78
  95.13.148.48
  95.13.65.5
  95.13.65.96
+95.13.66.156
  95.13.67.155
  95.13.67.176
  95.13.68.165
@@ -99702,7 +98886,6 @@
  95.13.74.243
  95.13.76.111
  95.13.77.249
-95.13.79.157
  95.13.79.164
  95.13.80.141
  95.13.80.188
@@ -99716,26 +98899,26 @@
  95.13.95.115
  95.13.95.24
  95.130.168.234
-95.131.135.202
-95.131.149.243
  95.131.70.76
+95.132.162.92
+95.132.54.89
  95.133.163.58
  95.133.163.98
  95.134.130.182
+95.135.108.133
  95.135.122.112
-95.135.134.93
  95.135.142.198
  95.135.149.148
+95.135.158.12
  95.136.111.129
  95.136.47.170
-95.136.68.117
  95.136.9.157
-95.137.130.106
  95.137.156.236
  95.137.240.3
  95.137.240.30
  95.138.228.28
  95.138.33.28
+95.139.224.60
  95.140.116.18
  95.140.27.135
  95.141.17.0
@@ -99994,11 +99177,12 @@
  95.141.17.97
  95.141.17.98
  95.141.17.99
+95.141.232.2
  95.141.36.112
  95.141.41.24
  95.142.120.17
-95.142.120.25
  95.142.121.21
+95.142.126.10
  95.142.161.63
  95.142.161.87
  95.142.164.239
@@ -100023,17 +99207,18 @@
  95.143.21.194
  95.143.21.241
  95.143.21.6
+95.143.21.63
  95.143.218.179
  95.143.22.137
  95.143.22.164
  95.143.22.173
-95.143.22.202
  95.143.22.62
-95.143.220.5
+95.143.8.182
  95.145.140.0
  95.15.140.230
  95.15.162.191
-95.153.126.185
+95.150.78.41
+95.152.62.138
  95.153.167.63
  95.153.31.87
  95.154.104.147
@@ -100063,7 +99248,8 @@
  95.158.217.19
  95.158.63.46
  95.158.63.61
-95.16.161.214
+95.158.64.101
+95.16.150.250
  95.160.23.204
  95.161.12.45
  95.161.188.246
@@ -100078,6 +99264,8 @@
  95.163.207.184
  95.163.255.158
  95.163.255.166
+95.163.255.176
+95.163.255.70
  95.164.65.194
  95.165.104.89
  95.165.108.113
@@ -100088,24 +99276,22 @@
  95.165.160.46
  95.165.163.188
  95.165.167.37
-95.165.172.171
+95.165.169.168
  95.165.182.230
  95.165.187.202
  95.165.26.27
  95.165.28.122
+95.165.96.72
  95.167.123.54
  95.167.159.250
  95.167.178.149
-95.168.116.6
-95.168.118.13
-95.168.118.15
  95.168.170.105
  95.168.96.42
  95.169.1.147
  95.169.10.152
+95.169.12.12
  95.169.181.121
  95.169.213.76
-95.169.22.100
  95.169.5.166
  95.169.6.123
  95.169.6.47
@@ -100159,36 +99345,40 @@
  95.179.241.15
  95.179.241.197
  95.179.250.205
+95.179.88.47
+95.18.192.64
  95.180.167.208
-95.180.195.156
-95.180.231.53
  95.181.131.153
  95.181.131.199
+95.181.150.174
+95.181.150.89
+95.181.151.79
  95.181.157.216
  95.181.157.227
  95.181.157.239
  95.181.191.97
  95.181.214.105
  95.181.230.146
+95.181.233.12
  95.181.45.234
  95.182.123.194
  95.183.51.24
  95.183.52.148
  95.183.55.40
  95.185.12.65
-95.187.29.209
  95.187.50.31
  95.188.71.19
  95.189.78.2
+95.19.50.117
  95.19.50.17
  95.19.50.252
  95.19.50.31
  95.19.50.32
  95.19.50.59
  95.191.196.85
+95.194.82.53
  95.195.215.245
  95.20.162.171
-95.208.200.36
  95.208.253.143
  95.209.155.91
  95.21.243.117
@@ -100211,7 +99401,6 @@
  95.211.203.106
  95.211.206.202
  95.211.208.50
-95.211.208.56
  95.211.209.158
  95.211.211.20
  95.211.212.131
@@ -100230,14 +99419,16 @@
  95.213.193.198
  95.213.193.200
  95.213.193.202
+95.213.193.205
  95.213.217.188
  95.213.224.102
  95.213.236.64
  95.214.10.116
  95.214.235.144
+95.214.41.173
+95.214.52.33
  95.214.53.145
  95.214.53.154
-95.214.54.84
  95.215.19.22
  95.215.206.244
  95.215.44.12
@@ -100246,6 +99437,8 @@
  95.215.46.191
  95.215.47.179
  95.215.47.52
+95.215.48.145
+95.215.50.230
  95.215.62.140
  95.215.62.171
  95.216.0.251
@@ -100262,9 +99455,9 @@
  95.216.124.20
  95.216.139.42
  95.216.140.185
-95.216.140.94
  95.216.145.1
  95.216.145.173
+95.216.147.49
  95.216.15.164
  95.216.152.179
  95.216.159.206
@@ -100297,6 +99490,7 @@
  95.216.28.254
  95.216.3.111
  95.216.31.79
+95.216.36.212
  95.216.36.231
  95.216.36.232
  95.216.36.239
@@ -100310,7 +99504,6 @@
  95.216.59.92
  95.216.68.44
  95.216.7.158
-95.216.70.91
  95.216.73.37
  95.216.76.224
  95.216.8.166
@@ -100319,21 +99512,19 @@
  95.216.96.167
  95.216.96.93
  95.216.97.16
-95.216.97.204
  95.216.98.26
  95.217.10.167
  95.217.10.7
-95.217.101.169
  95.217.105.108
  95.217.109.216
  95.217.109.218
  95.217.114.36
+95.217.120.190
  95.217.121.30
  95.217.121.97
  95.217.124.148
  95.217.125.203
  95.217.145.249
-95.217.153.97
  95.217.180.216
  95.217.183.221
  95.217.184.215
@@ -100350,6 +99541,7 @@
  95.217.205.27
  95.217.213.50
  95.217.23.149
+95.217.234.255
  95.217.237.152
  95.217.33.109
  95.217.34.169
@@ -100373,32 +99565,28 @@
  95.220.131.150
  95.221.143.112
  95.221.155.229
+95.222.189.150
  95.222.97.149
-95.223.251.106
-95.223.57.214
+95.223.229.212
  95.223.75.255
  95.224.117.226
  95.225.157.7
  95.227.198.80
-95.227.65.226
  95.229.138.72
  95.229.138.87
-95.23.25.200
  95.233.68.206
  95.234.98.85
  95.235.176.247
+95.235.245.215
  95.235.60.135
  95.239.125.104
-95.244.165.21
+95.245.155.130
  95.246.141.145
-95.246.48.69
+95.247.194.16
  95.247.233.159
-95.247.38.203
-95.248.200.129
  95.249.243.113
  95.25.221.54
  95.25.39.47
-95.25.45.39
  95.251.21.182
  95.251.21.97
  95.251.9.69
@@ -100406,20 +99594,19 @@
  95.253.238.77
  95.255.173.199
  95.255.49.42
+95.26.78.229
  95.29.42.110
-95.30.205.111
  95.31.119.210
  95.31.165.210
  95.31.172.45
  95.31.186.116
+95.31.245.107
  95.31.5.29
  95.33.254.230
-95.37.159.154
  95.38.171.201
  95.38.19.75
  95.39.12.16
  95.42.155.56
-95.42.177.190
  95.42.189.34
  95.43.103.104
  95.43.42.100
@@ -100438,26 +99625,23 @@
  95.55.95.187
  95.56.104.238
  95.56.130.6
-95.56.29.230
  95.57.189.199
+95.58.145.22
  95.59.105.179
  95.59.139.141
  95.59.26.160
  95.59.26.9
  95.59.7.26
-95.6.64.145
  95.6.70.92
  95.63.239.78
  95.65.124.252
  95.65.30.156
-95.65.79.119
  95.65.81.152
  95.65.89.96
  95.66.142.18
  95.66.182.136
  95.67.38.55
  95.67.46.86
-95.67.47.94
  95.67.48.94
  95.67.65.18
  95.67.81.50
@@ -100465,6 +99649,7 @@
  95.68.115.202
  95.68.116.41
  95.69.249.63
+95.70.128.86
  95.70.134.37
  95.70.220.173
  95.71.124.31
@@ -100475,14 +99660,13 @@
  95.76.118.185
  95.76.126.95
  95.76.153.115
-95.76.25.58
  95.77.104.79
-95.77.140.135
  95.77.16.197
  95.77.98.196
  95.77.98.92
  95.78.127.226
  95.78.162.117
+95.78.174.219
  95.79.112.74
  95.79.31.128
  95.79.34.35
@@ -100499,12 +99683,8 @@
  95.80.64.108
  95.80.85.33
  95.80.85.67
-95.81.0.251
-95.82.114.155
  95.82.119.54
-95.82.121.236
-95.82.127.48
-95.82.146.70
+95.82.136.170
  95.82.176.138
  95.83.73.31
  95.84.128.25
@@ -100527,7 +99707,6 @@
  95.85.19.196
  95.85.19.99
  95.85.196.137
-95.85.197.161
  95.85.23.210
  95.85.25.101
  95.85.26.75
@@ -100535,6 +99714,7 @@
  95.85.28.173
  95.85.30.184
  95.85.31.179
+95.85.31.92
  95.85.33.224
  95.85.34.53
  95.85.37.17
@@ -100564,27 +99744,24 @@
  95.87.24.151
  95.87.25.234
  95.88.246.1
-95.88.7.24
  95.89.250.59
  95.9.150.33
  95.9.180.128
  95.9.194.13
  95.9.5.93
+95.90.182.156
+95.90.182.98
  95.90.198.253
  95.90.232.212
  95.90.32.63
  95.90.6.49
  95.90.65.45
  95.91.139.120
-95.91.146.167
-95.91.195.101
  95.91.196.33
  95.91.214.75
  95.91.220.251
  95.91.45.50
-95.91.75.57
  95.93.218.249
-95.95.236.91
  95.97.209.10
  95.97.27.33
  950-365.com
@@ -100597,6 +99774,7 @@
  9552190-dot-n-e-w-me-ss-age-po-rt-al.wl.r.appspot.com
  955680-dot-n-e-w-me-ss-age-po-rt-al.wl.r.appspot.com
  955a0debde97dc9e7484e1ef4c08a2f2d869bb47.info
+95626562.blogspot.com
  956365365.com
  956753servicecenter.com
  95676761.janganpercayadprri.com
@@ -100629,6 +99807,7 @@
  96.19.243.197
  96.2.21.190
  96.21.177.8
+96.22.233.43
  96.22.82.34
  96.224.227.210
  96.224.251.104
@@ -100647,35 +99826,37 @@
  96.239.17.242
  96.242.147.73
  96.244.15.194
+96.244.218.117
+96.244.67.237
  96.245.74.37
  96.247.202.109
  96.247.204.58
  96.252.122.213
+96.252.37.32
  96.253.78.75
  96.254.171.10
  96.255.139.230
  96.255.84.96
  96.27.249.5
  96.27.65.237
+96.28.97.37
  96.30.195.215
  96.30.51.176
-96.30.68.20
  96.30.84.26
  96.31.77.62
+96.31.99.160
  96.32.154.196
-96.35.128.242
  96.35.236.9
  96.35.44.209
-96.36.156.39
  96.38.148.12
  96.38.41.34
  96.39.152.89
  96.39.166.117
+96.39.40.238
  96.39.76.211
  96.41.157.101
-96.42.151.215
+96.43.106.132
  96.43.106.231
-96.43.106.239
  96.43.106.244
  96.44.128.250
  96.44.130.190
@@ -100699,6 +99880,7 @@
  96.50.41.57
  96.54.206.56
  96.54.225.175
+96.56.213.182
  96.56.221.138
  96.57.24.186
  96.57.248.252
@@ -100706,6 +99888,7 @@
  96.59.157.47
  96.61.113.203
  96.64.29.46
+96.66.155.147
  96.66.200.209
  96.66.95.17
  96.67.86.201
@@ -100723,12 +99906,13 @@
  96.77.146.148
  96.77.43.233
  96.77.77.53
+96.78.175.38
  96.78.175.41
  96.78.175.45
  96.79.125.33
  96.8.114.178
+96.8.115.28
  96.8.120.113
-96.8.120.53
  96.8.120.60
  96.8.122.180
  96.80.107.217
@@ -100736,11 +99920,11 @@
  96.82.74.129
  96.84.128.196
  96.84.149.98
-96.85.110.193
  96.85.35.233
  96.86.235.11
  96.87.184.101
  96.87.188.193
+96.89.27.149
  96.9.183.85
  96.9.209.210
  96.9.231.108
@@ -100748,7 +99932,6 @@
  96.9.66.112
  96.9.66.187
  96.9.66.200
-96.9.66.9
  96.9.67.84
  96.9.69.164
  96.9.72.242
@@ -100771,6 +99954,7 @@
  96.93.196.89
  96.94.168.154
  96.95.125.180
+96.96.123.154
  96.ip-51-255-193.eu
  960365365.com
  96063940441-dot-oppaiwiuwe.rj.r.appspot.com
@@ -100796,28 +99980,16 @@
  97.107.127.214
  97.107.127.227
  97.107.131.216
-97.107.133.164
  97.107.137.60
+97.108.58.204
  97.112.1.159
-97.112.101.201
  97.112.101.248
-97.112.102.165
-97.112.102.41
-97.112.102.79
  97.112.105.45
-97.112.105.51
-97.112.106.181
  97.112.107.225
  97.112.107.247
-97.112.108.113
-97.112.108.204
-97.112.108.250
  97.112.108.35
  97.112.108.43
  97.112.108.68
-97.112.109.193
-97.112.109.223
-97.112.110.124
  97.112.12.148
  97.112.12.3
  97.112.12.50
@@ -100825,80 +99997,47 @@
  97.112.14.133
  97.112.14.14
  97.112.14.192
-97.112.19.167
  97.112.195.221
-97.112.198.173
  97.112.201.89
  97.112.247.135
  97.112.29.69
  97.112.38.11
  97.112.64.204
-97.112.68.25
  97.112.69.155
-97.112.69.52
  97.112.7.168
-97.112.70.212
  97.112.73.206
  97.112.74.252
-97.112.75.123
  97.112.78.113
  97.112.79.251
  97.112.80.108
  97.112.85.51
  97.112.86.90
-97.112.88.207
  97.112.91.169
  97.112.93.118
-97.112.93.157
-97.112.93.55
-97.112.93.83
  97.112.96.11
  97.112.96.128
  97.112.97.193
-97.112.97.250
-97.112.98.247
-97.112.98.98
  97.113.140.152
  97.113.224.20
-97.113.57.84
-97.113.7.37
  97.114.108.2
-97.114.114.22
-97.114.12.14
  97.114.158.76
-97.114.163.33
-97.114.172.236
  97.114.177.56
-97.114.185.89
-97.114.186.214
  97.114.19.123
-97.114.212.57
-97.114.215.96
  97.114.240.222
  97.114.247.64
  97.114.30.75
  97.114.39.172
  97.114.82.81
  97.115.145.50
-97.115.155.254
  97.115.50.123
-97.116.107.245
  97.116.186.232
  97.116.53.171
  97.116.53.3
  97.116.54.110
-97.116.63.22
  97.116.73.136
  97.116.78.58
-97.117.107.110
-97.117.132.140
-97.118.119.59
  97.118.153.121
-97.118.154.143
  97.118.163.1
-97.118.174.201
-97.118.176.217
-97.118.176.66
  97.118.239.236
  97.118.253.44
  97.118.45.182
@@ -100908,25 +100047,17 @@
  97.119.11.213
  97.119.132.167
  97.119.139.14
-97.119.154.32
-97.119.161.238
  97.119.174.12
-97.119.176.118
  97.119.186.214
-97.119.188.176
  97.119.208.231
  97.119.234.174
  97.119.240.251
-97.120.47.41
  97.121.139.68
  97.121.144.188
  97.121.173.132
-97.121.179.45
-97.122.222.24
  97.123.112.137
  97.123.116.7
  97.123.15.35
-97.123.164.240
  97.123.186.81
  97.123.32.124
  97.123.53.71
@@ -100935,21 +100066,12 @@
  97.124.114.40
  97.124.124.148
  97.124.217.47
-97.124.34.48
  97.124.50.98
-97.125.100.3
  97.125.156.152
  97.125.156.220
  97.125.157.41
-97.125.169.88
-97.125.179.22
-97.125.187.2
  97.125.189.231
-97.125.195.36
-97.125.228.110
  97.125.231.191
-97.125.81.71
-97.125.98.57
  97.126.91.4
  97.127.125.228
  97.127.129.214
@@ -100958,11 +100080,8 @@
  97.127.139.114
  97.127.141.43
  97.127.142.93
-97.127.145.151
  97.127.145.40
-97.127.152.51
  97.127.154.37
-97.127.162.206
  97.127.163.8
  97.127.17.64
  97.127.20.166
@@ -100981,6 +100100,7 @@
  97.66.248.3
  97.66.48.226
  97.66.79.173
+97.67.94.162
  97.69.160.154
  97.69.160.248
  97.69.166.228
@@ -100988,7 +100108,6 @@
  97.74.119.80
  97.74.134.60
  97.74.215.181
-97.74.228.115
  97.74.228.59
  97.74.232.157
  97.74.237.196
@@ -101002,23 +100121,24 @@
  97.77.231.90
  97.78.198.94
  97.79.239.42
-97.80.145.207
+97.80.173.53
  97.80.42.254
  97.81.244.191
  97.82.79.83
  97.83.173.243
  97.84.232.105
+97.84.247.52
  97.85.36.15
-97.86.239.30
  97.88.8.34
  97.90.49.141
-97.91.208.63
-97.92.0.182
+97.92.49.227
  97.93.150.128
  97.93.25.93
  97.93.59.56
+97.94.74.28
  97.95.55.249
  97.96.199.75
+97.97.179.172
  97.98.4.31
  97.99.205.241
  97.99.222.71
@@ -101042,6 +100162,7 @@
  98.102.222.30
  98.109.133.80
  98.109.159.216
+98.11.227.210
  98.110.192.92
  98.110.234.97
  98.111.230.166
@@ -101055,17 +100176,14 @@
  98.125.104.165
  98.125.110.244
  98.125.156.24
-98.125.185.130
  98.125.185.224
  98.125.186.145
  98.125.191.71
  98.125.193.62
  98.125.194.133
  98.125.207.60
-98.125.68.56
  98.125.80.113
  98.125.88.28
-98.125.90.31
  98.125.96.79
  98.126.10.242
  98.126.159.171
@@ -101097,9 +100215,11 @@
  98.126.215.93
  98.126.215.98
  98.126.23.24
+98.128.147.115
  98.128.152.150
  98.128.175.72
  98.128.212.156
+98.128.225.166
  98.129.77.98
  98.13.75.196
  98.130.2.58
@@ -101116,12 +100236,13 @@
  98.142.221.132
  98.143.148.45
  98.144.132.131
-98.145.176.89
  98.146.212.146
  98.149.253.118
  98.15.140.226
  98.151.250.238
  98.154.3.215
+98.154.87.18
+98.155.80.172
  98.156.108.211
  98.156.162.236
  98.157.226.168
@@ -101137,7 +100258,7 @@
  98.159.110.228
  98.159.110.231
  98.159.110.232
-98.159.85.251
+98.159.90.92
  98.159.99.102
  98.159.99.21
  98.159.99.212
@@ -101182,9 +100303,8 @@
  98.178.240.9
  98.178.72.4
  98.179.182.136
+98.180.217.149
  98.183.37.222
-98.184.33.203
-98.184.33.210
  98.184.33.215
  98.185.94.76
  98.185.94.94
@@ -101194,6 +100314,7 @@
  98.188.47.150
  98.189.109.138
  98.190.102.40
+98.190.102.49
  98.190.102.52
  98.190.102.62
  98.191.71.139
@@ -101208,10 +100329,12 @@
  98.199.196.197
  98.2.236.215
  98.200.189.189
+98.202.144.43
  98.202.232.200
  98.202.75.42
  98.203.162.230
  98.203.244.40
+98.206.110.75
  98.206.254.200
  98.210.81.157
  98.213.183.28
@@ -101225,7 +100348,6 @@
  98.227.86.240
  98.228.37.242
  98.23.125.149
-98.231.142.65
  98.231.32.93
  98.231.33.178
  98.233.39.111
@@ -101236,7 +100358,6 @@
  98.237.124.120
  98.239.128.154
  98.243.245.15
-98.246.66.238
  98.247.106.211
  98.247.52.166
  98.248.173.253
@@ -101244,6 +100365,7 @@
  98.251.9.73
  98.253.193.165
  98.253.34.137
+98.254.104.71
  98.254.237.116
  98.254.59.36
  98.26.226.238
@@ -101251,11 +100373,16 @@
  98.29.18.119
  98.32.83.73
  98.33.38.48
+98.34.81.140
  98.35.16.77
+98.35.76.230
  98.37.113.232
  98.37.169.82
  98.37.180.23
+98.38.164.169
+98.4.213.150
  98.4.24.177
+98.42.40.31
  98.42.43.106
  98.6.168.194
  98.8.246.84
@@ -101303,12 +100430,12 @@
  99.123.224.151
  99.124.216.71
  99.127.234.110
+99.129.217.156
  99.135.180.41
  99.14.51.66
  99.148.197.14
  99.152.118.172
  99.152.32.222
-99.160.58.11
  99.177.198.205
  99.184.69.177
  99.192.218.142
@@ -101323,7 +100450,6 @@
  99.194.13.212
  99.194.134.239
  99.194.134.46
-99.194.135.204
  99.194.138.253
  99.194.140.158
  99.194.145.117
@@ -101332,7 +100458,6 @@
  99.194.147.203
  99.194.156.96
  99.194.157.247
-99.194.192.245
  99.194.25.162
  99.194.3.167
  99.194.7.13
@@ -101341,21 +100466,14 @@
  99.195.116.179
  99.195.116.216
  99.195.117.250
-99.195.118.184
  99.195.121.63
  99.195.125.242
  99.195.132.125
  99.195.132.222
-99.195.132.71
-99.195.144.244
  99.195.146.156
-99.195.146.193
  99.195.149.128
-99.195.150.236
  99.195.151.12
-99.195.151.156
  99.195.44.252
-99.195.83.18
  99.195.86.41
  99.195.88.8
  99.195.95.191
@@ -101370,13 +100488,12 @@
  99.232.72.107
  99.233.162.27
  99.233.30.4
-99.235.242.8
  99.236.76.38
  99.237.64.18
  99.239.41.18
+99.244.138.6
  99.244.72.19
  99.25.248.162
-99.250.36.187
  99.251.231.95
  99.251.64.186
  99.252.189.19
@@ -101389,16 +100506,16 @@
  99.34.232.58
  99.38.11.186
  99.47.110.147
+99.51.187.63
  99.54.134.182
  99.56.114.255
  99.58.163.117
  99.59.120.66
-99.65.241.53
  99.65.75.153
  99.73.215.70
-99.76.182.139
  99.78.113.71
  99.78.113.72
+99.78.120.186
  99.79.40.250
  99.79.9.179
  99.88.47.34
@@ -101760,6 +100877,7 @@ a568.gazengel.com
  a56e39ccb480d26c6aa.info
  a584.hyperphp.com
  a58gh.jaysbrand.com
+a59eahe182s.typeform.com
  a59yg.onderhost.com
  a5d6.hyperphp.com
  a5f201cb-2489-40c2-849a-d843b004b723.htmlcomponentservice.com
@@ -101997,7 +101115,6 @@ aat.psdzy.com
  aatgroup-th.com
  aatgulbxelvxqfiq-dot-millinium.ey.r.appspot.com
  aatonlinemail.weebly.com
-aatreefelling.co.za
  aatsta-71.ga
  aatt-att.weebly.com
  aattattta.weebly.com
@@ -102353,6 +101470,7 @@ abosibarni.com
  abotarek98198.ddns.net
  aboudaboud1.hopto.org
  about-ads-microsoft-com.o365.frc.skyfencenet.com
+about-appeal-helpformcentre.cf
  about-business-facebook.com
  about-copyrightform.tk
  about-copyrightnotice.com
@@ -102362,7 +101480,6 @@ about-instagramverified.ml
  about-lnstagram.net
  about-lockedamazon.serveirc.com
  about-smokes.000webhostapp.com
-about-verifiedbadge.ml
  about.btreesystems.com
  about.facebook-page.business-id-145654234324234.com
  aboutacquisitions.com
@@ -102373,13 +101490,11 @@ aboutmapscidmeichpcn85320200901footer043.com
  aboutme.hassansolutions.com
  aboutmeza.000webhostapp.com
  aboutprice.co.za
-aboutrightamazon.shop
  abouts-copyrights-ig.com
  aboutssb.com
  abouttheaddress.newpaswordamazon.xyz
  abouttheinformation.newpaswordamazon.work
  abouttheupdate.newpaswordamazon.top
-abouttheupdate.onlinestoreamazoncard.top
  aboutworld.info
  aboveandbelow.com.au
  aboveapparel.buzz
@@ -103034,16 +102149,15 @@ accesso-you-web.com
  accesso0c2a97d7.panatec.it
  accessocliente.info
  accessoinstagramlogin.altervista.org
+accessolntesasp.com
  accessonliiine.com
  accessopds2.000webhostapp.com
  accessopostale.com
-accessopsd2-web.com
  accessorya.com
  accesspower.buzz
  accesspress.rdsarkar.com
  accesspyment-appid.serveirc.com
  accessretailpk.net
-accesssecurityproducts.co.uk
  accesssession.000webhostapp.com
  accesssupportcontactteam.com
  accessvascular.com
@@ -103316,6 +102430,7 @@ account-update-aws-co-jp.kiealine.com
  account-update-date-covid19.giize.com
  account-update-jp.club
  account-update-manage.com
+account-update-services-live.pgprln.bar
  account-update.278y0.cn
  account-update.account.7daf0619cbd37d6a81227e.info
  account-update.account.c48596f029eabb5a.info
@@ -103514,9 +102629,9 @@ account.manage-logged.support-linked.apple-verify.id.compactnew.service.balincvn
  account.microsoft.com.accountprotect.ml
  account.officeserver.at
  account.pagelimitation-summaryinfoandupdate.factwaewerj.com
-account.paxful.com.unissenseafrica.com
  account.post.ch.post-ch.net
  account.protonvpn.store
+account.rakuten.co.jp-weo9fhwe89rhw.com
  account.rakuten.co.jp.rakuten-account.monster
  account.rakuten.co.jp.rzvewazxc.monster
  account.rakuten.co.jp.rzvewazxc.xyz
@@ -103667,6 +102782,7 @@ accountrestrictservices.com
  accounts-alert.xyz
  accounts-and-services.co.uk
  accounts-appleld-apple.secures-page.jgshdg.com
+accounts-binance-log-in.com
  accounts-chasebank.com
  accounts-craigslist-idsupport184000893161.com
  accounts-craigslist-verifypostid91857122624.com
@@ -103680,6 +102796,7 @@ accounts-login-idm-telekomidm.cloud
  accounts-logmein.com
  accounts-mobile.com
  accounts-netflixnl.com
+accounts-newpayee.com
  accounts-online-center.com
  accounts-paxful.trade
  accounts-renewal.services
@@ -103943,11 +103060,13 @@ ace375b9ff0fd69ff0f.net
  ace75-my.sharepoint.com
  acebo0ok.000webhostapp.com
  acebook.cba.pl
+acebookaafosamfodsmaf.000webhostapp.com
  acecarelectrics.co.uk
  acecepu.000webhostapp.com
  aceconsultants.buzz
  acecourseprofessionals.com
  aceedu.in
+aceeprc.com.aceeprc.com
  aceess-app-i.tk
  aceessaraquii.com
  acega.com.sv
@@ -104172,6 +103291,7 @@ acpw.org.br
  acqffdgosnruhkcj-dot-millinium.ey.r.appspot.com
  acqnuxqbxiyksmqs-dot-millinium.ey.r.appspot.com
  acqua.solarcytec.com
+acquaprocess.eu
  acquapubblicasabina.it
  acquasantoniocom.nckifamily.gdn
  acquavivahotel.com
@@ -104253,6 +103373,7 @@ activacion-zonabetasegvra1bn.online
  activacionbancolombias.com
  activacionesabc-zonasegvuracovic-19bn.xyz
  activacionesdeproducto.com
+activacionesdeproductos.com
  activacionesgrupomultiredbn2-com.xyz
  activacionespersonas-bnzonasegvra39.xyz
  activacionessegurasclientes.com
@@ -104501,7 +103622,6 @@ adam5023698.xyz
  adam57-stewart-hsvony.admear.com
  adamamah.com
  adambarker.org
-adamcoinvestment.com
  adamdj.ct8.pl
  adamengdesigns.com
  adamitic-rollers.000webhostapp.com
@@ -104517,7 +103637,6 @@ adamp78.com
  adampaczka.com
  adampettycreative.com
  adamsm.co.za
-adamsmith56.com
  adamstheboutique.com
  adamtcarruthers.com
  adamvloeren.nl
@@ -104583,6 +103702,7 @@ addhun.ml
  addiamentali.org
  addicted-forum.dvrlists.com
  addictionexplained.icu
+addidasnike20202021.000webhostapp.com
  addingsecure.link
  addirector.cc
  addireengg.logicalat.com
@@ -104758,6 +103878,8 @@ admin-co-jo.xyz
  admin-connect.com
  admin-cres-edu-vn.000webhostapp.com
  admin-docs.app.link
+admin-foundation-1231564894848.tk
+admin-foundation-1231564894849.tk
  admin-information.nangovke.com
  admin-instant-verification.site44.com
  admin-office365c.myvnc.com
@@ -105251,9 +104373,11 @@ advanteclifesciences.com
  advantekwkr.ru
  advanzia-account.xyz
  advavoltiberica.com
+advbiruywgfiu7.gb.net
  adventhealthorl.com
  adventkjkt.or.id
  adventskacarolija.com
+adventureexplorer.in
  adventurehawks.com
  adventureitdate.com
  adventurejump.cl
@@ -105400,7 +104524,6 @@ aeqjjclqbukmcdsd-dot-millinium.ey.r.appspot.com
  aeqogedkxznbdkafoqrueig-id9005531907.com.zdbbhtf.cn
  aeqokcly.rogagot.com
  aeqsfbptjcseiviydtjgnroaiaoemtkljztj-dot-solar-vertex-285913.rj.r.appspot.com
-aequoguwkhivhfj2b4ixzo7kkq-adwhj77lcyoafdy-www-instagram-com.translate.goog
  aerationsplusla.com
  aercszosz.000webhostapp.com
  aerecruitment.ae
@@ -105638,6 +104761,7 @@ afrihotelsuites.com
  afrikor.co.za
  afriktechsolutions.com
  afrimarinecharter.com
+afrimedspecialist.com
  afriplugz.com
  afriqueindustries-sa.com
  afriquelemou.free.fr
@@ -105719,6 +104843,7 @@ agapetlc.com
  agapewilderness.com
  agarwalpackersaurangabad.com
  agarwalrishte.com
+agate-jolly-horse.glitch.me
  agazetadepiraquara.com.br
  agbanibeautycontest.000webhostapp.com
  agbmjqadhpvqxpwc-dot-millinium.ey.r.appspot.com
@@ -105752,6 +104877,7 @@ agenciablou.cl
  agenciaborges.com.br
  agenciabrasil.online
  agenciacriart.com.br
+agenciadigitalwdys.com
  agenciaeasybr.com.br
  agenciaetalk.com
  agenciaeureka.com.br
@@ -105847,6 +104973,7 @@ aggiornaisp.com
  aggiornamenti-intesasanpaolo.com
  aggiornamenti-utenze.com
  aggiornamentiweb.com
+aggiornamento-abilitazione-spid2021.it.jenswilms.com
  aggiornamento-abilitazione-spid2021i.goonbus.net
  aggiornamento-app-2020-lsp.info
  aggiornamento-app-intesa.com
@@ -105927,6 +105054,7 @@ agiye.com
  agkewqorzxmcbvznfqiroeid-97550011473jp.com.zxzlhtj.cn
  aglend.com.au
  aglfreight.com.my
+aglimmer-laundry.000webhostapp.com
  aglink.club
  aglnmfefkqebmobdqhjyshnjjrjayxhxyonc-dot-cedar-code-289917.nn.r.appspot.com
  aglzeyhwmr.cwp.com.pe
@@ -105973,6 +105101,7 @@ agrarimmo24.com
  agrarwirtschaftbiz.shaxiaprivacy.top
  agratama.xyz
  agrawalpackersmovers.com
+agreeablelividuserinterface.adasdfff.repl.co
  agreehillcheek.xyz
  agreement-id019.com
  agreement-id2020.com
@@ -106111,7 +105240,6 @@ ahappydesigner.com
  ahapropertisyariah.com
  ahavaukraine.com
  ahavietnam.com.vn
-ahayhamadiners7.blogspot.com
  ahb-sbuaubsnmw.com
  ahbfhlqams.duckdns.org
  ahbywwtbxccvkkba-dot-millinium.ey.r.appspot.com
@@ -106191,6 +105319,7 @@ ahpkjzhtovxmwshd-dot-millinium.ey.r.appspot.com
  ahplmlutmwhkygigycxkhihbnsuwyxohuxem-dot-cryptic-now-290917.ey.r.appspot.com
  ahpqotyiocwprsnx-dot-millinium.ey.r.appspot.com
  ahpuhibbeginseie-dot-millinium.ey.r.appspot.com
+ahr0chm6.wixsite.com
  ahrargil.com
  ahrdtxwlvujtturj-dot-millinium.ey.r.appspot.com
  ahs3.addroits.com
@@ -106242,7 +105371,6 @@ aib-scasettings.com
  aibaccountreview.live
  aibat.ru
  aibd.sn
-aibonlineverification.com
  aibreviewpayment.com
  aibverifypayment.com
  aica.co.jp
@@ -106353,7 +105481,6 @@ aionw.quickyad.com
  aios.dyndns.dk
  aiostory.com
  aipaaustin.com
-aipankart.com
  aipmgzyhemcvdauwnt.top
  aiqavxwhlaffdaxu-dot-millinium.ey.r.appspot.com
  aiqllgxcmmarwrdg-dot-millinium.ey.r.appspot.com
@@ -106426,6 +105553,7 @@ airbnb.long-term-rental-services.com
  airbnb.manage-property-4928107.com
  airbnb.nl.listing-rent-19428783-booking.live
  airbnb.request-listings.com
+airbnb.reservation-82701821.com
  airbnb.rooms-261514.com
  airbnb.rooms-booking-29872891-checkin-now-29r7f78.com
  airbnb.rooms-lettings.me
@@ -106454,7 +105582,6 @@ airbornegroup.in
  airbornmotorscom.batwoqisep.top
  airbornoutlet.com
  airbud.buzz
-airbudss.buzz
  airconditioner.buzz
  airconditionersrus.com
  airconditioning-waalwijk.nl
@@ -106468,7 +105595,6 @@ airdropsnew.com
  airdubaimusic.com
  airenherbals.com
  airfilters.buzz
-airflight.casa
  airfne.com
  airgunsofarizona.ru
  airierclownfish.htmlpasta.com
@@ -106606,6 +105732,7 @@ ajnjvqnmpsyljrrhwjueehxpco-dot-gleowayel400503.uc.r.appspot.com
  ajoingrip.000webhostapp.com
  ajoresfahan.ir
  ajpaulolandscaping.xyz
+ajpharmaholding.com
  ajpojournals.org
  ajqhanhtmhkyzcgw-dot-millinium.ey.r.appspot.com
  ajqmopylmmbxeghu-dot-millinium.ey.r.appspot.com
@@ -106752,7 +105879,6 @@ akob.org
  akonlinegift.com
  akoufkgynziyzklz-dot-millinium.ey.r.appspot.com
  akoxqdysegpgkddh-dot-millinium.ey.r.appspot.com
-akp-breitling.de
  akp7.svcoding.com
  akpamu.tk
  akpartiduyuruorgtr.com
@@ -106963,6 +106089,7 @@ alarmpiquillov.com
  alarmpistool.com
  alarmsystemsorlandoing.icu
  alasbah.com
+alasdemariposas.org
  alaseyou.xperience.monster
  alasisca.id
  alaskaaase.mypi.co
@@ -107059,7 +106186,6 @@ alcionenovios.com
  alcmanaus.com.br
  alcochemphil.com.ph
  alcody.site
-alcoholrescue.guru
  alcoholtisher.com
  alcoonteceu.com
  alcoptars.co.uk
@@ -107139,6 +106265,7 @@ alert-accountservice.kozow.com
  alert-activate-wf.com
  alert-amazoncenter.serveirc.com
  alert-amzn.serveirc.com
+alert-cancel-hali.com
  alert-center-wells.com
  alert-confrim00.gq
  alert-deregister.com
@@ -107457,6 +106584,7 @@ alharshagroup.com
  alhasanein.com
  alhaseebcorp.com
  alhashem.net
+alhazmico.com
  alhelli.com
  alheriarh.com
  alhjchstdyfonlinstgf.dns.army
@@ -107524,7 +106652,6 @@ alignmentconsulting.xyz
  aliibaba.cf
  aliiydr.xyz
  alika.com.br
-alike-hexagonal-character.glitch.me
  alilisaw.com
  alimdhg.com
  alimentacaosaudeebemestar.com.br
@@ -107533,7 +106660,6 @@ alimeri.com
  aliminksrl.ml
  alimstores.com
  alina.kenshung.com
-alina21.de
  alinaltdwkz.ru
  alinebandeira.com.br
  alinestudio.co.za
@@ -107634,7 +106760,6 @@ allamzteam.co.ug
  allan-it.com
  allanbaden.dk
  allaninteriors.ca
-allantoid-receipt.000webhostapp.com
  allartistbooking.com
  allattcurrentlymail.weebly.com
  allattnetdomain.weebly.com
@@ -107711,6 +106836,7 @@ allfreedating.ru
  allfundincrp.com
  allgates.uk
  allgrain-brewing.icu
+allgreenart.be
  allgroceries.in
  allgrupbokepersscrooot.v-25.com
  allhealthylifestyles.com
@@ -107930,6 +107056,7 @@ alondra-bravo.com
  alondragonz.com
  alondrax.com
  alone-cuff.000webhostapp.com
+aloneoriflame0.000webhostapp.com
  aloneskisehir.com
  alonsofag.com
  aloofbeetrootr.com
@@ -107987,6 +107114,7 @@ alphauniforms.ae
  alphauniverse-mea1.com
  alphaxiom.com
  alphazymhack.buzz
+alphqprotech.com
  alpinaemlak.com
  alpinecoffee.com.np
  alpinelead.info
@@ -108018,6 +107146,7 @@ alrazi-pharrna.com
  alrbnb-com.roomlistingsbe.link
  alrbnb.com.rooms.392070.live
  alrbnb.rooms-98235021.com
+alreaaiaa.com
  alreadqual.xyz
  alresalahct.com
  alrglocal.com
@@ -108073,7 +107202,6 @@ altaftailor.com.au
  altaikawater.com
  altaja.com.py
  altanyucetas.com
-altarcebicherorestaurantmuseo.com
  altarfx.com
  altaria.in
  altbiafm.com
@@ -108300,7 +107428,6 @@ amandambrandt.com
  amandaparker-profile.online
  amandascafe.com
  amandawang.co
-amandchove.com
  amandineballon.com
  amanecergaucho.com
  amaneri124.000webhostapp.com
@@ -108341,6 +107468,7 @@ amarguwahati.com
  amarholdings.co.ke
  amaritshop.com
  amarresdeamoryhechiceriadefe.com
+amarresdeamorymaestroshechiceros.com
  amarteargentina.com.ar
  amaryllidaceous.info
  amarzon-cards.com
@@ -108461,13 +107589,11 @@ amazloms.com
  amazmaonms.temp.swtest.ru
  amazmnan.buzz
  amazmnn.buzz
-amazn-cc.best
  amazn-co-jp.che88.top
  amazn-co-jp.queen1.top
  amazn-gift.xyz
  amazn-lockedaccountsecured.com
  amazn-secureaccountlockedverifed.com
-amazn-uu.best
  amazn.23wcp.com
  amazn.36wcp.com
  amazn.bosenjinju.com
@@ -108554,7 +107680,7 @@ amazon-accountupdate.uc.r.appspot.com
  amazon-activityacc.servebeer.com
  amazon-aktualisieren-covid-19.gleeze.com
  amazon-alliance.xyz
-amazon-amoe.buzz
+amazon-amae.cyou
  amazon-amoe.xyz
  amazon-app-shopvip996-dfsadfasdfaswertwtertetertdfgsdgsfg562.gq
  amazon-app-shopvip996-dfsadfasdfaswertwtertetertdfgsdgsfg562.ml
@@ -108565,7 +107691,6 @@ amazon-authenticationrequired.serveusers.com
  amazon-autoconfirm.updt.ipq.co
  amazon-b.top
  amazon-berrypopterbaik8945tuh8345-goblok.com
-amazon-bi.top
  amazon-billing-revision.kozow.com
  amazon-btc.com
  amazon-c0.jp2.4efa7aed6eaefc9b1ac18e.xyz
@@ -108750,6 +107875,7 @@ amazon-login-08.ga
  amazon-login-15.ga
  amazon-login-16.ga
  amazon-login.2292037.com
+amazon-login.bar
  amazon-login.co
  amazon-login.customerlogin-account.com
  amazon-loginx.com
@@ -110471,6 +109597,7 @@ amflafs.com
  amfpr.com
  amftmfltvmniqihfuftnrtguigsbfaufgppx-dot-solar-vertex-285913.rj.r.appspot.com
  amg-atlantic.com
+amgaccess.com
  amgadvertiser.com
  amgdsefgffghh.com
  amgedelsayed208.ddns.net
@@ -110610,6 +109737,7 @@ amorasbeauty.com
  amorashop.com.br
  amormisericordioso.cl
  amorous-acceleratio.000webhostapp.com
+amos524.org
  amosleh.com
  amotach-cn.com
  amowceuamazon.monster
@@ -110725,12 +109853,10 @@ amtiwqogzbndkqorueig-usid990057306uvjp.com.tlztppb.cn
  amtmosfcnsuzxbltfobmejeuth-dot-gleowayel400503.uc.r.appspot.com
  amtrantw.com
  amtravel.com.au
-amtvoy.buzz
  amtycgw.com
  amu.topkorder.su
  amueblado-155602226.casa
  amulet11.ru
-amundron.info
  amurehotel.mn
  amusedpersonals.com
  amushknm.beget.tech
@@ -110960,8 +110086,15 @@ anazom-cardae.com
  anazom-cardas.com
  anazom-web.rghhjkvbfdgiokjlbvnqretyutvbj.xyz
  anazom.67calderroad.com
+anazom.bewjvcqw.buzz
+anazom.bzxllbht.buzz
+anazom.djmzuxrbk.buzz
+anazom.frrxzqdn.buzz
+anazom.taeckpux.buzz
  anazom.website
  anazom.weightlosshotel.com
+anazom.zhwqmupe.buzz
+anazom.zjjbkshm.buzz
  anazon.cojp.xswcc.xyz
  anazon.urtjfdkgfzxcbgfhhjrtyoeortkdfggvhhj.xyz
  anazoncojpsing156asd156asd156gh1er56h1rt56156as165d3.onozoz.ru
@@ -111052,6 +110185,7 @@ andres.ug
  andres266554.xyz
  andrescrove.com
  andresdiaz.pymesonline.co
+andreshconcejal.solucioneslink.com
  andresirjan.ir
  andresjorge.com.mx
  andresmellado.com
@@ -111128,6 +110262,7 @@ anga9.drofortho.com
  angaldevils.ga
  angar.cc
  angcelolmes.com
+angebote-d15b5db6a5f2.com
  angebotsendegesendet.de
  angel-style.com.ua
  angel.ac.nz
@@ -111375,7 +110510,6 @@ annazom.buzz
  annazom.space
  annazon-chikes-co-jp.in-actiche.top
  annazon-loginto.jp.busoi.buzz
-annazon-vpsupportinto-co-jp.isoajm-cxakl.top
  annazon.club
  annazon.co.jp.praxgkm.cn
  annazon.co.uk
@@ -111503,6 +110637,7 @@ answer2unlock2020.com
  answercorncob.com
  answerjersey.com
  answerstest.ru
+answertounlock.com
  ansznhkmurxgygfzxu.top
  antacaranacom.chifanbackground.top
  antacesourcing.com
@@ -111519,6 +110654,7 @@ antecipeofertasparavoce.com
  antemundane-calcula.000webhostapp.com
  antena-uk.kz
  antena.cabanova.com
+antenadigital.antenascuritiba.net.br
  antenanavi.com
  anteniti.com
  antennaebuysellads.net
@@ -111587,6 +110723,7 @@ antipiracytudydetectorganisationfftugpb.ydns.eu
  antique-near.xyz
  antiquesarehistory.com
  antiquescollectablesandjuststuff.com
+antire.tk
  antis-peru.com
  antiscriptural-song.000webhostapp.com
  antiskill.flame.roskstar.aladdine.top
@@ -111658,7 +110795,6 @@ anwppkophrqsmnaf-dot-millinium.ey.r.appspot.com
  anxscnnkjkjqijcu-dot-millinium.ey.r.appspot.com
  any-connect.com
  anyadam.buzz
-anyagei.haojiahuozhenjieshemomeng.top
  anyang.06rl.com
  anybookreader.de
  anyes.com.cn
@@ -111684,6 +110820,7 @@ anz-viewpayment.com
  anz.ausecure1.com
  anz.com.au.mngt.info
  anz.com.au.recuser.info
+anz.com.au.shield-renewal.services
  anz.com.au.unusual.report
  anz.com.ucenter.direct
  anz.sms-security.live
@@ -111873,6 +111010,7 @@ ap1-acl.net
  ap1.amazon.com.update.app-accountactionmailaccsecc06.com
  ap5x9.addroits.com
  ap6-pr0mo-sua-otima-semana-cheias.com
+ap7zr1ce6xlwqzucomtuxnhrormvicnvhcnkymdix.filesusr.com
  ap8e41q56e132da.com
  apa-pentru-sanatate.ro
  apaaanajadehkepkbetdah.000webhostapp.com
@@ -111962,6 +111100,7 @@ apgneedles.com
  apgvunwjwtrmkqsvocazuhkmmuslnmudstll-dot-cryptic-now-290917.ey.r.appspot.com
  aphetitor.com
  aphl.lu
+aphomes.in
  aphoritt.com
  aphriapub.com
  aphrodisia.be
@@ -112005,6 +111144,7 @@ api3.lamanak.at
  apialertsecrit1yppl.com
  apibae.live
  apicos.8pa.co
+apidocs.i2chain.com
  apiex.bj
  apigoogle-accounts.biz
  apikey.officialappform.com
@@ -112194,7 +111334,6 @@ app-blokkade.info
  app-bull-bank.hastrips.com
  app-ca.com
  app-cadastro.duckdns.org
-app-cancellation-security.com
  app-centraldeatendimento.com
  app-cerb-gov.com
  app-certificata.com
@@ -112207,7 +111346,6 @@ app-desconto.com
  app-digitalparavoce.com
  app-dispositivo.com
  app-dispositivocliente.com
-app-ep-ignt21a-mwfspeakerweb-muapxk-tayvrv-msesc-westus.azurewebsites.net
  app-facebook-confirmation.4xnzpabyka-v1p3zwo8l3ye.p.runcloud.link
  app-fb2.blogspot.com
  app-feitopravc.com
@@ -112221,7 +111359,6 @@ app-gestaocaixaonline.com
  app-gestaodeatualizacao.com
  app-go.website
  app-halifax-mobileapp-verify.com
-app-host-list-75392.casa
  app-id-verification-online-account.haustierberatung.info
  app-idserviceaccountcloudactivator12392312.boldexperiencebyme.info
  app-intesa.com
@@ -112584,6 +111721,7 @@ appeal-1005625.com
  appeal-100928703989.com
  appeal-copyright.com
  appeal-form.limited-access.datacentre-pay-pal-trx10.com
+appeal-ig-support.com
  appeal-instagram.com
  appeal-page-id10943.info
  appeal-page-id23867.info
@@ -113196,6 +112334,7 @@ apple.id-accounts.support
  apple.id-inc-ios-slgn-in.us
  apple.id-iphoe.cn
  apple.id-suport.com
+apple.id-suportt.com
  apple.id.clientsinfo.tk
  apple.id.cloud.com.addictoffashion.com
  apple.id.iphons.cn
@@ -114041,7 +113180,6 @@ applicableto.professedamazon.cyou
  application-scure.vwekotyu.com
  application-update-form.com
  application.root.domain.server.subdomtrnsf.ml
-applicationbeer.guru
  applicationnow00bd50409.buzz
  applicationsupport.serveirc.com
  applicazionenuova.com
@@ -114763,6 +113901,7 @@ aramanfood.com
  aramcotools.ae
  aramcouk.ru
  aramex1.serveftp.com
+aramis-interim.com
  aramisconstruct.ro
  aramunca1980.blogspot.be
  arandahotel.ru
@@ -114797,6 +113936,7 @@ arc.nrru.ac.th
  arc1-aid.com
  arc1-ca.com
  arcadewarfare.com
+arcadistribuidorasc.com.br
  arcane.es3n.in
  arcaneknife.club
  arcaneknife.work
@@ -115201,6 +114341,8 @@ army73-1unny44.xyz
  arn4f.svcoding.com
  arnavinteriors.in
  arnazoinm-co-jojojo.buzz
+arnazon.oo.jp.arnazon.vsxdqam.xyz
+arnazon.oo.jp.arnazon.xfunkxn.xyz
  arnazong-co-jp.advance-check.buzz
  arneck-rescue.com
  arnoinox.com
@@ -115258,8 +114400,6 @@ arrantabiofileportal.ml
  array-bite843.ml
  arrayinfotec.com
  arrearirundalumcareer.in
-arredamenticarugati.com
-arredamenticarugati.it
  arredamentogiapponesecom.augerqisafety.top
  arriederal.info
  arrienting.info
@@ -115681,7 +114821,6 @@ asdeg.xyz
  asderd.xyz
  asdet.xyz
  asdf2g.xyz
-asdfasdfqweqwe.000webhostapp.com
  asdfasfasfd.cchos.network
  asdfawefwaerfawefpaypal.daterinisde.com
  asdfcxb44.duckdns.org
@@ -115726,6 +114865,8 @@ asdmonthly.com
  asdnbcv.ru
  asdoisk.vercel.app
  asdoo.ml
+asdqawe4qwr1qwarq.tk
+asdqwe4qwr1qwarq.tk
  asdsadasrdc.ug
  asdsadsasd.000webhostapp.com
  asdsagsdvfdvsdskjhjxcv.xyz
@@ -115961,6 +115102,7 @@ asmelhoresofertasdomesparavocecliente.club
  asmessagging1.com
  asmessagging1.me
  asmfvapkmeujearwvsaxubfzpauvzyllgubs-dot-cedar-code-289917.nn.r.appspot.com
+asmhvacnyc.com
  asmm.ro
  asmnutrition.ru
  asmonzs.000webhostapp.com
@@ -115991,7 +115133,6 @@ asolucaonetwork.com.br
  asomzon.webstarterz.com
  asoprocanor.com.co
  asoquefez.com.br
-asorigin.cyou
  asosorderlp.co.uk
  asou87yur-dot-p7q8y6t5.uc.r.appspot.com
  asov-trae.com
@@ -116124,6 +115265,7 @@ assistant-web.com
  assistantfamiliar.com
  assistantusamazon.serveirc.com
  assistentebb.online
+assistenza-app.info
  assistenza-conti.com
  assistenza-digitale-per-i-nuovi-criteri.org
  assistenza-gruppoisp.com
@@ -116516,6 +115658,7 @@ atinao.xyz
  atinglelove.htmlpasta.com
  atings.000webhostapp.com
  atiograks.com
+ation-recovery-identity.gq
  ationsopors.com
  atipt.ga
  atiqahlydia.web.id
@@ -116559,6 +115702,7 @@ atlantis-cpl.com
  atlantisblinds.co.uk
  atlantiscity1konutlari.com
  atlas-powerd.top
+atlasconcreteworks.com
  atlasdecarqo.com
  atlaselada.ro
  atlasfm.com
@@ -116810,6 +115954,7 @@ attatdomainbetsutemail.weebly.com
  attatt.godaddysites.com
  attatyourservice.weebly.com
  attawedo.weebly.com
+attbbv.weebly.com
  attbbvgcv.weebly.com
  attbeaveemail.weebly.com
  attbel.weebly.com
@@ -116910,6 +116055,7 @@ attemptedlogin-online.live
  attemptedlogin.com
  attemptedpaymentcheck.com
  attend-issue-lkcqzxgtub.casph.com
+attendanceand.com
  attendanceenginneringcollage.000webhostapp.com
  attention-account-recovery-supprt-amazon.info
  attention-risk-warning-account-support-id-rakuten.info
@@ -117378,6 +116524,7 @@ attsupportupgradenow.weebly.com
  attsurpport.weebly.com
  attsurv.000webhostapp.com
  attsystemlink.weebly.com
+attt-online.weebly.com
  attt.cemi.mx
  attt2login.weebly.com
  atttaccctounntsssc.weebly.com
@@ -117715,7 +116862,6 @@ au.support-apple.com-tel.aws-ipd.info
  au.webmailmailchkl.bar
  au233st.urbanizacionlagosazules.com
  au25-bom-demais-e-top.com
-au2maq.com
  auakyrrypcqbncis-dot-millinium.ey.r.appspot.com
  auas.es
  auavekrhuclidwjq-dot-millinium.ey.r.appspot.com
@@ -117724,7 +116870,6 @@ aubagovamsmqcptx-dot-millinium.ey.r.appspot.com
  aubamgouthoure.com
  aublibi.com
  aubootlegger.com
-aubreyyasmeen.ru
  auburbangkok.info
  auburnga.buzz
  auburnme.xyz
@@ -117753,6 +116898,7 @@ audigreece093.000webhostapp.com
  audio-msg1.3utilities.com
  audiocart.co.za
  audioimpacto.com.br
+audiomailrecordsbig1.z13.web.core.windows.net
  audiomaster.cc
  audioquilicura.cl
  audiorecord.live
@@ -118015,7 +117161,6 @@ auth-serviceapps.servehttp.com
  auth-servicemanage.appl.manage-appservice.com
  auth-services-adobe-comviewdocument.000webhostapp.com
  auth-servicewebscama.com
-auth-servivar.3utilities.com
  auth-signin-limited-account-paypalcom.giize.com
  auth-site.site
  auth-stap.info
@@ -118118,6 +117263,7 @@ authenticate-login-advanced-security.com
  authenticate-login-pp-details.com
  authenticate-mypayee-securely.com
  authenticate-new-payee.com
+authenticate-newlyadded-payee.com
  authenticate-online.com
  authenticate-onlinepayee.com
  authenticate-onlinepayment.com
@@ -118146,7 +117292,9 @@ authenticationmode.libertyuniversity.officedeskportal.xyz
  authenticenjoyer.com
  authenticingspurse.co
  authentif-am-zon.cloudaccess.host
+authentifdirectsms.com
  authentification-dsp2-sms.cloudaccess.host
+authentifsmsconfirme.com
  authentverificationauth-incoming-paypal-payment-mbxgbmd20bm.cf
  authentverificationauthupdate-paypal-rckeaeeq06.tk
  authentverificationauthupdate-paypal-rckeaeeq14.tk
@@ -118324,7 +117472,6 @@ autoconfirmsstatement.scrubmu.com
  autoconsignmentandsale.com
  autocraftmedia.com
  autocroot18.000webhostapp.com
-autodaro.com
  autodemontagenijmegen.nl
  autodepannage.ch
  autodesk-com-dot-gl494903049.wl.r.appspot.com
@@ -118574,6 +117721,7 @@ avdeeff.ca
  avdeevweb.had.su
  avdigitalconsulting.com
  avdimio.com
+avdivorcelawyers.com
  avdsamgspkjkyknr-dot-millinium.ey.r.appspot.com
  avecle-mailorange.webador.com
  avega-center.ru
@@ -118586,6 +117734,7 @@ avenaceous.com
  avendtla.com
  avengeritlabs.com
  avenidasuitesbrazil.com
+avenierrpharma.com
  avenir-crypto.com
  aventuracomeca.com
  avenueomar.net
@@ -119024,6 +118173,7 @@ axwmb.jaysbrand.com
  axwspiqipolsprjc-dot-millinium.ey.r.appspot.com
  axwzjjadpsdutacc-dot-millinium.ey.r.appspot.com
  axxaa.xyz
+axxcgzxcfe.fit
  axxentis.com
  axxqauuyteblwlgo-dot-millinium.ey.r.appspot.com
  axxwvstitvkddprf-dot-millinium.ey.r.appspot.com
@@ -119594,7 +118744,6 @@ ba7dwd7nbjpmmj-af06kfs2l.vercel.app
  baabaeyrkxedrhyswer4uywesruywe4rtwsedfg.2waky.com
  baabktntrzwlwnwt-dot-millinium.ey.r.appspot.com
  baabohqnqrbgboud-dot-millinium.ey.r.appspot.com
-baadmanoqtaasafisalinaakhay.blogspot.com
  baahiye.so
  baaincaneet-baaniameex-com-mx.on121120.xyz
  baakcafe.com
@@ -120115,6 +119264,7 @@ bamboomogleyt.com
  bambudeposu.com
  bamcupsupport.sytes.net
  bamdasdevelopment.com
+bamendauniversity.com
  bamgnbsapnggvglf-dot-millinium.ey.r.appspot.com
  bamidou.000webhostapp.com
  bamiha.azurewebsites.net
@@ -120176,7 +119326,6 @@ bancap0rlnternetlnterbank.com
  bancapersonas-bancoestado.cl.onetoone.cl
  bancapersonas-bancoestado.com
  bancapersonas.bancoestado.cl.arzala.com
-bancapor1nternet-net1nterbankpe1.com
  bancaporinte.bbv.a.pe-podemostodos.com
  bancaporinter.bbvpe.podemos-juntos.com
  bancaporinternet-bbva-continental-pe.club
@@ -120187,6 +119336,7 @@ bancaporinternet-interbankpe.expeditor.cl
  bancaporinternet-interbankperu1.com
  bancaporinternet-pe.sdreaofcanada.ca
  bancaporinternet-peruinterbank.com
+bancaporinternet.bbva.pe.lawkhouli.com.sa
  bancaporinternet.pe.brgaymap.com
  bancaporinternet.pe.pixilco.com
  bancaporinternetinterban.com
@@ -120440,6 +119590,7 @@ bandarwinsbobet.com
  bandbcreuse.com
  bandbsa.be
  bandep.ru
+banderu.us
  bandirmamegatemizlik.com
  bandit.godsshopp.com
  banditbars.com
@@ -120687,10 +119838,12 @@ bankomgeving.info
  bankowo.biz
  bankpas-recycleprocedure.eu
  bankpas.net
+bankpayee-unauthorise.com
  bankpayments.eagletradefx.com
  bankruptingscytools.co
  banks-capitals.com
  banks-chase.com
+banksblue.com
  banksinstruments.online
  banksonliine.com
  bankspower.ga
@@ -120791,6 +119944,7 @@ baorstery.com
  baotaiyulecheng.tavmo.com
  baotintuc60.info
  baotramlands.com
+baotuoiteen.net
  baotzvt.newhotstore.su
  baovechinhphap.com
  baoxian2.com
@@ -120955,6 +120109,7 @@ barrenproductivevideogames.figueroaads123.repl.co
  barriobistro.com
  barristerstevemoore.com
  barrmatchs.com
+barroserocha.adv.br
  barrserivc.barrel-of-knowledge.info
  barruz3dstudent.com
  barry-koch.com
@@ -121104,7 +120259,6 @@ batshonrealestate.com
  batta.co.in
  battered-exceptions.000webhostapp.com
  batteredbalancing.com
-batternaewconditioskj.us
  batteryingstechnologies.icu
  battle-pass2020.top
  battlebornk9.com
@@ -121402,6 +120556,7 @@ bc-unlock.com
  bc.atualizarcliente.app
  bc0y2.svcoding.com
  bc1qlcc26rtevfrkna8zpd5lyvwrahtvr.com
+bc2att.info
  bc3d.awaykart.com
  bc4s.svcoding.com
  bc8f85ac13b13573b984c209a181c8bcfb568a73.ph
@@ -121470,6 +120625,7 @@ bclqzezdanjjzbgu-dot-millinium.ey.r.appspot.com
  bclxrwdugnccegce-dot-millinium.ey.r.appspot.com
  bclzqscimmjoryfm-dot-millinium.ey.r.appspot.com
  bcmbconsulting.com
+bcmt.elin.co.za
  bcnpy.awaykart.com
  bcnsisnd.net
  bcnsistemas.pt
@@ -121859,7 +121015,6 @@ be7ieve.org
  be899.com
  bea12tmoond.com
  beaaba.com
-beachalive.cyou
  beachbitchapparel.com
  beacheventoplocatie.nl
  beachview.co.za
@@ -121932,6 +121087,7 @@ beautifulnaturalskincare.com
  beautifulnessshine.com
  beautifulrome.it
  beautiinthecity.com
+beautincollagen.rs
  beautiness.000webhostapp.com
  beautiversity.com
  beauttiosalon-us.com
@@ -122136,6 +121292,7 @@ beibei.xx007.cc
  beibfqywug.duckdns.org
  beicapellipdx.com
  beiercrescentapt.buzz
+beigebiodegradablebackend.josealbertoal21.repl.co
  beihai.06wi.com
  beiifightcovid.com
  beijingdelay.com
@@ -122190,6 +121347,7 @@ belhao.com
  beli2020.000webhostapp.com
  belickyo.com
  belielat.co.uk
+believable16442130.blob.core.windows.net
  believedinyourself.tk
  believemytravels.com
  belieyz-custumerprimeamzmembersh.com
@@ -122268,7 +121426,6 @@ bellstore.000webhostapp.com
  bellvada.co.id
  bellwireles.site
  bellychef.com
-bellygrow.us
  belmarselfstorage.com
  belmontrade.sk
  belnagroup.com
@@ -122617,6 +121774,7 @@ bestbuyperfumes.com
  bestcamerawebfactory.xyz
  bestcaraccessorieswebjpstore.club
  bestcardiologistnashik.in
+bestcarenepal.com
  bestcartdeal.com
  bestcclm.com
  bestcdnforbusiness.com
@@ -122972,7 +122130,6 @@ betprognoz.pro
  betqiuqiu.com
  betralif.saa.is
  betravelst.com
-betraychild.cyou
  betrpeyswllxqxeu-dot-millinium.ey.r.appspot.com
  betrsiondeflector.com
  betrust-eg.com
@@ -123023,10 +122180,12 @@ beurrtwvbjddvqcmshfinzlxul-dot-gleowayel400503.uc.r.appspot.com
  beutify.com
  beutifydesktop.com
  bev294863.xyz
+beveiligd-omgeving-regio.xyz
  beveiligd-updatepaneel.xyz
  beveiligde-portaal-hjk.xyz
  beveiliging-mijncards.noez.me
  bevelboardsurfboards.com
+beveragesmiami.solucioneslink.com
  beverlecs.co.uk
  beverlyhillspoloclub.co.id
  bevestig.toestelip-verificatie.xyz
@@ -123394,6 +122553,7 @@ bichumacie.temp.swtest.ru
  biciab-bf-us.000webhostapp.com
  biciab-grps-bf.000webhostapp.com
  bicicentroslezama.com
+bicideal.com
  bicimas.co
  bicscfyxtvllpxgd-dot-millinium.ey.r.appspot.com
  bicycles.ebay.itm50283658.cycling.sporting-goods.llc50283658.com
@@ -123528,6 +122688,7 @@ bigspacelion.weebly.com
  bigtasty.xyz
  bigtext.club
  bigtreestudios.org
+bigtvscreen.com
  biguacademyvtcom.chifanassume.top
  biguptheyounggs.000webhostapp.com
  bigvantour.cl
@@ -123555,11 +122716,9 @@ bike-nomad.com
  bikeath1337.com
  bikefabricate.com
  bikemyday.se
-bikeon33.com
  bikergirls.za.net
  bikerouteshop.com
  bikerzonebd.com
-bikes-marketplace-item.billabonghighrewa.com
  bikesectorcom.nckiengineering.gdn
  bikeshshrestha.com.np
  bikesterilizasyon.com
@@ -123680,6 +122839,7 @@ billing-update.info
  billing-update.services
  billing-update3264873.xyz
  billing-updateamzon.serveirc.com
+billing-updated.com
  billing-updates-three.com
  billing-updates-uk.net
  billing-usermy3.com
@@ -123694,6 +122854,7 @@ billing.netflix.user.solution.id2.client-redirection.com
  billing.o2-secure.com
  billing.paypal-activity.net
  billing.premiumnetflixcancelmembership.com
+billing.rahitechnosoft.com
  billing.secure-verify-account.cc
  billing.threeuk.info
  billing.up-three.co.uk
@@ -123859,6 +123020,7 @@ bink0id.sytes.net
  binnatto.de
  binns.netlify.app
  binoa.com
+binoy.stalphonsamissionva.org
  binsdrtjt.com
  binsyukle.com
  binsyukle.net
@@ -123905,7 +123067,6 @@ biomedicalwasteautoclave.com
  biomedmat.org
  bionafungusinuakerk.us
  bionet.nsc.ru
-bioneukerfunsguss.us
  bionicbodytraining.com
  bionuben.es
  biooiuyouy.com
@@ -123943,6 +123104,7 @@ birchadvisory.info
  birchdalefireandsecurity.com
  birchmeadowsafc.com
  birchwoodscriptitation.com
+birdi.elin.co.za
  birdiiz.com
  birdlandonetoone.com
  birdmarkets.xyz
@@ -124329,6 +123491,7 @@ bkprqerxqbldzonslyktrhpgahecqfoaapbv-dot-cryptic-now-290917.ey.r.appspot.com
  bkps11.duckdns.org
  bkpsange63.zzux.com
  bkpsugionovsmiakhalifa.m-whatsapp.ml
+bkptante-viral1.mrbonus.com
  bkpviralsex18tbruh0tsgt7.2waky.com
  bkpwhtaspp.whatsappyub.tk
  bkpwhyaaa.hoaztbokep.ga
@@ -124462,7 +123625,6 @@ blanketessay.com
  blanky.neagoeandrei.com
  blanquar.com
  blantsrojo.com
-blasoi33.com
  blasterimmerjumbo.com
  blastforcleaningservices.com
  blastingdental.com
@@ -124587,6 +123749,7 @@ blocco.intesa-servizio.info
  block-lloyds.co.uk
  block-payee-halifax.com
  block72-paypal.com
+blockchain-contactinfo.com
  blockchain-cryptocurrency-wallet.000webhostapp.com
  blockchain-etoro.com
  blockchain.arabglobalinvestment.com
@@ -124655,6 +123818,7 @@ blog.cotiabank.paypal-login.us
  blog.cspconsultoria.com.br
  blog.dabbleofdevops.com
  blog.daneshjooyi.com
+blog.daraisolty.com
  blog.dengjieyuan.com
  blog.desenfila.com
  blog.dmitrich.pro
@@ -124912,7 +124076,6 @@ bluemarble.cloud
  bluemontva.xyz
  bluemoonholidaysbd.com
  bluemooselounge.com
-bluemotos.com
  bluemttours.com
  bluemushroom.com.au
  bluenewsletter.ml
@@ -124924,6 +124087,7 @@ bluepalm.tech
  bluepentool.com
  bluepulse.co.za
  bluerespectde.nckila.gdn
+blueribbons.org
  blueriiver-eu.com
  bluescreamffim.000webhostapp.com
  bluescreening.com
@@ -124946,6 +124110,7 @@ bluesuici.de
  bluesuntourism.com
  bluesynergy.me
  blueteak.0fees.us
+blueteaks.ml
  blueteaksupportin-ig.com
  bluetechprism.com
  bluetextiles.in
@@ -125081,7 +124246,6 @@ bnanuncios.com
  bnarvklq.firebaseapp.com
  bnatsharm22.000webhostapp.com
  bnatten.temp.swtest.ru
-bnauaqo.buzz
  bnbhrgae.com
  bnbhrsfa.com
  bnbhzio.vteexcx.com
@@ -125332,8 +124496,6 @@ bockamp.com
  boclog.com
  boconceptla.com
  bocongan113vn.com
-bocoranangkatogeljitu-joingroup.000webhostapp.com
-bocoranangkatogenomaharl-joingroup.000webhostapp.com
  bocsberry.ru
  bodabom.com
  bodapsutfowdymau-dot-millinium.ey.r.appspot.com
@@ -125374,7 +124536,6 @@ boec.ubksg.ru
  boegdfvoaypwoanfoexftojigr-dot-gleowayel400503.uc.r.appspot.com
  boeijendmanagement.nl
  boeschboddenspies.com
-boesejennifer.de
  boetadippenaar.com
  boevqvrjjcbuljuumxcz.ru
  bofa-07i.com
@@ -125536,6 +124697,7 @@ bokep-xnxx7.jkub.com
  bokep-xxx.qpoe.com
  bokep.freedm7.com
  bokep.groups.areblog.my.id
+bokep.groupwhatsapp-wahyukadeo.cf
  bokep.grup.frezas.my.id
  bokep.jav2.org
  bokep.smamontok.getze99.gq
@@ -125553,7 +124715,6 @@ bokep2020xnxxgratis.itsaol.com
  bokep2020xnxxgratis2.port25.biz
  bokep27.duckdns.org
  bokep692020.000webhostapp.com
-bokep99864.000webhostapp.com
  bokepabg2020vidiobokep.000webhostapp.com
  bokepabgsmpsma.000webhostapp.com
  bokepajaa.gets5.com
@@ -125680,7 +124841,6 @@ bokuraga-yell.com
  bola788.com
  bolandi.ml
  bolanenkee.com
-bolavictimesport.000webhostapp.com
  bolbol.xyz
  bolboretaintimo.com
  bolckowmo.xyz
@@ -126371,6 +125531,7 @@ bqxyc.com
  bqzgqdkjsfschupjst.top
  br-abayat.com
  br-brazil-netonline.com
+br-facebook.co
  br-inc.ltd
  br-instagram.com
  br.com.ru
@@ -126678,7 +125839,6 @@ brassy-bolder-nectarine.glitch.me
  bratecbrt.com
  bratserahotel.com
  bravatindia.com
-brave-almondine-fall.glitch.me
  brave-golick-080358.netlify.app
  brave-haibt-a1f1ea.netlify.app
  brave-lalande-027fa7.netlify.app
@@ -126770,6 +125930,7 @@ brelaxmassage.com
  bremen.com.ve
  bremessi.com.br
  bremonx.com
+brenda341.xyz
  brenda3721378.xyz
  brenda64534.xyz
  brendaladd.com
@@ -127098,6 +126259,7 @@ brouq-sa.com
  brovivor.com
  brow-manage-prevent.tftpd.net
  brow-xenna.com.ua
+browardinsurancemiami.solucioneslink.com
  brown-about-town.com
  brown-seeds.com
  brownbums.com
@@ -127333,6 +126495,7 @@ bt.43t.shipmao3.xyz
  bt.business.iurycosta.com
  bt.mobilebilling01.com
  bt.mobilebilling20.com
+bt2.elin.co.za
  bt24.yanenergo.online
  bt34568.weebly.com
  bt3v.blob.core.windows.net
@@ -127441,6 +126604,7 @@ btqgamqatozmlmuw-dot-millinium.ey.r.appspot.com
  btqhyi.serviceorder.su
  btqijzrdpvlhzans-dot-millinium.ey.r.appspot.com
  btqzr.jaysbrand.com
+btresport.in
  btronufrzlrvrqndqugsmcpmtxilyhommtgt-dot-offgl8876899977678.uk.r.appspot.com
  btrsecurity.co.uk
  btsa.co.id
@@ -127532,6 +126696,7 @@ budi01.whatsaap.com.getsviip7.com
  budi01.whatsapp-youtube-indo.gq
  budi01fanspage226.000webhostapp.com
  budi01gaming.sytes.net
+budi01gaming.whastapp-grup2264.ml
  budi01gaminggrupwa.ftp1.biz
  budi01grubwa.000webhostapp.com
  budi01uwoe.zxix7.com
@@ -127566,7 +126731,6 @@ buekxzjfzudlvstzshutgfdbxscjrjshjxrx-dot-solar-vertex-285913.rj.r.appspot.com
  buenavecindad.com
  bueno.adv.br
  buesink.com
-buevent.com
  buf-peru.xyz
  buffalomerchants.com
  buffalopot.org
@@ -127586,6 +126750,7 @@ bugbyte.fi
  bugetareparticipativa.primariaarad.ro
  bugeventdmml.item1.shop
  buggerdione.com
+buggrnaclaim2-evn.64-b.it
  buggy-store.com
  buggycarwash.com
  bugil-tante-malam.000webhostapp.com
@@ -127678,6 +126843,7 @@ bulkfriendsinvite.com
  bulki.by
  bulkistan.com
  bulknmnpowder.com
+bulksms.xava.co.in
  bulkwebtraffic.io
  bulkydeafeningprofessional--five-nine.repl.co
  bullaoptine.kissr.com
@@ -127833,6 +126999,7 @@ buscar-dispositivo-ios.com
  buscar.iphone-app.info
  buscar.iphone-maps.info
  buscas.search-out.xyz
+buscascolegios.diit.cl
  busccampamentos.com
  buschfarbende.nckidoctor.gdn
  buseacycle.com
@@ -127856,6 +127023,7 @@ business-command.com
  business-confirm.com
  business-copyright-instagram.com
  business-copyright-instagram.ga
+business-copyrighthelp.com
  business-facebook-covid19.com
  business-inn.app.link
  business-instagrams.com
@@ -127985,6 +127153,7 @@ busywithwork.com
  busznqinzrkpudbm-dot-millinium.ey.r.appspot.com
  but-malte.web.app
  but63ers.tk
+butaaccessory.com
  butchers-71.tk
  butellgbcminsohj-dot-millinium.ey.r.appspot.com
  buthagnere.com
@@ -128163,6 +127332,7 @@ bwaez.xyz
  bwbnhhjtoawzshsktaktfcndok-dot-gleowayel400503.uc.r.appspot.com
  bwbskmpvlsmbeovw-dot-millinium.ey.r.appspot.com
  bwdandc.com
+bwdoutyovftlqqxdaqevbzexfr-dot-gleow2021ja.ue.r.appspot.com
  bwe8.byethost12.com
  bweam.app.link
  bweaqvmxakxugfcq-dot-millinium.ey.r.appspot.com
@@ -128391,7 +127561,6 @@ bzxuhrnvtjrwmbks-dot-millinium.ey.r.appspot.com
  bzyevrowrmfdvayt-dot-millinium.ey.r.appspot.com
  bzzgcwnfioxwzqgw-dot-millinium.ey.r.appspot.com
  bzztcommunicatie.nl
-c-1.top
  c-41.lawapass.com
  c-8nf.svcoding.com
  c-a.co.in
@@ -128725,6 +127894,7 @@ cadastro.homeaplicativo.ga
  cadastro.nusalvandosuafatura.digital
  cadastro.salvesuafatura.com
  cadastroagoraita.000webhostapp.com
+cadastrosita.com
  cadcamcae.bg
  cade-ica.com.ar
  cadeaux.hopto.org
@@ -128984,6 +128154,7 @@ calmingvapors.com
  calmwm.com
  calnfo.com
  calnot.cf
+calnot.ml
  calnus.com
  calongerentacar.com
  caloocanrob.com
@@ -129259,7 +128430,6 @@ cancelnewdevice.cc
  cancelnewpayeelogin.net
  canceloperation.com
  cancelorders.data-paymentmobile.com
-cancelpayee-verifications1.com
  cancelpayee.device-ath.com
  cancelpayeelogin.net
  cancelpayeeonline.com
@@ -129275,6 +128445,7 @@ cancelstore-viewpay-itemid0084727100.cf
  cancelsuspension.duckdns.org
  cancelunauthorisedpayee.com
  cancencludgent.xyz
+cancer.educandome.co
  canceraidsociety.org
  cancerfinances.org
  cancerford.duckdns.org
@@ -129574,7 +128745,6 @@ carbonazin.com
  carbonlooptechnologies.com
  carbonmosaic.it
  carbonquotes.com
-carboschservice.ru
  carbotech-tr.com
  carbuyernewyork.top
  carcassband.top
@@ -129778,6 +128948,7 @@ carrefour.minhacontadigital.xyz
  carrefour.nobritech.com.br
  carrefourcovid.com
  carrefourdescontosclube.com
+carrefoure.design
  carrefourliquida.site
  carrefourliquidaestoque.com
  carrefourlojaonline.com
@@ -130219,6 +129390,7 @@ castaneapa.buzz
  castel.saint-henri.be
  castell-distillery.com
  castelli.gr
+castellodicornelianobertario.it
  castelodeideias.pt
  castelooleos.com.br
  castennisacademy.be
@@ -130234,6 +129406,7 @@ castingsolled.com
  castle-wisecrack.com
  castleaccreinsurance.com
  castleacreeinsurance.com
+castlecast.us-south.cf.appdomain.cloud
  castled-allocation.000webhostapp.com
  castled-dynamometer.000webhostapp.com
  castlefc.com
@@ -130321,6 +129494,7 @@ catswiz.com
  cattelenitalia.icu
  cattleyadessert.online
  cattskiespina.com
+catuexpress.com
  catuto.cl
  cauchosandinos.com
  cauchuyennhanvan3.tk
@@ -130338,6 +129512,7 @@ causeweight-loss.world
  caution-www.arcseam.com.au
  cautionppal.xyz
  cauumdy.gq
+cavalcantiparticipacoes.com.br
  cavalluindistella.com
  cavalrzyguard.com
  cavancameroon.com
@@ -130599,7 +129774,6 @@ cctv.per.sg
  cctvalberton.co.za
  cctvdelnorte.com.mx
  ccu1-nl.nl
-ccuerstei.com
  ccurently1.weebly.com
  ccurenttly2.weebly.com
  ccurrently2.weebly.com
@@ -130799,6 +129973,7 @@ cdncachefiles.top
  cdndoubleclick.net
  cdnhot-whatsapp.69.ocry.com
  cdnimg.act31.com
+cdnlogin-netfliilxvhost150645.lowhost.ru
  cdnmage.com
  cdnmc.itsthirteendegrees.com
  cdnml-31eb6.firebaseapp.com
@@ -130830,9 +130005,11 @@ cdt-cli-24-com.umbler.net
  cdtilpgpzwvuimhi-dot-millinium.ey.r.appspot.com
  cdtuxeekfxpbwanr-dot-millinium.ey.r.appspot.com
  cdtyyegkjadowasn-dot-millinium.ey.r.appspot.com
+cdu-wsb.de
  cduggan.ddns.net
  cduwvyoqtnpezxsk-dot-millinium.ey.r.appspot.com
  cdwb-amazonservis5k.servebeer.com
+cdwdubai.com
  cdwfhezllc.temp.swtest.ru
  cdx4637854.mike-ehrmantraut.wikaba.com
  cdxjvyrxjkrntnzousenwtkfij-dot-gloff849483.uk.r.appspot.com
@@ -130878,6 +130055,7 @@ cebucoolstuff.com
  cebumeditec.com
  cebuphonly.jrzoutsourcingservices.com
  cebuplumber.com
+cec.asso.ac-amiens.fr
  cec2aeb59ce74a933b249b838d5b182264cb6c83.ph
  cecafieirl.com
  cecal-guess.000webhostapp.com
@@ -131084,6 +130262,7 @@ centericmailinwebs.wapka.website
  centerid-seclogin.servebeer.com
  centerlineband.biz
  centerlog-idcheck89320942.ru
+centermediacontact.com
  centermeinkontode.aba.vg
  centerofbiopolitics.com
  centeroflifechurch.com
@@ -131115,6 +130294,7 @@ centralaviationsolutions.com
  centralbilling.phototours.com
  centralchocados.cl
  centralcitybank.bizfinaciers.com
+centralcitybankonline.com
  centralcooperativa.com
  centralderendaextra.com.br
  centralebankeurope.com
@@ -131239,6 +130419,7 @@ ceroma.pl
  cersadarefga.tk
  cerserafe.tk
  cerserafera.tk
+cerstts.ga
  cert-center.ir
  cert-chase.com.a8f5f167f44f4964e6c998dee827110c.com
  cert-upgrservtrust.com
@@ -131250,6 +130431,7 @@ certifica-accesso-app.com
  certifica-app.info
  certifica-dati-personali-app.com
  certificacionperu.com
+certificacionreaseguros.org
  certificad0sonlinemaglz.com
  certificadobccr.com
  certificadodigitalcrgo.com
@@ -131268,7 +130450,6 @@ certifiedkn95.club
  certifiedmembership.top
  certifiedprolnstabluecheck.000webhostapp.com
  certifiquesupagod.com
-certify-payeealerts.com
  certifymyproperty.com
  certinaj.000webhostapp.com
  certipluseagnece.com
@@ -131335,6 +130516,7 @@ ceyssteam.bos.ru
  ceyzhofgnmctswhubdytfzwuvq-dot-gleowayel400503.uc.r.appspot.com
  cez.creatorlink.net
  cezaevinegonder.com
+cezcg3ieng6.com
  cezf.dogestocks.com
  ceziiakjndzexcty-dot-millinium.ey.r.appspot.com
  ceznziwkvidbesbd-dot-millinium.ey.r.appspot.com
@@ -131424,6 +130606,7 @@ cg29lhgyrqen08.com.de
  cg4-b.svcoding.com
  cg50dwpni8.firebaseapp.com
  cg52789.tmweb.ru
+cg69162.tmweb.ru
  cg76786.tmweb.ru
  cg9wb3zlci5yawdodc10b3.z06a.gq
  cgadministracion.com
@@ -131448,13 +130631,6 @@ cghmedia.com
  cghomrfrynpbjtegytsgrpkgrlimwijxzcqi-dot-cryptic-now-290917.ey.r.appspot.com
  cghxwcnwckjibqnr-dot-millinium.ey.r.appspot.com
  cghygiene.com
-cgi-bin-rbaccess-rbcge3m01f21f-f73ibrequest.xyz
-cgi-bin-rbaccess-rbcge3m01f21f-f77ibrequest.xyz
-cgi-bin-rbaccess-rbcgi2m01f21f-f73ibrequest.digital
-cgi-bin-rbaccess-rbcgi3m01f61f7ib-f21-ibf22-ibrequest.top
-cgi-bin-rbaccess-rbcgi3m01f71f-f21ibrequest.top
-cgi-bin-rbaccess-rbcgi3m01f81f-f21ibrequest.top
-cgi-bin-rbaccess-rbcgi3m01f91f-f21ibrequest.top
  cgi-ebay-de-ws-ebayisapi-dll.a0001.net
  cgi-paypal.com
  cgi-summary.serv764.ajktebaju.com
@@ -131548,7 +130724,6 @@ ch4as0-bnkacc8.info
  ch4s3-s3crt22.com
  ch4s3-secure-dashboard-r3port.eventosideal.com.br
  ch4z3-s3cur7y.com
-ch74a-8ysec8ss.com
  ch77067.tmweb.ru
  cha.6888ka.com
  cha.jameslanska.biz
@@ -131726,7 +130901,6 @@ chariotinfotech.com
  charisministries.id
  charitablepuppieshome.co.za
  charitasngo.org
-charitybird.guru
  charitylov.com
  charleneleeofcitycouncilofcupertino.com
  charles4364654.xyz
@@ -131764,6 +130938,7 @@ chartercountry.xyz
  charterhouse.com.br
  chartrcomuncations-alternate.app.link
  charttrader.in
+charutaplus.com
  charzgtgrzater.info
  charzgtgrzation.com
  chas202e.app.link
@@ -131785,7 +130960,6 @@ chase-alert.kozow.com
  chase-audio-276513.wl.r.appspot.com
  chase-authoririze.serveusers.com
  chase-authsupport.myvnc.com
-chase-bank-1.noaim.net
  chase-banking.online
  chase-banks.swarmsarm.com
  chase-bsh.com
@@ -131871,6 +131045,7 @@ chase-work.xyz
  chase.01c-authorized.com
  chase.8067984.com
  chase.aaclpoles.com
+chase.account.verify.update.com.growmaxmedia.com.au
  chase.alert.account.as-ostechi.com
  chase.alert.account.clayboughplaza.com
  chase.alert.account.lindseylazarevski.com
@@ -132335,9 +131510,9 @@ chat-whatsapp-join-grub-bokep.join-bkeps10.cf
  chat-whatsapp-kp1jlr5pzer0nb4o1jutmc.3-a.net
  chat-whatsapp-kpr0nb4o1jut5.onmypc.org
  chat-whatsapp-kpr1djlrg5pzegfr0nb4o1jutmc.mynumber.org
-chat-whatsapp-plus18.tk
  chat-whatsapp-sexyyhott18.wa-gruops.ml
  chat-whatsapp-tantemuda-v281g28.zzux.com
+chat-whatsapp-terbaru-2021.ourhobby.com
  chat-whatsapp-viral5.ourhobby.com
  chat-whatsapp-virall.ourhobby.com
  chat-whatsapp.as19557.net
@@ -132404,6 +131579,8 @@ chat-whatsapp4.xxuz.com
  chat-whatsapp62.jetos.com
  chat-whatsapp7.kha2020.tk
  chat-whatsapp7.sangegrup.ga
+chat-whatsapp8hzvbagotxjefecdpaux1.duckdns.org
+chat-whatsapp8hzvbagotxjefecdpauxy.duckdns.org
  chat-whatsapp9.2waky.com
  chat-whatsapp9.bokep57.cf
  chat-whatsapp9.sendsmtp.com
@@ -132479,6 +131656,7 @@ chat.whatsagp.com
  chat.whatsap.codm19.ga
  chat.whatsap.com.holl-vips.com
  chat.whatsap.xxx.4free9.com
+chat.whatsapbabycutedesah.semak99.ga
  chat.whatsapg.com
  chat.whatsapp-6192.ga
  chat.whatsapp.18pluz.kozow.com
@@ -132495,6 +131673,7 @@ chat.whatsapp.com-jw672lw5uw77ylxm7tparh7fgme.intemsy.com
  chat.whatsapp.com-kp0wvg2caw4ezw5zk.covied19.com
  chat.whatsapp.com-kp0wvg2caw4ezw5zk.holl3.com
  chat.whatsapp.com-l8ncvyiwi4h7imyfvabovj.zzipxc.tk
+chat.whatsapp.com.creamy.com.br
  chat.whatsapp.com.godh0jjckji95f0ubnqp7g.porngrup.com
  chat.whatsapp.com.grubwhatsapp-2021.cf
  chat.whatsapp.com.hol56.gq
@@ -132595,7 +131774,7 @@ chatingwhatsapp.tk
  chatingwhitmoe12.ml
  chatizel-paysage.fr
  chatjoin-wa.qhigh.com
-chatlive.fun
+chatme-bokep.organiccrap.com
  chatmusic.xyz
  chatnewwhatsap.ooguy.com
  chatntalk.club
@@ -132617,12 +131796,14 @@ chatsangekindovirall.join-wa.net
  chatsex-18.000webhostapp.com
  chatsex20.event-getss20.ga
  chatsexbro.mrbonus.com
+chatsexwhatsapp.gq
  chatsexwhatsapp.hol50.com
  chatsinglesonfb.ga
  chatsinglesonfb.gq
  chatstate.000webhostapp.com
  chatswaviranew4.25u.com
  chatswaviranew6.25u.com
+chatswhastapp.serveuser.com
  chatswhatsapp.ml
  chatswhatsapp.tk
  chatswhatsappx.xxuz.com
@@ -132675,7 +131856,9 @@ chatwhasapbkp.new55.ml
  chatwhasapbkp.wa-18.tk
  chatwhasappsgrbbkep.wikaba.com
  chatwhasappsgrubfrevideo.wikaba.com
+chatwhasstup.duckdns.org
  chatwhastaapgrupbokep.000webhostapp.com
+chatwhastapp.serveuser.com
  chatwhatapp-69.25u.com
  chatwhatapp-join.25u.com
  chatwhatapps-hot.ocries.com
@@ -132686,7 +131869,6 @@ chatwhatsaap01u.forumz.info
  chatwhatsaap1.ddns.mobi
  chatwhatsaapbokep2020.olls.shop
  chatwhatsaapjoin765.00.ns02.info
-chatwhatsaappvtm.000webhostapp.com
  chatwhatsap-com-grup-18.000webhostapp.com
  chatwhatsap.gabung.org
  chatwhatsap0.25u.com
@@ -132774,6 +131956,7 @@ chatwhatsappbokepvirall.free94.ml
  chatwhatsappbzmiap68c4fcdyergo8hao.ga
  chatwhatsappcome6zapcdw2pd3zy2v2icwqy.tk
  chatwhatsappdewasa.mrbonus.com
+chatwhatsappghtz.new-141.tk
  chatwhatsappgirls.tk
  chatwhatsappgroupporn18.mrslove.com
  chatwhatsappgrubsx.pubgproperties.com
@@ -132945,6 +132128,7 @@ checkaccont.paypal.com.chavinconsultores.com
  checkaccountid.ml
  checkaccountstatusd.does-it.net
  checkactivitytoday.com
+checkalertedpayment.com
  checkalltgeda.com
  checkandlogin.jp.net
  checkavalidations9898.ml
@@ -133082,7 +132266,6 @@ chefhattam.com
  chefsjaimeyramiro.com
  chegandodiadasmaespresenteieela.com
  chegouahoradeaproveitarcorra.com
-cheioruqwndfaslfefeyuewoi.xyz
  chekd5nuperuil.biz
  chekingking.com
  cheklnltau-mobile.com
@@ -133099,7 +132282,6 @@ chelseafc-dot-skype-meeting.uc.r.appspot.com
  chelseajane.com
  chelseamodel.cc
  chelsearolandarogefoundation.org
-chelsearosella.ru
  chelseyspurs.buzz
  chelsoto.cf
  chematar.cloudaccess.host
@@ -133108,6 +132290,7 @@ cheminpsy.fr
  cheminstryloginsxp.com
  chemisecamisetas.com.br
  chemit.co.kr
+chemlab.com.my
  chemlubbiotech.com
  chempharm.de
  chemright.site
@@ -133204,6 +132387,7 @@ chezmimi.com.br
  chezrafi.com
  chezrike.fr
  chfnfwiugkhumols-dot-millinium.ey.r.appspot.com
+chfourstdyanothestmw.dns.army
  chfourstdyanothestoq.dns.army
  chfujxepoggkaytr-dot-millinium.ey.r.appspot.com
  chfxnhdvnujwsmcrrfeylvidzitssmowulvy-dot-cedar-code-289917.nn.r.appspot.com
@@ -133470,6 +132654,7 @@ chongqing.yfqzdfd.com
  chonhangchuan.net
  choniacost.temp.swtest.ru
  chonlateeinternational.com
+chonquatet.net
  choobica.com
  choobika.com
  choodunadvised.net
@@ -133527,6 +132712,7 @@ chrissmith33.com
  christ-michael.net
  christaindiormgt.com
  christamol.temp.swtest.ru
+christeyns-bg.eu
  christian-communica.000webhostapp.com
  christian-financial.com
  christiancoffeemug.top
@@ -133562,6 +132748,7 @@ chrnywalibari.com
  chrobrymiedzyzdroje.pl
  chromaccess.com
  chromaspancom.shaxiaasian.top
+chrome-labs21.github.io
  chrome.theworkpc.com
  chrome1.hopto.org
  chromeguidedsmile.com
@@ -133730,6 +132917,7 @@ cicklylanspresado.com
  cicleta.cl
  ciclomodatorto.it
  ciclovitalcolombia.com
+cicmruwhjmcrtjkw.com
  cicropros.webcindario.com
  cid3r.hyperphp.com
  cidadao-gov-trabalhador2020.com
@@ -133919,6 +133107,7 @@ citati1.dusti.tj
  citationvie.com
  citbnks.com
  cite-mopa.web.app
+cite.ctiaspire.com
  cite4me.org
  citextremonlin.cf
  citextremonlin.ml
@@ -133984,6 +133173,7 @@ city-banks.com
  city-news.dkonto.pl
  city-power.org
  city-realtor-item9390.com
+city.ctiaspire.com
  city.dogedice.me
  city24.you2.pl
  cityapothecary.com.au
@@ -134126,6 +133316,7 @@ cjxtjsrueryygihboezncoxpze-dot-gloff849483.uk.r.appspot.com
  cjxzhsad.uygfdzmk.top
  cjzjpqgoapsnccfj-dot-millinium.ey.r.appspot.com
  ck-cosmetics-wellness.de
+ck18149.tmweb.ru
  ck43018.tmweb.ru
  ck49.mentriqq.com
  cka1.yf5b.dalianl.cn
@@ -134247,6 +133438,7 @@ claimfree70.2waky.com
  claimfreesite.webcindario.com
  claimfreeskinn.ga
  claimfreeskinorrpseune2020.000webhostapp.com
+claimga2021.com
  claimgov-refund.cf
  claimgratis61.2waky.com
  claimhadiahgratisbulanjuni-eventgarena2020.topup9.com
@@ -134272,6 +133464,7 @@ claimpubgm-s14.com
  claimpubgmobileevent.com
  claimpubgmobilehack.com
  claimrewardskinq.giize.com
+claims-sfree2.ml
  claims.06return-ref.com
  claims.pubgcompany.com
  claims13skin.jkub.com
@@ -134362,7 +133555,6 @@ classina.tokyo
  classipel.com.br
  classistern.xyz
  classrelief.com
-classroomhall.guru
  classroomlawyer.com
  classroomseasonal.com
  classroomsuccessnow.com
@@ -134426,6 +133618,7 @@ cleaningfor-uae.com
  cleaninggrad.com
  cleaningserviceslouisvilleky.com
  cleaningzen.com.au
+cleanlaptop.ru
  cleanmyplace.in
  cleanohome.com
  cleanoptiondata.com
@@ -134436,6 +133629,7 @@ cleanpro.guru
  cleanrashblockchain--five-nine.repl.co
  cleanrd.com
  cleanreviewi.website
+cleanscope.com.au
  cleanupcongresspac.com
  cleanwelllitconference.cartoomy.repl.co
  cleanwindow.top
@@ -134479,6 +133673,7 @@ cleonemo.com
  cleopatra43straton.000webhostapp.com
  cleopatrasneedle.co.uk
  cleoslostidols.com
+cleri.xyz
  clerici.eu
  clerici.info
  clerkish-lanterns.000webhostapp.com
@@ -134488,7 +133683,6 @@ clever-bhabha.netlify.app
  clever-blackwell-b81e70.netlify.com
  clever-clever-appea.000webhostapp.com
  clever-ibis.cloudvent.net
-clever-kowalevski-3c481f.netlify.app
  clever-morse-8cf2a8.netlify.app
  cleveradds.com
  clevercarrepairs.com
@@ -134929,6 +134123,7 @@ clubsalemap.su
  clubsimplyprice.com
  clubsoccerbdf.com
  clubtempel.de
+clubtopdeal.su
  clubulnautic.ro
  clubulnauticroman.ro
  clue-inspect.com
@@ -134959,6 +134154,7 @@ cm09912.tmweb.ru
  cm1.info
  cm315.cn
  cm65131.tmweb.ru
+cm78942.tmweb.ru
  cmahoneysingh.in
  cmailadvert15dx.world
  cmailserv19fd.club
@@ -135005,6 +134201,7 @@ cmmc-crad.longhuatyre.com
  cmmc-crad.yayuguanwang.com
  cmmqlgggmrbcnnyu-dot-millinium.ey.r.appspot.com
  cmnivaria.com
+cmnovacanaapaulista.sp.gov.br
  cmnss21.000webhostapp.com
  cmonsieurs.com
  cmowlrdveyfqknkt-dot-millinium.ey.r.appspot.com
@@ -135015,6 +134212,7 @@ cmphotos.es
  cmpny22work01.xyz
  cmqzcwkoajhseulo-dot-millinium.ey.r.appspot.com
  cms.bosna-s.ba
+cms.kku.universityapp.net
  cms.securityoperationscenter.de
  cms.vicloud.vn
  cmsbased.net
@@ -135140,6 +134338,7 @@ cnkegnmkhkzwprxu-dot-millinium.ey.r.appspot.com
  cnkkxglqthptjxpwgikcyhlozemtwgntlitm-dot-offglen.uk.r.appspot.com
  cnkpfjusmzurwtsoxmwsylqvqb-dot-triple-upgrade-293822.rj.r.appspot.com
  cnkpfjusmzurwtsoxmwsylqvqb.triple-upgrade-293822.rj.r.appspot.com
+cnkydzpkabwirmzx.com
  cnl.snprobbx.pbz.r.de.a2ip.ru
  cnlaw.co.zw
  cnlopaossiczxkbg-dot-millinium.ey.r.appspot.com
@@ -135262,9 +134461,11 @@ co25359.tmweb.ru
  co2mmittedtochangecom.nckiamerican.gdn
  co59268.tmweb.ru
  co9dance.com
+coaaa.ga
  coabhxzvxxzmxrvj-dot-millinium.ey.r.appspot.com
  coach-fpt.fr
  coachbagsoutletfactory.net
+coachboom.mhtechnologies.us
  coachesstrengthandconditioningresource.com
  coachhire-oxford.co.uk
  coaching-force.com
@@ -135320,14 +134521,12 @@ cocanphxulxycqouxdhdgqrakn-dot-gloff849483.uk.r.appspot.com
  cochesev-cuents.es
  cocheymotos.com
  cockapoosidjfjr.com
-cockier-sprayers.000webhostapp.com
  cockologins.cf
  cockroachexterminationperth.com.au
  cocktailcontent.com
  cocktailpayment.com
  cocky-chandrasekhar-72cffa.netlify.app
  cocky-galileo-fb18bb.netlify.app
-cocky-nightingale-40ccb8.netlify.app
  cocky-solder.000webhostapp.com
  cocky-wescoff-aac502.netlify.app
  cocnguyetsanlincupsg.com
@@ -135353,9 +134552,11 @@ cocukajanslari.com
  cocuva.com
  cod134241723promocional.com
  cod2.site
+coda-shop.serveuser.com
+codaeventshopgamenew.wikaba.com
  codamlshopp49.zyns.com
-codapayediamond.ezua.com
  codashoop.free.mexx6.com
+codashop-event2021.mrbonus.com
  codashop-freediamond.qpoe.com
  codashop-mlbb01.wikaba.com
  codashop-ph2020.ezua.com
@@ -135366,9 +134567,13 @@ codashopbug-free.xxuz.com
  codashopeventsactivity.ga
  codashopeventsactivity.gq
  codashopfreeresmi2020.000webhostapp.com
+codashopgratistopupfreefire.mrbonus.com
  codashopmlbb.mrbasic.com
+codashopmlx-newsme71.zyns.com
  codashopnewevents7s.gq
  codashopofficiall.000webhostapp.com
+codashopp-freedm.cf
+codashoppfree.zzux.com
  codashoppmlbb.itemdb.com
  codashopxfreeml.wikaba.com
  codashopxmlme.wikaba.com
@@ -135448,6 +134653,7 @@ cofico.com.br
  cofigrmwebais.000webhostapp.com
  cofima-spa.it
  cofip-funds.com
+cofisconconsultoria.com.br
  cofrance-telecommefr.fr
  cofrjkmmkwgadoqx-dot-millinium.ey.r.appspot.com
  coghahaand.com
@@ -135641,7 +134847,6 @@ collilers.com
  collins-creosote.com
  collinsgestion.com
  colloquialupgirding.online
-colmekk.duckdns.org
  colmenamotors.com
  colmrkbecek.theworkpc.com
  colnbases.verificatlonsupport.com
@@ -135704,6 +134909,7 @@ colpatria.banco.net.co
  colpatria.gq
  colpatria.reactivaciondeusuario.com.co
  colpatriascotiab.webcindario.com
+colpatriavirtual.github.io
  colpatrier.000webhostapp.com
  colpattriae.000webhostapp.com
  colpomed.com
@@ -135833,11 +135039,6 @@ com.appco.cc
  com.appleinc.de
  com.au.defence-nab.services
  com.bvn6.ru
-com.cgi-bin-rbaccess-rbcge3m01f21f-f75ibrequest.xyz
-com.cgi-bin-rbaccess-rbcgi2m01f21f-f73ibrequest.life
-com.cgi-bin-rbaccess-rbcgi2m01f21f-f73ibrequest.live
-com.cgi-bin-rbaccess-rbcgi2m01f21f-f73ibrequest.shop
-com.cgi-bin-rbaccess-rbcgi2m01f21f-f73ibrequest.xyz
  com.check-iphone.com
  com.cibc.com.ionisedfecconnerly.icu
  com.cm6j.ru
@@ -136157,7 +135358,6 @@ comomart.xyz
  comon.ac.ug
  comonuy.com
  comotabarafra.com
-comotocarviolaorapido.com
  comou.cc
  comoveeorg.shaxiaput.top
  comovencerorefluxo.com
@@ -136178,7 +135378,6 @@ compagnons-alzheimer.com
  compagnonvoyage.com
  companhiaitaunense.com.br
  companieshouseonlinedownload.com
-company-mx-19916486547863331.tk
  company-partenariat-investissement.com
  company.motopays.com
  company01.sutoweb.com
@@ -136208,7 +135407,6 @@ compassionate-downg.000webhostapp.com
  compassionate-dubinsky-013951.netlify.app
  compassionate-elion-c7cf66.netlify.app
  compassionate-engelbart-fc46a8.netlify.app
-compassionate-lovelace-693fc9.netlify.app
  compassionatecarejupiter.com
  compasslisting10726505.com
  compasslisting26706585.com
@@ -136222,7 +135420,6 @@ compesat.com
  competaprint.com
  competencialeal.com
  competent-agnesi-e535b5.netlify.app
-competent-bartik-cd47e7.netlify.app
  competent-borg-190248.netlify.com
  competent-heisenberg-c2c3b9.netlify.app
  competent-wing-ccdf5b.netlify.app
@@ -136248,7 +135445,6 @@ complainant.info
  complainerscla.xyz
  complaint-vk.000webhostapp.com
  complaintboardonline.com
-complaintsong.guru
  complan.hu
  complejoindustrialtiuna.com.ve
  complet.avessas.com
@@ -136415,6 +135611,7 @@ concatstring.com
  concealing-provisio.000webhostapp.com
  conceivable-freedom.000webhostapp.com
  concentration-descirconscriptions.com
+concentrical-equiva.000webhostapp.com
  concentricd.xyz
  conceptbrands.com.au
  conceptcharm.com
@@ -136456,6 +135653,7 @@ conditionssnap.000webhostapp.com
  condize.com
  condizioni.net
  condodisney.net
+condonians.com
  condos-at-the-beach.com
  condossea.com
  condoverpc.org.uk
@@ -136502,7 +135700,6 @@ confident-fermat-82200a.netlify.app
  confident-fermi-1e9947.netlify.app
  confident-hoover-947da2.netlify.com
  confident-hoover-e7a38c.netlify.app
-confident-kirch-8ba712.netlify.app
  confidentialite-profils.webnode.cr
  confidentiality.info
  confidesac.com
@@ -136574,6 +135771,7 @@ confirm-migrate-me-yahoo-1.webredirect.org
  confirm-mobile-uk.com
  confirm-my-account-pay-pal.4pu.com
  confirm-my-netflix.com
+confirm-my-newpayments-support.com
  confirm-my3.info
  confirm-needed.com
  confirm-new-payee.cc
@@ -136740,6 +135938,7 @@ congchuzs.com
  congdoantpvithanh.com
  congdongkynangmem.com
  congenialsumatranrhinoceros.htmlpasta.com
+congestible-ton.000webhostapp.com
  conghua.yfqzdfd.com
  conglolife.com
  congnghetuoitudong.com
@@ -136987,6 +136186,7 @@ construtorasempre.com.br
  consubcencheden.xyz
  consuelawilliams.com
  consuetudinary-spec.000webhostapp.com
+consulateins.solucioneslink.com
  consulenza-aggiornamento-app.com
  consulenza-web-online.com
  consulmuseum.ca
@@ -137078,6 +136278,7 @@ contactmairiecom.shaxianame.top
  contactorfor.com
  contactpromessagerie.web.app
  contacts-853652.info
+contactsmsconfirmation.com
  contactwebonline.24x7s.com
  contadeemail.weebly.com
  contafacilprime.com
@@ -137177,12 +136378,10 @@ content-71757835.voltoq.com
  content-724169532.helenquan.ca
  content-72436611.latuka.com.bo
  content-755417093355.keegan21.com
-content-75832817.keegan21.com
  content-77749454.interiorholic.net
  content-796468717.helenquan.ca
  content-80692424.bidsolutions.cl
  content-808801491.helenquan.ca
-content-812162152761.keegan21.com
  content-821961247.helenquan.ca
  content-837936425.helenquan.ca
  content-844948014.helenquan.ca
@@ -137269,6 +136468,7 @@ content-reset-account-support-security-amazon.com
  content-reset-account-support-security-appleid-apple.com
  content-reset-account-support-security-rakuten.com
  content.cloud-serv.eu
+content.codencil.com
  content.mentallyfitinstitute.com
  content43532522.texservis.su
  contentcenter.ir
@@ -137291,7 +136491,6 @@ contestaleartuu.000webhostapp.com
  contestshub.xyz
  contet-52392965.kingkobler.com
  conteudojuridiconline.com
-contextson.guru
  contiforcechallengefr.nckitickets.gdn
  contigosobrevivire.org
  continental-credit.com
@@ -137374,7 +136573,9 @@ controllo-urgente-mps.com
  controllo-urgente-we-bank.com
  controlloaccessi-ban.com
  controlloaggiornamento.com
+controlloappisp.com
  controlloautomatico.000webhostapp.com
+controllolntesasp.com
  controlmaxheacom.nckila.gdn
  controlparental.fr
  controlshop.support-futuremarket.com
@@ -137397,6 +136598,7 @@ conversionehub.ru
  conversionseo.co
  convert.gr
  convertinchtocm.com
+convertsunited.com
  convertt.co.kr
  convesdeim.cabanova.com
  convexsol.com
@@ -137455,6 +136657,7 @@ coolraccoon.com
  coolshop.live
  coolspeakers.eu
  coolstamptitle.club
+cooltaillights.com
  cooltennis.nl
  coolvacuum.ga
  coolvibes.xyz
@@ -137469,6 +136672,7 @@ coop.it-scegliere.club
  coop.it-scelto.club
  coopapotheken.gezondheidspremie.be
  coopapotheken.healthpremie.be
+coopbenecun.com.co
  coopecabril.com
  coopecarcreditoscr.com
  cooper-studio.xyz
@@ -137527,7 +136731,6 @@ copy-pasted-link.com
  copyfuti.hu
  copyhelpcenter-instagram.ml
  copyhgritstsupportteam.ml
-copylot.guru
  copyrgihtcontactaccount-inst.cf
  copyright-appealhelp.com
  copyright-belform.ml
@@ -137578,10 +136781,10 @@ copyright2-instagram.gq
  copyrightaccountconfirmation.tk
  copyrightappeal-instagram.com
  copyrightappealsupport.com
-copyrightbusiness-help.cf
  copyrightbusinessteam.com
  copyrightcenter.0fees.us
  copyrightcenters-instagram.ml
+copyrightcontrols.com
  copyrightcustomerservice.com
  copyrightcustomerservices.ml
  copyrightcustomeservices.ml
@@ -137589,6 +136792,7 @@ copyrightdefenseform.com
  copyrighted.0fees.us
  copyrightfor-facebook.com
  copyrightforhelpcenters.com
+copyrightformediasupport.ml
  copyrightforsecurityig.com
  copyrightforuser-ig.com
  copyrighthelpcenterss.cf
@@ -137604,12 +136808,12 @@ copyrighthelpsupportscenter.com
  copyrighthelpteams.com
  copyrightinfohelp.com
  copyrightinfrigementsupports.ml
+copyrightinfrigments.com
  copyrightinsagram.000webhostapp.com
  copyrightinstagram.business
  copyrightk-instagram.tk
  copyrightlhelp.ml
  copyrightlivesupportscenter.ml
-copyrightlnstagramservices.gearhostpreview.com
  copyrightlnstagramverification.com
  copyrightmediacontact-100348765.com
  copyrightmediasupport-10000387168.com
@@ -137632,6 +136836,7 @@ copyrights-violation-help.com
  copyrightsbusiness.com.instagram-helpteam.tk
  copyrightscenter.net
  copyrightscentersupport.ml
+copyrightservice2021.com
  copyrightservicebussines.000webhostapp.com
  copyrightservicesinstagram.com
  copyrightsform.com
@@ -137640,12 +136845,14 @@ copyrightshelp-centers.000webhostapp.com
  copyrightshelp.ml
  copyrightshelps-service.ml
  copyrightshelpsbusinessnotice.com
+copyrightshforsupport.com
  copyrightsmedia.com
  copyrightsmediahelp.com
  copyrightsobjectionform.ml
  copyrightsupport-bussiness.com
  copyrightsupportagency.com
  copyrightsupportcenterabout.com
+copyrightsupportformcenter.com
  copyrightsupportliveform.com
  copyrightsupportnotices.net
  copyrightsupportsservice.com
@@ -137730,6 +136937,7 @@ coriawp.elmamamobil.com
  coridenight.forexinfo.online
  coringa.r1-it.storage.cloud.it
  corinne-allemoz.fr
+corinne-soland.ch
  corinneca.moonfruit.com
  corinthiano.ug
  corinthianov.ug
@@ -138180,7 +137388,6 @@ coupedecheveux.org
  coupedeparis.f3m.free.fr
  coupiceme.com
  coupleofthingstosee.com
-couplesgifts.us
  coupletimpex.biz
  couponcodeslo.com
  coupondeasls.xyz
@@ -138233,7 +137440,6 @@ covergt.com
  coverless-mail.000webhostapp.com
  coverpageficxer.com
  coverturayveloci.webcindario.com
-coverysexygrupwhatsapp.wikaba.com
  coverz.co.uk
  coveyofcrows.com
  covfzgcqabkvnyaf-dot-millinium.ey.r.appspot.com
@@ -138344,7 +137550,6 @@ covid19requirementrp4rhd50345h0pdr3prp0p50p.s3.eu-north-1.amazonaws.com
  covid19response.fund
  covid19safejob.xyz
  covid19safety.myftp.org
-covid19supporteam.gq
  covid19tracer.ca
  covid19tracker.cc
  covid19video.offroadpcservice.com
@@ -138995,6 +138200,7 @@ cr.mufg.jp.9j46xf4k8cxa.xyz
  cr.mufg.jp.costa-del-sol-swingers.com
  cr.mufg.jp.crownjfashion.com
  cr.mufg.jp.efxcvx5xch2z.xyz
+cr.mufg.jp.qgqcyl.com
  cr.mufg.lxymw.com
  cr.mufg.marinawrestling.com
  cr.mufg.my-advantage-tennis-shop.com
@@ -139050,6 +138256,7 @@ craftivelogo.com
  craftleathermnl.com
  craftlok.com
  craftmetric.cloud
+craftnesia.id
  craftovary.com
  craftprimes.com
  craftresortphuket.com
@@ -139202,7 +138409,6 @@ crankisdg.servepics.com
  cranky-bassi-fbbfd0.netlify.app
  cranky-bose-78b530.netlify.app
  cranky-liskov-a0842b.netlify.app
-cranky-mahavira-4f42e4.netlify.app
  cranky-sinoussi-aa196d.netlify.app
  cranleighscoutgroup.org
  craonline-registration.com
@@ -139289,7 +138495,6 @@ createecho.org
  createliberty.com
  createroot.000webhostapp.com
  createshareunited.hopto.org
-creatigndam.casa
  creationarchitecture.top
  creationentreprise.guide
  creationsarchitecture.com
@@ -139582,6 +138787,7 @@ crosbyms.xyz
  croscovok.ru
  crosition.info
  crosplat.co.uk
+cross-eco.com
  cross-ratio-influen.000webhostapp.com
  crossb45.mywire.org
  crossbones.email
@@ -140250,6 +139456,7 @@ cubc.elmamamobil.com
  cube-projekt.at
  cube.joburg
  cubedomain-fill.nw.r.appspot.com
+cubescargoexpress.com
  cubeservers.co.uk
  cubeuser.tk
  cubice.myddns.me
@@ -140282,6 +139489,7 @@ cuentabancomovilparticulares.com
  cuentaddominiodelsistemarpido.moonfruit.com
  cuentanetflix.disenlaser.co
  cuentarut-online.top
+cuepxidwuyqruodmfzmlreipqn-dot-gleow2021ja.ue.r.appspot.com
  cueu0.app.link
  cueva-de-sal.changeland.com
  cueword.tk
@@ -140610,7 +139818,6 @@ customer-area.live
  customer-care1.xyz
  customer-centre-three.link
  customer-centre.link
-customer-centrehelps.com
  customer-daraz-survey.000webhostapp.com
  customer-department-alert.com
  customer-ebay.com
@@ -140705,6 +139912,7 @@ customers-data.services
  customers-safely-wells-fargo.com
  customers.opay.pk
  customers3773923www.site
+customersafetyagreement.000webhostapp.com
  customerscarezz.weebly.com
  customerservice.apple-center.authorized.identity.diabakena.org
  customerservice.scs-srl.it
@@ -140732,7 +139940,6 @@ customerwelcome.000webhostapp.com
  customeryahooofficials.weebly.com
  customes-process-support-ppl.com
  customgrup.ro
-customhottubcovers.info
  customizedtuo.professedamazon.icu
  custommdeskk.me
  customrecustom.top
@@ -140748,13 +139955,13 @@ custsomer.com
  custsupport1000.com
  custumetanet-uttbedbr.mzbomboniere.it
  custupdates.com
+custwestpac.com
  cusuppmyworldfosupp13.com
  cuszoulouiseje.gq
  cut-out-pails.000webhostapp.com
  cut.ci
  cutbeetroots.club
  cutebabywardrobe.store
-cutebeargift.casa
  cutebuddies.club
  cutecat.sa
  cutedogy.com
@@ -140870,6 +140077,7 @@ cvtmmdwkaazojxoa-dot-millinium.ey.r.appspot.com
  cvtr5gfbvmopl.xyz
  cvtresklop0plo0p88j.xyz
  cvvchaseupdate.live
+cvvlnk.xyz
  cvvohxvbxprvragc-dot-millinium.ey.r.appspot.com
  cvwjowqbwotzhzvn-dot-millinium.ey.r.appspot.com
  cvxasdxczxc.ug
@@ -140943,6 +140151,7 @@ cwzqzpzwvmxsvdkd-dot-millinium.ey.r.appspot.com
  cx-dispositivo1.com
  cx.money
  cx52066.tmweb.ru
+cx64342.tmweb.ru
  cxacf.ru
  cxapp.tk
  cxas32assa.appspot.com
@@ -141269,6 +140478,7 @@ d236t.svcoding.com
  d2575423ur.temp.swtest.ru
  d25965pi.beget.tech
  d26c5.weblium.site
+d26lpennugtm8s.cloudfront.net
  d2882xyni5hwu8.cloudfront.net
  d2balance.com
  d2df1929.ngrok.io
@@ -141452,6 +140662,7 @@ daffodilmarketing.com
  daffos.xyz
  daffymezlematic.com
  dafia.org
+dafjquefftpvpfcn.com
  daftargiveaway2020joss.000webhostapp.com
  daftargiveaways2020.000webhostapp.com
  daftarmenumasakan.web.id
@@ -141465,6 +140676,7 @@ daggersknivesandswords.com
  dagjpzmwfgwpdmvd-dot-millinium.ey.r.appspot.com
  daglezja-wycinkadrzew.pl
  daglimo.ru
+daglork.com
  dagmarmoraesbiscuit.com
  dagonlube.ru
  dagostim.com.br
@@ -141642,6 +140854,7 @@ damvdolgdayn.com
  damynghetuanmanh.com
  dan32i.com
  danabraz.com
+danaevara.com
  danaldea.ro
  danalph.com
  danamoten1.com
@@ -141816,7 +141029,6 @@ darcointernetional.com
  darcyeqution.com
  dardaseafoodrestaurant.com
  dare-dare.000webhostapp.com
-dareboot.cyou
  dareckleyministries.com
  dareforyoufriend.000webhostapp.com
  darekun.twilightparadox.com
@@ -142185,6 +141397,7 @@ davinci.techieteam.net
  davismgt.com
  davisra.com
  davitherbal.com
+davivienda-acceso-personas.com
  davivienda.cualquier-cosa.com
  davivienda.icu
  davivienda.inversionesargos.net
@@ -142228,6 +141441,7 @@ dawnthepetnanny.org
  dawoodaligamer.000webhostapp.com
  dawoodibohras.lk
  dawoodmarafie.com
+dawzilinaghirlistadirirojolamotrojo.blogspot.com
  daxex.pro
  daxuesen.com
  daxuminc.com
@@ -142268,7 +141482,6 @@ dazzling-agnesi-0258e7.netlify.app
  dazzling-calculating.ga
  dazzling-dijkstra-742e18.netlify.app
  dazzling-goldberg-17f6fe.netlify.app
-dazzling-wescoff-8b60dc.netlify.app
  dazzlingskill.com
  db-office365.000webhostapp.com
  db-phototan-wiederherstellen.de
@@ -142532,7 +141745,6 @@ ddpl.igstudio.in
  ddq9.jaysbrand.com
  ddqyxzhzcmglksss-dot-millinium.ey.r.appspot.com
  ddrcsangrur.com
-ddrearamab.com
  ddreciclaje.com
  ddrevent.com
  ddrfrodqesfmcdvb-dot-millinium.ey.r.appspot.com
@@ -142662,6 +141874,7 @@ deactivateatt.weebly.com
  deactivatepayee.com
  deactive-server00.com
  deadcherry.com
+deaddiseaseprotocolpa.us
  deaddog.com.br
  deadlegitimatemetadata--five-nine.repl.co
  deadlocktaskforce.com
@@ -142757,7 +141970,6 @@ decaffencja.pl
  decalvl.eu
  decamerous-displays.000webhostapp.com
  decasos.com
-decationzed.casa
  decaturilbgc.com
  decaty.xyz
  deccanmarket.com
@@ -142798,6 +142010,7 @@ declinedpay.com
  declinehalifaxpayee.com
  declinenatwestpayee.com
  declinepayee-online.com
+declinesteward.com
  declog.eu
  declosphilet.xyz
  decobrevo.com
@@ -142854,6 +142067,7 @@ dediirwansyah.com
  dedimakmur.com
  dedivan.ru
  dedlockwindy.co.za
+dedotinteriors.com
  dedqpsxrozcbwalgfgzasefanxuwripqwbrm-dot-glenxpecial3009493.ey.r.appspot.com
  dedrictunnel.buzz
  dedropinfoonboxxes.000webhostapp.com
@@ -142889,7 +142103,6 @@ deepmail-0.weebly.com
  deeprootministry.org
  deepsabrina.za.net
  deepsouthclothingcompany.com
-deepsugar.casa
  deeptisinghacademy.com
  deepvenom.000webhostapp.com
  deepwebeye.com
@@ -142973,6 +142186,7 @@ dehmola.ir
  dehomon.com
  dehw.shoesmogul.com
  deidrekreuz.com
+deigratia2.elin.co.za
  deinebavcom.nckidirectory.gdn
  deinniedersachsencom.augerqisafety.top
  deinrechtnet.shaxiarequest.top
@@ -143010,7 +142224,6 @@ dekoratornia-ciastek.pl
  dekoro.es
  dekoshoppingcom.shaxiaapril.top
  dekoshoppingcom.shaxialike.top
-dekovery.it
  dekovizyon.com
  deksafindo.co.id
  dekyriyrukkvowiuiuxjjuhbpv-dot-gleowayel400503.uc.r.appspot.com
@@ -143068,6 +142281,7 @@ deliciasdvally.com.pe
  deliciosapasion.com
  delicious-pcannuts.xyz
  delicioushabitat.com
+deliciousillfatedapplicationstack.sdsdsdsd77dsdsd.repl.co
  deliciousrecipees.com
  delifoodie.com
  delightfull.co.kr
@@ -143170,6 +142384,7 @@ demiurge.capital
  demkonwat.ga
  demmall.shop
  demnreaojs.bpzjhgoamu.top
+demo-cliente.mindcreative.com.br
  demo-dev.fr
  demo-phising68.000webhostapp.com
  demo-progenajans.com
@@ -143192,6 +142407,7 @@ demo.khanticables.com
  demo.liuzhixiong.top
  demo.logln.xn--lockchain-zy5d.com
  demo.magento.xn--blockchin-c2d.com
+demo.maxsence.co.in
  demo.mkt.exoret.com
  demo.mku.edu.vn
  demo.nhattkw.com
@@ -143242,7 +142458,6 @@ demolscorp.com
  demoluckyspinv1.jnrpanel.xyz
  demoluckyspinv3.jnrpanel.xyz
  demonbets.ru
-demondiazes.casa
  demondkapjesman.nl
  demonesia.net
  demonetarise.fr
@@ -143292,6 +142507,7 @@ denoyster.com
  denphycelhanu.tk
  denser-recognition.000webhostapp.com
  densitybanquet.win
+dent-estet.com
  dental-mega.com
  dental.jakubekdentistry.com
  dentalalerce.cl
@@ -143360,6 +142576,7 @@ departs-society-tobing-ganteng.info
  departs-society.my.id
  departs-societyi.co
  departure.world
+deparufficio.com
  depascoalcalhas.com.br
  depatmentmanage.com
  depaulaetitaraadvogados.com
@@ -143635,6 +142852,7 @@ designersnake.top
  designertiles.xyz
  designferreira.com.br
  designfitters.com
+designfuerdiesinne.de
  designisaverb.co
  designjunkyzcom.shaxiaadd.top
  designkit.guru
@@ -143774,7 +142992,6 @@ detallesconamor.com
  detalywro.ru
  detayraspa.com
  detc-48966235.tchekeflow.com
-detect-mp.online
  detect-unknownpayee.com
  detect-unsualactivty.com
  detected-modificati.000webhostapp.com
@@ -144004,6 +143221,7 @@ device-management.cc
  device-manager.cc
  device-onlinealert.com
  device-payee-authorisation.com
+device-payee-reverse-help.com
  device-payeeinfringement.link
  device-personal-wells.site
  device-register-uk.com
@@ -144080,6 +143298,7 @@ devices-verified.cc
  devicesapp-plc.com
  devicesecurity-online.com
  devicesherpa.com
+deviceverification-uk.com
  devie-king.pp.ua
  devies-ruralviacaja.com
  devieyehospital.in
@@ -144317,6 +143536,7 @@ dfrqrqqcwcpdsfqseaztqnresuurxbywodwc-dot-offglen.uk.r.appspot.com
  dfsdewsa.com
  dfsdfsdffg.xyz
  dfsdfuiecenter.com
+dfsfcsfcdsfsdvcfsvcscv.com
  dfsfgkg.uhbnempu.best
  dfsfwees.com
  dfsg4s.xyz
@@ -144411,6 +143631,7 @@ dgshanglingzs.com
  dgsound.com.br
  dgstrainingacademy.com
  dgsuriidxllpuknp-dot-millinium.ey.r.appspot.com
+dgt-directiongenerale-financesgouvprodrembst.justns.ru
  dgtalsuperstore.com
  dgte.hyperphp.com
  dgunldhnsqcoxcrpoysvtlgvhc-dot-gloff00403993445.uk.r.appspot.com
@@ -144494,13 +143715,14 @@ dhl-international.allsh.eu
  dhl-landingpage.land
  dhl-mmmail.com.ng
  dhl-officiale04.000webhostapp.com
+dhl-package-up.azurewebsites.net
  dhl-paczkanr.com
  dhl-parcel.co
  dhl-parcel24.com
  dhl-percel.com
  dhl-quocte.com
+dhl-service-client.azurewebsites.net
  dhl-service.gotdns.ch
-dhl-srvcdk.com
  dhl-suisse.gotdns.ch
  dhl-suisse2.gotdns.ch
  dhl-tracking-germany.forexcreed.com
@@ -144539,6 +143761,7 @@ dhlexpressparty.com
  dhlexpressshipping.com
  dhlglobal-mail-tracking.ga
  dhlglobal.serveirc.com
+dhlgpi.com
  dhlonboarding.com
  dhlpackage.servepics.com
  dhlpaket.online
@@ -144598,6 +143821,7 @@ dhybwe-nctwvm-ocuam.netlify.app
  dhzwg.awaykart.com
  dhzwoyqbkkokpysuqiiuonzlcdldhuqnuqix-dot-solar-vertex-285913.rj.r.appspot.com
  di-1.icu
+di-eureka.de
  di-fao.com
  di.jjconcreteseattle.com
  di11z2b9.firebaseapp.com
@@ -144616,7 +143840,6 @@ diabaetetsmasteralassjsk.us
  diabasic-balances.000webhostapp.com
  diabatesfreeddomdiets.us
  diabbetes.net
-diabbetstesmasterecalshsg.us
  diabetcentro.info
  diabetes-insight.info
  diabetesfreedom.net
@@ -144640,10 +143863,10 @@ diadosnamoradoeaqui.com
  diadosnamorados-american.com
  diadosnamoradosexclusivoame.com
  diadospaisespecialofertavemver.com
+diafir.ro
  diagnosismatchsk.com
  diagnostica-products.com
  diagnosticandstatisticalmanual.org
-diagoseis.com
  diahamada.ru
  diahmarsidi.com
  diakovpro.ru
@@ -144713,6 +143936,7 @@ diamondku.updates14.com
  diamondlanka.info
  diamondmar.top
  diamondprivilege.com
+diamondregular.com
  diamondrprp.000webhostapp.com
  diamonds-exchanges.com
  diamonds-markets.com
@@ -144767,6 +143991,7 @@ diaxejlriewjkhcj-dot-millinium.ey.r.appspot.com
  diazavendano.cl
  diazepo.com
  diazfoods32176invoicedoc.uc.r.appspot.com
+diba-tanlist-system.com
  dibaholding.com
  dibankae.com
  dibidalcycle.com
@@ -144852,6 +144077,7 @@ dienmayngocthach.com
  diennangmattroi.com
  dienombi.com
  dienstenveiligheidnl.com
+dienstomgeving.live
  dienthoaitot.vn
  dientutinhoc.com
  diepateninfo.shaxiaput.top
@@ -144952,6 +144178,7 @@ digital-marketing-institute-delhi.empeeevents.com
  digital-outlook-1drive.com
  digital-pix.digital
  digital-pr.ru
+digital-sonic-design.jp
  digital-unicredlt.com
  digital-virgin.com
  digital.active-restrict.com
@@ -144964,6 +144191,7 @@ digitaladvertiser.us
  digitalalliance.net
  digitalangels.eu
  digitalartstuv.tk
+digitalassets.ams3.digitaloceanspaces.com
  digitalathsala.000webhostapp.com
  digitalauth-amzn237.gotdns.ch
  digitalaxom.in
@@ -145309,6 +144537,7 @@ discoveryhostel.com
  discoveryouritem.co.uk
  discret-nahariya.co.il
  discretedan.com
+discriciones.westus2.cloudapp.azure.com
  discussioni-forum-ebay-it-t3.html-5.me
  discussioni-forum-ebay-it-wsr.html-5.me
  discussionoftheday.com
@@ -145495,6 +144724,7 @@ divinum-europe.com
  divirastudio.com
  division16llc.com
  divisiondefault.com
+divisordeantena.antenascuritiba.net.br
  divisorus.000webhostapp.com
  divisoul.com
  divnlog.top
@@ -145512,6 +144742,7 @@ divyareddyofficial.com
  diwafashions.com
  diwalirestaurant.com
  diwangyulecheng.tavmo.com
+diwantrading.com
  diwuwhkiigjqdsncmrzifvsily-dot-gleowayel400503.uc.r.appspot.com
  dixartcontractors.com
  dixdiiy.com
@@ -145714,6 +144945,7 @@ dkoipg.pw
  dkonline-germany.com
  dkoo11.com
  dkooznzdudzfwvkc-dot-millinium.ey.r.appspot.com
+dkowb.xyz
  dkp2y.cn
  dkpdfhwocjaxmhgq-dot-millinium.ey.r.appspot.com
  dkpmrsagdhgfufql-dot-millinium.ey.r.appspot.com
@@ -146073,6 +145305,7 @@ dockrover.com
  docksidedentistry.com
  doclab-console-auth.firebaseapp.com
  doclabel.fr
+docman.orientalservices.in
  docment-dot-trusty-sentinel-284111.ey.r.appspot.com
  docmerlin.com
  docnotes.biz
@@ -146318,6 +145551,7 @@ doktorlarrehberim.com
  dokyit.000webhostapp.com
  dol.dance
  dol.gov.1ln.cc
+dolabriform-problem.000webhostapp.com
  dolanmbakboyo.com
  dolapolepe94505.ipage.com
  dolartakip.online
@@ -146697,6 +145931,7 @@ dora92839.xyz
  doradofernando.com.ar
  doradztwo-kredytowe.pl
  doraflob.com
+dorapresumably.com
  doraya.eu
  dorcakkkaddm.com
  dorcaskenya.org
@@ -146923,6 +146158,7 @@ down.zmnds.com
  down1.baopu.cc
  down10.zol.com.cn
  down10d.zol.com.cn
+downasweet.casa
  downbeetroots.net
  downcdn.in
  downersnow.tk
@@ -146956,6 +146192,7 @@ download.ktkt.com
  download.moffice365.live
  download.mpc.am
  download.onlineappupdater.com
+download.panguzaoshi.cn
  download.pdf00.cn
  download.qip.ru
  download.qweas.com
@@ -147192,6 +146429,7 @@ drawshower.guru
  drawspin-luckyspinn.dns04.com
  drawspins15.dynamic-dns.net
  drayaco.com
+drbaby.com.sa
  drbean.pk
  drbigness.com
  drbobsimpson.com
@@ -147213,6 +146451,7 @@ drdlwallace.com
  drdoganaykurkcu.com
  dreadglaucomat.com
  dream-estate.ch
+dream-line.me
  dream.pics
  dreamalyzers.com
  dreambodygurus.com
@@ -147301,6 +146540,7 @@ drgh.r7yxz.cn
  drghwblxaulqfvgywxasdkvhgn-dot-gleow2021ja.ue.r.appspot.com
  drh4x.ddns.net
  drhalaelsaid.com
+drhankdelivered.com
  drheidimist.com
  drhickmanncom.shaxiaaccommodation.top
  drhickmanncom.shaxiaprimary.top
@@ -147477,6 +146717,7 @@ dropbox.tartanridge.org
  dropbox2.xyz
  dropboxccdn.com
  dropboxcloud.co
+dropboxdownloads.com
  dropboxfolder.xyz
  dropboxmaill.weebly.com
  dropboxon-lineusdocpdf.cfapps.io
@@ -147486,6 +146727,7 @@ dropboxserviceupdate.beach365.com.au
  dropbusinessboxpro.000webhostapp.com
  dropbxdocument.yolasite.com
  dropcup.xyz
+dropdawn.com
  dropebox.000webhostapp.com
  dropfile.webstarterz.com
  dropincor.com
@@ -147537,6 +146779,7 @@ drsarairannejad.com
  drsaultorres.com
  drsciencepublications.com
  drsehidlcjlbhwmd-dot-millinium.ey.r.appspot.com
+drsha.innovativesolutions.mobi
  drshekharbiswas.com
  drssilverman.com
  drssptljrjbadbyx-dot-millinium.ey.r.appspot.com
@@ -147549,12 +146792,14 @@ drtvmove.com
  drucker.com.ar
  druckingmaster.weebly.com
  drugdevice.org
+drugmonkey.ctiaspire.com
  druiumin.com
  drukdeothjung.bt
  drukkombucha.com
  drumetulguard.com.ro
  drummerboy.duckdns.org
  drupaceous-weave.000webhostapp.com
+drupal.website2.fr
  drurmilasoman.in
  drustre-efsy.web.app
  druzim.freewww.biz
@@ -147577,7 +146822,6 @@ dryhu.xyz
  drykit.de
  drylinkers.site
  dryproservices.com
-drysuudio.cam
  drzamindarseyecentre.com
  drzawgrzas.com
  drzrzr.com
@@ -147758,7 +147002,6 @@ dtours.si
  dtowjfohj.goruli.com
  dtparnian.ir
  dtpfuxpqslfnqlaj-dot-millinium.ey.r.appspot.com
-dtqpafijtnzipbqugemfkhagwh-dot-gleow2021ja.ue.r.appspot.com
  dtrendz.site
  dtsawdh.com
  dtsay.xyz
@@ -147776,7 +147019,6 @@ dtupl.com
  dtvkcrwbrbebasqkxqekopuprvalgzkfejuf-dot-solar-vertex-285913.rj.r.appspot.com
  dtvmeivznbovbqgvvggjipunfukdtytwtfxc-dot-glxcel49934343434.rj.r.appspot.com
  dtwladwhrlhyjxyj-dot-millinium.ey.r.appspot.com
-dtwuuueod.cam
  dtxhv.goruli.com
  dtyl.shop
  dtzdcizoeg.duckdns.org
@@ -147875,6 +147117,7 @@ dufre1in.site
  dufre3.site
  dufres.site
  dufyvibusn.ts.r.appspot.com
+duggbmrjg.fit
  duglazo.info
  dugqouxrljrgwkbjihjsqlxmyz-dot-gloff849483.uk.r.appspot.com
  dugraal.com
@@ -148111,6 +147354,7 @@ dvla-renew-taxpayment.www1.biz
  dvla-tax-car.com
  dvla-tax-return-gov.com
  dvla-taxpayment-renew.www1.biz
+dvla-taxrefund.co.uk
  dvla-uk-refund.com
  dvla-uk-security.www1.biz
  dvla-uk.veri-online.ir
@@ -148851,6 +148095,7 @@ eapy-denin.com
  eaqpcurvshwxnmg.top
  earch.trackyourpackagetab1.com
  earecords.co.za
+earforce.nl
  earlingramjr.com
  earlmalouis.com
  earlystickgraft.com
@@ -149301,6 +148546,7 @@ ebay.bicycles.sporting-goods.cycling.itm59l2o3s5.com
  ebay.bicycles.sporting-goods.itm1o29l60.com
  ebay.bicycles.sporting-goods.itm25827350.llc25827350.com
  ebay.bicycles.sporting-goods.itm50283658.llc50283658.com
+ebay.billingfail.com
  ebay.bosm.dk
  ebay.cameras-digital-photo-nikon-831l93o624348.llc831l93o6.com
  ebay.cameras.digital-cameras.itm169528383.llc169528383.com
@@ -149394,6 +148640,7 @@ ebay.com.m.ladus.xyz
  ebay.com.m.sles.xyz
  ebay.com.p323423.pw
  ebay.com.phones.smartphones.itm87l2813.com
+ebay.com1.i.11itm.com
  ebay.con-itm.37i45r36e2.xyz
  ebay.confirm-cart.com
  ebay.contact-web-user.cf
@@ -149444,6 +148691,7 @@ ebay.item-49258526.co.uk
  ebay.item-cars-trucks.com
  ebay.item-motors.com
  ebay.itm.com-2008-casita-17-deluxe-travel-trailer.acsvx.top
+ebay.itm.com.i.1ist.website
  ebay.megasoftisp.com
  ebay.online-verify.digital
  ebay.reconfirm-posting.us
@@ -149499,6 +148747,7 @@ ebilling-secured.co.uk
  ebills.thetrissilent.com
  ebillupdateshaw.is-an-accountant.com
  ebinaires.biz
+ebiuro.org.pl
  ebix.ga
  ebiz-biz.info
  ebizmaldives.com
@@ -149507,7 +148756,6 @@ ebjedpabrikankaos.com
  ebk5.svcoding.com
  ebkwznnqvcezvckabz.top
  eblmzvxoxocxjmfa-dot-millinium.ey.r.appspot.com
-eblstrdr.com
  ebmpapst.online
  ebnanazddq.duckdns.org
  ebnyjbewrd.duckdns.org
@@ -149564,6 +148812,7 @@ eby-kleinanzeigen-de-anzeige-3019391001.000webhostapp.com
  eby-kleinanzeigen-de-anzeige-3029381101.000webhostapp.com
  eby-kleinanzeigen-de-anzeige-70001928731.000webhostapp.com
  eby-kleinanzeigen-de-anzeige-78100636.000webhostapp.com
+eby-support.de
  eby.co.uk.3427748.com
  eby.co.uk.it93839.com
  ebyco-dedll.tractors-hereford-ltd.com
@@ -149721,7 +148970,6 @@ econoboxastonishing.xyz
  econogrindingcom.nckiwomen.gdn
  economiadigital.biz
  economiadigitalec.com
-economic-autumn-roarer.glitch.me
  economic-donkey.surge.sh
  economicdisgrace.win
  economicimpactnotice.org
@@ -149772,6 +149020,7 @@ ecqc884q89.vercel.app
  ecqelecxsdywqckc-dot-millinium.ey.r.appspot.com
  ecqotoqipdlthfhaczaumqhsyhltqtnvwgvx-dot-glegen303939423233.ue.r.appspot.com
  ecqvvrzpauhmkvor-dot-millinium.ey.r.appspot.com
+ecreditsbitl.com
  ecretailor.com
  ecrgocyprjwwgpsmsiclvpvtvl-dot-gleowayel400503.uc.r.appspot.com
  ecrib.e-lyfe.com
@@ -149817,6 +149066,7 @@ ed-tv.nl
  ed0a9.addroits.com
  ed17a5d2b0f5.mrbonus.com
  ed23531713e354e29a6b09cc976bb47b-dot-dbenitonline.ey.r.appspot.com
+ed36gq68wu7xvuyxh9aukmog.buzz
  ed6m5.jaysbrand.com
  edaivip.com
  edalajobs.com
@@ -149870,7 +149120,6 @@ edenzconsultants.com
  edersondomingues.com
  edestekaidatkapisi.com
  edev-govtronline.com
-edev-iade-geri-basvurumuz-platformu-bireysel.xyz
  edevlet-aidat-iade-form-gov-tr.com
  edevlet-destekk.com
  edevletaidat.online
@@ -149912,6 +149161,7 @@ edificiozenit.com.ar
  edifytrainingministries.org
  edigogsr.com
  edimentgrow.com
+edintraining.com
  ediomare.com.br
  edios.vzpsoft.com
  edisiramadhanindahboy.com
@@ -149941,6 +149191,7 @@ edktiasollfilwredflzhupzwh-dot-gleowayel400503.uc.r.appspot.com
  edlsat.shaxiaput.top
  edm.nickunj.com
  edmatools.ca
+edmclinic5.qnotice.com
  edmedicationguide.com
  edmondmagneti.com
  edmondok.icu
@@ -149981,7 +149232,6 @@ eduamazon.top
  eduamazonmonste.monster
  eduardo926737.xyz
  eduardoconill.blog.br
-eduardomendescanal.000webhostapp.com
  eduardovilacadesigner.com
  edubloc.com
  educacaoemvideo.com.br
@@ -150063,6 +149313,7 @@ ee-account-support-billing-team-resolve-issue.000webhostapp.com
  ee-account-update.com
  ee-account-verify.com
  ee-account-webhelp.000webhostapp.com
+ee-account.help
  ee-account.net
  ee-accountauth.com
  ee-accountbill-secure.com
@@ -150413,7 +149664,6 @@ ee-uk20bill.com
  ee-ukbilling-error.com
  ee-ukbilling.com
  ee-ukbillingpage.com
-ee-ukbillingupdate.com
  ee-ukbills.xyz
  ee-unlock-account.000webhostapp.com
  ee-update-account.com
@@ -150529,7 +149779,6 @@ ee.ref3176.co.uk
  ee.renew-account.co.uk
  ee.securbilling.help
  ee.securbillingreview.help
-ee.securing-details.com
  ee.services-paybill-online.co.uk
  ee.support.update-billing.mobi
  ee.uk-alerts.com
@@ -150625,6 +149874,7 @@ eebillingupdates.com
  eebilll.com
  eebillsupport-uk.com
  eebze60.hiejrows.info
+eec-channel.com
  eec6946d25.nxcli.net
  eecakesconf.at
  eecontract.verify-info-secure.com
@@ -150702,7 +149952,6 @@ eepcsiemhhuhalldbowwdcaovvhggyszpxcf.cryptic-now-290917.ey.r.appspot.com
  eeportal.cc
  eeqibjsmfunlfcht-dot-millinium.ey.r.appspot.com
  eerecovery.000webhostapp.com
-eeredirect-mobile-info.com
  eeredirect-support.com
  eeredirect-update.com
  eeredirect.info
@@ -150710,7 +149959,6 @@ eerna.com.bd
  eernejd-diskl.com
  eertfd.com
  eerv.nl
-eesecure-account.com
  eesecure-accountbill.com
  eesecure-accountinfo.com
  eesecure-billing.com
@@ -150744,6 +149992,7 @@ eeuk-update.com
  eeukbilling.com
  eeuklog.co.uk
  eeunlock-help.com
+eeupdatebilling-auth-secure.com
  eeupdatebillingservices.com
  eeupdates-customerbill.com
  eevalidation.com
@@ -150772,6 +150021,7 @@ efaktygwalt.waw.pl
  efarinaetaham.com
  efatahgroup.com
  efax-delivery-id18.com
+efaxdocument.ssbeautymiracle.com
  efaxononedrivebusiness99.web.app
  efbfan.goruli.com
  efbook-65123852.kemetera.com
@@ -150806,6 +150056,7 @@ efhcywwbgkiortvqlosutiazaveiqfzzgaae-dot-solar-vertex-285913.rj.r.appspot.com
  efhqqcmnewqbsfxc-dot-millinium.ey.r.appspot.com
  efhum.com
  eficadgdl.com
+efijuegohsbc.com
  efilisminmendham.ddns.net
  efilotsaediv2-rouy7gnirnms2.digital
  efis.top
@@ -151247,6 +150498,7 @@ ekwfovylanquiconwshayuulct-dot-gleowayel400503.uc.r.appspot.com
  ekwiteit.co.za
  ekwntrsrwzugumcjzgnn.top
  ekxitxytynrhpazo-dot-millinium.ey.r.appspot.com
+ekyghukuk.com
  ekyjo.gikorip.net
  ekzjwvqktznrzfmyzosrztppai-dot-gleowayel400503.uc.r.appspot.com
  el-mero-mero.elmamamobil.com
@@ -151356,7 +150608,6 @@ electro-technical.com
  electrocoagulation.xyz
  electrocoolhvacr.com
  electrocuenca.com
-electrofree.casa
  electrofyhub.com
  electrokav.com
  electrometric.xyz
@@ -151382,7 +150633,6 @@ electrumtools.care
  electrumwallet.download
  electsave.me
  electwillhaynie.com
-electworker.cyou
  elecvelpha.tk
  elefantenmarkecom.unitravel.top
  elegaladvisors.com
@@ -151420,7 +150670,6 @@ elena.susypro.com
  elenajae.info
  elenamagic.com
  elenavon.com
-elenecoletta.ru
  elenielefterias.com.au
  elenimavros.com
  elenoramount.buzz
@@ -151518,7 +150767,6 @@ elitedigital2017.com
  elitedynastyleague.icu
  eliteglobalrealty.in
  elitegrowth.net
-elitehomeinpmroves.us
  elitehq.net
  elitelashbrow.com
  elitelegendsports.com
@@ -151565,6 +150813,7 @@ elkingmedo01.hopto.org
  elkinsconstruction.com
  elkjournals.com
  ellabrowns.com
+elladaoriflame0110.000webhostapp.com
  ellageneartistry.co.uk
  ellami.de
  ellauni.the91s.com
@@ -151581,6 +150830,7 @@ ellieboutique.000webhostapp.com
  ellinika-proionta.net
  elliotgibbs.com
  elliott-songs.xyz
+ellipticaldishonestmodels--five-nine.repl.co
  elliteempregos.com
  ellmuhyselyteogkhoqpyvxoqffupaqletld-dot-glegen303939423233.ue.r.appspot.com
  ellor45.com
@@ -151659,6 +150909,7 @@ eltrendelossuenios.com.ar
  eltronesia.id
  eltubazodigital.com
  eluaccesorios.com
+eluhvzt2fxwpmii4qoz7jred34--www-paypal-com.translate.goog
  eluint.com
  elvbs.store
  elvecinito.cl
@@ -151764,6 +151015,7 @@ emailseguridad.pw
  emailseguridad.site
  emailsendwit.ru
  emailserng.yolasite.com
+emailserver002.xyz
  emailsettingmailbox.weebly.com
  emailsite.cc
  emailsmart.co
@@ -151795,6 +151047,7 @@ emaze.me
  embalagemdesushi.com.br
  embalagememgeral.com.br
  embalagensfortaleza.com.br
+embarqueja.com
  embarwasasa.top
  embassyconsular.com
  embassyhotelguntur.com
@@ -152000,7 +151253,6 @@ employeesalaryschedule25.000webhostapp.com
  employeesalaryschedule26.000webhostapp.com
  employeesalaryschedule39.000webhostapp.com
  employeesalaryschedule40.000webhostapp.com
-employeesalaryschedule41.000webhostapp.com
  employeesalaryschedule46.000webhostapp.com
  employeesalaryschedule47.000webhostapp.com
  employeesalaryschedule51.000webhostapp.com
@@ -152367,6 +151619,7 @@ engeim.com.br
  engelsmah0mes.com
  engenerconstrucao.com.br
  engenhariaga.com.br
+engenhariasolutions.com.br
  engeserv.com.br
  engetrate.com.br
  engetronics.com
@@ -152468,6 +151721,7 @@ enmmmgdd.duckdns.org
  ennaturismo.info
  ennezaradio.com
  enniestore.com
+ennovate.elin.co.za
  ennprh8lsharefilecomsst86tho4ons669e.us-east-2.elasticbeanstalk.com
  ennqqnonivrtugdtrryvsamaxk-dot-gleowayel400503.uc.r.appspot.com
  ennrc.com
@@ -152704,6 +151958,7 @@ epcocbetonghanoigiare.com
  epcocbetongmb.com
  epcomfrimpage.000webhostapp.com
  epectasys.ro
+epg.emiratespost.ae.parcel.24kservices.com
  epg.unas.edu.pe
  epgpianos.com.au
  ephcoplaza.ga
@@ -153383,6 +152638,7 @@ espacotieli.com.br
  espanabancosantander-clientes.nhbesantnet.com
  esparklight.com
  espaytakht.com
+espbornd.tk
  espe4us.com
  especial-das-maes.com
  especialdasemana.xyz
@@ -153447,7 +152703,6 @@ essmc.us
  esspeedesigns.autocertificates.com
  esswg.xyz
  est-clinsystline.gotdns.ch
-establecimossistemasderecoopilacionesydeterminados.tk
  estacaogourmetrs.com.br
  estacaonetpe.com.br
  estacionkpop.com
@@ -153503,6 +152758,7 @@ estra-as.com
  estrcy.xyz
  estrey.xyz
  estroinstallers.com
+estryipecont.com
  estuar.org
  estucoandino.com
  estudent.tv
@@ -153598,6 +152854,7 @@ etdfhiuddf.com
  etdicmx.gq
  etduqhxygwavmqsz-dot-millinium.ey.r.appspot.com
  etdvf.xyz
+eteccurso.com.br
  etechnik.co.at
  etecindsvc.com
  etehqeeq.com
@@ -154012,6 +153269,7 @@ europalettenkaufen.net
  europe-certbank.it
  europe-verification-account.48929855.pro
  europeaengineering.com
+european-wood.com
  europeby.guru
  europecartouchecom.shaxiaadd.top
  europeemailorg.nckichat.gdn
@@ -154258,6 +153516,7 @@ events.medialogic.cloud
  events.onpubg.com
  events.tencenters.com
  events15ucpubg.com
+events38.ga
  events4u.in
  eventsactivity-mlbb.ga
  eventsactivity-mlbb.ml
@@ -154269,6 +153528,7 @@ eventseason15.myz.info
  eventsetmaterial.com
  eventsfreeskinmlbb.dynamic-dns.net
  eventshareonline.nl
+eventskin-gratisff501.ml
  eventskin.lucky76.ml
  eventskinfreedm.otzo.com
  eventskingratis2020.zgarena.top
@@ -154283,6 +153543,7 @@ eventspinlucky.com
  eventspinpubgmobiles13.therealonday.com
  eventspubgmobiles.com
  eventspubgmy.com
+eventspubgnew.ocry.com
  eventsskinmlbbkof.zyns.com
  eventstickets.net
  eventsupport.live
@@ -154396,7 +153657,6 @@ evm0di.linkpc.net
  evmodi0.ddns.net
  evmomsblog.com
  evmvdnrbro.duckdns.org
-evnt-freenewtem.tk
  evnt-garena-ff.skins99.com
  evnt.com.br
  evntspubgmoble.000webhostapp.com
@@ -154430,6 +153690,7 @@ evos-notnot.whatsapp-youtubers.com
  evoshave.com
  evosroarcomeback.com
  evostore.com.np
+evotechss.com
  evoter.christbusinessnetwork.org
  evouquerdowlan.blogspot.com
  evoxhosting.com
@@ -154663,7 +153924,6 @@ executives.rubedo-ontwikkeling.nl
  executivetavel.com
  executivtrading.ro
  exee.space
-exelvip.com
  exempletes.info
  exenberger.at
  exeobmens.com
@@ -155309,11 +154569,13 @@ f4bag.mentriqq.com
  f4c.com.au
  f4c3b00kl0qin.000webhostapp.com
  f4c3dook.000webhostapp.com
+f4cboook-la-lognla-facbook-es-2ks421xpj.filesusr.com
  f4cboook-lognla-facbook-es-2my5xgies9.filesusr.com
  f4cboook-lognla-facbook-es-5dh4fiucqc.filesusr.com
  f4cboook-lognla-facbook-es-8kwrbnvq.filesusr.com
  f4cboook-lognla-facbook-es-dlew895et3.filesusr.com
  f4cboook-lognla-facbook-es-ekkhwsiwgz.filesusr.com
+f4cboook-lognla-facbook-es-gc8zwhvw6m.filesusr.com
  f4ceb00k20.000webhostapp.com
  f4cr5ryd.ewr.mwmt.xyz
  f4ixxa4ppkffo8l.edal.cc
@@ -155974,7 +155236,6 @@ facebook-id.mediahelpline.me
  facebook-id984574.page3846otos4gt3-item730945.com
  facebook-identity-regarding-copyright.my.id
  facebook-info.ga
-facebook-int.ga
  facebook-item-accont938.com
  facebook-item-marketplace.com
  facebook-item.4012985119237497395123.pro
@@ -156055,6 +155316,8 @@ facebook-login.xnx54sdc63xsxx22sx3xcvr5.facebook-secure-mobile-login.zerinth.co.
  facebook-login.xnx54sdc63xsxx22sx3xcvr5sanqfchny.zerinth.co.in
  facebook-m.parchisi-star-gift.ml
  facebook-manage-secure-listing-id.item73892204.com
+facebook-market-items38852.natasha-sikand.com
+facebook-marketplace-id44photo67181134666-item.com
  facebook-marketplace-item-745235462.tothemaxxup.com
  facebook-marketplace-item.276629608.com
  facebook-marketplace-item.2860381958.com
@@ -156067,6 +155330,7 @@ facebook-marketplace-item.73269064.com
  facebook-marketplace-item.9486864290.com
  facebook-marketplace-item02939203823.karnaphuli.org
  facebook-marketplace-listing-item6654.erii4.xyz
+facebook-marketplace.item-90271.com
  facebook-marketplace.mktiid.com
  facebook-marketplace.us
  facebook-marketplaces-92340.dallasdiadelosmuertos.com
@@ -156080,6 +155344,12 @@ facebook-mobile-login.mhjibon.com
  facebook-mobile-login.tajpharmalb.com
  facebook-network-mail.com
  facebook-news.online
+facebook-notags-00mo65d60.your-guide.net
+facebook-notags-6shm793ddf.your-guide.net
+facebook-notags-7likotq6hq.your-guide.net
+facebook-notags-cd354lxmsn.your-guide.net
+facebook-notags-qyyf86vz5.your-guide.net
+facebook-notags-s35be3gr8.your-guide.net
  facebook-nr.ga
  facebook-nr.ml
  facebook-nr.tk
@@ -156111,7 +155381,6 @@ facebook-page84201016452.com
  facebook-page84361990.com
  facebook-page85221990.com
  facebook-page96725322.com
-facebook-pembatalannblockir.ml
  facebook-phimtoico21.casacam.net
  facebook-phimtoico22.casacam.net
  facebook-po719vs.nenehh.best
@@ -156151,7 +155420,6 @@ facebook-search-results.dealer4-in-your-city.us
  facebook-search-results.properties-for-sale-in-your-area.us
  facebook-search.34-tattoo-artists-in-your-area.com
  facebook-secure-manage-listing.id839120111.com
-facebook-securiry-new-february2021.cf
  facebook-security-account.ml
  facebook-security-cancel-blockir.tk
  facebook-security-check.cf
@@ -156179,7 +155447,6 @@ facebook-supportmail-helpcenter.ml
  facebook-supports.com
  facebook-team-support.analysthawk.com
  facebook-terms-conditions.analysthawk.com
-facebook-tik.gq
  facebook-tr.ml
  facebook-uk.europe-signin.casa
  facebook-up.huidps.com
@@ -156282,6 +155549,7 @@ facebook.com-08203199.superprimavera.pt
  facebook.com-42661120.mezcalunion.com
  facebook.com-account.security.smahost.ro
  facebook.com-ads-id-588515710.facebooik-ads.com
+facebook.com-agreement-update.vslcomputers.com
  facebook.com-au-personal-login.growmaxmedia.com.au
  facebook.com-check-2579600192.kranti-india.org
  facebook.com-check-3134306713.kranti-india.org
@@ -156431,6 +155699,7 @@ facebook.common.uz
  facebook.compost388facebook.com.mdwmart.com
  facebook.comsopport.clientarea.pgssa.tk
  facebook.comvd.de
+facebook.comweb.net.centurylinknetworkbd.com
  facebook.conn.pw
  facebook.conn.workwithamazon.com
  facebook.corona-virus-news.xyz
@@ -156479,6 +155748,7 @@ facebook.item-online-view-post-6428942.xyz
  facebook.item43673.com
  facebook.item53215.com
  facebook.jelengradacac.com
+facebook.jobsite.life
  facebook.kaioum.com
  facebook.kalyanstone.com
  facebook.kangleigeeks.in
@@ -156486,6 +155756,7 @@ facebook.karmadlazwierzaka.eu
  facebook.kingsky32.co.kr
  facebook.lattam.com.mx
  facebook.lauritodomenico.com
+facebook.letsauth.org
  facebook.lidia39.club
  facebook.lifecenter.ca
  facebook.listing.cars.fx214.xyz
@@ -156753,14 +156024,12 @@ facebooklogin.join-watsap63.ga
  facebooklogin.krubs58.cf
  facebooklogin.mymom.info
  facebooklogin.ygto.com
-facebookloginpagee.blogspot.com
  facebookmepro.com
  facebookmessages.ml
  facebooknew.club
  facebooknotify.herokuapp.com
  facebooknu.com
  facebookpay.switchfinance.us
-facebookpembatalannblockir.tk
  facebookpemblokiran.kozow.com
  facebookphisher.razorsharpdesigns.com
  facebookphotos.fotoalbum0147.com
@@ -156775,8 +156044,6 @@ facebookpyt.tk
  facebookrecovery.com.diginik.net
  facebookri.com
  facebooks-notice.com
-facebooks-pembatalannblockir.ml
-facebooks-vn.tk
  facebooks.me
  facebooks.services
  facebooks.weblls.com
@@ -156916,6 +156183,7 @@ facee.fr
  faceeb00k.xyz
  faceebk.cf
  faceebk.xyz
+faceebok-id97524-manage.listing-item5942762295482.com
  faceebok-page59137502-id56718935238856.rauchethanding.com
  faceebok.com-id57621935374568.item585192057859215782.com
  faceebok.listing-ad7238575259-item571629254784.com
@@ -157039,7 +156307,6 @@ factorygun.club
  factoryoutlets.pk
  factsfirstmedia.com
  factualitical.xyz
-facturation-techni.3utilities.com
  facturation.ddns.net
  facturation90range.com
  facturationservice.com
@@ -157164,6 +156431,7 @@ fakih.net
  fakiuyouhhh.ddns.net
  fakoyufuyuwgvreo-dot-millinium.ey.r.appspot.com
  fakryx.com
+faks.tuturutu.eu
  fakt-news24.eu
  fakt24-news.eu
  fakt24warszawa.com.pl
@@ -157343,6 +156611,7 @@ fanfaronadee.com
  fanfaronquays.com
  fanfold-loops.000webhostapp.com
  fangqianghuaye.com
+fanhuntersagency.com
  fanina-tools.pl
  fankaerclothing.com
  fannmedias.com
@@ -157416,6 +156685,7 @@ faremakers.co.uk
  fares123.ddns.net
  faresmotors.com
  farg074go894true.com
+fargaatonaomaatitonawalomaaksa.blogspot.com
  fargo-279021.df.r.appspot.com
  fargo-appmember.mobi
  fargo-appmember.team
@@ -157484,10 +156754,12 @@ farmalinio.cloudaccess.host
  farmasiteam.com
  farmatrans.com
  farmbrokenzo.me
+farmers2public.com
  farmerschoice.co.ke
  farmerslounge.org
  farmexbot.online
  farmfit.ru
+farmnatural.in
  farmskinsgiveaway.com
  farmstrono.xyz
  farmsys.in
@@ -157560,6 +156832,7 @@ fasibuku.com
  faskskyaplo.creativespaces.net.in
  fasoiucp.goruli.com
  fasomeat.com
+fasscebook-com.000webhostapp.com
  fast-joingroup1.itsaol.com
  fast-joingrubwa4.xxuz.com
  fast-kusu-7207.boy.jp
@@ -157650,7 +156923,6 @@ fatimaferreira.com
  fatimamirandayoga.com
  fatinzbeaute.com
  fatlossmanualaunder.us
-fatlosssystem.casa
  fatmaesra.com
  fatmanurtaskesen.com
  fatopetshop.com
@@ -157670,6 +156942,7 @@ fatturapratichearu.com
  fatturarearubapagamento.com
  fatturaservizio.club
  fatturaservizio.live
+fatturazione-aruba.com
  fatturazione.aruba.1w8fstqj9a3zmzvhost115095.lowhost.ru
  fatturazione.jdevcloud.com
  fatturazione000.com
@@ -157738,6 +157011,7 @@ fayezhang.com
  fayjg.shoofgoal.com
  fayngduvg.goruli.com
  fayrecreations.com
+fayrewinds.org
  fayridgesuite.buzz
  faysal55.ddns.net
  faysos.com
@@ -157919,13 +157193,13 @@ fb-instagram-com.ml
  fb-item-1662553222.com
  fb-item-2947co.site
  fb-item-345737364.com
-fb-item-436548835782.com
  fb-item-4729476.com
  fb-item-48191041.com
  fb-item-5480me.club
  fb-item-57440marketing.website
  fb-item-587463532.com
  fb-item-6428.com
+fb-item-782635267521.com
  fb-item-791681.com
  fb-item-9145132.com
  fb-item-91632.com
@@ -158026,6 +157300,7 @@ fb-marketplace-business.us
  fb-marketplace-cars.us
  fb-marketplace-classifieds.club
  fb-marketplace-item-12216331.com
+fb-marketplace-item-1837645783.com
  fb-marketplace-item-530796437595316.online
  fb-marketplace-item-93792068275.com
  fb-marketplace-item.us
@@ -158243,6 +157518,8 @@ fb-sig-in6.cf
  fb-sig-in6.ga
  fb-signinsolution.com
  fb-sistem-kuncii.webnode.com
+fb-status-0twe5a41.juliascloset.lk
+fb-status-2da3kn35.juliascloset.lk
  fb-support-authenticate-web.000webhostapp.com
  fb-support-reset-credentials.000webhostapp.com
  fb-surelkp.xm8in.tk
@@ -158279,16 +157556,6 @@ fb-uber.sys-13k.xyz
  fb-unimporve-00443400000039hk.cf
  fb-unimporve-007778800039hk.cf
  fb-update-policy.365wrf5r.com
-fb-updates-100987647413543510-sb.tk
-fb-updates-100987647413543511-sb.tk
-fb-updates-100987647413543512-sb.tk
-fb-updates-100987647413543513-sb.tk
-fb-updates-100987647413543514-sb.tk
-fb-updates-100987647413543515-sb.tk
-fb-updates-100987647413543516-sb.tk
-fb-updates-100987647413543517-sb.tk
-fb-updates-100987647413543518-sb.tk
-fb-updates-100987647413543519-sb.tk
  fb-verifiedbadge-accountform.tk
  fb-video-vivo.club
  fb-video.weebly.com
@@ -158706,7 +157973,6 @@ fbhtp.com
  fbic24.000webhostapp.com
  fbid-123625402580779-set.gm.26696.verify.serve.g0v.me
  fbigov.co
-fbihlf2q.cc
  fbinfo2august.com
  fbinsta55.000webhostapp.com
  fbinstagramcopyright.com
@@ -158776,6 +158042,9 @@ fbmarketplace.realtorrproperts.us
  fbmarketplace663784427712044.com
  fbmarketplace8243870935.com
  fbmarketplace864787680688823.com
+fbmarketplacead13219009146876.com
+fbmarketplaceitem13219009146876.com
+fbmarketplaceitem1322190091468776.com
  fbmarketplaceitem1553949794780442.com
  fbmarketplaceitem234120701363488.com
  fbmarketplaceitem240737370322526.com
@@ -158794,6 +158063,7 @@ fbmarketplaceitem744016979710151.com
  fbmarketplaceitemf3501339902616401792.com
  fbmarketqld.live
  fbmarketsplace.us
+fbmarketsplaceitem1402604093406555.com
  fbmcffkpcjpankbq.top
  fbmdsn.com
  fbme-3948382982.live
@@ -159254,13 +158524,13 @@ fbss-unimprove-44334343hk.ml
  fbstarttouse.000webhostapp.com
  fbstats12.000webhostapp.com
  fbsupport3432.000webhostapp.com
-fbsupportbusiness.com
  fbsupportme.000webhostapp.com
  fbtech00.000webhostapp.com
  fbthentication.000webhostapp.com
  fbtsotbs.com
  fbuadnfksadj.webhostastest.top
  fbufz.xyz
+fbupdsec.com
  fbusiness.8756453445675.com
  fbusiness.marthathomas935.com
  fbv3-loginweb.n4t.co
@@ -159457,6 +158727,7 @@ fdgh4gh345.ru
  fdghdf344.ru
  fdgokwnlt.goruli.com
  fdhbfdx5f.ddns.net
+fdhdfhtrhdhbtd.easy.co
  fdhfd.gdfgjkdfh.com
  fdhidijfg.com
  fdhk.net
@@ -159637,6 +158908,7 @@ feggg.7jtba3.cn
  fegrp-download.com
  fegytxmqxkbzmxkrnxkliykbnxorixssnred-dot-off94032393204.uk.r.appspot.com
  fehler-siegen.de
+fehrfinancial.com
  feiashao.space
  feicuixue.com
  feieo.com
@@ -159683,6 +158955,7 @@ felipefeeh1.000webhostapp.com
  felipegussilborges.com
  felipetome.ga
  felipevargas.com.br
+felippealfredo.com
  felisadnryou.cf
  felisardon.temp.swtest.ru
  felixburgelcom.nckichicago.gdn
@@ -159696,7 +158969,6 @@ fellowesshreddersindia.com
  fellowguru.com
  fellowshipedit.com
  felomologo.com
-feloowsket.casa
  feltna.si
  feltonbde.xyz
  feltonhills.buzz
@@ -159876,6 +159148,7 @@ fetacdfgik.duckdns.org
  fetb.vip
  fetcc5akr.vercel.app
  fetedesvendangesauvernier.ch
+fetguet.c-agricole-inf.com
  fetih1453.org.tr
  fetish-art.net
  fetishistic-degrees.000webhostapp.com
@@ -159908,6 +159181,7 @@ ff-event1109.ddns.mobi
  ff-eventdm91.ddns.mobi
  ff-freedm62.ddns.mobi
  ff-geiersberg.at
+ff-grup.kozoa78.cf
  ff-im.000webhostapp.com
  ff-mabar.free-greop.gq
  ff.com.claim.your.bonus.updateyouraccxount.ml
@@ -160132,6 +159406,7 @@ fhamxjcjszzrbvyg-dot-millinium.ey.r.appspot.com
  fhawamerica.com
  fhawz.anahkedm.com
  fhayazilim.com
+fhb-marketplace.com
  fhbdjlhbf.mrbonus.com
  fhbjdkm13.com
  fhbrmjldgrujzesebidoptveju-dot-gleowayel400503.uc.r.appspot.com
@@ -160196,6 +159471,7 @@ fi-refund.online
  fi.a.tp9y.skylinecloud.xyz
  fi8orm3k-1skp2hsp2.vercel.app
  fiaebjtfuebczygbctvugkyiaw-dot-gleowayel400503.uc.r.appspot.com
+fiafunupe.flywheelsites.com
  fiajureen.000webhostapp.com
  fiash.com.cn
  fiasyfssa.mywps.me
@@ -160209,7 +159485,6 @@ fiberjalon.com
  fiberspotqatar.com
  fibertectelecom.com.br
  fibill.com
-fibregrip.cyou
  fibresat.co.za
  fibrofolliculoma.info
  fibromapp.com
@@ -160264,7 +159539,6 @@ fidowireless.tech
  fidtzpazryetfkza-dot-millinium.ey.r.appspot.com
  fiduciaire-hrt.com
  fiduciaryfocusllc.com
-fieldestatestownhomes.com
  fieldingtruffle.com
  fieldofabundance.ca
  fielworship.com
@@ -160915,6 +160189,7 @@ fix-mydevice.live
  fix-three.com
  fix.partyi.info
  fix07102020-emailsolutionstech.web.app
+fixauto.illumetechnology.com
  fixbharat.com
  fixbisque.com
  fixcepcom.chifanassume.top
@@ -161082,6 +160357,7 @@ flag-144425820.amarilisperu.com
  flag-156037398.amarilisperu.com
  flag-161206939.amarilisperu.com
  flag-161647309.amarilisperu.com
+flag-19436048.royal-eng.ps
  flag-215870544.amarilisperu.com
  flag-235727965.amarilisperu.com
  flag-24167805.royal-eng.ps
@@ -161332,7 +160608,6 @@ flgmedia.nl
  flickersoulfuldarling.buzz
  flickertheflame.com
  flie0010000.000webhostapp.com
-fliernotes.com
  flightarabia.com
  flightgoexpress.com
  flightstoeurope.us
@@ -161409,6 +160684,7 @@ flopseptum.com
  flora4567.com
  floradna.com
  floralwaters.a1oilindia.in
+floralwhitelazymp3.fernando45.repl.co
  florance92830.club
  florapansiyonotel.com
  floraselfcom.nckifrance.gdn
@@ -161484,7 +160760,6 @@ fluidoflovecom.shaxiapurpose.top
  fluidou-71.ml
  fluidtechfze.com
  fluoder.com.py
-fluorescent-mint-fact.glitch.me
  fluorinemoglen.com
  flurried-plead.000webhostapp.com
  flusanie.com
@@ -161523,7 +160798,6 @@ flyingbuddhadesign.com
  flyinghorsesmusicentertainment.com
  flynngroupinc-com.pagexl.com
  flynnwebapps.xyz
-flyoneair.casa
  flyp0rter.com
  flytag.store
  flythissim.com
@@ -161531,6 +160805,7 @@ flywheeltaxi.net
  flzbogrxaajhdzfa-dot-millinium.ey.r.appspot.com
  fm-fx.com
  fm-kantoormeubelen.nl
+fm-loerrach.de
  fm-x.onderhost.com
  fm.centeredinself.com
  fm0rc.mentriqq.com
@@ -161554,7 +160829,6 @@ fme.rogagot.com
  fmejixhxxmfblrxjfmxremuosi-dot-gleowayel400503.uc.r.appspot.com
  fmessenger1inicio.000webhostapp.com
  fmeuniversity.com
-fmfcgxwlsjwvsvwsmvtqhbpdlglsrgzj.000webhostapp.com
  fmfrlvnfodykndjy-dot-millinium.ey.r.appspot.com
  fmg1f.addroits.com
  fmgodhmshgwjtinuoxvdcltghovjebgiyykt-dot-glegen303939423233.ue.r.appspot.com
@@ -161798,6 +161072,7 @@ food-blogs.000webhostapp.com
  food-stories.ru
  food.hsh-bh.com
  food.jopedu.cn
+foodallergiez.com
  foodandwoodworks.com
  foodblog.club
  foodbooktv.com
@@ -161808,6 +161083,8 @@ foodera.co
  foodexkorea.com
  foodfocus.in
  foodforjoy.in
+foodforkidsgrowth.com
+foodfrozenideas.com
  foodfrozenjakarta.com
  foodgradepackagingsupply.com
  foodideh.com
@@ -161829,6 +161106,7 @@ foodtraveldrink.com
  foodward.mkv-consulting.com
  foodwaydelivery.com
  foodworks.mu
+foodzsafety.com
  foojlskfkeohkftk-dot-millinium.ey.r.appspot.com
  fool-signin-webcsr-online.com
  fooledbeer.xyz
@@ -161846,11 +161124,11 @@ footechanes.biz
  footless-crust.000webhostapp.com
  footlooking.kl.com.ua
  footrestsilver.com
+footweardirect.elin.co.za
  footytube.top
  footzyflipflops.com
  foozoop.com
  fopckwboqvndntbe-dot-millinium.ey.r.appspot.com
-for-confirmation-from-cop-supp.ml
  for-me.design
  for-realestate-page-736171177.com
  for-remont.ru
@@ -161996,13 +161274,13 @@ form.ref10-return.com
  form.support-updateaccid.bnlpes.com
  form.typeform.com
  form8.sadek-webdesigner.com
+formacao.org.br
  formacioncis.com
  formacionz.com
  formafitness.com.br
  formal-audio-279012.uc.r.appspot.com
  formalab.info
  formalincom.nckiamerican.gdn
-formalrefund.guru
  formandbackground.com
  formanymens24.co.com
  formatcomputers.net
@@ -162202,15 +161480,9 @@ foulturrin.com
  found-witnesses.000webhostapp.com
  found.new-in.us
  found.sing-us.com
-foundations-mx-19976486547863211.tk
-foundations-mx-19976486547863212.tk
-foundations-mx-19976486547863214.tk
-foundations-mx-19976486547863215.tk
-foundations-mx-19976486547863216.tk
-foundations-mx-19976486547863217.tk
-foundations-mx-19976486547863218.tk
-foundations-mx-19976486547863219.tk
-foundations-mx-19976486547863220.tk
+foundations-mx-19916486547863001.tk
+foundations-mx-19916486547863002.tk
+foundations-mx-19916486547863003.tk
  foundlity.com
  fountainofhope.com
  four-by-four.club
@@ -162355,6 +161627,7 @@ fr-fr.facebook.com.online-supportmain.com
  fr-fr.xn--acebook-mjb.com
  fr-icloud.com
  fr-impots.be
+fr-ntfx.com
  fr-ntfx.link
  fr-paypalobjects-manage.com.webepitome.com
  fr-postalecompte.com
@@ -162524,7 +161797,6 @@ free-10000-listings-due-today-3wedd44dw.xyz
  free-10000-listings-today.live
  free-accountsbox.com
  free-airtime.ga
-free-aitems.gq
  free-aja.com
  free-amazon.monster
  free-bitco.online
@@ -162533,6 +161805,7 @@ free-bytes.com
  free-chat981.ml
  free-claim4.cf
  free-claims62.cf
+free-claimzlq.tk
  free-depth.ru
  free-doppler.fun
  free-event-pubgmetro16.lkgdsca.ml
@@ -162542,7 +161815,6 @@ free-fire-price.000webhostapp.com
  free-flower-mongoose.glitch.me
  free-fooding.site
  free-funky.com
-free-gifts-pubgs.ml
  free-grub.my.id
  free-instgramfollowers.000webhostapp.com
  free-instgramfollowingget.000webhostapp.com
@@ -162741,7 +162013,6 @@ freemaintance110qqeddzxxyaki.xyz
  freemanhunt.ml
  freemanps.com
  freemaster.online
-freematerialmetroroyale.com
  freembyeasgc.000webhostapp.com
  freembyeaslla.000webhostapp.com
  freemobile-assistance-idfr.com
@@ -162822,7 +162093,6 @@ freespinevents.com
  freespinpubgmobile.com
  freespins18k.xyz
  freespins198.xyz
-freespinupdate.com
  freespiritmind.com
  freespiritweddings.com
  freestickers-vk.ml
@@ -163011,7 +162281,6 @@ friendsacrossthepasefika.buzz
  friendsandbrgrs.com
  friendsfirst.online
  friendsgroupsindia.com
-friendshipcell.guru
  friendslawassociate.com
  friendsofmenengai.org
  friendsofsluhockey.com
@@ -163084,7 +162353,6 @@ fromamazon.amazonfo.icu
  fromamazon.xyz
  fromamazonstore.xyz
  fromamzoncardservices.buzz
-fromamzonocardtherservicesmail.biz
  fromattacker.xyz
  fromattyahoomailnetfay.weebly.com
  fromattyahoomailsignintoupdatetothenewestversion.weebly.com
@@ -163102,6 +162370,7 @@ fromthelipsof.com
  fromthenotice.newamazoncojpdns.buzz
  fromthesky.top
  fronded-sources.000webhostapp.com
+frontal.gaming.grubwhatsapp-2021.ga
  frontal7.000webhostapp.com
  frontalgroup.my.id
  frontalgrup.v-26.my.id
@@ -163115,6 +162384,8 @@ frontierpowerhosting.com
  frontierrecruitment.com.au
  frontierweldingllc.com
  frontknife.work
+frontlearn.co.ke
+frontline-leaders.10xrewards.us
  frontlinefinance.info
  frontlineph.uk
  frontoff.live
@@ -163129,14 +162400,12 @@ froshnationng.com.nsgl.xyz
  frospubgm.com
  frostbest.com
  frostbill.com
+frosteams.com
  frostmorg.com
-frostmrewerds.com
-frostpubgm.com
  frosty-ardinghelli-2fad11.netlify.app
  frosty-benz-329e5d.netlify.app
  frosty-bore.netlify.com
  frosty-curie-82a6dc.netlify.app
-frosty-fermat-051f1b.netlify.app
  frosty-nobel-ca7f68.netlify.app
  frosty-ramanujan-09342d.netlify.app
  frosty-wiles-7e6058.netlify.app
@@ -163236,7 +162505,6 @@ fse2020.com
  fsecurity-authenticate.000webhostapp.com
  fseerere.bodybydesignfl.com
  fsefsfeg.xyz
-fsemvdgdrvokmxqdkfjluftpva-dot-gleow2021ja.ue.r.appspot.com
  fsf4t4gd.club
  fsfiyusbxfhuokps-dot-millinium.ey.r.appspot.com
  fsfydq.com
@@ -163263,7 +162531,6 @@ fspzdjbgpvjxfipv-dot-millinium.ey.r.appspot.com
  fsqnvuyparkzavastkploqveuq-dot-gleowayel400503.uc.r.appspot.com
  fsr.goruli.com
  fsr2ojyz3asfgu-g7rxvsvvm.vercel.app
-fsryuuis.work
  fsslg.com
  fsslptljsxktuzgq-dot-millinium.ey.r.appspot.com
  fssrnvrbboztitdy-dot-millinium.ey.r.appspot.com
@@ -163295,6 +162562,7 @@ ftbvcyarftnwhdku-dot-millinium.ey.r.appspot.com
  ftcgyvhubj4.com
  ftcr2.codesandbox.io
  ftcyaf.tanglescanner.com
+ftdbbssotfixnkvrjltcmvzvij-dot-gleow2021ja.ue.r.appspot.com
  ftdcaluhsbpdhaml-dot-millinium.ey.r.appspot.com
  ftdfad347r.6e3t.mwmt.xyz
  ftdgh.yqmmwh.cn
@@ -163306,6 +162574,7 @@ ftflirjdxqcuwhpf-dot-millinium.ey.r.appspot.com
  ftg-refunds.com
  ftgbewwaqw.accurateemployee.net
  ftgbvdewsqa17.vinouno.net
+ftgqdnshmdtzqflcajlvtkquvi-dot-gleow2021ja.ue.r.appspot.com
  fti10021588711003-com.preview-domain.com
  ftik.iainkediri.ac.id
  ftintoro.netlify.app
@@ -163339,7 +162608,6 @@ ftp.instagramsupportlive.cf
  ftp.janinepurves.com
  ftp.kingdomhotelsupplies.nl
  ftp.kreijkesafbouw.nl
-ftp.n3twork30cm.ml
  ftp.products.serveuser.com
  ftp.quickclickresume.com
  ftp.smmha.com
@@ -163361,7 +162629,6 @@ ftromppq75c-klepf-com.eoldal.hu
  ftrtbfbgylncxjat-dot-millinium.ey.r.appspot.com
  ftryu.tk
  ftsrscujutpzsumj-dot-millinium.ey.r.appspot.com
-ftsuyiiop.work
  fttzysqbhfupawhhtkclqbzycistlctuablf-dot-cryptic-now-290917.ey.r.appspot.com
  ftu.goruli.com
  ftvyiihbnhojwbda-dot-millinium.ey.r.appspot.com
@@ -163681,6 +162948,7 @@ fuxin.yfqzdfd.com
  fuyang1.06rl.com
  fuyao.tech
  fuyingyulecheng.tavmo.com
+fuzedev2.com
  fuzhou.06rl.com
  fuzhou1.06rl.com
  fuzhou1.06wi.com
@@ -163698,7 +162966,6 @@ fvehztdlwzcxsuvg-dot-millinium.ey.r.appspot.com
  fvgpnyxanshrxfjhyelfhoufpg-dot-gleowayel400503.uc.r.appspot.com
  fvilonkos1.xyz
  fvirbcxqiwfdnczt-dot-millinium.ey.r.appspot.com
-fviup1gq.cc
  fvj.dojnh.com
  fvjiafuli.com
  fvkoblach.at
@@ -163809,7 +163076,6 @@ fxxfazraidxaeumg-dot-millinium.ey.r.appspot.com
  fxyfqqktsmedfray-dot-millinium.ey.r.appspot.com
  fy.3dfy.top
  fy0506.cn
-fy0eaxsz.cc
  fy1i0cipn.et.r.appspot.com
  fy3s3x.xyz
  fyaehnvmuxckbmsj-dot-millinium.ey.r.appspot.com
@@ -163906,7 +163172,6 @@ fzywqfcatjpamwmu-dot-millinium.ey.r.appspot.com
  fzz.gg
  fzzelqmmahejpnktvjbcannehgjsuevancdj-dot-solar-vertex-285913.rj.r.appspot.com
  fzzxvuezroxonrzn-dot-millinium.ey.r.appspot.com
-g-3.top
  g-3k.jaysbrand.com
  g-adsgo.com
  g-amazon.top
@@ -164048,11 +163313,13 @@ gabrielinsg-001-site1.htempurl.com
  gabrielkrail.com
  gabriellesrestaurant.com
  gabrielsan.com
+gabrielvalentin.ro
  gabserv53.com
  gabsource53.com
  gabuanggrubbokep.000webhostapp.com
  gabubggrubwhatsapp.join-gruphot.com
  gabug-terus.000webhostapp.com
+gabung-bro.toh.info
  gabung-dan-meriah-grup-budi01-gaming.000webhostapp.com
  gabung-groub-bokep-seksi-2020.kulgar-infoupdate.ga
  gabung-groub-whatsapp-bokep.bft25.com
@@ -164107,6 +163374,7 @@ gabunggroup.whattsapps.com
  gabunggroups.000webhostapp.com
  gabunggroupwa.claim654.com
  gabunggroupwhatsapp1.tk
+gabunggroupwhatsappnotnotneww.get-now21.ml
  gabunggrubbokep.virall.in
  gabunggrubkita.oottz.com
  gabunggrubwahotmasuksini.000webhostapp.com
@@ -164134,6 +163402,7 @@ gabunggrupwhatsappbokep18.zzipxv.ga
  gabunggrupwhatsappbokephott.grub-bokepxnxx865.tk
  gabunggrupwhatsappnewwfiral20.chatwa9.tk
  gabunggrupwhatsappsange.wa-hot55.ml
+gabungjoinevent8.tk
  gabungkali-hendi55.gabung.org
  gabungkuygrupfreefire2020.000webhostapp.com
  gabungrupwhatsapp.whatsapp543.my.id
@@ -164314,7 +163583,6 @@ gambiiit2ls.000webhostapp.com
  gamdom-events.xyz
  gamdomgiveaway.club
  gamdotuolaam.gb.net
-game-mobile-legends-event-party.000webhostapp.com
  game-oreoo-4.com
  game-psychology.ru
  game-xroll.com
@@ -164488,6 +163756,7 @@ garagedoorrepairgarner.com
  garagedoorrepairparamus.com
  garagedoorrepairteaneck.com
  garagedoorsrepairraleigh.com
+garagelivet.se
  garagemarches.com
  garageportrait.com
  garageprosofflorida.com
@@ -164521,6 +163790,7 @@ gardengate.in
  gardenia-bd.com
  gardeniabakery.com
  gardenll.accesscam.org
+gardenoak.net
  gardenstrutturelegno.com
  gardenworx.ae
  gardiantop.xyz
@@ -164673,6 +163943,7 @@ gaus-skin.com
  gaushyang.co.th
  gausselectro.in
  gautamiheights.com
+gautaminfra.co.in
  gauthier.communication-iscpalyon.com
  gautmission.org
  gauwayngiget.tk
@@ -164851,6 +164122,7 @@ gcogle-analytics.com
  gcoronag.000webhostapp.com
  gcorpsa.com
  gcowntlxasuhadfe-dot-millinium.ey.r.appspot.com
+gcpc.co.id.chronoscurtain.com
  gcpfs.info
  gcqjx.com
  gcqpoyokibsccivh-dot-millinium.ey.r.appspot.com
@@ -165272,6 +164544,7 @@ georoc.co.za
  georqecourey.com
  geos1.cf
  geosealf.com
+geosigma.cl
  geositery.us
  geosrt.com
  geotechnic.co.uk
@@ -165538,6 +164811,7 @@ getsee-soft.site
  getsee.services
  getsees.xyz
  getsharktank.com
+getskinfree.com
  getskinmobilelegends.ml
  getskinpubgs13.loseyourip.com
  getskinrewardpubg.freeddns.com
@@ -165662,7 +164936,6 @@ gfi-albania.com
  gfindvf.com
  gfiouduco.000webhostapp.com
  gfiqwzmwwqkyjcxg-dot-millinium.ey.r.appspot.com
-gfisjgidji.000webhostapp.com
  gfixprice.space
  gfjgjhjkkk.page.link
  gfjhryret.com
@@ -165872,6 +165145,7 @@ ghipcstttikyjdri-dot-millinium.ey.r.appspot.com
  ghjfghjdfsdas.xyz
  ghjjjjmail.godaddysites.com
  ghjkf.fsjhgjkdhfs.com
+ghjkl879yuhy8.000webhostapp.com
  ghjklhjf.ru
  ghjkljj6.com
  ghjoxrqfbfngmfke-dot-millinium.ey.r.appspot.com
@@ -165907,7 +165181,6 @@ ghsghiusyu9882.com
  ghshjws.tk
  ghsqa.xyz
  ghsxh.xyz
-ghsyuioo.cam
  ghszgnvhrecvkjdszjhmjtpfac-dot-gleowayel400503.uc.r.appspot.com
  ght4dzr.com
  ghtamnrnjngya.icu
@@ -165989,6 +165262,7 @@ giffgaff-info.help
  giffgaff-me.com
  giffgaff-mobile-uk.com
  giffgaff-new1.com
+giffgaff-sim-support.com
  giffgaff-sim.support
  giffgaff-simswaps.support
  giffgaff-uk-gdpr.com
@@ -165999,6 +165273,7 @@ giffgaffer.support
  giffgaffs.support
  giffgaffsim-swap.com
  gifs.vone.appskhonia.com
+gift-claim5.tk
  gift-itemspubg.qhigh.com
  gift-spin.club
  gift-update-ml.cp-servlk.xyz
@@ -166100,6 +165375,7 @@ gimibimxurcbpdchjgptymrfqp-dot-gleowayel400503.uc.r.appspot.com
  gimsuri.xyz
  gimta-door.web.app
  gimumurwyqozmxsq-dot-millinium.ey.r.appspot.com
+gina-miles.shop
  gina3747523.xyz
  ginaandadrian.com
  ginbombardier.com.br
@@ -166128,6 +165404,7 @@ gioaqjklhoxf.eu
  gioielleriagibertini.com
  gioitrerusseykeo.com
  gioliofattura.xyz
+gionkeris23.com
  gioo.co
  giordaino.com
  gioto-ff-garena.000webhostapp.com
@@ -166198,6 +165475,7 @@ gitbim.com
  gitchia.com
  gite-la-brissais.fr
  gite-lafage.com
+giteletropical.com
  gites-pyrenees-estaing.com
  gitformage.com
  gitformlife.com
@@ -166250,6 +165528,7 @@ giveawaychocoflakes.000webhostapp.com
  giveawaycovid19.com
  giveawayf.toh.info
  giveawayfreefire6.000webhostapp.com
+giveawaygame-new2021.cf
  giveawayhp34.25u.com
  giveawayhp35.25u.com
  giveawayke17boz.ooguy.com
@@ -166348,6 +165627,7 @@ gjtshabvlpcjqduk-dot-millinium.ey.r.appspot.com
  gjttaamibpysxadlgatx.com
  gjulenbpaphqkywpolhjbxbtdz-dot-gleowayel400503.uc.r.appspot.com
  gjusvoqmkddfahvoccst.com
+gjutoixpvcqrnvkqemzdyijbzp-dot-gleow2021ja.ue.r.appspot.com
  gjv28ylgxyii.talagaremix.com
  gjvpuipydmnsckco-dot-millinium.ey.r.appspot.com
  gjvtri.org
@@ -166379,7 +165659,6 @@ gkh-psp.ru
  gkhdwewhwdricuyw-dot-millinium.ey.r.appspot.com
  gkilpatrick.town.ie
  gkjao02kgml12dhfaffgw537hvfs.top
-gkjuvboxlskgcphusacohkvzgd-dot-gleow2021ja.ue.r.appspot.com
  gkjx168.com
  gkkgorzow.pl
  gkldl.godaddysites.com
@@ -166500,7 +165779,6 @@ glibonlinewebapps.com
  gliclof.org
  glicouk.com
  glide.co
-glidenervous.cyou
  glidenetglobalcom.batwoqisep.top
  glidenetglobalcom.chifanassume.top
  glidfy.com
@@ -166643,6 +165921,7 @@ globalyouthrecruitment.com
  globdesign.com
  globeartdesigners.com
  globedivers.wordpress.com
+globeexchang.com
  globemblematicv.com
  globercm.com
  globibo.com
@@ -166662,6 +165941,7 @@ gloobdecor.com
  gloodin.com
  gloogle.site
  gloosuj-pomagaj.eu
+gloria312.xyz
  gloriabz.webrevolutionfactory.com
  gloriadating-a.com
  gloriadating-a.pro
@@ -166893,6 +166173,7 @@ go.jxvector.com
  go.libertymotorsonline.com
  go.steamid.top
  go.supportline.cf
+go.swipez.in
  go.t500track5.com
  go.xsuad.com
  go04.xyz
@@ -166925,7 +166206,6 @@ goaudio.info
  goazteiz.com
  gob2020-ayudas.com
  gobabynames.com
-gobalpark.casa
  gobbojr.com.br
  gobccr.com
  gobestchgo.com
@@ -166962,8 +166242,8 @@ godbuntu.net
  goddesshaircare.site
  godeageaux.com
  godeaug.org
+godeeisfrequencyshs.us
  godforme.tk
-godfrequency.buzz
  godgokaogkakga.ml
  godintullahoma.com
  godinyour.life
@@ -167083,6 +166363,7 @@ golbacom.com
  golbalsbcccc.weebly.com
  gold-iq.xyz
  gold-mail.ru
+gold.investforex.id
  gold080.ooguy.com
  goldankaufbiz.shaxiaapril.top
  goldapps.org
@@ -167330,7 +166611,6 @@ goofglte.com
  goofy-brown-edae5e.netlify.app
  goofy-heisenberg-024343.netlify.app
  goofy-heisenberg-557073.netlify.app
-goofy-mcclintock-8f7dcf.netlify.app
  goofy-mcclintock-a02634.netlify.app
  goofy-shannon-7573c7.netlify.app
  googeoffice.netlify.app
@@ -167691,6 +166971,7 @@ gov.taxin-rebate.com
  gov.taxinrebate.com
  gov.taxinrefund.com
  gov.taxre-gain.com
+gov.uk-alert.digital
  gov.uk-auth-c08.com
  gov.uk-auth-c19.com
  gov.uk-auth-c21.com
@@ -167741,11 +167022,9 @@ govaidca.com
  govbrcidades.creatorlink.net
  govca19-int.com
  govdvla.com
-goverla.otdihnavse100.com.ua
  governorsballoonsafaris.com
  govfree.pw
  govhmrc-refundtax.serveftp.com
-govhmrctax-claim.com
  govhotel.us
  govindaevents.com.au
  goviraltoo.com
@@ -167895,6 +167174,7 @@ gpumxbgnqsssnkev-dot-millinium.ey.r.appspot.com
  gpuvutuvihde.in
  gpvatwzcycacmjwb-dot-millinium.ey.r.appspot.com
  gpwo.shoesmogul.com
+gpworksinc.com
  gpyhaeljnouxvnks-dot-millinium.ey.r.appspot.com
  gpzjw8.net
  gpzvwfztbazuhcittazm.live
@@ -167937,6 +167217,7 @@ gqsbqxhtsgqbhynr-dot-millinium.ey.r.appspot.com
  gqtwqatpeomadhny-dot-millinium.ey.r.appspot.com
  gqtxnfqsjdppohywtuwsqaibcssehqmeizdb-dot-glenxpecial3009493.ey.r.appspot.com
  gquijiayap.duckdns.org
+gqumeqekjvgrxrtkyvwmmmhphg-dot-gleow2021ja.ue.r.appspot.com
  gquy4.app.link
  gqvngvvbxoyekoyawmmrjrvgqqxhbkvqoavr-dot-cedar-code-289917.nn.r.appspot.com
  gqvvrrvhheboqdmaoafwfxusbf-dot-gleowayel400503.uc.r.appspot.com
@@ -168163,6 +167444,7 @@ greachich.biz
  greaseautomotive.com
  greaseduthru.com
  great-buys.ru
+great-mind.ga
  great-plus.com
  greatafterbefore77.000webhostapp.com
  greatancestry.cyou
@@ -168205,6 +167487,7 @@ greeceori4flame.000webhostapp.com
  greedyalgorithms.xyz
  greeena.com
  greekelln04.com
+greekjesus.com
  greekmountains.theworkpc.com
  greeltimwordiag.xyz
  green-gold.co
@@ -168406,7 +167689,6 @@ gridkuperd.com
  gridsend-98f14.web.app
  gridwork.nl
  grieche.apptec24.com
-grieflaundry.cyou
  grieta.net
  grievance.gpshyampur.org.in
  griffinblock.com
@@ -168503,7 +167785,6 @@ groubwhatsaap2020.xxx-wa.com
  groughway.buzz
  grounded-therapies.co.uk
  groundedforyoungpeople.com
-groundsystemgensteor.us
  groundwater.co.ke
  group-18-sans.wikaba.com
  group-afr.com
@@ -168539,7 +167820,7 @@ group-porn82uoop.dynamic-dns.net
  group-porn82uosk.dynamic-dns.net
  group-porn82up1.dynamic-dns.net
  group-porn89uq1.dynamic-dns.net
-group-porn8os.dynamic-dns.net
+group-pornphh.dynamic-dns.net
  group-seks-video.wa-xxx.com
  group-sex-whatsapp.wikaba.com
  group-sex82uk.zzux.com
@@ -168550,6 +167831,7 @@ group-vcs-gratiss.000webhostapp.com
  group-vcs-tante-bispak.000webhostapp.com
  group-viral2020.000webhostapp.com
  group-wa-bokep-terbaru.giize.com
+group-wajoin18.tk
  group-watsapp-me18.jetos.com
  group-whatsaop-xx.hostjaya-free.cf
  group-whatsapp-bokep2020.dumb1.com
@@ -169021,13 +168303,11 @@ grub-bokepsimontok.vvipx7.ml
  grub-budi-01-gaming.real-20.com
  grub-chat-wa.000webhostapp.com
  grub-dewasa-bokep-viral-2020.000webhostapp.com
-grub-frontalgming21.gabung-whatsapp.cf
  grub-hot343.giize.com
  grub-mabar-freefire.gleeze.com
  grub-mabar.my.id
  grub-mabarbarengyoutuber.newwww.my.id
  grub-rea.jkub.com
-grub-videobokep.000webhostapp.com
  grub-wa-bok3p18.000webhostapp.com
  grub-wa-bokep-18-keatas-no.000webhostapp.com
  grub-wa-bokep73.000webhostapp.com
@@ -169072,6 +168352,7 @@ grub-whatsappbokep.join-bkeps10.gq
  grub-whatsappmabar2020.tk
  grub-whatshaap.4pu.com
  grub-xnxx.wikaba.com
+grub-youtuber77.ga
  grub.official-com.gq
  grub.whatsapp.new.duppor3.my.id
  grub18-keatasbr.000webhostapp.com
@@ -169252,7 +168533,6 @@ grubwhatsappberbagi.eventprize.top
  grubwhatsappbkp.zyns.com
  grubwhatsappbkp21.bokepsxz.tk
  grubwhatsappbokep.gq
-grubwhatsappcimbrut.duckdns.org
  grubwhatsapphot-new.join-new87.gq
  grubwhatsappjoin.vizvaz.com
  grubwhatsappnew01.lexax1.my.id
@@ -169349,6 +168629,7 @@ grup-free-fire-batelgrounds-com.000webhostapp.com
  grup-happy-18keatas.000webhostapp.com
  grup-hot.mantap2k20.tk
  grup-indonesia-2020.000webhostapp.com
+grup-invit-xyz.cf
  grup-join-whatsapp.vizvaz.com
  grup-join-whattsapp.gq
  grup-juniiv2.ga
@@ -169483,7 +168764,6 @@ grup-whatsappsviral.ftp1.biz
  grup-whatsappx.xnxxx.my.id
  grup-whatshap-free-fire-2020.000webhostapp.com
  grup-whatspp-bokep-indo18.000webhostapp.com
-grup-whtsapp.gq
  grup-youtuber.holds20.com
  grup.18pluss.frezas.my.id
  grup.bokep.wa.crotdsx.ygto.com
@@ -169794,7 +169074,6 @@ grupmabarkhususff.my03.com
  grupmabarmldanpubgmobile.000webhostapp.com
  grupmabarpubgwa2020.000webhostapp.com
  grupmabarthenay.000webhostapp.com
-grupmabarwanotnot.grubwa5.tk
  grupmalangbong.000webhostapp.com
  grupmantepbener.000webhostapp.com
  grupmemekcoy.000webhostapp.com
@@ -169943,6 +169222,7 @@ gruppo-isp-normativa.com
  gruppo-mps.com
  gruppo-mps.it
  gruppobpm-italia.com
+gruppodomus.com.br
  gruppogm.net
  gruppointesa-attivazione-sicurezza.com
  gruppointesa.biz
@@ -170039,6 +169319,7 @@ grupsexwhatsapp.4dq.com
  grupsexycewe.000webhostapp.com
  grupsispersonalstop.com
  grupsjoinwadewasa.join-viip.com
+grupsma.whatsapp-groupwa.gq
  grupswa.guied7.my.id
  grupswa.itsaol.com
  grupsx15.guied7.my.id
@@ -170252,6 +169533,7 @@ grupwhatsapp-bkp.lflink.com
  grupwhatsapp-indo.loginnow.gq
  grupwhatsapp-new.otzo.com
  grupwhatsapp-neww.otzo.com
+grupwhatsapp-notnot.claim61.tk
  grupwhatsapp-notnot.onmypc.org
  grupwhatsapp-terbaru2020.ddns.info
  grupwhatsapp.19covidd.com
@@ -170323,8 +169605,6 @@ grupwhatsappfreefire.login-data-facebook1.gq
  grupwhatsappfrontal.login-55.cf
  grupwhatsapphot18.group-bokepjapan18.gq
  grupwhatsapphotdewasa18plusplus.4dq.com
-grupwhatsappicapoetry.ga
-grupwhatsappinvite18.tk
  grupwhatsapplendir2k20.virall-2020.tk
  grupwhatsappmmo.jos18.cf
  grupwhatsappnew1s.mrbonus.com
@@ -170362,6 +169642,7 @@ grupwhattsappboke.wa-sex.com
  grupwhattsappvideoviralterbaru111690.000webhostapp.com
  grupwhattshappbokepviral.viewx6.com
  grupwhattssappbarbagividiodewasaterbaru2020.000webhostapp.com
+grupwhstappbokep.wikaba.com
  grupwhtsap188.000webhostapp.com
  grupwhtsp010.25u.com
  grupwhtspptlerbaru.000webhostapp.com
@@ -170401,6 +169682,7 @@ gs-jewellery.com
  gs.9i173.com
  gs.dvmdcb.com
  gs.jsscxx.com
+gs.monerorx.com
  gs11fd5.com
  gs68798094387.nw.r.appspot.com
  gs8y7phuok.dt.r.appspot.com
@@ -170566,7 +169848,6 @@ gthavjovbsgimtdypqkwsyabaxxzjyzkmjcb-dot-glxcel49934343434.rj.r.appspot.com
  gtigtex.info
  gtimarkets.com
  gtitco.com
-gtjevekyvnsjwrgnghmljvdzyl-dot-gleow2021ja.ue.r.appspot.com
  gtjjrcmwxcxgemzo-dot-millinium.ey.r.appspot.com
  gtjypro.com
  gtkvrytbyqbrrkta-dot-millinium.ey.r.appspot.com
@@ -170623,6 +169904,7 @@ guarantee.abc-australia.club
  guaranteedshippers.com
  guaranteevaults.com
  guarany.net
+guardarunners.pt
  guardbegun11.ml
  guarderiababyhouse.com
  guardhub.com
@@ -170682,17 +169964,17 @@ guide-09263233.zjlions.org
  guide-13548252.zjlions.org
  guide-20922961.zjlions.org
  guide-25862689.zjlions.org
-guide-31972066.zjlions.org
+guide-26644759.zjlions.org
  guide-33638921.zjlions.org
  guide-35053861.zjlions.org
  guide-35309792.zjlions.org
  guide-43661525.zjlions.org
-guide-45493304.zjlions.org
  guide-45612749.zjlions.org
  guide-55264331.zjlions.org
  guide-57747925.zjlions.org
  guide-58187148.zjlions.org
  guide-60399268.zjlions.org
+guide-62943643.zjlions.org
  guide-68190176.zjlions.org
  guide-69042808.zjlions.org
  guide-81027605.zjlions.org
@@ -170749,6 +170031,7 @@ gulfishop.com
  gulflubeltd.com
  gulfup.me
  gulhanhukuk.com
+gulliver.ma
  gullukomurelektronik.com
  gulosodeoz.com
  gulshanti.com
@@ -171043,6 +170326,7 @@ gygygyf.3k0necw.cn
  gygyiyut7t.lcgsu.cn
  gyheventos.cl
  gyhgiuf.1vu26n.cn
+gyhifektd188qrz.com
  gyhii.cam
  gyhuae2.com
  gyhuajiwa.com
@@ -171079,7 +170363,6 @@ gyrnta.com
  gyroenmoozflgbtngrza-dot-gleowyel040493443434989.wl.r.appspot.com
  gyrowtdhyeyottjo-dot-glexcel1.ue.r.appspot.com
  gysjwyqfcgocxhijfwauxbowxx-dot-gleowayel400503.uc.r.appspot.com
-gysuuiioost.cam
  gytm.jaysbrand.com
  gyttgod.com
  gyu88jh.nrtyjyt44ee.al1av.com
@@ -171248,7 +170531,6 @@ h6bp.jaysbrand.com
  h6iy78n1.firebaseapp.com
  h6jzv004yv6.plexusng.com
  h6od48ipwyklru07whz2tt6lu95p0gk4fudrym2al2l15m6wv.pastoraldomenor.org.br
-h6p9yvxp.cc
  h7-y.svcoding.com
  h709c.svcoding.com
  h712651hp1.com
@@ -171389,6 +170671,7 @@ hadiyecekilis.xyz
  hadoweggplant.com
  hadre.xyz
  hadybook.com
+hae-sun.com
  haeacokzchwhipdt-dot-millinium.ey.r.appspot.com
  haeal.ru
  haek.net
@@ -171506,6 +170789,7 @@ hajjumrahnetwork.com
  hajjumrahpost.com
  hajjumrahtips.com
  hajm.addroits.com
+hak7mrtmkmr66helwgevmqikri-adwhj77lcyoafdy-www-paypal-com.translate.goog
  hakan.gq
  hakanbasar.com
  hakdioewed.com
@@ -172499,7 +171783,6 @@ halifaxonlineaccess-security.com
  halifaxonlinehelp.com
  halifaxonlinehelparea.com
  halifaxonlinesecure.com
-halifaxpayee-authorisation.com
  halifaxpayee-check.com
  halifaxpayee-confirmation.com
  halifaxpayee-remove.info
@@ -172710,6 +171993,7 @@ handsome2afjs.000webhostapp.com
  handsomef8.com
  handsonbeautysalon.co.uk
  handstandbuffer.com
+handynearhypercard.dthsesrerf.repl.co
  handyphoto4.com
  handystarlet.com
  handystepcom.shuiabox.top
@@ -173044,6 +172328,7 @@ haushanapa.com
  haussanjungan.com
  haussman-invest.com
  haussmancapital.com
+hauteh.eu
  hautenorzmandie.info
  hautenuriche.com
  hautinard.kissr.com
@@ -173065,6 +172350,7 @@ havlv.org
  havoezbfiboxsydxwane-dot-gleowyel040493443434989.wl.r.appspot.com
  havygiu4.xyz
  hawa-nafsu.000webhostapp.com
+hawaamsalubayou.com
  hawaii-vacation-homes.com
  hawaiiancbdkingdom.com
  hawaiiholidayhq.com
@@ -173072,6 +172358,7 @@ hawaiiprize.com
  hawasytlatex.com
  hawatransportation.com
  hawefilterinfo.baerseventake.top
+hawgv.com
  hawkandhound.co
  hawkehealthsolutions.com
  hawkeyecontrol.com
@@ -173341,6 +172628,7 @@ hdyibgsftbkfrbrx-dot-millinium.ey.r.appspot.com
  hdyiinlqyrbxlstwbtiz.ru
  he.jjconcreteseattle.com
  he.welcometothehotelc.ru
+he196v.cn
  he57.yolasite.com
  head-jp.com
  head-on-kettles.000webhostapp.com
@@ -173418,7 +172706,6 @@ healthsogood.icu
  healthtech.tn
  healthtekinc.com
  healthteq.tk
-healthtips.buzz
  healthtipsadvisor.com
  healthtrackbd.com
  healthwiseonline.com.au
@@ -173427,6 +172714,7 @@ healthy2infinity.com
  healthyadvice.ml
  healthyat60plus.com
  healthyfruitandvegetables.com
+healthyhaabits.com
  healthylevelsupplements.com
  healthylife25.com
  healthylivingclinique.com
@@ -173450,7 +172738,6 @@ heapgozhlbjqdxop-dot-millinium.ey.r.appspot.com
  heartattakedefed.us
  heartburnsafe.com
  heartchakracheckup.com
-heartchapter.cyou
  heartinternet.co.uk.login.management.sportandrehab.com.au
  heartlandtrbk.000webhostapp.com
  heartmalls.tk
@@ -173466,7 +172753,7 @@ heartstrongyoga.com
  heartychern.com
  heashjshfa-ed9y95iw.firebaseapp.com
  heat.kpdnet.com
-heatattack.casa
+heaterintwintersz.ams3.digitaloceanspaces.com
  heatexchangerspecialist.com
  heather-nifty-mimosa.glitch.me
  heather12.ddns.net
@@ -173715,6 +173002,7 @@ help-dbr57g.cf
  help-dbr57g.ga
  help-dbr57g.ml
  help-deny-mypayees.com
+help-deny-newpayees.com
  help-deregister-payee-personalaccount.com
  help-desk.amazon.com.orders-canceled.com
  help-desk.amazon.com.orders-canceled.net
@@ -173722,7 +173010,6 @@ help-deskhalifax.com
  help-desktm.pw
  help-eemobile.com
  help-eesupport.com
-help-for-lnstagram.ga
  help-forcopyright.com
  help-globall-service.com
  help-go-to-myappleid.com.fullautomovil.cl
@@ -173825,6 +173112,7 @@ help-security.info
  help-service-badgeform.com
  help-service-team0.000webhostapp.com
  help-servicegamilie.000webhostapp.com
+help-servicelnstagram.ga
  help-services-accounts.com
  help-servicesed.info
  help-servicesmail.servehalflife.com
@@ -173833,7 +173121,6 @@ help-snnbc.monster
  help-snnbcs.xyz
  help-support-copright.ml
  help-support-secure.link
-help-supportlive-community.tk
  help-t-mobile.org
  help-team3.com
  help-teamservicesafemyappstore.club
@@ -173843,6 +173130,7 @@ help-to-remove.ouiweb.eu
  help-ukaccount.com
  help-valid.com
  help-verified-badge.com
+help-verify-my-newpayees.com
  help-verifyaccount.cf
  help-wells-fargo.services
  help-wells-secure.info
@@ -173888,6 +173176,7 @@ helpcenter-business.cf
  helpcenter-copyrightservice.com
  helpcenter-lnstagram.epizy.com
  helpcenter-lnstagram.zzz.com.ua
+helpcenter-service.ga
  helpcenter.creatorlink.net
  helpcenter01-amazon.myvnc.com
  helpcentercompanybuisness.com
@@ -173952,6 +173241,7 @@ helpers.ml
  helpfacebookbusiness.com
  helpfk.000webhostapp.com
  helpforcopyright.com
+helpformecenter.tk
  helpforpayment.000webhostapp.com
  helpforteam.com
  helpforviolatiom.000webhostapp.com
@@ -174206,6 +173496,7 @@ hermes.travel.pl
  hermeswritings.com
  herminejackets.com
  herminiaford.buzz
+hermitagegardens.com.au
  herms.com
  hernandeznm.buzz
  hernandeztreeservices.com
@@ -174221,7 +173512,6 @@ herperlovey.com
  herpesddhe.us
  herpesvirusfacts.com
  herpsclaesjsk.us
-herpskcsrresyl.us
  herralum.com.mx
  herrdangwerder.de
  herrenmode.tk
@@ -174540,6 +173830,7 @@ hhyfv.cn
  hhzsotmfkzuencys-dot-millinium.ey.r.appspot.com
  hhzttenvkdpaaezj-dot-millinium.ey.r.appspot.com
  hhzvxhgwtuoxspfejmkwxlaceu-dot-gleowayel400503.uc.r.appspot.com
+hi-cooking.com
  hi-j.com
  hi-peer.com
  hi-peer.eu
@@ -174686,6 +173977,7 @@ highimpactoutdoors.net
  highkickrecords.com
  highland-pools.com
  highlandindustries.xyz
+highlandroadcoc.com
  highlevelnaiveexecutables--five-nine.repl.co
  highlife420.net
  highlifefurniture.net
@@ -174788,6 +174080,7 @@ himdeal.xyz
  himel.co.za
  himertern.com
  himexen.com
+himikasultana.github.io
  himkon.cf
  himkon.ga
  himnmkukxhevljuq-dot-millinium.ey.r.appspot.com
@@ -174820,12 +174113,12 @@ hinmpzpdapjmnkuxvadhlazpzt-dot-gleowayel400503.uc.r.appspot.com
  hinsorn.ac.th
  hinter-den-schlagzeilen.info
  hinterface.com
-hintgalzrlpxqqelzlkomeppjc-dot-gleow2021ja.ue.r.appspot.com
  hiohgtr.gq
  hiolouinqare.com
  hiontrendy.com
  hiosbonhome.com
  hipaapotomus.com
+hipackeg.com
  hipcuyahoga.org
  hipdropde.com
  hipercomputer.com
@@ -175169,6 +174462,7 @@ hm-revenue-secure-login-claim-refund.gov-info.services
  hm-revenue-tax-form-secure.com
  hm-revenue-tax-refunds.ru
  hm-taxrefunduk.com
+hm-taxreturnpayment.com
  hm-uk-taxrefund.com
  hm.dp.ua
  hm.jjconcreteseattle.com
@@ -175325,7 +174619,6 @@ hmrc-taxreceive.uk
  hmrc-taxref.com
  hmrc-taxrefund-gov-uk.com
  hmrc-taxrefundclaim.com
-hmrc-taxrefundpayment.com
  hmrc-taxrepayments.com
  hmrc-taxreturnform.com
  hmrc-taxreturns.com
@@ -175423,6 +174716,7 @@ hmrc.gov.support-return.net
  hmrc.gov.support-uk.net
  hmrc.gov.uk-reclaim.com
  hmrc.gov.uk-tax-refund.lastinfoup.co.uk
+hmrc.gov.uk.mechcaddesign.com.au
  hmrc.govtaxclaim.com
  hmrc.govtaxingrefund.com
  hmrc.help-rebate.com
@@ -175597,7 +174891,6 @@ hmutkwvjvkhkyyie-dot-millinium.ey.r.appspot.com
  hmuv2.blob.core.windows.net
  hmvcri.com
  hmvjofabqfgzgipr-dot-millinium.ey.r.appspot.com
-hmwtxetfpzsbmldlumlsxenvbq-dot-gleow2021ja.ue.r.appspot.com
  hmxwczhmhewisoim-dot-millinium.ey.r.appspot.com
  hmyahymgbwpvsbyo-dot-millinium.ey.r.appspot.com
  hmyj.cc
@@ -175912,6 +175205,7 @@ home-banking-alerts.com
  home-banking-mps.com
  home-bevestigingverificatie.com
  home-case.com
+home-die-sendungsstatus.is-a-techie.com
  home-ee.co.uk
  home-estadomoviles.com
  home-facebook.official-9p.ga
@@ -176361,6 +175655,7 @@ hosting2070987.online.pro
  hosting2086464.online.pro
  hostingcloud.racing
  hostingdnswnl.gb.net
+hostinginsa.com
  hostingmatter.com
  hostingnetweb.com
  hostingpaneldmc.com
@@ -176594,7 +175889,6 @@ hottestklusin.ga
  hottestxxxvideo.com
  hotto.duckdns.org
  hottsevents.ml
-hotupdatev19.com
  hotwa.join-now.net
  hotwagrup-wa.000webhostapp.com
  hotwaindo.000webhostapp.com
@@ -176629,6 +175923,7 @@ housecaffe.it
  houseci.com
  housedream.net
  housedropdeals.com
+houseflush.buzz
  houseforsale.facebokr-marketplace.us
  houseforsale.facebokw-marketplace.us
  houseforsale.marketplacefbk.com
@@ -177394,7 +176689,6 @@ ht.mycophoria.com
  ht.raulisa.com
  ht.teamhired.org
  ht.tjbertsch.com
-ht2fxz4v.cc
  ht2xp.awaykart.com
  ht3010319930087281645261839001993901-381.netlify.com
  ht73-protec.ga
@@ -177432,6 +176726,7 @@ htlps-wwv.bancadeibogota.com-ew.com
  htlps-wwv.bancodebogota.com.co.aceitesymas.com.mx
  htlps-wwv.bancodebogota.com.co.batterycity.mx
  htlvktiosp.duckdns.org
+htm8932034.tonohost.com
  htmailwesed.ru
  html-dl-authentication.com
  html.house
@@ -177452,6 +176747,9 @@ htsws.xyz
  htsxupsxbqabtumi-dot-millinium.ey.r.appspot.com
  htt.munsternissan.com
  http-appie.com
+http-block-fb.cf
+http-block-fb.ga
+http-block-fb.gq
  http-cdek.ru
  http-gabung-grup-bokep-viral.000webhostapp.com
  http.farodevirh.com
@@ -177668,6 +176966,7 @@ humanding.com
  humane-marten.glitch.me
  humanfrequencycom.chifanassume.top
  humanhair.vn
+humanhealth2021.xyz
  humanhealthandscience.xyz
  humani.biz
  humanifestion.xyz
@@ -177712,7 +177011,6 @@ hungertriathlon.com
  hunggiang.vn
  hunghuhuhjij1.duckdns.org
  hungry-hawking-475114.netlify.app
-hungry-lovelace-af9734.netlify.app
  hungry-shockley-48c31c.netlify.app
  hungry-spence-11dfff.netlify.app
  hungry4more.be
@@ -177742,6 +177040,7 @@ huntingomar.com
  huntington.clothnfurnitures.com
  huntington.digital
  huntington.mypi.co
+huntington.net.au
  huntingtonalert.cf
  huntingtonbank.ns02.info
  huntingtonbankingservices.com
@@ -177781,7 +177080,6 @@ husgozqtciqsevyk-dot-millinium.ey.r.appspot.com
  hushavefritid.dk
  hushkush.net
  hushnsh.ddns.net
-husjjaa.cam
  husjklm.com
  huskedeggplantr.com
  huskennemerland.nl
@@ -177821,6 +177119,7 @@ huttechservices.nl
  hutwhitmplt.com
  huuisioio.cam
  huupkhbwk.rogagot.com
+huusiioju.cam
  huvudstadsguiden.eu
  huxdsrladybxvazbqvxmcjurgf-dot-gleowayel400503.uc.r.appspot.com
  huxere.xyz
@@ -177908,6 +177207,7 @@ hwfcobsypwubfefxffavanfashofpylhbwkd-dot-gl494903049.wl.r.appspot.com
  hwfsweden.se
  hwhbqzaqqodzamwv-dot-millinium.ey.r.appspot.com
  hwhqvbyqlqsqcjia-dot-millinium.ey.r.appspot.com
+hwinventory.in
  hwjtilutvshgtuvd-dot-millinium.ey.r.appspot.com
  hwjyufmmqefzamxdvhocpnmvzycvpsgjbawf-dot-cryptic-now-290917.ey.r.appspot.com
  hwke.srkproje.com
@@ -177940,11 +177240,9 @@ hx2n5qa34l8lnfa4gsaq0dbpblau4oeu375whd2.candaklfgd.com
  hx9.hamhonar.com
  hxazhhxmycyldpur-dot-millinium.ey.r.appspot.com
  hxb0.svcoding.com
-hxcurbag.com
  hxcxbbqchx.ts.r.appspot.com
  hxdkwobqcyymeefy-dot-millinium.ey.r.appspot.com
  hxdm500.com
-hxeh5owr.cc
  hxensonwenqroxwlufccucaqbvvflofuqznr-dot-gl494903049.wl.r.appspot.com
  hxev888.com
  hxfgg.cn
@@ -178013,7 +177311,6 @@ hyderabadmoversandpackers.com
  hyderabadtough.com
  hydg18900533060.com
  hydraall.com
-hydraamazonav.vip
  hydraeshm.com
  hydrangeaglobal.com
  hydrapro.co
@@ -178164,7 +177461,6 @@ hzpytt.com
  hzq9a.mentriqq.com
  hzqdhytcables.com
  hzr6a.jaysbrand.com
-hzskcuap.cc
  hzss.xtechspro.com
  hztvt.goruli.com
  hztwfiyupaphetvy-dot-millinium.ey.r.appspot.com
@@ -178177,6 +177473,7 @@ hzxgcmlokkpbxqvtmywqlmrvlgxtxfxqsskw-dot-glegen303939423233.ue.r.appspot.com
  hzyiruakgbcuknwloezewlgsnt-dot-gleowayel400503.uc.r.appspot.com
  hzyonxin.cn
  hzywfstzdhkyaqmx-dot-millinium.ey.r.appspot.com
+hzz1.at
  i--do.com
  i-ademsgunluk.org
  i-amazon.top
@@ -178645,6 +177942,7 @@ icloud.apuoz.cn
  icloud.br-ios-maps.live
  icloud.br-ld.support
  icloud.br-login.com
+icloud.bz-suport.live
  icloud.client-support.digital
  icloud.com-account.in
  icloud.com-appleid.link
@@ -179000,6 +178298,7 @@ icon-oreoo-2.com
  icon-oreoo-95.com
  icon-stikepppni.org
  icon.sg
+icon.shatangmu.cn
  iconickidz.in
  iconosgroup.com.co
  iconsultasapple.com
@@ -179075,7 +178374,6 @@ id-billing-myee-login-account-ee-co-uk.idsecure-ee.com
  id-billing1.com
  id-billinginfo.com
  id-case-33069181.benueheritage.org
-id-cocacola.com
  id-covid19.com
  id-ee-billing.com
  id-ee-co.uk
@@ -179090,7 +178388,6 @@ id-eeukauth.ga
  id-et-d.fr
  id-fortuneo.info
  id-icc.be
-id-id-faceb00k.000webhostapp.com
  id-j98udf40wd-co.jp.jiugou.wang
  id-kddi.com
  id-login.xyz
@@ -179249,6 +178546,7 @@ iddzb0mdweqg.talagaremix.com
  ide0311aes311-viviendases0444-mapa0193112es1.xyz
  idea-logowanie.at
  idea-logowanie.live
+idea-secure-login.com
  idea019d311es-viviendas313inmueble-es013444.xyz
  idea1li331-provincia31case-it013431.xyz
  idea1li332-apartament01casas-pt309444.xyz
@@ -179398,6 +178696,7 @@ idiotictwitchpatriarch20.com
  idirin1l.beget.tech
  idirin6v.beget.tech
  idiskbd.com
+idj.no
  idjdjdhdhkasiid.000webhostapp.com
  idkf-gps.cn
  idklearningcentre.com.ng
@@ -179420,6 +178719,7 @@ idmmacapp.org
  idmnageauthsid.myvnc.com
  idmoam-jazz-com-pk-4443-oaam-server-login-do.ml
  idmoig-jazz-com-pk-4443-oim.000webhostapp.com
+idmovie.online
  idmphotos.fr
  idms.appkey-secure-page.a5ol5odaoq.com
  idms.appkey-secure-page.godlike00.com
@@ -179780,6 +179080,7 @@ ig-clientservice.cf
  ig-communitycenter.com
  ig-copyright-defense.com
  ig-copyright-feedback.com
+ig-copyright-media.com
  ig-copyright-violation-support.ga
  ig-copyrightform-support.cf
  ig-copyrightform.com
@@ -179793,6 +179094,7 @@ ig-foto-qazgy-yimageqz.info
  ig-grow.000webhostapp.com
  ig-growth.000webhostapp.com
  ig-helpabouts.com
+ig-helpbadges.cf
  ig-helpcenter-supportss.ml
  ig-helpservice.com
  ig-helpsviolation.ml
@@ -179834,6 +179136,7 @@ igclienthelpservices.com
  igcnxporuytavihc-dot-millinium.ey.r.appspot.com
  igcopyright-business.com
  igcopyright-helpscenter.ml
+igcopyright.gearhostpreview.com
  igcopyrightappeall.com
  igcopyrightcentral.com
  igcopyrightcentre.com
@@ -179867,7 +179170,6 @@ ighbawqjqwkzihtlrbiwjvdrdo.triple-upgrade-293822.rj.r.appspot.com
  ighelp-form.com
  ighelp.center
  ighelperscenter.com
-ighelpmedia-supportcenter-offical.ml
  ighelpsformedia.com
  ighelpsupportmedia.com
  ighelpteamcopyright.atwebpages.com
@@ -179889,7 +179191,6 @@ igm-markets.com
  igmailcadastrandonline.joomla.com
  igmarealty.ru
  igmedia-comunuties.com
-igmediasecurity.cf
  igmee.000webhostapp.com
  igmost.000webhostapp.com
  ignaciomall.buzz
@@ -180181,6 +179482,8 @@ ikyeawgbioeulnhq-dot-millinium.ey.r.appspot.com
  ikyvtjesxk-j4lxtmxh2.vercel.app
  ikywipyq.gikorip.net
  ikze7verifyapps.servegame.com
+il-nuovo-aggiornamento-abilitazione-spid-2021.ashcome.net
+il-nuovo-aggiornamento-abilitazione-spid-2021.storyline.rs
  ilaajclinics.com
  ilabycxmrpymxvmjtzatkzwhuowyduezedmp-dot-solar-vertex-285913.rj.r.appspot.com
  ilafgkpndzrlovxgwzpniytnfzmskxuursuf-dot-glxcel49934343434.rj.r.appspot.com
@@ -180210,7 +179513,6 @@ ilery.info
  ilerydse2.info
  ilesepit.com
  iletisimbakanligi20gb.com
-ilexassociates.co.in
  ilgiardinodellevisciole.it
  ilgiuncobb.com
  ilglbneds.org
@@ -180369,6 +179671,7 @@ imarcmelbourne-view.com
  imargowbe.ru
  imarketsforextrading.com
  imaserd.com
+imasmari96.filesusr.com
  imaspro.com
  imateplus.com
  imatteradultdaycenter.com
@@ -180470,6 +179773,7 @@ immanuel.com.vn
  immarisaa.com
  immatriculation-cnss-services.000webhostapp.com
  immbanjarbaru.com
+immediate-attention-required.co.uk
  immediateresponses.link
  immediax.com
  immediencient.com
@@ -180549,6 +179853,7 @@ imperylify.com
  impexeaa.com
  impexlog.com.br
  impexsounds.xyz
+implantadoresdeusbyableadosporsistema.tk
  implantat-muelheim.de
  implement-analog643.ga
  impliedscripting.com
@@ -180559,6 +179864,7 @@ import.test.themerex.net
  import188.com
  importano.top
  important-verifybilling.com
+important74.weebly.com
  importantnotificationalertonlineresetcomcastvcxdfg555.000webhostapp.com
  importardechina.info
  imported-beneficial-magnesium.glitch.me
@@ -181004,6 +180310,7 @@ induscancer.net
  indusfood.com.pk
  indushandicrafts.com
  induspride.be
+industreal.pl
  industrial-elements.hr
  industrialcontroling.ooguy.com
  industrialesud.com
@@ -181175,8 +180482,10 @@ info-nl-knab.com
  info-nubank.com
  info-o2.com
  info-online-digital-checkout-inc.net
+info-onlinsicuro.com
  info-payement.com
  info-peringatan-pemblokiran.weebly.com
+info-portale-clienti.com
  info-post-ch.com
  info-poste.servemp3.com
  info-postnl.link
@@ -181312,7 +180621,6 @@ infohuntbd.com
  infoibadah.com
  infoinfoxm.000webhostapp.com
  infoinppl.serveirc.com
-infoinstagram.tk
  infointesa.com
  infoirc.kz
  infojtimgmqxkdqo-dot-millinium.ey.r.appspot.com
@@ -181369,6 +180677,7 @@ informacion-cuenta.usatulibokf.org
  informacion-seguridad.bangjago.com
  informacjapolska.work
  informacje-24.you2.pl
+informacje-alert24.eu
  informacje-fakty.pusiaweb.com
  informacje-live24.eu
  informacje-news.eu
@@ -181489,6 +180798,7 @@ infoupdate3.com
  infoupdatefb.com
  infoupdatesecureserver-intlappl.seutasformefindhie.com
  infousa.news
+infovator.com
  infoverif.com
  infoverify-ee.com
  infoweb-aggiorna-ora.000webhostapp.com
@@ -181506,7 +180816,6 @@ infraplan.co.uk
  infraprovedor-teste.com.br
  infrarotwaermekabineorg.shaxiaaustralia.top
  infrarotwaermekabineorg.shuiacast.top
-infrastructurs.com
  infuseits.com
  infusy.com
  infwinbankuptodaytemprarylink.com
@@ -181625,6 +180934,7 @@ ingresovirtual2020.com
  ingresovirtualcr.com
  ingresow-bci-cl.xyz
  ingresow-viabcperu.xyz
+ingressar.xyz
  ingresws-vlabcp-pe.xyz
  ingridbgarcia.com
  ingriddion-sophro.fr
@@ -181698,7 +181008,6 @@ ininox.com
  inisiarsesion.000webhostapp.com
  inism.net
  inistagram.tk
-inistgraamloogin.000webhostapp.com
  initial-lash.000webhostapp.com
  initiallogin.southernstrustonline.com
  initialsfoul.com
@@ -181934,7 +181243,6 @@ inscricaodecorrida.com.br
  inscricaoligoogle.chefsalvadori.com.br
  inscricoesterceirocampeonatoff.000webhostapp.com
  inscrnet.com
-inscructracionescintematicaslateralesdeprotecione.gq
  insectknife.club
  insectknife.work
  insectpud.net
@@ -181944,7 +181252,7 @@ inselder.com
  inseolytics.com
  inseparableness.xyz
  insercaodeanuidadeitaucard.com
-inserisci-dati-per-i-nuovi-criteri-di-sicurezza.justwebsolution.com
+inserisci-i-dati-per-i-nuovi-criteri-di-sicurezza-spid-2021.luyale.com
  insertdetails.tk
  insgramefree.000webhostapp.com
  inshchckdomainmailb.web.app
@@ -181999,7 +181307,6 @@ inspiredwindows.com.au
  inspirelaw.ca
  inspiring-allen-c6367a.netlify.app
  inspiring-mcclintock-a45b4f.netlify.app
-inspiring-meitner-1746b9.netlify.app
  inspiring-noyce-1c2b6d.netlify.app
  inspiring-panini-3fa481.netlify.app
  inspocoach.com
@@ -182018,10 +181325,10 @@ insta-copyrighthelp.com
  insta-drole.000webhostapp.com
  insta-followerincrease.000webhostapp.com
  insta-genuine.000webhostapp.com
+insta-gra-mesp.000webhostapp.com
  insta-gram-contest-modelling-authentication.000webhostapp.com
  insta-gram-photos.000webhostapp.com
  insta-gram.fr
-insta-grammemes.000webhostapp.com
  insta-gramweb.000webhostapp.com
  insta-payed-ads.000webhostapp.com
  insta-trading.com
@@ -182079,14 +181386,12 @@ instafoto.jdevcloud.com
  instafotogonder.com
  instafreereefollowersfor.000webhostapp.com
  instagaccountpictures.000webhostapp.com
-instagarm-spain.000webhostapp.com
  instagarm.app
  instagarmlike.000webhostapp.com
  instagarmllike.000webhostapp.com
  instageverify.0fees.us
  instagfran.000webhostapp.com
  instagggrame876.000webhostapp.com
-instagggramsupport-ge.ml
  instaggram.icu
  instagoceleb.000webhostapp.com
  instagr0msecurlty.000webhostapp.com
@@ -182276,7 +181581,6 @@ instagram-verification-badge.com
  instagram-verification-badge.gearhostpreview.com
  instagram-verification-com.ga
  instagram-verification-service.com
-instagram-verification-team.tk
  instagram-verification.org
  instagram-verified-badge-form.naip.net
  instagram-verified-badge.epizy.com
@@ -182309,6 +181613,7 @@ instagram-web.de
  instagram-webapp.de
  instagram-webclient.de
  instagram-websupport.com
+instagram-wep-app.web.app
  instagram-whatsapp-contact.ml
  instagram-whatshapp-business.cf
  instagram.abpnews.xyz
@@ -182334,7 +181639,6 @@ instagram.com-93293203283729172.hdaynch.xyz
  instagram.com.account.login.security.yesil.xyz
  instagram.com.authenticator.ga
  instagram.com.copyrights-login-verify.com
-instagram.com.frigotechdelperu.com
  instagram.com.instogram.site
  instagram.com.iogin.cf
  instagram.com.login.s5df46ss21s.oficinasylocalesfiore.com
@@ -182451,12 +181755,10 @@ instagrambluebadgesupport.com
  instagramblueteaksupport.ml
  instagrambluetick-badge.ml
  instagrambluetick.org
-instagrambluetickbadges.tk
  instagrambluetickhelp.instaenjoy.com
  instagrambusiness-service.com
  instagrambusinessteam.cf
  instagrambusinnes.gq
-instagrambussinesactiveform.ml
  instagrambussineshelpcenter.com
  instagrambussinesofficecenters.com
  instagrambussiness.com
@@ -182561,7 +181863,6 @@ instagramhelpcenterbluetick.com
  instagramhelpcentercopyright.ga
  instagramhelpcenterfroms.ml
  instagramhelpcentres.com
-instagramhelpcervies.gearhostpreview.com
  instagramhelpcn.0fees.us
  instagramhelpcoppiyrght.com
  instagramhelpcopyright.org
@@ -182572,6 +181873,7 @@ instagramhelpicenter.ga
  instagramhelpicenter.ml
  instagramhelpincentral.com
  instagramhelpingservice.com
+instagramhelpingservices.ga
  instagramhelpingsupport.com
  instagramhelpingteam.tk
  instagramhelpnotice.com
@@ -182654,6 +181956,7 @@ instagramserviceshelpcopyrights.com
  instagramservicesverify.ga
  instagramsforviolation.com
  instagramshelpteams.cf
+instagramssupport.ga
  instagramstatidl.0fees.us
  instagramstoriesfotoaccountinstagramfotoonline.site
  instagramstoriesprofilego.com.hyperdomen.com
@@ -182691,12 +181994,10 @@ instagramusernamelogin.netlify.app
  instagramverifaction.com
  instagramverifcenter.com
  instagramverification.co.uk
-instagramverificationbadge-form.ga
  instagramverificationbadge.com
  instagramverificationn.somee.com
  instagramverifications.tk
  instagramverified-helpcenter.com
-instagramverifiedbadge-form.gq
  instagramverifiedbadgesupportt.cf
  instagramverifiedhelp.ga
  instagramverifiedhelper.ml
@@ -182759,7 +182060,6 @@ instagrramm.0fees.us
  instagruim.000webhostapp.com
  instagrweb.000webhostapp.com
  instahakss.0fees.us
-instahardsmale.buzz
  instahelpcenter.co
  instaherseyim.000webhostapp.com
  instahilesi.net
@@ -182812,6 +182112,7 @@ instantauthenticatorisl.000webhostapp.com
  instantbonheur.fr
  instantcashflowtoday.com.ng
  instantcoronavirushometest.com
+instantdelivery.me
  instantdep.info
  instantfollow4ig.000webhostapp.com
  instantgame10.co.vu
@@ -182897,10 +182198,9 @@ instfgramm.000webhostapp.com
  instgarm.de
  instgram-iogin.000webhostapp.com
  instgram-logins.com
-instgram-secure-center.com
  instgram147.000webhostapp.com
+instgramcopyrghts.cf
  instgramforhelpscenters.000webhostapp.com
-instgramm.ga
  instgramuserweb.000webhostapp.com
  instgramverifaccount.com
  instgrmmv.000webhostapp.com
@@ -182945,7 +182245,6 @@ insttagraam.com
  insttapanel.000webhostapp.com
  instuition.com
  insularbank.ph
-insulinguide.work
  insulinpro.buzz
  insumoscortinasroller.com
  insumosesmar.com
@@ -182976,7 +182275,6 @@ int-reg700007.com
  int-stc.com
  int2ext.com
  int2float.com
-int3rmatic0s-1402.000webhostapp.com
  intactcollective.com
  intagram.my.id
  intagsram.000webhostapp.com
@@ -182988,6 +182286,7 @@ intbnchase.com
  intc.solutions
  intco.tk
  intcreditsuisse.com
+intech3d.es
  intechemuk.com
  intecwi.com
  integer023.ga
@@ -183042,6 +182341,7 @@ interac-etransfer.net
  interac-prestationqc.ca
  interac-urgenceqc.ca
  interac.alamocitycleaning.com
+interac.ca.arnaku.com
  interac.ca.myaccountsecure.manjumakhana.com
  interac.ca.nusragenonline.com
  interac.caqc0.com
@@ -183174,6 +182474,7 @@ intermaticox.webcindario.com
  intermed19.com
  interminable-inch.000webhostapp.com
  intermingling.info
+intermuner.ru
  internal-revenue.recoverbaycounty.net
  internal-update.serveirc.com
  internaladvocate.com
@@ -183295,6 +182596,7 @@ interwencja.you2.pl
  interworlddelivery.com
  intesa-01.atwebpages.com
  intesa-attivazione-psd2.000webhostapp.com
+intesa-psd2-info.com
  intesa-san-paolo-security.com
  intesa-sanpaolo.io
  intesa-sbloccocarta.com
@@ -183313,6 +182615,7 @@ intesasanpaolo-care.com
  intesasanpaolo-it-login.com
  intesasanpaolo-sblocco.info
  intesasanpaolo-sicurezza.info
+intesasanpaolo-sicurezza.news
  intesasanpaolo-sicurezza.xyz
  intesasanpaolo-verifica-dati.riepilogo-dati.biz
  intesasanpaolo-web.com
@@ -183545,7 +182848,6 @@ invitegroups-whatsapphot.my.id
  invitegroupswhatsapp.ml
  invitegroupwa-dylandpros.000webhostapp.com
  invitegroupwhatsapnewww.000webhostapp.com
-invitegroupwhatsapp-barbagigairahseru.onedumb.com
  invitegroupwhatsapp18.xxxwhatapp.com
  invitegroupwhatsappp332.ml
  invitegrub-whatsapphot.my.id
@@ -183681,7 +182983,6 @@ ionos.by.prohoster.biz
  ionos.gabiaworks.com
  ionos.it.14c702c3pagamento.condominiopatro.it
  ionos.it.apulia70.com.industrialcar.it
-ionosemailsrvr-e3e.ddns.net
  ionoshwanadwana.blogspot.com
  ionoskhal9578995410.blogspot.com
  ionshoppingmall.ionliveradio940fm.net
@@ -183945,6 +183246,7 @@ irancementex.com
  iranchah.com
  irandishwasher.ir
  iranfanavar.com
+iranfilme.ir
  irangoodshop.com
  iranianeconews.com
  iranjujube.ir
@@ -184310,7 +183612,6 @@ issuer72paypal.com
  issueresolved.co.in
  issues-netfilm.com
  issuesolve.co.in
-issuse-paypal-id521.com
  istanbulasiklari.com
  istanbulescortbeyza.top
  istanbulhaliyikamacim.com
@@ -184379,6 +183680,7 @@ it.support.emailblox.com
  it.support.loginprotected.com
  it.thisischeer.com
  it.xi-aruba.com
+it123.ru
  it404.org
  it4work.com.vn
  it4workcom.chifanbackground.top
@@ -184560,6 +183862,7 @@ itaucardpro.com
  itaucardpromo.com
  itaucardpromocao.com
  itaucards.net
+itaucardseguranca.com
  itaucardseguroplus-com.preview-domain.com
  itaucardweb.com
  itaucarseguro.com
@@ -185199,7 +184502,6 @@ izctyzwo.shoesmogul.com
  izdeharalbasrah.com
  izfiqclqwzxzjtpywdnxxldfkoderyjgsgoq-dot-cryptic-now-290917.ey.r.appspot.com
  izgerlh.rogagot.com
-izgfvhyejwezlvopixjwblmuun-dot-gleow2021ja.ue.r.appspot.com
  izgotovlu.ru
  izi-jobs.net
  izishop.info
@@ -185220,6 +184522,9 @@ izsiztiroidektomi.com
  izteh.com
  iztg-----login.ygber.com
  izu.co.jp
+izu001.webredirect.org
+izu002.casacam.net
+izu003.camdvr.org
  izub2qzmc5lv.talagaremix.com
  izumo-school.com
  izvestiboo.info
@@ -185345,7 +184650,6 @@ jacketes.com
  jacketflerovium.com
  jackgunterart.com
  jackhenrynetcommorg.unibiz.top
-jacklinberny.ru
  jackma.es
  jacknaut.com
  jackorgin.com
@@ -185595,6 +184899,7 @@ janganlupashareyabos.000webhostapp.com
  janganmerahlagi.rainbowshumor.com
  janganragu18.000webhostapp.com
  jangansopan.com
+jangenarm.com
  jangreetham.com
  janhaviprofile.in
  janhitcollegeofeducation.com
@@ -185733,10 +185038,8 @@ jatakavedhan.com
  jathra.co.uk
  jatkit.gq
  jatland.000webhostapp.com
-jatskyings.casa
  jaucpeozodvmpbmw-dot-millinium.ey.r.appspot.com
  jauhkekanan.com
-jauitywep.cam
  jaunimoform.wgsystems.lt
  jaunimopartija.lt
  jaures.be
@@ -186136,6 +185439,7 @@ jenis9q.dx.am
  jenkinsmews.icu
  jenkinswsquare.xyz
  jenmarkest.casa
+jenmcken.com
  jennalee.000webhostapp.com
  jennaleelove.000webhostapp.com
  jennamcarroll.com
@@ -186236,6 +185540,7 @@ jessymart.flexyhub.com
  jester.com.au
  jesterthompson.tk
  jesuisunhackeur.servehttp.com
+jesumbooludipe.com
  jesuomomolomo.com
  jesusferguson.us
  jesusgenerationministries.org
@@ -186352,6 +185657,7 @@ jghdf-71.tk
  jghieg.bjdbjfdkjblfjhbsdghvdgvf.xyz
  jghtnfdvcty.weebly.com
  jghutghfa.ooolky.cn
+jgjhgjhgjhg.com
  jgjzvzgblv.duckdns.org
  jgkbdkljfphlellk-dot-millinium.ey.r.appspot.com
  jgkh.xyz
@@ -186441,6 +185747,7 @@ jhsupplies.co.za
  jhtilhgtnocebbpd-dot-millinium.ey.r.appspot.com
  jhtnndprfshxyvla-dot-millinium.ey.r.appspot.com
  jhubgjehknme.weebly.com
+jhuiopo.cam
  jhutu.zsmihr.cn
  jhuxjsjdiledgqjr-dot-millinium.ey.r.appspot.com
  jhvg.000webhostapp.com
@@ -186656,7 +185963,6 @@ jiyuchen.club
  jiyushu.cn
  jizhang.lexianglexun.com
  jizhaobinglawyer.com
-jizzakhcraft.uz
  jj-edificaciones.com
  jj-js.com
  jj.topkorder.su
@@ -186931,6 +186237,7 @@ jnbloding.com
  jnblryhjnippmzfw-dot-millinium.ey.r.appspot.com
  jncdbvongfhbyuxk-dot-millinium.ey.r.appspot.com
  jncit.me
+jnckjsndchdshfewfdc.ams3.digitaloceanspaces.com
  jndasaas.com
  jndexpertservices.com
  jndud8.com
@@ -187443,7 +186750,6 @@ join-sini-group-18plus-dijamin-croot.000webhostapp.com
  join-the-pipe.org
  join-wa-hot.cf
  join-wa-me199.000webhostapp.com
-join-wa.grup-whatsapp2k21.ml
  join-wa18.my.id
  join-wa18.wikaba.com
  join-wa18plus.ddnsfree.com
@@ -187725,7 +187031,6 @@ joingroupwhatsappbkp18.verification-web.tk
  joingroupwhatsappbkp21.dns05.com
  joingroupwhatsappbokepterbaru2020.gamees.my.id
  joingroupwhatsappbokepterbott2020.getz-claim06.my.id
-joingroupwhatsappinvite.join-group71.tk
  joingroupx.jkub.com
  joingroupxsex.25u.com
  joingrouwhatsapp.vvipz5.ml
@@ -187811,7 +187116,6 @@ joingrup-bokepwhatsapp.newjoin.ga
  joingrup-budi01.wa-21.com
  joingrup-crott.ooguy.com
  joingrup-dewasa.ooguy.com
-joingrup-dewasa2021.duckdns.org
  joingrup-gow1.ga
  joingrup-whatsapp-newjoin.vvip-79.gq
  joingrup-whatsapp.holl-viip9.me
@@ -187820,6 +187124,7 @@ joingrup-whatsapp20.tk
  joingrup-whatsappbkp.gets-x.com
  joingrup-whatsappnew20.now79.tk
  joingrup-whatsappp.my.id
+joingrup-whtsappbvokep.htol22.gq
  joingrup.b88kp.event63.cf
  joingrup.ddnsfree.com
  joingrup.facebook-good.ga
@@ -187840,10 +187145,10 @@ joingrup123.api-whatsapp-6.cf
  joingrup16.whatsapp-995.gq
  joingrup18.laen.cf
  joingrup18.whatsapp4.ga
+joingrup18meporn.ourhobby.com
  joingrup18new.joins5.com
  joingrup18new2020.claim78.gq
  joingrup18plusnew.myl8.cf
-joingrup18pluss.ourhobby.com
  joingrup2.api-whatsapp-6.gq
  joingrup2020.vip-smm.com
  joingrup21.whatsapp-web-271.gq
@@ -187965,9 +187270,11 @@ joingrupmabarff2020coy.000webhostapp.com
  joingrupmabarfreefire-indonesia.000webhostapp.com
  joingrupmabarsamabangbudi01geming.000webhostapp.com
  joingrupmantapmantappokoknya.000webhostapp.com
+joingrupme18.ourhobby.com
+joingrupme18me.ourhobby.com
  joingrupmemberwa.dumb1.com
  joingrupmemek.grup-invite18.ml
-joingrupmesex.ourhobby.com
+joingrupmesexz18me.ourhobby.com
  joingrupnobarbokepbersama.000webhostapp.com
  joingrupnokep2k2018.000webhostapp.com
  joingruppbokepp18.000webhostapp.com
@@ -188077,7 +187384,6 @@ joingrupwhatsapp12.otzo.com
  joingrupwhatsapp12.zzux.com
  joingrupwhatsapp120.wikaba.com
  joingrupwhatsapp17.hot49.cf
-joingrupwhatsapp18.my03.com
  joingrupwhatsapp18.sexidude.com
  joingrupwhatsapp18pluss.00.mrbasic.com
  joingrupwhatsapp2020.ngntd55.tk
@@ -188154,7 +187460,7 @@ joinngrupp18.vvipx08.cf
  joinngruupp.wa-21.com
  joinninggroup18.0xz.org
  joinnmeet.me
-joinnow-grup10.ml
+joinnow-grup9.ml
  joinnow-whatsapp18.wa-groups.ml
  joinnwdgrupswhatsappdewasa.zyns.com
  joinofficialgroupwhtspp.tk
@@ -188221,6 +187527,7 @@ joinwagrup18.ocry.com
  joinwagrup20.000webhostapp.com
  joinwagrupp.joins-gb79.com
  joinwagrupyoutuber.claimfree-mobile12.gq
+joinwamabar.jkub.com
  joinwaya.000webhostapp.com
  joinwayah.000webhostapp.com
  joinwhasstappgroup.cf
@@ -188383,6 +187690,7 @@ jordanvascular.org
  jordinoalebri4.myjino.ru
  jorejnfhry.com
  jorge94595338.xyz
+jorgegonzalezvirtual.com
  jorgesrecipes.com
  jorgeyunda.com
  jorgobe.at
@@ -188437,6 +187745,7 @@ joshapart.com
  joshbeauchampdaily.com
  joshgeneralremodeling.us
  joshi.top
+joshidentalclinicjaipur.com
  joshifoundation.in
  joshikia.in
  joshinvestment.pro
@@ -188482,7 +187791,6 @@ journal.noesa.co.id
  journal.tgeeks.co.tz
  journal4familycom.nckiparis.gdn
  journalduglobetrotter.com
-journalemail.com
  journalistic-accele.000webhostapp.com
  journalofpolitics.org
  journalsurgicalsimulation.com
@@ -188544,9 +187852,7 @@ jp-amazon-team-fsvh3jh2ghstudio.xyz
  jp-amazon.0d2.xyz
  jp-amazon.4ng.xyz
  jp-amazon.6so.xyz
-jp-amazon.f1q.top
  jp-amazon.nvf.xyz
-jp-amazon.p-0.top
  jp-amazon.qy4.xyz
  jp-amazon.uj6.xyz
  jp-apple-com-175fj6oc.nln365.com
@@ -188600,11 +187906,9 @@ jp-morgan.tech
  jp-portal.connect.auone-mobile021.com
  jp-rakuten-in.cyou
  jp-rakuten-login.ga
-jp-rakuten.b-3.top
  jp-rakuten.buzz
  jp-rakuten.j-1.top
  jp-rakuten.net
-jp-rakuten.o-1.top
  jp-rakutenlogin.arocaproducciones.com
  jp-rakuteo-co.icu
  jp-review.online
@@ -189032,7 +188336,6 @@ jqzfzyxdjuafacvcu.top
  jqzidabuyxddcnfsrenkezblyjhogredgqpr-dot-cryptic-now-290917.ey.r.appspot.com
  jr-chiisai.net
  jr.r2dd.com
-jr1a3eit.cc
  jr39.awaykart.com
  jr6788.com
  jra-automacao.com.br
@@ -189068,7 +188371,6 @@ jrprthbgipsylmal-dot-millinium.ey.r.appspot.com
  jrqglmggfldmhqux-dot-millinium.ey.r.appspot.com
  jrrdf55y6-lz2fq1amd.vercel.app
  jrsaqgbdvzptuhk.top
-jrscap.in
  jrsmbljgwloniyze-dot-millinium.ey.r.appspot.com
  jrsvxnyndhjypfvp-dot-millinium.ey.r.appspot.com
  jrsx.jre.net.cn
@@ -189810,7 +189112,6 @@ k-t.icu
  k-techtools.com
  k-thephotostudio.com
  k.5qa.so
-k.com-35348450.vochtplekken.be
  k.honker.info
  k.ludong.tv
  k.psdzy.com
@@ -190440,6 +189741,7 @@ katieejohnston.com
  katiekerr.co.uk
  katieygraves.com
  katiliw.com
+katina-marie.com
  katiuoshiletinen.xyz
  katja9.xxuz.com
  katjaundfelix.de
@@ -190737,7 +190039,6 @@ kedin.duckdns.org
  kedkekk.co.cc
  keeblerplain.buzz
  keen-brahmagupta-cec944.netlify.app
-keen-lewin-867ae6.netlify.app
  keen-mclean-b4780a.netlify.app
  keen-pare-000b9f.netlify.app
  keen-ride-52e1b9.netlify.app
@@ -190945,6 +190246,7 @@ keralasite.com
  keramikadecor.com.ua
  keramikweltcom.shaxiarecord.top
  keramo.in
+keraviataprosbite.us
  kerbyblawqkbwozp-dot-millinium.ey.r.appspot.com
  kercali.com
  kerfoo.com
@@ -191282,7 +190584,6 @@ khdhgs2sadfsdfg4sdgdsg56fbgfsdg.ml
  khdmatqatar.com
  khdsaz.com
  khdubeuwpixsrmve-dot-millinium.ey.r.appspot.com
-khdvl4ff.cc
  khdyhgkyskxddmmc-dot-millinium.ey.r.appspot.com
  khebstveekriedle-dot-millinium.ey.r.appspot.com
  khefws.vipsnapchatsexting.com
@@ -191316,7 +190617,6 @@ khnzd.app.link
  khnzkukflxnvtwcbdmovrrbtdd-dot-gleowayel400503.uc.r.appspot.com
  khoahoc.bluebird.vn
  khoahocshop.tk
-khoaq50z.cc
  khobep.com
  khod.xyz
  khoedepdn247.com
@@ -191426,6 +190726,7 @@ kidfroopy.com
  kidkvenbo.com
  kidms.com
  kidnapomar.net
+kidnapsmoke.buzz
  kidneycentre.com
  kidneycurves.com
  kidneyshort.guru
@@ -191565,6 +190866,7 @@ kindermusikwithgosiacom.shaxiapotential.top
  kindersitze-vergleich.de
  kinderstubetomundjenny.com
  kindertagespflege-arcoiris.de
+kindheartedanchoredcgi.adasdfff.repl.co
  kindingme.sfo2.digitaloceanspaces.com
  kindled-buffer.000webhostapp.com
  kindleedxded.ru
@@ -192253,6 +191555,7 @@ knvjykemrhtdsngv-dot-millinium.ey.r.appspot.com
  knvoiciqkkogmazxdjzkcfkunygiapqunyzf-dot-glegen303939423233.ue.r.appspot.com
  knvtesofixacpslz-dot-millinium.ey.r.appspot.com
  knwc2.jaysbrand.com
+knwe.org
  knwosay-71.ga
  knxhpbrixgjswsmcsubeahpofw-dot-gleowayel400503.uc.r.appspot.com
  knypbxnvakayrbej-dot-millinium.ey.r.appspot.com
@@ -192617,6 +191920,7 @@ koronavirusz.ru
  koronavprofit.site
  korpen-haljarp.se
  korpussanctum.com
+korrectconceptservices.com
  korrekaminos.es
  korrika.eus
  korseland.com
@@ -192847,7 +192151,6 @@ kredikarti-aidatiade-basvurumuz.com
  kredikarti-iadatiade-geri-odeme.com
  kredit-kredit.ru
  kreditcadt.000webhostapp.com
-kreditinvestltd.com
  kreditorrf.ru
  kreditsuzukijabar.com
  kredittkortrangering.com
@@ -193085,6 +192388,7 @@ kuapxvjcqxowfwjy-dot-millinium.ey.r.appspot.com
  kuatiohngfrntqel-dot-millinium.ey.r.appspot.com
  kuayatgdhphwdjjj-dot-millinium.ey.r.appspot.com
  kubanuchpribor.ru
+kubatoglubaklava.com.tr
  kuberavc.com
  kubets.asia
  kubey.tech
@@ -193214,7 +192518,6 @@ kunze-immobilien.de
  kuota-gratis.vcd.ng
  kuoyd.meijiamaicai.com.cn
  kuoying.net
-kup0tlro.cc
  kupaliskohs.sk
  kupelis.com
  kupfvcibgn.duckdns.org
@@ -193647,6 +192950,7 @@ labanquepostale.ddns.net
  labanquepostale.frespaceclient.labik5.com
  labanquepostaleaccesscom-770921.ingress-comporellon.easywp.com
  labanquepostalefrlabanquepostalewebhost.com
+labanquepostalesecure.com
  labanquepostalesredlis.com
  labanquepostalesslvos.com
  labanquepostalevhost127668.lowhost.ru
@@ -194013,6 +193317,7 @@ lanmacrealty.duckdns.org
  lanmeishiye.com
  lanmqnneciufacsz-dot-millinium.ey.r.appspot.com
  lannylove.ddns.net
+lanos.in
  lanosknife.club
  lanpchaldaibans.cf
  lanscarp.com
@@ -194350,7 +193655,6 @@ laveronicamagazine.com
  lavery-ca.com
  laveyfleet.club
  laviago.com
-lavicor.com.ar
  lavicorpgroup.com
  lavidagroups.com
  lavidasegundanny.com
@@ -194619,7 +193923,6 @@ ldoflwqkmvrhxqakdikwrzjljg-dot-gleowayel400503.uc.r.appspot.com
  ldokja.xyz
  ldorb.com
  ldosqpdmfuasnmth-dot-millinium.ey.r.appspot.com
-ldpfnruwemeigfhqwkfdh.top
  ldpzshdtecjhskma-dot-millinium.ey.r.appspot.com
  ldrautovation.co.za
  ldrcreep.net
@@ -194716,6 +194019,7 @@ lean19.com
  leanakaryar.com
  leancoding.co
  leandrokblo.com
+leanhold.cyou
  leanhxuan.net
  leanldedyjerlogh-dot-millinium.ey.r.appspot.com
  leanmanufacturing.com.ar
@@ -194741,6 +194045,7 @@ learneru.co
  learneru.education
  learnforexeasyway.com
  learning-korea.com
+learning.real-academy.net
  learning.validate.santander.digital
  learning2liv.1gb.ru
  learning854.000webhostapp.com
@@ -195027,7 +194332,6 @@ leneng.ru
  lengbin.xyz
  lengendryme.com
  lengkapi-data-url.cf
-lengkapidata-url-facebookapp.ga
  lengkapsudah.com
  lengthways-restrain.000webhostapp.com
  lengwenxue.com
@@ -195307,6 +194611,7 @@ lfknmqovagmzeqdb-dot-millinium.ey.r.appspot.com
  lfkycsdatnyflqvb-dot-millinium.ey.r.appspot.com
  lfmdmlfmdfder.com
  lfmultiformas.com
+lfoqvwnkbjowipioawuuvdulds-dot-gleow2021ja.ue.r.appspot.com
  lforgot-en.us
  lfpfotoway.com
  lfqqfvyfuemerggh-dot-millinium.ey.r.appspot.com
@@ -195331,6 +194636,7 @@ lgaliatumse.com
  lgaogsyigrxqsdfcjvfpzwcguk-dot-gleowayel400503.uc.r.appspot.com
  lgc-wine.com
  lgcopyrightform.com
+lgcopyrighthelpcentre.com
  lgcopyrighthelpsupport.tk
  lgdayxbaggzbyqwk-dot-millinium.ey.r.appspot.com
  lgdrzbmfzihytcdi-dot-millinium.ey.r.appspot.com
@@ -195379,6 +194685,7 @@ lgto3oner-dot-t6yq5rw.rj.r.appspot.com
  lgtooner-dot-t6yq5rw.rj.r.appspot.com
  lgtughu.xyz
  lgubimlnyakyykcb-dot-millinium.ey.r.appspot.com
+lgucafixspplentms.us
  lgunxlajidubjxzx-dot-millinium.ey.r.appspot.com
  lguwvacjoktparygwfioudfhcs-dot-gleowayel400503.uc.r.appspot.com
  lguzxapqdaogxkcf-dot-millinium.ey.r.appspot.com
@@ -195591,6 +194898,7 @@ life.topbulletin.today
  lifeadvicer.com
  lifeandworkinjapan.info
  lifeapt.biz
+lifebeam.elin.co.za
  lifeblnc.ru
  lifeboat.media
  lifebuildco.com.au
@@ -195607,6 +194915,7 @@ lifecycleeng.com
  lifedive.gr
  lifeful-numeral.000webhostapp.com
  lifegiveaway.com
+lifeimprovementmedia.com
  lifeinsurancenew.com
  lifeisbetternow.ml
  lifeiswhatyoumakeofit.com
@@ -195688,6 +194997,7 @@ lightou-71.cf
  lightpressprint.co.zw
  lightreach53.com
  lights-craft.net
+lightsalmondecentopposites--five-nine.repl.co
  lightscafe.com
  lightscrawnyoutcomes--five-nine.repl.co
  lightspeedassociation.info
@@ -196120,7 +195430,6 @@ linkeroever.xyz
  linkgate.ml
  linkgensci.com
  linkgisel.cleansite.us
-linkgrup-youtuberff.gq
  linkgrup.getjoin5.gq
  linkgrupff2020.000webhostapp.com
  linkgrupwahot.000webhostapp.com
@@ -196241,7 +195550,6 @@ liquida-smartwatch.ml
  liquidacaodecarnaval.com
  liquidacaodejulhohoje.ml
  liquidacaodeofertasmagalu.com
-liquidacaomagalu.com
  liquidacaopromocional.com
  liquidacoesdestoque.com
  liquidacoesexpress.ml
@@ -196378,6 +195686,7 @@ littlecosm53.com
  littleelmapartments.com
  littlefabrics.com
  littleflowerckm.com
+littleflowerhostel.com
  littlefoots.ru
  littlegreenwheel.com
  littlehearts2littlehands.com
@@ -196487,7 +195796,6 @@ livemic.org
  livemusicguild.com
  livenative.org
  livenmitac-my.sharepoint.com
-liveonyoutubeweek.onmypc.net
  liveottelut.com
  livepind.com
  livepowerfully.io
@@ -196496,7 +195804,6 @@ liverings.xyz
  livermttttt.com
  liverpool-mx.site
  liversaleven.xyz
-liverxt.us
  liveskim.xyz
  liveskin.org.ru
  livesmile.dynip.org
@@ -196510,9 +195817,9 @@ livesupport-ig.com
  livesupportforlnstagram.com
  livesupportinsta.ga
  livesupportinstagram.com
+livesupports-com.tk
  liveswindows.casa
  liveteam-halifax.com
-livetelecaste.casa
  livethenobleway.com
  livetrade.ae
  livetrader.eu
@@ -196750,19 +196057,16 @@ lloyd.new-secure.co.uk
  lloyd.unauthpayee.com
  lloydalert.com
  lloydban.com
-lloydbank-accountprotection.com
-lloydbank-cancel-payee-newlogin.com
  lloydbank-cancel.com
-lloydbank-deregister-newlogin.com
  lloydbank-login.com
-lloydbank-manage-newpayees-gb.com
-lloydbank-online-devicemanagement.com
-lloydbank-secure-payee-attempt.com
-lloydbank-secureaccount.com
-lloydbank-securedevices.com
+lloydbank-onlinesupport.com
+lloydbank-remove-devicepairing.com
+lloydbank-support.com
  lloydbank.com.compliance-user.services
  lloydbank.new-secure.co.uk
+lloydbanking-cancel-recipient.com
  lloydbanking-payee-removal.com
+lloydbanking-supportservice.com
  lloydcancelpayee.com
  lloydconstruction.com
  lloydolb.com
@@ -196856,6 +196160,7 @@ lloyds-verifcation.com
  lloyds-verification.com
  lloyds-verify-device.com
  lloyds-verifymydevice.com
+lloyds-verifymypayee.com
  lloyds-verifynewdevice.com
  lloyds-verifypayee.com
  lloyds-verifypayees.com
@@ -196951,7 +196256,6 @@ lloydsbank.com.login-review-4453.info
  lloydsbank.com.login-review-976.info
  lloydsbank.com.submit-application.services
  lloydsbank.contacts-help.co.uk
-lloydsbank.deregister-payee-authentication.com
  lloydsbank.deregister-unknown-payee.com
  lloydsbank.device-auth-new-verify.com
  lloydsbank.device-login-verify-auth.com
@@ -196983,6 +196287,7 @@ lloydsbank.new-review-auth-device.com
  lloydsbank.new-secure.co.uk
  lloydsbank.newly-login-attempted-access-gained.com
  lloydsbank.online-auth-device-verify.com
+lloydsbank.online-auth-redirect-verified.com
  lloydsbank.online-login-auth-device.com
  lloydsbank.online-login-auth-verify-device.com
  lloydsbank.online-login-authenticate-info.com
@@ -197066,6 +196371,7 @@ lloydsgroup.live
  lloydsgroupsecurity.com
  lloydshelp-me.com
  lloydsinsecure.link
+lloydslogin.co
  lloydsnewpayee-cancel-setup.com
  lloydsonline-info.com
  lloydsonline-support.com
@@ -197074,7 +196380,6 @@ lloydspayee-confirmation.com
  lloydspayee-support.com
  lloydspayeeremoval.com
  lloydspayeeuk.com
-lloydsplc-secure.com
  lloydsplc.secure-auth-attempted-login.com
  lloydsprotectdata.co.uk
  lloydsregisterdevice.com
@@ -197110,6 +196415,7 @@ llyfzsnudgmagphzfemqazxegqglllyfypqx-dot-gl494903049.wl.r.appspot.com
  llyodank.managingbyod.com
  llzby.wangxianlong.com
  lm1wfbk5.firebaseapp.com
+lmaancha.co.il
  lmacjfggqrktwlqn-dot-millinium.ey.r.appspot.com
  lmafwvajipucfzbtbvuekpzcqrwvwoqzluug-dot-off94032393204.uk.r.appspot.com
  lmalon.ddnsking.com
@@ -197166,6 +196472,7 @@ lmsd-doc.ml
  lmsdorg.cabanova.com
  lmskdfadvert329.xyz
  lmsolutec.com
+lmsteclenteesess-com.umbler.net
  lmtelecom.net
  lmtprovisions.com
  lmttzkwomjknwdtlalleaodxwgmryhypagcf-dot-cedar-code-289917.nn.r.appspot.com
@@ -197205,6 +196512,7 @@ lng-betaalpas.icu
  lng-bevestigen.info
  lng-business-start.com
  lng-business.co
+lng-digitaalbankieren.com
  lng-gegevenscheck.nl
  lng-homebank.xyz
  lng-overzicht.top
@@ -197266,9 +196574,7 @@ lnstagram-client.info
  lnstagram-com-p-ctaub3qli-f-utm-sourceig-web-copy-link.ml
  lnstagram-contacthelped.ga
  lnstagram-contactverifiedbadge.ml
-lnstagram-copright-support-com.gq
  lnstagram-copyright-and-blueteak.com
-lnstagram-copyright-centraal.cf
  lnstagram-copyright-confirm.ml
  lnstagram-copyright-contact.com
  lnstagram-copyright-contact.ml
@@ -197293,7 +196599,6 @@ lnstagram-copyrightvioalation.com
  lnstagram-copyrightvioalation.tk
  lnstagram-copyrigthcenter.ml
  lnstagram-creators.com
-lnstagram-es-mxmx4545-klpqthzb.000webhostapp.com
  lnstagram-feedback.cf
  lnstagram-forcopyright.com
  lnstagram-forhelpcenter.ml
@@ -197347,6 +196652,7 @@ lnstagram-servicecopyright.com
  lnstagram-servicehelp.cf
  lnstagram-store.com
  lnstagram-support-client.com
+lnstagram-supportcenter.ga
  lnstagram-supportcentre.com
  lnstagram-supports-web.ml
  lnstagram-supportservice.ml
@@ -197355,6 +196661,7 @@ lnstagram-team-support.cf
  lnstagram-tickcopyright.ml
  lnstagram-verfysupport.com
  lnstagram-verifedbadges.com
+lnstagram-verifedbadges.tk
  lnstagram-verification-badge.com
  lnstagram-verification.net
  lnstagram-verificationaccounts.com
@@ -197365,13 +196672,13 @@ lnstagram-verifiedbadge-supports.com
  lnstagram-verifiedbadges-team.ml
  lnstagram-verifiednotice.com
  lnstagram-verifiedsupport.ga
+lnstagram-verify-acoount.gq
  lnstagram-verify-blue-badge.cf
  lnstagram-verify-forms.tk
  lnstagram-verify-help.tk
  lnstagram-verify.0fees.us
  lnstagram-verifyaccount.ml
  lnstagram-verifybluetick.tk
-lnstagram-verifycom.ga
  lnstagram-verifyyourcontent.ml
  lnstagram-veriifiedbadge.com
  lnstagram-verlfy.com
@@ -197548,7 +196855,6 @@ lnstagramsecurityhub.com
  lnstagramsecurtycenter.com
  lnstagramservice.ml
  lnstagramservicehelpers.com
-lnstagramserviceshelp.gq
  lnstagramservicesupport.com
  lnstagramsforsupportings.com
  lnstagramsforums.com
@@ -197574,7 +196880,6 @@ lnstagramteamhelp.com
  lnstagramteamhelpsupport.cf
  lnstagramverifedcopyright.com
  lnstagramverifedform.com
-lnstagramverifedsbedgenotice.gq
  lnstagramverificationbadge-form.ml
  lnstagramverificationbadgeform.com
  lnstagramverificationbadges.com
@@ -197589,7 +196894,11 @@ lnstagramverifiedbadgesform.ml
  lnstagramverifiedhelper.ml
  lnstagramverifiedsbadge.com
  lnstagramverifyapply.site
+lnstagramverifyapplyform.tk
+lnstagramverifybadgeapplyform.ml
+lnstagramverifybadgeapplyform.tk
  lnstagramverifybadgecontact.tk
+lnstagramverifybadgeform.com
  lnstagramverifybadges.epizy.com
  lnstagramverifybadgescenter.ml
  lnstagramverifybadgeteam.ml
@@ -197613,11 +196922,9 @@ lnstaqrambluetick.cf
  lnstasupport.com
  lnstaverifyaccounts.org
  lnstaverifyhelpsbadge.cf
-lnstgram-blueteak.tk
  lnstgram-help-service.com
  lnstgram.co
  lnstgramcopyrigtsupport.ml
-lnstgramforbusiness.ml
  lnstgrams.com
  lnstgrmthereport.xyz
  lnt-direct-money.com
@@ -197665,6 +196972,7 @@ load-facebookus-53920297.the222.ca
  load-facebookus-57558037.the222.ca
  load-facebookus-81644800.the222.ca
  load-facebookus-84401959.the222.ca
+load-serv-4285.xyz
  load.itmenagerie.tech
  load.passionfruitads.com
  load2nd.net
@@ -197847,6 +197155,7 @@ lockwoodinv.com
  loclipthudamnguyentruonggiang2k6.000webhostapp.com
  locloggercom.chifanassume.top
  locodesvan.com
+locomotivecasualw.com
  loctongchungcu.com
  locunphnsoskxvyp-dot-millinium.ey.r.appspot.com
  locuspura.com
@@ -198069,6 +197378,7 @@ login-ionos3948483737.blogspot.com
  login-labanquepostale.net
  login-liv.ga
  login-live-auth.herokuapp.com
+login-live-security.com
  login-live.com-s02.info
  login-log.secure-insurance-limiteds-paypal.idw877g4r51.business
  login-made-in-china-com-000babp0gud5bpg9abid-securelogin.pantheonsite.io
@@ -198218,6 +197528,7 @@ login-team-confirm.com
  login-tech.com
  login-telegram.com
  login-three-co-uk.com
+login-to-suncorp.buycannabisonline.info
  login-to-verify-r.weebly.com
  login-ugk8j9ybycp44seln0wg-user.signin-fsuvfeinib-unlock.club
  login-unzlmsfedktgmcfyvmle-user.intl-hupquneskz-region.club
@@ -198376,6 +197687,7 @@ login.informationaccapp-accidsecurtyt.intlserpise.qihkg.org
  login.instag.repl.co
  login.instagram.com.flipkartcom.in
  login.instagram.com.hdco.xyz
+login.instagram.securely-logout.com
  login.ionos.com.new.session.23541.nullbar-clothing.com
  login.ionos.es.homecomfortguys.com
  login.ismartv.id
@@ -198624,6 +197936,8 @@ loginandupdate.com
  loginappl.blogspot.com
  loginapps-288509.uc.r.appspot.com
  loginappspayphones.com
+loginattcurrentlydomainsite.weebly.com
+loginattcurrentlydomainwebsite.weebly.com
  loginattmailcurentlypass.weebly.com
  loginatttmailbox.weebly.com
  loginattyahoomailnvjd.weebly.com
@@ -199046,6 +198360,7 @@ longcronixsm0fficialhousingforpeoplelivelifeforko.cf
  longcrunchim0fficialbeachlandmarkincountryarenews.ml
  longdesun.com
  longdistancevanlines.info
+longhaired-ebony-purpose.glitch.me
  longhands.net
  longhear.net
  longi.ca
@@ -199270,6 +198585,7 @@ love30-chanko.com
  love3513love3513.ddns.net
  love69.live
  loveaccounting.com
+loveadoresu.com
  loveafrofoods.com
  lovealiceprofile.online
  loveandco.es
@@ -199281,6 +198597,8 @@ lovebugflorist.com
  lovecrushweddings.com
  lovedone3ww.weebly.com
  loveempire.life
+lovefagara.com
+lovefagara.net
  lovefamilyholidays.co.uk
  loveforevermea.com
  loveforriches.com
@@ -199303,6 +198621,7 @@ lovelydualcommands.idrael.repl.co
  lovelypets.mx
  lovelyromeapartments.it
  lovelysmiley.com
+lovelywww.000webhostapp.com
  lovemark.ro
  lovematters536577.000webhostapp.com
  lovemedare.000webhostapp.com
@@ -199311,6 +198630,8 @@ lovenetwork.icu
  lovepubgm.com
  loveqarma.com
  lover-kingers.000webhostapp.com
+loveragagarag.com
+loveragagarag.net
  lovernaw.ga
  loversclubxx.ml
  loveru.ru
@@ -199334,9 +198655,7 @@ loveyou01.000webhostapp.com
  loveyou01couple.000webhostapp.com
  loveyourvalentine.icu
  lovienmorelos.ru
-loving-bhaskara-7def90.netlify.app
  loving-northcutt-368286.netlify.app
-loving-swanson-b55ac6.netlify.app
  lovinggleamingargument.angueluisreyama.repl.co
  lovinghandsayurveda.com
  lovmesdkiunrgbouvyxmjqxiig-dot-gleowayel400503.uc.r.appspot.com
@@ -199675,7 +198994,6 @@ lucianodelarco.com.br
  lucianoweb.com.br
  luciatle-71.tk
  lucid-brahmagupta-91bfd6.netlify.app
-lucid-sinoussi-f1726c.netlify.app
  lucid.kiev.ua
  lucidfestival.com
  lucidinvestbank.com
@@ -200197,6 +199515,7 @@ lzxkvwzjatfvzfom-dot-millinium.ey.r.appspot.com
  lzxlmy.com
  lzxsw100.com
  lzzbhq.com
+m-1.top
  m-1secure-cib-c.com
  m-37.svcoding.com
  m-8.svcoding.com
@@ -200257,7 +199576,6 @@ m-facebook-url20.gq
  m-facebook-url20.ml
  m-facebook-url20.tk
  m-facebook.byethost6.com
-m-facebook.co
  m-facebook.iteem-9137523.com
  m-facebook.iteem-924521.com
  m-facebook.iteem-927321.com
@@ -200723,6 +200041,7 @@ m.hf356.com
  m.hf378.com
  m.hf387.com
  m.hf392.com
+m.hf502.com
  m.hf503.com
  m.hf505.com
  m.hf587.com
@@ -200768,6 +200087,7 @@ m.kvl3963.com
  m.kvm9723.com
  m.lkm8995.com
  m.lkp2333.com
+m.lkq8599.com
  m.lks2983.com
  m.lmax-china.xyz
  m.localcitycenter.com
@@ -200827,7 +200147,6 @@ m.secure.runescape.com-uws.xyz
  m.secure.runescape7l.com-rsk.xyz
  m.sgizmoca.com
  m.shopinseattle.com
-m.shoponlinesellfcb.furni41221414.com
  m.smartspotscene.xyz
  m.softix.cn
  m.tgs8zkl.icu
@@ -201115,6 +200434,7 @@ macu-up.nl
  macukeybnk.be
  macuntu.000webhostapp.com
  macvedas.somee.com
+macwoman12.000webhostapp.com
  macworldservices2.com
  macxgnzyntlxtzyonugoixomcdpriauucgrn-dot-solar-vertex-285913.rj.r.appspot.com
  macxgnzyntlxtzyonugoixomcdpriauucgrn.solar-vertex-285913.rj.r.appspot.com
@@ -201469,6 +200789,7 @@ maggiogateway.buzz
  maggioturnpi.xyz
  maggotmutablev.com
  magiagua.com.br
+magianegramagiablancayamarres.com
  magiaverdejardim.com
  magic-in-china.com
  magic-living.com
@@ -201609,6 +200930,7 @@ maichismarang.com
  maicongoiz.com
  maid34rmd.000webhostapp.com
  maidenofmettle.cyou
+maidmalierde.godaddysites.com
  maidservicesandiego.net
  maiecolife.com
  maiegall.com
@@ -201708,7 +201030,6 @@ mail.aggiornamento-dati-utenza-web.com
  mail.agricareseeds.com
  mail.ahcindia.com
  mail.airsoftguns.sk
-mail.ajericoff.bluehoststaff.com
  mail.alerts-americanexpress.com
  mail.alferesbh.com.br
  mail.aliton.ru
@@ -201823,6 +201144,7 @@ mail.clicknow-whatsapp.cc.jetos.com
  mail.clothingjam.com
  mail.cnbhzd.com
  mail.codashop-uygoblok.join-grupnew.my.id
+mail.codeload.org
  mail.com-whattsap.v7z.shop
  mail.cometak2.com
  mail.connectibtinterauth.com
@@ -201950,6 +201272,7 @@ mail.grup-ahahtantehotjepang.claim654.com
  mail.grup-bokep.vipx3.com
  mail.grup-bokep.xxx-wa.com
  mail.grup-wa-2020.myy.toh.info
+mail.grup-whatsapp.zynxc96.cf
  mail.grupbwhatsapp.help-glory99.ml
  mail.grupicapoetry.whatsapp-invite57.ga
  mail.grupmabar-budi01gaming.com
@@ -202021,6 +201344,7 @@ mail.jandajogagoyang.kozow.com
  mail.jannawels.nl
  mail.javxdwa.s13usa.org
  mail.jbrf.com.br
+mail.jeffsono.org
  mail.jetonluoyuncak.com
  mail.join-chatgruoooupwhatsappindobokep.tk
  mail.join-groupwhatsapp.bokepnew.gq
@@ -202118,11 +201442,13 @@ mail.mypayee-login.com
  mail.myservices-ee.co.uk
  mail.mythree.ltd
  mail.nathaliadill.com.br
+mail.naturblog.es
  mail.neftlixaggiornare.com
  mail.neve-indoor.nl
  mail.new-payee-error.info
  mail.new-threebill.com
  mail.new-unusual-activity.com
+mail.newebapp.com
  mail.newgrub.xxx-wa.com
  mail.newhavenrestoration.org
  mail.newpayee-notification.cc
@@ -202469,7 +201795,6 @@ mail10483.best
  mail11928.xyz
  mail138995.buzz
  mail163inboxlogin.dumb1.com
-mail2.royal-eng.ps
  mail23918.icu
  mail28282.icu
  mail28827.icu
@@ -202920,6 +202245,7 @@ maleficentslovely.000webhostapp.com
  malehuagesecereteaa.us
  malejaduff.com
  malencacom.baerseventake.top
+maleonsvr.com
  malepenet.xyz
  maleposer.com
  malerbetriebbandcom.shaxiaact.top
@@ -202927,6 +202253,7 @@ malereieninfo.batwoqisellers.top
  malesherbiaceous.xyz
  malevolent-ornament.000webhostapp.com
  malexandersports.com
+malhadlqlawidghyataytihkhlinankhedmo.blogspot.com
  malhipur.in
  mali7.eu
  maliaep.servepics.com
@@ -202948,7 +202275,6 @@ malivor.com
  maliyanir.com
  malka-reklama.com
  malkaragida.com
-malkmabghitichtrjelmaanaasahbi.blogspot.com
  malkorinda.com
  malkotarnovo.org
  malkow-pl.revres.pl
@@ -203426,7 +202752,6 @@ manchoujouser.com
  manchu-solvent.000webhostapp.com
  manchurian-dealers.000webhostapp.com
  mancityp.com
-mandadodeintimacao.bid
  mandalabymallorca.es
  mandalakunststudiocom.nckiregister.gdn
  mandan.com.tr
@@ -203508,6 +202833,7 @@ manicbling.com
  manickamcharitabletrust.com
  manidhara.com
  manierearchtecture.com
+manifestchrist.net
  manifestinglab.com
  manifestslaytion.com
  manihospitalmotihari.com
@@ -203613,7 +202939,6 @@ manufacturedhousingassociationregulatoryreform.org
  manufakturduschencom.shuiacause.top
  manupuniversity.org
  manuscript.ge
-manuserd.info
  manutencaodigital-app.com
  manutencaoitauchecks.com
  manutenzione-anagrafica.com
@@ -203882,6 +203207,7 @@ maringareservas.com.br
  marini.cloud
  marinio01.cloudaccess.host
  marinoxz.com
+mariobrown.net
  mariofm.com
  marioliveirapersonal.com.br
  marioshots.com
@@ -203979,6 +203305,7 @@ marketinghelper.com.au
  marketingo.info
  marketingpalpueblo.com
  marketingprogram.hu
+marketingrealestate.ru
  marketingsulweb.com
  marketingtech.com.uy
  marketingu.us
@@ -204305,7 +203632,6 @@ marketplace-item897867.com
  marketplace-item911627003561.com
  marketplace-o853awdlx597ei.com
  marketplace-online.duckdns.org
-marketplace-post.31512.eco3global.com
  marketplace-properti.profileefacebok.us
  marketplace-propertisale.com
  marketplace-propertysales.us
@@ -204695,6 +204021,7 @@ markthomastour.com
  marktinbet.pw
  marktour.co.mz
  marktplaats-betaal.nl
+marktplaats-check.org
  marktplaats-verificatie.us
  marktplaats-verificatiie.nl
  marktplaats.betaalverzoek-services.digital
@@ -204890,6 +204217,7 @@ masilbanet.shaxiaapril.top
  masinimarcajerutiere.ro
  masjid-alrahman.org
  masjid.wpsetup.info
+masjidhabeebiyarazviya.mysunni.com
  masjidnuruliman.my
  masjidsalmanalfarsi.org
  mask-clan.de
@@ -205037,7 +204365,6 @@ masukgrupbokep2020.wa-chats69.tk
  masukgrupwhatsapp.cf
  masukgrupwhatsapp.ga
  masukgrupwhatsappbokephot2020.vipxz8.com
-masukkan-data-akun-dengan-benar.gq
  masuksini18.000webhostapp.com
  masuksoblah.asia
  masukuntuknontongratisvideoku.000webhostapp.com
@@ -205137,7 +204464,9 @@ matrlkrzzfdsucbe-dot-millinium.ey.r.appspot.com
  matronal-trash.000webhostapp.com
  matronasnym.es
  matrouh1973.myftp.biz
+matruchhaya.co.in
  matt-e.it
+mattangusstudios.com
  mattarecords.com
  mattawamoose.com
  mattayom31.go.th
@@ -205288,6 +204617,7 @@ maxstroy.su
  maxsushi.com.br
  maxtechmfg.com
  maxtitaniumnutricao.com.br
+maxtools.casa
  maxtox.com.pk
  maxtrek.ru
  maxucs13.com
@@ -205381,6 +204711,7 @@ mballet.ru
  mbamlhabnd.duckdns.org
  mban422.eh.r.us.a2ip.ru
  mbank-redirection-mobile.blogspot.com
+mbankia.es
  mbankingvnn.com
  mbaristvahqmtdmp-dot-millinium.ey.r.appspot.com
  mbasepanel.site
@@ -205581,6 +204912,7 @@ mdaconsultora.com.ar
  mdaiyuruqkfokllj-dot-millinium.ey.r.appspot.com
  mdajwtktsxloycrz-dot-millinium.ey.r.appspot.com
  mdamangesurvassl.bounceme.net
+mdasa.elin.co.za
  mdb3ee.app
  mdbmsjlcgkllbqdk-dot-millinium.ey.r.appspot.com
  mdbrouckbnynsixdmriqatjtpausukjayvxs-dot-offgl8876899977678.uk.r.appspot.com
@@ -205618,6 +204950,7 @@ mdnnqobxotabbyyjvdsmdmqdov-dot-gleowayel400503.uc.r.appspot.com
  mdnvbberiu.gb.net
  mdp.mg
  mdp11.000webhostapp.com
+mdpofcpfsusdjnzxdocvtpaomt-dot-gleow2021ja.ue.r.appspot.com
  mdprobuilders.com
  mdqassessing.co.za
  mdqylnxapiqlawdwrcwozvjcmtpxxhpzdfmx-dot-cryptic-now-290917.ey.r.appspot.com
@@ -205697,6 +205030,7 @@ med-pro01.ru
  med.addroits.com
  med.siam.edu
  med1providers.com
+medadisputehelp.com
  medaka.site
  medamiaudette.getenjoyment.net
  medapothekenet.batwoqisellers.top
@@ -206151,7 +205485,6 @@ member-runescape.com
  member-service.godaddysites.com
  member-standard-application.support
  member-wellsapp.mobi
-member-whatsapp.duckdns.org
  member.empireaes.com
  member.rakuten.co.jp.rakutenasdmklwasdlwek.buzz
  member.rakuten.co.jp.rakutenasdmklwasdlwek.monster
@@ -206406,6 +205739,7 @@ merrylu.co.il
  merseqice2achiqd.ddnsfree.com
  mersh.cf
  mersia.com
+mersinchk.gov.tr
  mersinescortlari.com
  mersrekdocuments.ir
  mersutrip.com
@@ -206639,7 +205973,7 @@ metropolitanogoiania.com.br
  metropolitanpropinc.serveirc.com
  metropubgm.com
  metropubgm16.dnset.com
-metroroyaleexodus.com
+metropubgx.com
  metroroyalepubgm.com
  metroroyalprize.jetos.com
  metrospesial.com
@@ -206654,6 +205988,7 @@ mettasc.com.br
  mettek.com.tr
  mettergal.buzz
  mettlelawchambers.com
+mettropubgm.com
  metwoodexclusive.com
  metxe.com
  mety.strametyapi.com
@@ -207130,6 +206465,7 @@ micromacllc.com
  micromode53.xyz
  microndemo.ml
  micronews.eu
+micronotifications.com
  micropcsystem.com
  microphonemember.com
  microption.com
@@ -207181,7 +206517,6 @@ microsoft-store.sytes.net
  microsoft-trojan-warning.cf
  microsoft-verify.ddns.net
  microsoft-word.duckdns.org
-microsoft.licensing-servicecenter.com
  microsoft.loginoauth2.com
  microsoft.office365.outlook.owa.tradestarexports.com
  microsoft.officedocuments.me
@@ -207395,6 +206730,8 @@ mijn-passenherstel.xyz
  mijn-raboprocess.xyz
  mijn-sns-online-verificatie.xyz
  mijn-st2.nl
+mijn-updatecheck.xyz
+mijn-verzendingkosten.xyz
  mijn-wp3.nl
  mijn.ing-klantenservice.nl
  mijn.ing.nl.9bke68qkcvoa20z3p43g.cf
@@ -207407,6 +206744,8 @@ mijn.ing.nl.usamad.com
  mijnbetaalpas.info
  mijnfondsplatform.com
  mijnics-klantenomgeving.zap516804-3.plesk09.zap-webspace.com
+mijnics-onlineservers.info
+mijnics-onlineservice.info
  mijning-alert.nl
  mijning-herstelformulier.info
  mijning-login-nl.com
@@ -207471,6 +206810,7 @@ miketoddington.com
  mikevirdi.com
  mikeyscoffee.com
  mikhailk.ddns.net
+mikhailmotoringschool.com
  mikhimshaissayd.blogspot.ba
  mikhimshaissayd.blogspot.be
  mikhimshaissayd.blogspot.cl
@@ -207507,7 +206847,6 @@ miknoupasder.blogspot.com
  mikocin.site
  mikom.xyz
  mikomatsu.com
-mikr.cam
  mikrokaynakmerkezi.com
  mikrotik.com.pe
  mikrotips.com
@@ -207796,6 +207135,7 @@ minositett.tavmunka.org
  minotspritsail.com
  minoutohd.000webhostapp.com
  minpays.com
+minpic.de
  minstrelcrack.com
  minsumania.com
  mint-hospitality.com
@@ -207965,9 +207305,7 @@ mistcinemas.com
  mistercertified.net
  misterix.duckdns.org
  mistermiragerecordings.com
-misterpearl.com
  misterpi.at
-mistextinct.cyou
  mistikmarket.com
  mistimbas.com
  mistore.com.au
@@ -208107,7 +207445,6 @@ mjihkbocpygbsbqp-dot-millinium.ey.r.appspot.com
  mjjtncwnvckfoxlvddbr.com
  mjjtobmrqyolqqbqukpl.com
  mjk-s.com.ua
-mjk8v.app.link
  mjkarairmr.com
  mjkfdfvvmrplphncgunkeuarhi-dot-gleowayel400503.uc.r.appspot.com
  mjkhpsk5hkuavklffqly.us-south.cf.appdomain.cloud
@@ -208250,6 +207587,7 @@ mlbb-skineventpromo229.serveuser.com
  mlbb-skineventpromo231.serveusers.com
  mlbb-skineventpromo233.serveuser.com
  mlbb-skineventpromo437.wikaba.com
+mlbb2021-events.ga
  mlbb41.gq
  mlbbevent.xyz
  mlbbfreediamonds36.000webhostapp.com
@@ -208272,6 +207610,7 @@ mlbbskineventpromoo111.webredirect.org
  mlbbskinkofoktober.zyns.com
  mlbbsystem.com
  mlbbxkof.shock-connect.com
+mlbbxxskin.com
  mlbfreestream.gq
  mlbxotkidgnuzobl-dot-millinium.ey.r.appspot.com
  mlbyczaqurxrffbz-dot-millinium.ey.r.appspot.com
@@ -208344,6 +207683,7 @@ mmasenger.buzz
  mmasenger.xyz
  mmassyifa.com
  mmautodeals.com
+mmber-ppl.com
  mmbrfknzcqtfedfqviioqhbdpzkbzptzsfjo-dot-glegen303939423233.ue.r.appspot.com
  mmbvvfcvfkkgrxdrefrulmoyml-dot-gleowayel400503.uc.r.appspot.com
  mmbxvnfanyhenemn-dot-millinium.ey.r.appspot.com
@@ -208384,7 +207724,6 @@ mmkhokan.xyz
  mmknlhdsynweurwa-dot-millinium.ey.r.appspot.com
  mmktpxqybzqdmpcf-dot-millinium.ey.r.appspot.com
  mmlart.com
-mmlb-skinfree.tk
  mmlgmhhqlmatvron-dot-millinium.ey.r.appspot.com
  mmlksteel.ch
  mmlures-shop.com
@@ -208432,7 +207771,6 @@ mmsmsmdnplxizzde-dot-millinium.ey.r.appspot.com
  mmsn.svcoding.com
  mmsorange-hu.yolasite.com
  mmsorg.yolasite.com
-mmspassword.yolasite.com
  mmsportable.kissr.com
  mmspos01088.firebaseapp.com
  mmsprofiles.000webhostapp.com
@@ -208692,6 +208030,7 @@ mobile-instagramaid.com
  mobile-kleinanzeigen.de.m-elnioggen.de
  mobile-legend-bangbanghero.ezua.com
  mobile-legends-bagi2-hadiah.my.id
+mobile-legends-freeskin2021.gq
  mobile-legendsnovember13.mrbonus.com
  mobile-lgems.alsuemdekkzmd.com
  mobile-login-bofa.com
@@ -208751,6 +208090,7 @@ mobile.facebook.security.alejandrovelez.org
  mobile.fb.com.marketplace.item.70283649883493.com
  mobile.helpfb2313197.fbhhm.com
  mobile.ifacebock.com
+mobile.illumetechnology.com
  mobile.lnstagram.com.toufikk.com
  mobile.mfrga3inlakmok.com
  mobile.sccom.cn
@@ -208882,7 +208222,6 @@ mobilelegendsactivitynew.ml
  mobilelegendsactivitynew.tk
  mobilelegendsbb-eventskin.000webhostapp.com
  mobilelegendsclaim.com
-mobilelegendse-events.ml
  mobilelegendseventbangbang.cf
  mobilelegendseventsskin7.ga
  mobilelegendsevets2020.dynamic-dns.net
@@ -208928,6 +208267,7 @@ mobileservice04.mobi
  mobileserviceonline.serveirc.com
  mobileshelving.com
  mobileslocator.info
+mobilesuperstacks.josealbertoal21.repl.co
  mobilesuporte.com
  mobiletech.net
  mobilethemesnlivewallpaper.com
@@ -209052,7 +208392,6 @@ modernofficedecor.com
  modernrattan.com
  modernsfoodproducts.com
  modeschmuckankaufcom.chifanassume.top
-modest-colden-5017d6.netlify.app
  modest-engelbart-d48174.netlify.app
  modest-murdock-a959b2.netlify.app
  modest-yonath-531225.netlify.app
@@ -209286,6 +208625,7 @@ mon-compte-ameli.fr
  mon-compte-personnel.com
  mon-compte.me
  mon-espace-sfr.com
+mon-paiement.web.app
  mon-paypai.com
  mon-portal.firebaseapp.com
  mon-remboursement-impots-gouv.dropsagency.fr
@@ -209553,6 +208893,7 @@ moonton2102.tk
  moontonfreegiftmlbb2020.ml
  moontonlm.gq
  moontonpreorder.cf
+moontonrqb.ga
  moontonverification.ga
  mooonskj.ddns.net
  moorebingosupplies.com
@@ -209560,6 +208901,7 @@ moorelaw-pc.com
  moorepine.xyz
  mooreslawngarden.com
  moorestowncenter.com
+moorestvhardware.com
  moorheadmarine.ru
  moorheadmn.buzz
  moorshealthandbeauty.co.uk
@@ -209567,6 +208909,7 @@ mooruuukoo.com
  mooshine.com
  mootah-medical.com
  mooviewatch.life
+mopai.sg
  mopasuomi.com
  mopiagpdytbcxnxa-dot-millinium.ey.r.appspot.com
  mopsf321.tk
@@ -209956,7 +209299,6 @@ mpounta-donuts.gr
  mppaccche.com
  mpparagon.com
  mppowerservices.com
-mpptm.cam
  mpress.com.br
  mps-attiva-sicurezza.000webhostapp.com
  mps-gruppo.com
@@ -210023,6 +209365,7 @@ mr7x4.jaysbrand.com
  mr98.svcoding.com
  mracessorios.com
  mradoabocoaozsph-dot-millinium.ey.r.appspot.com
+mrads.tk
  mraisalvi.com
  mrandmrsjordan.com
  mrappadvisor.com
@@ -210155,6 +209498,7 @@ msbtbqsonqhxtlkl-dot-millinium.ey.r.appspot.com
  msbuyl.com
  mscbsgob-es.social
  msceoconnections.com
+msceosummit.com
  mscni.org
  msconsultants.co
  msctahmedabad.com
@@ -210299,7 +209643,6 @@ mssystems.com.pk
  mstxepxtkdekbdnh-dot-millinium.ey.r.appspot.com
  mstxqvytnnprlbvhdrowtiewcl-dot-gloff00403993445.uk.r.appspot.com
  msuclanac.onmicrosoft.com.inboxreadl.icu
-msuisyayu.cam
  msupdate.info
  msupdate.net
  msupdater.co.za
@@ -210357,6 +209700,7 @@ mteooebitdldtxjj-dot-millinium.ey.r.appspot.com
  mteukkdittzaatyykkzl-dot-gleowyel040493443434989.wl.r.appspot.com
  mtewntcixopeutvy-dot-millinium.ey.r.appspot.com
  mtfelektroteknik.com
+mtfinancialb.com
  mtfseqcrsrvpdxaarc.top
  mtg5dghpy3rvymvymjayma.filesusr.com
  mthgkaljfsbbiopidpmsdgcucjfrlkmwdtfa-dot-gl494903049.wl.r.appspot.com
@@ -210394,6 +209738,7 @@ mtrvzqwzgvifpvdphcsxnzmsbuabhlcrfibu-dot-cryptic-now-290917.ey.r.appspot.com
  mts-int.com
  mtsense.tk
  mtsoft.com.tr
+mtspsmjeli.sch.id
  mtuclwvvzmuvdold-dot-millinium.ey.r.appspot.com
  mtunctejbtjrkmlz-dot-millinium.ey.r.appspot.com
  mtuwe.xyz
@@ -210695,6 +210040,7 @@ musicisit.de
  musiclessons.co.education
  musicloverlys.cf
  musicloverlys.gq
+musicologynow.org
  musicperu.club
  musicreadingsavant.com
  musicstarstudios.com
@@ -210842,6 +210188,7 @@ mwebp11.plala.or.jp.qatartraining.com
  mwedesignwfi.ru
  mwen.com
  mwenhbpdhmwiczalbmuwmyzqnyyrnenxpyhl-dot-cryptic-now-290917.ey.r.appspot.com
+mwfbb.ctiaspire.com
  mwfvrqhphpwwgzwi-dot-millinium.ey.r.appspot.com
  mwgjmcuohzvhhyrt-dot-millinium.ey.r.appspot.com
  mwgjqtmbaetmcctrkd.top
@@ -211056,6 +210403,7 @@ my-payees.org
  my-paypal-verification.com
  my-paypal.asia
  my-pending-debate.com
+my-piano.ctiaspire.com
  my-platinum-service.info
  my-platinum-wallet.su
  my-pp-unusal-activity.com
@@ -211096,7 +210444,6 @@ my-threenumber.com
  my-threeupdate.link
  my-transactions.com
  my-ts3-cubic-login.bocadelmarcarpetcleaning.com
-my-unicredlt.com
  my-unionbankph.com
  my-userpaypal.serveirc.com
  my-vehicle-tax-refund.com
@@ -211130,6 +210477,7 @@ my.commbank.com.au.australia.code.netbank.confirm.laxmiagroco.com
  my.commbank.com.au.australia.netcode.confirmation.shailungpower.com
  my.commbank.com.au.netcode.account.netbank.code.nichesitesecrets.com
  my.commbank.com.au.netcode.accounts.netbank.code.consciousholisticliving.com
+my.ctiaspire.com
  my.cyon.ch.editinglibri.it
  my.dundee1.unee.me
  my.ee-billingfailed.com
@@ -211668,7 +211016,6 @@ mycuhub.com
  mycupcake.fr
  mycurlydemanagessl.bounceme.net
  mycurrent.xyz
-mycustomer-service-centre.com
  mycustomerservice.is-a-therapist.com
  mycut.com.cn
  mycvdbenefit19.com
@@ -211810,6 +211157,7 @@ myeeprotect.com
  myeesecurity.com
  myeesucuremyaccount.com
  myeesupport.000webhostapp.com
+myeesupportuk.com
  myeeuk.com
  myeeverify-bill.com
  myehterrwallet.com
@@ -211910,6 +211258,7 @@ mygridironstuff.com
  mygroke.com
  mygroupwhatsapsexy.mrslove.com
  mygrowseeds.com
+myguitar1.ctiaspire.com
  myguru.us
  mygwyl.shop
  myh-la.com
@@ -211974,6 +211323,7 @@ myinvestvision.com
  myiptv.ca
  myj33p.com
  myjainshasan.com
+myjcb-servico.com
  myjcb.update.co.jp.myjcb-service.top
  myjcbs-members.fsaiche.com
  myjcbs.com
@@ -212234,6 +211584,7 @@ myreturn-hmrc.com
  myrewardpubg.com
  myriadclassified.com
  myricardoqdestin.email
+myritz.vettickal.com
  myriwell.pro
  myrnd.info
  myrogers-livechat.com
@@ -212269,7 +211620,6 @@ myserviceproduc.com
  myservices-eehub.com
  myservices.live
  myshadplanx.cyou
-myshedplanss.buzz
  myshedpslakjhs.us
  myshop-bgj604.myinsales.ru
  myshop.yo.fr
@@ -212298,7 +211648,6 @@ myspinspubgm.com
  mysql.flypig.group
  mysql.justroll.ru
  mysquareaccunt.com
-mysrv1.com
  mysstitch.000webhostapp.com
  mystarholiday.com.my
  mystatebk.com
@@ -212486,6 +211835,7 @@ myvoicelinkedinapp.com
  mywasta.com
  mywayeg.info
  myweb-update.dynamic-dns.net
+myweb.ctiaspire.com
  mywebarticle.com
  mywebcoupon.com
  mywebnerd.com
@@ -212812,6 +212162,7 @@ nabsibs.com
  nabtechnic.com
  nabtolonu1913.blogspot.com
  nabtolonu1913.blogspot.kr
+nabukovel.com.ua
  nabverify.services
  nabverify.support
  nabxpgoiplsrvsfdwecvbjvofe-dot-gleowayel400503.uc.r.appspot.com
@@ -212861,6 +212212,7 @@ nagajitu.net
  nagalu-carinho.com
  nagari.or.id
  nagarnews24.com
+nagata-k.net
  nagel.pintogood.com
  nagetofic.com
  nagiah.website
@@ -212956,6 +212308,7 @@ nalihgoodpuzdsqa-dot-millinium.ey.r.appspot.com
  nalini.com.au
  nallyoolthxqdfsn-dot-millinium.ey.r.appspot.com
  nam.unitregistry.com.au
+namaalhijaz.com.sa
  namaomuseum.ca
  namapak.com
  namastekarnali.com.np
@@ -213436,6 +212789,7 @@ navar437.000webhostapp.com
  navaro-ruralviacastro.com
  navaryacht.com
  navase.com
+navayurveda.in
  naveenagra.com
  naveenassociates.co.in
  navegacaolacet.com.br
@@ -213588,6 +212942,7 @@ nbs0.mentriqq.com
  nbsghana.org
  nbsgs.xyz
  nbshe.top
+nbsmylwocrvwfvbbecgwpcgfoq-dot-gleow2021ja.ue.r.appspot.com
  nbstm.com
  nbtluikmmsqbqmyd-dot-millinium.ey.r.appspot.com
  nbtreeservice.com
@@ -213626,7 +212981,6 @@ ncd.kg
  ncdccc.com
  ncddsy.com
  ncdepydnnawotysl-dot-millinium.ey.r.appspot.com
-ncdjfqq.cam
  ncdnsx.asia
  ncdongyanq.com
  ncenterpanel.cn
@@ -213811,7 +213165,6 @@ neecombd.com
  neecyhbtswaxtgvzsd.top
  need-feedbackamazon.yoursimpleself.com
  need-pen.com
-need4bd.xyz
  needcareers.com
  needhamma.buzz
  needmoreupup.gq
@@ -214090,6 +213443,7 @@ netbaa.com
  netbank-cancel-newpayid.com
  netbank-cancel-payid.com
  netbank-newpayid.com
+netbank-secure.com
  netbank-secure.com.au
  netbank.west-hsbc.com
  netbanksecure.app
@@ -214220,7 +213574,6 @@ netflix-estrenos.com
  netflix-factura.com
  netflix-failedbilling.com
  netflix-fatturazione.com
-netflix-free-cards.blogspot.com
  netflix-gb.ftr3.su
  netflix-gb.tep2.su
  netflix-gf.com
@@ -214617,6 +213970,7 @@ netorgft4835487-my.sharepoint.com
  netotrade.com
  netpaymentservices.com
  netpeliix.com
+netperest.gb.net
  netpersonalizados.com
  netplus21.de
  netportalreglement.info
@@ -214725,7 +214079,6 @@ neuplastlcs.com
  neuralmapper.com
  neurocir.cl
  neuroen.de
-neurofix.work
  neurolat.id
  neurolinguistics.xyz
  neurologieregensburgde.nckiphoto.gdn
@@ -214738,7 +214091,6 @@ neurotransmitter.xyz
  neurotropic-dips.000webhostapp.com
  neuschelectrical.co.za
  neusoftware.com
-neutraldeep.guru
  neutralsources.com
  neutrondad.com
  neutrum.pl
@@ -214751,6 +214103,7 @@ nevergrowere.com
  neverland-g.com
  neverlandphotography.com
  neverlandvietnam.com
+neverseenshop.com.mx
  neverstable.info
  nevertudywalkachinese2loneinlifektugwq.ydns.eu
  nevesai.com.br
@@ -214817,10 +214170,10 @@ new-opt.com
  new-paired-device.cc
  new-paired-device.link
  new-paired-payee.com
-new-payee-alert-cancellation.com
  new-payee-alerts.com
  new-payee-authorisation.com
-new-payee-cancellation-support.com
+new-payee-confirm-security.com
+new-payee-decline-help.com
  new-payee-decline-support.com
  new-payee-decline.com
  new-payee-device.com
@@ -214928,7 +214281,6 @@ new20201.godaddysites.com
  new2020groupwhatsapp18.ve99.net
  new3-authorisation.com
  new3-network.com
-new3-validlogin.com
  new4.pipl.ua
  newabidgoods.com
  newaccess-288111.ey.r.appspot.com
@@ -215036,7 +214388,6 @@ newerracap.com
  newessayhelp.live
  newevent-freefire27.login-772.cf
  neweventmlbb2020.dynamic-dns.net
-neweventrewards.com
  newevents-mobilelegends.cf
  newevents12.qqpubgmevents.com
  neweventsdarigarenakulgar.claims2.com
@@ -215065,6 +214416,7 @@ newgoodandavailabledocumentreadyk.000webhostapp.com
  newgovtjobcircular.com
  newgqipf.goruli.com
  newgroups18s.000webhostapp.com
+newgroupsjoinsxxx.dsmtp.com
  newgroupsjoinwa.otzo.com
  newgroupswa-1.ourhobby.com
  newgroupwavirl.getez96.com
@@ -215190,6 +214542,7 @@ newpayee-secureaccount.com
  newpayee-secured-uk.com
  newpayee-secured.com
  newpayee-securityvalidation.com
+newpayee-updates.com
  newpayee-verifyalert.com
  newpayeeadd-secure.com
  newpayeecancel.net
@@ -215201,6 +214554,8 @@ newpayeeremoval.com
  newpayeereview-help.com
  newpayeereview.com
  newpayees-secure.com
+newpayees-security.live
+newpayees-update.com
  newpayeesupport.com
  newpaym-management.com
  newpaym-removal.com
@@ -215724,7 +215079,6 @@ nhgsqdk6ar9.com
  nhienbao.tk
  nhinsider.com
  nhipcauytevietnhat.com
-nhit.sg-host.com
  nhjrdphvjpcctxyp-dot-millinium.ey.r.appspot.com
  nhlan.com
  nhlbqkbsrkzihlzv-dot-millinium.ey.r.appspot.com
@@ -215932,7 +215286,6 @@ nightraid.me
  nightreti.com
  nightsalmon.xyz
  nightspiker.com
-nightview.casa
  nightvision.tech
  nightwoke.net
  nihaobrazzzahit.top
@@ -216005,6 +215358,7 @@ nimassloggs.ir
  nimbasia.com
  nimble.press
  nimbleclass166.com
+nimblegivingcase.sfsfffff.repl.co
  nimblemachines.beta.webenza.in
  nimbleoffice.org
  nimblescarceadware--five-nine.repl.co
@@ -216060,6 +215414,7 @@ niosdeledguide.com
  niosen.com
  nioslas.com
  nipfamily.nckibrazil.gdn
+niplast.rs
  nipolikernipo.cf
  nipolikernis.ml
  nipploncombineblades.com
@@ -216089,6 +215444,7 @@ nisargaraja.org
  nisbi.esex-esexmemekkeritingsiapcrot.srexeque.com
  nischalschalkboard.com
  nisen12345.ddns.net
+nishantkgautam.com
  nishatv.in
  nishchayedu.com
  nishikawakuchi.xyz
@@ -216420,6 +215776,7 @@ nnilll9998.000webhostapp.com
  nniyjslmfgurfbly-dot-millinium.ey.r.appspot.com
  nnj.addroits.com
  nnjastudio.com
+nnjuezeldipjqkevtjpqwdmjly-dot-gleow2021ja.ue.r.appspot.com
  nnklykwtsdafattiogqvpxvkwckcdyqajvwh-dot-cryptic-now-290917.ey.r.appspot.com
  nnkqtvwjbpajpdfk-dot-millinium.ey.r.appspot.com
  nnkxhpgmvzmjzeiydfwtrao.top
@@ -216530,6 +215887,7 @@ nobrealuminio.com.br
  nobrebronline.com.br
  nobrecargo.com.br
  nobrecidadania.com.br
+nocalnoodle.elin.co.za
  nocapnow.com
  nocc.pointnsave.com
  nocgihczygxqncodbdqizdqatqtcnxmhokfm-dot-solar-vertex-285913.rj.r.appspot.com
@@ -216548,6 +215906,7 @@ nocontent-immudgnz.velocityhub.com
  nocontent-jovohtsf.velocityhub.com
  nocontent-joxcshit.velocityhub.com
  nocontent-mnfsozmk.velocityhub.com
+nocontent-mpvvvoqo.velocityhub.com
  nocontent-mqrtpxoy.velocityhub.com
  nocontent-mullzsiy.velocityhub.com
  nocontent-nwcygrqp.velocityhub.com
@@ -216567,12 +215926,10 @@ nocontent-qxhntxyw.velocityhub.com
  nocontent-rfckykuf.velocityhub.com
  nocontent-rkjyqwzk.velocityhub.com
  nocontent-rznmxswz.velocityhub.com
-nocontent-rztwjtyn.velocityhub.com
  nocontent-sqqkmkyw.velocityhub.com
  nocontent-sxoxffei.velocityhub.com
  nocontent-syrxvomx.velocityhub.com
  nocontent-tnxsqiil.velocityhub.com
-nocontent-tyvnrwno.velocityhub.com
  nocontent-uibuwpss.velocityhub.com
  nocontent-upjhiolu.velocityhub.com
  nocontent-uvkquxnm.velocityhub.com
@@ -216581,6 +215938,7 @@ nocontent-uxvxklgg.velocityhub.com
  nocontent-uyudjiit.velocityhub.com
  nocontent-uzzrkyst.velocityhub.com
  nocontent-vmtryjyv.velocityhub.com
+nocontent-vnqlnxry.velocityhub.com
  nocontent-vuykrlnm.velocityhub.com
  nocontent-vvvppxqo.velocityhub.com
  nocontent-vzzrxnpv.velocityhub.com
@@ -216755,6 +216113,7 @@ nonametue33.live
  nonamewget54.live
  nonbelligerent-peak.000webhostapp.com
  noncemeadowlark.com
+nonchalant-crowd.surge.sh
  nonchalant-cute-braid.glitch.me
  nonconfirmative.info
  nonconstructive.info
@@ -216907,6 +216266,7 @@ nordmanngoldcom.nckithailand.gdn
  nordoffshore.nl
  nordorange.com
  nordvnnkjppnn.com
+nordxtremesolutions.ro
  noredowits.com
  norefedelese.com
  norenatiord.xyz
@@ -217026,7 +216386,6 @@ nossaslojas.tintasmc.com.br
  nossocentrogamek.com
  nossocombatecontraocorona.com
  nossocomecodesemanafeliz.com
-nostalgic-leavitt-6cfeb9.netlify.app
  nostalgic-lichterman-1412e9.netlify.com
  nostalgic-liskov-b4d36c.netlify.app
  nostalgic-sinoussi-6bc12b.netlify.app
@@ -217108,6 +216467,7 @@ notags.fbookcom-xttoxejx.electronicamarvan.com
  notags.fbookcom-xyqbwzbn.electronicamarvan.com
  notags.fbookcom-yszovtqo.electronicamarvan.com
  notags.fbookcom-zeqbonet.electronicamarvan.com
+notaires.ml
  notamuzikaletleri.com
  notardes.com
  notarial-spins.000webhostapp.com
@@ -217312,6 +216672,7 @@ novel-chaos.com
  novelcoronavirus.cc
  novelcoronavirusnews.xyz
  noveldocs.com
+noveleasy.cyou
  novelideas.com
  novelindo.xyz
  novellastrave.xyz
@@ -217328,7 +216689,6 @@ novich-c2ead.web.app
  novidades-do-mes-dos-namorados.com
  novidcerts.com
  novinroyapolymer.com
-novitests2021.pl
  novito.com.ua
  novo-acesso.segurowebmail.ml
  novo.aplicativobr.ml
@@ -217411,6 +216771,7 @@ npnoulggxxezdfeh-dot-millinium.ey.r.appspot.com
  npoexcellence.com
  npppolytechnic.org
  nppvnouohchdnrai-dot-millinium.ey.r.appspot.com
+nppwcpqvpsjvelzzjxpcaummcz-dot-gleow2021ja.ue.r.appspot.com
  nprvaspsoscpizbc-dot-millinium.ey.r.appspot.com
  nprvfhzbrpfvyorj-dot-millinium.ey.r.appspot.com
  npsgxdkfndxhhiuvohpqfwfnvynvfcebmsmg-dot-glenxpecial3009493.ey.r.appspot.com
@@ -217539,6 +216900,7 @@ ns1.royal-eng.ps
  ns1.tenracksprofit.xyz
  ns1.thanwya-online.com
  ns1.throwhosting.com
+ns1.unkrunchdesabor.com.mx
  ns2.alalmiyalhura.com
  ns2.apple-desk.co.uk
  ns2.arifcts.net
@@ -217640,6 +217002,7 @@ nsuhiizb.goruli.com
  nsuqotmyxfwfdxyq-dot-millinium.ey.r.appspot.com
  nsweb.nissenren-scort.co.jp.cd0e6d0e59a07e4d68c21a9c5b12d0d0e67a8.net
  nswhjwhjd6q.com
+nswylgntytrrjzsylvgkjblvwq-dot-gleow2021ja.ue.r.appspot.com
  nsxgqnobc.shoesmogul.com
  nsxsh.xyz
  nt-entreprises.com
@@ -217776,6 +217139,7 @@ nujmjeltndvqxzricfckibaaaeosspywosir-dot-cedar-code-289917.nn.r.appspot.com
  nuklrajwfioptvqxxghfedsvmn-dot-gloff849483.uk.r.appspot.com
  nukqzndfnuzzlqpzyoko.top
  nukumorinoie.com
+nukwfejxdhzmqdrskbdrghczjn-dot-gleow2021ja.ue.r.appspot.com
  nulinepcs.org
  nullifyrearend.com
  nullmblematicv.com
@@ -218176,7 +217540,6 @@ nzby1orv6o.000webhostapp.com
  nzbybike.stage.net.nz
  nzcnmehyvwoopdot-dot-millinium.ey.r.appspot.com
  nzcofjwpsqpvanrn-dot-millinium.ey.r.appspot.com
-nzcxak-log.buzz
  nzcxvwxjmvummssrkz.top
  nzdebuq.goruli.com
  nzfhledtazsjvdbg-dot-millinium.ey.r.appspot.com
@@ -218288,7 +217651,6 @@ o2-securityteam.com
  o2-support.net
  o2-updatebilling.com
  o2-updatebillinginfo.com
-o2-updatebillings.com
  o2-updateinformation.com
  o2-verify-billing.net
  o2-your-billing.com
@@ -218300,7 +217662,6 @@ o2.account1-service.com
  o2.bill-alert.net
  o2.bill-uk1.com
  o2.billing-1account.com
-o2.ebill-confirm.live
  o2.failed-info.com
  o2.invoice093.com
  o2.mobilebilling01.com
@@ -218347,6 +217708,7 @@ o2billing.network
  o2billing.services
  o2billing.support
  o2billingerror.com
+o2billingfailure.com
  o2billingsupport.com
  o2billingupdate.com
  o2cab.com
@@ -218517,6 +217879,7 @@ obird.ca
  obiwan2021.xyz
  obixpdf.sa7o.com
  objectionable-elimi.000webhostapp.com
+objectionlivecenters.ml
  objectionsupportform.tk
  objectiontocopyrightlnstagram.com
  objective-fermi-75a252.netlify.com
@@ -218529,7 +217892,6 @@ objew.xyz
  obkejxnbravpgjsk-dot-millinium.ey.r.appspot.com
  obkkzgllcywkuuzv-dot-millinium.ey.r.appspot.com
  oblacheniya.ru
-oblifonline.us
  oblseaquioscumponsboassemanas.com
  obltjcebsvqmvgpo-dot-millinium.ey.r.appspot.com
  oblykotafolkkcvf-dot-millinium.ey.r.appspot.com
@@ -218663,6 +218025,7 @@ ocrbhd.com
  ocrie.com
  ocrocketsociety.org
  ocryws.com
+ocslf76xbox.com
  ocsps.org
  ocstudio.tv
  ocszgkofmtalxuns-dot-millinium.ey.r.appspot.com
@@ -218837,7 +218200,6 @@ oezeyoujwoilfpwxiuqofrlhpvnupabhfuju-dot-solar-vertex-285913.rj.r.appspot.com
  oezpiauooqeuozbr-dot-millinium.ey.r.appspot.com
  of-icc-es-123.du.r.appspot.com
  of357-alternate.app.link
-of76n.app.link
  ofacepraelasok.xyz
  ofam.com.ru
  ofcaidqnvyfutdrhncdgejaovuvxcrvknnxs-dot-glenxpecial3009493.ey.r.appspot.com
@@ -218846,7 +218208,6 @@ ofdpsogtdpaljfus-dot-millinium.ey.r.appspot.com
  ofdugudqpksgzlsavfmyxkzefp-dot-gleowayel400503.uc.r.appspot.com
  ofelafoods.com
  oferamericanasweb.com
-oferecendosempreomelhorparavoce.club
  ofert-al.com
  oferta-ame.com
  oferta-boas.com
@@ -219209,6 +218570,7 @@ offertail.com
  offertodeals.com
  offerup.user.fbk-profile78384.online
  offerup.ver-fied-763286773.site
+offf.to
  offgrounds.co
  offic3274717.sitebuilder.name.tools
  offical--fafebook.000webhostapp.com
@@ -219511,9 +218873,7 @@ oficialpubgindonesia.net
  oficina-bankia-eses-support.com
  oficina24.online
  oficinadenatacao.com.br
-oficiodigitaltjsp.bid
  oficionado.com
-oficlsnhtbxxyobbanyqpmuxph-dot-gleow2021ja.ue.r.appspot.com
  oficnna.sytes.net
  oficsqxxznqyxnke-dot-millinium.ey.r.appspot.com
  ofiosisdf.net
@@ -219541,6 +218901,7 @@ ofqzi3.mxp4037.com
  ofsboacnrtokvywqcdttotpzvnbbbdrvlpdv-dot-gl494903049.wl.r.appspot.com
  ofsd.goruli.com
  ofspymk.rogagot.com
+ofstlaxcala.gob.mx
  oftalmoday.com.br
  oftasoler.es
  oftbxwfgkzmxaeun-dot-millinium.ey.r.appspot.com
@@ -219795,6 +219156,7 @@ ok-bonusesfera.hopto.org
  ok.uananymore.ru
  ok.ygto.com
  ok0009.com
+ok202088.com
  oka-kaikei-okayama.com
  okactprep.com
  okamayasahashi.online
@@ -219888,7 +219250,6 @@ okxcrjnyygzjgwgj-dot-millinium.ey.r.appspot.com
  okxlnzwvodtijrzf-dot-millinium.ey.r.appspot.com
  okykhqmbuqflandf-dot-millinium.ey.r.appspot.com
  okzozwrlqrotanxs-dot-millinium.ey.r.appspot.com
-okzxwpczfwrvapolugctbtiwku-dot-gleow2021ja.ue.r.appspot.com
  ol1u.ru
  ol2.ir
  ola-muito9-bombastaaproveita.com
@@ -220003,6 +219364,7 @@ oldschool.secure.com-xr.ru
  oldschoolfun.net
  oldschoolrunescape-award.com
  oldschoolrunescape-awards.com
+oldschoolvalue.s3.amazonaws.com
  oldstyle.ro
  oldthemahalo.webgraphity.com
  oldtime.ddns.net
@@ -220065,6 +219427,7 @@ oliwei.com
  olizk101.000webhostapp.com
  oljyesfrndojukywkpjbamwqfqufwnoqrooe-dot-glegen303939423233.ue.r.appspot.com
  olkiyut.com
+olkshs.ga
  ollegoods.com
  olli-f.de
  olliemezlematic.com
@@ -220109,6 +219472,7 @@ oluxgroup.com
  oluyamachine.xyz
  olvedps.live
  olvhdiaeapylfmdd-dot-millinium.ey.r.appspot.com
+olvishaouvvtjbrdjiucwquapt-dot-gleow2021ja.ue.r.appspot.com
  olvxrqeaihkbgjhc-dot-millinium.ey.r.appspot.com
  olwenenergy.com
  olwgvvwpkumjcinl-dot-millinium.ey.r.appspot.com
@@ -220125,6 +219489,9 @@ olx-pl.ml
  olx-polland.com
  olx-secure.pl
  olx-y.pl
+olx.pl-id629502.site
+olx.pl-id760296.site
+olx.pl-konto.ltd
  olx.pl.3ds.website
  olx.pl.oferta.kim
  olx.pl.platnosc.info
@@ -220160,6 +219527,7 @@ omanxvgjkunhgxqafvxthpujedetkhzasuvq-dot-cedar-code-289917.nn.r.appspot.com
  omar800.ddns.net
  omarelbalshy.com
  omarisouza.com
+omaromatic.com
  omasjderse.com
  omaterce.com
  omawood.com
@@ -220184,7 +219552,6 @@ omegawiki.dynalias.com
  omelettewhimplev.com
  omelhor-mes-em-variedades-express.com
  omelhor-sempre-aqui-do-seu-lado.com
-omelhoraoseulado.club
  omelhorconjuntodatramontinaparavoce.club
  omelhormeschegando.uni5.net
  omelhorsempreparavoce.com
@@ -220429,6 +219796,7 @@ onefarmdesign.com
  onefibre.co.uk
  onefifteen.nl
  oneflextiank.com
+onegonaddown.com
  onegreen.hk
  oneheartwarriors.at
  oneidcode.com
@@ -220547,6 +219915,7 @@ onli-ne.webredirect.org
  onli2connexionsinfg.webnode.at
  onliformat.000webhostapp.com
  onligne-messageriepro.webnode.com.co
+onlin9mtb.myvnc.com
  onlinbanking-asb.duckdns.org
  onlinchase.ipq.co
  onlinciti-001-site1.atempurl.com
@@ -220851,6 +220220,7 @@ online.hmrc.gov.uk.alaventa.cl
  online.hsbc.securityinterface.name
  online.lloyds-payee.co.uk
  online.lloyds-personal.co.uk
+online.natwest-welfare.com
  online.particulares-santander.club
  online.scotiabank-com.scotiweb.mx.scotlastore.com
  online.scotiabank.i1i0.xyz
@@ -220882,6 +220252,7 @@ onlineaccountupdates.exprm.com
  onlineaccountverification.com
  onlineacesonlineacesonlineacessonlineaces.weebly.com
  onlineacessoapk.online
+onlineactsmsbanacion.com
  onlineaddaforstudy.com
  onlinealertnotificationsupportservicescomcastresetnbvc530.000webhostapp.com
  onlinealfa.com
@@ -220904,6 +220275,8 @@ onlinebanking-authenticate.info
  onlinebanking-bankofamerica-com.cleverapps.io
  onlinebanking-devices.info
  onlinebanking-infostacking.pro
+onlinebanking-login-accounts.com
+onlinebanking-logon-accounts.com
  onlinebanking-mobile.com
  onlinebanking-mtb.com.virtualbranch.online
  onlinebanking-new-payees.com
@@ -220987,7 +220360,7 @@ onlineexcelviewer.ddns.net
  onlinefantacysports.com
  onlinefbcontest.000webhostapp.com
  onlinefidosolutions.com
-onlineflirt.fun
+onlinefnc.nz
  onlineforouvm-page1987589.000webhostapp.com
  onlinefreegiveaway.000webhostapp.com
  onlinegirlssexdate.creatorlink.net
@@ -221095,7 +220468,6 @@ onlinesharedproject.uc.r.appspot.com
  onlinesharedt20lc0c08llc1ca771.an.r.appspot.com
  onlineshop.koeln
  onlineshopsecurity.com
-onlinesitese.xyz
  onlinesport88.com
  onlinesportsboard.com
  onlinesquare4.net
@@ -221124,6 +220496,7 @@ onlinetransactionventeachat.000webhostapp.com
  onlineuk-login.com
  onlineupdateaccount.ddns.net
  onlineverificacion.ejemplo.me
+onlineverification.misecure.com
  onlineverificationatthdjd.weebly.com
  onlineverifictaion-paypal.hackerjeffry.com
  onlineverifield.xyz
@@ -221269,6 +220642,7 @@ ooi.cc
  ooicoamnblgcrxxw-dot-millinium.ey.r.appspot.com
  ooid.info
  ooin.ga
+ooisolutions.co.in
  oojhywzshlcvxjaudfikbrgvwr-dot-gleowayel400503.uc.r.appspot.com
  oojo.ru
  oojskfeosatobxot-dot-millinium.ey.r.appspot.com
@@ -221347,7 +220721,6 @@ open-checkid.co
  open-checkjpid.co
  open-css.money
  open-field-outlet.000webhostapp.com
-open-headset.000webhostapp.com
  open-roll.com
  open-vcs-gadis.qepxhp.ga
  open-way-view.ga
@@ -221442,6 +220815,7 @@ ophopparee.com
  ophtalmiccenter.com
  ophthalmiatrics.xyz
  opicolece.com
+opievolta.com
  opilacorp-bd.com
  opilagha.com
  opimomliin.com
@@ -221530,6 +220904,7 @@ opticats.com
  opticron.com.mx
  opticsbd.com
  optiko.ca
+optiline.com.ve
  optimaiot.com
  optimal-estate.com
  optimaldentist.com
@@ -221772,6 +221147,7 @@ oratt-71.ml
  orbayunatural.es
  orbelyx.com
  orbhftvemqtyzoqt-dot-millinium.ey.r.appspot.com
+orbiculate-news.000webhostapp.com
  orbity3.com
  orbitztour.com
  orcapm.com
@@ -221895,6 +221271,7 @@ orientalrugcleanings.com
  orientalspawellness.com
  orientationinlaws.com
  orientcam.org
+orientgatewayltd.com
  orientsdelivery.xyz
  orientsteels.com
  orienttegas.com
@@ -222044,6 +221421,7 @@ oscarengineeringclasses.com
  oscarolivas.com
  oscarorce.com
  oscarorchid.com
+oscarrajans.xyz
  oscarsnet.shaxiaca.top
  oscgmeovchngaeykofcyfpyyes-dot-gloff849483.uk.r.appspot.com
  oscl.gr
@@ -222099,6 +221477,7 @@ osobyzagionione.eu
  osobyzagionione.pl
  osohc6.com
  osohealthful.com
+osorio.webmarketinggt.com
  osoriofinance.com
  ososos.zapto.org
  ospcity.com
@@ -222513,7 +221892,6 @@ outlukupdated.netlify.app
  outlulk.neards.xyz
  outlupdateinv.netlify.app
  outlyingcalmoctagon.figueroaads123.repl.co
-outmail.royal-eng.ps
  outmailingoutlook.netlify.com
  outmazx.ml
  outmost-disks.000webhostapp.com
@@ -222735,6 +222113,7 @@ owerr.creatorlink.net
  owgnjqycheeysyqvttkx-dot-gleowyel040493443434989.wl.r.appspot.com
  owhtescmkcnonfkcoabbzafhlpdaysccssnu-dot-off94032393204.uk.r.appspot.com
  owibzwztts.duckdns.org
+owinltcfzfvhzqbt.com
  owkd-paypalservis5g.servebeer.com
  owksuccvuqdaewzhegacotcsnm-dot-gleowayel400503.uc.r.appspot.com
  owl.li
@@ -223067,7 +222446,6 @@ pa.thejerkparade.com
  pa.transformationartist.info
  pa.trvlmd.net
  pa0s.cloudns.asia
-paaaetrypaaal.000webhostapp.com
  paachpumpiaon.com
  paaqrxufncpyrotdpwkb-dot-gleowyel040493443434989.wl.r.appspot.com
  paargolbal.in
@@ -223151,6 +222529,7 @@ packethics.cyou
  packexim.vn
  packisaurelagrandz.000webhostapp.com
  packmedica.com
+packrile.com
  packsdechetumal.000webhostapp.com
  packservie.giize.com
  packshotclippingpath.com
@@ -223339,7 +222718,6 @@ page-review-login.info
  page-securiityy.000webhostapp.com
  page-signpoliticy.servebeer.com
  page-support62021.info
-page-unde-review2913.com
  page-under-appeal1192.xyz
  page-under-preview-5528.info
  page-under-preview-7452.info
@@ -223351,7 +222729,6 @@ page-under-preview6277.info
  page-under-preview8245.info
  page-under-preview9213.info
  page-under-review-184.com
-page-under-review2913.com
  page-under-reviews74.com
  page-user-block3.ga
  page-vide0.yolasite.com
@@ -223446,7 +222823,6 @@ pages-certificated-valid-invitation-14934702020.tk
  pages-certificated-valid-invitation-14934802020.tk
  pages-certificated-valid-invitation-14934922020.tk
  pages-certificated-valid-invitation-245242020.tk
-pages-community-standart-and-identity.xyz
  pages-help-identify-certificated-2020.my.id
  pages-reconfirm-active-info-2020.my.id
  pages-user-blocked.cf
@@ -223484,6 +222860,7 @@ pagessappleid-com.servecounterstrike.com
  pagesupportmessagebox.my.id
  pagesyouraccount.cloudns.asia
  pageversionsupport.net
+pageviewbills.ddns.net
  pagewebappsecure-manageaccountveriynginfo.jaswikan.com
  paggsgesesnoteconfrtrims.000webhostapp.com
  pagiee.org
@@ -223547,10 +222924,8 @@ painel.valorcomdescontoeaqui.com.br
  paingain.casa
  painmanage.ru
  painmanagement-atlanta.com
-painmussle.casa
  painpage.org
  painpause.work
-painreliftool.casa
  paintable-piles.000webhostapp.com
  paintballrentals.gq
  paintbeer.nl
@@ -223558,6 +222933,7 @@ painterbl.com
  painteromar.loan
  painters-online.xyz
  painterzindubai.com
+paintfiller.com
  paintglue.net
  paintingfivehead.com
  paintingworld77.000webhostapp.com
@@ -223599,6 +222975,7 @@ pakistanprinters.com
  pakistanreforminitiative.org
  pakjapannews.com
  pakket-bevestigen.xyz
+pakket-verzenden.me
  pakketservices.me
  paklawyer.com
  pakmarinesurveyors.com
@@ -223785,6 +223162,7 @@ panelbilling10.ru
  panelchidet.com
  paneldashbroadsquare.net
  paneldelmangador.blogspot.com
+panelfate.com
  panelfollowersig.rv20.net
  panelgame.tk
  panelli.kz
@@ -223975,6 +223353,7 @@ parceirolatam.com
  parceiros-americanas.me
  parcel-express-tracking-packages.com
  parcel.emiratespost.ae.bangerpickleball.com
+parceldeliveries.net
  parcelinn.com
  parcelnord.com
  parceltracking1.com
@@ -224055,7 +223434,6 @@ parnassyswnet.ru
  parnetsgroup.com
  paroissesaintabraham.com
  paroolal.com
-parootc.us
  paroquiasirmas.com.br
  parquecentral.com.co
  parquedascamelias.emplavi.com.br
@@ -224209,7 +223587,6 @@ passionateminnow.com
  passionconcert.com
  passionfitnessnet.chifanbackground.top
  passionlymja.com
-passionskill.guru
  passiveworkfromhome.com
  passlock-vk.000webhostapp.com
  passornaluminium.com
@@ -224227,7 +223604,6 @@ passprotabilababacom.000webhostapp.com
  passupt.web.app
  password-account-updater.gthomltd.com
  password-recover220119.000webhostapp.com
-password0.yolasite.com
  passwordfrecover.000webhostapp.com
  past-strengthened-halibut.glitch.me
  past.eu-gb.cf.appdomain.cloud
@@ -224282,8 +223658,10 @@ pathfinderuniversity.com.ng
  pathikareps.com
  pathofexile.host
  pathologie-rosenheim.homepage.t-online.de
+paths.elin.co.za
  pathypothesis.com
  patiboro.ga
+patience-ils-poussent.fr
  patiencecondition.club
  patinhodomal.duckdns.org
  patio.com.br
@@ -224329,6 +223707,7 @@ patrickedwardfallon.com
  patrickeliot.com
  patrickfoundation.net
  patrickglobalusa.com
+patrickneu.de
  patrickpalooza.com
  patrickstutzman.com
  patrilinear-mixture.000webhostapp.com
@@ -224424,6 +223803,7 @@ pavaroy5.beget.tech
  paveguard.ae
  pavelaras.zapto.org
  pavelsnack.000webhostapp.com
+pavementgroup.com
  paveway.co.ke
  pavgsrvptbfmduvy-dot-millinium.ey.r.appspot.com
  pavhd.com
@@ -224516,8 +223896,10 @@ pay-h3g.services
  pay-info.net
  pay-mobile-ee.com
  pay-netflx-monthly-com.blogdns.com
+pay-newpayee.com
  pay-notice-login.network
  pay-nujilppuern.com
+pay-olxdostawa.pl
  pay-p-al.com
  pay-pa-l-pay-reg.tk
  pay-pae.com
@@ -224568,6 +223950,7 @@ pay.qaux.cn
  pay.rmba.cn
  pay.ygox.cn
  pay.zutd.cn
+pay01-olx.pl
  pay1.sgog.cn
  pay1996.000webhostapp.com
  pay2020.jdevcloud.com
@@ -224609,7 +223992,6 @@ paydepalneverisomeno.4lima.de
  paydestruction.com
  payecnseu.com
  payee-access.uk
-payee-addition-verify.com
  payee-alertdevice.com
  payee-amends.com
  payee-assist-protection.com
@@ -224679,6 +224061,7 @@ payee-secure.vip
  payee-securekey.com
  payee-securesupport.com
  payee-security-alert.live
+payee-security-confirm-help.com
  payee-security-measure.com
  payee-security-online.net
  payee-security.co.uk
@@ -224760,6 +224143,7 @@ payeesecure-help.com
  payeesecure-hlep.com
  payeesecure-manage.com
  payeesecure-new.com
+payeesecure-web.com
  payeesecuredalerts.com
  payeesecurelogin.net
  payeesecuremanagement.com
@@ -224955,6 +224339,7 @@ payp-review-info.com
  payp-secure.xyz
  payp-uk.com
  payp-verification-login-user-login.werthantrading.com
+payp.li
  payp.mypaypalverification.com
  payp1982he.azurewebsites.net
  payp33.ml
@@ -225438,6 +224823,7 @@ paypal-uehdjkd.moenzymesr.com
  paypal-uk-limitation.com
  paypal-uk-limited.com
  paypal-uk-signin-home-account-verification.webpp.services
+paypal-uk-webcmd-login.done-login-access-krf41asdsge4h6g354sa3sdwej5yxncv54er.sentient.asia
  paypal-uk.80el6.eu
  paypal-uk.com.securewebapps.info
  paypal-uk.personal-information-authentication.com
@@ -225455,6 +224841,7 @@ paypal-unusual-activity-detected-verification-pending.pypaal.com
  paypal-update-account-centre.com
  paypal-update-billing.com
  paypal-update-com.vilaflor.gt
+paypal-update-uss.azurewebsites.net
  paypal-update-v8.ga
  paypal-update.fr
  paypal-update.igh.org.in
@@ -226300,7 +225687,6 @@ paypalice.com
  paypalid-online.serveftp.com
  paypalid-verifedmyaccount.inspirasikita.org
  paypalii.tk
-paypalil.ga
  paypalinc1.com
  paypalinc54.com
  paypalinc762.com
@@ -226579,9 +225965,11 @@ payplticket6015291.info
  payplticket603150798.info
  payplticket6350815.info
  payplticket7103795.info
+payplticket71642230.info
+payplticket71642231.info
+payplticket71642232.info
  payplticket760320880.info
  payplticket79013590.info
-payplticket8267274313.info
  payplticket85331791.info
  payplticket9472492.info
  payplticketcz933710.info
@@ -226612,6 +226000,7 @@ payqal-secure-ezslove-probleme-id-1245564165.arturortega.com
  payqal.net
  payqalc.000webhostapp.com
  payqalertonline.com
+payqijcxrzqzkpsyyjekfpocfo-dot-gleow2021ja.ue.r.appspot.com
  payresolver.com
  payrol.pay.s3-website.us-east-2.amazonaws.com
  payrpal-services.com
@@ -226815,7 +226204,6 @@ pcwibovhzjcwownl-dot-millinium.ey.r.appspot.com
  pcwizbiz.com
  pcxful.com
  pcxrzugjugnrbbqp-dot-millinium.ey.r.appspot.com
-pcyhvrntfgnlxqojwmfbsltzhq-dot-gleow2021ja.ue.r.appspot.com
  pczltdxjfexnctxn-dot-millinium.ey.r.appspot.com
  pd-iskra-lj.si
  pd2i.pw
@@ -227011,6 +226399,7 @@ peenni.xyz
  peenpxblfoxdxhlyhgqzebamdnurnvxjizxp-dot-solar-vertex-285913.rj.r.appspot.com
  peepschannel.com
  peer.yourluv.co
+peerlesstraining.com.au
  peescup.fun
  pefbazaar.com
  pefe.in
@@ -227072,12 +226461,7 @@ peluqueriaybellezaevas.com
  pemarules.in
  pembaislandhotel.co.tz
  pembangunankepri.com
-pembataalannblockirfacebooks.ml
  pembatalaan-blokir-fb.otzo.com
-pembatalaann-blockirfacebook.tk
-pembatalaannblock-facebook.ml
-pembatalaannblockir-facebooks.ml
-pembatalaannblockirfacebooks.ml
  pembatalan-blokir-facebook.zyanapro.com
  pembatalan-blokir18.ml
  pembatalan-pemblokiiran.weebly.com
@@ -227085,12 +226469,20 @@ pembatalanakun.blokircfbb20.my.id
  pembatalanblockir-facebook.oottz.com
  pembatalanblokir-fb.jetos.com
  pembatalanblokir-fb.misecure.com
+pembatalanblokirfacebok177.ml
  pembatalanblokirfacebook.dudu-07.ga
  pembatalanblokirfacebook.tk
  pembatalanfacebook.blokircfbb20.my.id
+pembatalann-blocked-facebook.tk
  pembatalann-blockirfacebook.ml
+pembatalann-blockirfacebooks.ml
+pembatalannblocked-facebook.tk
+pembatalannblocked-facebooks.tk
+pembatalannblockedfacebook.ml
+pembatalannblockedfacebook.tk
+pembatalannblockedfacebooks.ml
+pembatalannblockedfacebooks.tk
  pembatalannblockir-facebook.ml
-pembatalannblockir-facebook.tk
  pembatalanpemblokiran.viyyy-11.gq
  pembatalanpemblokiran2020.000webhostapp.com
  pembatalanpemblokiran2020.webnode.com
@@ -227105,6 +226497,7 @@ pemblokiran-login-facebook.ga
  pemblokiran-login-facebook.tk
  pemblokiran-newfb.ga
  pemblokiran-zip.my.id
+pemblokiran.kozoa78.tk
  pemblokiran2002.000webhostapp.com
  pemblokiran2020.000webhostapp.com
  pemblokiran21.biz.id
@@ -227124,6 +226517,7 @@ pemblokiranfbresmi1.tk
  pembrokega.buzz
  pemersatu-bangsa-17.000webhostapp.com
  pemersatu-bangsa-berbagi12345.000webhostapp.com
+pemersatu-bangsa10.cf
  pemersatubangsawhsatsappgruplokal.000webhostapp.com
  pemjiduutjmeovhv-dot-millinium.ey.r.appspot.com
  pemsum.org
@@ -227153,6 +226547,7 @@ pending-validatepayee.com
  pending.messages.brieige.com
  pendingdevice.com
  pendingdevices.com
+pendingdevices.link
  pendinggrowert.com
  pendinghmrc-uk-taxrebate.com
  pendingref.com
@@ -227333,6 +226728,7 @@ perfume.pk
  perfumedopens.com
  perfumegallery.com.au
  pergamin0-escrach0.000webhostapp.com
+pergoblinds.com
  perhapspays.tk
  perhodastmou.tk
  perhulory.com
@@ -227627,7 +227023,6 @@ petshappyhome.com
  petsittingexcellence.com
  petter8358227.xyz
  pettisvilleoh.xyz
-pettybluekeychanger.elmazoprieto.repl.co
  pettyrosso.it
  peturreja1971.blogspot.be
  peturreja1971.blogspot.com
@@ -227746,7 +227141,6 @@ pghsystsrwdfqgasd.com
  pgihgwnol.biogenicherb.com
  pgjtqycnpngvzhci-dot-millinium.ey.r.appspot.com
  pgjyiqvjwfmdmwqh-dot-millinium.ey.r.appspot.com
-pglwxikfksdkahempclrlnpyzp-dot-gleow2021ja.ue.r.appspot.com
  pglxtjufqhfadyhq-dot-millinium.ey.r.appspot.com
  pglxtxbrjgqgfpdy-dot-millinium.ey.r.appspot.com
  pgm-patrimoine.com
@@ -227853,7 +227247,6 @@ phcpharmaconsultnet.nckifitness.gdn
  phdchiropractic.com
  phdhcoupon.com
  phdm9.jaysbrand.com
-phdpills.club
  phegokfrymbozerf-dot-millinium.ey.r.appspot.com
  phelieuasia.com
  phelieuhoanghung.com
@@ -227920,6 +227313,7 @@ phishus.net
  phising122-1.000webhostapp.com
  phising673.000webhostapp.com
  phisingcandra.000webhostapp.com
+phittc.com
  phixsene.xyz
  phjgas.ug
  phjjfbretkmzsujqafmsmbtnza-dot-gleowayel400503.uc.r.appspot.com
@@ -227990,7 +227384,6 @@ photo21124.000webhostapp.com
  photo360.kubooking.com
  photo64578.000webhostapp.com
  photoartcontestgoodvibesandtravel.000webhostapp.com
-photobank2021.xyz
  photoboothpr.com
  photoboothsupplier.com
  photocake-guides.com
@@ -228083,7 +227476,6 @@ piajeppesen.dk
  piandizano.it
  piano-tuning-how-to.com
  pianobanan.com
-pianochampion.casa
  pianohub-170fd.appspot.com
  pianohub-170fd.dt.r.appspot.com
  pianomusics.cf
@@ -228372,6 +227764,7 @@ pirates-mist.ru
  piratestable.com
  piratic-flap.000webhostapp.com
  piratsalim.cc
+pirawince.com
  pirckxungwkv.com
  pirenejskiepsy.pl
  pirgdkkoqratxifilmcpqjugkfzgenufnfdb-dot-solar-vertex-285913.rj.r.appspot.com
@@ -228382,6 +227775,7 @@ pirmary.dynu.net
  pisarz.internetdsl.pl
  pisccajesenljjqz-dot-millinium.ey.r.appspot.com
  pisceshosting.com
+piscinadisolbiateolona.it
  piscinapanela.info
  piscinarosate.it
  pisciniste.ma
@@ -228971,7 +228365,6 @@ pljukgv.ga
  plkhjk.cf
  plkurier.eu
  pllogistix-intl.com
-pllqlaa.cam
  plm.org.hk
  plmyra.com
  plnue.club
@@ -229030,6 +228423,7 @@ plumbingpanamacitybeach.com
  plumdynamic.com
  plumillasyoka.com
  plumulose-sharpener.000webhostapp.com
+plumvillage.com.sg
  plunatavan.com
  plunderco.com
  plurais.pt
@@ -229054,6 +228448,7 @@ plvetlcbuoyhzuce-dot-millinium.ey.r.appspot.com
  plvzbzghajhmuasn-dot-millinium.ey.r.appspot.com
  plwseni.com
  plwxxdzjefsayqkg-dot-millinium.ey.r.appspot.com
+plymouthrocklegal.com
  plyu896.com
  plyzroylmmfxgzzd-dot-millinium.ey.r.appspot.com
  plzlcweb.com
@@ -229163,7 +228558,9 @@ pnkjg.mentriqq.com
  pnl17.ddns.net
  pnm.dermals.org
  pnmuauxyrzwnfptqau.top
+pnnspwdcvacigralejjghmrjwc-dot-gleow2021ja.ue.r.appspot.com
  pnny.kommanditgesel.icu
+pnp-creative.de
  pnp-th.com
  pnpboxes.com
  pnpsropar.com
@@ -229357,7 +228754,6 @@ polatlimatbaa.com
  polatlinet.com
  polcans.com
  pole.com.vc
-polemoniaceous-sort.000webhostapp.com
  polentaowl.com
  polesmkppoplwwm.duckdns.org
  polesportsfrance-marseille.fr
@@ -229547,6 +228943,7 @@ pontosacumulados.000webhostapp.com
  pontosacumulados.xyz
  pontosacumulou.redirectme.net
  pontosappita.com
+pontoscertoita.myddns.me
  pontosemilhias.000webhostapp.com
  pontosinternetnc2.com
  pontosita.myddns.me
@@ -229620,6 +229017,7 @@ popokinger.com
  poposidks.duckdns.org
  popperandshow.com
  poppermblematicv.com
+poppied-tissues.000webhostapp.com
  popplanet.com.au
  popprint.com.br
  poppylon.com
@@ -229677,7 +229075,6 @@ pornhubwa.join-now.net
  pornhubx.qhigh.com
  pornjoinsex.ocry.com
  pornman.com
-pornmesexvidio.ourhobby.com
  porno-gringo.com
  porno322.com
  pornogalaxy.chat.ru
@@ -229946,7 +229343,6 @@ positiveblacknetwork.com
  positivecommand.com
  positivefinancialgroup.xyz
  positiveomar.net
-positivethought.casa
  positivi-t.com
  positivitythinking.com
  poskorea.kr
@@ -229962,6 +229358,7 @@ possetinfoils.online
  possible-coast-283604.wl.r.appspot.com
  possibleomar.com
  possiblepaypal.com
+possiblewood.com
  possitivehamerviruscompany.club
  post-03450240.pytsoluciones.com
  post-03677722.ingeniousmarketer.com
@@ -230050,7 +229447,6 @@ post-ch.espace-client-ca.site
  post-e.top
  post-f.top
  post-g.top
-post-home-sendungsstatus.barrell-of-knowledge.info
  post-home-sendungsstatus.is-a-llama.com
  post-home-sendungsstatus.is-an-engineer.com
  post-i.top
@@ -230071,6 +229467,7 @@ post-y.top
  post-z.top
  post.360degreehosting.com
  post.ch-customer-package.com.u1283495.cp.regruhosting.ru
+post.ch-en-shortcut1.swisspost-com-b1440447.guidiroberto.com
  post.fbcom-79454563.premiumboxes.com
  post.new-item-sale-trade-56040129470.xyz
  post.new-item-sale-trade-6873021098.xyz
@@ -230222,6 +229619,7 @@ postnl-verzendkosten.live
  postnl.nl.verzendlabels.top
  postnlsorteercentrumzendingtrackentracemijnaccount.info
  postoveschranky.com
+postpartumpostmortem.com
  postpericardial.xyz
  posts-12274191.e3offices.com
  posts-21162629.e3offices.com
@@ -230328,6 +229726,7 @@ powent.net
  power-boost.buzz
  power4event.extra16.com
  power4goods.com
+power760.com
  poweragecoopnet.shaxiaas.top
  poweragecoopus.shaxiaadd.top
  powerbanks.bounceme.net
@@ -230342,6 +229741,7 @@ powerexpress.in
  powerfrog.net
  powerful-invited-marscapone.glitch.me
  poweringinfluence.com
+powerlessseriousbrace.adasdfff.repl.co
  powerline-groups.com
  powerlinkaudio.com
  powerlinks.info
@@ -230424,6 +229824,7 @@ pp-logon.com
  pp-notification.com
  pp-paymentalerts.com
  pp-payments.me
+pp-ppsupport.000webhostapp.com
  pp-reactivate.com
  pp-renewal-verify.com
  pp-resolution-centre012.com
@@ -230614,7 +230015,6 @@ ppluserswebappsid.com
  pplusrlog.xyz
  pplverification.blogspot.com
  pplverify.resolvelimitations.tk
-pplwebappsobjects.com
  ppmakrifatulilmi.or.id
  ppmki.org
  pponline-restricted.com
@@ -230677,6 +230077,7 @@ pq-tk.pqrs.info
  pq372.svcoding.com
  pq4hm.addroits.com
  pq8t9.jaysbrand.com
+pqaqexyesnuejejccnepdydrca-dot-gleow2021ja.ue.r.appspot.com
  pqaxkffjrmnwgmem-dot-tetete-app.ue.r.appspot.com
  pqaxkffjrmnwgmem.tetete-app.ue.r.appspot.com
  pqbdytdrhxyvrkykdf.top
@@ -230695,6 +230096,7 @@ pqfxfxoknijqjpuq-dot-millinium.ey.r.appspot.com
  pqgaowidnthwlnbewvbhgivromkgcgnygfwu-dot-solar-vertex-285913.rj.r.appspot.com
  pqghtqjylztyafwn-dot-millinium.ey.r.appspot.com
  pqjqymzglqivooqh-dot-millinium.ey.r.appspot.com
+pqjxrpbcsolyugqthzcpqbcexn-dot-gleow2021ja.ue.r.appspot.com
  pqjylbnvalmlecgmfybalknxcstafyxbjbaj-dot-solar-vertex-285913.rj.r.appspot.com
  pqk.rogagot.com
  pqmgnvbrdwhfnjyleqljtnhzevbfhvolyhwy-dot-offglen.uk.r.appspot.com
@@ -230739,7 +230141,6 @@ practical-hodgkin-b109a8.netlify.app
  practical-perlman-550e2f.netlify.app
  practical-shockley-f451be.netlify.app
  practical-volhard-e1a3ca.netlify.app
-practical-wright-8f14e0.netlify.app
  practicalpeso.com
  practiclick.xyz
  practicum.botfactory.pro
@@ -230773,6 +230174,7 @@ prakritistore.in
  prakrititours.com.np
  pramahikvision-mail.net
  pramanaartharaharja.com
+pramitmedicalstore.com
  pramlee.com.my
  pramodkumarsingh.000webhostapp.com
  pranaplanet.com
@@ -230797,7 +230199,6 @@ prathameshbroadband.net
  pratibhasarees.com
  pratichedeifatturazionearuba.net
  pratichedeifatturazionearuba.org
-praticidade-segurancaparavoce.club
  praticideas.net
  pratidiner-bangladesh.com
  pratiikshrestha.000webhostapp.com
@@ -231028,6 +230429,7 @@ pressearthy.com
  presseclub-magdeburg.de
  pressenetgoogleapis.com
  pressftopayrespect.com
+pressionism.xyz
  presspointorg.chifanassume.top
  presspointorg.shaxiaaverage.top
  pressseasconkenya.com
@@ -231224,6 +230626,7 @@ primeagribusiness.com
  primeamazon.monster
  primeanimate.com
  primeappleid-managesigninvoice.dijalankansajanakal.com
+primecarefertilitycentre.co.ke
  primedeliv.com.br
  primedideo.gq
  primeeast.net
@@ -231367,7 +230770,6 @@ privacypaqes-notifications4.ga
  privacytools.life
  privacytools.su
  privacyweb-sicurezza.info
-privacyy-issue-notification-identityy.my.id
  privasii88.weebly.com
  privat-epargne.com
  privatadm.live
@@ -231396,7 +230798,6 @@ privatepopular.com
  privatepp.club
  privatesecurityandfinance.com
  privatetraffic.guru
-privatibusiness.it
  privatiiordackerch.ml
  privatkunde.best
  privatkunden-login874329832982.com
@@ -231536,7 +230937,6 @@ processing.authsecuremanages.com
  processingcheckdata1.com
  processingissue-updatenow.world
  processkaart-verificatie.com
-processo-pr-gov.email
  processrendered.com
  processsecure-netflix.com
  processserverskitchener.ca
@@ -231585,6 +230985,7 @@ producer.gamemorefun.net
  producersjourney.com
  product-kick.com
  productbeforebuying.com
+productenhance.com
  productfb586787656454564373.com
  production.sparshims.com
  productiondelphi.minehosting.xyz
@@ -231849,7 +231250,7 @@ profitablevacationrentals.com
  profitcall.net
  profitcoach.net
  profitcoins24.com
-proflighterasalagamegs.us
+profliffghtrealagame.us
  proflightgamebioyskisd.us
  proflines.ga
  profmaharaja.com
@@ -231893,12 +231294,14 @@ programsandtraining.net
  programsandtrainings.info
  programsfull.com
  progressfoundation.org.in
+progressive.croydon.online
  progressmining.com.au
  progressomar.top
  prohdmakeup.com
  prohmi.de
  prohumanistic.xyz
  proinse.com
+proinso.sa.com
  proinvest.trade
  proinvision.sk
  proitservice.ru
@@ -231919,6 +231322,7 @@ projectedplushing.com
  projecthal.info
  projectinternet.com
  projectiqengineering.in
+projectmanagementcoursesinsingapore.com
  projectnmax7887.000webhostapp.com
  projectolynx.com
  projectprivate.cyou
@@ -231978,7 +231382,6 @@ promesapuertorico.com
  promethi.ml
  promethiumswooth.com
  promfx.com
-promindocmplexlelvle.us
  promintra.in
  promise-my.com
  promixcopl.com
@@ -232095,6 +231498,7 @@ propanbutancom.nckiamerican.gdn
  propanda.com.ng
  proparoxytone-berth.000webhostapp.com
  propcomwcowuk.ru
+properavder.casa
  propergrass.com
  properrty.co
  properties-ads-fbpage962613.net
@@ -232109,6 +231513,8 @@ propertiespage745232562320.com
  propertiesrealtygrouppage-temproperties-pfb201145471385.org
  propertiesspage54356.com
  propertiesunlimitedph.com
+propertiq.elin.co.za
+propertiq2.elin.co.za
  propertisale.facebokz-marketplace.us
  propertisale.markettplace-flacebok.us
  propertisales.facebok-marketplacesads.us
@@ -232201,11 +231607,12 @@ protecaoativajp.joomla.com
  protecaoportal.com.br
  proteccion-de-datos-arg.com
  proteccionseguridad.com
+protecface.casa
  protechsp.com
  protect-eu-mimecast.messaging.sndpwebtech.com
  protect-ld-8456132134561az31.rahrogroup.com
  protect-mimecast.delevering-report.arcmedicalbilling.com
-protect-paypal-id893.com
+protect-mylogindetails.com
  protect-unconfirmed-transaction.com
  protect-your-halifax-account.com
  protect.theresortweddings.com
@@ -232281,6 +231688,7 @@ protocolsolution.com
  protocosll.xyz
  protocuysocponskjsh.us
  protonmail.com.renser.us
+protonmailteams.weebly.com
  protonpowertools.com
  protonsonic.com.my
  protour.vn
@@ -232293,13 +231701,13 @@ protsxtelisarb.com
  prouddamaging.com
  proudground.org
  prouns.rs
-provaccine.us
  provado.in
  provalcare.com
  provashlife.com
  proveedorsites.000webhostapp.com
  provellpharmma.com
  provenancegifts.com
+provence.elin.co.za
  provenforceindonesia.com
  provenhealsynergy.com
  proviamocosamanca.it
@@ -232374,7 +231782,9 @@ prtptpllwaqaybfl-dot-millinium.ey.r.appspot.com
  prtramblingcom.shaxiapussy.top
  prudish-hit.000webhostapp.com
  prueba.aquiypunto.com
+prueba.danielluza.com
  prueba.pantoanima.es
+prueba2.adivertirse.com.mx
  pruebaa9.000webhostapp.com
  pruebaderebuild.000webhostapp.com
  pruebaingenieria1234567.000webhostapp.com
@@ -232521,7 +231931,6 @@ psn-codes-generator.com
  psnacademy.in
  psndea.ci
  psngbubu.otzo.com
-psosk.gov.bd
  psotm.pl
  pspariz.com
  pspgemencheh.edu.my
@@ -232726,6 +232135,7 @@ pubgbox13.com
  pubgbug14.jkub.com
  pubgbugs13.my03.com
  pubgcare.com
+pubgchiken.com
  pubgclubx.com
  pubgcok.com
  pubgcollectmobile.com
@@ -232764,7 +232174,6 @@ pubgeventts2.2waky.com
  pubgeventucs.com
  pubgeventzz.com
  pubgexodusvip.com
-pubgexp18.duckdns.org
  pubgfer.com
  pubgfix.com
  pubgforarab.com
@@ -232934,6 +232343,7 @@ pubgmobile-s14.gleeze.com
  pubgmobile-sparktheflame.com
  pubgmobile-spinx.com
  pubgmobile-tournamentonline-season12.000webhostapp.com
+pubgmobile.com.xxucpubg.com
  pubgmobile.evenluck.com
  pubgmobile.loseyourip.com
  pubgmobile.royaleepass13.gifttsnow.com
@@ -232941,6 +232351,7 @@ pubgmobile015.com
  pubgmobile08.com
  pubgmobile11official.000webhostapp.com
  pubgmobile13.eventsluck.com
+pubgmobile17evnt.com
  pubgmobile2020freeus.ga
  pubgmobile23.otzo.com
  pubgmobile69.com
@@ -232949,6 +232360,7 @@ pubgmobileclaim.net
  pubgmobilecz.com
  pubgmobileeofficial.com
  pubgmobileevent58.freeddns.com
+pubgmobileexodus.com
  pubgmobilefreeeuss.cf
  pubgmobilegift.site
  pubgmobilegifte.com
@@ -232984,7 +232396,6 @@ pubgmobileventid.com
  pubgmobileventspin.com
  pubgmobilevip.com
  pubgmobilewinter-s10.000webhostapp.com
-pubgmobilexofficial.com
  pubgmobilexroyale.com
  pubgmobilexvoting.com
  pubgmobille.online
@@ -233066,6 +232477,7 @@ pubgrooms.in
  pubgroses.com
  pubgroyale.in
  pubgroyalepass.com
+pubgroyalpas2021.dns04.com
  pubgrp13.rulepubg.com
  pubgrp13.zzux.com
  pubgrpmax.com
@@ -233532,6 +232944,7 @@ pvewigzaaeqklmpyhpdvgjiwsa-dot-gleowayel400503.uc.r.appspot.com
  pvexxbhrrevwqexktufgzdugag-dot-gloff849483.uk.r.appspot.com
  pvflqvuogfllnpmr-dot-millinium.ey.r.appspot.com
  pvhuwmrudkxsycph-dot-millinium.ey.r.appspot.com
+pview-fymupnsdbt.arcinovationz.com.au
  pvigazcydffnfdovgbtlkxnzpc-dot-gloff00403993445.uk.r.appspot.com
  pvinselanlagencom.chifanbudget.top
  pvisack.free.fr
@@ -234261,7 +233674,6 @@ qjd39.mentriqq.com
  qjdax.mentriqq.com
  qjdhnusmgcazrmknshccgqrlol-dot-gleowayel400503.uc.r.appspot.com
  qjdpjy.goruli.com
-qjgcbxcdqiqoioydqffpodsjrx-dot-gleow2021ja.ue.r.appspot.com
  qjgvohyphohcgqrg-dot-millinium.ey.r.appspot.com
  qjgwfnmjnedmecks-dot-millinium.ey.r.appspot.com
  qjgwtrkdqawbqglr-dot-millinium.ey.r.appspot.com
@@ -234549,6 +233961,7 @@ qrbjvobmwgsoqdxs-dot-millinium.ey.r.appspot.com
  qrc-valves.com
  qrch.healthygenez.club
  qrcqdordmzekdyqwhnvimvjtxfcluvxdgsmg-dot-cedar-code-289917.nn.r.appspot.com
+qrcsvxmyjprrdpydjzrekmuxzl-dot-gleow2021ja.ue.r.appspot.com
  qrdhsuxzczxbtngmyhyxtctdrfnldpquqwqt-dot-solar-vertex-285913.rj.r.appspot.com
  qrdocqcnsaapuyxi-dot-millinium.ey.r.appspot.com
  qreenmaple.com
@@ -234818,6 +234231,7 @@ quemonezneza.000webhostapp.com
  quemviuissoegay.ddns.net
  quenshud.nahbwsyh.top
  quentinberra.fr
+quenvn.cam
  queoro.net
  querodemaisok.tk
  queroumavidaleve.com.br
@@ -234834,7 +234248,6 @@ queseriaslomba.com
  quesosmarkasa.com
  questerind.com
  questingpanda.com
-questis.guru
  questoutwall.xyz
  questraworld.es
  queue-pleskqposexim.indusdrills.org
@@ -234857,7 +234270,6 @@ quick.check-location.hotmal.log-xxxx.view.accaccess.com
  quickapps.in.net
  quickbizsoft.com
  quickbook73remittance47.ue.r.appspot.com
-quickby.in
  quickcarrental.ca
  quickcheckinfo.link
  quickchenge.com
@@ -234892,6 +234304,7 @@ quietdoorhardware.com
  quietlapland.com
  quietunripegreenware--five-nine.repl.co
  quiken.estate
+quillfish855598381199.blob.core.windows.net
  quilt-emmental-c26mmr7y7p.glitch.me
  quiltsetc.ca
  quimitorres.com
@@ -234921,6 +234334,7 @@ quip.onedrivefaxmail.club
  quipertise.com
  quirky-clarke-d15627.netlify.app
  quirky-johnson-c4a60c.netlify.app
+quirky-noether-5c0860.netlify.app
  quirky-noether-cd4453.netlify.app
  quistsolutions.eu
  quitaragora.godaddysites.com
@@ -234947,7 +234361,6 @@ quizzical-jang-166024.netlify.app
  quizzical-lamport-2bde27.netlify.app
  quizzical-leakey-647bbb.netlify.app
  quizzical-ptolemy-1e6d7f.netlify.app
-quizzical-wing-b03752.netlify.app
  quizzigquiz.000webhostapp.com
  quizzingbee.com
  qujedvbiikqvwuljmenftyyiiebfuaurdmwx-dot-cedar-code-289917.nn.r.appspot.com
@@ -234968,6 +234381,7 @@ quot3listordei.000webhostapp.com
  quota.creatorlink.net
  quotazimdata.000webhostapp.com
  quote-citate.site
+quoteelections.com
  quotes.solarflexion.com
  quotesenglish.vone.appskhonia.com
  quoteshub.in
@@ -235474,6 +234888,7 @@ rachel5601339.xyz
  racheroventadora.work
  rachini.ml
  rachmail.weebly.com
+rachmat-assuhaimi.my.id
  rachte001.host
  racinewv.buzz
  racinggpnet.shaxiaact.top
@@ -235528,6 +234943,7 @@ radiateur-deco.com
  radiaverse53.com
  radienten.com
  radimania.gleeze.com
+radintm.com
  radio-elkalem.com
  radio-medjugorje.com
  radio.kolelarab.com
@@ -235704,7 +235120,6 @@ raje0.svcoding.com
  rajengineers.net
  rajgarhia.net
  rajiasacademy.com
-rajibpalit.ifunnelspro.com
  rajinder.tk
  rajinderssidhu.com
  rajpaneerhouse.com
@@ -235723,6 +235138,7 @@ rakennus-mestari.fi
  rakentonchangxinq.xyz
  rakentonchangxinr.xyz
  rakentonchangxinw.xyz
+rakeshkhatri.in
  raketa.site
  raketanm-orjrfk.org
  raketanm-ppfnml.cc
@@ -235876,7 +235292,9 @@ rakuten-card.co.jp.id-corp-oo-gnav.vip
  rakuten-card.co.jp.jacken.xyz
  rakuten-card.co.jp.membershiponlionsunseteri.xyz
  rakuten-card.hostw.shop
+rakuten-card.icu
  rakuten-card.vip
+rakuten-card.work
  rakuten-carda.com
  rakuten-cardac.com
  rakuten-cardae.com
@@ -235964,8 +235382,6 @@ rakuten-jp-co.top
  rakuten-jp-login.tk
  rakuten-jp.buzz
  rakuten-jp.monster
-rakuten-li.buzz
-rakuten-li.online
  rakuten-login.top
  rakuten-lotte-jp.top
  rakuten-ma.com
@@ -235973,11 +235389,9 @@ rakuten-mail.pw
  rakuten-mail.site
  rakuten-mail.xyz
  rakuten-maill.buzz
-rakuten-market.buzz
-rakuten-market.cyou
-rakuten-market.xyz
  rakuten-ra.com
  rakuten-rc.com
+rakuten-store.buzz
  rakuten-support.com
  rakuten-tokyo.xyz
  rakuten-updat.cn
@@ -235999,6 +235413,7 @@ rakuten-verify.cyou
  rakuten-verify.monster
  rakuten-verify.xyz
  rakuten.51niujin.xyz
+rakuten.addwdq.xyz
  rakuten.arauakuenten.top
  rakuten.asxizxb.cn
  rakuten.c0.jp1.4efa7aed6eaefc9b1ac19ace.xyz
@@ -237032,6 +236447,9 @@ rakutensafe.xyz
  rakutensafejapan.com
  rakutensdfawejfl.monster
  rakutensdfwefzxcvwwezcver.monster
+rakutent.bncfgbxe.shop
+rakutent.bncfgbxe.tokyo
+rakutent.bncfgbxe.xyz
  rakutenteam.xyz
  rakutentep.top
  rakutentokyo.xyz
@@ -237083,7 +236501,6 @@ rakutevns.xyz
  rakutevnz.xyz
  rakutien.co.jpdflhnslsnslblrkglksrmbsfegn.sfhsjkbg.cn
  rakutien.xyz
-rakutjp.xyz
  rakutn-co-jp.mail1.best
  rakutnaevip.xyz
  rakutnavip.xyz
@@ -237698,6 +237115,7 @@ rcl.yme.so
  rcliner.cl
  rcltravel-crew.com
  rcmcrackrat.zapto.org
+rcmesilva.charbelsales.com.br
  rcmgdev44.xyz
  rcmvisions.com
  rcncrkkqsrtrdvqt-dot-millinium.ey.r.appspot.com
@@ -237841,6 +237259,7 @@ reach-brone.mywire.org
  reachingforhigherground.com
  reachinghappiness.icu
  reachziraat.com
+reacredit.com.br
  react-ba2roi.stackblitz.io
  react-happy.xyz
  reactione-fastisccinto.net
@@ -237908,6 +237327,7 @@ read-14953324.bid-digital.com
  read-15241106.bid-digital.com
  read-15648891.bid-digital.com
  read-16342249.bid-digital.com
+read-16409972.ht-egypt.com
  read-17045524.bid-digital.com
  read-17608546.bid-digital.com
  read-17903797.bid-digital.com
@@ -238430,7 +237850,6 @@ recibo-deappsy.ddns.net
  reciclare.info.ro
  reciearyahudapps.servegame.com
  reciev3dfikes.hopto.org
-recife.top
  recipe.247computronics.com.np
  recipeacademycom.nckibasketball.gdn
  recipetoday.xyz
@@ -238625,6 +238044,7 @@ redatcttserr.com
  redaten.rakutaha.top
  redbankfarm.com.au
  redbankinter.com
+redbats.co.in
  redbeat.club
  redbuddhazen.com
  redbunkerfilms.com
@@ -238632,6 +238052,7 @@ redchillicrackers.com
  redcleaning.com.au
  redclinic.in
  redcloakmusic.com.br
+redcorpabogados.com
  redcross-so.net
  redcrosswee.ml
  redcz.xyz
@@ -238737,6 +238158,7 @@ redirectwwer.servequake.com
  redirmail-apsupp-003549874833478523.billing-update379323.xyz
  redirpcpoints.com
  redisecincs.com
+redismsauthentifenligne.com
  reditecte3.crm7.com.br
  reditr.net
  redjewelry.biz
@@ -238835,7 +238257,6 @@ refclaim10.com
  refdklekfldldklrf.com
  refer-deauthorise.com
  refereedignity.com
-refereeimmune.cyou
  refereelighter.com
  referenc3ser1vice-ca.com
  reference-17743.site
@@ -238855,9 +238276,7 @@ referral.best
  referralpays.com
  referralwx.com
  reff-noreplysupport913.notifycation-oofrom.com
-reff-notice.com
  reff-update.com
-reff-urgant.com
  reff10202021.email
  reff15153333.email
  refferals-id823402932.chysajywuighd.com
@@ -238898,7 +238317,6 @@ refresh.riverterrace.org
  refreshing-towel.com
  refreshmall.in
  refricararcondicionado.com.br
-refrigeratorapple.guru
  refrimaisinstalacoes.com.br
  refrrallblock.cloudaccess.host
  refsc.ru
@@ -238965,6 +238383,7 @@ regeimaging.in
  regencymyanmar.com
  regencyship.info
  regenerationcongo.com
+regentediting.com
  regentmanagements.com
  reggaejammintours.com
  reggiesregallimo.com
@@ -239099,16 +238518,10 @@ regularizeclientesagora.com
  regularizeonlnebv.yolasite.com
  regularpaw.com
  regularscatter.com
-regulation-security-ck6789581264958600.tk
  regulation-security-ck6789581264958601.tk
-regulation-security-ck6789581264958602.tk
  regulation-security-ck6789581264958603.tk
-regulation-security-ck6789581264958604.tk
-regulation-security-ck6789581264958605.tk
  regulation-security-ck6789581264958606.tk
-regulation-security-ck6789581264958607.tk
  regulation-security-ck6789581264958608.tk
-regulation-security-ck6789581264958609.tk
  regulfirst.xyz
  rehabalt.ca
  rehabglaucomas.com
@@ -239231,11 +238644,11 @@ relax.relax.moncheri-relax.ru
  relax1.dyndns.dk
  relaxbikes.com
  relaxed-goldstine-ece9e8.netlify.app
-relaxed-jepsen-a80f45.netlify.app
  relaxed-notice.000webhostapp.com
  relaxed-pike-29ccd7.netlify.app
  relaxed-pike-9dcd69.netlify.app
  relaxed-tesla-4e34cd.netlify.app
+relaxindulge.co.nz
  relaycounsel.xyz
  relaymanagement.info
  relaypro.info
@@ -239517,6 +238930,7 @@ removepayee.co.uk
  removepctrojan.com
  removepop.co
  removesecure-payee.com
+removeunathorised-device.com
  removing-cancellation.com
  removing-payee.cc
  remowork.ru
@@ -239623,7 +239037,6 @@ reno-kitchen.com
  renodrives.com.br
  renoplexe.com
  renouvellement-enligne.com
-renouvellement-fr-fr.com
  renova-int.ru
  renovacaiixabr.000webhostapp.com
  renovacao2020.com
@@ -239737,6 +239150,7 @@ rep-99016970.roenneberg.com
  rep-99341830.roenneberg.com
  rep-99401721.roenneberg.com
  repair-dental-v1.laziz.ca
+repair-electrons.com
  repair.client-configuration.uniabuja.edu.ng
  repair56.ru
  repaireservice.ooguy.com
@@ -239751,6 +239165,7 @@ reparaties-ipad.nl
  reparationboitevitesseambares.com
  reparaturedvcom.shaxiaasian.top
  reparoaireroca.org
+repatriacioncolombia.com
  repay-claim.com
  repaymentsuk.com
  repbccjexqbgfcdp-dot-millinium.ey.r.appspot.com
@@ -239788,13 +239203,21 @@ repondeursfr-vocale-box.yolasite.com
  report-01673202.nabalifares.ps
  report-04719599.nabalifares.ps
  report-05254850.bnrc.bz
+report-06352561.nabalifares.ps
  report-07727674.nabalifares.ps
+report-09320449.nabalifares.ps
+report-09630838.nabalifares.ps
  report-14178777.nabalifares.ps
  report-15043066.nabalifares.ps
+report-20882209.nabalifares.ps
+report-29863712.nabalifares.ps
+report-34261538.nabalifares.ps
  report-56982800.bnrc.bz
  report-59347730.bnrc.bz
+report-64245034.nabalifares.ps
  report-83047937.nabalifares.ps
  report-84256296.nabalifares.ps
+report-99888812.nabalifares.ps
  report-abuse.studio.site
  report-apple-mail-sevice-account.serveirc.com
  report-appleld.apple.secureaccount-id.bdsadf.ga
@@ -239924,6 +239347,7 @@ reselishat.xyz
  reseller-233.mco2.hostdime.com
  resendpages2020.my.id
  resenroparonto.space
+resepkomplit.com
  reservacionadopta.000webhostapp.com
  reservas.miitauviajes.co
  reservaspersonalenlinea.com
@@ -239994,6 +239418,7 @@ resieacoea.ml
  resiffern.xyz
  resiko-gede.teuing.rf.bollon.goblog.rangcxk.com
  resiliencethroughart.org
+resilient-unique-gardenia.glitch.me
  resin3dprinterstore.com
  resisproject.me
  resistance-africaine.com
@@ -240331,7 +239756,6 @@ retrieve-update.gq
  retrievepaypal.com
  retrieversloast.com
  retrievuppdate.cf
-retrigger.top
  retrmsosqs5.yolasite.com
  retrnissued.com
  retrnlnvoice.com
@@ -240421,7 +239845,6 @@ reverent-darwin-9eedc5.netlify.app
  reverent-goldwasser-b61599.netlify.app
  reverent-hugle-68f9f2.netlify.app
  reverent-mclean-37a573.netlify.app
-reverent-mestorf-e3b099.netlify.app
  reverify-access.com
  reverify-devices.cc
  reverify-netflixbilling.cc
@@ -240536,7 +239959,6 @@ revistaunipaz.000webhostapp.com
  revivafotografiaescolar.com
  reviveapi.club
  revivehairstudioindia.com
-reviverise.cyou
  revivetherapy.uk
  revm-89093175.einfach-umzug.com
  revmtpers.com
@@ -240570,8 +239992,10 @@ revolution-bd.com
  revolution-epargne.com
  revolutionbroadhead.com
  revolutionpropertiesllc.com
+revolutionstore.casa
  revolutuk.info11.co.uk
  revolvingly.xyz
+revolvingsimplisticlaws--five-nine.repl.co
  revopilte3.club
  revovercortytems.000webhostapp.com
  revrzz.com
@@ -240605,6 +240029,7 @@ rewardsarefunorg.licubooks.gdn
  rewardsecretpubgm8.com
  rewardservicespersonallogin.info
  rewardsff190.000webhostapp.com
+rewardsgameonline.com
  rewardskinpubg.ooguy.com
  rewardspubgm.giize.com
  rewardspubgskin.gleeze.com
@@ -240668,7 +240093,6 @@ rf4w4.com
  rfanews.sslport.work
  rfaqdejtmewfwcjymgtbclhwxr-dot-gleowayel400503.uc.r.appspot.com
  rfarm.net
-rfbutkzhkuqyjflnglwivsztjk-dot-gleow2021ja.ue.r.appspot.com
  rfd-royalight.com
  rfeybtjrlcdturzj-dot-millinium.ey.r.appspot.com
  rffrvdgkckjwuizd-dot-millinium.ey.r.appspot.com
@@ -240769,7 +240193,6 @@ rguvsxhdvhgoxsqq-dot-millinium.ey.r.appspot.com
  rgvgnk391hiu.talagaremix.com
  rgviixkxvqczmdpr-dot-millinium.ey.r.appspot.com
  rgwwcuoyxtyjqtnk-dot-millinium.ey.r.appspot.com
-rgxhvniedeyshghtlcjuuzaxce-dot-gleow2021ja.ue.r.appspot.com
  rgyg.rl2078.cn
  rgyolo.2fa637.cn
  rgys.muhuangshi.cn
@@ -240896,6 +240319,7 @@ ribg.ooguy.com
  ribi-dzophat.000webhostapp.com
  riblanda.com
  ricado.9e.cz
+ricamidream.it
  ricardobonifazi.com
  ricardocastillo.com
  ricardoeletro-hom.i9xp.net.br
@@ -241117,6 +240541,7 @@ ripple-xrp.net
  ripple.ceo
  ripplegift.ceo
  rippletap.buzz
+rippr.cc
  ripristina-utenza-web.one
  ripristino-applicazione-aggiornamento.info
  ripristino-conto-immediato.com
@@ -241258,6 +240683,7 @@ rjqqwxqgwtdistjvznitemhhps-dot-secret-argon-296111.uk.r.appspot.com
  rjqqzyffnrmvfnzdwsetsvkpon-dot-gleowayel400503.uc.r.appspot.com
  rjs-2.mentriqq.com
  rjsoft.nl
+rjssvwleydomiusnasqvblwofx-dot-gleow2021ja.ue.r.appspot.com
  rjstdkhhpamixxtndomladbfnxxqyjvysmwb-dot-cryptic-now-290917.ey.r.appspot.com
  rjujebgmgwsqmsbk-dot-millinium.ey.r.appspot.com
  rjvbtxpdhfxtcztvth.top
@@ -241493,6 +240919,7 @@ rmv-84731173.detalhesmusical.com.br
  rmv-85274614.detalhesmusical.com.br
  rmv-85384300.detalhesmusical.com.br
  rmv-87080337.detalhesmusical.com.br
+rmv-871838391.adventistgh.org
  rmv-887957336.adventistgh.org
  rmv-89534989.detalhesmusical.com.br
  rmv-899999877.adventistgh.org
@@ -241577,7 +241004,6 @@ roadtripkiddos.icu
  roadubettlapi.tk
  roadwarrior.app
  roajic.goruli.com
-roalmsteghkpcoctioygcmorcm-dot-gleow2021ja.ue.r.appspot.com
  roan-slash-pomelo.glitch.me
  roannestanislausolimpia.casa
  roar-cbd.com
@@ -241606,6 +241032,7 @@ robertgfkensell-saer.com
  roberthvac.com
  roberto-restivo.it
  roberto-victoria.com
+robertoconceicao.adv.br
  robertodondi.com
  robertogowin.com
  robertoseifert.com
@@ -241653,7 +241080,6 @@ robotechcity.com
  robotgratifiedv.com
  robotic-tide-275809.el.r.appspot.com
  robotica.cl
-roboticfirefighter.top
  robotics.kinex11.info
  roboticsinglesitesurgery.com
  roboticsurgerybangalore.com
@@ -241891,6 +241317,7 @@ rollxsnice.xyz
  rollystax.com
  rologopoulos.cf
  rolstoeltaxinederland.nl
+roltek.com.br
  rolx.wolrdcaresolidarityfund.xyz
  romai-szallas.hu
  romaic-beat.000webhostapp.com
@@ -242178,7 +241605,6 @@ routrackerlinefx.ml
  rouxlive.tk
  rovaconstruction.com
  rover-chm.000webhostapp.com
-rover-cra.000webhostapp.com
  rover-mxn.000webhostapp.com
  rover-ps30.000webhostapp.com
  rover.ebay.item173829137.online
@@ -242215,6 +241641,7 @@ royal-granito.com
  royal-mail-cust-delivery.mgifinc.com
  royal-mail-help.com
  royal-mail-via.com
+royal-updateinfo.com
  royal888bet.com
  royalagondabeachvillas.com
  royalalec.com
@@ -242224,6 +241651,7 @@ royalbank-reset--7839384993.com
  royalbank.com.0sf-50tg05-f54t.com
  royalbank.com.cgi-bin-rbaccess-rbcgi3m01f17f-f13ibrequest.xyz
  royalbank.com.cgi-bin-rbaccess-rbcgi3m01f57f-f13ibrequest.xyz
+royalbank.com.cgi-bin-rbaccess-rbcgi3m01f81f-f21ibrequest.top
  royalbank.com.wkoj4vg72vt.doggoneracing.com
  royalbank.com.xa-mxv.com
  royalbank.com.xtudocapela.com.br
@@ -242258,9 +241686,9 @@ royalini.com
  royaljokar.000webhostapp.com
  royalland.com.tr
  royalluxuryshipping.com
-royalmail-orders.co
  royalmail-redelivery.support
-royalmail-support.net
+royalmail.unpaidfee-pay.com
+royalmaildepot.com
  royalmaill.top
  royalmedicpharma.com
  royalmeds.in
@@ -242304,7 +241732,6 @@ rozalli.com.ua
  rozemondcoaching.nl
  rozgrywka-oceniaj.eu
  rozhan-hse.com
-rozi.info
  rozii-chaos.com
  roznica-opt.com.ua
  roznorodnoscjestwsrodnasszkola51projekt.pl
@@ -242486,6 +241913,7 @@ rrssserralheria.com.br
  rrteredsd.com
  rrthulasi.unaux.com
  rrtt-yhg.com
+rrucuaxfj.fit
  rrugetimi.com
  rruraippuuuwhkadfqko.club
  rrvjznuujmhckzqsgfxwzmptva-dot-gleowayel400503.uc.r.appspot.com
@@ -242582,7 +242010,6 @@ rsuxsgnzruofoacq-dot-millinium.ey.r.appspot.com
  rsvda.topkorder.su
  rsvoid.com
  rsvr.gucac.com
-rsvvgshj.cam
  rsw4m.qiuvienr.com
  rsw7.ru
  rswiljbxvjipodakcfotx.online
@@ -242841,8 +242268,8 @@ rules-49763747.roidschemicals.org
  rules-51046644.roidschemicals.org
  rules-99811397.roidschemicals.org
  rules-all.web.app
-rules.fb-com-92124734.f45t.com
  rules.fbcom-i1rol4ivl.darryl-siemreap.info
+rules.fbcom-pvhofu541.darryl-siemreap.info
  rules.tr00bleshoot.maximum.tr4cking.mail.co.jp.nopewari.com
  rulesbreaker.000webhostapp.com
  ruletka-stikerovvk.000webhostapp.com
@@ -242878,6 +242305,7 @@ runawaysecliptic.top
  runda-wygranych.eu
  runderfulthailand.com
  rundll.co.in
+rundownpositiveapplications.sdsdsdsd77dsdsd.repl.co
  runescape-benefits.club
  runescape-benefits.com
  runescape-bonds.com
@@ -243041,9 +242469,7 @@ rutangord002idasjdhgashuidgasyui.askjidgbiuqaqwe.co
  rutanzoo.com
  rutassalvajes.com
  rutbtvmyljueiinx-dot-millinium.ey.r.appspot.com
-ruteeenlixujhwn.xyz
  rutenlongger6.com
-rutenseanpeckdur.xyz
  rutgers.id
  ruthandricardo.com
  ruthannadaley.com
@@ -243394,6 +242820,7 @@ s.lobaline.com
  s.newhomeprograms.com.es
  s.oooooooooo.ga
  s.promptit.net
+s.thechinesemuslim.com
  s.vollar.ga
  s.xteme.com
  s016jp6669.info
@@ -243569,7 +242996,6 @@ s8u913f0fed42f3c6a45b3.net
  s8vhs21.com
  s8wqph7m.firebaseapp.com
  s92673tu.beget.tech
-s973454980238668645789827366497203975890547864598033674329.fra1.digitaloceanspaces.com
  s97n3.svcoding.com
  s9agency.com
  s9bd37d6a8af0619cbd37d6.info
@@ -243731,7 +243157,6 @@ sadeg.club
  sadervoyages.intnet.mu
  sadfastkt-71.gq
  sadfgwer23.duckdns.org
-sadfqwer4weq1ffgga.ml
  sadfresupportt.com
  sadfresupportt.net
  sadfresupportt.org
@@ -243786,6 +243211,7 @@ safariswithjon.com
  safariworldtours.ga
  safariworldtours.gq
  safcoin.africa.ronells.co.za
+safcol-colors.com
  safdsfsfdsa.info
  safe-check.000webhostapp.com
  safe-deliveryaccount.textbrafouse.info
@@ -243812,7 +243238,6 @@ safeboxgroup.com
  safebrwsing.com
  safechasetoken.com
  safecovid.com
-safecustomerlogins.com
  safedoc2.homelinux.com
  safeeakhfarms.com
  safefromcovid-19.com
@@ -243866,7 +243291,6 @@ safetyharborhomestore.com
  safetyrun.xyz
  safetytechspy.com
  safeyouform.com
-saffe-jp.info
  saffertnet.chifanassume.top
  saffertnet.shaxiaput.top
  saffety-page-transparency-securee.000webhostapp.com
@@ -244023,6 +243447,7 @@ sairaku.net
  sairamschool.edu.in
  saiscon-crard.top
  saismiami.com
+saisoftwareinc.com
  saissco.com
  saistuquee.com
  saitamashiyuuta.xyz
@@ -244201,7 +243626,6 @@ salongsmall.se
  salonii.com
  salonmelisenta.ru
  salonprimavera.by
-salonsettle.cyou
  salsahd.com
  salsamania.ddns.net
  salsapalbarrio.com
@@ -244520,7 +243944,6 @@ santaanahuesca.ru
  santaander-appmvil.ovh
  santaftpuser.unifiedmarketingsolutions.com
  santaideaoficial.com
-santainfancia.com.br
  santaisarobot.com
  santaliny.net
  santaliny.org
@@ -244614,7 +244037,6 @@ santinas.cl
  santinastravenue.buzz
  santinohelpserve.com
  santonlineinc.com
-santosh.ravan606.ifunnelspro.com
  santoshwomencarehospital.com
  santoveli.com
  santrasaferd.com
@@ -244656,6 +244078,7 @@ saporiofscarsdale.com
  sapp-italliness.myftp.biz
  sappalot.de
  sappc2.info
+sapphireadventuretravel.com
  sapphiredom53.com
  sapphiregraphicsarts.com
  sapphirelvclub.com
@@ -244702,6 +244125,7 @@ saranilsson.xyz
  saranshock.com
  sarapeculi.000webhostapp.com
  saraphinnaclaron.weebly.com
+sarastewart341.xyz
  saraswaticlasses.net.in
  sarathbabuji.com
  saratov.kitaiavtozap.ru
@@ -244711,6 +244135,7 @@ sarcasticchiefmosaic.boswellmichael.repl.co
  sarcoid-evenings.000webhostapp.com
  sardano.xyz
  sardardhambhavnagar.org
+sardarmask.com
  sardarnetworking.com
  sarderlearning.com
  sardinegecko.com
@@ -244854,6 +244279,7 @@ savageandwiser.com
  savageconquest.com
  savagegrows.buzz
  savagegrowx.cyou
+savagelargs.cyou
  savagemouser.com
  savagemousert.com
  savages.cyou
@@ -244978,6 +244404,7 @@ sbclinkedservicedin.weebly.com
  sbctlbikdggibsadcfmfmmyhnenzhlmwuqlm-dot-offgl8876899977678.uk.r.appspot.com
  sbcxx.weebly.com
  sbdflw.tw
+sbdhnqjwuy.bdhsdnjwuqfkfgr.buzz
  sbe2group.com
  sber-host.000webhostapp.com
  sber2020qq.best
@@ -244986,7 +244413,6 @@ sberbank-2020.net.ru
  sberbankgiveds.ru
  sbeyxegg.buyonlineb.su
  sbfurniture-bd.com
-sbhdnjwuakriadfnqlif.top
  sbhdomain.my.id
  sbi-xa.com
  sbiglobal.net
@@ -245522,6 +244948,7 @@ sdaqt.xyz
  sdast.xyz
  sdawqe.myddns.rocks
  sdayhaneql.tastypriceo.su
+sdbhnqjeyu.hdsdnjwuadfghrkesdf.top
  sdboatstore.com
  sdbsdfbzdfbdfb.ddns.net
  sdc0088.000webhostapp.com
@@ -245596,6 +245023,7 @@ sdhgbfngtb.ga
  sdhgsjsjnsjtjsrhsfhjsrhjsrhjnsr.myartsonline.com
  sdhjksdklskjdsd.azurewebsites.net
  sdhzyhsoxofvhkatlieqdkfrqlsmnmhmfaja-dot-solar-vertex-285913.rj.r.appspot.com
+sdikfgbwsiduerf2w3i9esducwoejdcb2gi8dus2goweudj324r53.toh.info
  sdilindia.com
  sdj-online.xyz
  sdjhbkjhfeo.top
@@ -245813,6 +245241,7 @@ sec-18986eab.ddns.net
  sec-acc-log.000webhostapp.com
  sec-check-verify.xyz
  sec-commbank.com
+sec-doc-w.com
  sec-ee-login.com
  sec-m-a-i-l.000webhostapp.com
  sec-now.co.uk
@@ -245926,6 +245355,7 @@ securaex.000webhostapp.com
  securcbankofameriea.cloudaccess.host
  securd.xyz
  securdoctral.ga
+secure--login.gq
  secure-01apple.redirectme.net
  secure-03bchase.serveftp.com
  secure-05b.azurewebsites.net
@@ -246136,6 +245566,7 @@ secure-connection-wells.com
  secure-crdrfw.cf
  secure-cspaypal3d.osterlingotu.com
  secure-customers-facebook.item20201073322.com
+secure-data.club
  secure-de-paiement-plp.000webhostapp.com
  secure-deletepayee.com
  secure-deregister-mobile.com
@@ -246153,10 +245584,10 @@ secure-devicemanage.net
  secure-deviceonline-login.com
  secure-deviceonline.cc
  secure-devices-online-logins.com
-secure-devices-online.com
  secure-devices-onlinelogin.com
  secure-dll-in.000webhostapp.com
  secure-dns-resolve.com
+secure-doc-reader.com
  secure-document-viewer-login.du.r.appspot.com
  secure-docusign.net
  secure-dynamic.serveirc.com
@@ -246364,13 +245795,14 @@ secure-online-devices.co.uk
  secure-online-halifax.com
  secure-online-halifaxmobileapp-systemupgradeapp.otticagrande.com
  secure-online-info.duckdns.org
+secure-online-paye.com
  secure-online-payee-login.com
  secure-online-reset.com
  secure-onlinebanking-review-dashboards.ddnsfree.com
  secure-onlinehali.com
  secure-onlinehalifax.co.uk
  secure-onlinenatwest.com
-secure-onlinepayee.live
+secure-onlinepayee.link
  secure-onlinesend.com
  secure-onlineservice.com
  secure-paiement236b9e3e.exhemplara.it
@@ -246403,7 +245835,6 @@ secure-payment221.serveirc.com
  secure-payment222.axagufniman.com
  secure-payment234.gomanxis.com
  secure-paypailine.serveirc.com
-secure-paypal-id863.com
  secure-paypal-service-review-dashboard2.casacam.net
  secure-paypal-verification-review-dashboard.ddnsfree.com
  secure-paypal.acceptsedge.com
@@ -246453,6 +245884,7 @@ secure-registered-device.com
  secure-reminder-endpoint.link
  secure-remove-newpayee.co.uk
  secure-remove-payee.com
+secure-remove.xyz
  secure-resolveproblem.com
  secure-restore.me
  secure-review-mypayees.live
@@ -246497,6 +245929,7 @@ secure-tsb.safety-account.com
  secure-uk-halifax.com
  secure-ukpayeeaccount.com
  secure-unauthorised-payees.com
+secure-unauthorisedlogin-attempt.com
  secure-up-login.com
  secure-update-infoo.com
  secure-update-online-account-information.auth-arturo.com
@@ -246967,6 +246400,7 @@ secure.runescape.rs-er.xyz
  secure.runescape.rs-ew.xyz
  secure.runescape.rs-f.xyz
  secure.runescape.rs-ff.xyz
+secure.runescape.rs-io.xyz
  secure.runescape.rs-l.xyz
  secure.runescape.rs-o.xyz
  secure.runescape.rs-oe.xyz
@@ -247078,6 +246512,7 @@ secure01-redirect.com
  secure01.appid.customer-service.bagaikesetselamatmaca.com
  secure01.apple.com-home.luceprima.com.br
  secure01.apple.com-home.tonicopipoqueiro.com.br
+secure010a-login.x24hr.com
  secure0125cchase-auth-dashboard.duckdns.org
  secure01a-charse.com
  secure01a-chase.giize.com
@@ -247404,6 +246839,7 @@ secure3.idmsa.appleid.imacshop.info
  secure3.idmsa.appleid.macios.co
  secure30rd-apple.zapto.org
  secure32.in.net
+secure345-accou678.ddns.net
  secure347.000webhostapp.com
  secure34d-paypal.serveirc.com
  secure365onlinerenew.com
@@ -247602,7 +247038,6 @@ secured-paybylink.pl
  secured-payee.com
  secured-payeecheck.com
  secured-payees.com
-secured-paypal864.com
  secured-registrated-newmobile.com
  secured-runescapes.com
  secured-sign-in-amazon-uknown-access-from-unauthorised-device.staysafe2.com
@@ -247800,12 +247235,11 @@ securelimitedupdate.serveirc.com
  securelin-activaton.cba.pl
  secureline-activity.dynamic-dns.net
  secureline-helpdesk.com
-securelloyd-customer-connect.com
-securelloyd-customer-payee.com
-securelloyd-customer-payees.com
+securelloyd-connect-customer.com
  securelloyd-data.com
  securelloyd-device.com
  securelloyds-auth.com
+securelloyds-helpteam.com
  securelloyds.com
  securelog.live
  securelogin-28162748274.selfip.com
@@ -247887,6 +247321,7 @@ securemyhalifax.com
  securemyhs.com
  securemylloydsaccount.com
  securemylogin.live
+securemyonline-banking.com
  securemypayee-auth.com
  securemypayee-auth.info
  securemypayee-info-auth.com
@@ -248035,7 +247470,6 @@ securesquared.co.uk
  securessl-dkb.com
  securestep-chase.com
  securesuite21.com
-securesun.casa
  securesupports.myvnc.com
  securesweb.com
  securesystem-captcha.info
@@ -248131,7 +247565,6 @@ securex.login.accounts.click.gift-arg0s-c0-uk.icu
  secureyouraccount12.000webhostapp.com
  securezza.at
  securfb20.my.id
-securidaccessmfa.de
  securie01a.chase.id-login-server.com
  securing-paypal.com
  securingbravoonly.quibee.com.my
@@ -248211,6 +247644,7 @@ security-limitedsdevice.xvaaxca.com
  security-limitedsdevice.zbhscs.com
  security-lloyds.com
  security-lloydspayee.com
+security-login-attempt.com
  security-loginattempt.com
  security-mage.com
  security-mail-support.000webhostapp.com
@@ -248235,6 +247669,7 @@ security-newpayee-alert.link
  security-olb.co.uk
  security-online-halifax.com
  security-online-login.com
+security-onlinebanking-signin.com
  security-operation-center.de
  security-page-busines.000webhostapp.com
  security-page-help.000webhostapp.com
@@ -248284,7 +247719,6 @@ security-portal.club
  security-poypol.redirectme.net
  security-process.com
  security-profile-devices.com
-security-protectaccount.com
  security-ref019.com
  security-ref585.com
  security-removal-halifax.com
@@ -248373,6 +247807,7 @@ security.paypal-service.live
  security.paypal.com.userid.874585.compraycambia.com
  security.personalbanking-hs.com
  security.publicmutual.net
+security.request-confirm.com
  security.secure.s3-website.us-east-2.amazonaws.com
  security.service-customer.area.capt-shop.com
  security.tonextpro.com
@@ -248563,6 +247998,7 @@ seelenauftragcom.shaxiaaustralia.top
  seelokkyou.song9991.monster
  seemasartworkhalt.com
  seemlue.com
+seemyboobs.ctiaspire.com
  seencompany.com
  seenext.com.pk
  seepisiolt.com
@@ -248577,11 +248013,13 @@ sefp-boispro.fr
  sefr-yek.com
  seg-dispositivo.com
  seg-seguro.com
+segalsmetals.elin.co.za
  segami.ga
  segami.ml
  segarkanbos.com
  segenorsa.com
  segerstrom8445.yolasite.com
+segfeitopravoce.com
  segmentednewz.com
  segmobionline.ml
  segn-co-xyz.preview-domain.com
@@ -248703,6 +248141,7 @@ selariatripoli.com.br
  selaronpedacosdomundo.com.br
  selberschoen.net
  selbstinszenierungnet.shaxiaadd.top
+seldforcomics.casa
  selebtop.xyz
  seleccionsodimac.ru
  select-wines.org
@@ -248713,7 +248152,6 @@ selectedhomesfutureclaims.com
  selectfreshproduce.co.ke
  selection-axafova.art
  selectit.biz
-selective-bolder-fireplace.glitch.me
  selectortv.com
  selectpinl.site
  selectqcstaffing.com
@@ -248755,6 +248193,7 @@ selfupgradeservice.servehttp.com
  selfuseproperty.com
  seliconos.3utilities.com
  selimyildiz.com.tr
+sell-to-russians.ru
  sell.marketcsgo.cc
  sella-autenticazione.com
  sella-banca.online
@@ -248867,8 +248306,6 @@ semprejunto-com-voce.com
  semprelive-diaadia-lindo.com
  sempremagaluu.com
  sempremilhasexpirando.club
-semprepensandoemvoce.club
-semprepensandonomelhorparavoce.club
  semprepres.sslblindado.com
  semprepresensecurity.com
  semprepresente-apppass.com
@@ -249033,6 +248470,7 @@ sequrahs.net
  ser.yohuaibei.cn
  serabazar.com
  seralat.com
+seranaidlevel.xyz
  serapple.com
  seraqueetea.org
  serben.mywire.org
@@ -249161,7 +248599,6 @@ server-connect08a.com
  server-d888.9c7e81200us.autenticationmail.com
  server-d88876f8ba94.9c7e81200.awkowaokawoapakdin.com
  server-d88876f8ba94.9c7e81200us.jancokasukirik.com
-server-digitalsegbn-tok.com
  server-domains-china.us-south.cf.appdomain.cloud
  server-idapple.com
  server-mailapp.servehalflife.com
@@ -249374,6 +248811,7 @@ service-account.yalogi.business
  service-account1.serveirc.com
  service-accountinfos.com
  service-acer.by
+service-activationsecure.fr
  service-amaz.com
  service-amazon-assistant.admin-datapages.ooguy.com
  service-amazon-update-account2020.giize.com
@@ -249655,7 +249093,6 @@ serviceconnectatt.weebly.com
  serviceconnectinfosclientinternetmail.webnode.sk
  serviceconnexioninternetwebmailinfos.webnode.sk
  servicecustomerstripe1.com
-servicecxkj-jp.cc
  servicedaccommodation4u.com
  servicedental.chifancall.top
  servicedesecurite.com
@@ -249866,7 +249303,6 @@ servicewikii.com
  servicewserndesign.com
  servicexlafkntion.xyz
  serviceyouraccount.serveuser.com
-servicezz-jp.cc
  serviciar.com
  servicio-es-bannkia.com
  servicio-face.000webhostapp.com
@@ -250435,6 +249871,7 @@ sg3c.addroits.com
  sg771.kwikfunnels.com
  sg96.awaykart.com
  sgaaalife.com.koalapropelas.com
+sgaircon.com.sg
  sgauhd.ga
  sgb3p.svcoding.com
  sgbapple8393938supportsistemshop.ssfdgfyrisuzu-9.com
@@ -250632,6 +250069,7 @@ shaistasmart.in
  shaiyalineofage.servegame.com
  shajishalom.com
  shajwan.no-ip.org
+shaka.ai
  shakeel.pk
  shakeelgroup-bh.com
  shakeraleighbeauty.com
@@ -250758,6 +250196,7 @@ sharedcolo.top
  shareddocusign.com
  shareddom18d2td08788lot80d172m.us-east-2.elasticbeanstalk.com
  shareddt.dns-cloud.net
+sharedepartment.com
  sharedfile45363doc.uc.r.appspot.com
  sharedpont77wwjxjx.df.r.appspot.com
  sharedstoragefraiou.tk
@@ -250803,6 +250242,7 @@ sharepointmxrecuerexp1.z13.web.core.windows.net
  sharepointmxrecuerimu1.z13.web.core.windows.net
  sharepointmxrecxdrroy2.z13.web.core.windows.net
  sharepointmxrecxdrroy3.z13.web.core.windows.net
+sharepointnoticesig1.z13.web.core.windows.net
  sharepointonenotes.com
  sharepointonlinedrives.com
  sharepointonlinevvckcfoz1fo7eakdjd9z64isxcew3o.s3.us-east-2.amazonaws.com
@@ -250854,6 +250294,7 @@ sharp-bartik-bf03ef.netlify.com
  sharp-clarke-e3e343.netlify.app
  sharp-minsky-1d077f.netlify.app
  sharpdeanne.com
+sharpdigit.biz
  sharpimpressions.org
  sharpmode53.xyz
  sharppli.com
@@ -250960,7 +250401,6 @@ sheisbatala.com
  shekharsinstitutenalgonda.com
  sheldonschweidt.com
  shell-indir.com
-shell-sumptuous-wisteria.glitch.me
  shell.blackunix.com
  shell7498pzb.allsalelist.com
  shelljs.com
@@ -251120,7 +250560,6 @@ shipment.free-h.net
  shipoala.us
  shippeirfinances.com
  shipping.adsflycircle.com
-shippingcontainer.buzz
  shippingdataaccess.ddns.net
  shippingintime.com
  shipservice-hr.market
@@ -251193,6 +250632,7 @@ shnywyglyxgs.002.sh.cn
  shoalbaycompany.com
  shobdomela.com
  shobiz365.com
+shockfight.buzz
  shockhel.000webhostapp.com
  shockhillhomes.com
  shockingoutgoingunit.krmarluxia.repl.co
@@ -251204,7 +250644,6 @@ shoeloungeatl.com
  shoemix.com.br
  shoesoutlet.co
  shoesstockshop.ru
-shogunal-trains.000webhostapp.com
  shohadayeazeran.ir
  shokawasekina.com
  shollmusc.com
@@ -251732,6 +251171,7 @@ sidainformate.org.ve
  sidanah.com
  sidcastic.com
  siddalingeshwarassociates.com
+siddharthpanditpautra.com
  siddhesh123e.000webhostapp.com
  siddhivinayakengjaipur.in
  side685238525442.xyz
@@ -251740,6 +251180,7 @@ sidehustlemarketer.co.uk
  sidereal-plots.000webhostapp.com
  sidet.com.mx
  sideward-depots.000webhostapp.com
+sideways-thundering-activity.glitch.me
  sidneyradial.xyz
  sidonycrealestate.com
  sidore.com.ua
@@ -252591,6 +252032,7 @@ simibccrad.top
  simicani.com
  similarcontact.guru
  similardnesday.xyz
+similarindulge.com
  similaritish.xyz
  simintern.com
  siminthearenatake.us-south.cf.appdomain.cloud
@@ -253203,7 +252645,6 @@ skindnarog.com
  skinezy.fun
  skinfinish.ru.com
  skinfood.fun
-skinfree.claimx13.com
  skinfree89.my.id
  skinfreepubgm.giize.com
  skinfreereward.theworkpc.com
@@ -253214,6 +252655,7 @@ skingfts12.dns04.com
  skingfts12.my03.com
  skingfts12.xxuz.com
  skingfts13pubg.25u.com
+skingiftmlbb21.duckdns.org
  skingo.ru.com
  skingohome.xyz
  skinharman.fun
@@ -253271,6 +252713,7 @@ skinsleaders.com
  skinslkbyfaceit.fun
  skinslobby.com
  skinslux.work
+skinsml-giftx71.zyns.com
  skinsmoney.work
  skinsmoon.com
  skinspinner.club
@@ -253394,6 +252837,7 @@ skyeconsultoria.com.br
  skyeranet.com
  skyfinancial.in
  skyflle.com
+skyflyfares.com
  skyfree9324.ddns.net
  skyfxpro.net
  skygroup.company
@@ -253460,7 +252904,6 @@ slashdb.com
  slashed-lid.000webhostapp.com
  slashingdelegator.win
  slasquareup.com
-slateblueoutgoingmathematics.elmuto00otrogit.repl.co
  slatenctionnit.xyz
  slaterarts.com
  slausonswapmeet.net
@@ -253504,7 +252947,6 @@ slgtldrxmjzzqrsxwjwwmcinfe-dot-gleowayel400503.uc.r.appspot.com
  slhgbls001.top
  slhgbls004.top
  slhrqty.ddns.net
-sliago.com
  sliazmlsjna.top
  sliceharm.guru
  slicekitchen.com
@@ -253821,6 +253263,7 @@ smbc-caerd.best
  smbc-camrd.xyz
  smbc-carb.buzz
  smbc-carb.monster
+smbc-carb.vip
  smbc-carb.xyz
  smbc-card-cc.monster
  smbc-card-cc.xyz
@@ -254400,6 +253843,7 @@ smogathon.com
  smogglaucomat.com
  smoggyrectangularglueware--five-nine.repl.co
  smokatstore.com
+smokeandgrowrichtour.com
  smokefreehousingny.org
  smokercloser.org
  smokesips.com
@@ -254580,7 +254024,6 @@ snapposecolorld.xyz
  snappyframes.com
  snappygracefulinfinity.sdsdsdsd77dsdsd.repl.co
  snappylink.000webhostapp.com
-snapreset.live
  snapsupport15.000webhostapp.com
  snapsupportforum.000webhostapp.com
  snapsuppverf.000webhostapp.com
@@ -254597,6 +254040,7 @@ snatelik.com
  snatnino.com
  snazzymedia.ie
  sncc-iq.com
+sncf.career-inspiration.com
  snchealthmedico.com
  sncshyamavan.org
  sndatest.000webhostapp.com
@@ -254756,7 +254200,7 @@ sobafin.com
  sobakevich.biz
  sobcase.com
  soberfolk.com
-sobesednika.ru
+soberlifeco.com
  sobhainternationalcitygurgaon.in
  sobjibazar.com
  sobokorob.net.ru
@@ -254886,7 +254330,6 @@ socialpagebluecheck.xyz
  socialpages2020.my.id
  socialpro.ml
  socialresponsibilityunion.org
-socialsciencepublication.com
  socialstatistics.zapto.org
  socialwebsystems.com
  sociedadalikante.com
@@ -254906,7 +254349,6 @@ society-recovery-privacy.com
  society-recovery.my.id
  society-secur-recovery-privacy-identity.com
  society4millenials.com
-societyuser.guru
  sociopathic-standin.000webhostapp.com
  soclaelfeerr.gq
  soclever.com.sg
@@ -254951,6 +254393,7 @@ sofrehgard.com
  sofsuite.com
  soft-portal.ml
  soft-shell-destinat.000webhostapp.com
+soft-solutiontv.com
  soft-spoken-satelli.000webhostapp.com
  soft-theme.com
  soft.110route.com
@@ -255017,6 +254460,7 @@ sogemadgestion.com
  soggerfpt.com
  soggyjampackedbrackets.olivercaba.repl.co
  soggyparchedspreadsheets--five-nine.repl.co
+soggysparsefan--five-nine.repl.co
  sogiitx.org
  sogive.net
  sohailmujffar.000webhostapp.com
@@ -255121,7 +254565,6 @@ solicitestone.pagedemo.co
  solicituddigitalmh.com
  solicitysolar.co.zw
  solicon.us
-solicwebaps.azurewebsites.net
  solidallianzemfb.com
  solidarietaumana.it
  solideck.com.br
@@ -255370,6 +254813,7 @@ soporte-servidores-seguros-pay-1001002002002.com
  soporte-tecnico08.000webhostapp.com
  soporte.apple.com-conect.us
  soporte.apple.com.fnd-ios.us
+soporte.feval.co
  soporte.kl.com.ua
  soporte.ruptivo.com
  soporte.securityoperationscenter.de
@@ -255473,6 +254917,7 @@ sougyou-shien.net
  soukizombafestival.com
  soukotu.info
  soul-yemen.org
+soulbacher.de
  soulcastor.com
  soulcenter.art
  souldancing.cn
@@ -255510,6 +254955,7 @@ sououzilrggrewyrvrnowcuakvuwkhsehoqd-dot-cryptic-now-290917.ey.r.appspot.com
  souperkitchen.org
  soupier-licenses.000webhostapp.com
  soupiest-recesses.000webhostapp.com
+souprosperidade.com
  soupysometabs--five-nine.repl.co
  souqaziz.com
  souqchatbot.com
@@ -255528,6 +254974,7 @@ sourcetoearn.info
  sourcingandlogistic.com
  soursingsegura23bn-tag.xyz
  sousakupartners.com
+sousbe.cabinlook.com
  soused-meridians.000webhostapp.com
  souso20.blogspot.com
  southafrica-vip.xyz
@@ -255596,7 +255043,6 @@ sowkinah.com
  sowlef.com
  sowr-paypalservis5g.servebeer.com
  sowseglass.com
-sowtaqqmqbofgjtzkdoodgmfym-dot-gleow2021ja.ue.r.appspot.com
  soxlablengdiumenet.xyz
  soxmi.vipsnapchatsexting.com
  soxzc.000webhostapp.com
@@ -255788,7 +255234,6 @@ spay-information.serveirc.com
  spayments-paxful.com
  spaziomicron.it
  spaziozero.org
-spb-computer.ru
  spb-sexhome.ru
  spbsmm.ru
  spbv.org
@@ -255856,6 +255301,7 @@ spectrun.club
  speculativeness.xyz
  specy.by
  specyfika.xn.pl
+sped-farb.pl
  spedaqinterfreight.com
  spede.000webhostapp.com
  speechgrow.buzz
@@ -256063,6 +255509,7 @@ spk-authserv.xyz
  spk-filliale-direkt.xyz
  spk-finanzgruppe-de-home-portalredirect.ru
  spk-service.de
+spk-sicherheit2021.xyz
  spk-sicherheits-check.org
  spkfod.coms.cso.gov.tt
  splac-dlug.com
@@ -256186,6 +255633,7 @@ spotifyno.beget.tech
  spotifyregalo.000webhostapp.com
  spotifysubscription.fail
  spotifyverify.serveirc.com
+spotisemtana.com
  spotlfy-sign-in.d9ygh3iuhs.semuaakanshendyjancokpadawaktunya.com
  spotlightappearances.com
  spotmarka.ap0x.com
@@ -256255,6 +255703,7 @@ sprzedaz-nr-940031.in.net
  spschool.tk
  spsshomeworkhelp.com
  sptconstruction.co.za
+spuarmessaginsuport.com
  spunkyhealthylife.com
  spunkyvids.com
  spurious.io
@@ -256326,6 +255775,7 @@ sqribplus.cyou
  sqrresrvce.org
  sqrtey.com
  sqrure-mee.com
+sqsguiporosxyqbpzwbidzvuxj-dot-gleow2021ja.ue.r.appspot.com
  sqsupportuare.com
  sqtcfy.tanglescanner.com
  sqtry.com
@@ -256358,7 +255808,6 @@ squamver.com
  squandering.xyz
  squaoei0.com
  squaoei1.com
-squaomsbds.com
  squaoreosn.com
  squapacemessga.com
  squapundit.com
@@ -256611,7 +256060,6 @@ sruedlqzbdeglfvgmebwhsgfqz-dot-gleowayel400503.uc.r.appspot.com
  srushtiinstitutemncl.com
  srv-amazonservic9k.servebeer.com
  srv-applelckdservpa.serveirc.com
-srv-auth.web.app
  srv-cluster02.com.br
  srv-externaluserlogin-amazon.gleeze.com
  srv.cybesys.com
@@ -257076,6 +256524,7 @@ stamentstoreprime8326373953appleidap.duckdns.org
  stametcurug.com
  stamfordvt.buzz
  stampagrafica.es
+stampasegnaletica.com
  stampduty.sampleplan-vim.club
  stampile-sibiu.ro
  standard.sglobal-service.com
@@ -257209,7 +256658,6 @@ startupbackyard.icu
  startupcentre.ru
  startupforbusiness.com
  startupindustrial.com.br
-startuppro.biz
  startupshop.us
  startupterrscetw.baersevensunday.top
  startuptshirt.my
@@ -257316,6 +256764,7 @@ staxxvending.com
  staxxvending.info
  staxxvending.net
  staxxvendingservices.com
+stayathome247.co.za
  staycalm.club
  staycoolautoparts.com
  staydryroofingspecialists.co.uk
@@ -257347,6 +256796,9 @@ stdychnesqudusisstds.dns.army
  stdykalamikonlinstyv.dns.army
  stdykungcommunicstaz.dns.army
  stdykungeduationaldeveloper15investmenqg.duckdns.org
+stdypycsslwinnerstgk.dns.army
+stdyrmtcntlenverstgv.dns.army
+stdyrusschinetwomast.dns.army
  stdyshgshgnationstgh.dns.army
  stdyunitedfrkesokoriorimistreetsmsttyr.ydns.eu
  stdyunitedkesokostxm.dns.army
@@ -257780,7 +257232,6 @@ stemadda.com
  stemcellserectiledysfunction.com
  stemcoderacademy.com
  stemenstilte.nl
-stemidea.guru
  stemkenya.org
  stemkids.com.au
  stemplusacademy.com
@@ -258093,6 +257544,7 @@ stopweedtoday.com
  storage.googleapis.com.statics.alliantccreditunion.org
  storage.googleapis.com.statics.ibcaserv.xyz
  storage.nett00n.org
+storagegenuine.com
  storageshared.000webhostapp.com
  storagesharedcdsxo.dnsabr.com
  storagestream.casa
@@ -258213,6 +257665,7 @@ straoraticult.info
  strapping-dioxide.000webhostapp.com
  strappingsolutions.com
  strarwars.zzz.com.ua
+strashield.com
  strasnersuperstoreblog.com
  strata.ch
  stratbuks.com
@@ -258411,6 +257864,7 @@ studio.joyopos.us
  studio13comm.com
  studio2w.com.br
  studio3academia.com.br
+studio4brow.com
  studio4thdimension.com
  studio5m.pl
  studio63productions.com
@@ -258464,7 +257918,6 @@ stunninglearning.com
  stunomar.com
  stuntrover.com
  stupbratt.no
-stupefied-feynman-1b134a.netlify.app
  stupefied-kowalevski-af6362.netlify.app
  stupefied-liskov-f5f339.netlify.app
  stupefied-ramanujan-0653d1.netlify.app
@@ -258585,6 +258038,7 @@ suborno-ent.com
  suboyulecheng.tavmo.com
  subparallel-rose.000webhostapp.com
  subpav.org
+subplotconch.com
  subpp2020may18818506.2020ppa262525us144.org
  subqo.com
  subsapp.com
@@ -258668,6 +258122,7 @@ subtriangular-maneu.000webhostapp.com
  subul.com.sa
  suburbanapprehensivefactor.figueroaads123.repl.co
  suburbanindustries.net
+suburbanlittleleague.com
  suburbanswag.info
  suburmart.com
  subuys.com
@@ -258739,6 +258194,7 @@ sucursal-profesional-bancolombiasas.zz.com.ve
  sucursal-virtualgrupobancolombia.com.co
  sucursal.personas.bacolombia.com.mypass.live
  sucursalactiva.xyz
+sucursalbancolombia.online
  sucursalbancolombia.transaccionespersonas.com
  sucursalbancolombiapesonal.com
  sucursalbancolxx.webcindario.com
@@ -258812,6 +258268,7 @@ sucursalpersonas.ingresagrupobancolombiia.com
  sucursalpersonas.ingresagruupobancolombia.com
  sucursalpersonas.portalbankcolombia.com.co
  sucursalpersonas.transaccionalbancolombia.co
+sucursalpersonas.transaccionbancolombia.com
  sucursalpersonas.transaccionesbacolombia.thewnetwork.com
  sucursalpersonas.transaccionesbancolombia.com-back-buttonooooooooooverifiedalertasynotificacioness.alserviciorat-tray.com
  sucursalpersonas.transaccionesbancolombia.com-backs-buttonooooooooooverifiedalertasynotificacioness.alserviciorat-tray.com
@@ -258962,7 +258419,6 @@ sufibusinessclassflights.co.uk
  sufikalam.com
  sufindiatours.com
  sufyr.top
-sugalbalance.casa
  sugandhachejara.com
  sugano.trictalmk.com
  sugar22.com
@@ -258988,6 +258444,7 @@ suh-china.com
  suhailbahw.com
  suharrying.info
  suhaswebs.ml
+suhead.ga
  suhead.tk
  suhfuhs.cf
  suhpqiumpjsv.ru
@@ -259014,6 +258471,7 @@ suizjdcjbpjapbelmpfrjaaejc-dot-gleow2021ja.ue.r.appspot.com
  sujalamcropcare.com
  sujalappliances.co.in
  sujet-du-bac.com
+suju.qnotice.com
  sukababysite.000webhostapp.com
  sukaponic.com
  sukces-wspolnych.eu
@@ -259224,6 +258682,7 @@ sunjuan.winmail01.cn
  sunkara.me
  sunla.winmail01.cn
  sunlightoverseas.com
+sunmarkholidays.com
  sunmeter.eu
  sunmo.winmail01.cn
  sunmotors-recycle.com
@@ -259255,7 +258714,6 @@ sunshinemotel.com
  sunshinestate-florida.com
  sunshinewebdesign01.com
  sunshinewondervillas.biz
-sunshining.top
  sunt.link
  sunt2ehelp.online
  sunt5.webcindario.com
@@ -259270,6 +258728,7 @@ suntruistt.com
  suntrust-0061.webcindario.com
  suntrust-personal-banking-overview.ddnsgeek.com
  suntrust.accessonline-dlbank.com
+suntrust.cathemselves.com
  suntrust.com53662987.verification.today
  suntrust.dlbonline-bank.com
  suntrust.healthcarebarter.icu
@@ -259316,6 +258775,7 @@ super-ofertas-smart.tk
  super-ofertas.hopto.org
  super-promo-todo-dia.com
  super-promocao-ame.ml
+super-registry.s3.eu-central-1.amazonaws.com
  super-reinforcement.000webhostapp.com
  super-vote.ru
  super4ksmart.myddns.me
@@ -259411,6 +258871,7 @@ supersellerfl.com
  supersexytrends.com
  superson-com.ml
  superstarrr.hk
+superstart.qnotice.com
  superstartart.xyz
  superstartimes.icu
  supersupremebeautycenter.com
@@ -259465,7 +258926,6 @@ suporte-agora.com
  suporte-caixa.app
  suporte-cliente.com
  suporte-da-apple.com
-suporte-eprotocolo.date
  suporte-guardiaopj.digital
  suporte-it.ml
  suporte-ltau.app-personnalite.me
@@ -259475,13 +258935,13 @@ suporte.aplicativobron.gq
  suporte.br-apple.com
  suporte.cliente-itau.online
  suporte.mercadobitcoin.com.br-atendimento.trade
-suporteacessonecessario.ga
  suporteapps.net
  suporteauthy.com.br
  suportebanco.com
  suportebbempresarial.ga
  suportecaixa-ru.1gb.ru
  suportecartaoitau.com
+suportedetv.antenascuritiba.net.br
  suportegerente.online
  suporteitaucard.com
  suporteitaufacil.com
@@ -259493,9 +258953,7 @@ suportmail-outlo1.hospedagemdesites.ws
  suportnetflix.info
  suportonlinebb.net
  suports-a.net
-suports-identity-page-notification.my.id
  suports-notification-copyright-identiity.my.id
-suports-notification-secur-identiity.gq
  suports-page-notification-identity-recovery.ga
  suports-page-notification-identity-recovery.gq
  suportsaccount.0fees.us
@@ -259531,6 +258989,7 @@ supplment-arena.com
  supply-beauty.com
  supplyskinz.xyz
  suppmailaccount.ddns.net
+suppmybigcatel.com
  suppopiterjuve.info
  suppor-center-ee.com
  supporinstaagram.000webhostapp.com
@@ -259663,6 +259122,7 @@ support-ncvbvcjaka.nreagb.com
  support-netflix.ca
  support-netflix.info
  support-netflixx.xyz
+support-new-payees.com
  support-notif3.com
  support-office365.date
  support-office365.dns.army
@@ -259675,6 +259135,7 @@ support-payeeremove.com
  support-paypai.xyz
  support-paypal.com-cgi-bin.info
  support-paypal.serigo.com
+support-paypal2021.checkuser.admin-pan3l-sold.webredirect.org
  support-paypalverificationaccountisrequired-idosf501.tk
  support-paypalverificationaccountisrequired-idosf502.tk
  support-paypalverificationaccountisrequired-idosf503.tk
@@ -259916,6 +259377,7 @@ supporthelp-letsunlock-mysubscription.com
  supporthelp2810123456789.tk
  supporthelpform.com
  supporthelpforyou.000webhostapp.com
+supporthelplogin.com
  supporthit7.net
  supporticloudmail.com
  supportid.redixlick.com
@@ -260170,6 +259632,7 @@ surzadetneo.gq
  sus.videoya.xyz
  susadosa.com
  susai.ro
+susan312.xyz
  susanamendez10029834.000webhostapp.com
  susanapt.000webhostapp.com
  susancardenasart.com
@@ -260180,6 +259643,7 @@ susanjdurst.com
  susanjgreer.com
  susanlynnepeters.com
  susannahlints.com
+susannbraun.de
  susanrcordova.com
  susanslewis.xyz
  susansouthwellpool.com
@@ -260239,7 +259703,6 @@ suspgercvrysrvce01.my.id
  suspicious-activity-paypal.vrfd-arz-sppt4.com
  suspicious-austin-cd8033.netlify.app
  suspicious-euclid-2b302b.netlify.app
-suspicious-hermann-96a46b.netlify.app
  suspicious-login-attempt.com
  suspicious-online-payment.com
  suspiciousactivity.xyz
@@ -260316,7 +259779,6 @@ svca.info
  svchost.xyz
  svchost123.myftp.biz
  svchostest.ddns.net
-svcity.com
  svcupdate.com
  svcvhcswhkvgfdtcburgoietpleakmmiaaii-dot-solar-vertex-285913.rj.r.appspot.com
  svdihtkweotokghqqojqxcglyw-dot-gleowayel400503.uc.r.appspot.com
@@ -260554,6 +260016,7 @@ swiss-post.azurewebsites.net
  swiss-post.ch-dashboard-payment.bigskyreptiles.com.au
  swiss-sbb.com
  swiss.creatorlink.net
+swiss.post.ch.customer-package.info.u1297137.cp.regruhosting.ru
  swisscom-client.info
  swisscom-contact.ouba.com
  swisscom-contacts.dafun.com
@@ -260745,7 +260208,6 @@ syootwlrywqfebgijddvvfsbcqinfczsivsu-dot-solar-vertex-285913.rj.r.appspot.com
  syphiloid-class.000webhostapp.com
  sypin.gr
  sypl5yg.liporsz.info
-sypolsinger.online
  sypportsier.eu
  sypsycorhe.com
  sypwefxkclaxwwoaktrxxviipc-dot-gleowayel400503.uc.r.appspot.com
@@ -260767,6 +260229,7 @@ sys-xfinitysupport0-27.000webhostapp.com
  sys-xfinitysupport0-28.000webhostapp.com
  sys.admin.log.burgermen.org
  sys.dynu.com
+sys.pbmadu.co.id
  sys108-onba.webcindario.com
  sys32.publicvm.com
  sys726389198272.webcindario.com
@@ -260784,7 +260247,6 @@ systeeing.xyz
  system-amazonseo.serveirc.com
  system-backup.biz
  system-bot.com
-system-correct-billing.co.uk
  system-paypal.sajakuhanya.com
  system-payu.online
  system-r-e-q-u-i-r-e-m-e-n-t-s.giize.com
@@ -260906,7 +260368,6 @@ szinesgyongyok.hu
  szivarvanynetwhu.ru
  szjlhxfood.com
  szkaabouvdvlyhvylihwsgvpte-dot-gleowayel400503.uc.r.appspot.com
-szkolenia-excel2021.pl
  szkoleniatotum.pl
  szkypw.com
  szlhchrs.goruli.com
@@ -260952,7 +260413,6 @@ szybko.fun
  szzhongzhuang.com
  szzlwx.cn
  t-1yk.svcoding.com
-t-6.top
  t-app.ddns.net
  t-bagnation.com
  t-bot.io
@@ -261147,8 +260607,6 @@ tacelook00.000webhostapp.com
  tachoservicehlde.shaxiaaccommodation.top
  tachyoncv.vc
  tacklecorner.co.uk
-taclaightkistea1200.us
-taclightytauutiliyty.us
  tacofohert.ml
  tacosaurs.info
  tacsi4niym.temp.swtest.ru
@@ -261156,7 +260614,9 @@ tactfultruim.com
  tacticalhvac.net
  tacticaltechnicians.com
  tacticaltrainingdatabase.com
+tacticohosting.com
  tadalafil-shoprx.com
+tadalafilonlinebestcheap.com
  tadangnam1000.cf
  tadarusan.com
  tadbeerad.ae
@@ -261494,6 +260954,7 @@ tanjongkrueng.id
  tanjungbuton.com
  tankprankers.com
  tankthegastax.com
+tanlist-diba-system.com
  tanmhopisj.xyz
  tanmobile-deinfo.de
  tannatbtl.com
@@ -261686,6 +261147,7 @@ taumiq.com
  taupunktberechnung.de
  taur.info
  taurasagency.com
+taurus.ug
  tauschcare.org
  tausendkleider.de
  tautan-vidio-hotv1.000webhostapp.com
@@ -261800,6 +261262,7 @@ taxrebhm.tax
  taxreceive-secure.uk
  taxrefca.com
  taxrefuk.com
+taxrefund-gov-claim.com
  taxrefund-gov.fund
  taxrefund-hmrc.info
  taxrefund-rebait.com
@@ -261864,7 +261327,6 @@ tbgcaethehnwgjppaz.top
  tbgmud.net
  tbgykxdnfzdhqaxtchozhaumlc-dot-gleowayel400503.uc.r.appspot.com
  tbhsf.s2jqs.cn
-tbilisi.top
  tbilisiperforming.com
  tbj8a.awaykart.com
  tbjuzgffvwfcnyezew.top
@@ -261917,6 +261379,7 @@ tccsemdrama-inscricao.ml
  tcdig.com
  tcdonline.org
  tcenteronline.com
+tcesingur.com
  tcfbbnk.com
  tcfeckne.firebaseapp.com
  tcfibank.com
@@ -262235,6 +261698,7 @@ technokraftslabs.com
  technolead.mx
  technologiechabot.com
  technologievimy.com
+technologydistilled.com
  technopers.com
  technorash.com
  technoring.de
@@ -262351,6 +261815,7 @@ tediciady45.000webhostapp.com
  tedious-mixtures.000webhostapp.com
  tedofit.com
  tedqhswvyqkbdzvwxtclczxgmhqsboqrxlmv-dot-solar-vertex-285913.rj.r.appspot.com
+teduae.com
  tedvankoleji.com
  tedwoodworking.org
  tedzey.info
@@ -262472,6 +261937,7 @@ telecreditobetabcp.me
  telecreditos.webcindario.com
  telecreditosbcp.online
  telefonica-com-dot-gl494903049.wl.r.appspot.com
+telefoonverificatie-mijnabn.xyz
  teleglobalsecurity.it
  telegramapi.gq
  telegramapi.tk
@@ -262525,6 +261991,8 @@ telmobilitydata.com
  telomedic.com
  telorjambans.com
  telotenemos.cl
+telponwhatsapp4.duckdns.org
+telponwhatsapp5.duckdns.org
  telros.ru
  telsandalyesi.com
  telse01.000webhostapp.com
@@ -262612,7 +262080,6 @@ temprazin.mydoctorfinder.com
  temproperties0133fde485f3a-realtygrouppage0134223-pfb204767.net
  temproperties3fde485f3a-realtygrouppage34223-pfb204767.net
  tempsite.review
-tempsquecadure.space
  temptest123.reveance.nl
  temptmag.com
  temscsquare.com
@@ -262759,7 +262226,6 @@ terminalsystems.eu
  terminatemailatt.weebly.com
  terminationagt.net
  terminationalx.com
-terminatrortinnitusuys.us
  termlivedesk.info
  termoalbiate.com
  termoedilsrl.net
@@ -262934,12 +262400,14 @@ test.numerica-asbl.be
  test.old.xn--kaken-tbb.com
  test.paypal.com-informationaccounts.com
  test.prohackingsoftware.com
+test.protocsconnectes.eu
  test.sdcgroup.com.au
  test.shalay.com
  test.shaostoul.com
  test.shop.xn--blockchin-c2d.com
  test.sportechd.com
  test.staging.xn--kaken-tbb.com
+test.studecademy.com
  test.stylevesti.ru
  test.synergyglobal.one
  test.taphoare.com
@@ -263017,6 +262485,7 @@ testing-adjusting-balancing.com
  testing.in.rs
  testing.lmdy.uk.com
  testing.nudev.net
+testing.thinkingcorp.in
  testing.web-x.io
  testing0.site
  testing14.lightmix.com
@@ -263170,6 +262639,7 @@ tfgs.mobilesuns.com
  tfgs.ynmtzs.cn
  tfhconline.net
  tfjburyeuusdfxcsmmcg-dot-gleowyel040493443434989.wl.r.appspot.com
+tfjsrypvwdudgrofdwzaqdsdab-dot-gleow2021ja.ue.r.appspot.com
  tflfkkh0avp2.talagaremix.com
  tflpj.com
  tfnaeplsg.handipants.com
@@ -263206,6 +262676,7 @@ tgewa.gulfhirings.com
  tggamer24.000webhostapp.com
  tggrfdecfgg.ga
  tggtwzltrqtdfawhahhudwwsru-dot-gleowayel400503.uc.r.appspot.com
+tghomerepair.com
  tgilrisolk.duckdns.org
  tgivewa.squirly.info
  tgjemiqgymuliqouluuakrrerx-dot-gloff849483.uk.r.appspot.com
@@ -263620,6 +263091,7 @@ thefourth-71.ga
  thefreeskinzhub.xyz
  thefundestoyer.top
  thefuturecapital.com
+thefuturelife.in
  thegadgetlord.com
  thegallerystore.in
  thegamehallscom.nckicruise.gdn
@@ -264017,7 +263489,6 @@ therightwaytofloss.com
  theritewaydrivingschool.com
  theritteragency.com
  therivetdgh.com
-thermalprint.casa
  thermalswitchfactory.com
  thermas.by
  thermic-scratch.000webhostapp.com
@@ -264245,7 +263716,6 @@ thinkoutsidecoaching.com
  thinkowe.guru
  thinktobehappy.com
  thinkyoeoysmotyhe.club
-thioses.com
  thiparromer.xyz
  third-flare-287607.wm.r.appspot.com
  thirdwaychurch.com
@@ -264269,6 +263739,7 @@ thismonspoppove.info
  thistleworthlesspatterns.rafi9898.repl.co
  thithpt.edu.vn
  thiture.xyz
+thiyltkkwudqkjypsfgkuqjqna-dot-gleow2021ja.ue.r.appspot.com
  thjcfsj.dynssl.com
  thkiqbudhxdwgipgmuwinkbpje-dot-gleowayel400503.uc.r.appspot.com
  thoatran.000webhostapp.com
@@ -264317,7 +263788,6 @@ thornier-dimensions.000webhostapp.com
  thorntonbeta.000webhostapp.com
  thoroughbredcalendar.com
  thorrak.com
-thorrut.com
  thorskarate.eu
  thortonpost.com
  thosewebbs.com
@@ -264325,6 +263795,7 @@ thottchalnerosbo.ml
  thoublimmanis.xyz
  thoucamixers.xyz
  thoughtfulfunctionalpostscript--five-nine.repl.co
+thoughtfulwiryinstances.omarbaez.repl.co
  thoughtscombined.com
  thoughtstopaper.com
  thoughtwax.com
@@ -264657,7 +264128,6 @@ throwsailory.com
  throwsniff.cyou
  thrustfinancialgroup.com
  thrustmarkets.com
-thrustmiss.guru
  thsapidllsignlnssluidcoetyneriindeushdyefwscg.aba.vg
  thshgfhrtj.co.cc
  thsyuwshakjnd666iajnxx666.com
@@ -264949,6 +264419,7 @@ timeline-vyqyysutq.mstransport.ae
  timeline-wkozyixtj.mstransport.ae
  timeline-wqnvpqtkt.mstransport.ae
  timeline-yiospfyye.mstransport.ae
+timelinegifts.com
  timelineinfotech.com
  timelinelimitless.000webhostapp.com
  timelinemaintenance.ae
@@ -264990,7 +264461,6 @@ timeoutshelter.org
  timeq.uz
  timercongo.com
  timesawu.xyz
-timeshareexpretrre.us
  timesmold.org
  timesofconquest.icu
  timesoftimber.com
@@ -265024,6 +264494,7 @@ timplex.my
  tims-webb.000webhostapp.com
  timwarren.tv
  tin-melodious-shingle.glitch.me
+tina-smith-app.shop
  tina575profile.online
  tinac.wedding
  tinaecotton.com
@@ -265035,7 +264506,6 @@ tinderaccountpictures.000webhostapp.com
  tinderphotocom.shaxiabeauty.top
  tindertwerk.ml
  tindubaii.000webhostapp.com
-tinerw34.com
  tineyanten.com
  tinfosrierla.yolasite.com
  tingdrinkscaddy.com
@@ -265123,6 +264593,7 @@ tiritadepapel.cl
  tirnotrade.com
  tirocinio.eu
  tirupatireddy.com
+tiscali-mail-login-online-account.com
  tischleindeckdichorg.baerseventeam.top
  tischlereierhartcom.chifanaudit.top
  tischlereikollercom.augerqisafety.top
@@ -265139,6 +264610,7 @@ titaaurings.redkite.com.ph
  titafricanfashion.com
  titan-valves.com
  titan.eventgarena-17agustus.gq
+titanautomobiles.com
  titanbane.com
  titandandmgratis.garena-ff9.my.id
  titanevents.getcom1.gq
@@ -265424,6 +264896,7 @@ today4534.com
  todayais.com
  todayalbanianews.info
  todaybirthdayfamous.com
+todaydeliveries.net
  todayfortune.cyou
  todayif.com
  todayissoftware.com
@@ -265507,7 +264980,6 @@ tokarconstruction.icu
  token-desbloqueio.com
  token-mobile30hs.ddns.net
  tokendigital-bn1multired.com
-tokendigital.bn1-segurazona.com
  tokendigital.registrosmvltired.xyz
  tokendigital.zonasegvraperu1bn.com
  tokendigitalbnsegura.com
@@ -265858,6 +265330,7 @@ topup-pulsa-gratis-freefire.000webhostapp.com
  topup-whatsupgrub-gg.diamondff15.gq
  topupbz.com
  topupdiamondfreefirekalaharifre.000webhostapp.com
+topupfreecodashop.xxuz.com
  topupfreefromunipin.000webhostapp.com
  topupgarenaa.000webhostapp.com
  topupgradetypeflashlite.icu
@@ -265914,6 +265387,7 @@ torpstreets.buzz
  torradestoqueagosto.ml
  torratorradejulho.com
  torreslimos.com
+torresquinterocorp.com
  torringtonct.buzz
  torrinwine.com
  torrozaagencia.com
@@ -265928,6 +265402,7 @@ tostani.cl
  tostslices01.xyz
  total-investidor-com-br.preview-domain.com
  total-options.com
+totalacessseguro.com
  totalcallrotterdam.nl
  totalcattlemarketing.com
  totaldynamicpools.com
@@ -265977,6 +265452,7 @@ touchupxs.com
  touchworldintl.com
  tough-glossy-century.glitch.me
  tough-wonderful-toy.glitch.me
+touhidalam09.github.io
  touka.parsysit.com
  toupdate.amzaon.authorization.buzz
  toupdate15.com
@@ -266443,7 +265919,6 @@ transfert-interac.xyz
  transferwisefirewallsystemupdatedinfo.duckdns.org
  transfinaco.com
  transfora.asilitv.com
-transformator66.ru
  transformers.net.nz
  transgear.in
  transisthmian-reloc.000webhostapp.com
@@ -266478,6 +265953,7 @@ transportesmakool.com
  transportesparedes.com
  transportesprimedobra.com.br
  transportesprisma.com
+transportesrajju.com
  transportesycementoshidalgo.es
  transportmada.com
  transporty24.net
@@ -266605,7 +266081,6 @@ treaszuniop.cc.dvrlists.com
  treatioansmsaevrs.com
  treatioansmsas.top
  treatment.jaysbrand.com
-treatrun.cyou
  treatycotton.guru
  treatyloan.blogspot.com
  treatyloan.blogspot.fr
@@ -266741,10 +266216,12 @@ tribvlafrica.com
  tricarpellary-effic.000webhostapp.com
  trichromatic-transi.000webhostapp.com
  triciaklink.com
+trickpubgm.com
  trickthehourse.net
  tricktotrip.com
  tricoliteenergy.in
  tricolor-tungsten-buckthornpepperberry.glitch.me
+triconville.com
  tricotyledonous.xyz
  tricouri-brand.ro
  tricyclejanlove.com
@@ -266813,7 +266290,6 @@ triomphecapital.com
  tripamsder.com
  tripatory.com
  tripaxi.com
-tripfew.cyou
  triphowd.com
  tripl1-threat9.xyz
  triple5triple4.com
@@ -266880,6 +266356,8 @@ trksmm25.live
  trlink.me
  trlmakvdyqwyptrukhnbkkcqhforybbnnbfy-dot-cryptic-now-290917.ey.r.appspot.com
  trlremmaocgfrnlmjuznaquiub-dot-gleowayel400503.uc.r.appspot.com
+trlucv.cf
+trlucv.ml
  trmreporting.com
  trocadepontosonline.com
  trocarponto.com
@@ -267134,7 +266612,6 @@ tsad.goruli.com
  tsatest-812.tk
  tsatwg2bdst4.000webhostapp.com
  tsavo.ke
-tsb-demo.tuga.tools
  tsb-online.auth5s.com
  tsb-online.payee-add-online.com
  tsb-security-issue.com
@@ -267143,7 +266620,6 @@ tsb.new-loginattempt.com
  tsb.page
  tsb.personal-banking-authorisation.com
  tsb.uk-secure-deregisterdevice.com
-tsb.verify-payeegroup.com
  tsbfraud.com
  tsbmanagepayee.com
  tsbqgpsuez.duckdns.org
@@ -267166,6 +266642,7 @@ tsfjd.com
  tsgalleria.com
  tsgesg.jdim.com.cn
  tsgfc.cn
+tsgwuwncm2.tonohost.com
  tshaku-news.net
  tshirt-factory.eu
  tshirtkampanya.tk
@@ -267251,6 +266728,7 @@ tte5ee578.weebly.com
  ttechttech.000webhostapp.com
  tternikscsgo.work
  tterra.pt
+ttersedisputehelp.com
  ttf.tidt47.cn
  ttfg.8js1c.cn
  ttgsjushaj.weebly.com
@@ -267474,6 +266952,7 @@ turinnyr.buzz
  turismo-joven.com.ar
  turismochaco.com
  turismodeemociones.com
+turismoecuador.org
  turismosantillanacom.shaxianame.top
  turistejo.pt
  turisti.al
@@ -267865,13 +267344,12 @@ tycoweb.com
  tycp133.com
  tyczquarere.tk
  tydecydujesz.org
-tydggsjs.cam
-tyebnndh.cam
  tyewt.u15d15.cn
  tyf45dfxxoptimistimpalabf13563.uk.r.appspot.com
  tyfghfghhub.xyz
  tyfhg.xyz
  tyfhgs.rfbmc9tc4lf.cn
+tygcdjnfefcjukjyshbimo.weebly.com
  tygf6.alnawwar.com
  tygiveways.fun
  tyh.shoesmogul.com
@@ -267926,7 +267404,6 @@ tyrolmailcom.shaxiaarts.top
  tyronescleancredit.com
  tyrus.com.ng
  tysiopmndjj.cam
-tysioppp.cam
  tysk.goruli.com
  tysley.com
  tytttte.qa2.com.cn
@@ -267994,6 +267471,7 @@ u0005522m0100jp.m006jp3371.info
  u056pdfozxz.appspot.com
  u0929560.cp.regruhosting.ru
  u0945186.cp.regruhosting.ru
+u098l73l28.com
  u0997683.cp.regruhosting.ru
  u0999907.cp.regruhosting.ru
  u0lmailserver.ddns.net
@@ -268069,6 +267547,7 @@ u2pp.top
  u2sk3.codesandbox.io
  u3075118.ct.sendgrid.net
  u3fvdjvbfc.outlook.webredirect.org
+u3qj4.csb.app
  u4037714.ct.sendgrid.net
  u4718414.ct.sendgrid.net
  u4rl.com
@@ -268247,6 +267726,7 @@ ubrrrtaxi.com
  ubsall.com
  ubsbanks.com
  ubsbd.com.bd
+ubssbnk.com
  ubtforex.com
  ubtr.healthygenez.club
  ubtsichol.com
@@ -268304,7 +267784,6 @@ ucpredzy.rogagot.com
  ucpubg22.com
  ucpubgms.qhigh.com
  ucpubgms13.com
-ucpubgtops.com
  ucpubgxmobile.com
  ucrackeditwefixit.com
  ucs.unmuha.ac.id
@@ -268374,6 +267853,7 @@ ueasoi.com
  ueathlorturetr.xyz
  ueber55.de
  uebllymqxbrachytpuhksiswfbltuopegdwi-dot-gl494903049.wl.r.appspot.com
+uecdkypkfnjdudewdvyodtvchy-dot-gleow2021ja.ue.r.appspot.com
  uecl.shop
  uedahospitalcom.shaxiamarketing.top
  uedayuichicom.chifanblow.top
@@ -268425,6 +267905,7 @@ ufjf-edu-br.000webhostapp.com
  ufjnlmwiymnsblsidmkhkxiphi-dot-gleowayel400503.uc.r.appspot.com
  uflago-done.web.app
  uflawless.com
+uflexathletics.com
  uflowokasion.casa
  ufoarihzrnfldsooicnzuomogeuxfrenvolf-dot-solar-vertex-285913.rj.r.appspot.com
  ufoarihzrnfldsooicnzuomogeuxfrenvolf.solar-vertex-285913.rj.r.appspot.com
@@ -268469,6 +267950,7 @@ ugoiusosf.cf
  ugottahavea.com
  ugovendut.com
  ugovlahovic.hr
+ugprs-ubih.org
  ugptogo.org
  ugroup.webeden.co.uk
  ugrowcouncil.com
@@ -268571,6 +268053,7 @@ ujwlhu.serviceorder.su
  ujwulbnih.dermals.org
  ujwvjikjuzvjziqknvjphaufumfvbjvmaprr-dot-cedar-code-289917.nn.r.appspot.com
  ujytr.fiesta.it
+ujzkuimrywnusmov.com
  ujzuopinji.com
  uk-articleuk10.site
  uk-auth-c14.com
@@ -268583,6 +268066,7 @@ uk-center-help-online.com
  uk-centre.info
  uk-centre3.info
  uk-claim.info
+uk-confirmation.co.uk
  uk-covid-19-relieve.com
  uk-deliveries.support
  uk-device-alert.com
@@ -268616,6 +268100,7 @@ uk-prime-subscription.adminit.com.au
  uk-rebates-gov.com
  uk-ref111287.com
  uk-refunds-tax.com
+uk-reverse.co.uk
  uk-securecentre.com
  uk-tax-hmrc.com
  uk-taxitloseit.com
@@ -268691,7 +268176,6 @@ ukgolekduit.com
  ukgov-apply.com
  ukgov-billinginfo.com
  ukgov-billingsupports.com
-ukgov-claim.co.uk
  ukgov-detail.com
  ukgov-gateform.com
  ukgov-identify.com
@@ -268852,6 +268336,7 @@ ultrabrokerage.buzz
  ultrafamilynet.augerqisafety.top
  ultragameshow.000webhostapp.com
  ultraknitfashions.com
+ultramainfests88.us
  ultramarineproducts.in
  ultramontane-signif.000webhostapp.com
  ultranationmedia.com
@@ -268866,7 +268351,6 @@ ultratelephoto.casa
  ultravcn.com
  ultrawellmultiservices.com
  ultrawhite.nl
-ultrawide.casa
  ulukantasarim.com
  ulukapaet.com
  ulusalofis.com
@@ -268941,6 +268425,7 @@ umuri.weebly.com
  umuugbmalw.duckdns.org
  umwelt-kirchhof.de
  umweltreportcom.shaxiaprimary.top
+umxxstkkpivsijrrnolcixshjd-dot-gleow2021ja.ue.r.appspot.com
  un-538059170.letsfitworld.com
  un-702152396.letsfitworld.com
  un-905474697.letsfitworld.com
@@ -268971,16 +268456,15 @@ unauthorise-bankpayment.com
  unauthorise-digitalpayment.com
  unauthorise-mobilepayment.com
  unauthorise-newpayee.com
+unauthorise-newrecipient.com
  unauthorise-onlinepayment.com
-unauthorise-payeeadd.com
  unauthorise-paymentonline.com
+unauthorised-attempted-login.com
  unauthorised-attemptedpayment.com
  unauthorised-cancelpayment.com
-unauthorised-login-secure.com
  unauthorised-payeerequest.com
  unauthorised-payment.com
  unauthorised-paymentcancel.com
-unauthorised-secure-login.com
  unauthorised-transaction.net
  unauthorisedpayee-gb.com
  unauthorisedpayeehelp.com
@@ -269033,7 +268517,6 @@ uncoolagency.com
  uncoordinated-radia.000webhostapp.com
  uncredentialled.info
  uncrugby.com
-unctoe.com
  undagangrupwa01.000webhostapp.com
  undangan-grubwa76.cf
  undangan-grup-berbagi-video-bokep.000webhostapp.com
@@ -269095,6 +268578,7 @@ unench.com
  unendingburnt.com
  unendingcarded.com
  uneneroun.tk
+unequaleducation.com
  unete24.com
  unetica.fr
  unetsolutions.com
@@ -269279,6 +268763,7 @@ uniquewv.com
  unireconfrimes12.cf
  unis.link
  unisarasedialitybi.xyz
+unisoftcc.com
  unisonsouthayr.org.uk
  unisurprise.com
  unisvvap.live
@@ -269331,7 +268816,6 @@ unitvoficial.com.br
  unitybankau.com
  unitypestcontrolandservices.com
  unitysistemas.com
-unitysyiuyeiosiu.us
  unitytec.com.br
  unitytool.com
  univ-alger.dz
@@ -269397,6 +268881,7 @@ unl0csecure-amazon.serveirc.com
  unlamd-nl.nl
  unlawfulmoglen.com
  unlawfulomission.com
+unleaded-lookout.000webhostapp.com
  unleased-hug.000webhostapp.com
  unlimited.movies.and.series.netflix.afraplants.ir
  unlimited.movies.and.series.netflix.irsa-art.ir
@@ -269494,6 +268979,7 @@ unready-details.000webhostapp.com
  unreclaimable-ribbo.000webhostapp.com
  unrecognised-devicedetection.com
  unrecognisedpayee-removal.com
+unrecognisedpayeerequest.com
  unrecognisedtransaction.support
  unreconstructed-mon.000webhostapp.com
  unrecurecd.com
@@ -269682,7 +269168,6 @@ unusual-hs-activity.com
  unusual-login-new-device.com
  unusual-registered-device.com
  unusual-sigonpaypal.com
-unusualaction-login.com
  unverified-payeesec.net
  unverified-reqeusts.com
  unverify-loginrequests.com
@@ -269752,7 +269237,6 @@ upchaselog66.webcindario.com
  upcom-pro.be
  upcoming100.com
  upcountrypsychiatry.com
-upd-auth.work
  upd-detailsform.co.uk
  upd-form.com
  upd-formsecure.co.uk
@@ -270094,6 +269578,7 @@ updatepay.xyz
  updatepaym.com
  updatepayment-kr.serveirc.com
  updatepayment.site
+updatepaymentfailure.com
  updatepaypal-services.com
  updateproces.services
  updatequota.byethost5.com
@@ -270130,7 +269615,6 @@ updates.cn.com
  updates.eeinfo.net
  updates.gtaprovince.ru
  updatescheck.com
-updateseason17.com
  updatesecurity.ooguy.com
  updatesecurityamazn.com
  updatesecurityapp.servebeer.com
@@ -270811,6 +270295,7 @@ user-terms7628.com
  user-terms7645.com
  user-updates-co-jp.cyou
  user-verification-paypal.duckdns.org
+user-verification8n.serveftp.com
  user-verify-securityy.gleeze.com
  user-verify-service.misecure.com
  user-verify01.ddns.net
@@ -270918,6 +270403,7 @@ userssecuresaccounts.com
  userst.000webhostapp.com
  usersupdatesallaccounts.com
  usersvalidation.weebly.com
+uservipa.com
  userwebivery.live
  userweblogin.com
  userx0fdv9000.an.r.appspot.com
@@ -271159,7 +270645,6 @@ uuu.liunian.mobi
  uuud540.cn
  uuuiquiuroff.du.r.appspot.com
  uuviettravel.net
-uuwjsrt.cam
  uuwoieictrkpzbipznwwcouxtyuyffomvdfo-dot-gl494903049.wl.r.appspot.com
  uuww3o.al1av.com
  uuww55pp.al1av.com
@@ -271390,7 +270875,6 @@ v59lm6tqmv6.c.updraftclone.com
  v5k42qw3j1y955f6.com
  v5td.hyperphp.com
  v73adrian79.company
-v7ioz.app.link
  v7k15go.senandungmerana.info
  v801209.me
  v839002.buzz
@@ -271425,7 +270909,6 @@ vacmsywr01.ml
  vacompany.co.za
  vacomsystems.com
  vacontd.com
-vacuumask.cyou
  vacxv.000webhostapp.com
  vadapt.com
  vaddesobhanadri.com
@@ -271489,6 +270972,7 @@ vakifbayramappp.ml
  vakiftanbayramvaktim.ml
  vakvtem.co.xakutem.pw
  vakvtem.kyvslbk.cn
+val-boil.000webhostapp.com
  valarchihomes.com
  valarchihomes.qmarkonline.com
  valatyn.biz
@@ -271806,6 +271290,7 @@ vastukkalp.com
  vastuvidyaarchitects.com
  vasty-journal.000webhostapp.com
  vastyrannouse.at
+vasudhabiotech.com
  vasudhaivakutumb.com
  vasumadhi.com
  vasylivka.lebrada.gov.ua
@@ -272063,6 +271548,7 @@ veganwarrior.racevmarketing.com
  vegaplas.cl
  vegas.localcitycenter.com
  vegashatstore.com
+vegasuperoffer.com
  vegasvalleybh.com
  vegasvikingsecurity.com
  vegaswiss.com
@@ -272240,6 +271726,7 @@ ventdepot.ro
  vente-online.000webhostapp.com
  venteexpress.ma
  venteypunto.com
+ventilable-audits.000webhostapp.com
  ventillos.ug
  ventoclima.hopto.org
  ventral-decreases.000webhostapp.com
@@ -272634,6 +272121,7 @@ verifications-online-restrictions.com
  verifications.account-limited.posgtyhm.com
  verifications.instagram.ezzuari.web.id
  verifications.vip
+verifications56-banking.dynamic-dns.net
  verificationsbadgesupports.ml
  verificationsbcglobalofficeadminet.weebly.com
  verificationsdatasbase-s.web.app
@@ -272680,8 +272168,11 @@ verified.xn--twtter-4va.com.co
  verifiedbadge-form.com
  verifiedbadge-lnstagram.ml
  verifiedbadgebusiness.com
+verifiedbadgeformcenters.com
  verifiedbadgehelp-form.ml
  verifiedbadges-instagram.com
+verifiedbadgesformcenter.com
+verifiedbadgesupportcenter.com
  verifiedbadgeverification.com
  verifiedbyfbk.com
  verifiedlink.uk
@@ -273233,6 +272724,8 @@ verifyyourdetails.com
  verifyyourfbaccounttologin.kashi.com.ng
  verifyyourwebmail.bitrix24.site
  verifyyyyouracounttttinnnformmm.com
+veriificacintarjeta-690f4e.ingress-comporellon.easywp.com
+veriificacintarjeta.blogspot.com
  veriifiikasipemblokiran.000webhostapp.com
  veriifikasiakun.weebly.com
  veriify-authacoount.ddnsgeek.com
@@ -273241,6 +272734,7 @@ veriifying-accounts.serveblog.net
  veriiiifffikassssiipemmmblokkiranid.000webhostapp.com
  veriiiiiffikkkkaaaasssiipemblookkirannn.000webhostapp.com
  veriiiiiifffffiiiiikasiipemblokkiraann.000webhostapp.com
+verimatrix.yuno-tv.com
  verinet.dk
  verinit166.com
  verionlobter.live
@@ -273255,6 +272749,7 @@ veritificartbcpmovil-peru.cola-ge.com
  veritress.info
  veritynova.com
  veritype166.com
+verivikasi-pemblokiran-fb01.ga
  verivikasi-pemblokiran-fb03.tk
  verivikasi.fego-xfb.cf
  verixon.co.uk
@@ -273296,6 +272791,7 @@ verminous-patch.000webhostapp.com
  vermoegenmanagencom.chifanblock.top
  vermoegenmanagencom.shaxiarecord.top
  vermoegensaufbaumitimmobilieninfo.augerqisafety.top
+vermontrentalfarm.ru
  vermoote.de
  vern-particul-santanderesinfo.com
  vern436453.xyz
@@ -273724,6 +273220,7 @@ vidalgesso.com.br
  vidallakesapt.buzz
  vidamelhor.shop
  vidar321.ru
+vidativatriclub.com.br
  vidax68109.temp.swtest.ru
  vidbase53.com
  vidbokepviralgrub.xxxsdz.tk
@@ -273902,7 +273399,6 @@ vidioxnxx.xxuz.com
  vidiyo.me
  vidogar.com.ar
  vidoogle.co
-vidoon4sj.casa
  vidorencontrer.tk
  vidramaq.com.br
  vidrioyaluminiosayj.com
@@ -274114,6 +273610,7 @@ villasakuraubud.com
  villasalento.puglia.it
  villasatlarisa.com
  villashippingtradingpv-my.sharepoint.com
+villasoledadbeachresort.com
  villasroofingcontractors.com
  villatera.com
  villedefrancecovid19.online
@@ -274173,7 +273670,6 @@ vinhcba.com
  vinhchau.net
  vinhomesgoldenriver.info
  vinhomeswestpointhanoi.com
-vinhosbrasileiros.com
  viniciuscampanhol.com.br
  viniciuscorinthiano.ug
  viniciusrangel.com
@@ -274254,6 +273750,7 @@ vipdomainshop.com
  viperbux.com
  vipercloud.in
  viperseo.co
+vipescorthatunlar.com
  vipfilehost.com
  vipgetseason15.com
  vipgohot2020.panasonixholl.gq
@@ -274511,7 +274008,6 @@ visions.alnisamart.com
  visions.ddns.net
  visionscape.duckdns.org
  visionstk.com
-visionthen.casa
  visiourertsti.xyz
  visispout53.com
  visisrc166.com
@@ -274544,7 +274040,6 @@ vistaprinthead.com
  vistasadprojects.com
  vistasigns.com.mx
  visten23.ru
-vistourin5.com
  vistratfonline.com
  vistrokijomegadyn.ml
  visu-all.ch
@@ -274555,6 +274050,7 @@ visualeyestuscaloosa.com
  visualfirewall.com
  visualhome.cl
  visualhorsepowerserver.com
+visualizar.recptsclientes.com
  visualized-schedule.000webhostapp.com
  visualizzamovimenti.com
  visuallychallenged.com
@@ -274634,6 +274130,7 @@ vivasivo.com
  vivationdesign.com
  vivatruck.eu
  vivb.tk
+viveirodoiscorregos.com.br
  vivekanandmspmdholpur.com
  viveknaithani.com
  vivekprakashtiwari.com
@@ -274671,6 +274168,7 @@ vizertv.xyz
  vizor.cloud
  vizpoets.com
  vizzamedia.com
+vizzanoindonesia.co.id
  vizzwebsolutions.com
  vj-shah.com
  vjaymanagement.chifanassociate.top
@@ -274852,6 +274350,7 @@ vkrkaypjxzzkowfgferrhixxlj-dot-gleowayel400503.uc.r.appspot.com
  vkroulette1337.000webhostapp.com
  vkru.kl.com.ua
  vksafe.com
+vksales.com
  vksaodyd.kro.kr
  vksavesmusic.webservis.ru
  vksecure.site
@@ -274973,7 +274472,6 @@ vmdmtvdeaxcyqbjrtv.top
  vmdtint.us
  vmdtsxtfbuc.asdwndpqowmlsa.org
  vmedia-billing-gb.com
-vmedia-billing-help.com
  vmedia-helpdesk.com
  vmedia-personal-update.com
  vmeyineidiixeqbdnudvememud-dot-gloff849483.uk.r.appspot.com
@@ -275431,6 +274929,7 @@ vps-2282d033.vps.ovh.net
  vps-22bb18bc.vps.ovh.net
  vps-2303d288.vps.ovh.net
  vps-30193158.vps.ovh.net
+vps-310989.unkrunchdesabor.com.mx
  vps-39f001b3.vps.ovh.net
  vps-3c85983f.vps.ovh.net
  vps-48ce3bea.vps.ovh.net
@@ -275626,8 +275125,10 @@ vtpgroup.co.in
  vtrtuer.com
  vtscomputers.com
  vtsjythatuhxotqmmkbkvmisiz-dot-gleowayel400503.uc.r.appspot.com
+vtube.fadlymotivator.com
  vtvstudio.com
  vtxmail2018.myfreesites.net
+vtxojkmjfbtfqluqlxgxlylyvo-dot-gleow2021ja.ue.r.appspot.com
  vtxwtpuixfjzqyjixfmrcvvfbv-dot-gleowayel400503.uc.r.appspot.com
  vtyllllyxl.duckdns.org
  vtzgr13l.firebaseapp.com
@@ -275657,6 +275158,7 @@ vulsdjmidvyikhnjdlqndsryhx-dot-gleowayel400503.uc.r.appspot.com
  vuluwlikuwdpqhcviyafuydxlg-dot-gleowayel400503.uc.r.appspot.com
  vumks.com
  vunzfihmwpnaqakzegtrdme.top
+vuongcode.com
  vuonorganic.com
  vuonsangtao.vn
  vuotolauta.tk
@@ -275785,6 +275287,7 @@ vwwvroblox.com
  vwyrebi.ts.r.appspot.com
  vwzkqxufdiyymmaerntttwfner-dot-gleowayel400503.uc.r.appspot.com
  vxabybupvu.duckdns.org
+vxbrandz.com
  vxcznbvbzcxn.servecounterstrike.com
  vxgdft.shoesmogul.com
  vxgqejudtcxyhwxz.top
@@ -276032,6 +275535,7 @@ wa2zur5yaq.projects.webpages.one
  wa47bc7309gd7gswk848m.zxjargalbavyar.repl.co
  wa73f17um8ze-rb4075sve.vercel.app
  wa7xck5d3vnk.talagaremix.com
+waa.25u.com
  waaaa1.duckdns.org
  waagenstammcom.shaxiapussy.top
  waahasapsange.mrbonus.com
@@ -276046,6 +275550,7 @@ wabokep-indo.info15.net
  wabokep1817.hubbbb29.ga
  wabokepjapan.000webhostapp.com
  wabroswear.com
+wabzaafkollamyablienbqinahnaaw.blogspot.com
  wacademy.asia
  wach8.com
  wachatt20.ml
@@ -276105,6 +275610,7 @@ wagroupjointomygroup2020.000webhostapp.com
  wagrub-indo.pricee.gq
  wagrub651.wa-sex.com
  wagrubbkp671.nett13.ml
+wagrubfreefire2k21.duckdns.org
  wagrubjoinda61461.000webhostapp.com
  wagrubku.site
  wagruopbokep.000webhostapp.com
@@ -276146,6 +275652,7 @@ waistponcho.com
  wait-please02.blogspot.com
  waitbuzz.net
  waiter.ml
+waitiaodixoiasx.azurewebsites.net
  waiyanphonelinn.me
  wajavxdhola.vipxz8.com
  wajibambilllhadiiahh100jtnya.ooguy.com
@@ -276289,6 +275796,7 @@ wangyispl.cn
  wangyutv.com
  wangzhankong.com
  wangzonghang.cn
+wanhaber.com.tr
  wanhuidg.com
  waniakurier.com
  waniscao.com
@@ -276418,7 +275926,6 @@ wasanacare.lk
  wasange2.wa-18.com
  wasap3.cf
  waschmaschinetopladercom.nckifrance.gdn
-wascloldgenretaoe.us
  wascqs.com
  waseda-investment.jp
  wasemoren.net
@@ -276458,6 +275965,7 @@ watch-kredit.ru
  watchcorona.com
  watchdogdns.duckdns.org
  watchdoughrefbikin.ml
+watcherinsrisuk.000webhostapp.com
  watcheslovetop.top
  watchesofswitzerland.eu
  watchespower.com
@@ -276536,6 +276044,7 @@ waverif.joins5.com
  waverif.misecure.com
  waversor.com
  wavesenginering.com
+wavesetgroup.net
  wavesetgroup.org
  wavesetholdings.com
  wavesolution.xyz
@@ -276590,6 +276099,7 @@ wayutuber.garena34.my.id
  waywithwords.net
  wayzatamn.buzz
  wazaa.mywire.org
+wazap.co.il
  wazex.xyz
  wazifonline.com
  waznesprawy.online
@@ -276960,7 +276470,6 @@ web-page-amzn-account-verificationj.com
  web-page-amzn-account-verifications.com
  web-paypai.com-secure.verlfyapps-loginfodestlnity.com
  web-paypal.com
-web-proxy.io
  web-reactiveacc0unt.idealseries.info
  web-rechungbetrag-domain.de
  web-registrosonasegvrabnonline1.club
@@ -277214,7 +276723,6 @@ webextractz.com
  webfabrik-mv.de
  webfiddle.net
  webfoliofaxn.com
-webfusionrh.com
  webgazy.cabanova.com
  webgifttingexperts.com
  webgisjambi.com
@@ -277272,6 +276780,7 @@ webloginnavigator-dewebkonto.cloud
  weblogverification.com
  weblube.com.my
  weblums.weebly.com
+weblysecurserviceone.net
  webmadrasa.com
  webmagazine-crediario.com
  webmail-123reg.app.link
@@ -277351,6 +276860,7 @@ webmail.facam.fr
  webmail.fastcarbuyer.icu
  webmail.fightingforfit.icu
  webmail.freehealthstudy.icu
+webmail.gaianets.com
  webmail.gba.fr
  webmail.gift14.kozow.com
  webmail.gjared.com
@@ -277400,6 +276910,7 @@ webmail.oxfordkashi.com
  webmail.paypal007.serveirc.com
  webmail.pharmchecker.xyz
  webmail.plala.or.jp.synergycooling.com.au
+webmail.plexusmedicalfrance.fr
  webmail.prismaflex.com
  webmail.propertysalesusa.icu
  webmail.proremontapple.ru
@@ -277424,6 +276935,7 @@ webmail.simplesubtraction.xyz
  webmail.sistemaamazonasenergia.com
  webmail.sokorri.com
  webmail.spcbrasil.adm.br
+webmail.ssecurenet.com
  webmail.suisui.ne.jp.manexweb.club
  webmail.support-panel.com
  webmail.sweetdreamsfairy.icu
@@ -277569,6 +277081,7 @@ website-americanas.net
  website-link-mijning.com
  website-onlineeeaccountmembers-help-form.000webhostapp.com
  website-onlinemyee-online-form-visit.000webhostapp.com
+website-work.com
  website.fauzulhasan.com
  website.scienceinstituteonline.in
  website.sikkco.com
@@ -278047,6 +277560,7 @@ wenti.000webhostapp.com
  wentuomachinery.com
  wenusemeee.com
  wenzhou.06wi.com
+weodegozlemqwertyuioplkjhgfdsazxcvbnmkjhgfretwuqolaasdew.eu-gb.cf.appdomain.cloud
  weorder-xrs.000webhostapp.com
  weowx.com
  weplayaem.com
@@ -278392,7 +277906,6 @@ wg21xijg43.ru
  wgc9.awaykart.com
  wgconstructors.com
  wgd-7.svcoding.com
-wgd-danndorf.com
  wgeauae.com
  wgergaeh.gb.net
  wgetaruba.org
@@ -278656,7 +278169,10 @@ whatsapp-gabungvip4.ezua.com
  whatsapp-gabungvip5.ezua.com
  whatsapp-gerups.myvnc.com
  whatsapp-grb-sxyz-virlinvi3.otzo.com
+whatsapp-grbsx-inv1te-jo.otzo.com
+whatsapp-grbsx-jo-inc.otzo.com
  whatsapp-grbx-joininvite-x.otzo.com
+whatsapp-grbxtc-invit3-jo.otzo.com
  whatsapp-groub.dns04.com
  whatsapp-group-berbagivideo18.wikaba.com
  whatsapp-group-bogelinvite2-chatwhatsapp.jetos.com
@@ -278806,8 +278322,6 @@ whatsapp-joingrub.mcalias.com
  whatsapp-joingrupbokepjepang.holl88.com
  whatsapp-joingrupnew18.wa-bokep7.cf
  whatsapp-joinngrupinvite.ocry.com
-whatsapp-joinxc.get-xyz06.ga
-whatsapp-joinxx.new-xyz3.cf
  whatsapp-khususdewasa18plus.viral-xxx.ga
  whatsapp-linkinvit-group18sex.2waky.com
  whatsapp-lordpoi-dewasa18.2waky.com
@@ -278822,6 +278336,7 @@ whatsapp-sexx-ind.ml
  whatsapp-sx-invitegroup-newvirals.itsaol.com
  whatsapp-sx-linkinvite-joingroup.2waky.com
  whatsapp-sxinvite-viral-uty.otzo.com
+whatsapp-sxyt-grbinv1t-yo.otzo.com
  whatsapp-v1.zzux-vv.ga
  whatsapp-videos.4dq.com
  whatsapp-videoviral.ga
@@ -278838,6 +278353,7 @@ whatsapp.bkp.croot-18.tk
  whatsapp.bokep0016.ga
  whatsapp.bokep091615.ml
  whatsapp.brazil7.my.id
+whatsapp.espborn.tk
  whatsapp.eventszs-xyzz.my.id
  whatsapp.freegrub.cf
  whatsapp.group.onviy.com
@@ -278858,7 +278374,6 @@ whatsapp.s4r4.com
  whatsapp.sesk18-com.gq
  whatsapp.sex18.org
  whatsapp.sexx99.ml
-whatsapp.spprtcom.tk
  whatsapp.srv51.com
  whatsapp.video.tahue.ml
  whatsapp.viral1011.my.id
@@ -278909,7 +278424,6 @@ whatsapp40.lflink.com
  whatsapp49.lflink.com
  whatsapp52.lflink.com
  whatsapp65.lflink.com
-whatsapp7.moonton-asw02.ml
  whatsapp758.hol7.shop
  whatsapp758.vipx2.shop
  whatsapp764.login-108.ml
@@ -279008,6 +278522,7 @@ whatsappgrpup2020.myvnc.com
  whatsappgrub-mabarfreefire-budi01gaming.zzux.com
  whatsappgrub.25u.com
  whatsappgrub.asia
+whatsappgrub.ddns.net
  whatsappgrub.hol8.me
  whatsappgrub.xxx-bokep.tk
  whatsappgrub0.kalem-2.my.id
@@ -279017,6 +278532,7 @@ whatsappgrubchat.vrt20.ga
  whatsappgrubchatcsxx.tk
  whatsappgrubchatpornxx.tk
  whatsappgrubjoinfreefire02.bole77.ml
+whatsappgrubmabarfreefire2k21.duckdns.org
  whatsappgrubrendyrangerteam333.popy88.cf
  whatsappgruop-join.bimtod92.my.id
  whatsappgrup-02.wa-joiin.com
@@ -279301,6 +278817,7 @@ whenim81.com
  wheningoldcoast.com
  whenjessgrowsup.com
  whenliesbecomethetruth.com
+whensmyweeding.com
  whente.work
  whenvideoup.thestableplace2content.pro
  wherdent.com
@@ -279448,6 +278965,7 @@ whtsapxnnx162.dynamic-dns.net
  whtsapxnnxx.jetos.com
  whtsaztjaiauztaywnekaiauztztqhqkaozoxndbdjd.000webhostapp.com
  whtsppgrupsharemom.tk
+whtsppu95.duckdns.org
  whtssapp.ga
  whtssapp.gq
  whtssapp.ml
@@ -279553,7 +279071,6 @@ wijdoenbeter.be
  wijgaanscheiden.com
  wijlgatzwinfrxrudxhjskwyll-dot-gleowayel400503.uc.r.appspot.com
  wikalen.co.za
-wikanajsaks.wikaba.com
  wiki.alonsofontanero.com
  wikiarch.cz
  wikidara.com
@@ -279636,6 +279153,7 @@ wildcard.mezcalunion.com
  wildcard.mls-d2-f4-sdd.com
  wildcard.mms-c4d-2w3.com
  wildcard.motakalim.com
+wildcard.nabalifares.ps
  wildcard.newsmedia77.com
  wildcard.oidjwoidj84.com
  wildcard.pawsaccesories.com
@@ -279920,6 +279438,7 @@ winnabownc.buzz
  winncann.com
  winner-capital.com
  winner.com-ae.club
+winnerclaimscash.com
  winnerletters.com
  winnersinternationalgroup.in
  winnersmind.co.za
@@ -280475,7 +279994,6 @@ woodworkersolution.com
  woodworkingdm.com
  woodworkingeasytools.ml
  woodworkingreview.net
-woodworkrange.buzz
  woodworks.buzz
  woodymgmt.com
  woodysportsbar.com
@@ -280521,7 +280039,6 @@ wordpresssetstraight.com
  wordpubg.com
  wordsgrowere.com
  wordsyouwant.com
-wordtruck.guru
  work.digitalvichar.com
  work.jonwillchambers.co.uk
  work01fb01.my.id
@@ -280571,6 +280088,7 @@ workplacelending.com
  workplacesynergies.in
  workprotocoles-com.webs.com
  workpump.com
+workshop.arceliotivane.com
  workshop4linkedin.m050c212.c040jp9933.info
  workshopstl.com
  worksitehealthsolutions.org
@@ -280688,7 +280206,6 @@ wotdancenow.com
  wotheraz.com
  wotnoh.security-operations-center.de
  wotreplay-wg.ru
-woudesteinwnl.ru
  wouldnotchange.tk
  woutloo3-very9.xyz
  wovukhbwqlpscifsbjizrozvmi-dot-gleowayel400503.uc.r.appspot.com
@@ -280728,6 +280245,7 @@ wp.moon.ponstars.crc-it.nl
  wp.murabaat.com
  wp.osmangony.info
  wp.quercus.palustris.dk
+wp.readhere.in
  wp.regalporn.com
  wp.richardhyettlawyernotary.com
  wp.rifki.net
@@ -280857,7 +280375,6 @@ writabeats.com
  writec.ca
  writefb.000webhostapp.com
  writersjunction.net
-writersoil.cyou
  writesofpassage.co.za
  writhestampcrab.com
  writicism.xyz
@@ -280866,9 +280383,11 @@ writingfromling.live
  writinginstrument.co.uk
  writingpup.com
  writions.xyz
+writtendeer.com
  wriuzjxasbgdzfzlcgbbgfvycylsloylvzyw-dot-cedar-code-289917.nn.r.appspot.com
  wrjctzbnvbbzsbmnynnmzocloj-dot-gleowayel400503.uc.r.appspot.com
  wrk44.ddns.net
+wrkmvztxeivqccbn.com
  wrkngspam.ooguy.com
  wrkngspamcasacam.net.eventml.my.id
  wrkngspm01.ooguy.com
@@ -281913,7 +281432,6 @@ x6d3f.jaysbrand.com
  x6g9s.addroits.com
  x6h6kg1si0n3xu1c0k95eqwt8fcj3udv8p6v7cjifwawh8iri.pastoraldomenor.org.br
  x6qz2.addroits.com
-x6r.top
  x7-d.jaysbrand.com
  x71h0.addroits.com
  x74y.mentriqq.com
@@ -282628,6 +282146,7 @@ xn--80abir6dhvwq.xn--p1ai
  xn--80abnk0a8a0ga.xn--p1ai
  xn--80ac2add4bf6di.xn--p1ai
  xn--80aceg5a5a4c9b0a.xn--p1ai
+xn--80ada4a9b0b2ae.xn--p1ai
  xn--80adafaiy2bcy.xn--p1acf
  xn--80adegn0adoige0a.xn--p1ai
  xn--80adg3b.net
@@ -282639,7 +282158,6 @@ xn--80aihh4bh0a.xn--p1ai
  xn--80aj7ad0cnlv.xn--p1ai
  xn--80ajahcbcdpeycafhi6j5d.xn--p1ai
  xn--80ajcz5a1dp.xn--p1ai
-xn--80ajgx5cc.xn--p1ai
  xn--80akackgdchp7bcf0au.xn--p1ai
  xn--80akinnkiib6h.xn--90ais
  xn--80al0adb1gd.xn--p1ai
@@ -282653,11 +282171,11 @@ xn--90abhg7daa2h.xn--p1ai
  xn--90acbjm3dvb4b.xn--p1ai
  xn--90achbqoo0ahef9czcb.xn--p1ai
  xn--90afdnal1aqq.xn--p1ai
+xn--90afg0e8a.xn--p1ai
  xn--90ai2a4agsih.xn--p1ai
  xn--90aklxb0b3b.xn--p1ai
  xn--90atja9g.xn--p1ai
  xn--90avpa.xn--p1ai
-xn--abcdelossueos-skb.com.ar
  xn--accweb-muv-desjardns-s9c36d.com
  xn--acsso-pagseguro-cnb.com
  xn--altnoran-vkb.com.tr
@@ -282670,16 +282188,14 @@ xn--b1afbbs3ar0b.xn--p1ai
  xn--b1agpzh0e.xn--80adxhks
  xn--b1ahs9dfg.xn--p1ai
  xn--b1ai0aj8aya.xn--p1ai
-xn--b1ai3ab5aw.xn--p1ai
-xn--b1ai6acth0boh.xn--p1ai
  xn--b1ak2a1a3a.xn--p1ai
  xn--b1alaggrfb0ah6h.xn--p1ai
  xn--b1amjbe6ij.xn--p1ai
  xn--b1amvejg.com
  xn--b1anip5db.xn--p1ai
  xn--b1aqffhy.xn--p1ai
+xn--b1asfjl3bo7c.xn--p1ai
  xn--b1asjc5a0d.xn--p1ai
-xn--b1aydf5ec.xn--p1ai
  xn--bakofamerica-3t1f.la
  xn--bakofamrica-49a5i.net
  xn--bancoita-v5a.com
@@ -282700,7 +282216,6 @@ xn--bnkofmerc-qcbee85c.vg
  xn--bnkofmeric-j9c424eea.ph
  xn--bobleslring-g9a.dk
  xn--borsaliman-6ub.com
-xn--boxbrry-uya.com
  xn--bstchange-03a.net
  xn--bstchange-v4a.net
  xn--bstchange-vf7d.com
@@ -282736,7 +282251,6 @@ xn--e1aceh5b.xn--p1acf
  xn--e1adigbdjz5k.xn--p1ai
  xn--e1afilellcz.xn--p1ai
  xn--e1agci3ay4bqr.xn--p1ai
-xn--e1ajit4c.xn--p1ai
  xn--e1amnbw.xn--p1ai
  xn--efaktygwat-i0b.pl
  xn--elctrum-u8a.com
@@ -282758,8 +282272,7 @@ xn--fn-kka.no
  xn--fnsterputssollentuna-39b.se
  xn--foxbt-wsa.com
  xn--g1aasaw1dza.xn--p1ai
-xn--g1acbc6dia0dc.xn--p1ai
-xn--g1agj5adzp.xn--p1ai
+xn--g1agdb6c9a.xn--p1ai
  xn--gmal-sya.com
  xn--google-analytcs-xpb.com
  xn--grupbnclmbi-o7ag7veb.com
@@ -282835,6 +282348,7 @@ xn--onetgwat-dpb.waw.pl
  xn--onetmesecret-vfb.com
  xn--organikdkkan-klb.com
  xn--orw0a8690a.com
+xn--p1aaofthhoc.xn--p1ai
  xn--pacincia-xl-qbb.com
  xn--pof-5icbb.gq
  xn--polimerbizmimarlk-rvc.com
@@ -282912,7 +282426,6 @@ xn--viajarconnios-skb.com.uy
  xn--vrftet-pua.biz
  xn--wellness-rhn-fjb.de
  xn--wlq44nxt1aboc.com
-xn--www-bmobnk-lj3e.com
  xn--www-xodus-e4a.io
  xn--zelokul-80a.com
  xn-amazon.de
@@ -283425,7 +282938,6 @@ xxxxxzwa.kali-shop.ru
  xxxyyzz21.xyz
  xxxze.co.nu
  xxyfit.xyz
-xxyhub.xyz
  xxylpt.com
  xxynow.xyz
  xxypro.xyz
@@ -283810,6 +283322,7 @@ yahooverificatiom.weebly.com
  yahooverification0.weebly.com
  yahooverificationatt.weebly.com
  yahooverificationupdateservice.weebly.com
+yahooviewweb.weebly.com
  yahoowebmailing.weebly.com
  yahoowebpagemailupdatingservice.weebly.com
  yahoowebservices.weebly.com
@@ -283910,7 +283423,6 @@ yanji.06wi.com
  yanji.yfqzdfd.com
  yankeefanblogs.com
  yanlipin.net
-yann-decoration.fr
  yanniff.000webhostapp.com
  yannigeorgasteam.com
  yannmagallon-graphiste.fr
@@ -284475,7 +283987,6 @@ ymdnbrktxd.top
  ymehgo.com
  ymep.svcoding.com
  ymevobec.gikorip.net
-ymgawimhjnizyhjyifrpsyfuuj-dot-gleow2021ja.ue.r.appspot.com
  ymgsaaqlxoncugioleuyyuyujf-dot-gleowayel400503.uc.r.appspot.com
  ymhdexakiby.gikorip.net
  ymhsptcffopjulmyarrlvwupih-dot-gleowayel400503.uc.r.appspot.com
@@ -284705,7 +284216,6 @@ youqudeshi.com.cn
  your-3id.com
  your-account-apple-hass-been-update.giize.com
  your-account-apple-update-111-186341718433199.com
-your-account-billinga-ddress-toverify.icu
  your-accout-locked.theworkpc.com
  your-appleidsuccespayment.com
  your-billingshpfy.com
@@ -284788,6 +284298,7 @@ yourstoresupport.ru
  yourstrulycosmetics.ca
  yoursweb.com
  yourtargetedresults.com
+yourtopdog.com.au
  yourtpfvk.com
  yourtravelkg.com
  yourtube.site
@@ -284798,13 +284309,13 @@ youryahoostore.weebly.com
  yousay.site
  youseevideos.xyz
  yousefalharbi.ddns.net
+yousefmetany.com
  youssef-amrani.ma
  youssef123456.ddns.net
  youstamptitle.club
  youstore21.com
  yousubmis.restartrakuten.xyz
  youtbook.xyz
-youthful-spence-ca0d09.netlify.app
  youthguarantee.org.cy
  youthindiaassociation.com
  youthmessage.guru
@@ -285104,6 +284615,7 @@ yummy-shine-decade.glitch.me
  yummydoughcom.nckithailand.gdn
  yummyfoodblog.net
  yummysli.ocry.com
+yummyyogaudaipur.com
  yumrate.com
  yumsxk.dermals.org
  yumurtasiorganikkoy.com
@@ -285187,6 +284699,7 @@ yvyoy27iom9.sinicambyjohnshaven.com
  yw.yiyousf.com
  yw0210.shaxiaadvertising.top
  yw0321.shaxiarates.top
+yw120.net
  yw6zznixrjgm6jomj8gs.oidjwoidj84.com
  ywabigbyqqjwsryuetgqevqwcujdwkkbptra-dot-gl494903049.wl.r.appspot.com
  ywaetdshgx.duckdns.org
@@ -285301,6 +284814,7 @@ yzdpharmacy.com
  yzf-r250.co.cc
  yzfeckpmv.goruli.com
  yzfzxgs.gzwsjc.com
+yzhu.georgetown.domains
  yzkh.awaykart.com
  yzlangfeng.com
  yzmwh.com
@@ -285338,6 +284852,7 @@ z.89fk.top
  z.r2dd.com
  z.snprobbx.pbz.r.de.a2ip.ru
  z.ysshj.cn
+z.zz.ht
  z0dbg.mentriqq.com
  z0e9d.awaykart.com
  z0v0r3se0vsv.top
@@ -285426,6 +284941,7 @@ zaebalzaebal1.com
  zaferaniyehcenter.com
  zaffronmart.com
  zaginiona24.eu
+zaginiony-24.eu
  zaglosuj-dzisiaj.eu
  zaglosuj-kliknij.eu
  zaglosuj-teraz.eu
@@ -285613,6 +285129,7 @@ zapooi.cf
  zappingtv76.000webhostapp.com
  zapps.in
  zapslskk.tk
+zaqkpdupebawzglklwsexyktyz-dot-gleow2021ja.ue.r.appspot.com
  zaqta-71.tk
  zaqwsxcde.sportsontheweb.net
  zara-shops.ru
@@ -285700,8 +285217,6 @@ zbyk.drl.pl
  zbyk.mentriqq.com
  zbzppbwqmm.biz
  zc-d.addroits.com
-zc21.org
-zc22.org
  zcard.pro
  zcb.hsdgk.cn
  zcbsj.xyz
diff --git a/blacklists/malware/urls b/blacklists/malware/urls

index aa584407ec2a2b8fefe1c68106f496dbb5e4530e..cda994cb3963a60e1f4bddb97cb197ce4f1cf83e 100644 (file)
--- a/blacklists/malware/urls
+++ b/blacklists/malware/urls
@@ -1,350 +1,35 @@
-0ad8b925.ithemeshosting.com.php73-39.lan3-1.websitetestlink.com/secured.mpp/mpp/signin/61e2/websrc
  0i.is/7Tr9
  0i.is/CpAq
  0i.is/IqWc
-103.124.104.118/bxdlmi
-103.124.104.118/eoxmkb
-103.124.104.118/ghpmuy
-103.124.104.118/lqlakm
-103.124.104.118/nxftvi
-103.124.104.118/qokcon
-103.124.104.118/rlrtqe
-103.124.104.118/rysypg
-103.124.104.118/uybnji
-103.124.104.118/vvahia
-103.124.104.118/wkomqp
-103.124.104.118/yeansn
-103.124.104.118/yuwenb
-103.124.106.203/cof4/inst.exe
-107.173.219.2/regasm/khj.doc
-107.173.219.2/regasm/reg.exe
-108.190.201.37/.i
-109.193.235.70/.i
-115.73.14.102/.i
-118.99.183.235/.i
-121.154.84.91/.i
-122.165.171.31/.i
-123.195.184.77/.i
  123formbuilder.com/form-5559915/microsoft-team
  123formbuilder.com/form-5580797
-13.211.115.239/view-signin.php
-134.255.62.138/.i
-14.102.26.201/.i
-14.188.233.243/.i
-154.223.166.124/53
-163.172.226.76/Anti_Bins/Antisocial.arm
-163.172.226.76/Anti_Bins/Antisocial.arm5
-163.172.226.76/Anti_Bins/Antisocial.arm6
-163.172.226.76/Anti_Bins/Antisocial.arm7
-163.172.226.76/Anti_Bins/Antisocial.m68k
-163.172.226.76/Anti_Bins/Antisocial.mips
-163.172.226.76/Anti_Bins/Antisocial.mpsl
-163.172.226.76/Anti_Bins/Antisocial.ppc
-163.172.226.76/Anti_Bins/Antisocial.sh4
-163.172.226.76/Anti_Bins/Antisocial.x86
-172.245.26.136/vbc/document.doc
-172.245.26.136/vbc/vbc.exe
-172.245.52.102/SBIDIOT/arm
-172.245.52.102/SBIDIOT/arm6
-172.245.52.102/SBIDIOT/arm7
-172.245.52.102/SBIDIOT/mips
-172.245.52.102/SBIDIOT/mpsl
-172.245.52.102/SBIDIOT/ppc
-172.245.52.102/SBIDIOT/x86
-172.245.52.102/mips
-172.86.75.206/arm
-172.86.75.206/arm5
-172.86.75.206/arm6
-172.86.75.206/arm7
-172.86.75.206/mips
-172.86.75.206/x86_64
-173.175.91.75/.i
-176.111.174.14/1.exe
-176.111.174.14/ER.exe
-176.111.174.14/cr.exe
-176.111.174.67/7Ndd3SnW/plugins/cred.dll
-176.111.174.67/7Ndd3SnW/plugins/scr.dll
-176.123.9.211/BidenisabitchFndp/deathtrump.arm
-176.123.9.211/BidenisabitchFndp/deathtrump.arm7
-176.240.84.106/.i
-178.117.233.13/.i
-179.159.58.134/.i
-180.218.161.74/.i
-185.161.211.58/Maly%20nanocre%202021_RbDlvErWAV133.bin
-185.161.211.58/Mekino_nanocore_rIfno101.bin
-185.215.113.23/4dcYcWsw3/plugins/cred.dll
-185.215.113.23/4dcYcWsw3/plugins/scr.dll
-185.55.1.182/.i
-188.152.41.141/.i
-189.79.110.214/.i
-192.210.239.10/a-r.m-4.GHOUL
-192.210.239.10/a-r.m-5.GHOUL
-192.210.239.10/a-r.m-6.GHOUL
-192.210.239.10/a-r.m-7.GHOUL
-192.210.239.10/i-5.8-6.GHOUL
-192.210.239.10/m-6.8-k.GHOUL
-192.210.239.10/m-i.p-s.GHOUL
-192.210.239.10/m-p.s-l.GHOUL
-192.210.239.10/p-p.c-.GHOUL
-192.210.239.10/s-h.4-.GHOUL
-192.210.239.10/x-3.2-.GHOUL
-193.239.147.165/os/eso.exe
-193.239.147.165/os/io.exe
-193.239.147.165/os/o.exe
-193.239.147.165/os/ssx.exe
-193.239.147.165/os/sz.exe
-195.201.83.120/m.txt
-195.62.53.96/bot.aarch64
-195.62.53.96/bot.arm5
-195.62.53.96/bot.arm7
+185.239.242.35/Fierce.arm4
+185.239.242.35/Fierce.mips
  1drv.ms/xs/s
-2.57.122.22/cbr.arm
-2.57.122.22/cbr.arm7
-2.86.205.82/.i
-20.43.16.199/Finance/bmo-mobile/
-20.43.16.199/Finance/mobilesco
-20.43.16.199/Finance/mobilesco/mfaAuth.html
-20.43.16.199/Finance/tang
-201.124.72.36/.i
-201.145.147.14/.i
-201.218.97.142/.i
-209.141.35.205/a-r.m-4.Fourloko
-209.141.35.205/a-r.m-5.Fourloko
-209.141.35.205/a-r.m-6.Fourloko
-209.141.35.205/a-r.m-7.Fourloko
-209.141.35.205/i-5.8-6.Fourloko
-209.141.35.205/m-6.8-k.Fourloko
-209.141.35.205/m-i.p-s.Fourloko
-209.141.35.205/m-p.s-l.Fourloko
-209.141.35.205/p-p.c-.Fourloko
-209.141.35.205/s-h.4-.Fourloko
-209.141.35.205/x-3.2-.Fourloko
-209.141.35.205/x-8.6-.Fourloko
-213.240.218.15/.i
-222.211.72.66/CXDBDL.dll
-23.226.166.120/.i
-2amaz2k3y3sygvtpcfsi3yodqe-adwhj77lcyoafdy-www-paypal-com.translate.goog/us/home
-31.168.94.16/.i
-32792.prolocksmithwinterpark.com/w4cvjov.rar
-360down7.miiyun.cn/2017/06/radbxnzdxbd.exe
-37.72.172.10/bins/sora.arm
-37.72.172.10/bins/sora.arm5
-37.72.172.10/bins/sora.arm6
-37.72.172.10/bins/sora.m68k
-37.72.172.10/bins/sora.mpsl
-37.72.172.10/bins/sora.ppc
-37.72.172.10/bins/sora.sh4
-37.72.172.10/bins/sora.x86
-39.113.245.254/.i
-3bd5841b.guidiroberto.com/fr/
-40.69.98.102/Finance/bmo-mobile
-40.69.98.102/Finance/simplii
-40.69.98.102/Finance/simplii/index.php
-40.69.98.102/Finance/tang
-40.69.98.102/Finance/tang/antibot.php
-40.69.98.102/Finance/tang/index.php
-40.69.99.254/Finance/bmo-mobile
-40.69.99.254/Finance/bmo-mobile/
-40.69.99.254/Finance/bmo-mobile/myonportal.php
-40.69.99.254/Finance/simplii
-40.69.99.254/Finance/simplii/index.php
-40.69.99.254/Finance/tang
-40.69.99.254/Finance/tang/
-40.69.99.254/Finance/tang/antibot.php
-40.85.225.15/Finance/simplii
-40.85.225.15/Finance/simplii/index.php
-40.85.225.15/Finance/tang
-40.85.225.15/Finance/tang/antibot.php
-40.85.225.15/Finance/tang/index.php
-45.14.148.234/arc
-45.14.148.234/arm
-45.14.148.234/arm5
-45.14.148.234/arm6
-45.14.148.234/arm7
-45.14.148.234/i586
-45.14.148.234/i686
-45.14.148.234/mips
-45.14.148.234/mipsel
-45.14.148.234/sh4
-45.14.148.234/x86_64
-45.145.185.100/0x83911d24Fx.sh
-45.153.203.134/FL.bin
-45.153.203.134/NT.bin
-45.153.203.134/as.exe
-45.153.203.149/lx/apep.arm
-45.153.203.149/lx/apep.arm5
-45.153.203.149/lx/apep.arm6
-45.153.203.149/lx/apep.arm7
-45.153.203.149/lx/apep.m68k
-45.153.203.149/lx/apep.mips
-45.153.203.149/lx/apep.mpsl
-45.153.203.149/lx/apep.ppc
-45.153.203.149/lx/apep.x86
-45.153.203.219/uwu/arm
-45.153.203.219/uwu/arm5
-45.153.203.219/uwu/arm6
-45.153.203.219/uwu/arm7
-45.153.203.219/uwu/m68k
-45.153.203.219/uwu/mips
-45.153.203.219/uwu/mpsl
-45.153.203.219/uwu/ppc
-45.153.203.219/uwu/sh4
-45.153.203.219/uwu/x86
-45.162.146.187/.i
-45.95.169.213/armv4l
-45.95.169.213/armv6l
-45.95.169.213/armv7l
-45.95.169.213/i586
-45.95.169.213/i686
-45.95.169.213/m68k
-45.95.169.213/mips
-45.95.169.213/mipsel
-45.95.169.213/powerpc
-45.95.169.213/sh4
-45.95.169.213/sparc
-45.95.169.213/x86
-46.214.27.4/.i
-49.142.162.113/.i
-49.159.20.121/.i
-5.180.211.73/bins/sora.arm
-5.180.211.73/bins/sora.arm5
-5.180.211.73/bins/sora.arm6
-5.180.211.73/bins/sora.arm7
-5.180.211.73/bins/sora.m68k
-5.180.211.73/bins/sora.mips
-5.180.211.73/bins/sora.mpsl
-5.180.211.73/bins/sora.ppc
-5.180.211.73/bins/sora.sh4
-5.180.211.73/bins/sora.x86
-50.115.174.102/apache2
-50.115.174.102/bash
-50.115.174.102/cron
-50.115.174.102/ftp
-50.115.174.102/ntpd
-50.115.174.102/openssh
-50.115.174.102/pftp
-50.115.174.102/sh
-50.115.174.102/sshd
-50.115.174.102/tftp
-50.115.174.102/wget
-51.68.222.90/Primitive--x--Kaiten.arm4
-51.68.222.90/Primitive--x--Kaiten.arm5
-51.68.222.90/Primitive--x--Kaiten.arm6
-51.68.222.90/Primitive--x--Kaiten.arm7
-51.68.222.90/Primitive--x--Kaiten.mips
-51.68.222.90/Primitive--x--Kaiten.mpsl
-51.68.222.90/Primitive--x--Kaiten.ppc
-51.68.222.90/Primitive--x--Kaiten.sparc
-51.68.222.90/Primitive--x--Kaiten.x86
-52.139.39.141/Finance/simplii
-52.139.39.141/Finance/simplii/index.php
-52.139.39.141/Finance/tang
-52.139.39.141/Finance/tang/antibot.php
-52.139.39.141/Finance/tang/index.php
-52.229.120.193/Finance/bmo-mobile/
-52.229.120.193/Finance/simplii
-52.229.120.193/Finance/simplii/index.php
-52.229.120.193/Finance/tang
-52.229.120.193/Finance/tang/antibot.php
-52.229.120.193/Finance/tang/index.php
+36.231.35.30/.i
+45.14.149.228/arm7
+45.14.149.228/bins/jew.m68k
  54.36.180.122/aria2c.exe
-54.36.180.122/data/rsumerge.exe
  54.36.180.122/nya_patcher.exe
  54.36.180.122/rsumerge.exe
-61.70.132.86/.i
-62.219.138.44/.i
-65.0.173.107/slaves/hinatasocute.arm
-65.0.173.107/slaves/hinatasocute.arm5
-65.0.173.107/slaves/hinatasocute.arm6
-65.0.173.107/slaves/hinatasocute.m68k
-65.0.173.107/slaves/hinatasocute.mips
-65.0.173.107/slaves/hinatasocute.mpsl
-65.0.173.107/slaves/hinatasocute.ppc
-65.0.173.107/slaves/hinatasocute.sh4
-65.0.173.107/slaves/hinatasocute.x86
-68.132.130.227/.i
-6hhymaxeqmv5w5xyogt2tyl33e--www-paypal-com.translate.goog/us/home
-73.204.216.103/.i
-85.96.176.172/.i
-88.218.227.201/x01/arm
-88.218.227.201/x01/arm5
-88.218.227.201/x01/arm6
-88.218.227.201/x01/arm7
-88.218.227.201/x01/mips
-88.218.227.201/x01/mpsl
-88.218.227.201/x01/ppc
-88.218.227.201/x01/x86
-88.248.51.139/.i
-91.212.150.4/gonu.exe
-95.214.52.33/i586
-95.214.52.33/i686
-95.214.52.33/m68k
-95.214.52.33/mips
-95.214.52.33/mipsel
-95.214.52.33/sh4
-95.214.52.33/sparc
-95.214.52.33/x86
-a.guidiroberto.com/SWZKYmI3VlFUVko1Nzc2OU5YUEtYQT09/
-about-appeal-form.com/copyright/
  abre.ai/as0p
  abre.ai/bLoA
  abre.ai/caixacx
  abre.ai/seguranca-app
-account.rakuten.co.jp-weo9fhwe89rhw.com/rms/nid/loginfwdi
-aceeprc.com.aceeprc.com/q54njs.rar
-adventureexplorer.in/xjbnf2a.zip
-afrimedspecialist.com/zxfenbo.tar
-agenciadigitalwdys.com/qwc634.tar
-ajpharmaholding.com/vie16wr3f.rar
-akassohdemo.ci/iconso/controlleurs/my.dhl-com/my.dhl-com/
-aksfleet.com/mailbox/cpsess0757610916/
-alasdemariposas.org/nagap1et.tar
-alert-delete-payee.com/lloyds
-alert-delete-payee.com/lloyds/Login.php
-aliceflorist.com/themes/wellsfargo/
-allgreenart.be/ey51gr0gy.tar
  allowcopy.com/open
  allowcopy.com/open/
  alturl.com/tdhf4
-amarresdeamorymaestroshechiceros.com/dpwxmx9.zip
-amos524.org/ey3u200l2.rar
  ams3.digitaloceanspaces.com/ams1
  ams3.digitaloceanspaces.com/ams1/click.html
  ams3.digitaloceanspaces.com/newvm
  ams3.digitaloceanspaces.com/newvm/index.html
-andreshconcejal.solucioneslink.com/l22i0mpf.tar
  angelfire.com/games/gamez3
  angelfire.com/games/gamez3/facebook.htm
-aniaman.com/hea.co.nz/Drive
  anon.to/H2jGQ0
  anon.to/uRnAyx
-answertounlock.com/1727
-antenadigital.antenascuritiba.net.br/f05xj3.zip
-ap7zr1ce6xlwqzucomtuxnhrormvicnvhcnkymdix.filesusr.com/html
-ap7zr1ce6xlwqzucomtuxnhrormvicnvhcnkymdix.filesusr.com/html/6db5d6_e8dfaa83226a4f98308464d5e2efa6a6.html
-appelesuportt.com/2/4-72
-aptservicios.com.mx/.well-known/switzerland/De/
-arcadistribuidorasc.com.br/nrrz2i0qs.rar
-atlasconcreteworks.com/dgcivv7mk.zip
-avdivorcelawyers.com/auth/
-bamendauniversity.com/kl/janomo_HLTtwjhO149.bin
-banderu.us/rdp.exe
-banksblue.com/f2ww1ghen.tar
-baotuoiteen.net/cgi-bin
-baotuoiteen.net/cgi-bin/il2.php
-bcmt.elin.co.za/t5iivue.zip
-beautincollagen.rs/jp6jr63.zip
-bestcarenepal.com/n1q4lmdv.rar
-beveragesmiami.solucioneslink.com/swx0m2.rar
-billetterie.angers-sco.dspsport.com/Dsp/web/site/packages/Payment
-billetterie.angers-sco.dspsport.com/Dsp/web/site/packages/Payment/info3Dsecure.htm
-billing.rahitechnosoft.com/xu0v344.tar
-binoy.stalphonsamissionva.org/hy2y6t.tar
  biolinky.co/legendarycontract
  biolinky.co/luckyxspin
  biolinky.co/tencentmetro
-birdi.elin.co.za/pxyvskq.zip
-birdi.elin.co.za/zdp389o.rar
  bit.do/EN9NET
  bit.do/Help-Recovery-Page
  bit.do/Hiosene
@@ -456,7 +141,6 @@ bit.ly/2J0gybv
  bit.ly/2Jkx7vI
  bit.ly/2MPKgOT
  bit.ly/2N1bVA5
-bit.ly/2N20cBr
  bit.ly/2NFJdSk
  bit.ly/2O8mtdK
  bit.ly/2OF4njD
@@ -526,6 +210,7 @@ bit.ly/36VRD0I
  bit.ly/36fGMQv
  bit.ly/36g7SoG
  bit.ly/36wCTos
+bit.ly/37ahuDc
  bit.ly/38Xmo4D
  bit.ly/38iiI0y
  bit.ly/38p7HqJ
@@ -537,7 +222,6 @@ bit.ly/3aLThC9
  bit.ly/3aOIEPT
  bit.ly/3aS6b36
  bit.ly/3aiQ9yX
-bit.ly/3b48FMj
  bit.ly/3b8sOAs
  bit.ly/3bhoSgj
  bit.ly/3bjrj1Q
@@ -624,6 +308,10 @@ bitbucket.org/clipdiary/clipdiary/downloads/clipdiary.exe
  bitbucket.org/fiarbot/fairbot/downloads/fairbot.exe
  bitbucket.org/jessypinkman/bsplayer/downloads/BSPlayer.exe
  bitbucket.org/listary/listary/downloads/Listary.exe
+bitbucket.org/mminminminmin05/testtest/downloads/flesh.exe
+bitbucket.org/mminminminmin05/testtest/downloads/instaler.exe
+bitbucket.org/mminminminmin05/testtest/downloads/installer.exe
+bitbucket.org/mminminminmin05/testtest/downloads/jayson.exe
  bitbucket.org/tanake5518/fi/downloads/1_cr.txt
  bitbucket.org/tanake5518/fi/downloads/Symptomaticshon5.exe
  bitbucket.org/tanake5518/fi/downloads/attached.txt
@@ -643,53 +331,17 @@ bitly.com/3kXAhXj
  bitly.com/3oFHKMQ
  bitly.com/3p4HWWh
  bitly.com/PAYPAL-LOGIN-IL
-blockchain-contactinfo.com/bingoo
-blockchain-contactinfo.com/bingoo/
-blockchain-contactinfo.com/bingoo/signin.php
-blockchain-contactinfo.com/nuance
-blockchain-contactinfo.com/nuance/nuanceChat.html
-blog.daraisolty.com/ntny3f.tar
-blueribbons.org/content/pyta
-browardinsurancemiami.solucioneslink.com/fmb5fkc9r.tar
-bt2.elin.co.za/y97rgl89g.rar
-bulksms.xava.co.in/hcsb55qhf.zip
-buscascolegios.diit.cl/txs9e9.zip
  cakeurl.com/sw3zY
-cambriacalvary.org/boa/boa/boa
-cambriacalvary.org/boa/boa/boa/verifyemail.html
-cambriacalvary.org/boa/boa/boa/verifyidentity.html
-cancer.educandome.co/hwzemy2gf.zip
  capesandbox.com/file/sample/2582/8729e52104ec08ca7002b217c42c3ec12262badbb3f11faaab1829eba505c3cb
-castlecast.us-south.cf.appdomain.cloud/file/redirect/
-cavalcantiparticipacoes.com.br/iq76v84.rar
  cdn.discordapp.com/attachments/680977014139650072/681241009618681896/n.exe
-cdnlogin-netfliilxvhost150645.lowhost.ru/es/par/acceso-clientes.php
-cdwdubai.com/bdq06u.zip
-cec.asso.ac-amiens.fr/images/lcibbrryy.png
-charutaplus.com/srhly3h.rar
-chasebankupdateverification.onlineupdateservice.com.ng/Chase/home/
-chasebankupdateverification.onlineupdateservice.com.ng/Chase/home/auth/
-chemlab.com.my/mgonb4.tar
-christeyns-bg.eu/kapaz/repl/gopz/werp/ES5O6bTiJMX1I24.exe
-cleanlaptop.ru/chashepro3.exe
-cleanscope.com.au/sps1ky2.zip
-coachboom.mhtechnologies.us/cpwjurqt.zip
-cofisconconsultoria.com.br/w719x9.rar
-commcache.com/support/
-consulateins.solucioneslink.com/ibc8sr.tar
-content.codencil.com/mwnjpm.tar
-cooltaillights.com/forsale/EBAY/Ebay_files/_vti_cnf/image038.exe
-coopbenecun.com.co/f0nuq5.zip
-corinne-soland.ch/Wordpress/ncca
-corinne-soland.ch/Wordpress/ncca/mnic.php
+cdn.discordapp.com/attachments/804088489854369795/810984346428899328/Qescymij.exe
+cdn.discordapp.com/attachments/807580932323278865/810461956971823124/eba_meb.apk
  cort.as/-FgvH
  cpbild.co/c6d466d
-cubescargoexpress.com/sd2iz5vxl.tar
-customer-services43.dynamic-dns.net/M&T
-customer-services43.dynamic-dns.net/M&T/
-customer-services43.dynamic-dns.net/M&T/login.php
  cutt.ly/6kBj81c/
+cutt.ly/Ik185Yp/
  cutt.ly/QiCMqtb
+cutt.ly/QkNeNjL/
  cutt.ly/SsyhHnk
  cutt.ly/SyhM3BP
  cutt.ly/ViXGZKL
@@ -698,51 +350,13 @@ cutt.ly/WgAU6fN
  cutt.ly/_BCP
  cutt.ly/actualizarbcp
  cutt.ly/ldTGuAB
-cutt.ly/pkVjtk7/
  cutt.ly/tsqb6ai
  cutt.ly/vsqbVMI
  cutt.us/9WNKq
  cutt.us/X41CC
  cutt.us/rHqRx
  cyw.pe.kr/images/baba/Alibaba.com/Alibaba.com/Alibaba.co.uk/35c2f42de3a745af1c74bd8fc03250ad
-daglork.com/origin-wm-bin_IfYlLvTpt119.bin
-danaevara.com/d9it9p.rar
-ded5346.inmotionhosting.com/~bc8a2e5/a/amazonV1/amazon/
-dedotinteriors.com/rocp5r64z.rar
-deigratia2.elin.co.za/gqb529x.zip
-delivery-uk-support.help/RoyalMail
-delivery-uk-support.help/RoyalMail/loading.php
-delivery-uk-support.help/RoyalMail/secure.php
-delivery-uk-support.help/RoyalMail/user.php
-delivery-uk-support.help/RoyalMail/verifylogin.php
-demo-cliente.mindcreative.com.br/zixzerzy.rar
-demo.firstframework.net/.well-known/pki-validation/b/1f815340df0907b57254b4130aa0aec3/
-demo.maxsence.co.in/oi1u13vh.tar
-dent-estet.com/meppur.tar
-dfsfcsfcdsfsdvcfsvcscv.com/Ledger/Output.exe
-dhl-service-client.azurewebsites.net/Package/DHL/Account/Informaions/ddcb5d4ed9f703b40877efdee3e48773
-dhl-service-client.azurewebsites.net/Package/DHL/Account/Informaions/ddcb5d4ed9f703b40877efdee3e48773/cvv.html
-dhl-service-client.azurewebsites.net/Package/DHL/Account/Informaions/ddcb5d4ed9f703b40877efdee3e48773/info.html
-dhlgpi.com/appleid.apple.com.loginid.api.viewlogin
-dhlgpi.com/eba.
-dhlgpi.com/eba.e1saisonale-angebote-bn_7109743159.eby.desl.
-dhlgpi.com/eba.e1saisonale-angebote-bn_7109743159.eby.desllx
-dhlgpi.com/f2.
-dhlgpi.com/itemxx
-dhlgpi.com/login.icscards.opdracht
-dhlgpi.com/rno.html.
-dhlgpi.com/rno.htmlx
-dhlgpi.com/scwej
-diafir.ro/inwq2o.rar
-digitalassets.ams3.digitaloceanspaces.com/RandF/MultitimerRT.exe
-discriciones.westus2.cloudapp.azure.com/BHYU64.zip
-disnypluspage.com/99503bdd3c5a4c4671ada72d6fd81433/account
-disnypluspage.com/99503bdd3c5a4c4671ada72d6fd81433/account/billing.php
-divisordeantena.antenascuritiba.net.br/cres678.rar
-diwantrading.com/u33wx0p3y.zip
  dlvr.it/RXVbg3
-docman.orientalservices.in/klhg5ymq.zip
-docman.orientalservices.in/siopj7qv.rar
  docs.google.com/forms/d/1cftY9nPkgtssMgHl5uc070iUbDW-vRpa7sBpQQYOSCk/viewform
  docs.google.com/forms/d/1ubfTadXuGDGvTvNscAY0_f78KUm17eHjm5vf2Ltz6Hs/viewform
  docs.google.com/forms/d/e/1FAIpQLScF68Z9GTY6VGd_OJVtROggMC5gl95AoNcW27gHvVatJQfp4Q/viewform
@@ -787,48 +401,11 @@ docs.google.com/forms/d/e/1FAIpQLSfgVWY26SZ_Aumb4Tj52fkdiZr979r97zbXoy45CT7ojbzU
  docs.google.com/forms/d/e/1FAIpQLSflOWOdPVSHQxAOf0Yu5HMfUUbV1VQp2ddfltTkAYApDSsUyg/viewform
  docs.google.com/forms/d/e/1FAIpQLSflxxuI_0dV49fhRtRiIo5E1uN2RBMGgMLQI-6qGDZVNV-ZVQ/viewform
  docs.google.com/forms/d/e/1FAIpQLSfw3glHBuhrFSF4kTOw1sa_BSsYr9NBQF4RhDYAv_g6xXgPoA/viewform
-dorapresumably.com/ASB/online-FastNet-safeguard-policy/MNVNXMDFIDJIWQWQPIRFLDGKIRTJSDF/bal
-dorapresumably.com/ASB/online-FastNet-safeguard-policy/MNVNXMDFIDJIWQWQPIRFLDGKIRTJSDF/bal/
-dorapresumably.com/ASB/online-FastNet-safeguard-policy/MNVNXMDFIDJIWQWQPIRFLDGKIRTJSDF/bal/index.php
-download.panguzaoshi.cn/DaydayAlarm/DaydayAlarm-185.exe
-download.panguzaoshi.cn/zShut/zShut-194.exe
  drive.google.com/uc
  dropbox.com/l/AABy5Irzd_ji2DuiO-i5z8ZZ70_ZRnRBTLQ
  dropbox.com/l/AADF6y5O_I_uxzPM7EarhSzPUoBxa9VQXQ0
-drsha.innovativesolutions.mobi/dyh3tb9j.zip
-drupal.website2.fr/gie1gz.zip
  dwnlds.co/ab3f360
-ebay.com1.i.11itm.com/itm/2003-Chevrolet-Tahoe-LT/782635115722/u/61906281/
-ebay.com1.i.11itm.com/itm/2003-chevrolet-tahoe-lt/782635115722/u/61906281/
-ebay.negative-feedback-profile.live/Uvaa2R3VFTjY-bsrbKWLapVhs-K34XdRJq8jgW
-ebay.negative-feedback-profile.live/Uvaa2R3VFTjY-bsrbKWLapVhs-K34XdRJq8jgW/
-ebay.negative-feedback-profile.live/Uvaa2R3VFTjY-bsrbKWLapVhs-K34XdRJq8jgW/Sign_in_or_Register_eBay.php
-eby3892032.temp.swtest.ru/item-2339223
-eby3892032.temp.swtest.ru/item-2339223/login.htm
-edintraining.com/a6l77u.rar
-edmclinic5.qnotice.com/zh88olo4d.rar
-ee-billinginformation.com/EE
-ee-billingsupport-help.com/banks/online.citi.eu
-ee-billingsupport-help.com/banks/online.citi.eu/
-ee-billingsupport-help.com/banks/online.citi.eu/Login.php
-eeupdatebilling-auth-secure.com/banks/online.citi.eu/GBIPB/JSO/signon
-eeupdatebilling-auth-secure.com/banks/online.citi.eu/GBIPB/JSO/signon/DisplayUsernameSignon.html
-eluhvzt2fxwpmii4qoz7jred34--www-paypal-com.translate.goog/lu/home
-emposoft.com/Posten/No
-emposoft.com/Posten/No/index.php
-ennovate.elin.co.za/bc9xpv.rar
-ennovate.elin.co.za/qwq6hbbnt.tar
-european-wood.com/secure.png
  evernote.com/shard/s349/client/snv
-faarhanali.com/netflix/2ed12b4a2eb5ada
-faarhanali.com/netflix/2ed12b4a2eb5ada/login.php
-faks.tuturutu.eu/wes6j3tb.rar
-fanhuntersagency.com/jasmyu
-fanhuntersagency.com/jasmyu/index.php
-farmnatural.in/v6l0qu.rar
-fayrewinds.org/j/6wRkZPVzVP7jnUtsm4yoQ4hE37ToWC4ho4
-fb-livesupports.ml/contact/form/636276399721841
-fehrfinancial.com/lib/touchSwipe/INFO~dir/sms/85729e0ff4270be72345c7c181a83c4e
  firebasestorage.googleapis.com/v0/b/access439984393434430fd4c34f4.appspot.com/o
  firebasestorage.googleapis.com/v0/b/access439984393434430fd4c34f4.appspot.com/o/index.html
  firebasestorage.googleapis.com/v0/b/apps-00303000300mic.appspot.com/o
@@ -987,8 +564,6 @@ firebasestorage.googleapis.com/v0/b/woodtoday-ae8d3.appspot.com/o
  firebasestorage.googleapis.com/v0/b/woodtoday-ae8d3.appspot.com/o/index.html
  firebasestorage.googleapis.com/v0/b/workse-d507e.appspot.com/o
  firebasestorage.googleapis.com/v0/b/workse-d507e.appspot.com/o/mananayoindex.html
-fixauto.illumetechnology.com/g5bm4p.tar
-footweardirect.elin.co.za/rucd3vr8.rar
  form.elementform.com/0a4b86bcfd8d414b9fbce0329020508d45549925
  form.jotform.com/201644738915057
  form.jotform.com/202268964605057/
@@ -1003,7 +578,9 @@ forms.gle/NVnFexmawRVwWhCr6
  forms.gle/QXLX8JeufPLa3pbTA
  forms.gle/RSCdFLdsUj6rQXeF6
  forms.gle/TQseMbpmTuzYxPYj8
+forms.gle/WPpKKRh4TJcWahxX9
  forms.gle/X9QwytY9CNsj9tjn6
+forms.gle/dUh3RmB6D1uHVQLq9
  forms.gle/eMRs4MAh8ARWLAnNA
  forms.gle/evknEHhNcLqYcU7EA
  forms.gle/h2gpkwfqYEURyZfBA
@@ -1012,13 +589,7 @@ forms.gle/su3QLmquExCofMcX7
  forms.gle/uGjm1KN5rRTUdArS6
  fra1.digitaloceanspaces.com/zooms
  fra1.digitaloceanspaces.com/zooms/zoom.html
-frontlearn.co.ke/mwhyz3g.rar
-frontline-leaders.10xrewards.us/n9h2ze39.zip
-gabrielvalentin.ro/xgjhumz.zip
  gamerlaunch.com/community/users/blog/4908663/1794789
-garagelivet.se/yp1r8w2.tar
-gautaminfra.co.in/css/newinc
-gcpc.co.id.chronoscurtain.com/fh9twg.zip
  gg.gg/ElPeruPrimero
  gg.gg/auto_atendimento
  gg.gg/fwi76
@@ -1029,24 +600,10 @@ gg.gg/jgwhv
  gg.gg/lng51
  gg.gg/lnzh7
  gg.gg/ls61b
-giteletropical.com/jukxh4.tar
  github.com/instCap/nleo/raw/master/yt-conv.exe
  github.com/instCap/nleo/raw/master/yt-convE.exe
  github.com/instCap/nleo/raw/master/yt-convU.exe
-gmailqclh.ebpages.com/6403699283853312/
-gpworksinc.com/ntd7zy47.zip
-great-mind.ga/shared-doc
-great-mind.ga/shared-doc/index.php
-greekjesus.com/DHL/DHL/dhl/
-gs.monerorx.com/aa.exe
-hae-sun.com/cHFZQ
-headieschannelspending.com/haematoma/mazon/cee77/
-highlandroadcoc.com/k26unm.zip
-hkshjje111.com/mazon/c684a
-hkshjje111.com/mazon/c684a/signin.php
  holofly.eu/fwi15oz.tar
-home-die-sendungsstatus.is-a-techie.com/post
-home-die-sendungsstatus.is-a-techie.com/post/access.php
  ht.ly/10IO30qSAAi
  ht.ly/1Yzh30r1i6R
  ht.ly/2Wh830qSzga
@@ -1087,24 +644,7 @@ ht.ly/zBcg30qCsiy
  htl.li/XVTs30qzpMo
  htl.li/fjhC30pZk72
  htl.li/kL5q30q5utK
-https-lcloud.com/location
-hzz1.at/CHOFEB_ZwIyZsvW14.bin
-hzz1.at/FEBOZD_qWcUlut72.bin
-hzz1.at/rochaspa_HKRuWeae151.bin
-ib-rinne.de/js/kMTc4NWJhN2U2ZDI2NWFmYWU3NWI4YTJhZGIyYzAwZQ/myaccount/sign_in
-icloud-find-logins.live/2/6-12
-icon.shatangmu.cn/gm/6daocircle.exe
-idea-secure-login.com/3/ddg.dll
-idj.no/a2mfhn.zip
-ig-appealcopyright.com/form/
-ighelpverifieds.com/instagram/
-indiaoutdooradvertising.com/xr/xx
-industreal.pl/k1sop7x7v.rar
-infovator.com/vtjifkic.rar
-intermuner.ru/asdf/
-ipanguacu.rn.leg.br/DHL/
  iplogger.org/2KmWW5
-iranfilme.ir/jpqxr2.tar
  is.gd/CB9Ipo
  is.gd/ING1ES
  is.gd/Q3dT9l
@@ -1121,36 +661,17 @@ is.gd/uae_girls_number
  is.gd/wRd7yK
  is.gd/youappweb
  is.gd/zrYBJr
-isaac.mikhailmotoringschool.com/katn9wt.rar
  islam-guide.com/cgi-bin/goto.cgi
-it123.ru/aa/aa.exe
-itsecurityalerts.com/bank-of-america
-izu001.webredirect.org/uploud//5bab0b1d864615bab0b1d864b3/698_bin_aDVzRNx101.bin
-izu002.casacam.net/uploud//5bab0b1d864615bab0b1d864b3/822_bin_XapyvlkxM95.bin
-izu003.camdvr.org/uploud//5bab0b1d864615bab0b1d864b3/368_bin_nqKQUQn248.bin
  j.mp/2BUqTCt
  j.mp/2ZZtIeM
  j.mp/39oczg7
  j.mp/3asgxFT
-kbmovers.co.za/upload/slide
-kbmovers.co.za/upload/slide/wp-sync/webmail.php
-klobomnbvoiuopwoer.com/amzsupport
-korrectconceptservices.com/gy2fyh8.rar
-kubatoglubaklava.com.tr/o2il129j2.zip
+kalawatihomes.com/ds/1602.gif
  kutt.it/3MdFZz
  kutt.it/GZ0Eo1
  kutt.it/nZEaRO/
-lamoorespizza.com/Dropbox/dropbox/o1
-lamoorespizza.com/Dropbox/dropbox/o1/main.html
  landpage.co/a8eb4190-031d-11eb-ad8f-f2646ce6f5c7
  landpage.co/f171b772-03ff-11eb-b136-be6044770142
-lanos.in/n5i7fx.rar
-learning.real-academy.net/zvg9gcd.zip
-lifebeam.elin.co.za/c57vb3975.tar
-lifeimprovementmedia.com/huntington/
-lifeimprovementmedia.com/huntington/card-plus/banke
-lifeimprovementmedia.com/huntington/card-plus/banke/oath.php
-lightofgod.otticagrilli.com/lightofgod/
  linktr.ee/Blkg7
  linktr.ee/FREESKINSLEGENDARY
  linktr.ee/PUBG.MOBILE.SEASON.15
@@ -1166,84 +687,16 @@ linktr.ee/amemuito
  linktr.ee/pubglukyspinevent.com
  litelink.at/Cartao_Carrefour
  litelink.at/cartaoatacadao2020
-littleblacktheatre.com/excel/3/oauth2/authorize/files
-littleblacktheatre.com/excel/3/oauth2/authorize/files/621ffa813.
-littleblacktheatre.com/excel/3/oauth2/authorize/files/9b0fcf9e9.
-littleblacktheatre.com/excel/3/oauth2/authorize/files/9b0fcf9e9eea82819530de7fb3d4.php
-littleblacktheatre.com/excel/3/oauth2/authorize/files/d50188627dae315510f7988b312d.php
-littleflowerhostel.com/dfxlvuvo.zip
-lloyds-bank-new-payee.com/lloyds
-lloyds-bank-new-payee.com/lloyds/Login.php
-lmaancha.co.il/s85ekun.zip
-lmasshop.com/pages/Amazon/
  lnk.news/2rovk
  lnkd.in/dC_EFvE
-lnstagramhelpscopyrights.com/support
-locomotivecasualw.com/sapphire
-locomotivecasualw.com/sapphire/dashboard.php
-logbromw.com/project/vendor/psy/psysh/src
-logbromw.com/project/vendor/psy/psysh/src/task_mail__token_QAWWOHKWQKSaIK6CqOhwn21m1ArKV3te.php
-logistic.soft-solutiontv.com/ubsi4unj.zip
-ludwig.otticagrilli.com/ludwig/
-magianegramagiablancayamarres.com/uc9zj3df1.zip
-mail.codeload.org/p81sb894.zip
-mail.inlightprod.com/wordpress
-mail.inlightprod.com/wordpress/wp-admin/js/il/il-xppl
-mail.jeffsono.org/colxljjqo.zip
-mail.lloyds-bank-new-payee.com/lloyds
-mail.lloyds-bank-new-payee.com/lloyds/Login.php
-mail.vertigoshop.eu/landing/product/agent-za-regeneraciju
-mailorderdeliver.com/23602
-majidmc.sa/joliaa
-majidmc.sa/joliaa/9.html
  mapage.noos.fr/~jeanmarie.regall/7546t5.exe
-mariobrown.net/chromiumi.exe
-masjidhabeebiyarazviya.mysunni.com/bh82iup.tar
-matruchhaya.co.in/tvo86jez7.tar
-mattangusstudios.com/asb-tax-residency-information-update/VDBVSYWS7WSGDWS7WB3YWGED0MHGLUYFFTDFCGBG/auth
-mattangusstudios.com/asb-tax-residency-information-update/VDBVSYWS7WSGDWS7WB3YWGED0MHGLUYFFTDFCGBG/auth/index.php
-mdasa.elin.co.za/j51h1upw7.rar
  mediafire.com/file/yn8dnlx4znw0qwy/AppTrailers.9.1.10amt.exe
-mersinchk.gov.tr/qiu3587b.tar
-mikhailmotoringschool.com/tsb8kv.zip
-molson64perlom.com/redir/gene/ppsecureReservedFlight33ae96ed9c4df2401da6fa5a5b82935252
-molson64perlom.com/redir/gene/ppsecureReservedFlight33ae96ed9c4df2401da6fa5a5b82935252/
-molson64perlom.com/redir/gene/ppsecureReservedFlight33ae96ed9c4df2401da6fa5a5b82935252/full.php
-molson64perlom.com/redir/gene/ppsecureReservedFlight33ae96ed9c4df2401da6fa5a5b82935252/fulls.php
-molson64perlom.com/redir/gene/ppsecureReservedFlight33ae96ed9c4df2401da6fa5a5b82935252/que.php
-monroestvets.com/chase-login/
-monroestvets.com/chase-login/home
-monroestvets.com/chase-login/home/index.php
-moorestvhardware.com/OZD_LcAMsZvdB171.bin
-moorestvhardware.com/act_KnABOZMQ98.bin
-moorestvhardware.com/fsx_hrrFmuAmd43.bin
-mopai.sg/r3fj2d.zip
-msg.futurmail.fr/exchweb/bin/auth/owalogon.asp
-mtspsmjeli.sch.id/Img/KINO.exe
-myritz.vettickal.com/iqfzfrfv.tar
-nabukovel.com.ua/js/SMBC/
-nabukovel.com.ua/js/SMBC/02e9255ca2598a900d220eeb7b7893bb/
-nabukovel.com.ua/js/SMBC/879b01f196542cbece1c17e825e9e2b4
-nabukovel.com.ua/js/SMBC/879b01f196542cbece1c17e825e9e2b4/
-navayurveda.in/odfgax3gl.rar
  net.geo.opera.com/opera/stable/windows
  net.geo.opera.com/opera/stable/windows/
-netperest.gb.net/vbnji/
-netprofitmechanisationsprayer.live/dispute/
-neverseenshop.com.mx/f05vu41g.rar
-newingtonroad.co.za/VIM/Comcast_Xfinity/
  news-ontime.com/Nov.1/Shark-Tank-Diet8.0/Keto-Lean.html
  news-ontime.com/Nov.1/Shark-Tank-Diet8.0/Keto-Pure-ss.html
  news-ontime.com/Nov.1/Shark-Tank-Diet8.0/Slim-X-Genie-Keto.html
-niplast.rs/webadmin/roundcube/44ea2c683e185df551bb51fd7817f1e9
-noaim.org/C63/1
-noaim.org/C63/1/
-noaim.org/C63/1/verification-card.php
-nocalnoodle.elin.co.za/o2xbh6q.zip
-nocalnoodle.elin.co.za/wgb318q.rar
-nordxtremesolutions.ro/smcywzaao.zip
-ns1.unkrunchdesabor.com.mx/prong/compte/lcs
-ns1.unkrunchdesabor.com.mx/prong/compte/lcs/login.php
+notion.so/PROTONMAIL-COM-9d81207bfbac4a64a483deb07e84c517/
  nyc3.digitaloceanspaces.com/informationtechinformationtechinformationtech
  nyc3.digitaloceanspaces.com/informationtechinformationtechinformationtech/words87289.html
  objectstorage.eu-amsterdam-1.oraclecloud.com/n/axvzq6ccdhre/b/covna/o
@@ -1269,22 +722,7 @@ objectstorage.us-phoenix-1.oraclecloud.com/n/axxhgwgjih8t/b/voicenote/o/117-Crl.
  objectstorage.us-phoenix-1.oraclecloud.com/n/axy0ck15gxtn/b/outcall/o/11-Crl.html
  objectstorage.us-sanjose-1.oraclecloud.com/n/axcdfbfimho2/b/bucket-20200807Voicemessagesreviewportal-0627/o
  objectstorage.us-sanjose-1.oraclecloud.com/n/axcdfbfimho2/b/bucket-20200807Voicemessagesreviewportal-0627/o/index.html
-oc5p5jb3eyyqrvmlqpftgsrflm-adwhj77lcyoafdy-www-paypal-com.translate.goog/us/home
-ocslf76xbox.com/Valentines/banks/directing/bmo
-ocslf76xbox.com/Valentines/banks/directing/bmo/information.php
-ocslf76xbox.com/Valentines/banks/directing/cibc
-ocslf76xbox.com/Valentines/banks/directing/cibc/index.php
-ocslf76xbox.com/Valentines/banks/directing/desjardins
-ocslf76xbox.com/Valentines/banks/directing/desjardins/index.php
-ocslf76xbox.com/Valentines/banks/directing/royalbank
-ocslf76xbox.com/Valentines/banks/directing/royalbank/index.html
-ocslf76xbox.com/Valentines/banks/directing/tangerine
-ocslf76xbox.com/Valentines/banks/directing/tangerine/index.php
-olayeenger.ml/100/wgbground
-omaromatic.com/h8fv2whx.tar
  onedrive.live.com/download
-orientgatewayltd.com/nrep1o.tar
-osorio.webmarketinggt.com/i9vxud.zip
  ow.ly/3IRf30qF4Kw
  ow.ly/BD9i50AVlOV
  ow.ly/BgVO30qE9fg
@@ -1297,142 +735,35 @@ ow.ly/h7We30qCZgS
  ow.ly/kgMD50BM5Gl
  ow.ly/tEjO30qJvOw
  ow.ly/yxK730qUYLl
-packrile.com/ES/ES_elcmel/
  padlet-uploads.storage.googleapis.com/610964646/d0a82b340ac6b4eb2fed334399fe2e84
  padlet-uploads.storage.googleapis.com/610964646/d0a82b340ac6b4eb2fed334399fe2e84/palad.html
-paintfiller.com/chase-login/home
-paintfiller.com/chase-login/home/authenticating.php
  pastebin.com/raw/DawJ5x7m
  pastebin.com/raw/Yt0EUBML
  pastebin.com/raw/xpEutJ0a
-paths.elin.co.za/fwr98ev.zip
-pavementgroup.com/pdf/Host_MTYhAnhYrd180.bin
-pavementgroup.com/pdf/Host_NcxeCm210.bin
-pavementgroup.com/pdf/Host_OjFGklRj144.bin
-pavementgroup.com/pdf/Host_fZbzoGWE142.bin
-pavementgroup.com/pdf/Host_kbcZWKSr168.bin
-pavementgroup.com/pdf/Host_tKEDhGwv189.bin
-pavementgroup.com/pdf/Host_wSwlQTc200.bin
-pavementgroup.com/pdf/Host_yysbnhCkM16.bin
-pavementgroup.com/pdf/obj2scoopingly.gzip
-pay.topgrads.net/d
-pay01-olx.pl/track
-paypal-me.katalog.cyou/pay/
-paypal-uk-webcmd-login.done-login-access-krf41asdsge4h6g354sa3sdwej5yxncv54er.sentient.asia/ID/secure-code1008/webapps
-paypal-uk-webcmd-login.done-login-access-krf41asdsge4h6g354sa3sdwej5yxncv54er.sentient.asia/ID/secure-code1399/webapps
-paypal-uk-webcmd-login.done-login-access-krf41asdsge4h6g354sa3sdwej5yxncv54er.sentient.asia/ID/secure-code1437/webapps/mpp
-paypal-uk-webcmd-login.done-login-access-krf41asdsge4h6g354sa3sdwej5yxncv54er.sentient.asia/ID/secure-code1448/webapps/mpp
-paypal-uk-webcmd-login.done-login-access-krf41asdsge4h6g354sa3sdwej5yxncv54er.sentient.asia/ID/secure-code1448/webapps/mpp/Home.php
-paypal-uk-webcmd-login.done-login-access-krf41asdsge4h6g354sa3sdwej5yxncv54er.sentient.asia/ID/secure-code2198/webapps
-paypal-uk-webcmd-login.done-login-access-krf41asdsge4h6g354sa3sdwej5yxncv54er.sentient.asia/ID/secure-code404/webapps
-paypal-uk-webcmd-login.done-login-access-krf41asdsge4h6g354sa3sdwej5yxncv54er.sentient.asia/ID/secure-code5236/webapps/mpp
-paypal-uk-webcmd-login.done-login-access-krf41asdsge4h6g354sa3sdwej5yxncv54er.sentient.asia/ID/secure-code5236/webapps/mpp/Home.php
-paypal-uk-webcmd-login.done-login-access-krf41asdsge4h6g354sa3sdwej5yxncv54er.sentient.asia/ID/secure-code551/webapps
-paypal-uk-webcmd-login.done-login-access-krf41asdsge4h6g354sa3sdwej5yxncv54er.sentient.asia/ID/secure-code591/webapps
-paypal-uk-webcmd-login.done-login-access-krf41asdsge4h6g354sa3sdwej5yxncv54er.sentient.asia/ID/secure-code686/webapps
-paypal-uk-webcmd-login.done-login-access-krf41asdsge4h6g354sa3sdwej5yxncv54er.sentient.asia/ID/secure-code716/webapps
-paypal-uk-webcmd-login.done-login-access-krf41asdsge4h6g354sa3sdwej5yxncv54er.sentient.asia/ID/secure-code746/webapps
-paypal-uk-webcmd-login.done-login-access-krf41asdsge4h6g354sa3sdwej5yxncv54er.sentient.asia/ID/secure-code865/webapps
-paypal-uk-webcmd-login.done-login-access-krf41asdsge4h6g354sa3sdwej5yxncv54er.sentient.asia/ID/secure-code901/webapps
-payplchhkin.org/xcc-opt/ad2a8462e2eaf752aaa1a0f988f11df5
-pcmmasale.com/css/Net
-pcmmasale.com/css/Net/unlock.php
-phittc.com/on7b92j.rar
-plumvillage.com.sg/02142021.4019
-plumvillage.com.sg/02142021.4019/index.html
-plymouthrocklegal.com/nmj
-possiblewood.com/eli/
-post.ch-en-shortcut1.swisspost-com-b1440447.guidiroberto.com/NDkrQUxCWTVtK255M1Nzamo2Wnk2Zz09/
-post.ch-en-shortcut2.swisspost-com-8b4f4589.guidiroberto.com/SWZKYmI3VlFUVko1Nzc2OU5YUEtYQT09/
-postael.accesscam.org/po/p/06305
-postael.accesscam.org/po/p/0f34c
-postael.accesscam.org/po/p/10287
-postael.accesscam.org/po/p/13041
-postael.accesscam.org/po/p/1c331
-postael.accesscam.org/po/p/1f935
-postael.accesscam.org/po/p/2784d
-postael.accesscam.org/po/p/2a60e
-postael.accesscam.org/po/p/2a7b2
-postael.accesscam.org/po/p/354a3
-postael.accesscam.org/po/p/364cd
-postael.accesscam.org/po/p/38826
-postael.accesscam.org/po/p/3b347
-postael.accesscam.org/po/p/4001f
-postael.accesscam.org/po/p/456b4
-postael.accesscam.org/po/p/49ec0
-postael.accesscam.org/po/p/4e95f
-postael.accesscam.org/po/p/5031f
-postael.accesscam.org/po/p/58f11
-postael.accesscam.org/po/p/59d7a
-postael.accesscam.org/po/p/5a685
-postael.accesscam.org/po/p/5ae66
-postael.accesscam.org/po/p/5cd82
-postael.accesscam.org/po/p/601c5
-postael.accesscam.org/po/p/62f93
-postael.accesscam.org/po/p/642d4
-postael.accesscam.org/po/p/64c06
-postael.accesscam.org/po/p/72bc4
-postael.accesscam.org/po/p/7870d
-postael.accesscam.org/po/p/7c3bd
-postael.accesscam.org/po/p/8094f
-postael.accesscam.org/po/p/91ce4
-postael.accesscam.org/po/p/92f32
-postael.accesscam.org/po/p/9b93b
-postael.accesscam.org/po/p/9df75
-postael.accesscam.org/po/p/9ecf2
-postael.accesscam.org/po/p/a0fcd
-postael.accesscam.org/po/p/ad6da
-postael.accesscam.org/po/p/b3e20
-postael.accesscam.org/po/p/c9b76
-postael.accesscam.org/po/p/cb1a6
-postael.accesscam.org/po/p/cd6d4
-postael.accesscam.org/po/p/d86d4
-postael.accesscam.org/po/p/fac0e
-postael.accesscam.org/po/p/fd2b5
-power760.com/z95mjq2r.zip
-pramitmedicalstore.com/ourtime/site....
-pramitmedicalstore.com/ourtime/site.....
-pramitmedicalstore.com/ourtime/site/....
-pramitmedicalstore.com/ourtime/site/.....
-propertiq.elin.co.za/zdu5vah7x.zip
-propertiq2.elin.co.za/atzx93.zip
-propertiq2.elin.co.za/n4vznai.rar
-provence.elin.co.za/i4u57i.zip
-prueba.danielluza.com/s4h7cl.zip
-prueba2.adivertirse.com.mx/f7wnn0i.tar
-pubgmobile.com.xxucpubg.com/event
-rachmat-assuhaimi.my.id/urvvr0opg.tar
-rakeshkhatri.in/f21hc3mc.rar
+phantomboxing.co.uk/k4onj7v.tar
  rb.gy/05vruj
  rb.gy/0dxzro
-rb.gy/0lcisd
  rb.gy/ajgrnt
  rb.gy/aqr3sk/
  rb.gy/aqwj7l
+rb.gy/esedwa
  rb.gy/fihzov
-rb.gy/gty4bm
+rb.gy/gbiyqm
  rb.gy/hobteq/
  rb.gy/ia1oft
  rb.gy/iifoiu
  rb.gy/kn27px/
  rb.gy/lflert
  rb.gy/ludoy0
-rb.gy/lyswfw
  rb.gy/n5ozim
  rb.gy/rqkrxe
  rb.gy/rrl1ll
  rb.gy/rtlomb
-rb.gy/uk9ehn
-rb.gy/v8lodv
  rb.gy/vnwszq
-rb.gy/wdug2r
  rb.gy/xalpmw
  rb.gy/y5c8aa
  rb.gy/yrzlzc
-rb.gy/zfnooy
  rcl.ink/PD6
-rcmesilva.charbelsales.com.br/p09999.zip
-reacredit.com.br/painel/wa/simple_slide/plugins/dragslider/221.dll
  rebrand.ly/000ATT
  rebrand.ly/0gn930f/
  rebrand.ly/0kc6ihu
@@ -1502,30 +833,11 @@ rebrand.ly/yngvu65
  rebrand.ly/zikqv8f
  rebrand.ly/zitln6v
  rebrand.ly/zshyr3j
-redbats.co.in/nuzx6o.zip
-regentediting.com/edited/NEDBANK
-regentediting.com/edited/NEDBANK/NedbankMoney.htm
-relaxindulge.co.nz/bbsc7ejpd.rar
-repair-electrons.com/OZD_gYTKR147.bin
-repair-electrons.com/act_rgwCCi38.bin
-repair-electrons.com/rochaspa_EgOMdDbA209.bin
-repatriacioncolombia.com/syo4wssg.zip
-resepkomplit.com/P2w9ZSZpPTVGNkI2NzBrN3E4OA=
-resilient-unique-gardenia.glitch.me/#a
  reurl.cc/1xRr1Y
  reurl.cc/WL16RO
  reurl.cc/bRkoqE
  reurl.cc/gvjOLp
  reurl.cc/oLeEQj
-rickstv.com/pop/smtp/inc
-rickstv.com/pop/smtp/inc/msg.php
-rippr.cc/bot.arm4
-rippr.cc/bot.arm5
-rippr.cc/bot.arm6
-rippr.cc/bot.arm7
-rippr.cc/bot.x86
-robertoconceicao.adv.br/s3bx9sp.rar
-roltek.com.br/qa8a2gl.rar
  rplg.co/2-nfc-click
  rplg.co/28aec060
  rplg.co/522f6060
@@ -1590,8 +902,6 @@ s.id/u0e9d
  s.id/uDQqs
  s.id/uGGf1
  s.id/versleuteling
-s.lanternamagica.org/swo/
-s.thechinesemuslim.com/ix0cpw.tar
  s3-ap-northeast-1.amazonaws.com/cxrequirement.sharepointeseugwpjlmahxedgkqsbjlzfgsn
  s3-ap-northeast-1.amazonaws.com/cxrequirement.sharepointeseugwpjlmahxedgkqsbjlzfgsn/index.html
  s3-ap-southeast-1.amazonaws.com/xuip
@@ -1636,80 +946,19 @@ s3.us-east-2.amazonaws.com/www.microsoft.com.v83
  s3.us-east-2.amazonaws.com/www.microsoft.com.v83/inAAi33.html
  s3.us-east-2.amazonaws.com/www1.microsoft.com.st
  s3.us-east-2.amazonaws.com/www1.microsoft.com.st/inAAi33.html
-safcol-colors.com/s9nkeseeb.rar
-safersecurityincandmore.com/mua/
-safersecurityincandmore.com/mua/.
-safersecurityincandmore.com/mua/145.239.113.739052/sucursalpersonas.transaccionesbancolombia.com/mua
-safersecurityincandmore.com/mua/145.239.113.739052/sucursalpersonas.transaccionesbancolombia.com/mua/index.html
-safersecurityincandmore.com/mua/149.13.33.132530/sucursalpersonas.transaccionesbancolombia.com/mua
-safersecurityincandmore.com/mua/149.13.33.132530/sucursalpersonas.transaccionesbancolombia.com/mua/index.html
-safersecurityincandmore.com/mua/149.13.33.133175/sucursalpersonas.transaccionesbancolombia.com/mua
-safersecurityincandmore.com/mua/149.13.33.133175/sucursalpersonas.transaccionesbancolombia.com/mua/index.html
-safersecurityincandmore.com/mua/149.13.33.138349/sucursalpersonas.transaccionesbancolombia.com/mua
-safersecurityincandmore.com/mua/149.13.33.138349/sucursalpersonas.transaccionesbancolombia.com/mua/index.html
-safersecurityincandmore.com/mua/154.30.133.1918518/sucursalpersonas.transaccionesbancolombia.com/mua
-safersecurityincandmore.com/mua/154.30.133.1918518/sucursalpersonas.transaccionesbancolombia.com/mua/index.html
-safersecurityincandmore.com/mua/18.234.234.36942/sucursalpersonas.transaccionesbancolombia.com/mua
-safersecurityincandmore.com/mua/18.234.234.36942/sucursalpersonas.transaccionesbancolombia.com/mua/index.html
-safersecurityincandmore.com/mua/34.237.113.1133310/sucursalpersonas.transaccionesbancolombia.com/mua
-safersecurityincandmore.com/mua/34.237.113.1133310/sucursalpersonas.transaccionesbancolombia.com/mua/index.html
-safersecurityincandmore.com/mua/34.237.113.1134145/sucursalpersonas.transaccionesbancolombia.com/mua
-safersecurityincandmore.com/mua/34.237.113.1134145/sucursalpersonas.transaccionesbancolombia.com/mua/index.html
-safersecurityincandmore.com/mua/34.237.113.1136872/sucursalpersonas.transaccionesbancolombia.com/mua
-safersecurityincandmore.com/mua/34.237.113.1136872/sucursalpersonas.transaccionesbancolombia.com/mua/index.html
-safersecurityincandmore.com/mua/34.237.113.1139613/sucursalpersonas.transaccionesbancolombia.com/mua
-safersecurityincandmore.com/mua/34.237.113.1139613/sucursalpersonas.transaccionesbancolombia.com/mua/index.html
-safersecurityincandmore.com/mua/45.40.125.1808327/sucursalpersonas.transaccionesbancolombia.com/mua
-safersecurityincandmore.com/mua/45.40.125.1808327/sucursalpersonas.transaccionesbancolombia.com/mua/index.html
-safersecurityincandmore.com/mua/54.84.138.1344279/sucursalpersonas.transaccionesbancolombia.com/mua
-safersecurityincandmore.com/mua/54.84.138.1344279/sucursalpersonas.transaccionesbancolombia.com/mua/index.html
-safersecurityincandmore.com/mua/66.153.185.2257948/sucursalpersonas.transaccionesbancolombia.com/mua
-safersecurityincandmore.com/mua/66.153.185.2257948/sucursalpersonas.transaccionesbancolombia.com/mua/index.html
-safersecurityincandmore.com/mua/66.153.185.2285831/sucursalpersonas.transaccionesbancolombia.com/mua
-safersecurityincandmore.com/mua/66.153.185.2285831/sucursalpersonas.transaccionesbancolombia.com/mua/index.html
-safersecurityincandmore.com/mua/89.249.64.1716591/sucursalpersonas.transaccionesbancolombia.com/mua
-safersecurityincandmore.com/mua/89.249.64.1716591/sucursalpersonas.transaccionesbancolombia.com/mua/
-safersecurityincandmore.com/mua/unknown2794/sucursalpersonas.transaccionesbancolombia.com/mua
-safersecurityincandmore.com/mua/unknown2794/sucursalpersonas.transaccionesbancolombia.com/mua/index.html
-safersecurityincandmore.com/mua/unknown5070/sucursalpersonas.transaccionesbancolombia.com/mua
-safersecurityincandmore.com/mua/unknown5070/sucursalpersonas.transaccionesbancolombia.com/mua/index.html
-safersecurityincandmore.com/mua/unknown6695/sucursalpersonas.transaccionesbancolombia.com/mua
-safersecurityincandmore.com/mua/unknown6695/sucursalpersonas.transaccionesbancolombia.com/mua/index.html
-safersecurityincandmore.com/mua/unknown8812/sucursalpersonas.transaccionesbancolombia.com/mua
-safersecurityincandmore.com/mua/unknown8812/sucursalpersonas.transaccionesbancolombia.com/mua/index.html
-saisoftwareinc.com/ds/1002.gif
-sandbox.seekerbolivia.com/fonts/ik
-sandbox.seekerbolivia.com/fonts/ik/login.php
-sapphireadventuretravel.com/a859nd3.zip
-sardarmask.com/rochaspa_PAHTX22.bin
  scienceasia.org/1987.13.n4/FGBFGTHRTT54ER3467UTRDSVFR3465
  scienceasia.org/1987.13.n4/FGBFGTHRTT54ER3467UTRDSVFR3465/mag.html
-sctrlgin.com/spotify.update-billing/
-seasidegraphicslv.com/chase-login/home
-seasidegraphicslv.com/chase-login/home/
-seasidegraphicslv.com/chase-login/home/e-mail.verification.php
-sec-doc-w.com/img/SCD10093264.jpg
-secure-doc-reader.com/independent_appraisal.jar
-segalsmetals.elin.co.za/klt6bj9.rar
-segalsmetals.elin.co.za/u1d82t.zip
  sendspace.com/pro/dl/45rnsw
  sfo2.digitaloceanspaces.com/spacezoomincemeetingcloud
  sfo2.digitaloceanspaces.com/spacezoomincemeetingcloud/AAwsodhdYTTYSHyuey.html
-shaka.ai/CHASE
-shaka.ai/CHASE/dashboard.php
  share.hsforms.com/1HWBy9E8zQ5CPqHe5EI6IGA3245i
  share.hsforms.com/1OWoQghkBQDO-dfBLtGExeQ4g63f
+short.pe/15Zvi
  short.pe/q00Sa
  shorturl.at/oIJP1
  shorturl.at/rRTX4
-shrinikunjabiharitrust.org.in/ofs/wgbground
-siddharthpanditpautra.com/zgra2pn.zip
  sites.google.com/view/embedded-fi/home
  slack-redir.net/link
-smbvidros.com/Acob/NzLqdPkZnP56xQKNrAQMmKxSKEKAUoD5YesIOW5ROHd5FZLlcgPC
-smbvidros.com/Acob/NzLqdPkZnP56xQKNrAQMmKxSKEKAUoD5YesIOW5ROHd5FZLlcgPC/login.html
-smbvidros.com/Acob/NzLqdPkZnP56xQKNrAQMmKxSKEKAUoD5YesIOW5ROHd5FZLlcgPC/otp.htm
-smokeandgrowrichtour.com/ux1cfm0.rar
  snip.ly/03elb0
  snip.ly/3b3y76
  snip.ly/7u961z
@@ -1739,23 +988,12 @@ snip.ly/www.netflix.com-Login-secure
  snip.ly/www.netflix.com-Login-secure/
  snip.ly/www.netflix.com-costumer-login/
  snip.ly/www.netflix.com-signIn-account/
-soberlifeco.com/contra
-soberlifeco.com/contra/emptyd.siteok
-soberlifeco.com/contra/storage.php
-soft-solutiontv.com/lz47e2xz.rar
  soo.gd/BSmq
  soo.gd/T0F1
  soo.gd/kxVY
  soo.gd/l6Rg
  soo.gd/y3rR
-soporte.feval.co/krkf6y8.tar
-spappstest.com/img/portfolio/countdown
-spotisemtana.com/suisse/
-spuarmessaginsuport.com/sq
-ssdo.lanternamagica.org/swo/
  st6.ning.com/topology/rest/1.0/file/get/8122054091/
-stayathome247.co.za/files/NediBarlars~STROKE~SPONONO~PASSY.htm
-stdyrusschinetwomast.dns.army/receiprt/regasm.exe
  stemschool.net/ra2k83h.zip
  stor.ee/4kTV
  storage.googleapis.com/0ffice/ajo2
@@ -2225,27 +1463,6 @@ storage.googleapis.com/ym-windows/windows.htm
  storage.googleapis.com/zhieurgfieuhfhre
  storage.googleapis.com/zhieurgfieuhfhre/hoif.htm
  storage.ning.com/topology/rest/1.0/file/get/8122054091/
-storagegenuine.com/.xxqqqq
-strashield.com/back/new_vvxzswlW155.bin
-strashield.com/main/new_vvxzswlW155.bin
-studio4brow.com/r351sjzw.zip
-suburbanlittleleague.com/epl/pl/gFRkjlhxpe8IzLt.exe
-suchen.mobile-fahrzeuge.details-html-id309261773.de/mycas
-suhead.ga/online/commbank1
-suhead.ga/online/commbank1/credit-card.html
-suhead.ga/online/commbank1/logon.html
-suhead.ga/online/commbank1/phone.html
-suhead.ga/w/commbank1
-suhead.ga/w/commbank1/credit-card.html
-suhead.ga/w/commbank1/logon.html
-suhead.ga/w/commbank1/phone.html
-suju.qnotice.com/j240mw.zip
-sunmarkholidays.com/ds/0702.gif
-superstart.qnotice.com/rsrhun.zip
-suportedetv.antenascuritiba.net.br/epw3crsc.zip
-support-paypal2021.checkuser.admin-pan3l-sold.webredirect.org/PaypalCyanide/home/customer_center/customer_Case=IDPP00C448
-support-paypal2021.checkuser.admin-pan3l-sold.webredirect.org/PaypalCyanide/home/customer_center/customer_Case=IDPP00C448/indexx.php
-support-paypal2021.checkuser.admin-pan3l-sold.webredirect.org/PaypalCyanide/home/customer_center/customer_Case=IDPP00C448/myaccount/Sign-in/
  surveygizmo.com/s3/5635022/AT-T/
  surveygizmo.com/s3/5655517/at-t
  surveygizmo.com/s3/5679924/AT-T-Login/
@@ -2260,8 +1477,6 @@ surveygizmo.com/s3/5799006/Sbcglobal
  surveygizmo.com/s3/5966390/AT-T-Mail
  surveygizmo.com/s3/5989878/Sign-in-to-continue
  surveyheart.com/form/5e23c40fb533f62621f5252d
-susannbraun.de/jrn/
-sys.pbmadu.co.id/ibwblm.zip
  t.cn/A6LxgDxg
  t.co/0Y8DHT78dD
  t.co/2XX7ZSQTqN
@@ -2279,18 +1494,6 @@ t.co/m6Fz3ChX91
  t.co/mCmzxZ8cyT
  t.co/mSKJH9xhZW
  t.ly/4HEr
-tacticohosting.com/j1da592.zip
-taurus.ug/ac.exe
-taurus.ug/ds1.exe
-taurus.ug/ds2.exe
-taurus.ug/rc.exe
-tcesingur.com/rq2kzgrv1.rar
-technologydistilled.com/a-nurse-ss8d9/z
-teduae.com/wyzl_mpcXWrOwO171.bin
-test.protocsconnectes.eu/wbvu57.tar
-test.studecademy.com/ma022i.zip
-testing.thinkingcorp.in/sii00umt.tar
-thefuturelife.in/u5i3acz.zip
  tiny.cc/3cutsz
  tiny.cc/6mihnz
  tiny.cc/nlf03y
@@ -2314,7 +1517,6 @@ tinyurl.com/yd6xagxj
  tinyurl.com/yxlsspu4
  tinyurl.com/yybqmkhf/
  tinyurl.com/yyvm8qr5
-titanautomobiles.com/ds/1002.gif
  tny.sh/08RvQg7
  tny.sh/DYG6yzX
  tny.sh/KOGWRZt
@@ -2332,16 +1534,8 @@ tny.sh/santrest
  tny.sh/share-myfile
  tny.sh/wBXwb4M
  tny.sh/z1iOyHK
-todaydeliveries.net/Package/info/pack/Package
-todaydeliveries.net/Package/info/pack/Package/Bill.php
-torresquinterocorp.com/w50lew.zip
  tr.im/AlertaslBCP
  translate.sogoucdn.com/pcvtsnapshotorigin
-treqin.com/36528office/
-tricloh.ga/commbank/com-au/commbank/
-tricloh.ga/mycommbank/au/commbank/
-tsunagari.sakura.ne.jp/school2/
-tsunagari.sakura.ne.jp/well/
  u.nu/2744a
  u.nu/42qil
  u.nu/dvh6r
@@ -2361,15 +1555,8 @@ u.to/eAnBGQ
  u.to/iwFOGg
  u.to/x9AVFg
  ucarecdn.com/2a7b935a-1c7f-46e2-a05a-094adb8108a6/myflycodes.exe
-ugprs-ubih.org/babfyptc.tar
-unequaleducation.com/qjx7qn.zip
-unisoftcc.com/fsrldo3.zip
-unkrunchdesabor.com.mx/prong/compte/lcs
-unkrunchdesabor.com.mx/prong/compte/lcs/login.php
  uqr.to/icvk
  uqr.to/k5ga
-urlth.me/QfUh9/
-urlth.me/ycPBD/
  urlz.fr/aE9L
  urlz.fr/bUm9
  urlz.fr/cBMP
@@ -2413,40 +1600,6 @@ urlz.fr/ejHy
  urlz.fr/ekkz
  v.gd/eoauYu
  v.ht/7pzM
-vegasuperoffer.com/20FreeVC/.home
-vegasuperoffer.com/20FreeVC/.home/login.php
-villasoledadbeachresort.com/a8k45o.rar
-viveirodoiscorregos.com.br/backup_18-02-2020/demo/wa_p_albums/p_album_k6nvoe2b0/k6nvoe2b6e5sqg/2200.dll
-viveirodoiscorregos.com.br/backup_18-02-2020/demo/wa_p_albums/p_album_k6nvoe2b0/k6nvoe2b6e5sqg/221.dll
-viveirodoiscorregos.com.br/backup_18-02-2020/demo/wa_p_albums/p_album_k6nvoe2b0/k6nvoe2b6e5sqg/3338.dll
-viveirodoiscorregos.com.br/backup_18-02-2020/demo/wa_p_albums/p_album_k6nvoe2b0/k6nvoe2b6e5sqg/mon41_cr.dll
-viveirodoiscorregos.com.br/backup_18-02-2020/demo/wa_p_albums/p_album_k6nvoe2b0/k6nvoe2b6e5sqg/mon4498.dll
-viveirodoiscorregos.com.br/backup_18-02-2020/demo/wa_p_albums/p_album_k6nvoe2b0/k6nvoe2b6e5sqg/mon44_cr.dll
-viveirodoiscorregos.com.br/backup_18-02-2020/demo/wa_p_albums/p_album_k6nvoe2b0/k6nvoe2b6e5sqg/mon48_cr.dll
-vksales.com/wekboa.zip
-vladutbogaciu.com/visa%20Prime/
-voltivoeg.com/dashboard/officeex
-voltivoeg.com/dashboard/officeex/updates.htm
-vps-310989.unkrunchdesabor.com.mx/prong/compte/lcs
-vps-310989.unkrunchdesabor.com.mx/prong/compte/lcs/login.php
-vtube.fadlymotivator.com/m3opvg.tar
-vuongcode.com/mf8v4wu.zip
  wa.me/260979441405
-wanhaber.com.tr/owaa
-wanhaber.com.tr/owaa/logon.php
-wazap.co.il/wt/
-webmail.hautot-communication.fr/exchweb/bin/auth/owalogon.asp
-webmail.marininter.9services.com/exchweb/bin/auth/owalogon.asp
-website-work.com/qpi2gjn.tar
-whensmyweeding.com/wpj/webmail-op.jp
-whensmyweeding.com/wpj/webmail-op.jp/webmail-op.jp
-workshop.arceliotivane.com/xduphk8.rar
-wp.readhere.in/kijg7ql.zip
-xx.otticagrilli.com/xx/
-yaliyase.com/skw/ro3/4e5046fc8d6a97d18a5f54beaed54dea
-yaliyase.com/skw/ro3/4e5046fc8d6a97d18a5f54beaed54dea/signin.php
-yousefmetany.com/smk/back/Loader_tKCXLt27.bin
-yousefmetany.com/smk/main/Loader_tKCXLt27.bin
-yummyyogaudaipur.com/vih4srug0.rar
-z.zz.ht/iTR2p.jpg
+zhuoxinwei.com/work.exe
  zonehmirrors.org/defaced/2019/09/11/magazinepromo.net/magazinepromo.net/
author	Travis CI User <travis@example.org>
	Wed, 17 Feb 2021 04:15:38 +0000 (04:15 +0000)
committer	Travis CI User <travis@example.org>
	Wed, 17 Feb 2021 04:15:38 +0000 (04:15 +0000)
README.md		patch \| blob \| blame \| history
blacklists/README		patch \| blob \| blame \| history
blacklists/adult/domains		patch \| blob \| blame \| history
blacklists/adult/urls		patch \| blob \| blame \| history
blacklists/malware/domains		patch \| blob \| blame \| history
blacklists/malware/urls		patch \| blob \| blame \| history