Automatic blacklist update

author Travis CI User <travis@example.org>

Sun, 31 Jan 2021 06:44:56 +0000 (06:44 +0000)

committer Travis CI User <travis@example.org>

Sun, 31 Jan 2021 06:44:56 +0000 (06:44 +0000)
author Travis CI User <travis@example.org>
Sun, 31 Jan 2021 06:44:56 +0000 (06:44 +0000)
committer Travis CI User <travis@example.org>
Sun, 31 Jan 2021 06:44:56 +0000 (06:44 +0000)
diff --git a/README.md b/README.md

index 1eaa39bad93a38aa279d5cb0bfdb24c047d57e72..a03983f2f31b0a46e96d04ca0cc2adcde3ef7956 100644 (file)
--- a/README.md
+++ b/README.md
@@ -6,7 +6,7 @@ __Note__: this repository is only intended to mirror lists, to modify/update the
  ## Lists
  | Name | Size | Description |
  |:-----|:-----|:------------|
-| [adult](blacklists/adult) | 2734745 | Some adult site from erotic to hard pornography |
+| [adult](blacklists/adult) | 2735055 | Some adult site from erotic to hard pornography |
  | [agressif](blacklists/agressif) | 385 | Some aggressive sites |
  | [arjel](blacklists/arjel) | 69 | ARJEL which is a french certification authority for gambling sites |
  | [associations_religieuses](blacklists/associations_religieuses) | 1 | religious_association |
@@ -22,7 +22,7 @@ __Note__: this repository is only intended to mirror lists, to modify/update the
  | [cooking](blacklists/cooking) | 21 | Sites for cooking |
  | [cryptojacking](blacklists/cryptojacking) | 8788 | Mining site by hijacking |
  | [dangerous_material](blacklists/dangerous_material) | 49 | Sites which describe how to make bomb and some dangerous material |
-| [dating](blacklists/dating) | 368604 | Dating, matching site for single person |
+| [dating](blacklists/dating) | 368605 | Dating, matching site for single person |
  | [ddos](blacklists/ddos) | 306 | DDoS or Stresser Sites |
  | [dialer](blacklists/dialer) | 0 | Dialer Sites |
  | [doh](blacklists/doh) | 67 | Site which provides DNS over HTTP service |
@@ -38,7 +38,7 @@ __Note__: this repository is only intended to mirror lists, to modify/update the
  | [jobsearch](blacklists/jobsearch) | 386 | Site to looking for job |
  | [lingerie](blacklists/lingerie) | 83 | Sites for lingerie |
  | [liste_bu](blacklists/liste_bu) | 2881 | A french list for educational sites. VERY locally oriented. may help libraries |
-| [malware](blacklists/malware) | 275917 | Any website which deliver malware |
+| [malware](blacklists/malware) | 292684 | Any website which deliver malware |
  | [manga](blacklists/manga) | 779 | Any website related to manga, and cartoons |
  | [marketingware](blacklists/marketingware) | 28 | Very special marketing sites |
  | [mixed_adult](blacklists/mixed_adult) | 152 | Websites which contains adult sections unstructured |
diff --git a/blacklists/README b/blacklists/README

index 2202c0b6ae2168e2317c0300b4bd4bfcb8b1fd3c..0239a37124560da6505787eac8174923dedaa0f2 100644 (file)
--- a/blacklists/README
+++ b/blacklists/README
@@ -41,7 +41,7 @@ adult.tar.gz          is a list of adult sites. They are based on
                                          Symon Aked
                                          Todd Sieland-Peterson
  
-Last version Friday 29 January 2021 with 2664410 domains and 70335 urls : 11700 Kb.
+Last version Saturday 30 January 2021 with 2664606 domains and 70449 urls : 11704 Kb.
                         
  
  OTHER :
diff --git a/blacklists/adult/domains b/blacklists/adult/domains

index 1208b432401a34cac700af26cb9e2edab0507e97..ab32154a009d25fa71ed20f0ce2d62ce97418bfb 100644 (file)
--- a/blacklists/adult/domains
+++ b/blacklists/adult/domains
@@ -140868,6 +140868,7 @@ abraxasstuff.tumblr.com
  abrbrayfywuubtzf-dot-millinium.ey.r.appspot.com
  abreasts.com
  abrencontre.com
+abrest.zahorie.eu
  abretesexo.com
  abreuvoirdesexe.free.fr
  abreviation-tech294.gq
@@ -143529,6 +143530,7 @@ accidentalbear.tumblr.com
  accidentalfree.phpbbx.de
  accidentalgainer.tumblr.com
  accidentally-furry.tumblr.com
+accidentally-nude.tumblr.com
  accidentallynakedblog.tumblr.com
  accidentalmistress.blogspot.ae
  accidentalmistress.blogspot.al
@@ -173751,6 +173753,7 @@ adultliveshow.com
  adultlivesites.co.uk
  adultlivevideo.co.uk
  adultlivewebcams.net
+adultload-blog.blogspot.com
  adultload.ws
  adultlocator.com
  adultlock.biz
@@ -180777,6 +180780,7 @@ adultstart.nl
  adultstartpagina.nl
  adultstartups.com
  adultstarvlog.com
+adultstarwardrobe.tumblr.com
  adultstation.net
  adultstation.nl
  adultsteen.com
@@ -191997,6 +192001,7 @@ ahh-nas.tumblr.com
  ahh-putain.tumblr.com
  ahhairy.com
  ahhcydtaugkgjchcu.com
+ahhentertainment.blogspot.com
  ahhfreepornpics.com
  ahhfuck.com
  ahhh.com
@@ -194434,6 +194439,7 @@ airytube.com
  airzoneengineering.com
  ais140mumbai.com
  ais4antjuanette.tumblr.com
+aisan-porn.org
  aisaslut.tumblr.com
  aisbaran.org
  aische-pervers-pornos.com
@@ -203595,6 +203601,7 @@ alexsandercr.blogspot.tw
  alexsandercr.blogspot.ug
  alexseverin.com
  alexshemale.com
+alexsiander.blogspot.com
  alexskinks.tumblr.com
  alexsmind.tumblr.com
  alexsmithwest.tumblr.com
@@ -211235,6 +211242,7 @@ allaboutpornstar.blogspot.sk
  allaboutpornstar.blogspot.sn
  allaboutpornstar.blogspot.tw
  allaboutpornstar.blogspot.ug
+allaboutpureshemale.blogspot.com
  allaboutpussy.info
  allaboutricky.com
  allaboutsex.gr
@@ -212088,6 +212096,7 @@ allasiansex.com
  allasiansporn.com
  allasiantgp.com
  allasiantube.com
+allasianvids.com
  allasianvod.com
  allasianxxx.com
  allasiaporn.com
@@ -212955,6 +212964,7 @@ allenmarks.se
  allennin.tumblr.com
  allenservice.ga
  allensin155.tumblr.com
+allenslivs.se
  allenssexywebcam.gaycamarades.com
  allentownpapershow.com
  allenzhengzheng.tumblr.com
@@ -261401,6 +261411,7 @@ analcreampiehotnessdaily.tumblr.com
  analcreampieonly.tumblr.com
  analcreampieporn.org
  analcreampiesexfilms.nl
+analcreampieshit.blogspot.com
  analcreampiesonly.tumblr.com
  analcreampievids.com
  analcris.tumblr.com
@@ -275647,6 +275658,7 @@ animalporn.beastzone.com
  animalporn.bestelinks.nl
  animalporn.com
  animalporn.da.ru
+animalporn.dog
  animalporn.eu
  animalporn.info
  animalporn.me
@@ -276798,6 +276810,7 @@ anime-hentaipics.blogspot.sk
  anime-hentaipics.blogspot.sn
  anime-hentaipics.blogspot.tw
  anime-hentaipics.blogspot.ug
+anime-lesbians.blogspot.com
  anime-lovers.com
  anime-magic.cjb.net
  anime-manga-hentai-sex-xxl.de
@@ -300983,6 +300996,7 @@ armbander.com
  armbuddy.co.za
  armcandy.com
  armcandyinternational.com
+armchairelvis.tumblr.com
  armchaisrmarch.com
  armed.camarades.com
  armedandgayngerous.tumblr.com
@@ -307069,6 +307083,7 @@ asexblogs.com
  asexboobsreal.tumblr.com
  asexbook.com
  asexbox.com
+asexbox.net
  asexcafe.com
  asexcam.com
  asexcam.nl
@@ -342904,6 +342919,7 @@ avalynevans.tumblr.com
  avamarieerosee.tumblr.com
  avamarteens.canalblog.com
  avanal.com
+avanalofficialblog.blogspot.com
  avanasy.tumblr.com
  avandis.de
  avanewellness.com
@@ -343157,6 +343173,7 @@ avellanoeuropeo.ufro.cl
  avenaceous.com
  avendesora.tumblr.com
  avendtla.com
+avengemymind.tumblr.com
  avengeravenue.tumblr.com
  avengeraxillo.blogspot.ae
  avengeraxillo.blogspot.al
@@ -365537,6 +365554,7 @@ bald-cunt.com
  bald-pussy-pics.com
  bald-teens.com
  bald-wet-pussy.com
+baldamourpforzheimpuffinbalingen.blogspot.com
  baldandsexy.com
  baldaquins.canalblog.com
  baldbastard.com
@@ -369931,6 +369949,7 @@ bangbuzz.fr
  bangcamp.com
  bangcity.com
  bangclub-xxx.startspot.nl
+bangcock101.blogspot.com
  bangcomix.com
  bangcum.com
  bangdate.com
@@ -380035,6 +380054,7 @@ bbwaanal.tumblr.com
  bbwabbie.com
  bbwaction.com
  bbwadeline.com
+bbwadultvideos.com
  bbwalbum.com
  bbwallthebbws.tumblr.com
  bbwamateurnetwork.com
@@ -384183,6 +384203,7 @@ bdsm-gay-boys.com
  bdsm-gay.com
  bdsm-gay.org
  bdsm-gay.tumblr.com
+bdsm-gear.blogspot.com
  bdsm-gear.com
  bdsm-genre.tumblr.com
  bdsm-girl.com
@@ -388330,6 +388351,7 @@ bdsmxxxmag.com
  bdsmxxxvideo.com
  bdsmyou.com
  bdsmzaken.nl
+bdsmzimmertittenneten.blogspot.com
  bdsn.com
  bdsnhontrach.vn
  bdsphatphat.com
@@ -422174,6 +422196,7 @@ bethanyuniformsensation.blogspot.ug
  bethasda-71.ga
  bethasda-71.gq
  bethasda-71.ml
+bethbroderickpicture.blogspot.com
  bethcumsxxx.blogspot.ae
  bethcumsxxx.blogspot.al
  bethcumsxxx.blogspot.am
@@ -426498,6 +426521,7 @@ bi-mmf-guy-on-guy-action.blogspot.sk
  bi-mmf-guy-on-guy-action.blogspot.sn
  bi-mmf-guy-on-guy-action.blogspot.tw
  bi-mmf-guy-on-guy-action.blogspot.ug
+bi-mmf.blogspot.com
  bi-nky.tumblr.com
  bi-no-anal.tumblr.com
  bi-nordic-guy.tumblr.com
@@ -429606,6 +429630,7 @@ big-boobs-pictures.xprv.com
  big-boobs-porn.com
  big-boobs-porn.net
  big-boobs-post.com
+big-boobs-sex-outlaws.blogspot.com
  big-boobs-sex.blogspot.ae
  big-boobs-sex.blogspot.al
  big-boobs-sex.blogspot.am
@@ -455404,6 +455429,7 @@ bitoprotwdwallet.000webhostapp.com
  bitoprowallet.000webhostapp.com
  bitoraxe.com
  bitothebi.tumblr.com
+bitporn18.blogspot.com
  bitpornhub.com
  bitporno.com
  bitporno.ru
@@ -488282,6 +488308,7 @@ bokepanaksekolahan.hosthorde.net
  bokepasu.new9.my.id
  bokepbandungtantevsponakanpart2terbaru2020.000webhostapp.com
  bokepbangbang.000webhostapp.com
+bokepbarat.mobi
  bokepbaruviral.servemp3.com
  bokepbos.new9.my.id
  bokepchat.wa-18.com
@@ -550680,6 +550707,7 @@ buttspictures.com
  buttspigsnsluts.tumblr.com
  buttsplay.18amateur.net
  buttspy.com
+buttsqueeze.blogspot.com
  buttsroad.com
  buttstagram.com
  buttstar.webjump.com
@@ -561081,6 +561109,7 @@ cam2cam-community.de
  cam2cam-erotikchat.com
  cam2cam-fille.com
  cam2cam-flash.com
+cam2cam-free-cyber-sex-no-registration.udivin.ru
  cam2cam-girls-chat.com
  cam2cam-girls.net
  cam2cam-king.com
@@ -568281,6 +568310,7 @@ campusporn.com
  campusporno.com
  campuss.net
  campussluts.com
+campusstory.be
  campusstuds.com
  campussy.nl
  campussys.com
@@ -576321,6 +576351,7 @@ captainkreten.tumblr.com
  captainlesbianporno.tumblr.com
  captainlikes2play.tumblr.com
  captainlookielou.tumblr.com
+captainloudcollectorninja.tumblr.com
  captainmacsfishhouse.com
  captainmancraig.tumblr.com
  captainmoliveira.tumblr.com
@@ -599000,6 +599031,7 @@ celeb.pl
  celeb.slonov.net
  celeb.to
  celeb.today
+celeb1000.blogspot.com
  celeb13.tripod.com
  celeb2000.com
  celeb24.de
@@ -612499,6 +612531,7 @@ cerisesexy.canalblog.com
  cerisesurgateau.canalblog.com
  cerisex.com
  cerita-porno.net
+cerita-seks-melayuy3.blogspot.com
  ceritabuatcoli.blogspot.ae
  ceritabuatcoli.blogspot.al
  ceritabuatcoli.blogspot.am
@@ -613314,6 +613347,7 @@ ceskeporno.com
  ceskepornozdarma.cz
  cesky-sex.cz
  ceskysex.info
+ceskytelefonniseznam.com
  cesnaproducciones.com
  cespenar-virethorn.tumblr.com
  cessvetetme1975.blogspot.ae
@@ -657676,6 +657710,7 @@ clintredwoodhelp.com
  clints-blog.tumblr.com
  clintsporn.tumblr.com
  clioadams.tumblr.com
+clip-14268.blogspot.com
  clip-2-mature.com
  clip-de-sexe.com
  clip-free-porn.singova.org
@@ -668753,6 +668788,7 @@ cockharnesses.com
  cockhaven.tumblr.com
  cockheadlovr.tumblr.com
  cockheaven.com
+cockhero.info
  cockhogs.com
  cockholmsyndrome.tumblr.com
  cockhorny.com
@@ -690826,6 +690862,7 @@ copair.org
  coparmexpuebla.org
  copashti.com
  copavflex.com.br
+copbydayfangirlbynight.tumblr.com
  copcopl.com
  copcoq.canalblog.com
  copd.terrashare.com
@@ -728366,6 +728403,7 @@ cumtube.nl
  cumtubes.com
  cumtubesonline.com
  cumtumbler.com
+cumtv-d554.blogspot.com
  cumtv-webcam-chat.com
  cumtv.cjb.net
  cumtv.com
@@ -732216,6 +732254,7 @@ cute-shemale.net
  cute-shemales.com
  cute-shotadicks.tumblr.com
  cute-shukujyo.com
+cute-slut-kourtney.tumblr.com
  cute-stacy-silver.blogspot.ae
  cute-stacy-silver.blogspot.al
  cute-stacy-silver.blogspot.am
@@ -740180,6 +740219,7 @@ daddy-needs-love.tumblr.com
  daddy-notice-me.tumblr.com
  daddy-of-the-angel.tumblr.com
  daddy-perfection.tumblr.com
+daddy-porn-videos.com
  daddy-porn.com
  daddy-princesa.tumblr.com
  daddy-said-deeper-whore.tumblr.com
@@ -760298,6 +760338,7 @@ davidbaptistechirot.blogspot.tw
  davidbaptistechirot.blogspot.ug
  davidbetta.com
  davidbetty18.tumblr.com
+davidbigcock69.tumblr.com
  davidbowiesdarksexualhabits.tumblr.com
  davidboy.com
  davidboyz300.tumblr.com
@@ -789160,6 +789201,7 @@ dgporn.com
  dgpxezvibybnlvxaeysfjtwctv-dot-gloff849483.uk.r.appspot.com
  dgqgboudhlymponcbyaltiapji-dot-gleowayel400503.uc.r.appspot.com
  dgqptrjtazcteiqs-dot-millinium.ey.r.appspot.com
+dgrandevideodanez.blogspot.com
  dgreitkelis.lt
  dgret.xyz
  dgrizzly.tumblr.com
@@ -805760,6 +805802,7 @@ dirtypansexuallove.tumblr.com
  dirtypantiepics.tumblr.com
  dirtypanties.net
  dirtypanties.startspot.nl
+dirtypantiesconnoisseur.tumblr.com
  dirtypantieslist.com
  dirtypants.tumblr.com
  dirtypanty.net
@@ -830661,6 +830704,7 @@ dreamgirlusa.com
  dreamgirlwebcams.com
  dreamgirlz.co.uk
  dreamgirlzelite.tumblr.com
+dreamgirlzzz.blogspot.com
  dreamhooker.com
  dreamhot.centerblog.net
  dreamhouse.in.th
@@ -856557,6 +856601,7 @@ eeredirect.info
  eerlijkesex.nl
  eerna.com.bd
  eernejd-diskl.com
+eerodromee.blogspot.com
  eeroticsex.com
  eerotikka.tumblr.com
  eerste-gangbang.startspot.nl
@@ -859116,6 +859161,7 @@ ektoralx-gmrnsqrihx.cwp.com.pe
  ektorbaboden88.tumblr.com
  ektronix.tumblr.com
  ekttdkomtaggdjhyfnwehvfftc-dot-gloff849483.uk.r.appspot.com
+ektwr.blogspot.com
  ekurgu.anadolu.edu.tr
  ekurhulenigovza2020upt.000webhostapp.com
  ekurumsalgiris-hemenbasvurumm.com
@@ -880238,6 +880284,7 @@ enjoythefantasy.com
  enjoytheporn.com
  enjoytheride91.tumblr.com
  enjoythesexytimes.tumblr.com
+enjoytits.blogspot.com
  enjoytits.tumblr.com
  enjoyus.com
  enjoyusnaked.tumblr.com
@@ -889350,6 +889397,7 @@ erostopp.de
  erostore.at
  erostore.cz
  erostore.de
+erostories.xyz
  erostory.canalblog.com
  erostory.pl
  erostower.de
@@ -944708,6 +944756,7 @@ familyviolation.com
  familyxxxincest.com
  famish.biz
  famke.startspot.nl
+famkejanssenfake.blogspot.com
  famkejorg.tumblr.com
  famluver.tumblr.com
  fammilecorna.tumblr.com
@@ -960523,6 +960572,7 @@ felisardon.temp.swtest.ru
  feliskedi.tumblr.com
  felisnox.com
  felissexxx.tumblr.com
+felitsatauekugeq.blogspot.com
  felix09719.tumblr.com
  felix1167.tumblr.com
  felix200us.tumblr.com
@@ -964299,6 +964349,7 @@ fembomb.com
  femboy-furry-comics.tumblr.com
  femboy-irina-deactivated2016012.tumblr.com
  femboy-xd.tumblr.com
+femboy.club
  femboyaddict.com
  femboyadventures.tumblr.com
  femboyatheart.tumblr.com
@@ -972846,6 +972897,7 @@ fetischmodel.com
  fetischnetz.com
  fetischoutfit.de
  fetischpark.de
+fetischpartiessm.blogspot.com
  fetischpartner.com
  fetischpass.com
  fetischpass.de
@@ -1004818,6 +1004870,7 @@ forum-hard.fr
  forum-intime.com
  forum-lingerie.com
  forum-porno.fr
+forum-pornodump-net.blogspot.com
  forum-sex-austria.com
  forum-sex.al.crazy-wet-web.com
  forum-sex.bds0d.com
@@ -1010101,6 +1010154,7 @@ fr.bravesporno.com
  fr.buzzimag.com
  fr.cam.exposed
  fr.chat.tchatche.com
+fr.gratisnederlandseporno.com
  fr.huuo.com
  fr.investdiamond.com
  fr.lanetubeporn.com
@@ -1030394,6 +1030448,7 @@ free-xxx-passwords-sex-pics-and-porn-movies.com
  free-xxx-passwords-sex-porn-pics-ultra-gay-movies-xxx-stories.com
  free-xxx-passwords-xxx-sex-pics-movies-ultra.com
  free-xxx-photo.com
+free-xxx-pics-jug.blogspot.com
  free-xxx-pics.de
  free-xxx-pics.szm.com
  free-xxx-picture.blogspot.ae
@@ -1038688,6 +1038743,7 @@ freehentaisexporn.com
  freehentaitentacles.com
  freehentaivideo.net
  freehentaivideoss.com
+freehentaivideostifa.blogspot.com
  freehentaivids.com
  freehentaiworld.com
  freehentia.net
@@ -1051075,6 +1051131,7 @@ freetube8porn.com
  freetubecats.com
  freetubegalore.com
  freetubegolic.com
+freetubehub.com
  freetubemovs.info
  freetubeonly.com
  freetubeporn.net
@@ -1063915,6 +1063972,7 @@ fuckingpaddy.tumblr.com
  fuckingparadiz.skyblog.com
  fuckingparties.com
  fuckingpause.com
+fuckingpenetration.blogspot.com
  fuckingpersonale.tumblr.com
  fuckingpervert.com
  fuckingphotograph.com
@@ -1073097,6 +1073155,7 @@ funkyfiona.tumblr.com
  funkygalaxy.com
  funkygalleries.com
  funkygirl.mabulle.com
+funkyguste.blogspot.com
  funkyhippiefreak.tumblr.com
  funkyhot.com
  funkymamajama.blog.com
@@ -1080195,6 +1080254,7 @@ galeriegwiazdyporno.com
  galerieimages.com
  galerieisabelle.free.fr
  galerielibertine.com
+galerieparisi.fr
  galeriephotoporno.com
  galeriephotosex.canalblog.com
  galeriephotosexe.canalblog.com
@@ -1092477,6 +1092537,7 @@ gay-heaven.tumblr.com
  gay-heiss.tumblr.com
  gay-hemsworth-geek.tumblr.com
  gay-hentai-art.com
+gay-hentai-lesbian.blogspot.com
  gay-hentai-porn.com
  gay-hentai-yaoi.blogspot.ae
  gay-hentai-yaoi.blogspot.al
@@ -1134039,6 +1134100,7 @@ gifbang.tumblr.com
  gifboom.com
  gifbug.com
  gifbug.tumblr.com
+gifcandy.net
  gifcbqaqokcinadn-dot-millinium.ey.r.appspot.com
  gifcommefirefuck.tumblr.com
  gifconnexxxion.centerblog.net
@@ -1135108,6 +1135170,7 @@ gigu.ga
  gigxmzxapfemxumt-dot-millinium.ey.r.appspot.com
  gigxxx.com
  gihanze.com
+gihevixodamanek.blogspot.com
  gihixomi37.tumblr.com
  giiahfiejhg.cn
  giibkhtfqxatjdal-dot-millinium.ey.r.appspot.com
@@ -1172473,6 +1172536,7 @@ groundsex.com
  groundstodivorceme.tumblr.com
  groundupprojects.com
  groundwater.co.ke
+groundzerosimp.tumblr.com
  group----sex.com
  group---sex.com
  group-0-gays.tumblr.com
@@ -1173746,6 +1173810,7 @@ groupsexyfucking.tumblr.com
  groupsexynew2020whatsapp.otzo.com
  groupsexywhatsappjoin2020.xxuz.com
  groupsfreegabung.000webhostapp.com
+groupsgaycollegehunk.blogspot.com
  groupsgayhunkdick.blogspot.ae
  groupsgayhunkdick.blogspot.al
  groupsgayhunkdick.blogspot.am
@@ -1176317,6 +1176382,7 @@ gtx1.tumblr.com
  gtxgiveaway.fun
  gtxlpfirefly.000webhostapp.com
  gtxwlhvkkhofcxuo-dot-millinium.ey.r.appspot.com
+gtxxxtreme.blogspot.com
  gtxxxtreme.com
  gtysgx.com
  gtyuvbjnbnbppicf-dot-millinium.ey.r.appspot.com
@@ -1185688,6 +1185754,7 @@ hairyguysingayporn.tumblr.com
  hairyguysonline.com
  hairyguysrule.tumblr.com
  hairyhardtube.com
+hairyharleys.blogspot.com
  hairyharrietta.tumblr.com
  hairyhd.com
  hairyhere.com
@@ -1193184,6 +1193251,7 @@ hardcore-cartoon-sex-toons.com
  hardcore-cartoons.com
  hardcore-chubby-porn.com
  hardcore-clip.net
+hardcore-clips.blogspot.com
  hardcore-club.org
  hardcore-comics.com
  hardcore-community.de
@@ -1204836,6 +1204904,7 @@ hdmaxtube.com
  hdmedicalexams.net
  hdmilez.tumblr.com
  hdmilfclips.com
+hdmilftube.com
  hdmilfvideos.com
  hdmmlrqcdrytjwye-dot-millinium.ey.r.appspot.com
  hdmobilepornvideo.com
@@ -1211828,6 +1211897,7 @@ hentai-central.tumblr.com
  hentai-chica.tumblr.com
  hentai-chicks-with-dicks.tumblr.com
  hentai-classik.ze.cx
+hentai-clips.blogspot.com
  hentai-collection.com
  hentai-comics.ca.tc
  hentai-comics.com
@@ -1214656,6 +1214726,7 @@ hentaichunks.com
  hentaicinema.com
  hentaicity.unblog.fr
  hentaiclan.com
+hentaiclassification.blogspot.com
  hentaiclick.com
  hentaiclicker.com
  hentaiclip.com
@@ -1283785,6 +1283856,7 @@ hotpagina.nl
  hotpaginas.nl
  hotpainsex.com
  hotpakiaunts.tumblr.com
+hotpakistanisexdating.blogspot.com
  hotpalegays.tumblr.com
  hotpamelaanderson.terrashare.com
  hotpanties1.tumblr.com
@@ -1307835,6 +1307907,7 @@ i-free-gay-movie.blogspot.tw
  i-free-gay-movie.blogspot.ug
  i-free-porn.com
  i-free-sex-pictures.com
+i-free-sex-story.blogspot.com
  i-fuck-better.tumblr.com
  i-fuck-like-abeast.tumblr.com
  i-fuck-like-you-wanna-fuck.tumblr.com
@@ -1326556,6 +1326629,7 @@ indianauntyworld.blogspot.ug
  indianbabess.com
  indianbamboo.tumblr.com
  indianbangalorescorts.com
+indianbbwdominance.blogspot.com
  indianbears.tumblr.com
  indianbeautiespoint.com
  indianbeautifulgirlsphoto.blogspot.ae
@@ -1337794,6 +1337868,7 @@ interracial-amateur-1.com
  interracial-amateur-sex.com
  interracial-anal-porn.com
  interracial-anal-sex.com
+interracial-anal.blogspot.com
  interracial-anal.net
  interracial-and-stuff.tumblr.com
  interracial-archives.tumblr.com
@@ -1344849,6 +1344924,7 @@ iroveri.com
  irox.biz
  irp2345.tumblr.com
  irpbmxntwggzmaazpecygbsroi-dot-gleowayel400503.uc.r.appspot.com
+irplanet.blogspot.com
  irplbhfjaeohbbdt-dot-millinium.ey.r.appspot.com
  irporel.com
  irpornaddict.tumblr.com
@@ -1353604,6 +1353680,7 @@ jackosman2.blogspot.tw
  jackosman2.blogspot.ug
  jackospadesxxx.tumblr.com
  jackperv.tumblr.com
+jackpeterson4402.blogspot.com
  jackporntube.com
  jackpot4u.tumblr.com
  jackpotescorts.com
@@ -1364716,6 +1364793,7 @@ javfreer18.blogspot.sn
  javfreer18.blogspot.tw
  javfreer18.blogspot.ug
  javfuck.com
+javfull.net
  javfull.tv
  javfun.me
  javgalleries.com
@@ -1364793,6 +1364871,7 @@ javhd.today
  javhd3x.com
  javhdfree.net
  javhdindo18.4free9.com
+javhdporn.net
  javhentaitv.com
  javhihi.com
  javhole.com
@@ -1398256,6 +1398335,7 @@ justwishtobeacuterealgirlygirl.tumblr.com
  justwives.tumblr.com
  justwondering6770.tumblr.com
  justwordme6.tumblr.com
+justwritezz.tumblr.com
  justx.com
  justxhamster.com
  justxnxx.com
@@ -1399023,6 +1399103,7 @@ k2s8r8o50h9nkxrvf73xxx.usercash.com
  k2sporn.com
  k2studio.com
  k2svfrzqzaf0tcbtv5f5.usercash.com
+k2thaizo.tumblr.com
  k2thbjzelenkq3026vdl41w.usercash.com
  k2uctluu3z23eaxrdj74gn.usercash.com
  k2vt3gulpkgnut4i8mgku.usercash.com
@@ -1429074,6 +1429155,7 @@ knowsherplace.tumblr.com
  knowshow2useit.tumblr.com
  knowsomefacts.000webhostapp.com
  knowswhathelikes.tumblr.com
+knowucd.com
  knowwhatsfuckingcrazy.tumblr.com
  knowyong.com
  knowyourgayporn.com
@@ -1429187,6 +1429269,7 @@ knunse.tk
  knuppelkut.nl
  knusprig-titten-hitler.tumblr.com
  knutbewersdorffde.chifanaudit.top
+knutcampbellallegan.blogspot.com
  knutczpgotuqpavetsiewjzloj-dot-gleowayel400503.uc.r.appspot.com
  knutsach.tumblr.com
  knutschkontakt.de
@@ -1439513,6 +1439596,7 @@ labelle-treff.de
  labelle11.book.fr
  labellecourtisane.com
  labelled-sex-pictures.com
+labelleeurope.be
  labellefemme.over-blog.com
  labellesophie.blogs.fr
  labellesuzon.com
@@ -1445031,6 +1445115,7 @@ lafesseefantasmee.blogspot.sn
  lafesseefantasmee.blogspot.tw
  lafesseefantasmee.blogspot.ug
  lafesseex.canalblog.com
+lafesseillustre.blogspot.com
  lafetichiste.com
  lafetishpride.com
  laffitte-beijing.com
@@ -1488590,6 +1488675,7 @@ liliclub.com
  liliesandbeauties.org
  lilifrance2015.tumblr.com
  liligirly91.skyblog.com
+liligrololos.blogspot.com
  lilijensen.com
  lilikhendarwati.com
  lililamazone.canalblog.com
@@ -1498875,6 +1498961,7 @@ live-cybersex-girls-sexlog.blogspot.sk
  live-cybersex-girls-sexlog.blogspot.sn
  live-cybersex-girls-sexlog.blogspot.tw
  live-cybersex-girls-sexlog.blogspot.ug
+live-cybersex-girls-zone.blogspot.com
  live-cybersex.de
  live-dirty-sex.com
  live-doctor-chat.dacp.org
@@ -1510751,6 +1510838,7 @@ localsextoday.com
  localsexyfriends.com
  localshemales.com
  localshemalesex.com
+localslutz.blogspot.com
  localsnapsext.com
  localswingers.com
  localswingersca.com
@@ -1524506,6 +1524594,7 @@ loveshoponline.ca
  loveshoppe.com
  loveshow.pl
  lovesickcorrectiveapparel.com
+lovesilkythings.tumblr.com
  lovesissybois.tumblr.com
  lovesissyshemale.tumblr.com
  lovesissysluttammy.tumblr.com
@@ -1572163,6 +1572252,7 @@ mature-sex.tv
  mature-sex.ultra3d.net
  mature-sex.us
  mature-sex.us.tc
+mature-sex.vip
  mature-sex.ws
  mature-sex.ze.cx
  mature-sex.zzw.pl
@@ -1586707,6 +1586797,7 @@ megandouglas.com
  meganeryan.unblog.fr
  meganeryan2.unblog.fr
  meganetnews.com
+meganfoxx18.blogspot.com
  meganfoxxxdaily.tumblr.com
  meganickaroo.tumblr.com
  meganie-webcam-strip-show.hotsexc.com
@@ -1611112,6 +1611203,7 @@ milfs.pro
  milfs.tumblr.com
  milfs2bang.com
  milfs30.tumblr.com
+milfs310108.blogspot.com
  milfs333.tumblr.com
  milfs40plus.tumblr.com
  milfs4fun.com
@@ -1630193,6 +1630285,7 @@ moderngirlsmovie.blogspot.sk
  moderngirlsmovie.blogspot.sn
  moderngirlsmovie.blogspot.tw
  moderngirlsmovie.blogspot.ug
+moderngirlswrlds.blogspot.com
  modernhentaiporn.com
  moderninvestments.icu
  modernishlife.tumblr.com
@@ -1652237,6 +1652330,7 @@ mssuperdomebooty.com
  mssvuthmsvsv.azurewebsites.net
  mssystems.com.pk
  mst-ang.com
+mst8.me
  mstammyaz.tumblr.com
  mstammysboi.tumblr.com
  mstanya.blogspot.ae
@@ -1662293,6 +1662387,7 @@ my3ddreams.com
  my3dgirlfriends.com
  my3dhentai.com
  my3dporn.com
+my3dporncomics.tumblr.com
  my3dporno.com
  my3dsex.com
  my3dtoons.com
@@ -1668887,6 +1668982,7 @@ mygirlisexposed.tumblr.com
  mygirllovesanal.com
  mygirllovesperm.tumblr.com
  mygirlnudeandhot.tumblr.com
+mygirls.me
  mygirlsdog.tumblr.com
  mygirlsex.com
  mygirlsfantasys.tumblr.com
@@ -1684749,6 +1684845,7 @@ nakedamateurguys.blogspot.sn
  nakedamateurguys.blogspot.tw
  nakedamateurguys.blogspot.ug
  nakedamateurmilf.com
+nakedamateurpics.blogspot.com
  nakedamateurpics.tumblr.com
  nakedamateurporn.com
  nakedamateurporn.net
@@ -1690265,6 +1690362,7 @@ namethatporno.com
  namethatpornstar.com
  namethatredhead.tumblr.com
  namethatsextoy.com
+nametheporn.blogspot.com
  nameyourring.com
  namfbsh.tw
  nami-porn.xyz
@@ -1699715,6 +1699813,7 @@ naughtyhanna.tumblr.com
  naughtyhardcorehousewife.com
  naughtyheadnurse.com
  naughtyhentai.biz
+naughtyhentai.com
  naughtyhigh.com
  naughtyhillary.com
  naughtyholes.com
@@ -1703749,6 +1703848,7 @@ ne4tflix2-inf0.com
  ne666an.xyz
  neadfreak.tumblr.com
  neakz456.tumblr.com
+nealevmtioinlfw.blogspot.com
  nealhelps.com
  nealhunterhyde.com
  neallaw.ca
@@ -1710931,6 +1711031,7 @@ new-xnxx.com
  new-xvideos.com
  new-xxx-sites.com
  new-york-alley-31395.pancakeapps.com
+new-york-callgirls.tumblr.com
  new-york-escorts.com
  new-york-sex.com
  new-york-singles-swingers-dating.sinfree.net
@@ -1712745,6 +1712846,7 @@ newpornstars.net
  newpornstars.tumblr.com
  newpornstars.tv
  newpornstartube.com
+newpornstarxx3.blogspot.com
  newporntalents.com
  newporntalents.net
  newporntoday.com
@@ -1713317,6 +1713419,7 @@ newshemalegirlfriends.tumblr.com
  newshemalemodels.com
  newshemalesex.com
  newshemaletube.com
+newshoetouch.tumblr.com
  newshothardcoresex2.blog.fc2.com
  newshotmovies.blogspot.ae
  newshotmovies.blogspot.al
@@ -1728646,6 +1728749,7 @@ noonproposition76.com
  nooo11.ddns.net
  nooooiiice.tumblr.com
  nooootsfw.tumblr.com
+noopsterstories.blogspot.com
  noor.me.ke
  noor.school
  nooragifts.com
@@ -1732659,6 +1732763,7 @@ novinhascamonlinex.blogspot.sn
  novinhascamonlinex.blogspot.tw
  novinhascamonlinex.blogspot.ug
  novinhasdoporno.com
+novinhasdoyoutube.blogspot.com
  novinhasdozapzap.com
  novinhasexohd.com
  novinhasgozando.com
@@ -1736257,6 +1736362,7 @@ nude-asians.com
  nude-asians.net
  nude-asiansex.com
  nude-ass-pics.com
+nude-ass.blogspot.com
  nude-ass1.com
  nude-attitude.com
  nude-babe-sex.com
@@ -1736662,6 +1736768,7 @@ nude-cameltoe-pics.blogspot.sk
  nude-cameltoe-pics.blogspot.sn
  nude-cameltoe-pics.blogspot.tw
  nude-cameltoe-pics.blogspot.ug
+nude-cams-cybersex.blogspot.com
  nude-cams-live-sex-chat.com
  nude-cams.net
  nude-candace-bailey.blogspot.ae
@@ -1746328,6 +1746435,7 @@ nudesex.co.uk
  nudesex.com
  nudesex.net
  nudesex.org
+nudesex3911.blogspot.com
  nudesex4u.com
  nudesexadultgayonwebcam.blogspot.ae
  nudesexadultgayonwebcam.blogspot.al
@@ -1755214,6 +1755322,7 @@ obnova.zzux.com
  obnoxiousdick.tumblr.com
  obnoxiousfucker.tumblr.com
  oboa.on.ca
+obocorunuxenon.blogspot.com
  oboksa.com
  obolko.site
  obolsolutions.com
@@ -1762999,6 +1763108,7 @@ oldladyboobies.com
  oldladyboobs.com
  oldladyphonesex.com
  oldladyporn.com
+oldladyporn.net
  oldladypornpics.com
  oldladypornxxx.com
  oldladysex.com
@@ -1765866,6 +1765976,7 @@ omgkewl.net
  omgkingsgloriousorgysex.tumblr.com
  omgkinkykikistuff.tumblr.com
  omgkinkylonerlove.tumblr.com
+omgkrisblr.tumblr.com
  omgletsfucktonight.tumblr.com
  omglicketysplitsposts.tumblr.com
  omglingerie.tumblr.com
@@ -1789249,6 +1789360,7 @@ padronaamanda.com
  padronaamanda.org
  padronetv.tumblr.com
  padultsextoysq.com
+padxfi.blogspot.com
  paedosexualitaet.de
  paegrooiqhxtxkuy-dot-millinium.ey.r.appspot.com
  paelladick.com
@@ -1791472,6 +1791584,7 @@ pakistanicutegirls.blogspot.sn
  pakistanicutegirls.blogspot.tw
  pakistanicutegirls.blogspot.ug
  pakistanifood.giize.com
+pakistaniporn2.com
  pakistanipornvideos.net
  pakistanipornvideos.org
  pakistanisex.net
@@ -1825597,6 +1825710,7 @@ petite-bodies-tiny-tits.tumblr.com
  petite-bourgeoise.com
  petite-branlette.com
  petite-catin.tumblr.com
+petite-catty.blogspot.com
  petite-chargeur.tumblr.com
  petite-chaudasse.com
  petite-choufleur.tumblr.com
@@ -1856069,6 +1856183,7 @@ playsexe.fr
  playsexegratuit.com
  playsexgame.com
  playsexgames.com
+playsexgames.men
  playsexmegastore.com
  playsexmovies.com
  playsexnow.com
@@ -1887271,6 +1887386,7 @@ pornarmyfaction.net
  pornaroid.tumblr.com
  pornaroo.com
  pornaround.com
+pornaroundtheworld.blogspot.com
  pornarray.com
  pornarray.tumblr.com
  pornars.com
@@ -1887651,6 +1887767,7 @@ pornbase.org
  pornbase.ws
  pornbasement.com
  pornbash.com
+pornbasic.com
  pornbasis.com
  pornbastards.com
  pornbatmanhentai.com
@@ -1889292,6 +1889409,7 @@ porncinema.ch
  porncinema.com
  porncinema.org
  porncinema.tumblr.com
+porncinemainwomannakedsexse.blogspot.com
  porncinemapass.com
  porncinemas.com
  porncinemax.com
@@ -1893950,6 +1894068,7 @@ pornguides.com
  pornguides.net
  pornguilty.com
  porngumbo.com
+porngun.net
  porngunz.com
  porngur.com
  porngurra.com
@@ -1902787,6 +1902906,7 @@ porno-sexe-x.chez.tiscali.fr
  porno-sexe-x.com
  porno-sexe.be
  porno-sexe.biz
+porno-sexe.blogspot.com
  porno-sexe.ca
  porno-sexe.com
  porno-sexe.eu
@@ -1926293,6 +1926413,7 @@ pornstar-biography.com
  pornstar-bitches.com
  pornstar-blog.net
  pornstar-blowjobs.com
+pornstar-bondage.blogspot.com
  pornstar-bookmarks.com
  pornstar-briana-banks.com
  pornstar-brianabanks.com
@@ -1942117,6 +1942238,7 @@ preggobangers.com
  preggobellycummer1974.tumblr.com
  preggobellyxxx.tumblr.com
  preggoboobs.com
+preggocaptions.tumblr.com
  preggochicks.com
  preggodream.com
  preggodreams.com
@@ -1950736,6 +1950858,7 @@ privatesexfilms.com
  privatesexfilms.nl
  privatesexgallery.com
  privatesexgallery.net
+privatesexkontakt.blogspot.com
  privatesexkontakte.blogg.de
  privatesexkontakte.de
  privatesexmovies.com
@@ -1966256,6 +1966379,7 @@ pussypornoxxx.com
  pussypornoxxxtitts.com
  pussypornpics.com
  pussypornpics.net
+pussypornpics.org
  pussypornpictures.com
  pussypornsex.com
  pussypornstar.blogspot.com
@@ -1990118,6 +1990242,7 @@ real--sex.com
  real-adult-dating.com
  real-adult.ro
  real-alpha-men.tumblr.com
+real-amateur-fucks.blogspot.com
  real-amateur-hardcore-sex.com
  real-amateur-hotties.tumblr.com
  real-amateur-milfs.tumblr.com
@@ -2005487,6 +2005612,7 @@ rencontre-entre-libertins.blogspot.ug
  rencontre-erotique.tumblr.com
  rencontre-et-sexe.com
  rencontre-et-vous.com
+rencontre-extra-conjugale.blogspot.com
  rencontre-extraconjugale-gratuit.com
  rencontre-facile.eu
  rencontre-facile.fr
@@ -2019076,6 +2019202,7 @@ robertchandler.tumblr.com
  robertchouraqui.com
  robertclim.tumblr.com
  robertdays.com
+robertdesideria2985.blogspot.com
  robertdick.org
  robertfloresunite.com
  robertfuncklove.tumblr.com
@@ -2019596,6 +2019723,7 @@ rocareindia.co.in
  rocbattle.com
  rocboy69.tumblr.com
  roccabriviosforza.it
+rocco-siffredi-picture4554.blogspot.com
  rocco-siffredi.com
  rocco-siffredi.org
  rocco-xxx.theydirty.com
@@ -2027998,6 +2028126,7 @@ rt24.news
  rt2h.mentriqq.com
  rt2thepoint.tumblr.com
  rt3-webmail.serveuser.com
+rt5t656.blogspot.com
  rt7-webmail.serveuser.com
  rtabboo89.tumblr.com
  rtadpuhuqerczqnek.top
@@ -2053609,6 +2053738,7 @@ scatpaysites.com
  scatpig.tumblr.com
  scatpisssex.tumblr.com
  scatporn-tube.com
+scatporn.club
  scatporn.com
  scatporn.info
  scatporn.net
@@ -2060558,6 +2060688,7 @@ secondlifeporn.blogspot.sn
  secondlifeporn.blogspot.tw
  secondlifeporn.blogspot.ug
  secondlifesex.nl
+secondlifesex.tumblr.com
  secondlifesexe.com
  secondmoscow.ru
  secondporn.com
@@ -2072006,6 +2072137,7 @@ sensosleeper.com
  sensozone.fr
  sensso.com
  sensti.tumblr.com
+sensua.tumblr.com
  sensuagirls.com
  sensuaiseprovocantes.com
  sensual---gifs.tumblr.com
@@ -2073106,6 +2073238,7 @@ sensualmilf.com
  sensualmilf.tumblr.com
  sensualmindspa.com
  sensualmistress.com
+sensualmistressphonesex.blogspot.com
  sensualmoms.com
  sensualmothers.com
  sensualness.com
@@ -2120394,6 +2120527,7 @@ sexgratuit.perfecturl.com
  sexgratuit.piano-info.net
  sexgratuit.tv
  sexgratuit.ws
+sexgratuitfrancaisprisedeforcesexe.blogspot.com
  sexgratuitphoto.greatestjournal.com
  sexgreatlinks.com
  sexgreatsite.cn
@@ -2145977,6 +2146111,7 @@ sexroad.com
  sexroadtrip.com
  sexrobot.com
  sexrobotchatprogram.blogspot.com
+sexrobotchatwithman.blogspot.com
  sexrobotmonkey.tumblr.com
  sexrobots.com
  sexroby.it
@@ -2160562,6 +2160697,7 @@ sexvideohardcore.com
  sexvideohits.ru
  sexvideohost.com
  sexvideohq.com
+sexvideoin69.blogspot.com
  sexvideoindex.com
  sexvideoizle.tk
  sexvideoizlehd.com
@@ -2160661,6 +2160797,7 @@ sexvideoresim.com
  sexvideorussia.com
  sexvideos-1.de
  sexvideos-abz.de
+sexvideos-blog1.tumblr.com
  sexvideos-downloaden.com
  sexvideos-downloaden.de.tf
  sexvideos-dvd.com
@@ -2160685,6 +2160822,7 @@ sexvideos-tube.com
  sexvideos-tv.de
  sexvideos-umsonst.com
  sexvideos-umsonst.de.vu
+sexvideos-us.blogspot.com
  sexvideos-von.de
  sexvideos-x.com
  sexvideos-zum-downloaden.de.tf
@@ -2160813,6 +2160951,7 @@ sexvideosfree.blogspot.sn
  sexvideosfree.blogspot.tw
  sexvideosfree.blogspot.ug
  sexvideosfree.net
+sexvideosfreedownloads.blogspot.com
  sexvideosgratuit.fr
  sexvideosgratuit.free.fr
  sexvideoshere.com
@@ -2172840,6 +2172979,7 @@ sexy-mature-chick.com
  sexy-mature-gay.tumblr.com
  sexy-mature-ladies.com
  sexy-mature-lesbian.icp.in.ua
+sexy-mature-milf-sex-models.tumblr.com
  sexy-mature-older-woman.com
  sexy-mature-older-women.com
  sexy-mature-photos.com
@@ -2212255,6 +2212395,7 @@ sexyselenaspice.blogspot.ug
  sexyselenaspice.com
  sexyselfiealbum.tumblr.com
  sexyselfiebabes.tumblr.com
+sexyselfiebabes101.tumblr.com
  sexyselfieblonde.tumblr.com
  sexyselfiebonanza.tumblr.com
  sexyselfieme.tumblr.com
@@ -2218111,6 +2218252,7 @@ sexytrek.com
  sexytrend.ru
  sexytribu.com
  sexytribu.it
+sexytribute.tumblr.com
  sexytrick.com
  sexytrinas.com
  sexytrinastemple.com
@@ -2227504,6 +2227646,7 @@ shecock-lover.tumblr.com
  shecock-sucker.tumblr.com
  shecockboy.tumblr.com
  shecockisthebest.tumblr.com
+shecockorgy.com
  shecockscumming.tumblr.com
  shecocktales.tumblr.com
  shecockworld.tumblr.com
@@ -2230751,6 +2230894,7 @@ shemale-videos.blogspot.ug
  shemale-videos.com
  shemale-videos.net
  shemale-videos.org
+shemale-vids.blogspot.com
  shemale-web-review.com
  shemale-webcams.com
  shemale-webcams.net
@@ -2237861,6 +2238005,7 @@ shoeism.blogspot.sk
  shoeism.blogspot.sn
  shoeism.blogspot.tw
  shoeism.blogspot.ug
+shoejob.net
  shoekage.com
  shoelaundryhouse.com
  shoeloungeatl.com
@@ -2245645,6 +2245790,7 @@ sincindy.com
  sincinema.co.uk
  sincity.nl
  sincitychamberofcommerce.com
+sincityclips.blogspot.com
  sincitycouple4u.tumblr.com
  sincitydating.com
  sincitydigital.com
@@ -2252504,6 +2252650,7 @@ sissyslut4bigblackcock.tumblr.com
  sissyslut4cock.tumblr.com
  sissyslut4goddess.tumblr.com
  sissyslut664.tumblr.com
+sissyslut99.tumblr.com
  sissyslutallice.tumblr.com
  sissyslutapril.tumblr.com
  sissyslutariana.tumblr.com
@@ -2265626,6 +2265773,7 @@ slutsxxxporn.com
  slutsxxxposed.tumblr.com
  slutsxxxposed2.tumblr.com
  slutsy.net
+slutt-me.blogspot.com
  sluttbot.tumblr.com
  sluttcollection.tumblr.com
  sluttcunt.tumblr.com
@@ -2292530,6 +2292678,7 @@ spankingspot.blogspot.tw
  spankingspot.blogspot.ug
  spankingstarlets.com
  spankingstars.com
+spankingstoriesuk.blogspot.com
  spankingstory.net
  spankingstuff.com
  spankingtales.com
@@ -2320349,6 +2320498,7 @@ striptease-masturbation-orgy-2013.blogspot.ug
  striptease-poker.com
  striptease-porn.com
  striptease-studio89.com
+striptease-threesome-2013.blogspot.com
  striptease-xxx.com
  striptease.algemenestartpagina.nl
  striptease.com
@@ -2328224,6 +2328374,7 @@ suckmebionic.tumblr.com
  suckmebitch-review.com
  suckmebitch.com
  suckmeboobs.com
+suckmefuckme.blogspot.com
  suckmefuckmekissmemissme.tumblr.com
  suckmefuckmeomg.tumblr.com
  suckmefuckmepayme.tumblr.com
@@ -2339895,6 +2340046,7 @@ suzybuzy.blogspot.ug
  suzyerotika.hu
  suzyminx.tumblr.com
  suzymovs.com
+suzypants.blogspot.com
  suzyq.com
  suzyq.modelcentro.com
  suzysake.com
@@ -2359485,6 +2359637,7 @@ taumiq.com
  taunfolds.tumblr.com
  taunus27.com
  taunussex.de
+taunyamorelli96-blog.tumblr.com
  taupunktberechnung.de
  taur.info
  taurasagency.com
@@ -2361758,6 +2361911,7 @@ tcporn.info
  tcporno.com
  tcpsessionsconnect.com
  tcrd.co.kr
+tcrichelle.be
  tcrldreajzshgqfjnpxeghzjiklmfzwwhdbp-dot-glxcel49934343434.rj.r.appspot.com
  tcs808.tumblr.com
  tcsbbuk.com
@@ -2361935,6 +2362089,7 @@ tdzy.lawapass.com
  te-ama.com
  te-en.com
  te-en.org
+te-girl-en.blogspot.com
  te-group.org
  te-sexe-anal.com
  tea-and-oranges.blogspot.ae
@@ -2375879,6 +2376034,7 @@ teenpornfinder.com
  teenpornflat.com
  teenpornforum.com
  teenpornfotos.com
+teenpornfreee.blogspot.com
  teenpornfresh.com
  teenpornfuck.com
  teenpornfun.com
@@ -2413815,6 +2413971,7 @@ thejoysofbeingleashed.blogspot.ug
  thejoyspot.co.uk
  thejswszead.com
  thejuicylatincocks.tumblr.com
+thejuicypage.tumblr.com
  thejuicypussy.com
  thejwolff1.tumblr.com
  thek.awaykart.com
@@ -2429405,6 +2429562,7 @@ thexxxsites.com
  thexxxstop.com
  thexxxstore.com
  thexxxteam.com
+thexxxvideos.blogspot.com
  thexxxvideos.com
  thexxxvids.com
  thexxxwebsite.hpg.ig.com.br
@@ -2443062,6 +2443220,7 @@ titsboobsbreasts.tumblr.com
  titsboobshooters.com
  titsboobsknockers.tumblr.com
  titsboobsnipples.com
+titsbox.com
  titsbrand-blog.tumblr.com
  titsbumslegs.tumblr.com
  titsburg.com
@@ -2447456,6 +2447615,7 @@ toilmikey.tumblr.com
  toincest.com
  toine2012.tumblr.com
  toioii.tumblr.com
+toituresfredledent.be
  toivn.com
  toiyeuvn.dongaruou.com
  tojo361.tumblr.com
@@ -2465531,6 +2465691,7 @@ trans-sexe.com
  trans-sexe.fr
  trans-sexe.org
  trans-sexe.ws
+trans-sexuales.blogspot.com
  trans-sexuals.com
  trans-sexualz.blogspot.ae
  trans-sexualz.blogspot.al
@@ -2469098,6 +2469259,7 @@ transsexualpictures.nu
  transsexualpix.com
  transsexualpixs.com
  transsexualplanet.com
+transsexualporn.blogspot.com
  transsexualporn.com
  transsexualporn.eu
  transsexualporn.net
@@ -2481132,6 +2481294,7 @@ tubemovie4k.com
  tubemovies4k.com
  tubemovies7.com
  tubemoviesclips.com
+tubemovs4k.com
  tubemovs8k.com
  tubemovz.com
  tubemu.com
@@ -2483544,6 +2483707,7 @@ turasogutmas.com
  turayanet.nckiregister.gdn
  turbanli-porno.com
  turbo-gay.tumblr.com
+turbo-porn.blogspot.com
  turbo-porno.com
  turbo-sex.com
  turbo-sexe.com
@@ -2497692,6 +2497856,7 @@ uncannyxxx.tumblr.com
  uncars.ru
  unccboy.tumblr.com
  uncencoredsex.com
+uncenf2c.blogspot.com
  uncenjapan.net
  uncenporn.com
  uncensites.com
@@ -2540883,6 +2541048,7 @@ vintagestreamvideo.com
  vintagetaboo.com
  vintageteenporn.com
  vintagethumbnails.com
+vintagetits.blogspot.com
  vintagetoons.net
  vintagetube.pro
  vintagetube.xyz
@@ -2568750,6 +2568916,7 @@ webcamsexchatten.startspot.nl
  webcamsexchatvrouwen.nl
  webcamsexchicks.com
  webcamsexcom.nl
+webcamsexcommunity.blogspot.com
  webcamsexcontact.nl
  webcamsexcontacten.nl
  webcamsexdames.be
@@ -2579668,6 +2579835,7 @@ wgkenny.com
  wgktsvbifwbbsmkvudtzfpvhxo-dot-gloff849483.uk.r.appspot.com
  wgmfcohtpdgzgfwfmqgyopveugmlwrobhucp-dot-cedar-code-289917.nn.r.appspot.com
  wgmmodmdhsehlfxhazzxcrozon-dot-gleowayel400503.uc.r.appspot.com
+wgnoticetitfuckpicfreexxxamateu.blogspot.com
  wgoegtunlhseatudfibvzizlseuypqahuktj-dot-solar-vertex-285913.rj.r.appspot.com
  wgporn.info
  wgporn.ru
@@ -2592408,6 +2592576,7 @@ wmksex.bizland.com
  wmksex.chat.ru
  wmkxh.onderhost.com
  wmm.theedgecom.com
+wmmad.blogspot.com
  wmmforum.com
  wmmgb.com
  wmmp0wwqpcuser.dt.r.appspot.com
@@ -2608001,6 +2608170,7 @@ xasiangirl.com
  xasiangirlsx.tumblr.com
  xasiankoreanx.blog.excite.it
  xasianorgy.com
+xasianpornx.blogspot.com
  xasians.com
  xasiansex.com
  xasiansluts.com
@@ -2632345,6 +2632515,7 @@ xxxmail.com
  xxxmail.net
  xxxmain.com
  xxxmaja.com
+xxxmaldiveslivecams.blogspot.com
  xxxmale.tumblr.com
  xxxmalegaypicsxxx.tumblr.com
  xxxmalesex.com
@@ -2637210,6 +2637381,7 @@ xxxvegavixen.free.fr
  xxxventure.com
  xxxverhalen.nl
  xxxvery.com
+xxxverystream.blogspot.com
  xxxvibrators.com
  xxxvice.com
  xxxvid-cd.com
@@ -2646505,6 +2646677,7 @@ youngasiansex.net
  youngasiansex.tumblr.com
  youngasiansexbabes.com
  youngasianteen.com
+youngasiantrannies.blogspot.com
  youngasiantubes.com
  youngasiantubes.net
  youngass.com
@@ -2649501,6 +2649674,7 @@ youpicktube.com
  youplaisir.com
  youplaporn.com
  youplaywithmycock.com
+youporn-18.blogspot.com
  youporn-clips.com
  youporn-deutsch.com
  youporn-deutsch.tv
@@ -2657339,6 +2657513,7 @@ zeldasmaturepics.tumblr.com
  zeldatube.pro
  zeldaxxx.pro
  zeleader.com
+zeleniyteraceze.blogspot.com
  zelensek.beget.tech
  zelenushka.com
  zelf-vingeren.jouwpagina.nl
@@ -2658080,6 +2658255,7 @@ zgxzhpmfnpcsubptjh.top
  zgz5b.codesandbox.io
  zgzxqyrzwapp.cqhc.net
  zh.com.pl
+zh.hentai-cosplays.com
  zh.laiporn.com
  zh.rehom-logistics.com
  zh.sg
@@ -2664408,3 +2664584,23 @@ xxx
  porn
  sex
  adult
+xxx
+porn
+sex
+adult
+xxx
+porn
+sex
+adult
+xxx
+porn
+sex
+adult
+xxx
+porn
+sex
+adult
+xxx
+porn
+sex
+adult
diff --git a/blacklists/adult/urls b/blacklists/adult/urls

index 0789fe946869c16fa5e01a290b1e88652183223b..5c0d7803dcd3293451ad0609380d9f81bbc2a10a 100644 (file)
--- a/blacklists/adult/urls
+++ b/blacklists/adult/urls
@@ -1866,6 +1866,7 @@
  2brooklyn.tumblr.com/post/102608877972/iloveshemaledicks-i-love-shemale-dick-so-do
  2by-day.com/jasmine
  2by-day.com/sugar-stone
+2d-market.com/Browse
  2dehands.nl/computer/onderdelen/webcams/
  2dmax90.tumblr.com/post/123051420752
  2ememain.be/l/cd-dvd/q/hardcore
@@ -2487,6 +2488,7 @@
  8photos.com/pics/Models
  8photos.com/pics2/Models/
  8teensyard.com/xs1
+8teenxxxhd.com/label
  8tracks.com/explore/bdsm
  8tracks.com/explore/bondage
  8tracks.com/explore/erotic
@@ -2890,6 +2892,7 @@ actressdirectory.org/E
  actressfakes.com/actress-farzana-nude-with-hairy-pussy-and-underarms
  actressfakes.com/porn-star-sunny-leone-lesbian-sex-pics
  actressfakes.com/sunny-leone-nude-naked-sex-pictures
+actressjav.com/miha-028-a-delivery-health-call-girl-who-
  actu-gay.com/fr
  actu-gay.eu/fr
  actu-star.be/tag/angelina-jolie
@@ -2935,6 +2938,7 @@ actustar.com/Actualites/19938
  actwin.com/beguildy
  acuerdate.dyndns.org/index.php/fotos-chicas-uax/
  acuriousmuse.blogspot.co.uk/2012
+acuteschoolgirl.blogspot.com/2008
  acw.loudeye.com/buenavista/bvmg/hollywoodrecords/jessemccartney_beautiful-soul_300.asx
  ad-mcr.info/sala_de_chat_para_adultos
  ad.100-gen.tbn.ru/cgi-bin/iframe/dreamsex
@@ -3126,7 +3130,6 @@ adultgalleryokvpr.blogspot.com/2020/12
  adultgallerywcoxa.blogspot.com/2020
  adulthotnewsxxx.blogspot.com/2016
  adulthumorjokes.blogspot.com/2016
-adultload-blog.blogspot.com/2013
  adultmatchdoctor.com/thread_91_13120_1
  adultmoviebooth.com.com/upskirt
  adultnode.com/iloveincest
@@ -3147,6 +3150,7 @@ adultswim.com/videos/webisodes/leon-andy-whore-wife
  adulttoymegastore.com.au/sex-toys/bondage_play
  adulttoysmale.blogspot.com/2019/04
  adultvideosarchive.com/aishe-pervers-slut-serves-her-pussy-on-the-menu
+adultwebcamkinkysexwulfst.blogspot.com/2009/08
  adultworld2.blogspot.fr/2013/03
  adultxpic.com/maggie-q-getting-fucked
  adultxpic.com/page
@@ -3301,6 +3305,7 @@ ahalia.com/adulte
  ahalia.com/annonces
  ahalia.com/sexe
  ahawallpaper.com/celebrities-female
+ahegaobaku.tumblr.com/post/616729869043253248/can-i-req-some-hate-sex-w-tobio-i-mean-not-hate
  ahhhyesss.tumblr.com/following/page/4
  ahidi.com/topphp
  ahirugama.com/cute82/Pacific-Girl
@@ -3565,7 +3570,6 @@ allamericansummercamps.com/summercampsex/
  allan.greve.com/babe
  allanfrost.tumblr.com/post/94685029240/shewantstosuck-gorgeous-naked-blowjob-girls
  allanswalk.com/portal_memberdata/portraits/mbeno
-allasianvids.com/fr/video/sexy-fuck-for-naughty-masseuse
  allbeautifulthingin.tumblr.com/post/137948819283
  allcarpictures.com/aston-martin
  allcenter.com.br/allcenter/home.asp
@@ -4131,7 +4135,6 @@ anaalgenomen.nl/mov
  anabundanceofporn.tumblr.com/post/129320679236/bestamateursex-sasha-grey-via-rnsfw
  anafor.ru/pics/erotic/
  anais.at/ecspay4it/private-livesex
-analcreampieshit.blogspot.com/2015
  analcult.net/post/129503464341/dildo-in-her-ass-finger-in-her-pussy
  analgapandmore.tumblr.com/post/109925705376/hatefuckingforbeginners-youre-thinking-the-law
  analisfunnyworld.tumblr.com/post/92144387556/dirty-sex
@@ -4430,6 +4433,7 @@ angelgolde.tumblr.com/likes/page/2
  angelicstockinganarchy.tumblr.com/post/137290755529/girls
  angelika.net/ladies
  angelikaminsk.com/ladies
+angelina-jolie-celebrity.blogspot.com/2019
  angelina-jolie-celebrity.blogspot.com/2019/06
  angelina-jolie-celebrity.blogspot.com/2019/12
  angelizeddevilme.tumblr.com/page/4
@@ -4509,7 +4513,6 @@ animatedtrannys.tumblr.com/post/132854486377/porn-ladyboy-dickgirl-sissy-shemale
  animationsbackgrounds.com/clipart/free_screensavers
  animaux.vivastreet.fr/donne-vend-chien-chat+hauts-de-seine/show_pics1858455
  animaux.vivastreet.fr/donne-vend-chien-chat/show_pics1820597
-anime-lesbians.blogspot.com/2005
  anime-ultime.net/file-0-1/1644-Kiss-X-Sis-Interdit-16-ans-vostfr-streaming-ddl-hd
  anime-ultime.net/file-0-1/2281-Panty-amp-Stocking-with-Garterbelt-vostfr-streaming-ddl-hd
  anime-ultime.net/file-0-1/3913-Rescue-Me-Interdit---16-ans-vostfr-streaming-ddl-hd
@@ -5225,6 +5228,7 @@ archives.dnip.net/movies
  archivesexyteens-blog.tumblr.com/post/126463096776/porn-teen-sex
  archivesexyteens-blog.tumblr.com/post/126545303616/mexican-teens-upskirt
  archivesexyteens-blog.tumblr.com/post/126786748876/anal-sex-xxx-porn-teen
+archivesexyteens-blog.tumblr.com/post/126790840771/young-adult-life-away
  archivesexyteens-blog.tumblr.com/post/126790939161/teen-adults-how
  archivio.panorama.it/cultura/libri/Non-solo-sesso-e-playmate-i-segreti-della-rivoluzione-firmata-Playboy
  arcigay.it/sessosicuro/
@@ -5546,6 +5550,7 @@ asiangirl2015.tumblr.com/post/109483220947/can-you-do-a-smut-about-bts-v-catchin
  asianngentot.blogspot.com/2019
  asianpays.com/extra
  asianpays.com/newbanners
+asianpornset.com/en/free-asian-category/cTAtMTEzNy0xMTE
  asianqmschoolgirlqmsluts.blogspot.com/2009/01
  asiansex.co/mf.php
  asiansister.com/v_vide_364_Wet_inside_pussy_horny_girl_shaved_pussyn
@@ -5889,7 +5894,6 @@ avadianneday.com/adult-categories/baby
  availableimages.com/celebs
  avaleuse.eu/blog
  avalon.net/~reaper/v
-avanalofficialblog.blogspot.com/2015
  avancecv.com/img/icons/tabs/image
  avatarme.com/FACIAL
  avatarme.com/SHEMALE
@@ -6115,6 +6119,7 @@ baddogsites.com/Entertainment/Adult
  badgerherald.com/artsetc/2014/02/05/hump-day-simple-tips-give-fantastic-fucking-blowjob-es
  badgif.tumblr.com/post/52738599902
  badgirls.pl/tancerki-erotyczne/
+badgirlsgetit.blogspot.com/2006
  badhairdays.fr/tag/petite-culotte
  badlittlemonkey.tumblr.com/post/99182352573/allsportsgirls-hottest-whore-erotic-bitches
  badmovies.org/othermovies/terrorfirmer/
@@ -6230,7 +6235,6 @@ bandfordpic.bloground.ru/2008/02/03/free-naked-picture-of-alina-and-nude-carmen-
  bandwidthcrazy.com/marksphpbb
  bane-huntress.com/Bohra%5FNaono/
  bangboobs.blogspot.com/2009/12
-bangcock101.blogspot.com/2020/12
  bangkok.backpage.com/FemaleEscorts
  banglachotibookfree.blogspot.com/2009/07
  banglists.com/toppics/dir-2
@@ -6241,6 +6245,7 @@ bangsaedmpexxx.blogspot.com/2011
  bangtan-in-bed.tumblr.com/post/113108044837/can-i-request-a-gangbang-smut-of-all-the-members
  bangtanboyssmutbts.tumblr.com/post/628333696593903616/cyber-sex-m
  bangtaniejungkookie.tumblr.com/post/164208841541/when-you-catch-him-masturbating-with-your-panties
+bangtaniejungkookie.tumblr.com/post/167654585776/hi-could-you-do-a-yoongi-smut-where-he-is-your
  bangtanofarmys.tumblr.com/post/162443072276/days-of-the-week-thursday-smut
  bangtantaegi.tumblr.com/post/628812515148742656/bts-reaction-giving-him-a-blowjob-while-hes-on
  bannedbids.tumblr.com/post/32764181518/bannedbids-gay-fetish-auctions
@@ -6536,6 +6541,7 @@ bdsm-247.blogspot.com/2012
  bdsm-bondage.blogspot.com/2005
  bdsm-personals.blogspot.com/2005/02
  bdsm-threesome-sex-2013.blogspot.com/2014
+bdsm.one/vids
  bdsm.one/vids/994326
  bdsm.one/vids/996700
  bdsm.one/vids/999925
@@ -6837,6 +6843,7 @@ best.com/~tja
  best.com/~trond/free/pix
  best.com/~ww4
  bestactiongirlz.com/september-free16
+bestappsstudio.blogspot.com/2014
  bestarticle.org/relationships/satin-panty-fetish-tips-for-finding-women-with-a-panty-fetish
  bestassesonline.tumblr.com/post/104234945526/beautiful-teen-ass-bdsm-sluts-best-asses
  bestassesonline.tumblr.com/post/104239751026/sexy-ass-with-lingerie-bdsm-sluts-best-asses
@@ -6919,7 +6926,6 @@ betaloservirgin.tumblr.com/following
  betanews.com/article/New_XXX_Domains_for_Adult_Web_Sites/1117727799
  betches.com/top-10-celebs-who-we-think-are-probably-sluts
  betcheslovethis.com/article/blow-job-umd-video-blow-up-pool
-bethbroderickpicture.blogspot.com/2008/02
  betintoskirts.blogspot.com/2016
  betisier-de-fly-irc-be.blogspot.com/2006/07
  betolerant.fr/rencontre-ados-jeunes-lesbiennes
@@ -7135,6 +7141,8 @@ bipolar-sunshine-says-bite-me.tumblr.com/post/108253704396
  bipolar-sunshine-says-bite-me.tumblr.com/post/109999450481/analcult-brunette-getting-fucked-by-a-thick-cock
  bird-of-paradise.eu/je-cherche-couple-gay-irapuato
  birds-have-teeth.tumblr.com/post/613539486486462464/i-just-wanna-praise-and-dirty-izuku-and-watch-him
+birds-have-teeth.tumblr.com/post/616873220980850688/spanking-deku-like-he-was-being-a-bratty-sub-so
+birdsbees2.blogspot.com/2019
  birdsnest.com.au/womens/shop-by/bodyshape/big-boobs/outfits
  birmingham.backpage.com/Strippers/party-strippers-rush-parties-sexy-lesbian-strip-show-with-toys-877-442-0345
  birmingham.vivastreet.co.uk/dating+birmingham
@@ -7315,6 +7323,7 @@ blackgirlsinlove.com/post
  blackglovesfan.tumblr.com/post/126947192508/mistress-anli-booty-close-up-from-my-leather
  blackguys.tumblr.com/post/109134692162/bigger-boys-xxx-massive-cock-videos-once
  blackmack1977.tumblr.com/post/120095321827
+blackmailbdsm.blogspot.com/2011/04
  blackmandlatinf.tumblr.com/post/128332337868/my-wife-is-freaky-and-enjoys-licking-my-ass
  blackmenrevenge.tumblr.com/post
  blackmenvswhitesissy.blogspot.com/2015
@@ -9441,6 +9450,7 @@ boyssexvideos-blog.tumblr.com/post/142322011603/unchained-gay-wrestling-vids
  boyssexvideos-blog.tumblr.com/post/142322234608/black-gaymovies-video-click
  boyssexvideos-blog.tumblr.com/post/142322347008/porn-gay-toons
  boyssexvideos-blog.tumblr.com/post/142323175893/adult-gay-games-download
+boyssexvideos-blog.tumblr.com/post/142323490908/yung-boys-gay
  boyssexvideos-blog.tumblr.com/post/142323572163/individual-gay-leather
  boyssexvideos-blog.tumblr.com/post/142380291078/pic-post-twinks-free
  boyssexvideos-blog.tumblr.com/post/142380738363/thailand-tag-results-gay
@@ -9523,6 +9533,7 @@ brawallpapers.com/sexywallpapers
  brayglobal.com/cams
  brazilblackbear.tumblr.com/post/122670828440/hot-nipples
  brazilian-girls-blog.blogspot.com/2006
+brazzersnetwork.pro/video/24979/blessed-motherfucker-pulverizes-fabulous-damsel-in-the-woods
  breadcrumbsinthebutter.typepad.com/bread_crumbs_in_the_butte/2005/02/
  breakkup.com/with-me
  breast-forms.tumblr.com/want2whore
@@ -10110,6 +10121,7 @@ callnetuk.com/home/supermodels
  caloga.com/nl/060616/
  caloga.com/nl/060620/
  caloga.com/nl/060622/
+calteahood.tumblr.com/post/182389447699/im-a-real-slut-for-mutual-masturbation-with-cal
  calumsbasspick.tumblr.com/post/105961919234/eating-you-out
  calweb.calweb.com/~ilk
  calweb.com/~ilk
@@ -10626,7 +10638,6 @@ cednad.com/cp/fascm2/Documents/planninglecture.doc
  cedro11.blogspot.com/2019/06
  celeb-nude-fakes.blogspot.com/p
  celeb.run.hu/monica_belluci
-celeb1000.blogspot.com/2008
  celeb2185.rssing.com/chan-58183151/all_p387.html
  celebbinge.com/2007/11/22
  celebboard.de/toplist
@@ -11976,6 +11987,7 @@ chris.pixel-styles.com/burningbook
  chris1ob.tumblr.com/post/133349686480/littlej420-twinkseason-biig-dick-wish-i
  chrisachilleos.co.uk/main/gallerie/
  chrisdonnan.com/blog/2005/04
+chrisgolsonphotography.blogspot.com/2012
  chrisgolsonphotography.blogspot.com/2012/12
  chrisgolsonphotography.blogspot.com/2013/04
  chrishotrod2000.tumblr.com/post/130209352339/talked-to-this-really-sexy-asian-guy-on-grindr-and
@@ -12304,7 +12316,6 @@ clik.to/teen-extreme-bondage
  cliketclak.skynetblogs.be/post/3882134/-de-la-penetration-du-modele-par-le-photograp
  clinicrunner.com/blogs/2015/09/13/adult-nude-pics/
  clintaurban.tumblr.com/post/135021143205/me-blowing-clouds-and-getting-cock-sucked-my
-clip-14268.blogspot.com/2008
  clip-hardc.com/gallr/clip-0972
  clip-paroles.fr/orelsan-sale-pute
  clip.dj/adult-xxx-anonymous-http-adult-xxx-pictures-tumblr-com-download-mp3-mp4-yOvceRQQ9nw
@@ -12526,6 +12537,7 @@ cocklovingmama.tumblr.com/post/154730675125/inseminatemywife-nudesnporn-you-dont
  cocknpussyporn-blog.tumblr.com/page/2
  cockringsvibrator.blogspot.com/2017/11
  cockringsvibrator.blogspot.com/2018/11
+cocksucker-karofsky.tumblr.com/page/56
  cocksures.rifes.co/image
  cocksures.rifes.co/post
  cocksures.rifes.co/submit
@@ -13667,6 +13679,7 @@ cumuseumofterror.com/Sounds/wavs/windmoan.wav
  cumwithrne.tumblr.com/post/103318615370/suck-off69
  cumwithrne.tumblr.com/post/103373500151/fuck-me-till-the-end
  cunnilingus-conaisseur.tumblr.com/post/135123825652/cunnilingus-conaisseur-when-you-just-have-to-eat
+cunnilingus3.blogspot.com/2010/01
  cunt-zone.com/jerry228
  cuntrust.com/fuksi134
  cuntsx.com/teen
@@ -13720,6 +13733,7 @@ cutbartman36.tumblr.com/following
  cutbfs.net/plus-gros-nichon-du-monde-annuaire-dominatrice-le-m
  cutebabedoggystyle.blogspot.com/2013
  cutecdrobyn.tumblr.com/post/146452325043/fuck-me-like-a-whore
+cutecdstories.blogspot.com/2016/01
  cutecut-deactivated20120918.tumblr.com/post/8730761857/yeah-i-will-cum-on-your-juicy-pussy
  cutelive.ru/category/xxx
  cutely-dark.tumblr.com/post/76706236888/whore-degrader-take-it-you-fucking-whore-this
@@ -14041,7 +14055,6 @@ daddieslittle16.tumblr.com/post/117263287833/tiny-girlz-tiny-hot-girls-with-smal
  daddy-darhk.tumblr.com/post/139879488499/fucktoysluts-hatefuck-the-whore
  daddy-day-1.tumblr.com/post/97604745102/allsportsgirls-shaven-cunt-young-pussy-chatte
  daddy-mike.tumblr.com/post/156982824208/cumslut-webwhore-cassandra-jean-carter-wants-her
-daddy-porn-videos.com/fr/daddy-categories
  daddy-wants-to-own.tumblr.com/post/134646494542/everydayfixxx-to-the-women-who-love-sucking
  daddy4boiz.tumblr.com/post/147713787648/latinobugchaser-these-mexican-tops-give-this
  daddy4yngsissies.tumblr.com/post/139739672843/daddys-cock-would-you-suck-it-sissy
@@ -14075,6 +14088,7 @@ daddysongayporn-blog.tumblr.com/post/138514994605/falcon-twink-porn-star-list-ga
  daddysongayporn-blog.tumblr.com/post/138575735595/vintage-gay-loops-william-higgins-william
  daddysongayporn-blog.tumblr.com/post/138576192145/sauna-queer-rio
  daddysongayporn-blog.tumblr.com/post/138576779245/free-old-gay-cock-suckers
+daddysongayporn-blog.tumblr.com/post/138576889900/men-bear-black-guy
  daddysongayporn-blog.tumblr.com/post/138579220300/porn-plot-long-lived-fuck-minor-gay-bareback
  daddysongayporn-blog.tumblr.com/post/138637280555/can-you-be-gay-in-the-sims-gamecube-asian-porn
  daddysongayporn-blog.tumblr.com/post/138699646285/gay-bar-pismo-beach-california-young-boy-gay
@@ -18273,6 +18287,7 @@ desitory.blogspot.com/2012
  desiurl.com/38f8a
  desiurl.com/4c224
  desiurl.com/62af9
+desixxxgirlspic.blogspot.com/2018
  desk.myspace.com/html.ng/site=myspace&position=skyscraper&page=www.myspace.com
  deskbabe.tumblr.com/post/100616227919/hot-bella-solo-stripshow-guitar-solo-blonde
  deskofbrian.com/2011/04/text-message-saves-prostitute-tortured-in-bondage-room
@@ -18829,6 +18844,7 @@ dirty41.tumblr.com/post/50947675383/xxxfreebdsm-visit-us-for-sexy-bdsm-bondage
  dirtyandhornygifs.tumblr.com/post/94771383853/tubaves-salope-se-fait-baiser-comme-une-pute
  dirtyauntyvicky.tumblr.com/post/127245638574/via-clothes-sex-cum-nylon-special-fellation
  dirtybetanerd.tumblr.com/post/89996486021/phoxxypwny-i-laughed-so-fucking-hard-at-this
+dirtybtsgot7.tumblr.com/post/145482134857/party-fun-threesome-mark-and-jaebum-got7
  dirtybtsgot7.tumblr.com/post/145880005802/i-cant-wait-jimin-bts
  dirtybtssnaps.tumblr.com/post/175245520696/playful-sex-with-taehyung
  dirtycamcum.tumblr.com/post/158484015248
@@ -18851,6 +18867,7 @@ dirtylikeminded.tumblr.com/page/4
  dirtylittleminddd.tumblr.com/following/page/2
  dirtymessy.blogspot.com/2011
  dirtypepsi-b.tumblr.com/post/111599145762/what-me-and-auntie-sally-do-under-the-covers-xxx
+dirtyrainbowstories.tumblr.com/post/174505632952/mettaton-and-2b-have-a-disagreement-over-who-has
  dirtyrodz.tumblr.com/post/116947160188/highuponsex-i-have-a-fetish-for-boobies-3
  dirtyshanks.blogspot.com/2011
  dirtyshanks.blogspot.fr/2011
@@ -20756,6 +20773,7 @@ ebony-blowjob-melons-cum-covered.blogspot.com/2012/03
  ebony-luxury.tumblr.com/post/115562232996/we-have-a-treat-for-all-porn-lovers-out-there
  ebony-rachets-nsfw.tumblr.com/post/115680114399/for-more-black-ebony-pussy-xxx-check-out
  ebony.com/love-sex/shades-of-black-bdsm-482
+ebony46teen46slut.blogspot.com/2009
  ebook-diffusion.com/escort-girl/
  ebook-romance.info/romance-erotique/
  ebook-romance.info/romance-erotique/call-me-bitch-t1-a-6-de-emma-green/
@@ -21279,6 +21297,7 @@ emergic.org/archives/2005/08/03
  emergic.org/archives/2005/08/04
  emezeta.com/articulos/relatos-eroticos-en-emezeta
  emilienpatetgallou.blog.parents.fr/2007/01/24/des-nouvelles-vite-fait
+emilybrowningpicture.blogspot.com/2008/01
  emilys-feet.tumblr.com/post/108306975584/gamer-girl
  emilyyirwin.tumblr.com/post/98200131950/troublemaker-luke-smut-part-2
  eminyprivate-deactivated2015111.tumblr.com/post/124392083732/fucking-the-sluts-cunt-and-ass
@@ -21565,9 +21584,6 @@ enjoy-ingpic.blogspot.com/2012/08
  enjoy.ne.jp/~ayahiro/sexy
  enjoycloseupcloseupblog.tumblr.com/post/154026074638/the-only-rule-of-this-sex-app-you-must-fuck-any
  enjoystation.net/Player/mp3-128.asx
-enjoytits.blogspot.com/.
-enjoytits.blogspot.com/2015/01
-enjoytits.blogspot.com/2016/05
  enjoyview.tumblr.com/post/64763074618/guy-licking-brunette-babes-pussy-from-porn-gifs
  enlightment.ageofmister.com/promo_fr/gratuit/hard/008
  enlightment.ageofmister.com/promo_fr/gratuit/hard/020
@@ -21742,7 +21758,6 @@ erosisntpleasure.tumblr.com/post/60324505000
  erosmind.tumblr.com/post
  erossa.com/banner
  erossquiver.tumblr.com/post/102676646450/jason-has-like-a-porn-star-size-dick-and-nico-is
-erostories.xyz/bestiality
  erot.org/menu
  erotic-beauty.over-blog.com/2015/10
  erotic-comics-1032.blogspot.com/2005/02
@@ -24033,6 +24048,7 @@ femdomalt.blogspot.com/2012/05
  femdomboots.blogspot.com/2010
  femdomboots.blogspot.com/2012
  femdomempire.net/femdom
+femdoming.com/fiction/dominant-female-roommate-panties
  femdomqueendom.tumblr.com/post/135435470010/smothermeplease-horny-hotties-near-you-are
  femdomsissyslave.tumblr.com/following/page/5
  femdomstrapon.blogspot.com/2015
@@ -24122,6 +24138,7 @@ femmezoom.com/reponse-85009-229.phtm
  femmezoom.com/reponse-85598-229.phtm
  femmezoom.com/reponse-88903-229.phtm
  femofreehost.com/sweety
+femslutstuff.tumblr.com/likes
  fender72.tumblr.com/post/138436739772/mary-hoyda-web-slut-cock-sucking-whore-repost-her
  fennakillbill.com/black
  fennakillbill.com/partouze
@@ -24160,6 +24177,7 @@ fetishalias.com/getfree/61xx_2007
  fetishfantasies3.tumblr.com/post
  fetishkingdom.net/mf.php
  fetishmadam.com/117
+fetishsexon.com/movie
  fetishsexon.com/watch_top/OGUtMTMzMy0xMzg0ODU0OA
  fettischist.tumblr.com/post
  fettube.tv/Jade-LaRoche-Scores-A-Hat-Trick_v971
@@ -24226,6 +24244,7 @@ ffh.spinchat.de/login/oldsession?target=/mail;sess=cooksr-SaycAmFOikn-ylQ9t5ENru
  ffh.spinchat.de/login/oldsession?target=/mail;sess=cookstHiYjT2IQzhJQD1-Q5vuGLCNwN7RSEOS38AAAEAAHn6JXY;args=
  ffh.spinchat.de/login/oldsession?target=/mail;sess=cooksvCpa5tOOHsADVmE8w-J2R9w6bilRSERqX8AAAEAABLGYZI;args=
  ffrf.org/about/getting-acquainted/item/13501-vatican-has-preteen-age-of-sexual-consent
+ffucktoiletfag.tumblr.com/following/page/27
  fhm.co.za/reporter
  fhmonline.com/girls
  fibesos.tumblr.com/post/126383252546/michaelclitsfford-can-you-imagine-what-sex-with
@@ -24904,6 +24923,7 @@ focusonthefamily.ca/parenting/teens/talking-to-your-teen-about-masturbation
  focusonthefamily.com/marriage/divorce-and-infidelity/pornography-and-virtual-infidelity/virtual-infidelity-and-marriage
  focusonthefamily.com/marriage/sex-and-intimacy/understanding-your-husbands-sexual-needs
  focusonthefamily.com/parenting/sexuality/when-children-use-pornography
+fodfiuodufdoifudofffff.blogspot.com/2017
  foggys-funnies.com/o3/naked-cowboy
  foghs.freeuk.com/webbuk
  foibompravoce.blogspot.com/2011
@@ -25154,8 +25174,6 @@ fortunecity.com/village/hawtrey/282
  fortunecookiechronicles.com/blog/adult01/anime
  forum-assistantmaternel.org/t24204-pipi-culotte-juste-chez-moi
  forum-entraidsida.niceboard.com/t6-risque-avec-une-fellation
-forum-pornodump-net.blogspot.com/2018
-forum-pornodump-net.blogspot.com/2020/09
  forum.aufeminin.com/forum/couple2/__f141251_couple2-raconter-vos-histoires-coquines-1-peu-la-honte.html
  forum.aufeminin.com/forum/matern2/__f133123_matern2--questions-sekse-fou.html
  forum.bioware.com/topic/525899-iron-bull-and-bdsm-sex
@@ -25804,7 +25822,6 @@ fr.facebox.com/xxxapoxxx
  fr.facebox.com/xxxmademoizel_paradizexxx/blog/blogid=403586
  fr.filesmap.com/xxx
  fr.gautamblogs.com/what-is-fisting-how-do-it-right
-fr.gratisnederlandseporno.com/category/amateur
  fr.gravatar.com/wilddesireserotica
  fr.groups.yahoo.com/group/Garter_Wedding_Lingerie2/messages
  fr.groups.yahoo.com/group/MARI_ENVOYE
@@ -26280,6 +26297,7 @@ frecklesredsandsomuchmore.tumblr.com/post/109403113162/cum-chicks-daily-update-o
  fred.net/imzadi
  fredbird.org/lire/log/2006-04-06-sexe-et-politique
  fredboy-fred.blogspot.com/2012
+freddiesaysalright.tumblr.com/post/187027812939/lingerie
  fredrickakinsm86.tumblr.com/brandi-love-stripper-video
  fredrickville.com/article/6/167
  free-albums.net/mp3/artists/info/adult
@@ -26337,6 +26355,7 @@ free-fetishlinks.com/topsite
  free-full-length-porn-tim.tumblr.com/post/27859445029/black-anal-cream-pies-sleazy-dream-woman-free
  free-full-length-porn-tim.tumblr.com/post/27866240472/bristol-palin-eviscerated-by-celebrities-over-gay
  free-game-downloads.mosw.com/abandonware/pc/adult
+free-gangbang-videos.blogspot.com/2005/02
  free-gay-dating.vivastreet.co.uk/gay-dating-gay-personals
  free-image-hosting.org/clips
  free-manpi.com/freexxx/
@@ -26579,7 +26598,6 @@ freegaymanmovie-blog.tumblr.com/post/122897824821/big-haiy-dude-men
  freegroupsexchatlivesexsex.blogspot.com/2009/08
  freeguestbooks.com/cgi-bin
  freehdpornpictures.blogspot.com/2012/01
-freehentaivideostifa.blogspot.com/2010
  freehomepages.com/anastacia
  freehomepages.com/cathy
  freehomepages.com/kimandmm/wwwboard/
@@ -27024,16 +27042,18 @@ fuckhouse-likes.tumblr.com/post/155298661165/11hdwett-pissing-on-cock-golden-sho
  fuckin-failure-blog-blog.tumblr.com/post/13306999262/thejonashood-q-how-do-you-masturbate
  fucking-nude-porn-xsekv.blogspot.com/2020
  fuckingexperience.tumblr.com/post/119359343211/englishhornycouple-coast69couple
-fuckingpenetration.blogspot.com/2014
  fuckingpornfree.com/xvideos
+fuckingsexywoman-blog.tumblr.com/post/130169676954/teen-killed-sexy-woman-hard-cum-black
  fuckingsexywoman-blog.tumblr.com/post/130235486924/study-finds-youngs-collegegirl-girlfriend-some
  fuckingsexywoman-blog.tumblr.com/post/130301152789/collegegirl-girls-supersecret-suck-porn-videos
  fuckingsexywoman-blog.tumblr.com/post/130302259944/mid-sixteenth-century-nice-tube-girl-porn/amp
  fuckingslutwomanvideos.tumblr.com/post/164304462373/kocakurtus-gangbang-more-hot-fucking-slut
  fuckingyoungpeople-blog.tumblr.com/post/129880207502/novel-follows-high-teens-junior-dirty-white
  fuckmefillmethrillme.tumblr.com/post/129930960142/i-dont-want-to-have-sex-i-want-you-to-fuck
+fuckpussy.vip/en/throat
  fuckswomenssex-blog.tumblr.com/page/3
  fuckswomenssex-blog.tumblr.com/post/126544095351/english-teenager-deep-throat-blowjob
+fuckswomenssex-blog.tumblr.com/post/126710340036/girl-white-youthful-boys-sex-in-shower-room
  fuckthenightaway.tumblr.com/post/187469652644/you-like-it-wet-so-do-i-chaeyoung
  fuckwithmymind18.tumblr.com/./redtubes-hottamale1000-
  fuckwithmymind18.tumblr.com/./redtubes-hottamale1000-this-
@@ -27050,6 +27070,7 @@ fuerzasarmadasecuador.org/espanol/actualidad/guest
  fukkad.com/celebrity
  fukuoka.cool.ne.jp/keiura
  fukyopicture.tumblr.com/post/109326494490/cocaine-lorraines-fucked-video
+fulanismut.blogspot.com/2013
  fulienjabre.unblog.fr/2007/09/09/la-fabuleuse-vie-de-jean-charles-clitoris-ou-dune-mauvaise-fiction-erotisante
  fulikongcom.tumblr.com/post
  full-porn-films.blogspot.com/2021/01
@@ -27098,8 +27119,6 @@ funkeros.blogsome.com/2009/01/08/children-hard-core-and-sex
  funkeros.blogsome.com/2009/01/08/clip-free-mature-mpeg-porn-woman
  funkeros.blogsome.com/2009/01/08/clip-free-mature-mpeg-xxx
  funkeros.blogsome.com/2009/01/08/free-hardcore-nude-womans
-funkyguste.blogspot.com/2011/11
-funkyguste.blogspot.com/2012
  funlovingcheatercgy.tumblr.com/post/122413167981/girlwholustsafteroldmen-me-this-kitty-kitten
  funmunch.com/celebrities
  funmunch.com/videos
@@ -27743,7 +27762,6 @@ gawker.com/regrettably-farrah-abraham-wrote-an-erotic-romance-n-1557019859
  gawker.com/tag/bondage
  gawker.com/teen-girl-ejected-from-prom-because-horny-dads-cant-sto-1575694507
  gawker.com/theres-a-blowjob-on-youtube-the-nymphomaniac-trailer-1469739897
-gay-hentai-lesbian.blogspot.com/2011/04
  gay-movie-club.com/gay/02_08/02
  gay-movie-club.com/gay/08_08/02
  gay-nerds.com/site/
@@ -27753,6 +27771,7 @@ gay-search.blogspot.com/2008/06
  gay.com/health/hiv
  gay.com/travel
  gay.propeller.com/story/2008/01/31/video-porno-bisex-sesso-bi-pompini
+gay3somecouples01.tumblr.com/post/179908111660/boys-vol2release-year-2004-studio-cheeks-stand
  gay3somecouples01.tumblr.com/post/180522612145/taboo-boysrelease-year-2016-studio-acceed
  gayamateurbar21.tumblr.com/post/614612734111301632/mature-straight-bear-has-deep-throat-equality
  gayamazinglyclubs.tumblr.com/post/130650353893/twink-black-twink-boy-black-twink-twink-black/amp
@@ -27773,12 +27792,16 @@ gaychristianz-blog.tumblr.com/post/142658059392/blowjob-hunk-threesome
  gaychristianz-blog.tumblr.com/post/142658368512/first-boys-kiss-on-film
  gaychristianz-blog.tumblr.com/post/142658624402/practising-safe-twink-sex
  gaychristianz-blog.tumblr.com/post/142659511277/boys-male-twin-models
+gaychristianz-blog.tumblr.com/post/142659992467/register-of-japanese-movies-close-by-gay-guys
  gaychristianz-blog.tumblr.com/post/142660128422/gay-black-mans-cock
  gaychubbycutie47.tumblr.com/post/620891338540482560/18yo-sweet-boy-jerkoff-milwaukie-take-a-look
  gaycouplecom66.tumblr.com/post/629360302662778880/naughty-boyfriends-interesting-petting-trio-in
  gaycultes.blogspot.com/2008
+gaycultes.blogspot.com/2009
  gayculturelove.blogspot.com/2017
  gaycumfree-blog.tumblr.com/post/156777798810/smart-10th-impression-masturbation-teen
+gaycybersex.blogspot.com/2013
+gaydatinghard01.tumblr.com/post/623835428530880512/brothercrush-handsome-guy-breeds-his-younger
  gaydreamfilmes.blogspot.com/2015
  gayfetishkink.com/Home/
  gayfolie.site.voila.fr/sexe_gay_poilu
@@ -28335,6 +28358,7 @@ gieferolehymy1436.blogspot.com/2013/01
  gieferolehymy1436.blogspot.com/2013/05
  gieferolehymy1436.blogspot.com/2013/06
  gieferolehymy1436.blogspot.com/2013/07
+gieferolehymy1436.blogspot.com/2013/09
  gierman.pl/f551-erotyczne/
  gif-007.tumblr.com/post/127388254625/top-trending-gif
  gif.6996.us/post/32898488097
@@ -28610,6 +28634,7 @@ gofish.com/adultChallenge.gfp
  gofrance.about.com/od/sexadultsonly
  gofuckaduck.com/forum/index.php
  gogaygroupsex-blog.tumblr.com/page/2
+gogaygroupsex-blog.tumblr.com/post/129180230390/boys-saunas-massage-in-shropshire
  gogaygroupsex-blog.tumblr.com/post/129317289000/queer-black-gang-fuck
  gogloom.com/Coolsmile/uro-scato
  gogng.co/q1rmd
@@ -29048,6 +29073,7 @@ gooteo.com/anuncios-relaciones_ocasionales-Madrid-contactos.21-3-26-c.html
  gordonasgostosas.blogspot.com/2012
  gordonbitch01.canalblog.com/albums/mistress_eddy_whore
  gordonthomas.co.uk/video/video-porno-scato-59532-1361f
+gordramstcams.blogspot.com/2014/10
  gorgeousasians.me/0b30b4cefc06d
  gorgeousasians.me/bikini-babes-10
  gorgeousclit.tumblr.com/post/117663868825/amateur-lesbian-sex-cumshot-ass-fuck-shemale
@@ -29133,6 +29159,7 @@ grabyoursc.com/kim-possible-oprno
  gracelessheartsong.tumblr.com/post/129862625319/teen-femdom-love-sub-males-place-led-by-his
  gracenglamour.com/masturbation-is-no-sin
  gracielou3bush.tumblr.com/post/17483548770/boobs-sex-tits-ladies-gangbang-heaven-sexy
+gradiva-rivdi-jensen.tumblr.com/following
  grafted.net/h-n
  gralactica.com/2701
  grammie.com/busty
@@ -29733,9 +29760,11 @@ gzumetria43.org/pokemon-porn
  h.webring.com/t/XXX-Amateur
  h0esvck.tumblr.com/post/184817245961/bts-walk-in-on-catch-you-masturbating
  h0esvck.tumblr.com/post/190357266271/hellooo-i-found-your-blog-today-and-its
+h0esvck.tumblr.com/post/190371045751/bts-reaction-to-wanting-to-fuck-the
  h0esvck.tumblr.com/post/611773463482466304/a-bts-reaction-to-creampie-maybe
  h0esvck.tumblr.com/post/612496560644882432/innerchildsgf-q-what-was-the-best-time-as-well
  h0esvck.tumblr.com/post/612496560644882432/q-what-was-the-best-time-as-well-as-the-most
+h0esvck.tumblr.com/post/617673818489733120/lmao-a-crack-reaction-to-like-there-was-sexual
  h0mmedesbois.tumblr.com/post/114797836239/shaved-skater-muscle-boy-cam-flex-wank-and-cumshot
  h0st.com/twa
  h2b.ca/rvfxh
@@ -30109,6 +30138,7 @@ hardcorepond.com/gomc/3
  hardcorequake.com/date0721
  hardcorexxxporno.blogspot.com/2015/04
  hardcotonic.com/ams927
+hardd4cockd4cum.blogspot.com/2008/12
  harddig.tumblr.com/post/153978369662/amy-dube-dick-dubord-slut-exposed
  hardexposure.com/beauties85
  hardextreme.fr.tc/moteurxdir
@@ -30185,6 +30215,8 @@ hdporntime.fysyjy.com/mature-whore-is-doing-everything-he-can-to-fuck
  hdsextube.org/video-porno/mutfakta-komsuyla-seks
  hdtubex.me/se
  hdvprod.com/mangas
+hdxxxtube.online/video
+hdxxxtube.online/video/47181/sexy-amateur-flasher-beaus-outdoor-striptease-and-voyeur-exhibitionism-of-winter
  he.net/~pandora
  heading-south.com/freethumbs
  headlikeahole.bandcamp.com/track/hot-sexy-lusty
@@ -30449,6 +30481,7 @@ hentai.ohpureporn.com/nsfwsenpaicomic1
  hentaibedta.net/video-afternoon-exhibitionists-tomoko-chizuru-hentai-movie-collection
  hentaibrasil.net/category/playboy-e-sexy/
  hentaibrasil.net/playboy-e-sexy-de-maio/
+hentaibros.com/anime/hip-brothel-cum-in-the-whore
  hentaicentral1.blogspot.com/2013/08
  hentaifuntime2.tumblr.com/post/69989587067/ghetto-hentai-elf-with-huge-boobs-gangbang-by
  hentaigames4life.blogspot.com/2019/03
@@ -30878,6 +30911,7 @@ holepleasures-blog.tumblr.com/post/143035071458/ass-sex-lesbain-or-gay
  holepleasures-blog.tumblr.com/post/143035166408/allyson-paflas-gay-homosexual-marriage
  holepleasures-blog.tumblr.com/post/143035556533/youporn-download-gay-porno
  holepleasures-blog.tumblr.com/post/143035571568/examines-anti-queer-violence
+holepleasures-blog.tumblr.com/post/143035664798/gay-ageing-handjob
  holepleasures-blog.tumblr.com/post/143035944638/gay-ameture-college-sex
  holepleasures-blog.tumblr.com/post/143038062608/gay-sperm-unconfined-samples
  holepleasures-blog.tumblr.com/post/143038161273/rencontre-gay-mec-actif
@@ -32005,6 +32039,7 @@ hornyredheadbarebumshbclan.blogspot.com/2009
  hornysgguy13.tumblr.com/post/133461338856/asiansexcherry-wet
  hornytexasboy.tumblr.com/post/31165599825/nerdnawesome-nerdnawesome-do-me-hard-cum
  hornytraveler210.tumblr.com/post/138339326813/sluttytumbgirl-more-sluts
+hornytwatsadultchatnetworkc.blogspot.com/2009/08
  hornytwoguys.tumblr.com/post/101841140249/gay-fantasies-handcuffs-today-at-t-w-o-horny
  hornytwoguys.tumblr.com/post/101841140249/gay-fantasies-handcuffs-today-at-two-horny
  hornytxt.com/cgi-bin
@@ -32098,8 +32133,10 @@ hot50.net/star
  hot97.com/news/morning-show/porn-stars-sara-jay-gianna-michaels-breaks-down-working-adult-industry-video
  hotactresslisaann.blogspot.com/2011/03
  hotaddict.tumblr.com/page/60
+hotamericano.blogspot.com/2013
  hotandexposed.tumblr.com/post/57823116238/actor-ian-parks-naked-and-hard
  hotasiangirls.info/blog
+hotassgirlfriendgetsacreampie.blogspot.com/2013/06
  hotassgirlfriendgetsacreampie.blogspot.com/2013/08
  hotasssexsexarabiansexbol.blogspot.com/2009/08
  hotbabeslust.com/tag/shaven-pussy
@@ -32179,6 +32216,7 @@ hotmoms247.tumblr.com/post/128781256465/fuck-a-horny-milf-tonight-httpbitly1kivv
  hotmovies.linux-dude.com/download
  hotnepal.com/wallpaper
  hotnextdoorgranny.tumblr.com/post/126081930009/amateur-granny-whores-hot-free-pictures
+hotnudepornubdas.blogspot.com/2020
  hotnylon.mpspace.net/set02
  hotoffers.info/287
  hotorientalmpegs.com/movs/058
@@ -32366,6 +32404,7 @@ hubpages.com/tag/tranny
  hubpages.com/tag/transsexual
  hubpages.com/tag/transvestite
  hubpages.com/tag/transvestites
+huckupxxx.blogspot.com/2018
  hudromental.tumblr.com/post/137971163762/so-sexy-so-beautiful-my-cock-gets-very-hard
  huffingtonpost.ca/news/pornography/
  huffingtonpost.com/entry/22-sexy-songs-that-give-female-masturbation-the-love-it-deserves_55d767e6e4b08cd3359c009f
@@ -32377,6 +32416,7 @@ huffingtonpost.fr/amp/entry/sexualite-bdsm-bondage_b_8509570
  huffingtonpost.fr/magali-crosetcalisto/addiction-porno-sexualite_a_21614206
  huffrei.de/imprimant/rencontres-scato
  hugebreastfan.tumblr.com/post/126373791164/biggerandbigger-minkafucked3
+hugecocktv.com/porn_clips/exhibitionist/page/4
  hugecomplot.tumblr.com/post/33504604272/t-cuty-bra-breast-babe-instagirl-sexy
  hugecumload.tumblr.com/post/59886713608/annunci-sesso
  hugenaturalsbustycleavagegirls.tumblr.com/post/119042677305/free-nude-random-webcam-sex-shows-myfreecam
@@ -34456,7 +34496,6 @@ indianapolis.craigslist.org/cas
  indianapolis.craigslist.org/msr
  indianapolis.tribe.net/recommendation/Taras-Naughty-Shop/indianapolis-in/60419053-5c18-434f-847c-b4e6da6941df
  indianas4.com/entertainment/photos
-indianbbwdominance.blogspot.com/2012
  indianboy916.tumblr.com/post/104666931076/colungafrank-jay-seidon-twitter-pics-sexy
  indiancute.com/fr
  indiancute.com/top/lusty-fetish
@@ -34833,6 +34872,7 @@ internalpathways.blogspot.com/2012/10
  international-transport-autos.com/adult-porn-xxx-videos-femmes-du-cul-la-courneuve
  international-transport-autos.com/sex-erotic-xxx-femme-partouze-epinay-sur-seine
  international-transport-autos.com/shaved-pussy-annonces-rencontre-sex-saint-sebastien-sur-loire
+internationalsissyboy.blogspot.com/2010
  internationalweb.sk/005
  internationalweb.sk/012
  internet-club.com/usa/karogers
@@ -35158,6 +35198,7 @@ itsinthere.com/Paris-Hilton-Video
  itsjaybitch-deactivated20110619.tumblr.com/post/5746453742/reblog-if-lady-gaga-is-a-fake-ass-whore
  itsjustartguys.tumblr.com/post/109698987755/hentaifutanarigratuit-enculer-hardcore-par-une
  itsme1149.tumblr.com/post/112721832987/nudeteenslove-sexy-nude-teens-photos-pictures
+itsmydreamlifethings.tumblr.com/post/612251492739596288/first-time-sex-after-baby-henry-cavill-x-female
  itsmykink.tumblr.com/post/132437429324/if-you-like-big-cocks-then-you-should-let-me-put
  itsmyurls.com/meikoaskaraxxx
  itsmyurls.com/outbound/531cd9feb7e3a739bc7cd83b
@@ -35340,6 +35381,7 @@ japan-net.or.jp/~ivp/av/rezu/rzk
  japan-sogo.net/shop/ranking/adult
  japanator.com/deals-to-write-home-about-tokyopop-sale-at-borders-4425.phtml
  japanbukkakevideos.blogspot.com/2020
+japanese-bondage-bbw-2013.blogspot.com/2017/11
  japanese-lesbians.blogspot.com/2005
  japanese-panty.com/pantybusters
  japaneseteengirlsgetfucked.blogspot.com/2017/05
@@ -35375,14 +35417,12 @@ javbb.com/node/48
  javboo.com/video
  javdlmp4.blogspot.com/2019/10
  javfree.la/genres/soapland-girl
-javfull.net/nnpj-418
-javfull.net/tag/katsuo-butsusan-mousouzoku
  javgambatte.blogspot.com/2019/07
  javhd720.tumblr.com/page/2
  javhd720.tumblr.com/post/163445006490/kv-187-91-minute-non-stop-shooting-uncut-editing
-javhdporn.net/video/svomn-116
  javii.iquebec.com/archives
  javmovs.com/mkmp-336
+javshujin.com/censored/ekdv-534
  javtc.tv/category
  javwide.blogspot.com/2018
  jaw62.tumblr.com/post/111419253066/dirtydescent-oh-my-fucking-god-i-want-to-fuck
@@ -35397,6 +35437,7 @@ jaynbeefetishes.tumblr.com/post/139648150261
  jaynotezbeats.com/sized-called-sophie-dee-porn-a-pornography/
  jayseballbustingstories.blogspot.com/2013
  jaystrades.com/web/index.php
+jazkarim.tumblr.com/post/173221966610/free-pantyhose-chloro-movies
  jazlabs.com/bdsm
  jazminbunninsfw.tumblr.com/post/54827966957/motikiti-anal-breast-grab-censored-cum-gangbang
  jazyra75.soup.io/post/355313306
@@ -35668,6 +35709,7 @@ jitterbug.com/spank
  jiveturkeys.com/bob/bob1
  jizzfarm.com/fr/search/sunny-lone-new-porno
  jizzmovies.tumblr.com/post/93523746388/http-www-butchercocks-com-you-gotta-fuck
+jizzoncam.com/videos/808/lusycandy-huge-natural-boobs-double-penetration-webcam-masturbation
  jjdir.com/insanecockbrothers
  jjflag.tumblr.com/post/127024781972/so-fucking-sexy
  jjilat.tumblr.com/post/131612243931/latinaslutwife69-miticcum-xxx-gangbang
@@ -35828,6 +35870,7 @@ joshnelson88.tumblr.com/post/108990449831/amateurmasturbations-hairbrush-masturb
  joshnelson88.tumblr.com/post/109124371961/amateurmasturbations-blonde-girl-undress-and
  joshpeckofficial.com/post/127901362103/i-am-great-at-multitasking-i-am-both-cute-and
  joshrocket.net/g
+joshslater.tumblr.com/likes
  josporn.com/videos/3349-blonde-with-big-milkings-and-group-sex-brunette
  jotleaf.com/mishasexual/mishas-left-titty
  jotleaf.com/slut-hutt.tumblr.com
@@ -36232,6 +36275,7 @@ kaboodle.com/yasserverx
  kaboodle.com/yehudaha7s
  kaboodle.com/yitzhakt03
  kaboodle.com/yuriguloat
+kabooxoo.blogspot.com/2013/11
  kafeteria.pl/felieton/sex-factor-a_8404
  kahunaa.tumblr.com/post/35339196954/black-amateur-parties-on-cam-and-plays-with-pussy
  kahunaa.tumblr.com/post/43901647169/chinese-teen-chokes-on-her-boyfriends-cock
@@ -36720,6 +36764,7 @@ kinkynerdyblackguy.tumblr.com/post/147659698595/mysexyanimegirl-reblog-if-you-lo
  kinkyparejita.blogspot.com/2012/07
  kinkypencils.tumblr.com/post/121270963652/untitled-by-glooh
  kinkypocket.com/videos
+kinkytaboophonesex.blogspot.com/2009
  kinkyvikingvixen.tumblr.com/post/132364302979/starfucked-more-in-red-soon-off-to-bed
  kinoman-online.pl/film-online/3518-pornografia-pornography-2003
  kintubo.kakiko.com/lohnesa
@@ -36909,6 +36954,7 @@ kobe888.unblog.fr/2008/03/13/fun-speed-dating-tres-speed
  kobieta.pl/drukuj/artykul/hentai-erotyczna-manga
  kobold2.tumblr.com/post/134458549744/i-like-girls-when-they-see-my-big-dick-their
  koibitofansubbl.blogspot.com/2014/03
+koiibito.tumblr.com/post/620753813438136320/birthday-boy-oikawa-toorufreader
  koin.com/2015/02/06/oregon-judge-upskirt-photos-of-teen-not-illegal/
  koipondcentral.com/tmp257/cnf283
  kokainekate.tumblr.com/post/121773908564/always-one-titty-out
@@ -37064,6 +37110,7 @@ kubirestyle.tumblr.com/tags
  kubstu.kub.nl/~s590479/jpg
  kuerzer.org/7k0
  kulia.biz/1/index.html
+kuliangshuai.tumblr.com/following/page/4
  kuloglu.tumblr.com/post/55771484665/http-www-boobpedia-com-boobs-elizabeth-starr
  kumi.cz/xxx/
  kumiko-lingerie.com/lingerie-sexy/nipples-et-accessoires
@@ -37424,6 +37471,7 @@ latroiona.com/b
  laughfactory.com/jokes/sex-jokes
  laughmason.tumblr.com/post/133438423490/i-was-feeling-pretty-bootylicious-after-my-workout
  laurasneckbite.tumblr.com/post/46752090302/vagina-clitoris-penis-sex-sex-sex-fuck-me
+lauravalerieporn.blogspot.com/2009/01
  laurengaybello.tumblr.com/post/87052714787/no-business-like-show-business/amp
  laurentletadic.tumblr.com/post/129204076278/el-homoerotismo-de-gregory-prescott
  lava.net/~cicerale
@@ -37701,6 +37749,7 @@ leolist.cc/personals/female-companions/metro-vancouver
  leonart.co.uk/karen
  leonisa.com/en/panties/enhancer-padded-panty-and-butt-lifters
  leonisa.com/en/tqm-by-leonisa-teen-lingerie-and-girls-underwear/magazine
+leopharry.tumblr.com/post/94511881155/1-what-tends-to-feel-better-for-you-sex-or
  lep.lg.ua/~rem/
  leparadisprix.com/divertissements/rencontres_femmes
  lepenthouse.com/en/erotic-massage-montreal
@@ -37745,6 +37794,7 @@ lesbianjournals.com/category
  lesbianjournals.com/wp-content
  lesbianmassages.tumblr.com/post/64536844904/httplesbiansextubexxxcategoriessupermassage
  lesbianmassages.tumblr.com/post/64540243495/httpwwwbravotubenetvideoshot-massage-scene-w
+lesbianmassages.tumblr.com/post/64541185708/httplesbianpornmoviesorg-click-to-view
  lesbianskissing.hlfpjifsf.info/gay-teen-fuck
  lesbiansportsvideos.com/index.html
  lesbiennes-coquines.net/1
@@ -37903,6 +37953,7 @@ lickmyassbro.tumblr.com/post/136869533302/hot-men-near-you-are-looking-for-sex-r
  lickmyassbro.tumblr.com/post/136871959106/find-a-gay-sex-partner-httpbitly1wzxsnc
  lickmyassbro.tumblr.com/post/136873348560/find-a-gay-sex-partner-httpbitly1wzxsnc
  lickmyassbro.tumblr.com/post/136875552582/meet-and-fuck-hot-local-guys
+liddyd.tumblr.com/following
  liege.kijiji.be/f-dominatrice-Rencontres-W0QQlangZfrQQCatIdZ3QQKeywordZdominatrice
  liege.kijiji.be/f-dominatrice-Rencontres-W0QQlangZfrQQisSearchFormZtrueQQCatIdZ3QQKeywordZdominatrice
  liege.kijiji.be/f-transexuelle-Rencontres-W0QQlangZfrQQCatIdZ3QQKeywordZtransexuelle
@@ -37933,6 +37984,7 @@ lightfantasticstories.blogspot.com/2015/06
  lightfantasticstories.blogspot.com/2016
  lightfantasticstories.blogspot.com/2017/12
  lightningvids.com/mikesapartment/
+lijahycy34.tumblr.com/post/54363982246/free-nude-grannys-tgp
  likalotapoussey.tumblr.com/post/111527212478/cumrun-i-wlll-come-into-your-house-and-fucking
  like.com/womensintimatewear-search--dreamgirl
  likearea.com/fr
@@ -38182,6 +38234,7 @@ littlegirlscatporn.blogspot.com/2014/12
  littlejessica94.tumblr.com/post/145482175464/dsexxxstyleanal-i-need-it
  littlelotte-xo.tumblr.com/post/109863432345/pinksextape-me
  littlemisskookie.tumblr.com/post/166348311793/in-the-middle/amp
+littlemisskookie.tumblr.com/post/181160925383/sated
  littlemissnaughty-xoxo.blogspot.com/2015
  littlepantiez.tumblr.com/post/108635597575/sexy-little-bikini
  littlerock.craigslist.org/cas
@@ -38430,7 +38483,6 @@ local-tranny.com/us/transexual-arizona
  localaccess.com/rlalonde
  localcouple72.tumblr.com/post/145512954739/londonsdirtiest
  localendar.com/public/pissing30
-localslutz.blogspot.com/2013
  locanto.sg/geo/1215309/Erotic/209
  lockednow.tumblr.com/post/129200011806/chapinchaste-a-cocky-jock-looks-real-good
  lockerroomlust.tumblr.com/post/137246608929/live-gay-sex-cams-httpxxxcamboyscom
@@ -38509,6 +38561,7 @@ longisland.backpage.com/FemaleEscorts/sexy-brunette-goddess-is-here-in-calls-onl
  longlinenorth.telediz.com/2008/01/05/free-tims-picks-nostril-piercing-tabitha-stevens-free-video
  longlog88.tumblr.com/post/118355381304/sweet-sexy-slut-one-of-the-best-blowjob-i-ever
  longpornmovie.blogspot.com/2020
+longslegsonl.blogspot.com/2005/11
  longyeusex.blogspot.com/2013
  lonimonster.tumblr.com/post/69721266710/blondes-or-brunettes-boobs-or-ass
  looble.net/go/2
@@ -38942,6 +38995,7 @@ lustyargonianwarrior.tumblr.com/post/49346012215/gay-orc-orgy-gay-fantasy-erotic
  lustybomb.com/teenportal
  lustydesire.net/penthouse-couples-satin-scented-bondage-kit-peach
  lustynights.co.uk/product-category/bondage
+lustytext.blogspot.com/2012/01
  lutgamstoun.blog4ever.com/blog/index-24284.html
  lutik-gurt.blogspot.com/2012
  lutik-gurt.blogspot.com/2013/01
@@ -39469,10 +39523,12 @@ maksylmyheart.tumblr.com/post/90391364658/morning-part-3-pure-smut
  maktoobblog.com/sexywomen-world
  malayfuck.net/lucah/amature-rimjob
  malayfuck.net/lucah/grose-busen
+malayfuck.net/lucah/grosse-busen-milch-saugen-youpornhardcore-com
  malayfuck.net/lucah/i-fucked-my-best-friends-wife
  malayfuck.net/lucah/l-empire-des-sens-fellation
  malayfuck.net/lucah/pregnant-sex-video-download
  malayfuck.net/lucah/sophie-dee-naughty-america-xxx-hd-wooty-1080p
+malayfuck.net/lucah/sophie-dee-nude-gif
  malayfuck.net/video/1844/busty-mature-madame-nikki-benz-prefers-young-boys
  maldito-ocio.com/category/revistas/
  maldito-ocio.com/revistas/
@@ -39519,6 +39575,7 @@ malicieuxbaisers.tumblr.com/post/12886468019/erotique
  maligno.org/trafficmix
  malika78.online.fr/photos
  malikluvsbbw.tumblr.com/post/109565149032/sexy-baby
+malinapytania.blogspot.com/2016
  malindalo.com/2013/10/ya-novels-about-lesbians-and-bisexual-girls
  malinj1.tumblr.com/post/157543731072/jackieseroticlesbiandream-lesbian-movie
  maliweb-malijet.tumblr.com/post/87275318514/masturbation-comment-les-femmes-se-donnent-du
@@ -39601,6 +39658,7 @@ mangahere.co/manga/erotic_fairy_tales_the_little_match_girl
  mangahere.co/manga/erotic_fairy_tales_the_star_money
  mangaonline.forumactif.com/t351-2-fanfic-sur-fruit-basket-une-hentai-et-une-tout-public
  mangapanda.info/18-mature-manga-ecchi-lovers-borderline-hentai
+mangashentaii-bigtits.blogspot.com/2011/01
  mangastore.com/manga/art/images/adultes
  mangastore.com/manga/manga/images/adultes
  mangavillage.com/top100
@@ -39901,7 +39959,6 @@ mattymacc.tumblr.com/post/131897572470/hotgaymales-getting-nude-outside-and-some
  maturbationation.tumblr.com/post/119679871374/sensual-sexxx-fckinglikerabbits-i-swear-this
  mature-bot.com/hq/posing
  mature-fuck-young-chubby-pussy-mastur.blogspot.com/2011/10
-mature-sex.vip/fr/xxxx
  mature-stockings-hax-blog.tumblr.com/post/12376174411/leading-news-about-stockings-mature
  mature-stockings-hax-blog.tumblr.com/post/12385320149/stockings-mature-latest-news
  mature.dyndns.org/mature
@@ -41853,9 +41910,9 @@ milam.net/~pa12
  milano.mentelocale.it/30615-sesso-a-milano-locali-hot-lap-dance-striptease-e-club-prive
  mildlyrelevantthoughts.com/2010/03/michael-steeles-lesbian-sex-bondage-fetish
  milfhunter.cz/video/15497/jynx-maze-hardcore-foot-fetish-daily-the-1-foot-fetish-site-on-the-internet
+milflatinacama.blogspot.com/2020/04
  milfophilia.tumblr.com/post/95268335394/mature-ladies-extreme
  milfs-exposed.tumblr.com/post/145898192657
-milfs310108.blogspot.com/2008
  milfsaffair.com/?ainfo=NDUyNTd8MTYzNnww&skin=185&i=1
  milfsaffair.com/index.php?skin=189&i=1
  milfspussies.tumblr.com/post/110658005300/random-sex-chat-fun-milf-pussies
@@ -42001,6 +42058,7 @@ mipagina.euskaltel.es/oscar33/
  miportal.es/temasexy/
  mirage.kky.vslib.cz/~zich/pictures
  mirandahooker.blogspot.com/2012
+mirandahooker.blogspot.com/2013/01
  miravia.com/images/images/New/rape
  miravia.com/images/images/New/zoo
  mireportaje.com/codigo
@@ -42715,6 +42773,7 @@ monhit.com/Webmasters
  moni-nikolowa.tumblr.com/post/105561039504/come-on-masturbate-lingerie-couple-dirty
  monicacurtiss.wix.com/maitresse
  monikeatrevida.blogspot.com/2010
+monikeatrevida.blogspot.com/2013/06
  monitor.hr/belle
  monitor.net.ru/forum/files/porn-best-video_163.zip
  monitor.net.ru/forum/files/secreet-pornn-videoo_139.zip
@@ -43152,6 +43211,7 @@ moviesworlds.com/land
  moviesxxxporn-blog.tumblr.com/page/2
  moviesxxxporn-blog.tumblr.com/post/127035469584/frlust-av-titeln-old-schoolgirl
  moviesxxxporn-blog.tumblr.com/post/127038871199/download-video-adolescent
+moviesxxxporn-blog.tumblr.com/post/127196767359/cutie-porn-tube-relax
  moviesxxxporn-blog.tumblr.com/post/127274969184/underweight-virgin-girls-live-well-nhs
  movieteensex-blog.tumblr.com/page/2
  movieteensex-blog.tumblr.com/page/3
@@ -44214,6 +44274,7 @@ mysterioussenshi.com/rebellingteenager
  mysterlingarcher.com/post/137798592101/today-i-fucked-up-by-saving-my-husband
  mysticalmaze.com/simply
  mysticalsharkvoidpurse.tumblr.com/following
+mysticdaddies.tumblr.com/post/154917245907/rfavsaeransex-toys-favorite-positions-obvi
  mysticfurry.tumblr.com/post/125964388004/sexy-females
  mysticmessenger-fic.tumblr.com/post/152054822107/how-they-punish-mc-spanking-orgasm-denial-ect
  mystyle.com/mystyle/photos
@@ -44226,6 +44287,7 @@ mytinysecrets.com/4-steps-how-to-get-a-nipple-orgasm
  mytinysecrets.com/a-womans-guide-to-penis-worship
  mytinysecrets.com/how-to-eat-pussy-a-magical-guide-for-evolved-people
  mytinysecrets.com/the-joy-of-sucking-cock-3-delicious-tips-to-help-you-savor-the-feast/
+mytranssexualtransformation.blogspot.com/2015
  mytvdate.com/template/home.php?ulang=english
  mytvdate.com/template_new
  myurl.com.tw/0c15
@@ -44517,7 +44579,6 @@ naked-truth.searchmole.co.uk/search
  naked-weapon.searchmole.co.uk/search
  naked-youth.searchmole.co.uk/search
  naked.la/touch
-nakedamateurpics.blogspot.com/2012
  nakedboyreading.tumblr.com/post/85679888205/hottest-young-gay-authors-kaleb-cove
  nakedbritishfemales.tumblr.com/post/103118530065/shag-a-british-slut-tonight-fuck-her-do-what-you
  nakedbritishfemales.tumblr.com/post/103145577789/shag-a-british-slut-tonight-fuck-her-do-what-you
@@ -44593,7 +44654,6 @@ nakkies.com/disclaimer.php?redirect=/index.php
  namaii.com/pink
  namebud.com/zoo
  namenomin.tumblr.com/post/126861591595/sexgifs8-best-hardcore-porn-videos
-nametheporn.blogspot.com/2017
  nametrack.com/landing/xxx-porn-fucking-adult-video.com
  nametrack.com/whois/xxx-porn-fucking-adult-video.com
  nametrucklife.blogolia.com/2008/01/01/alexis-love-pic
@@ -44797,6 +44857,7 @@ nekodesign.com/nix_pix
  nekothedragonslayer.tumblr.com/post/132428170550/erotique-femm3-finger-licking-good
  nelecylu73.blog.com/2013/06/30/4/
  neo-tech.com/penis
+neoculturedrabbles.tumblr.com/post/185725556467/join-us-m
  neogogol.com/forum
  neonbeyond.tumblr.com/post/135820125798/one-of-the-hardest-things-you-will-ever-have-to
  neonfire.dragonfire.net/vivaa
@@ -45018,6 +45079,7 @@ new-prod.com//www/cttc
  new-prod.com/www/cttc
  new-tranny-videos.com/category_with_shemales
  new-xxxmovies.com/fr/tag-xxx/femboy
+new-xxxmovies.com/niche/iq726a607e7a7f70731d19
  new-xxxmovies.com/tag-xxx/hidden
  new-xxxmovies.com/xxx-girl
  new2it69.tumblr.com/post/145270522892/ocswingers-adulteratedtidalwave
@@ -45076,7 +45138,9 @@ newoneh.tumblr.com/post/150630531457/berlincumcock-my-juicy-cock-suck-it
  newpicturez.com/anal
  newpix4free.com/Gallery_2189
  newplay-st.com/index.html
+newpornoknyxw.blogspot.com/2020
  newpornpicsttmers.blogspot.com/2020/12
+newpornstarxx1.blogspot.com/2013/05
  newpremiumpics.tumblr.com/likes
  newpron.co/videos
  newreject.tumblr.com/post/141135767403/can-you-give-some-blowjob-tips-i-need-to-improve
@@ -45186,6 +45250,7 @@ nice-sex2008.net/vids
  nice.backpage.com/en-un/TranssexualEscorts
  nice.kijiji.fr/c-Rencontres-Autres-RECHERCHE-DOMINATRICE-SUR-NICE-W0QQAdIdZ8748582
  nice.wannonce.com/rencontres-adultes-85/
+niceassnudefreempegnudegothicsm.blogspot.com/2009/08
  nicecleangalleries.com/thehun/ss12
  nicesweetdick.com/thedick
  niceteens.info/panties
@@ -45756,7 +45821,6 @@ nude--girls.blogspot.com/2015/09
  nude--girls.blogspot.com/2015/11
  nude--girls.blogspot.com/2016/02
  nude--girls.blogspot.com/2016/04
-nude-ass.blogspot.com/2005
  nude-babes-xxx-babe-gutte.blogspot.com/2011/08
  nude-babes-xxx-babe-gutte.blogspot.com/2011/11
  nude-beach-babe-shay-fox-r.blogspot.com/2011/06
@@ -45819,6 +45883,7 @@ nunuporn.com/cat/taiwan_90s_x_rated_movie_2
  nurse-tv.net/bn/join
  nursemania.com/unf
  nuru-massage.com/hg/27emy-Joey
+nuteensex.com/fr/vaginal
  nutritionalresearch.info/escorte-ladychou
  nutten-blog.com/category
  nuttyclothed.tumblr.com/post/./amateurcocksuckerz-cumsh
@@ -46293,6 +46358,7 @@ only-passionate-girlfriends-here.tumblr.com/archive
  onlybestpics.net/other/bb
  onlydesivideos.com/mov/24803
  onlydudes.tv/fr/category/ass-to-mouth
+onlydudes.tv/fr/search/nipple
  onlyfree.com/pure/hot/vmcrr11
  onlyfree.com/pure/new/
  onlyfree.com/pure/new/cockh10
@@ -46303,6 +46369,7 @@ onlyhere-onlynow.com/web131
  onlyhere-onlynow.com/web154
  onlyhotselfie.tumblr.com/post/112956207720/frequent-snapchat-user-more-beautiful-girls
  onlyindian.net/mv/big-breast-pressing-and-doing-naked-sex
+onlyindian.net/mv/desi-girl-ass-fuck8ng
  onlymarried-slut.tumblr.com/post/40184515130/absorblust-good-blowjob-in-a-store-dressing
  onlyshavedstuff.tumblr.com/post/110863169461/only-shaved-stuff-showing-off-dudes-with-out
  onlythekinkiest.tumblr.com/post/47090963713/stuffitinme-kinky-masturbation-and-pussy
@@ -46908,7 +46975,6 @@ pacificrimpoontantg.tumblr.com/post/156993259365/asianlover2016-two-thai-whore-s
  padlo.skystorm.net/zoo
  padoretiosman.ifrance.com/redwine
  padseb.tumblr.com/post/105769010653/kinky-night
-padxfi.blogspot.com/2017
  paenzoon.blogspot.com/p
  paffy.com/members/pics
  page.freett.com/heptadecaone
@@ -47033,6 +47099,7 @@ painofmind.bandcamp.com/album/t-34-premium-hardcore
  paintedfemales.tumblr.com/post/132477387078/bodypainting20-calligraphy-on-girls
  pair.com/geeky/
  paisdelocos.com/adultos
+pakiinstantsexchat.blogspot.com/2013/06
  palaispassion.blogspot.com/2012/02
  palanganismoexacerbado.com/.
  palanganismoexacerbado.com/curly-hair
@@ -49640,6 +49707,7 @@ porn-xxx-arab.blogspot.com/./sex-girls-fuck-videos-naked
  porn.6996.us/post/69770934785/more-nude-girls-models-picture-at-girlsgonudecom
  porn.goshow.tv/en
  porn.goshow.tv/fr/sex-films/255221/striptease-erotique-en-lingerie-sexy
+porn18sex9.blogspot.com/2019
  porn1guruxxx.blogspot.com/2020
  porn5k.me/video/sex-in-the-whorehouse
  porn720p.xyz/video/kinky-teen-slut-christy-mack-softcore-video-clip
@@ -49649,8 +49717,6 @@ porn800.me/tags/family-sex-fun
  pornaddictedfemale.tumblr.com/addict
  pornaga.com/page/anna-
  pornanderotic.blogvis.com/2009/01/07/nude-woman-having-sex
-pornaroundtheworld.blogspot.com/2010/05
-pornbasic.com/ass-licking-dick-sucking
  pornbeurette.com/arab-girl-tits-and-solo-masturbation-afgan-whorehouses
  pornbeurette.com/asiansexpornocom-hot-arab-girlfriend-blowjob-and-anal-sex
  pornbeurette.com/levrette-gros-qejaculation
@@ -49667,10 +49733,10 @@ pornbold.blogspot.com/2017
  pornbold.blogspot.com/2020
  pornbytes.blogspot.com/2005/07
  porncaptionslesbian.blogspot.com/2018
-porncinemainwomannakedsexse.blogspot.com/2009/08
  pornclips.me/fr/214/throat-fucked/view
  porncuze.com/tags
  porndons.com/perfect-10-body-gets-a-nice-dose-of-cum-inside-of-her/
+porndude.me/videos
  pornfile.cz/xhBvPaQ6/mature-les-mamans-se-font-enculer-lisa-ann-xxx-anal-ass-fucking-porno-hard-adult-sex-avi
  pornformi.fr/premium
  pornfreetube.xyz/sex
@@ -49696,6 +49762,7 @@ pornisthezeitgeist.blogspot.com/2013
  pornlolhd.com/video/1152338/couple-amateur-fellation-et-sexe-sous-la-douche
  pornlust.eu/tag
  pornmaniac.tv/fr/tag
+pornmaster.cc/hd/1/amrecan-sex-xxxxxxx/sex-swing-rimming-for-horny-lesbians
  pornmaster.cc/hd/126/www-bhanupriya
  pornmatex.blogspot.com/2020
  pornmovs.space/fr/go
@@ -49771,6 +49838,7 @@ pornstarsdigest.com/asian-pornstar-mila-jade
  pornstarsdigest.com/asian-pornstar-rita-kitano
  pornstarsdigest.com/category/asian-chinese-and-japanese-pornstars
  pornstarsdigest.com/category/male-pornstars
+porntb.com/albums/4231/sophie-dee-shaved-pussy
  pornteenfemale-blog.tumblr.com/post/120972694424/money-online-teeny-surveys-for-nsw-people
  pornteenfemale-blog.tumblr.com/post/121059122329/free-teeny-blowjob-sample
  pornteenfemale-blog.tumblr.com/post/121059776444/lady-fingering-in-shower
@@ -49814,6 +49882,7 @@ pornwix.com/category
  pornxluvo.com/video/juicy-black-girl-rides-a-big-cock-in-her-loose-pussy-4558328394410780171
  pornxxonline.com/2015/08/20/obscene-hottie-christy-mack-loves-being-fucked-hard-in-a-van-sex-xxx-porn
  pornxxxmovs.com/fr/hot/nympho
+pornyoufree.blogspot.com/2012
  pornyoungteenv-blog.tumblr.com/post/117559760475/teeny-teen-girls-getting-fucked-in-the-om
  porownywarka.interia.pl/oferta-erotyka
  porownywarka.interia.pl/oferta-filmy-erotyczne
@@ -51600,6 +51669,7 @@ ratedgross.com/tags
  ratedgross.com/videos
  ratedgross.com/videos/degrading-his-wife-with-deepthroat-puking-vomit-and-tears
  ratedgross.com/videos/sexy-brunette-with-an-amazing-ass-and-big-labia-lips-shits-for-us-in-a-scat-compilation
+ratedgross.com/videos/sexy-teen-blonde-shits-tastes-it-and-gives-a-wicked-scat-blowjob
  ratemeveythingaboutme.co.uk/topsites
  ratemymanboobies.com/ratemy
  ratherimpressive.tumblr.com/post/72235383566
@@ -51612,6 +51682,7 @@ raven12274.tumblr.com/post/129621275383/analsexbouquet-sissy-gangbang-threesome-
  ravenrile.com/new/hot2
  ravenswallowz.tumblr.com/page/13
  ravenswallowz.tumblr.com/page/14
+ravenswallowz.tumblr.com/page/15
  ravenswallowz.tumblr.com/page/4
  ravenswallowz.tumblr.com/page/42
  ravenswallowz.tumblr.com/page/43
@@ -53001,6 +53072,7 @@ refinery29.com/2016/07/116151/phone-sex-tips-how-to-talk-dirty
  refinery29.com/adult-underwear-drawer-sexy-lingerie
  refinery29.com/amp/2016/03/106651/public-sex-stories
  refinery29.com/big-penis-sex-stigma
+refinery29.com/en-us/nipple-orgasm-stimulation-tips
  refinery29.com/fr-fr/bienfaits-de-la-masturbation-orgasme-en-couple
  refinery29.com/fr-fr/comment-se-servir-de-sa-langue-pour-le-sexe-oral
  refinery29.com/how-to-masturbate
@@ -53134,7 +53206,6 @@ ren-oto.com/zepmand
  rencontre-2.com/videos
  rencontre-ado.com/Forums-pour-ados/Les-forums/17055/Comment-retarder-l-ejaculation
  rencontre-dordogne.blogspot.com/2013/10
-rencontre-extra-conjugale.blogspot.com/2013
  rencontre-femme-mure.tumblr.com/post/69758934485/rendez-vous-erotique-avec-une-femme-mature-salope
  rencontre-gay.vivastreet.fr/annonces-rencontre-gay/q/bondage
  rencontre-lesbienne.vivastreet.com/annonces-rencontre-lesbienne
@@ -53209,6 +53280,7 @@ researchlatina.com/lat276
  researchlatina.com/lat277
  researchlatina.com/lat278
  researchlatina.com/lat280
+reseaucitadelle.blogspot.com/2012
  reseauetudiant.com/forum/read/f187/i10519t10519
  reseauetudiant.com/forum/read/f797/i2382t2382
  reseauxl.com/ANAL-ROYALE
@@ -53575,7 +53647,6 @@ robtex.com/ext/dom/www.live-sex.tv
  robthetumblur.tumblr.com/post/132975282808/greenjade1-sexy-busty-chinese-babe-wearing-a
  roccasinibalda.eu/Pont-de-Ch
  roccasinibalda.eu/Saint-Coulombvieillerenlesbiennesafricaine/q
-rocco-siffredi-picture4554.blogspot.com/2003/03
  roccodreamholidayasia.tumblr.com/post/180788169439/8-best-adults-hotels-in-subic-bay-to-bang-girls
  roccosteelefan.tumblr.com/post/133128641052/ghost110-rocco-steele-fucking-a-fan-in-this
  rock-n-roll-imagines.tumblr.com/post/62798530390/mr-mrs-horny-smut
@@ -53592,6 +53663,7 @@ rockshoppe.com/pinups
  rockstar6554.tumblr.com/following/page/15
  rockto7.tumblr.com/post/112270381033/thenaughtygay-follow
  rockwellclothing.com/parra
+rockyil312.tumblr.com/following
  rockytech.com/orientalxxx/girl2
  rockytech.com/orientalxxx/girl3
  rocorambles.tumblr.com/post/628101220579590144/ok-but-kageyama-is-such-a-boob-person-right
@@ -53818,7 +53890,6 @@ rssing.com/index.php
  rsspect.com/rss/littledirties.xml
  rstmp.tumblr.com/post/109785912823/blackownedwhitesissy-fuck-my-mouth-harder-daddy
  rt002ceg.eresmas.net/adult
-rt5t656.blogspot.com/2012/01
  rteksystems.com/documents/pill/cache
  rtfd.net/free4you/
  rtl.be/people/people/sexy/754959
@@ -54158,7 +54229,9 @@ samiam.org/~badboys
  sammiedanielshdvideos.tumblr.com/post
  sammyslutcunt-deactivated201501.tumblr.com/post/108947451306/oh-fuck-you-you-little-fucking-darling-squeeze
  sammysperm.tumblr.com/post/149586822842/gigglefuck-red-is-sexy-r
+sampleboys-blog.tumblr.com/post/142604059783/boy-cam-hilariousfilm
  sampleboys-blog.tumblr.com/post/142604129258/gay-porno-layoutscodes
+sampleboys-blog.tumblr.com/post/142604401443/boys-gay-lez-match-makercom
  sampleboys-blog.tumblr.com/post/142604504538/www-gay-sex-sites
  sampleboys-blog.tumblr.com/post/142605426673/baros-hot-gay-part
  sampleboys-blog.tumblr.com/post/142606327803/swart-junior-gay-boys-thugs
@@ -54657,6 +54730,7 @@ sebastian-outdoors.tumblr.com/post/110914999836/kalebsutra-sex-position-playtime
  sebastianshaw23.tumblr.com/post/113168978763/nude-art
  sebastien39.tumblr.com/post/111178641265/gay-bdsm-world-gay-bondage-live-on-webcam-adult
  sebbi.de/archives/2005/07/19/i-hate-you-spamers
+sebshairline.tumblr.com/post/183523065925/okay-but-edging-seb
  sebsys.com/sophie
  secasa.com.au/pages/the-victorian-register-of-sex-offenders
  seckince.com/s/
@@ -54747,6 +54821,7 @@ seins.unblog.fr/2007/04/18/porno-films-extrait-gros-seins-sexe-video-porno-gratu
  seks-filmy.za.darmo.biz/whore-in-one-nicole-ray-fucked-outdoor
  seks-show.pl/gangbang/amateur-slutwife-bareback-creampie-gangbang
  seks-show.pl/nastolatki/hot-amateur-chick-porn-with-anal-scenes-scene
+seksdarmo.com/group/ass-licking
  seksfilmpjes.nl/?p=316&pi=seksfilmpjes-com
  seksfilmpjes.nl/?p=316&pi=spermaplaatjes-nl
  seksfilmpjes.nl/?tb=1&p=316&pi=typein
@@ -55000,6 +55075,7 @@ sexe.ze-newsget.org/salopesxchiennassex
  sexe45.iquebec.com/Chatte
  sexe45.iquebec.com/Chattes
  sexe4free.blogspot.com/2007/04
+sexedforbiguys.tumblr.com/post/184608798257/butt-sex-101-sex-ed-for-bi-guys
  sexedforbiguys.tumblr.com/post/188436120214/sex-with-a-clit-owner-part-2-bodies-made-for
  sexedplus.com/not-having-sex-is-fine-too
  sexeducationteens-blog-blog.tumblr.com/post/119803711165/cutie-white-girls-lesivian
@@ -55045,7 +55121,6 @@ sexpornx.com/indian-adult-cartoon-penthouse-tv-hd1-16
  sexpornx.com/indian-handjob-adult-penthouse-tv-hd1-17
  sexpornx.com/latina-world-adult-playboy-naughty-dorm-girls-get-crazy-2
  sexportal.com.ua/en
-sexrobotchatwithman.blogspot.com/2013
  sexshop-midt.dk/shop/default.asp
  sexshop-midt.dk/shop/frontpage.html
  sexshop.wirtua.net/PartnerDefault.asp?PartnerID=33
@@ -55083,8 +55158,6 @@ sexualityandu.ca/sexual-health
  sexualrealities.blogspot.com/2011/05
  sexualsite1.blogspot.com/2010
  sexualtrance.com/?tid=sexualtrance.com
-sexvideoin69.blogspot.com/2020/08
-sexvideosfreedownloads.blogspot.com/2011/09
  sexvideoskit.com/fr/in-video-category
  sexvideoskit.com/fr/tag/big
  sexvideoskit.com/in-video-category
@@ -55121,6 +55194,7 @@ sexyasouhait.com/dirty-whore-swallowed-eight-cumshots
  sexyblack-escortegirl.blogspot.com/2011/02
  sexycharito.blogspot.com/2010/05
  sexydreamserotic.blogspot.com/2013
+sexyeighteen.blogspot.com/2014/03
  sexyeroticajangt.blogspot.com/2020
  sexyeyez.com/video/cepten-porno-izle
  sexygeeky.harrybentley.co.uk/webcomic-links/
@@ -55180,6 +55254,7 @@ sexystuffbymail.tumblr.com/post/164743673965/bottoms-up-anal-comfort-lube-63oz-s
  sexytags.net/keyword/kendra_james/Sesso
  sexytransmascthings.tumblr.com/post/150391672162/what-a-sexy-soft-t-boy-cock-suck-it-for-me
  sexyvices.com/directory1.cfm
+sexywomansmokingvampiresex.blogspot.com/2009/08
  sexyyoungcuties.tumblr.com/post/146770938259/naked-hot-girl-horny-teen
  sexyzellaphillips.blogspot.com/2020
  seytech.tumblr.com/post/121056983939/postcumshot-cumshot-lesbian-sex-threesome-adult
@@ -55280,6 +55355,7 @@ shawnsprincesse.tumblr.com/post/137210432591/hot-mess-harry-styles-au
  shawnsprincesse.tumblr.com/post/180494840956/nda-harry-stylesshawn-mendes-au
  shay-laren.over-blog.com/m
  she-loved-her-endlessly.tumblr.com/post/103499514289/refreshinglyclassic-burningoleander
+sheblokes57.com/tag/cocksucker
  sheblokes57.com/video/10019/pov-mega-bitch-gulps-cum
  shecuckedme.tumblr.com/post/110111391912/wickedvegas2point0-www-heywicked-com
  shecuckedme.tumblr.com/post/116462422032
@@ -55322,6 +55398,7 @@ shemale.pornvids.fr/video/kdraW_transexuelle-punk-dernier-dani-daniels-punit-son
  shemale.pornvids.fr/video/pEpGp_femboy-salope-minables-ladyboygold
  shemale.pornvids.fr/video/r1ann_mignon-tgirl-obtient-rimjob
  shemale.pornvids.fr/video/z64Q1_rada-en-penthouse-piquer-play-ladyboygold
+shemalecam.com/landing/templates
  shemalecams.pro/cute-shemale-webcam-tubes
  shepenis.tumblr.com/post/123756756456/hookup-with-a-shemale-tonight
  sherbrooke.kijiji.ca/c-rencontres-aventures-Transexuel-recherche-W0QQAdIdZ100860616
@@ -55518,8 +55595,6 @@ shockingfiles.com/peemania/4
  shockingvideoyes.blogspot.com/topbigvideo13.blogspot.com/xxxlvideo.blogspot.com
  shockwavegames.de/freegames/hentai
  shockwavegames.de/freegames/pornholio
-shoejob.net/category/fetish-
-shoejob.net/red-snake-leather-heels-erotique-shoe-sex
  shoepaparazzi.com/boot-trends-bondage-torture-and-comfort
  shoga.wwa.com/~flagg
  shojo-palace.superforum.fr/t99-6teen-hentai-6teen-hentai-comics
@@ -55804,7 +55879,6 @@ sin.typepad.com/shauna_by_night/2006/03
  sinart.asso.fr/en/petites-culottes-chaudes-et-mouillees-la-chatte-aux-tresors-fantasmes-de-femmes-26913
  sinatrablue134.tumblr.com/post/149239912509
  sinbad.net/~mikec
-sincityclips.blogspot.com/2011
  sindystroker.tumblr.com/archive
  sinfullvibes.tumblr.com/post/123784432628/send-me-nudes-when-you-get-home-so-i-know-youre
  sing365.com/music/lyric.nsf/Def-Dick-lyrics-Bone-Thugs-N-Harmony/7A1CE742BD30E38B48256C92000BF87B
@@ -55842,6 +55916,7 @@ sissis-cam.de/viewpage.php?page_id=48
  sissy-boi-slave.tumblr.com/post/130365503702/triple-shemale-trannyfucksguy-shemale-bdsm
  sissy-brian.tumblr.com/post/116125668942/sissy-slut-status
  sissy-chrissy-boi.tumblr.com/post/121503243093/sissyslutwannabe420-likeshemalepost-i
+sissy-feminization-fantasies.tumblr.com/following
  sissy-jana.tumblr.com/post/110405284408/femdom-zone-free-webcam-adult-chat-with-horny
  sissy-pantyhose-feet.tumblr.com/post/138042371141/pantyhoseorgasm-omg-yesss-what-a-lucky-girl-to
  sissy-planet.tumblr.com/post/165800255862
@@ -56392,6 +56467,7 @@ skyblog.com/photo_profil/you-fuck-bitch_23291661
  skydiamondz.tumblr.com/post/161705996904/calicocksucker-justme085-caught-at-the
  skydiving-nude.searchmole.co.uk/search
  skyehighnova.tumblr.com/post/140828482025/20-yr-old-hotwife-looking-for-a-bbc-to-fuck
+skyhealth.top/sex
  skykite.info/MFFF/03aaa
  skykite.info/MMMF/05
  skykite.info/MMMF/purec/13h
@@ -56431,6 +56507,7 @@ slave4tg.tumblr.com/post/130149293220/this-goes-out-to-all-you-tgirl-goddesses-o
  slaveboy22222.tumblr.com/post/109241803650/chastityliving
  slavebride.blogspot.com/2010
  slavedj-betamale.tumblr.com/following
+slaveexchangenola.tumblr.com/following
  slavegirlscentral.tumblr.com/post/156646983487/slave-sluts-sucking-cock
  slavelina.tumblr.com/post/81362012772/rapesluts-two-pathetic-cunts-making-out-with-a
  slaveormaster.tumblr.com/post/38963487739
@@ -56452,6 +56529,7 @@ sleazylezzies.com/xx
  sledujutelku.cz/porn
  sleeping-ass-ebony-babe-dog-porn.blogspot.com/2011/05
  sleeping-ass-ebony-babe-dog-porn.blogspot.com/2011/10
+sleeping-ass-ebony-babe-dog-porn.blogspot.com/2011/12
  sleeping-ass-ebony-babe-dog-porn.blogspot.com/2012/03
  sleeppy.lflinkup.net/voyeurs
  sleezedoutt.tumblr.com/post/127754496887/thecocoacumslut-chris-got-a-long-fucking
@@ -56591,6 +56669,7 @@ smsprotexion.be/advalvas/fr
  smterry.tumblr.com/post/32921850048/two-women-fisting-pussy-and-ass-using-1-and-2
  smudger19xxx.tumblr.com/post/134085276165/jennas-quick-guide-to-anal-orgasms
  smugrobotics.tumblr.com/post/49401537700/kink-checklist-meme-ask-for-tommy-john-or-bane
+smutbymia.tumblr.com/post/190889529628/omg-can-u-pls-make-another-nipple-sucking-fic-but
  smutcam.live/webcam-blow-jobs
  smutdocket.com/julio9515
  smutdr.tumblr.com/post/104042935998/vigorouswildebonys-cock-hungry-big-breasts
@@ -56608,6 +56687,7 @@ snafu.de/~jaeger.m/pam
  snafu.de/~sascha
  snagfilms.com/films/title/begging_naked
  snapchatforum.com/forum/44-snapchat-nude-pictures-girls
+snapofactress.blogspot.com/2012
  snapplepapple.blogspot.com/p
  snapsafadoo.tumblr.com/post/154086457704/fuckmeorsomethingplease-pussy-is-so-tight
  snarkerati.com/celebrity-gossip
@@ -57514,6 +57594,7 @@ sterenn.tumblr.com/post/38907695125/g33kdesire-g33k-desire-blowjobs-cumshot
  sternkey.tumblr.com/post/139690602019/zendildos-cindrfnrella-crazygggstuff
  stetienne.org/bob
  steveeray.com/bikini
+steveh1977.tumblr.com/following
  stevenrogerstv.tumblr.com/post/39349005263/transsexuals-transvestites-shemales-i-love
  stevenrogerstv.tumblr.com/post/43672341352/transsexuals-transvestites-shemales-i-love
  steverogersisavirgin.tumblr.com/post/107192394103/beingsillyandgay-lesbian-goddesss-you-know
@@ -57687,6 +57768,7 @@ stripchatcams.com/livesex
  stripclubdirectoryeroticasex.blogspot.com/2009/08
  striplvapp.com/collections/all
  stripperclaradantas.blogspot.com/2015/01
+stripteasecams.net/category
  stripteasfreeeroticpictureofnake.blogspot.com/2009
  stripvideohornynymphosgothics.blogspot.com/2009
  stripyhelmet.net/thehun
@@ -58138,6 +58220,7 @@ sw-town.com/maiko
  sw4rmed-deactivated20150131.tumblr.com/post/76891227081/sex-ink-metal-xxx
  swagglemaggles.tumblr.com/post/98272079474/lesbian-goddesss-fuck-fuck-fuck-fuck-that
  swallowdeez.tumblr.com/post
+swallowing-cock.blogspot.com/2007
  swanblood.tumblr.com/post/16110374261/content-sex-discussion-of-fetishes
  swanswanhummingbird.tumblr.com/post/109922235670/sexymilesladies-erotic-sexy-fun-archive
  swe-gaming.com/joe9733
@@ -58577,6 +58660,7 @@ taschen.com/pages/en/catalogue/sex
  taskbarclock.blogspot.com/2019/01
  tasks.elpeus.org/mitch4298
  tasmania.globat.com/~zerotom.net
+tastefulnudeteens-blog.tumblr.com/page/4
  tastelikehome.co.za/sex/sex-sado-mazo-f6be4-2f16c
  tastemycherryplease.tumblr.com/post/142274823734/please-rape-me-im-such-a-dirty-whore-doing-this
  tasteygirls.tumblr.com/post/108251277109/girlmasturbation-close-up-self-fucking-and
@@ -59059,6 +59143,7 @@ teen-blonde-ass-eliza-dushku-nude-bl.blogspot.com/2011/07
  teen-blonde-ass-eliza-dushku-nude-bl.blogspot.com/2012/05
  teen-model-young.com/staci-lemonrock
  teen-naturist-pics4049.blogspot.com/2005
+teen-shemales.blogspot.com/2005/02
  teen.com/bella-thorne-ariana-grande-emma-stone-2011-redhead-pink-hair-celebrities-photos
  teen.seo-admin.info/adult_2
  teenadviceexpert-blog.tumblr.com/post/117032247927/orgasm-sexy-young-free-pics
@@ -59309,6 +59394,7 @@ tequiladc2020.tumblr.com/image/139643914198
  tequiladc2020.tumblr.com/image/139773523428
  tequiladc2020.tumblr.com/post
  ter69pro.blogspot.com/2020
+tera-patrick-bestof-blog.tumblr.com/page/2
  tera4free.com/galleries/ebony
  terabytetown.com/members/blade/
  tereluziamac.blogspot.com/2012
@@ -60046,6 +60132,7 @@ tezcat.com/~ksbrooks/gj
  tezlabyte.dk/upload/chicks/Pics
  tezyqo88.blog.co.uk/2013/06/28/barbi-benton-pussy-catherine-bell-nude-jim-greenwood-great-debate-16174411
  tezyqo88.blog.co.uk/2013/06/28/carrie-prejean-sextape-sarah-michelle-gellar-boobs-hmccoy-at-coxohio-16177108
+tf-lover.tumblr.com/post/630969733792006144/now-lets-see-those-pigs-pinch-my-ass-said
  tf.tribes.cc/telfort/px/urlt/175/www.phonerotica.com/wap/pics/shoots
  tf1.fr/video/sexy
  tf1.lci.fr/video/sexy/sexy_entree
@@ -60623,6 +60710,7 @@ themetapicture.com/not-yet-little-asian
  themidwifeisin.com/post/138243138880/so-having-sex-with-a-condom-tends-to-hurt-me-but
  themightychin.com/chins_babes
  themistressadler.tumblr.com/post/106363079281/my-first-time-being-a-cock-whore-for-mistress
+themistresstaha.blogspot.com/2012/11
  themlmrescueteam.com/the-lesbian-midget
  themoteur.com/top
  themysticelburrito.tumblr.com/post/95583418558/i-dont-even-fuck-with-foot-fetish-shit-like-this
@@ -61475,6 +61563,7 @@ thoughts.com/shoes
  thr33somefun.tumblr.com/post/137669084987/double-stuffin-pussy-it-really-does-feel-fucking
  threepanty.tumblr.com/post/98063412760/panty-adult-panties-nudity
  threesome-mmf-black-pre-teen-pussy-l.blogspot.com/2011/12
+threesome-positions.blogspot.com/2005
  threesome.linux-dude.com/groupsex
  threesome.onthenet.as/groupsex
  threesomesblog.tumblr.com/post/134362073046/my-passionate-babes-photos-xxx-lesbian-nipple
@@ -61501,6 +61590,7 @@ thubbythoughts.tumblr.com/post/148459508599/sexytimeforsex-listen-to-that-pussy-
  thudam.me/xvideos/v/32551809
  thudam.me/xvideos/v/34155669
  thudam.me/xvideos/v/35698011/sex-Furry-Foursome
+thudam.me/xvideos/v/42559211/sex-Clear-Genitals-Lady-Love-Dildo-In-The-Vagina
  thudam.me/xvideos/v/4943066
  thudam.me/xvideos/v/50509325/sex-impregnating-my-two-sisters-bbw-goth-threesome-parts-1-amp-2
  thudam.me/xvideos/v/59526753
@@ -61910,6 +62000,7 @@ todaysbighit.com/2013
  toddcouples.com/products/novelty-toys/cockrings/
  toddcouples.com/products/novelty-toys/cockrings/double-penetration-cockrings
  todihiqila.unblog.fr/2014/11/05/fetish-sex-an-erotic-guide-for-couples-book
+todobaku-shoukat.tumblr.com/post/174021007365/lingerie-explicit-smut
  todochistoso.com/category/cositas-cachondas/
  todocoleccion.net/coleccionismo-adultos-revistas/red-butts-revista-sado-disciplina-anos-90-revista-erotica
  todoelvicio.com/amateur.html
@@ -62750,6 +62841,7 @@ tranniesmovies.net/new-shemale-student-surprises-friend-with-a-fucking
  tranniesmovies.net/shemale-sea-fucking
  tranniesmovies.net/three-on-one-alleyway-shemale-gangbang-surprise
  tranny-gifs.tumblr.com/post/123717474214/click-here-now-for-real-shemales-performing-live
+tranny-tits.blogspot.com/search/label/transsexual
  trannyfuckingsex.tumblr.com/post/159776362105/girlboy-part-2-finger-oral-lee
  trannyfuckingsex.tumblr.com/post/159849390895/a-sandy-surprise-4k-secret-download-tit-cum
  trannyfuckingsex.tumblr.com/post/159920526635/ts-boss-breaks-in-her-new-assistant-style-tit
@@ -62766,8 +62858,10 @@ trans.pill-drug-store.com/shemale
  transbodypride.tumblr.com/post/66079518121/heres-a-pic-of-my-smoking-hot-girlfriends-lips
  transbutt.tumblr.com/post/137583783327/michiou-gay-orgy-on-trumps-lawn-whos-in
  transcanuck.com/2014/08/we-applaud-drew-curtis-and-fark-for-banning-sexism-racism-and-lgbt-bashing/
+transex.blogspot.com/2005/02
  transexe.xyz/hardcore
  transexualnightlife.com/transexual-clubs
+transexuel-toulouse.blogspot.com/2018
  transfert.net/Dossier-sexe-Tout-ce-que-vous-avez
  transform.to/~dansan/icb2e/
  transformher.blogspot.com/2011/06
@@ -63515,7 +63609,6 @@ tuntematonmaa.net/ousm
  tuntematonmaa.net/turunbaletti
  turacody.socialgo.com/forum
  turandot.com.tw/images/thumbs
-turbo-porn.blogspot.com/2020
  turbo-transerfing.ru/videos
  turbogvideos.com/2017
  turboimagehost.com/p/1800937/nice_creampie_1.jpg.html
@@ -63779,8 +63872,11 @@ twinkcumlord.tumblr.com/post/109107730459/submit-your-hot-nudes-or-videos-like-t
  twinkfilmsfree.tumblr.com/post/116666946496/gay-male-gallery-free-orgy
  twinkfilmsfree.tumblr.com/post/116667535076/emo-twink-video-tgp
  twinkfilmsfree.tumblr.com/post/116667606846/gay-porn-gay-video
+twinkfilmsfree.tumblr.com/post/116668520666/gay-mature-twinks
  twinkfilmsfree.tumblr.com/post/116668543226/toys-twinks-uncut
  twinkfilmsfree.tumblr.com/post/116668677816/bfs-hung-black-bfs-hunk/amp
+twinkfilmsfree.tumblr.com/post/116668720871/free-gay-sex-jerk-off-galleries-sex
+twinkfilmsfree.tumblr.com/post/116669111376/broke-straight-boys-review
  twinkfilmsfree.tumblr.com/post/116670421766/queer-big-penis-pistures
  twinkfilmsfree.tumblr.com/post/116671171291/cock-unencumbered-teenaged-stark-naked-boys
  twinkfilmsfree.tumblr.com/post/116671238621/gay-fat-booty-anus-fucking
@@ -63803,6 +63899,7 @@ twinkhugeinsertions.tumblr.com/post/128522632741/free-queer-xxx-video-of-the-day
  twinkhugeinsertions.tumblr.com/post/128523201151/gay-guys-kissing-pics
  twinkhugeinsertions.tumblr.com/post/128523349236/boy-clip-free-gay-vivo
  twinkhugeinsertions.tumblr.com/post/128524529381/video-gay-ballero
+twinkmama.blogspot.com/2010
  twinks-french-art.tumblr.com/post/115039695176/roissy-charles-de-gaule-vendredi-soir-23
  twinks-rule-my-universe.tumblr.com/post/96843878428/evn89-he-is-so-fuckin-hot-so-hot-why-would
  twinksaddict2.tumblr.com/post/111454626375/fursnake7-nudefathersandsons-fucking-hot-twin
@@ -64954,6 +65051,7 @@ vaudoise1844.tumblr.com/post/124658523526/only-girls-masturbation-video-follow-m
  vavoommag.com/gal/tuesday
  vavoommag.com/members
  vaxxine.com/misc/sponsors/elitecash
+vbokepindi.blogspot.com/2019
  vbs.tv/blog/a-to-z-of-sexual-history-masturbation-prevention
  vbs.tv/blog/the-female-eunuch-s-knife-wound-blowjob-conception
  vbs.tv/de/videos/label/Sex/
@@ -65084,6 +65182,7 @@ vice.com/en_uk/read/talking-big-dicks-submission-and-the-changing-porn-industry-
  vice.com/en_uk/read/the-end-of-uk-bdsm-282
  vice.com/en_uk/read/we-asked-some-girls-how-they-masturbate-876
  vice.com/en_uk/read/we-spoke-to-malcolm-brenner-the-guy-who-had-sex-with-a-dolphin-and-the-star-of-new-documentary
+vice.com/fr/article/59dzqd/la-vie-sexuelle-dun-mec-qui-porte-la-lingerie-de-sa-cherie
  vice.com/fr/article/xdbm87/ce-quon-voit-lorsquon-est-une-fille-en-soiree-bdsm-282
  vice.com/fr/read/danemark-capitale-europeenne-du-tourisme-sexuel-zoophile
  vice.com/fr/read/dernier-porno-de-paris-soiree-couples-beverley-909
@@ -66213,6 +66312,7 @@ warianoz.com/foros/forumdisplay.php?f=57
  warimode.com/gals/akiko
  warimode.com/gals/deai
  warmbeebosoftbeebo.tumblr.com/post/190815068045/caricatures-ofand-intimacy
+warmbeebosoftbeebo.tumblr.com/post/617124861880500224/ok-i-have-a-feminine-question-idk-why-i
  warmbeebosoftbeebo.tumblr.com/post/618488958773608448/what-is-sex-with-bonus-positions-to-help-him-come
  warmbeebosoftbeebo.tumblr.com/post/630367314925273088/gay-sex-well-sex-frottage-erotica-inherent
  warmingglow.uproxx.com/2009/08/teens-having-sex-and-doing-drugs
@@ -67430,6 +67530,7 @@ webmediaportal.com/hollywood-celebrities/hot-alexus-winston-maxim-photos-alexus-
  webmodels.se/johanna
  webmotosclasicas.com.ar/search/label/pinup
  webmup.com/2c24a
+webnovel.com/book/random-jikook-smut-stories_14956308205253505/fucked-by-my-high-school-jock_40148361692634477
  webodromo.com/Top/Adult/Image_Galleries
  webofchaos.blogspot.com/2017
  webofchaos.blogspot.com/2020
@@ -68132,7 +68233,6 @@ wgn.net/~rgurse
  wgn.net/~rlj/series-a4hdn2-010
  wgn.net/~westex/img
  wgn.net/~westex/links
-wgnoticetitfuckpicfreexxxamateu.blogspot.com/2009/08
  wgrd.com/girls-who-masturbate-with-crack-pipes-get-in-trouble-bar-stool
  wgwp.com/dkneht
  wgwp.com/dunia
@@ -68917,6 +69017,7 @@ wtc-ep.edu/espl/somos/images/5727940/96697
  wtf.headbash.com/cumshots
  wtfconcrete.tumblr.com/post/75390313277/du-son-lourd-gras-crasseux-comme-une-sodomie
  wtfcouple.tumblr.com/post/149547779440/maximumxxxporn-cheating-sex-video-tube
+wtfsexfacts.blogspot.com/2010
  wtfzodiacsigns.com/post/137586238067/8-zodiac-signs-who-has-sexy-voice
  wtv-zone.com/silverbullet111/cd/dickinsonbruce
  wtvr.com/2013/12/03/teen-caught-having-sex-with-dog
@@ -69232,7 +69333,6 @@ xasiandvd.com/new04B
  xasiandvd.com/new06C
  xasiandvd.com/new_face
  xasiandvd.com/newface3
-xasianpornx.blogspot.com/2014/07
  xavierpow.tumblr.com/page/8
  xaxor.com/female
  xbellybabes.tumblr.com/post/152494867808/anal-play-naughty-girls-on-webcam
@@ -69386,6 +69486,7 @@ xnxx.tubekek.com/video-k09uzb0
  xnxx.tubekek.com/video-r49am68/young_american_brunette_on_adult_video_chat
  xnxx.tubekek.com/video-t9bnxed/erotic_centerfold_turns_into_mad_bitch_and_shags_her_lesbo_buddy_with_strap_dildo
  xnxx.tubekek.com/video-u1vpjd7
+xnxx.tubekek.com/video-x7hnna2/22/cyber_sex
  xnxx.tubekek.com/video-xzmlf76
  xnxx2013chatonline.blogspot.com/2013/06
  xnxx4porn.com/search/latex-anal-fisting/13
@@ -69481,6 +69582,7 @@ xtubex.tumblr.com/post/103758273857/bondage-hentai-coed-gangbang-and-splash-cum
  xuguangxue.tumblr.com/post/46710449552/sexy-anal-teen-anal-penetration-the-first
  xunocomun.tumblr.com/post/110456874989/sexy-pictures-at-my-tumblr-blog
  xuvana.cw.cm/chat
+xuxa-ilarie.blogspot.com/2008/01
  xv8r.com/./active-elite-female-college-student-intellectual-
  xvideo.mx/se
  xvideos.wapka.cc/amateur-channels/lana_lava
@@ -69496,7 +69598,9 @@ xvideos.wapka.cc/video55764095
  xvideos.wapka.cc/video6138614/jynx_maze_et_roxi_texas_deuxieme_partie
  xvideos.wapka.cc/video8906776
  xvideos17.com/videos/rough-throat-fucking-foursome-GjXJ
+xvideos2.rocks/video
  xvideosfeed.blogspot.com/2016
+xvideosok.com/en/video/1426482545966120480
  xvideosonline.org/french-slut-pipe-en-voiture-et-baise-en-avion
  xvideossxnxx.com/awesome-group-sex-in-the-club-linkfull-http-q-gs-e5zew-search
  xvolex-deactivated20131022.tumblr.com/post/54536437709/httpxvolextumblrcom-best-perverted-sex
@@ -69531,6 +69635,8 @@ xxvalkyrie.tumblr.com/post/138246569337
  xxvalkyrie.tumblr.com/post/138358107812
  xxvalkyrie.tumblr.com/post/138388230022
  xxx-erotic-stories.blogspot.com/2008
+xxx-erotic-stories.blogspot.com/2010
+xxx-sluts.blogspot.com/2015/05
  xxx.pornpeel.com/853084
  xxx.tubedare.net/search
  xxx.tubedare.net/search/hits
@@ -69557,8 +69663,10 @@ xxxftw666.tumblr.com/post/118425821925/biggangbanglover-group-fuck-photos-videos
  xxxfuckvideo.blogspot.com/2018
  xxxgif.info/doggystyle-hardcore-fucking-of-her-pretty-pussy
  xxxgif.info/make-her-come
+xxxgirlssex.blogspot.com/2008
  xxxgranny.tumblr.com/post/149336105334/nude-grannies-matures-pussy
  xxxhd.pl/Twardy-penis-rznie-dwie-gorace-cipki-hd
+xxxkinkywiqxxx.blogspot.com/2012/10
  xxxlesbiantv.com/fr
  xxxlicious.com/fr/
  xxxlivehd.com/fr/kilo-porn/quickie
@@ -69570,15 +69678,19 @@ xxxpretty.com/category
  xxxsex69.blogspot.com/2016
  xxxsexe91xxx.tumblr.com/post/107232040780/sluty-anal-wife-dpdoug-timea-bella
  xxxsexzoo.com/videos/hot-japan-bondage-zoophilia-porn-for-a-hot-woman
+xxxsexzoo.com/videos/severe-adult-xxx-zoophilia-along-amateur-female
  xxxstreamingporn.biz/explicit-hardcore-orgasms
  xxxstreamingporn.net/hardcore-tied-up-double-penetration-gangbang-rape
  xxxtubebbw.com/en/bbw-tape/Public
  xxxtubegain.com/en/category-of-xxx/aWktNTc0LTM0Nw
  xxxtubeon.com/clips-free
+xxxvideojdzfl.blogspot.com/2020/12
+xxxvideou.blogspot.com/2019/12
  xxxvideou.blogspot.com/2020
  xxxwetstory.com/asian
  xxxxjenniferdu76xxxx.skyrock.mobi/related_blogs
  xxxxmpegfreepornnudefemaleph.blogspot.com/2009
+xxxxporn.mobi/xxx/108411/khalifa-alia-sex-neket
  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx.com/buy/adult/movie/sex
  xxypics.blogspot.com/2019/08
  xybidy67.soup.io/post/355414133
@@ -69782,6 +69894,7 @@ yougotnojams73.tumblr.com/post/189409971926/bts-reactions-the-boys-watch-you-guy
  youlingerie.tumblr.com/shop-now
  youmeatsixfanfictions.tumblr.com/promptlist
  young-angels.ru/LPT
+young-hairy-pussy-naked-big-b.blogspot.com/2011/05
  young-hairy-pussy-naked-big-b.blogspot.com/2011/10
  young-hairy-pussy-naked-big-b.blogspot.com/2012/01
  young-kat.net/galleries/011
@@ -69795,7 +69908,6 @@ young-webcam-video.blogspot.com/2018
  young-webcam-video.blogspot.com/2018/05
  young.scot/information/identity/questions-you-might-be-asked-if-you-come-out-as-lesbian-gay-or-bisexual
  younganddumbslut.tumblr.com/post/115398539336/womynrespecter-youre-gonna-suck-my-cock-in-the
-youngasiantrannies.blogspot.com/2013/02
  youngbicouple-deactivated201501.tumblr.com/post/104549305455/my-baby-has-a-sexy-tight-little-ass-i-constantly
  youngboytwinks.com/index.shtml
  youngfattiessex.biz/AdultHugeBoob
@@ -69828,6 +69940,7 @@ youngsweetface.tumblr.com/post/116765323902/tiny-girl-lady-boys
  youngsweetface.tumblr.com/post/116767303472/free-video-amateur-striptease-slut
  youngtapeporn.com/video/sydney-se-fait-baiser-avec-sa-petite-culotte-en
  youngteenagewomen.tumblr.com/post/132243465901/amateur-nipple-slip-collegegirl-hard-sexy
+youngteenstepped-blog.tumblr.com/post/125470771114/teenybopper-sexy-lesbian-girls-having-sex
  youpa.com/sexe_gratuit
  youpil.net/category/sexy
  youpinet.com/xxx-adultes
@@ -70313,6 +70426,7 @@ zurichinvestmentsltd.com/2257/
  zuzaa.com/gallery
  zv-magazine.be/sfw
  zv-magazine.be/user
+zverevaippahynu.blogspot.com/2011
  zvezd.ru/inostr
  zvornik.bbfr.net/t18-zoophilie-extrait-gratuit-xxx-vieille-cochonne-nue-photo-amateur-de-femme-vestiaire
  zvraceny.cz/video/59477-bizarre-ejaculation-sado-sexual-nipple-torture-practises/
diff --git a/blacklists/dating/domains b/blacklists/dating/domains

index 8c262028d99eb217a01db9ad0d0d3952ba59d2de..7583c7df2bc3ec2ee9d957a6e796d3e99330b7df 100644 (file)
--- a/blacklists/dating/domains
+++ b/blacklists/dating/domains
@@ -368592,3 +368592,4 @@ zzzyzxxx.tumblr.com
  zzzz-m.tumblr.com
  zzzzporn.com
  zzzzzzzxxs.kali-shop.ru
+planbi.fr
diff --git a/blacklists/malware/domains b/blacklists/malware/domains

index 18396b3a5d327db83533660ed7e90120ea09953e..427fa89a14ce1da4ec2ebcf667b60696345bbd6a 100644 (file)
--- a/blacklists/malware/domains
+++ b/blacklists/malware/domains
@@ -360,7 +360,6 @@
  0ckvh7ixp4.xyz
  0cra-cerbrelief.info
  0cv1vz.wang
-0d08c5a62c3637892.temporary.link
  0d3b2eda0f3141744.temporary.link
  0d43fefdde03fc1d207c35ca6bc0ae6b.icu
  0d4498c9-1a5a-4332-8163-5a8c68a45895.godaddysites.com
@@ -525,12 +524,14 @@
  1.0.220.3
  1.0.220.98
  1.0.224.112
+1.0.227.211
  1.0.231.185
  1.0.232.183
  1.0.240.94
  1.0.255.224
  1.0.255.243
  1.1.131.251
+1.1.138.168
  1.1.160.73
  1.1.161.184
  1.1.161.244
@@ -541,6 +542,7 @@
  1.1.223.69
  1.1.223.95
  1.1.225.182
+1.1.226.123
  1.1.227.163
  1.1.228.99
  1.1.233.240
@@ -557,6 +559,7 @@
  1.10.152.238
  1.10.165.49
  1.10.171.36
+1.10.180.38
  1.10.186.114
  1.10.186.167
  1.10.186.35
@@ -576,18 +579,27 @@
  1.10.229.231
  1.10.232.83
  1.10.239.138
+1.10.242.190
  1.10.246.179
+1.10.248.147
  1.10.248.244
+1.11.201.18
+1.119.131.102
  1.119.153.110
+1.119.166.234
  1.122.234.70
  1.122.64.110
+1.129.20.95
+1.129.27.254
  1.136.110.148
  1.157.192.174
  1.159.22.75
+1.160.100.177
  1.164.140.145
  1.164.97.194
  1.165.181.69
  1.165.182.50
+1.168.216.132
  1.170.183.146
  1.171.195.111
  1.17110.com
@@ -615,13 +627,19 @@
  1.179.180.98
  1.179.181.149
  1.179.183.73
+1.179.185.50
  1.179.186.174
  1.179.186.69
+1.179.196.109
  1.179.196.65
  1.179.198.226
  1.179.201.153
  1.179.246.244
+1.180.217.139
  1.186.242.12
+1.186.248.136
+1.186.37.103
+1.186.38.60
  1.186.40.157
  1.186.40.177
  1.186.40.2
@@ -629,13 +647,18 @@
  1.186.57.150
  1.186.63.133
  1.189.196.47
+1.193.160.164
  1.196.152.217
  1.198.72.233
-1.2.159.244
+1.199.192.166
+1.199.195.45
+1.2.136.96
+1.2.153.211
  1.2.169.101
  1.2.169.49
  1.2.169.8
  1.2.169.81
+1.2.171.224
  1.2.180.189
  1.2.192.103
  1.2.194.102
@@ -674,18 +697,24 @@
  1.20.103.248
  1.20.137.82
  1.20.156.220
+1.20.156.226
+1.20.166.29
  1.20.169.156
  1.20.169.206
  1.20.175.61
+1.20.178.145
  1.20.181.193
  1.20.181.198
  1.20.202.13
+1.20.202.137
+1.20.203.157
  1.20.203.212
  1.20.207.166
  1.20.207.169
  1.20.207.188
  1.20.207.243
  1.20.207.99
+1.20.217.192
  1.20.217.221
  1.20.217.52
  1.20.217.78
@@ -696,7 +725,9 @@
  1.20.227.66
  1.20.229.67
  1.20.233.188
+1.20.235.199
  1.20.241.42
+1.20.81.101
  1.20.96.156
  1.20.96.158
  1.20.96.164
@@ -710,21 +741,32 @@
  1.20.98.66
  1.20.99.122
  1.20.99.44
+1.202.76.226
+1.202.77.210
+1.204.173.253
+1.204.64.87
+1.204.69.8
  1.209.110.87
  1.209.171.34
  1.209.229.179
  1.212.157.115
  1.212.181.131
+1.214.156.164
  1.214.220.227
  1.214.224.154
+1.214.245.27
  1.214.89.69
  1.215.122.108
  1.215.138.84
  1.215.162.195
  1.217.24.139
+1.22.196.12
+1.22.8.188
  1.220.145.45
+1.220.185.149
  1.220.89.178
  1.220.9.68
+1.220.90.53
  1.221.173.148
  1.221.254.82
  1.222.170.43
@@ -736,18 +778,28 @@
  1.222.43.19
  1.222.44.52
  1.223.248.99
+1.225.40.156
+1.225.81.206
  1.226.84.243
  1.227.57.126
  1.229.165.34
  1.229.224.78
+1.23.183.197
  1.230.213.123
  1.232.247.3
  1.233.163.193
+1.234.13.176
+1.234.23.177
  1.234.4.69
+1.234.51.108
+1.234.58.149
  1.234.58.193
  1.234.58.236
+1.235.192.218
+1.245.241.62
  1.245.4.163
  1.245.47.108
+1.245.61.144
  1.246.222.105
  1.246.222.107
  1.246.222.109
@@ -826,17 +878,24 @@
  1.246.223.94
  1.246.80.41
  1.249.251.115
+1.253.1.4
  1.254.152.220
  1.254.154.42
+1.254.250.52
  1.255.226.37
  1.26.131.93
+1.27.228.230
+1.29.113.180
  1.30.215.144
+1.30.218.89
  1.32.44.16
  1.32.46.20
  1.32.47.53
  1.32.59.217
  1.34.136.15
+1.36.210.62
  1.36.88.200
+1.38.221.28
  1.4.130.100
  1.4.135.231
  1.4.146.232
@@ -860,27 +919,43 @@
  1.4.253.31
  1.42.201.180
  1.4buyuklergazete.com
+1.52.168.135
+1.52.23.122
+1.52.51.7
  1.52.86.154
  1.53.137.12
  1.53.137.164
  1.53.137.220
  1.53.137.84
  1.53.137.92
+1.53.142.102
+1.53.180.47
+1.53.190.106
  1.53.206.149
  1.54.117.174
+1.54.201.35
  1.54.208.131
+1.55.165.141
  1.55.195.71
  1.55.215.30
  1.55.223.95
  1.55.241.4
  1.55.51.64
+1.56.207.130
  1.6.10.90
  1.6.135.164
+1.6.182.218
+1.6.233.253
  1.60.118.55
+1.62.89.184
+1.63.226.147
+1.64.87.148
  1.69.205.173
  1.69.243.225bin.sh
  1.69.248.56
+1.71.128.18
  1.71.142.183
+1.71.143.177
  1.80.148.227
  1.80.150.13
  1.80.150.76
@@ -888,7 +963,12 @@
  1.80.184.12
  1.80.55.134
  1.83.54.182
+1.83.55.155
  1.85.0.98
+1.85.13.236
+1.85.17.20
+1.85.36.252
+1.85.7.164
  1.9.111.145
  1.9.164.242
  1.9.167.35
@@ -910,6 +990,7 @@
  10.4buyuklergazete.com
  100-365.net
  100-diamond.000webhostapp.com
+100.0.220.63
  100.1.149.223
  100.111.231.2.static.cdnserver.in
  100.12.36.75
@@ -943,6 +1024,7 @@
  100.36.140.60
  100.36.76.248
  100.37.254.90
+100.38.148.84
  100.38.234.159
  100.40.179.150
  100.42.229.74
@@ -1014,6 +1096,7 @@
  101.0.54.90
  101.0.81.153
  101.100.146.147
+101.100.177.165
  101.101.209.80
  101.101.217.165
  101.108.107.36
@@ -1023,7 +1106,7 @@
  101.108.123.252
  101.108.124.243
  101.108.124.70
-101.108.132.73
+101.108.130.145
  101.108.135.13
  101.108.135.73
  101.108.145.106
@@ -1066,6 +1149,7 @@
  101.108.32.208
  101.108.53.194
  101.108.61.106
+101.108.61.119
  101.108.71.147
  101.108.93.12
  101.108.93.164
@@ -1089,9 +1173,11 @@
  101.109.177.14
  101.109.177.238
  101.109.180.72
+101.109.181.139
  101.109.184.193
  101.109.20.112
  101.109.210.48
+101.109.239.113
  101.109.24.213
  101.109.245.200
  101.109.247.173
@@ -1117,6 +1203,8 @@
  101.109.70.33
  101.109.83.194
  101.112.160.71
+101.127.232.199
+101.128.117.43
  101.132.149.193
  101.132.182.76
  101.132.33.79
@@ -1125,17 +1213,23 @@
  101.132.43.162
  101.132.72.117
  101.133.226.119
-101.16.98.170
+101.133.235.75
  101.165.169.151
+101.166.192.44
+101.166.85.252
  101.173.40.161
  101.177.1.164
  101.178.223.39
+101.187.123.101
+101.190.180.72
  101.198.186.254
  101.20.110.104
  101.20.136.171
  101.20.171.255
  101.20.171.61
+101.20.244.126
  101.20.35.78
+101.200.124.44
  101.200.160.24
  101.200.177.198
  101.200.40.4
@@ -1143,6 +1237,12 @@
  101.200.57.240
  101.201.62.45
  101.203.174.175
+101.206.162.156
+101.206.162.178
+101.206.162.249
+101.226.21.105
+101.226.253.162
+101.227.5.66
  101.227.67.35
  101.227.82.60
  101.227.82.75
@@ -1151,17 +1251,31 @@
  101.228.34.153
  101.229.100.143
  101.229.100.236
+101.229.147.118
+101.230.248.162
+101.230.248.163
+101.230.248.164
+101.230.248.165
+101.230.248.166
  101.231.104.82
+101.231.124.6
+101.231.146.34
  101.231.146.36
+101.231.96.174
+101.236.60.31
  101.25.112.240
  101.25.117.141
  101.25.29.40
  101.25.99.61
+101.251.197.238
  101.251.198.115
+101.251.207.228
+101.251.219.100
  101.251.219.115
  101.251.219.243
  101.254.136.130
  101.254.159.218
+101.254.233.194
  101.255.115.122
  101.255.116.61
  101.255.117.2
@@ -1173,6 +1287,7 @@
  101.255.125.59
  101.255.140.101
  101.255.149.2
+101.255.171.218
  101.255.40.18
  101.255.52.210
  101.255.55.10
@@ -1180,51 +1295,81 @@
  101.255.62.202
  101.255.63.10
  101.255.63.22
+101.255.65.138
  101.255.66.147
  101.255.75.46
  101.255.79.18
  101.255.79.249
+101.255.81.91
  101.255.9.10
  101.255.94.130
  101.26.71.19
  101.26.88.95
-101.26.89.226
+101.26.94.145
  101.28.48.219
  101.30.106.196
+101.30.61.34
+101.32.10.15
  101.32.11.194
  101.32.11.54
  101.32.114.84
  101.32.116.55
+101.32.12.110
  101.32.12.174
  101.32.14.126
  101.32.14.194
  101.32.168.188
  101.32.176.44
+101.32.178.208
  101.32.178.38
  101.32.178.46
  101.32.181.140
  101.32.181.199
+101.32.181.50
  101.32.182.55
  101.32.182.62
  101.32.183.189
  101.32.187.120
  101.32.187.45
+101.32.188.89
  101.32.189.31
+101.32.192.175
  101.32.192.63
+101.32.194.166
+101.32.202.154
  101.32.204.175
  101.32.204.213
  101.32.204.78
-101.32.206.75
+101.32.206.161
+101.32.206.243
  101.32.207.241
  101.32.208.125
+101.32.208.137
  101.32.21.206
  101.32.211.212
+101.32.213.171
+101.32.218.82
  101.32.22.56
  101.32.242.16
  101.32.243.161
+101.32.26.159
  101.32.33.145
+101.32.34.76
+101.32.36.242
+101.32.42.252
+101.32.45.10
+101.32.45.219
+101.32.46.20
+101.32.48.90
+101.32.5.102
+101.32.68.55
  101.32.7.111
+101.32.72.24
  101.32.74.75
+101.32.75.168
+101.32.94.47
+101.33.116.189
+101.33.117.207
  101.33.117.60
  101.33.118.203
  101.33.118.32
@@ -1236,21 +1381,40 @@
  101.33.124.123
  101.33.124.208
  101.33.124.250
+101.33.124.69
  101.33.125.127
  101.33.125.136
  101.33.127.133
+101.33.127.224
+101.33.127.66
  101.36.105.167
  101.36.109.214
+101.36.110.127
+101.36.112.191
  101.36.113.66
+101.36.117.109
+101.36.118.33
+101.36.118.82
+101.36.122.11
+101.36.124.151
+101.36.125.50
+101.36.126.24
  101.36.126.34
+101.36.127.47
  101.36.127.61
  101.36.151.139
  101.36.151.78
+101.36.178.20
  101.36.178.48
+101.36.179.145
+101.36.181.142
  101.37.118.54
  101.37.33.19
+101.4.130.234
  101.4.136.34
+101.4.62.36
  101.50.1.2
+101.50.99.51
  101.51.105.202
  101.51.105.249
  101.51.106.70
@@ -1268,6 +1432,8 @@
  101.51.141.81
  101.51.144.75
  101.51.157.194
+101.51.158.32
+101.51.159.253
  101.51.16.87
  101.51.160.4
  101.51.171.97
@@ -1275,11 +1441,15 @@
  101.51.218.209
  101.51.219.156
  101.51.22.117
+101.51.23.65
  101.51.235.127
+101.51.24.134
  101.51.241.89
  101.51.242.130
  101.51.33.228
+101.51.41.81
  101.51.43.143
+101.51.48.241
  101.51.52.231
  101.51.59.242
  101.51.65.242
@@ -1289,12 +1459,15 @@
  101.51.70.41
  101.51.71.3
  101.51.86.28
+101.6.64.76
  101.64.116.52
  101.64.117.49
+101.64.136.9
  101.64.137.222
  101.64.156.58
  101.64.157.103
  101.64.157.146
+101.64.157.239
  101.65.128.150
  101.65.129.116
  101.65.160.13
@@ -1304,26 +1477,37 @@
  101.67.243.158
  101.69.119.31
  101.69.200.162
+101.69.240.94
  101.69.247.6
  101.70.15.84
  101.70.52.105
+101.71.28.72
  101.71.3.53
  101.71.51.192
  101.72.33.145
  101.73.145.214
  101.73.20.114
  101.78.15.54
+101.78.3.29
+101.78.9.237
+101.79.167.114
  101.79.5.58
  101.83.38.142
  101.87.98.162
  101.89.110.1
  101.89.116.39
+101.89.143.15
+101.89.161.81
  101.89.188.88
+101.89.63.136
  101.91.178.122
  101.91.199.49
+101.91.238.43
+101.93.107.120
  101.95.86.34
  101.98.149.170
  101.98.167.205
+101.99.14.49
  101.99.14.54
  101.99.20.59
  101.99.36.37
@@ -1349,11 +1533,19 @@
  101gowrie.com
  101jo.com
  101login-screens.weebly.com
-102.128.131.4
+102.105.96.206
+102.114.227.89
+102.114.25.84
+102.114.46.70
+102.114.9.57
+102.118.114.6
+102.118.205.2
+102.129.175.128
  102.129.175.155
  102.129.199.111
  102.129.199.83
  102.129.249.232
+102.129.36.189
  102.129.79.10
  102.130.112.193
  102.130.119.99
@@ -1362,6 +1554,7 @@
  102.132.245.16
  102.133.167.0
  102.134.136.1
+102.134.175.96
  102.134.176.103
  102.134.176.114
  102.134.176.12
@@ -1371,10 +1564,22 @@
  102.134.176.96
  102.134.180.75
  102.137.241.7
+102.141.121.13
+102.141.121.14
  102.141.197.17
+102.141.48.145
+102.152.144.154
+102.152.39.150
+102.152.39.34
+102.152.53.144
  102.164.108.43
+102.164.202.199
  102.164.210.125
  102.164.248.235
+102.165.30.29
+102.165.30.33
+102.165.30.41
+102.165.30.49
  102.165.52.62
  102.165.54.170
  102.165.54.171
@@ -1403,18 +1608,29 @@
  102.177.147.1
  102.177.160.1
  102.182.204.96
+102.186.30.230
+102.222.181.80
+102.223.73.187
  102.23.221.1
  102.23.242.15
  102.244.120.10
  102.33.21.34
  102.33.21.36
+102.36.164.141
+102.37.10.45
+102.37.43.139
+102.38.101.47
  102.38.49.250
  102.38.50.227
  102.38.50.228
  102.38.50.62
  102.38.50.65
+102.39.181.60
  102.45.138.94
+102.45.220.174
  102.51.5.106
+102.53.11.65
+102.53.4.42
  102.53.4.85
  102.64.122.244
  102.64.122.40
@@ -1426,7 +1642,10 @@
  102.65.20.91
  102.65.89.16
  102.67.19.132
+102.67.23.131
  102.67.68.1
+102.67.69.211
+102.67.69.217
  102.67.73.1
  102.67.74.1
  102.68.134.14
@@ -1443,17 +1662,22 @@
  103.1.237.174
  103.1.93.184
  103.1.93.59
+103.1.94.139
  103.1.94.78
  103.10.133.169
  103.10.133.81
  103.10.157.9
  103.10.168.240
+103.10.169.212
  103.10.210.17
  103.10.228.221
  103.10.23.161
+103.10.3.104
  103.10.56.190
  103.10.59.73
  103.10.81.172
+103.10.87.54
+103.100.137.40
  103.100.159.25
  103.100.188.51
  103.100.209.118
@@ -1464,6 +1688,7 @@
  103.100.211.77
  103.100.83.253
  103.101.161.33
+103.101.162.209
  103.101.174.145
  103.101.233.13
  103.101.52.48
@@ -1472,7 +1697,12 @@
  103.102.141.61
  103.102.142.184
  103.102.145.34
+103.102.205.38
+103.102.239.236
  103.102.87.90
+103.102.90.30
+103.103.128.88
+103.103.42.253
  103.103.52.40
  103.103.71.8
  103.104.124.33
@@ -1481,11 +1711,13 @@
  103.104.213.118
  103.104.215.234
  103.104.227.154
-103.104.59.143
+103.104.231.11
+103.104.248.248
  103.104.61.102
  103.105.130.136
  103.105.142.132
  103.105.195.230
+103.105.196.32
  103.105.208.66
  103.105.209.26
  103.105.212.106
@@ -1503,11 +1735,13 @@
  103.105.40.145
  103.105.40.161
  103.105.40.70
+103.105.67.146
  103.105.70.9
  103.106.112.11
  103.106.148.209
  103.106.158.252
  103.106.192.245
+103.106.20.212
  103.106.219.131
  103.106.219.209
  103.106.219.222
@@ -1547,6 +1781,7 @@
  103.106.65.243
  103.107.160.169
  103.107.161.54
+103.107.17.205
  103.107.68.1
  103.107.68.109
  103.107.68.129
@@ -1616,6 +1851,7 @@
  103.108.58.212
  103.108.75.153
  103.108.87.133
+103.108.87.161
  103.108.98.1
  103.109.0.20
  103.109.0.242
@@ -1623,11 +1859,13 @@
  103.109.101.216
  103.109.15.141
  103.109.15.196
+103.109.152.210
  103.109.160.58
  103.109.180.20
  103.109.182.193
  103.109.194.210
  103.109.209.15
+103.109.217.250
  103.109.3.1
  103.109.3.134
  103.109.3.141
@@ -1678,10 +1916,13 @@
  103.110.126.111
  103.110.160.198
  103.110.22.186
+103.110.48.255
  103.110.49.223
  103.110.59.3
+103.110.84.196
  103.110.88.218
  103.110.89.148
+103.111.110.154
  103.111.137.18
  103.111.137.65
  103.111.137.66
@@ -1695,6 +1936,7 @@
  103.111.22.65
  103.111.28.166
  103.111.29.130
+103.111.30.40
  103.111.31.230
  103.111.53.82
  103.111.82.154
@@ -1707,6 +1949,7 @@
  103.112.212.30
  103.112.241.16
  103.112.244.249
+103.112.252.6
  103.112.29.124
  103.112.60.33
  103.112.60.5
@@ -1727,6 +1970,7 @@
  103.112.86.174
  103.113.104.176
  103.113.104.225
+103.113.104.43
  103.113.106.178
  103.113.106.226
  103.113.106.227
@@ -1745,9 +1989,16 @@
  103.113.3.226
  103.113.3.242
  103.113.3.74
+103.113.67.32
  103.114.0.3
  103.114.104.35
+103.114.105.83
  103.114.106.11
+103.114.107.149
+103.114.107.249
+103.114.161.195
+103.114.161.196
+103.114.192.57
  103.114.61.150
  103.114.97.1
  103.114.97.74
@@ -1768,6 +2019,7 @@
  103.115.119.254
  103.115.14.1
  103.115.164.99
+103.115.202.38
  103.115.252.129
  103.115.252.26
  103.115.252.30
@@ -1784,9 +2036,10 @@
  103.115.255.86
  103.115.255.90
  103.115.255.93
-103.115.42.209
+103.116.201.98
  103.116.203.244
  103.116.47.92
+103.116.57.64
  103.116.78.103
  103.117.103.213
  103.117.108.106
@@ -1795,17 +2048,22 @@
  103.117.108.30
  103.117.146.210
  103.117.146.98
+103.117.152.41
  103.117.152.75
+103.117.153.220
+103.117.180.48
  103.117.203.245
  103.117.229.173
  103.117.229.26
  103.117.233.59
  103.118.169.85
  103.118.76.54
+103.119.101.129
  103.119.116.26
  103.119.144.206
  103.119.229.130
  103.119.244.10
+103.119.92.107
  103.12.114.38
  103.12.114.50
  103.12.114.58
@@ -1845,13 +2103,16 @@
  103.12.246.81
  103.12.246.97
  103.12.31.75
+103.120.135.218
  103.120.168.3
+103.120.179.28
+103.120.185.90
+103.120.189.34
  103.120.223.27
  103.121.215.208
  103.121.215.211
  103.121.224.11
  103.121.42.229
-103.121.57.106
  103.122.104.134
  103.122.105.242
  103.122.177.12
@@ -1865,65 +2126,99 @@
  103.123.170.189
  103.123.170.190
  103.123.170.67
+103.123.224.198
  103.123.229.106
  103.123.235.158
+103.123.235.40
  103.123.246.66
+103.123.25.80
  103.123.65.186
  103.124.104.118
  103.124.136.77
  103.124.137.173
  103.124.147.22
+103.124.173.33
  103.124.175.139
+103.124.205.142
+103.124.94.169
  103.124.95.136
  103.124.95.223
  103.125.106.2
  103.125.117.202
  103.125.128.45
+103.125.151.4
+103.125.151.5
  103.125.170.22
+103.125.176.2
  103.125.189.202
  103.125.189.52
+103.125.189.59
+103.125.191.106
  103.125.191.123
  103.125.191.136
+103.125.191.233
+103.125.191.4
+103.125.191.69
  103.125.191.78
  103.125.218.107
+103.125.39.54
  103.125.43.12
  103.125.43.53
+103.125.56.74
  103.126.100.13
  103.126.100.18
  103.126.100.31
  103.126.218.69
  103.126.218.70
+103.126.49.30
+103.127.108.96
  103.127.124.117
+103.127.157.210
  103.127.185.133
  103.127.206.109
  103.127.41.103
  103.127.57.162
  103.129.115.2
  103.129.13.45
+103.129.192.196
  103.129.194.1
  103.129.195.48
  103.129.197.185
  103.129.221.55
+103.129.223.101
  103.129.223.126
  103.129.223.136
+103.129.223.98
  103.13.132.206
+103.13.185.34
  103.13.229.170
  103.13.240.38
+103.13.88.90
+103.130.112.133
  103.130.173.110
  103.130.184.211
+103.130.184.234
  103.130.196.154
  103.130.209.251
+103.130.214.25
+103.130.214.48
  103.130.214.77
  103.130.215.118
+103.130.215.181
+103.130.215.57
  103.130.219.74
  103.131.104.52
  103.131.104.63
  103.131.52.4
  103.131.80.2
+103.132.244.191
+103.133.105.194
+103.133.109.40
  103.133.110.62
  103.133.223.122
  103.133.56.68
  103.133.82.125
+103.134.177.163
  103.134.200.26
  103.134.202.225
  103.134.202.26
@@ -1938,7 +2233,9 @@
  103.135.174.229
  103.135.207.3
  103.136.40.50
+103.136.40.88
  103.136.82.50
+103.137.113.85
  103.137.124.10
  103.137.124.12
  103.137.124.15
@@ -1973,6 +2270,7 @@
  103.138.5.221
  103.138.69.197
  103.138.8.155
+103.138.90.180
  103.139.120.231
  103.139.163.210
  103.139.163.219
@@ -1996,9 +2294,12 @@
  103.14.38.186
  103.14.38.188
  103.14.45.98
+103.140.104.212
+103.140.131.26
  103.140.189.167
  103.140.235.90
  103.140.238.246
+103.140.66.5
  103.140.82.1
  103.140.83.101
  103.140.83.109
@@ -2017,13 +2318,16 @@
  103.140.83.94
  103.141.108.142
  103.141.108.185
+103.141.138.114
  103.141.138.119
  103.141.138.133
+103.141.138.134
  103.141.138.247
  103.141.138.252
  103.141.142.47
  103.141.177.91
  103.141.52.234
+103.141.97.57
  103.142.111.146
  103.142.164.37
  103.142.164.38
@@ -2043,6 +2347,7 @@
  103.142.210.45
  103.142.210.46
  103.142.68.2
+103.143.193.226
  103.143.20.82
  103.143.20.84
  103.143.20.86
@@ -2077,27 +2382,32 @@
  103.143.77.75
  103.143.77.89
  103.143.84.72
+103.144.102.12
  103.144.146.226
  103.144.146.52
  103.144.146.67
  103.144.147.226
  103.144.180.2
  103.144.213.13
+103.144.82.250
  103.145.12.11
  103.145.12.91
-103.145.13.43
-103.145.13.58
-103.145.144.120
  103.145.190.138
  103.145.252.23
+103.145.254.221
+103.145.255.142
  103.145.67.246
  103.145.8.146
+103.146.100.130
+103.146.100.29
  103.146.110.22
  103.146.176.124
  103.146.182.94
  103.146.184.228
  103.146.31.52
  103.147.10.222
+103.147.222.243
+103.147.3.153
  103.147.4.82
  103.147.5.67
  103.148.195.11
@@ -2117,6 +2427,11 @@
  103.148.79.114
  103.148.79.120
  103.149.12.183
+103.149.158.0
+103.149.158.9
+103.149.196.158
+103.149.203.21
+103.149.248.57
  103.15.140.140
  103.15.226.14
  103.15.242.210
@@ -2129,31 +2444,63 @@
  103.15.251.76
  103.15.40.202
  103.15.83.83
+103.150.112.234
  103.150.215.101
  103.150.215.115
+103.150.218.30
  103.150.238.215
  103.150.238.216
  103.150.238.221
  103.150.239.25
+103.150.68.124
+103.151.122.165
+103.151.123.208
+103.151.124.247
+103.151.124.97
  103.151.130.253
  103.151.176.21
  103.151.182.6
+103.151.188.159
  103.151.43.104
  103.152.199.178
  103.152.221.178
+103.152.242.19
  103.152.242.51
+103.152.43.165
  103.152.5.2
  103.152.5.70
  103.152.79.138
+103.153.182.59
+103.153.183.215
+103.153.183.57
+103.153.183.86
  103.153.92.137
+103.154.9.66
+103.154.9.68
  103.155.162.236
  103.155.166.250
+103.155.72.137
+103.155.72.86
  103.155.92.28
  103.155.92.72
  103.155.93.241
+103.156.145.139
+103.156.145.145
+103.156.145.155
+103.156.145.157
+103.156.145.192
+103.156.145.205
+103.156.145.215
+103.156.145.229
+103.156.224.14
  103.156.90.37
+103.156.92.189
  103.157.186.163
  103.157.220.197
+103.157.225.48
+103.157.25.3
+103.157.25.4
+103.157.25.5
  103.158.220.10
  103.16.115.18
  103.16.128.63
@@ -2175,10 +2522,14 @@
  103.160.121.251
  103.17.117.40
  103.17.117.43
+103.17.236.83
  103.17.49.2
+103.17.96.208
+103.18.10.18
  103.18.179.196
  103.18.179.212
  103.18.77.46
+103.19.141.144
  103.19.229.150
  103.19.252.130
  103.19.252.210
@@ -2207,6 +2558,7 @@
  103.194.242.158
  103.194.242.254
  103.194.242.78
+103.194.243.212
  103.194.248.166
  103.194.251.42
  103.194.88.37
@@ -2218,6 +2570,7 @@
  103.195.90.7
  103.196.233.199
  103.196.53.209
+103.197.132.66
  103.197.134.18
  103.197.134.22
  103.197.168.2
@@ -2228,6 +2581,7 @@
  103.197.170.61
  103.197.171.13
  103.197.171.14
+103.197.32.50
  103.197.48.178
  103.197.48.98
  103.197.75.1
@@ -2235,6 +2589,7 @@
  103.198.192.14
  103.198.34.164
  103.199.110.42
+103.199.126.41
  103.199.155.198
  103.199.155.26
  103.199.156.121
@@ -2287,16 +2642,21 @@
  103.199.97.33
  103.199.97.5
  103.199.97.9
+103.2.134.222
+103.2.135.10
+103.2.181.70
  103.20.166.167
  103.20.188.94
  103.20.189.126
  103.20.191.242
  103.20.33.185
  103.200.116.12
+103.200.133.49
  103.200.135.226
  103.200.135.228
  103.200.135.229
  103.200.135.230
+103.200.30.12
  103.200.37.31
  103.200.40.194
  103.200.95.82
@@ -2308,6 +2668,7 @@
  103.204.109.178
  103.204.111.137
  103.204.166.206
+103.204.52.66
  103.204.54.50
  103.204.70.11
  103.205.128.129
@@ -2375,7 +2736,10 @@
  103.205.177.229
  103.205.182.142
  103.205.243.67
+103.205.5.158
+103.205.68.2
  103.205.7.83
+103.205.7.84
  103.206.105.193
  103.206.128.137
  103.206.130.201
@@ -2389,17 +2753,27 @@
  103.206.254.170
  103.206.254.242
  103.207.0.193
+103.207.11.10
+103.207.11.6
+103.207.156.207
+103.207.170.134
  103.207.37.133
  103.207.37.184
  103.207.37.189
+103.207.37.233
  103.207.38.202
  103.207.38.215
+103.207.38.31
  103.207.39.131
+103.207.42.75
+103.207.7.57
  103.207.96.21
  103.207.96.225
  103.207.96.226
  103.207.97.33
  103.208.120.125
+103.208.137.57
+103.208.152.184
  103.208.152.34
  103.208.200.114
  103.208.200.222
@@ -2407,6 +2781,8 @@
  103.208.220.135
  103.208.220.139
  103.208.220.142
+103.208.68.221
+103.208.74.18
  103.209.178.208
  103.209.187.154
  103.209.194.101
@@ -2432,11 +2808,14 @@
  103.210.236.19
  103.210.236.229
  103.210.236.47
+103.210.236.73
  103.210.237.13
  103.210.237.40
+103.210.239.35
  103.210.29.113
  103.210.29.193
  103.210.31.49
+103.210.72.72
  103.210.86.185
  103.211.11.1
  103.211.11.13
@@ -2447,6 +2826,7 @@
  103.211.11.69
  103.211.11.81
  103.211.11.9
+103.211.167.11
  103.211.190.194
  103.211.218.202
  103.211.219.205
@@ -2493,6 +2873,8 @@
  103.211.8.89
  103.211.8.93
  103.211.8.97
+103.212.120.87
+103.212.121.95
  103.212.128.152
  103.212.128.228
  103.212.128.253
@@ -2542,6 +2924,8 @@
  103.214.55.34
  103.214.55.6
  103.214.6.199
+103.214.60.43
+103.214.61.175
  103.214.61.41
  103.214.65.230
  103.215.136.88
@@ -2552,6 +2936,7 @@
  103.215.177.153
  103.215.177.211
  103.215.177.231
+103.215.223.99
  103.215.236.2
  103.215.80.182
  103.215.81.107
@@ -2563,6 +2948,7 @@
  103.216.218.207
  103.216.239.202
  103.216.48.83
+103.216.69.207
  103.216.82.146
  103.216.82.153
  103.216.82.18
@@ -2593,6 +2979,7 @@
  103.217.121.74
  103.217.121.79
  103.217.121.87
+103.217.121.97
  103.217.123.0
  103.217.123.113
  103.217.123.114
@@ -2601,15 +2988,24 @@
  103.217.123.220
  103.217.123.231
  103.217.123.84
+103.217.133.76
+103.217.152.207
  103.217.173.210
  103.217.213.129
  103.217.213.145
+103.217.242.40
  103.218.2.188
  103.218.240.75
  103.218.26.169
+103.219.112.48
+103.219.112.63
+103.219.147.2
  103.219.187.55
  103.219.187.56
+103.219.207.118
  103.219.212.87
+103.219.40.245
+103.219.60.167
  103.22.144.67
  103.22.248.59
  103.22.251.45
@@ -2641,6 +3037,7 @@
  103.221.235.168
  103.221.235.235
  103.221.252.38
+103.221.252.46
  103.221.253.145
  103.221.253.242
  103.221.254.102
@@ -2655,6 +3052,7 @@
  103.223.12.139
  103.223.12.156
  103.223.12.183
+103.223.12.245
  103.224.118.79
  103.224.185.16
  103.224.185.208
@@ -2662,6 +3060,7 @@
  103.224.185.48
  103.224.195.41
  103.224.203.40
+103.224.241.45
  103.224.245.4
  103.224.250.94
  103.224.48.38
@@ -2674,9 +3073,12 @@
  103.224.83.36
  103.224.83.71
  103.224.83.91
+103.225.103.5
+103.225.139.230
  103.225.206.22
  103.225.212.13
  103.225.212.14
+103.225.22.118
  103.225.228.1
  103.225.228.101
  103.225.228.105
@@ -2712,8 +3114,11 @@
  103.226.232.4
  103.226.248.225
  103.226.249.187
+103.226.250.169
+103.226.250.79
  103.226.49.138
  103.226.51.80
+103.226.93.26
  103.227.145.6
  103.227.147.142
  103.227.176.23
@@ -2727,6 +3132,7 @@
  103.228.119.125
  103.228.119.129
  103.228.119.137
+103.228.142.237
  103.228.152.25
  103.228.53.155
  103.228.71.39
@@ -2762,11 +3168,16 @@
  103.23.119.57
  103.23.119.60
  103.23.119.61
+103.23.124.66
+103.23.124.94
+103.23.127.218
  103.23.154.184
  103.23.21.127
  103.23.236.94
  103.23.41.110
+103.230.123.43
  103.230.155.154
+103.230.221.132
  103.231.101.57
  103.231.162.68
  103.231.191.7
@@ -2774,11 +3185,13 @@
  103.231.228.244
  103.231.253.20
  103.231.40.144
+103.231.44.187
  103.231.88.10
  103.232.104.227
  103.232.107.132
  103.232.120.109
  103.232.121.152
+103.232.25.71
  103.232.33.147
  103.232.33.52
  103.232.64.226
@@ -2787,6 +3200,7 @@
  103.232.65.78
  103.232.67.180
  103.233.0.121
+103.233.0.18
  103.233.103.233
  103.233.103.237
  103.233.103.241
@@ -2801,6 +3215,8 @@
  103.233.154.18
  103.233.154.19
  103.233.2.162
+103.233.3.137
+103.233.5.24
  103.233.8.6
  103.233.80.154
  103.233.80.25
@@ -2811,12 +3227,14 @@
  103.234.220.195
  103.234.254.10
  103.234.254.164
+103.234.94.45
  103.235.164.110
  103.235.165.8
  103.235.170.162
  103.235.198.60
  103.235.199.46
  103.235.199.9
+103.235.227.60
  103.235.230.196
  103.236.114.38
  103.236.160.129
@@ -2839,13 +3257,17 @@
  103.236.201.88
  103.236.253.28
  103.237.144.150
+103.237.145.182
  103.237.56.16
  103.238.14.242
  103.238.224.138
  103.238.225.129
  103.238.226.160
  103.238.227.56
+103.238.228.117
  103.238.231.60
+103.238.69.144
+103.238.69.169
  103.238.69.194
  103.238.69.228
  103.239.147.129
@@ -2857,14 +3279,18 @@
  103.239.255.170
  103.239.55.73
  103.24.110.89
+103.24.135.243
  103.24.230.86
  103.240.100.106
  103.240.100.214
+103.240.102.33
+103.240.140.146
  103.240.160.21
  103.240.161.101
  103.240.161.108
  103.240.161.109
  103.240.168.138
+103.240.170.191
  103.240.206.196
  103.240.250.169
  103.240.33.113
@@ -2885,6 +3311,7 @@
  103.240.34.218
  103.240.64.130
  103.240.77.98
+103.240.79.150
  103.240.79.160
  103.241.141.234
  103.241.178.10
@@ -2900,10 +3327,12 @@
  103.241.227.118
  103.241.227.98
  103.241.227.99
+103.241.232.66
  103.241.5.113
  103.241.5.174
  103.242.107.226
  103.242.107.241
+103.242.107.82
  103.242.118.205
  103.242.119.217
  103.242.125.243
@@ -2911,14 +3340,20 @@
  103.242.14.68
  103.242.14.8
  103.242.166.5
+103.242.168.14
+103.242.196.31
+103.242.3.134
  103.242.45.68
+103.242.47.229
  103.242.56.122
  103.242.66.56
  103.242.72.7
  103.243.115.230
  103.243.131.231
+103.243.143.152
  103.243.173.210
  103.243.173.214
+103.243.184.54
  103.243.24.191
  103.243.24.212
  103.243.24.42
@@ -2934,7 +3369,12 @@
  103.243.82.198
  103.243.82.234
  103.244.108.160
+103.244.111.196
+103.244.177.250
  103.244.205.146
+103.244.205.94
+103.244.206.74
+103.244.4.66
  103.245.153.70
  103.245.19.30
  103.245.205.162
@@ -2948,6 +3388,9 @@
  103.246.1.218
  103.246.1.220
  103.246.1.222
+103.246.106.118
+103.246.240.26
+103.246.240.30
  103.246.245.253
  103.247.13.129
  103.247.13.45
@@ -2967,6 +3410,7 @@
  103.248.219.172
  103.248.248.146
  103.248.31.50
+103.248.33.51
  103.248.85.244
  103.249.100.244
  103.249.155.137
@@ -2981,17 +3425,24 @@
  103.249.180.166
  103.249.180.198
  103.249.181.76
+103.249.240.41
  103.249.28.142
  103.249.28.195
  103.249.28.87
  103.249.31.189
+103.249.77.2
+103.249.83.66
+103.249.83.84
  103.25.0.202
  103.25.120.138
  103.25.121.153
  103.25.122.41
  103.25.130.114
+103.25.21.34
+103.25.250.235
  103.25.3.82
  103.25.45.38
+103.25.84.233
  103.250.148.82
  103.250.152.30
  103.250.153.203
@@ -3009,6 +3460,7 @@
  103.250.69.94
  103.250.71.33
  103.251.176.22
+103.251.176.243
  103.251.189.129
  103.251.190.6
  103.251.214.167
@@ -3040,6 +3492,7 @@
  103.251.225.10
  103.251.225.16
  103.251.57.23
+103.251.82.191
  103.251.83.14
  103.252.117.100
  103.252.12.223
@@ -3048,14 +3501,18 @@
  103.252.168.75
  103.252.17.146
  103.252.35.170
+103.252.5.228
  103.252.6.77
+103.253.105.34
  103.253.113.54
+103.253.115.183
  103.253.14.43
  103.253.145.133
  103.253.146.56
  103.253.146.90
  103.253.154.155
  103.253.154.52
+103.253.200.161
  103.253.208.96
  103.253.27.108
  103.253.41.63
@@ -3071,10 +3528,14 @@
  103.254.94.91
  103.255.146.202
  103.255.15.24
+103.255.191.76
  103.255.237.203
  103.255.237.7
  103.255.53.98
+103.255.6.117
+103.255.6.89
  103.26.111.229
+103.26.136.173
  103.26.213.117
  103.26.215.69
  103.26.246.122
@@ -3083,8 +3544,13 @@
  103.27.109.164
  103.27.109.166
  103.27.202.58
+103.27.236.10
  103.27.239.185
  103.27.239.216
+103.27.32.42
+103.27.34.48
+103.27.4.161
+103.27.60.222
  103.27.61.222
  103.27.79.136
  103.27.79.185
@@ -3108,11 +3574,16 @@
  103.28.84.81
  103.28.86.241
  103.29.117.129
+103.29.151.146
  103.29.156.142
+103.29.184.251
  103.29.69.57
  103.29.70.69
  103.29.90.134
+103.3.220.125
+103.3.222.131
  103.3.46.213
+103.3.46.92
  103.30.0.249
  103.30.0.5
  103.30.151.17
@@ -3127,11 +3598,13 @@
  103.31.109.218
  103.31.109.247
  103.31.109.59
+103.31.109.6
  103.31.109.66
  103.31.157.205
  103.31.157.206
  103.31.157.210
  103.31.20.109
+103.31.225.200
  103.31.227.183
  103.31.227.24
  103.31.232.93
@@ -3166,6 +3639,7 @@
  103.36.11.243
  103.36.11.248
  103.36.124.158
+103.36.124.165
  103.36.125.162
  103.36.126.14
  103.36.35.135
@@ -3198,13 +3672,20 @@
  103.38.67.13
  103.38.83.14
  103.39.131.88
+103.39.213.170
+103.39.220.205
+103.39.235.166
  103.39.236.213
  103.39.29.101
  103.4.146.220
  103.4.147.82
  103.4.164.205
+103.4.196.67
+103.4.217.138
  103.4.217.139
+103.4.233.93
  103.4.94.178
+103.40.116.68
  103.40.160.194
  103.40.162.37
  103.40.172.173
@@ -3214,7 +3695,12 @@
  103.40.197.163
  103.40.22.97
  103.40.240.244
+103.40.241.21
+103.40.242.32
+103.40.244.146
  103.40.248.117
+103.40.248.203
+103.40.249.242
  103.40.8.183
  103.40.8.188
  103.40.8.192
@@ -3225,6 +3711,7 @@
  103.40.8.73
  103.40.8.87
  103.40.8.93
+103.41.110.115
  103.41.147.137
  103.41.177.33
  103.41.177.35
@@ -3232,6 +3719,7 @@
  103.41.25.33
  103.41.25.35
  103.41.28.70
+103.41.28.98
  103.41.29.134
  103.41.66.179
  103.41.66.250
@@ -3245,6 +3733,7 @@
  103.42.254.102
  103.42.254.108
  103.42.254.194
+103.42.87.36
  103.43.129.227
  103.43.151.46
  103.43.16.146
@@ -3252,6 +3741,7 @@
  103.43.185.142
  103.43.185.166
  103.43.202.18
+103.43.249.151
  103.43.42.85
  103.43.65.242
  103.43.93.26
@@ -3262,9 +3752,14 @@
  103.44.15.193
  103.44.18.233
  103.44.18.248
+103.44.218.83
+103.44.218.93
  103.44.23.104
+103.44.240.204
  103.44.246.33
+103.44.248.252
  103.44.253.18
+103.44.254.183
  103.44.28.78
  103.44.50.114
  103.44.50.121
@@ -3272,20 +3767,37 @@
  103.45.100.189
  103.45.101.112
  103.45.101.50
+103.45.102.170
  103.45.103.207
  103.45.103.80
+103.45.105.120
+103.45.108.130
  103.45.111.35
  103.45.112.197
+103.45.116.183
+103.45.118.124
  103.45.118.92
  103.45.128.242
  103.45.174.196
  103.45.177.136
+103.45.177.26
+103.45.177.42
  103.45.177.73
+103.45.179.71
+103.45.183.123
+103.45.183.223
+103.45.184.120
  103.45.185.14
+103.45.190.6
+103.45.251.8
+103.45.65.36
+103.45.65.42
+103.45.65.76
  103.46.128.41
  103.46.128.43
  103.46.210.134
  103.46.234.129
+103.46.239.133
  103.47.104.227
  103.47.104.230
  103.47.104.236
@@ -3293,12 +3805,15 @@
  103.47.104.248
  103.47.104.249
  103.47.104.250
+103.47.14.246
+103.47.184.2
  103.47.216.201
  103.47.217.129
  103.47.217.214
  103.47.217.225
  103.47.218.76
  103.47.66.154
+103.47.82.188
  103.47.92.33
  103.47.93.113
  103.47.93.193
@@ -3323,12 +3838,17 @@
  103.48.192.48
  103.48.193.7
  103.48.25.195
+103.48.82.78
+103.49.243.242
  103.49.28.58
  103.49.28.64
  103.49.53.129
+103.5.125.21
  103.50.148.129
+103.50.148.5
  103.50.150.225
  103.50.162.156
+103.50.163.234
  103.50.168.193
  103.50.170.117
  103.50.170.121
@@ -3341,6 +3861,7 @@
  103.50.170.49
  103.50.170.65
  103.50.170.81
+103.51.103.3
  103.51.12.206
  103.51.12.32
  103.51.145.196
@@ -3361,7 +3882,14 @@
  103.51.46.255
  103.51.46.4
  103.51.47.9
+103.52.135.200
+103.52.135.201
+103.52.135.202
+103.52.135.203
+103.52.135.206
+103.52.135.207
  103.52.135.220
+103.52.135.8
  103.52.171.165
  103.52.209.41
  103.52.209.81
@@ -3400,10 +3928,13 @@
  103.54.30.57
  103.54.36.59
  103.54.95.70
+103.55.100.37
  103.55.144.243
  103.55.144.70
  103.55.24.37
+103.55.36.28
  103.56.113.172
+103.56.113.232
  103.56.115.142
  103.56.115.156
  103.56.115.76
@@ -3413,6 +3944,8 @@
  103.56.235.186
  103.57.120.249
  103.57.121.10
+103.57.123.1
+103.57.133.39
  103.57.143.246
  103.57.192.138
  103.57.201.91
@@ -3443,9 +3976,11 @@
  103.57.83.192
  103.57.83.224
  103.57.85.244
+103.58.117.244
  103.58.16.106
  103.58.16.254
  103.58.17.246
+103.58.65.219
  103.58.66.204
  103.58.66.21
  103.58.73.78
@@ -3464,9 +3999,12 @@
  103.6.104.104
  103.6.158.163
  103.6.184.222
+103.6.196.92
+103.6.198.44
  103.60.125.66
  103.60.137.117
  103.60.173.250
+103.60.175.82
  103.60.180.130
  103.60.181.210
  103.60.181.212
@@ -3475,6 +4013,7 @@
  103.60.187.129
  103.60.212.113
  103.60.214.18
+103.61.101.11
  103.61.113.244
  103.61.198.114
  103.61.198.122
@@ -3487,11 +4026,16 @@
  103.63.2.148
  103.63.2.210
  103.65.182.26
+103.65.237.243
+103.65.238.115
  103.66.176.45
  103.66.176.81
  103.66.177.169
  103.66.177.189
  103.66.178.43
+103.66.218.41
+103.66.218.60
+103.66.219.242
  103.66.232.1
  103.66.232.201
  103.66.232.5
@@ -3510,9 +4054,11 @@
  103.66.79.148
  103.66.79.27
  103.66.79.37
+103.67.152.230
  103.67.16.6
  103.67.17.1
  103.67.235.10
+103.67.235.104
  103.67.235.8
  103.68.0.114
  103.68.0.188
@@ -3521,6 +4067,7 @@
  103.68.181.35
  103.68.35.162
  103.68.35.166
+103.68.45.62
  103.68.54.66
  103.69.118.77
  103.69.120.136
@@ -3545,9 +4092,11 @@
  103.69.216.110
  103.69.216.134
  103.69.216.138
+103.69.216.154
  103.69.220.11
  103.69.224.57
  103.69.45.202
+103.69.9.63
  103.70.130.26
  103.70.140.194
  103.70.140.198
@@ -3555,6 +4104,7 @@
  103.70.141.126
  103.70.145.211
  103.70.146.106
+103.70.199.62
  103.70.204.1
  103.70.204.194
  103.70.204.201
@@ -3568,11 +4118,15 @@
  103.70.77.18
  103.71.252.18
  103.71.46.139
+103.72.144.228
+103.72.166.21
  103.72.172.20
  103.72.4.148
  103.73.101.126
+103.73.101.18
  103.73.102.130
  103.73.152.24bin.sh
+103.73.160.144
  103.73.161.123
  103.73.162.156
  103.73.183.15
@@ -3594,9 +4148,11 @@
  103.74.227.177
  103.74.244.244
  103.74.245.23
+103.74.68.86
  103.74.70.142
  103.74.70.97
  103.75.1.198
+103.75.125.99
  103.75.148.103
  103.75.148.17
  103.75.148.203
@@ -3654,9 +4210,11 @@
  103.76.253.150
  103.76.253.156
  103.76.253.162
+103.76.44.155
  103.76.80.202
  103.76.85.149
  103.77.159.59
+103.77.16.133
  103.77.189.126
  103.77.20.1
  103.77.207.150
@@ -3664,6 +4222,8 @@
  103.77.23.202
  103.77.23.241
  103.77.235.35
+103.77.43.212
+103.77.43.219
  103.77.49.194
  103.77.8.149
  103.78.133.219
@@ -3671,6 +4231,7 @@
  103.78.143.4
  103.78.150.32
  103.78.151.117
+103.78.154.20
  103.78.16.194
  103.78.164.201
  103.78.165.130
@@ -3701,6 +4262,7 @@
  103.78.37.102
  103.78.37.98
  103.78.38.34
+103.78.52.130
  103.78.81.227
  103.78.82.154
  103.79.117.5
@@ -3710,23 +4272,29 @@
  103.79.169.137
  103.79.169.145
  103.79.169.153
+103.79.171.181
+103.79.171.182
  103.79.176.31
  103.79.74.26
  103.79.74.3
  103.8.115.27
+103.8.119.166
  103.8.119.17
  103.8.12.100
  103.8.195.34
  103.8.27.10
  103.8.59.1
  103.8.59.9
+103.80.142.251
  103.80.24.32
  103.80.25.18
+103.80.36.34
  103.80.38.82
  103.80.38.83
  103.80.51.61
  103.80.70.254
  103.80.83.161
+103.81.1.55
  103.81.104.141
  103.81.104.242
  103.81.104.38
@@ -3734,6 +4302,7 @@
  103.81.104.93
  103.81.114.182
  103.81.170.160
+103.81.38.181
  103.82.11.209
  103.82.11.237
  103.82.143.89
@@ -3742,12 +4311,14 @@
  103.82.145.111
  103.82.146.154
  103.82.208.121
+103.82.223.139
  103.82.233.2
  103.82.241.2
  103.82.43.174
  103.82.54.154
  103.82.54.88
  103.82.55.64
+103.82.67.167
  103.82.8.189
  103.82.8.193
  103.82.8.197
@@ -3781,6 +4352,8 @@
  103.83.185.193
  103.83.205.57
  103.83.79.69
+103.83.81.152
+103.83.95.82
  103.84.131.14
  103.84.134.1
  103.84.134.9
@@ -3802,10 +4375,12 @@
  103.85.106.110
  103.85.16.123
  103.85.162.26
+103.85.229.33
  103.85.63.66
  103.85.67.114
  103.85.67.169
  103.85.67.94
+103.85.85.136
  103.85.86.157
  103.86.1.17
  103.86.1.2
@@ -3822,7 +4397,10 @@
  103.86.153.82
  103.86.155.102
  103.86.155.78
+103.86.160.91
+103.86.160.93
  103.86.161.245
+103.86.180.10
  103.86.195.186
  103.86.195.190
  103.86.44.122
@@ -3830,6 +4408,7 @@
  103.86.49.187
  103.86.49.28
  103.86.50.211
+103.86.51.156
  103.86.70.222
  103.86.86.71
  103.87.113.127
@@ -3871,6 +4450,7 @@
  103.87.25.193
  103.87.251.146
  103.87.26.125
+103.87.27.122
  103.87.31.169
  103.87.48.1
  103.87.48.45
@@ -3881,11 +4461,16 @@
  103.88.221.194
  103.88.233.5
  103.88.234.58
+103.88.247.212
+103.88.253.83
  103.88.253.88
  103.89.152.190
  103.89.176.74
  103.89.252.123
+103.89.254.138
  103.89.88.39
+103.89.90.208
+103.89.90.42
  103.89.91.205
  103.9.113.90
  103.9.114.118
@@ -3897,22 +4482,36 @@
  103.9.159.87
  103.9.174.70
  103.9.188.229
+103.9.188.23
  103.9.191.40
  103.9.227.210
  103.9.79.132
  103.90.145.196
+103.90.160.81
+103.90.162.104
+103.90.162.118
+103.90.162.120
+103.90.163.199
+103.90.163.206
+103.90.163.75
+103.90.163.84
+103.90.163.87
+103.90.163.89
+103.90.190.54
  103.90.200.226
  103.90.201.70
  103.90.203.152
  103.90.220.97
+103.90.228.165
  103.90.74.242
-103.91.123.92
  103.91.128.182
  103.91.128.34
  103.91.130.1
+103.91.141.164
  103.91.17.136
  103.91.17.147
  103.91.210.187
+103.91.244.50
  103.91.245.11
  103.91.245.12bin.sh
  103.91.245.13bin.sh
@@ -3923,7 +4522,9 @@
  103.91.245.30
  103.91.245.3bin.sh
  103.91.245.45
+103.91.245.47
  103.91.245.5
+103.91.67.235
  103.91.90.221
  103.92.101.178
  103.92.212.1
@@ -3939,15 +4540,22 @@
  103.92.225.95
  103.92.25.90
  103.92.25.95
+103.92.26.252
  103.92.29.114
+103.92.40.246
+103.93.17.149
  103.93.180.102
  103.93.220.182
+103.93.37.25
  103.94.0.178
  103.94.121.27
  103.94.125.254
  103.94.133.94
+103.94.139.14
+103.94.139.31
  103.94.16.129
  103.94.2.35
+103.94.3.123
  103.94.6.18
  103.94.7.250
  103.94.7.254
@@ -3962,10 +4570,14 @@
  103.95.98.179
  103.95.98.90
  103.95.99.229
+103.96.220.115
  103.96.73.160
  103.96.73.208
+103.96.96.114
+103.97.100.15
  103.97.124.53
  103.97.125.174
+103.97.139.170
  103.97.164.98
  103.97.179.141
  103.97.240.193
@@ -3981,6 +4593,7 @@
  103.97.3.83
  103.97.6.230
  103.98.120.89
+103.98.123.24
  103.98.128.51
  103.98.148.132
  103.98.152.79
@@ -3996,9 +4609,13 @@
  103.99.170.220
  103.99.176.32
  103.99.177.247
+103.99.189.33
+103.99.196.253
  103.99.207.151
  103.99.244.70
  103.99.251.189
+103.99.3.205
+103.99.3.216
  103.99.9.198
  1030408.servicesndt1.club
  103298943.snapchatprime.com
@@ -4008,10 +4625,13 @@
  104.1.169.215
  104.1.55.171
  104.12.66.70
+104.128.234.207
  104.128.239.58
  104.128.48.202
  104.128.85.56
+104.128.92.120
  104.128.92.28
+104.128.93.238
  104.128.95.31
  104.129.131.148
  104.129.15.149
@@ -4026,6 +4646,7 @@
  104.129.198.145
  104.129.199.36
  104.129.200.127
+104.129.24.114
  104.129.255.119
  104.129.255.158
  104.129.255.172
@@ -4068,6 +4689,7 @@
  104.131.0.18
  104.131.0.47
  104.131.1.142
+104.131.1.89
  104.131.101.240
  104.131.103.37
  104.131.105.231
@@ -4082,11 +4704,15 @@
  104.131.112.4
  104.131.112.44
  104.131.114.87
+104.131.115.14
  104.131.12.181
  104.131.12.184
  104.131.12.204
  104.131.123.46
+104.131.126.87
  104.131.128.33
+104.131.13.185
+104.131.133.123
  104.131.135.41
  104.131.136.164
  104.131.140.246
@@ -4098,9 +4724,11 @@
  104.131.16.119
  104.131.16.214
  104.131.160.67
-104.131.162.122
+104.131.161.95
  104.131.162.164
+104.131.164.93
  104.131.165.39
+104.131.166.12
  104.131.170.46
  104.131.172.115
  104.131.173.23
@@ -4109,7 +4737,9 @@
  104.131.175.91
  104.131.176.180
  104.131.178.207
+104.131.179.220
  104.131.180.54
+104.131.181.4
  104.131.184.60
  104.131.185.86
  104.131.186.240
@@ -4118,6 +4748,7 @@
  104.131.189.57
  104.131.19.14
  104.131.19.195
+104.131.190.193
  104.131.191.119
  104.131.191.163
  104.131.196.231
@@ -4132,23 +4763,36 @@
  104.131.22.162
  104.131.220.136
  104.131.221.134
+104.131.231.109
  104.131.24.85
  104.131.242.136
+104.131.249.57
  104.131.255.30
  104.131.26.176
  104.131.27.166
  104.131.29.92
  104.131.31.240
+104.131.31.75
+104.131.32.115
  104.131.37.140
+104.131.37.206
  104.131.38.152
  104.131.4.232
+104.131.40.125
+104.131.40.97
  104.131.41.16
  104.131.41.185
  104.131.41.46
  104.131.44.150
+104.131.45.150
  104.131.45.239
+104.131.46.160
+104.131.46.166
  104.131.48.26
+104.131.51.209
+104.131.55.236
  104.131.56.33
+104.131.57.95
  104.131.58.110
  104.131.58.132
  104.131.58.179
@@ -4157,10 +4801,13 @@
  104.131.60.220
  104.131.60.87
  104.131.61.161
+104.131.62.234
  104.131.63.163
  104.131.63.47
  104.131.64.164
+104.131.65.184
  104.131.66.22
+104.131.68.23
  104.131.68.246
  104.131.7.119
  104.131.7.177
@@ -4173,6 +4820,7 @@
  104.131.8.2
  104.131.81.54
  104.131.83.113
+104.131.83.83
  104.131.84.0
  104.131.84.253
  104.131.84.29
@@ -4183,6 +4831,7 @@
  104.131.88.229
  104.131.89.163
  104.131.89.54
+104.131.91.148
  104.131.91.212
  104.131.91.253
  104.131.92.77
@@ -4190,6 +4839,7 @@
  104.131.93.254
  104.131.98.30
  104.131.99.238
+104.131.99.96
  104.136.130.152
  104.139.74.25
  104.140.103.41
@@ -4197,9 +4847,11 @@
  104.140.114.108
  104.140.114.109
  104.140.114.112
+104.140.14.139
  104.140.151.116
  104.140.18.100
  104.140.18.106
+104.140.188.6
  104.140.208.190
  104.140.208.40
  104.140.242.35
@@ -4341,6 +4993,7 @@
  104.145.236.57
  104.148.114.139
  104.148.124.120
+104.148.41.8
  104.148.57.2
  104.148.64.26
  104.149.134.218
@@ -4348,10 +5001,16 @@
  104.149.140.74
  104.149.213.18
  104.149.50.108
+104.152.111.218
  104.152.168.29
+104.152.186.21
  104.152.187.114
  104.152.191.110
+104.152.52.70
  104.153.101.197
+104.153.102.152
+104.153.103.134
+104.154.147.52
  104.154.156.5
  104.154.203.62
  104.154.236.234
@@ -4380,12 +5039,14 @@
  104.155.203.174
  104.155.210.188
  104.155.213.192
+104.155.213.9
  104.155.214.251
  104.155.217.160
  104.155.225.130
  104.155.227.128
  104.155.71.104
  104.155.87.142
+104.156.0.46
  104.156.227.60
  104.156.227.84
  104.156.230.231
@@ -4421,6 +5082,8 @@
  104.160.17.217
  104.160.17.4
  104.160.185.227
+104.160.41.247
+104.160.42.222
  104.160.44.248
  104.160.44.80
  104.160.7.249
@@ -4435,6 +5098,7 @@
  104.161.79.192
  104.162.53.114
  104.163.204.204
+104.166.7.19
  104.166.89.122
  104.167.0.4
  104.167.114.241
@@ -4499,14 +5163,17 @@
  104.175.168.148
  104.175.99.243
  104.184.37.250
+104.185.7.106
  104.187.161.81
  104.192.0.18
  104.192.0.226
  104.192.0.230
+104.192.102.10
  104.192.103.3
  104.192.103.78
  104.192.108.19
  104.192.2.118
+104.192.2.162
  104.192.5.49
  104.192.74.19
  104.192.74.22
@@ -4573,6 +5240,7 @@
  104.197.139.104
  104.197.173.169
  104.197.181.70
+104.197.184.104
  104.197.20.225
  104.197.202.178
  104.197.216.242
@@ -4593,6 +5261,7 @@
  104.198.124.113
  104.198.146.118
  104.198.157.73
+104.198.16.231
  104.198.163.89
  104.198.170.193
  104.198.172.68
@@ -4630,6 +5299,9 @@
  104.199.216.0
  104.199.218.144
  104.199.251.134
+104.199.32.206
+104.199.35.3
+104.199.53.197
  104.199.56.247
  104.2.96.26
  104.20.22.42
@@ -4648,8 +5320,52 @@
  104.200.67.27
  104.200.67.57
  104.200.78.166
+104.205.157.84
+104.206.128.30
+104.206.128.50
  104.206.252.66
  104.206.252.71
+104.206.50.10
+104.206.50.12
+104.206.50.13
+104.206.50.14
+104.206.50.15
+104.206.50.16
+104.206.50.17
+104.206.50.18
+104.206.50.19
+104.206.50.2
+104.206.50.20
+104.206.50.21
+104.206.50.22
+104.206.50.23
+104.206.50.24
+104.206.50.25
+104.206.50.26
+104.206.50.27
+104.206.50.28
+104.206.50.29
+104.206.50.3
+104.206.50.30
+104.206.50.31
+104.206.50.32
+104.206.50.35
+104.206.50.36
+104.206.50.37
+104.206.50.38
+104.206.50.39
+104.206.50.4
+104.206.50.40
+104.206.50.41
+104.206.50.42
+104.206.50.43
+104.206.50.44
+104.206.50.45
+104.206.50.46
+104.206.50.5
+104.206.50.6
+104.206.50.8
+104.206.50.9
  104.206.81.14
  104.206.96.58
  104.207.129.179
@@ -4662,6 +5378,7 @@
  104.207.154.52
  104.207.156.6
  104.207.156.71
+104.207.207.135
  104.208.154.110
  104.208.237.78
  104.208.24.175
@@ -4669,20 +5386,26 @@
  104.208.32.156
  104.208.38.202
  104.209.183.160
+104.209.246.177
  104.209.248.48
  104.209.34.100
  104.210.213.35
  104.210.40.19
  104.210.58.78
+104.210.59.93
  104.211.158.124
  104.211.16.26
+104.211.164.221
  104.211.18.235
  104.211.27.49
  104.211.28.157
  104.211.29.53
  104.211.29.96
  104.211.30.116
+104.211.34.53
  104.211.49.188
+104.211.57.3
+104.211.77.169
  104.211.8.210
  104.214.51.93
  104.214.59.120
@@ -4722,8 +5445,10 @@
  104.223.33.84
  104.223.36.228
  104.223.38.83
+104.223.93.198
  104.224.139.137
  104.224.140.215
+104.224.140.216
  104.224.141.75
  104.224.142.70
  104.224.149.157
@@ -4731,13 +5456,21 @@
  104.224.151.213
  104.224.151.47
  104.224.156.104
+104.224.171.39
  104.224.178.44
+104.224.183.154
+104.224.184.30
  104.224.191.210
+104.225.142.128
+104.225.153.190
+104.225.154.136
+104.225.155.67
  104.225.158.162
  104.225.161.3
  104.225.173.42
  104.225.187.44
  104.225.233.10
+104.225.236.41
  104.225.251.29
  104.227.112.189
  104.227.112.240
@@ -4788,6 +5521,7 @@
  104.233.232.22
  104.233.73.77
  104.233.86.91
+104.236.0.114
  104.236.102.153
  104.236.102.180
  104.236.102.245
@@ -4797,14 +5531,20 @@
  104.236.11.76
  104.236.110.41
  104.236.111.116
+104.236.111.220
  104.236.112.177
  104.236.112.52
  104.236.114.23
  104.236.116.168
  104.236.117.221
  104.236.118.20
+104.236.118.6
+104.236.120.31
  104.236.121.248
  104.236.122.214
+104.236.122.229
+104.236.124.45
+104.236.125.73
  104.236.127.247
  104.236.130.131
  104.236.130.51
@@ -4847,6 +5587,7 @@
  104.236.20.102
  104.236.20.117
  104.236.200.181
+104.236.201.168
  104.236.203.25
  104.236.203.29
  104.236.205.123
@@ -4860,6 +5601,7 @@
  104.236.211.236
  104.236.213.3
  104.236.213.97
+104.236.214.8
  104.236.215.42
  104.236.218.145
  104.236.218.248
@@ -4871,8 +5613,11 @@
  104.236.220.251
  104.236.221.118
  104.236.224.26
+104.236.226.89
+104.236.228.230
  104.236.229.60
  104.236.23.116
+104.236.230.184
  104.236.234.24
  104.236.236.216
  104.236.24.146
@@ -4884,6 +5629,7 @@
  104.236.241.177
  104.236.242.141
  104.236.242.60
+104.236.244.98
  104.236.246.16
  104.236.246.234
  104.236.246.93
@@ -4903,35 +5649,44 @@
  104.236.35.132
  104.236.35.211
  104.236.38.57
+104.236.39.24
  104.236.39.38
  104.236.4.161
  104.236.40.85
+104.236.41.119
  104.236.43.172
  104.236.43.56
  104.236.45.171
  104.236.46.212
  104.236.47.100
+104.236.48.174
  104.236.48.178
  104.236.49.107
  104.236.5.255
  104.236.5.5
  104.236.5.8
+104.236.50.42
  104.236.51.179
  104.236.51.222
  104.236.52.216
  104.236.52.89
+104.236.52.94
  104.236.54.196
  104.236.58.164
  104.236.59.151
  104.236.6.235
  104.236.61.188
  104.236.62.50
+104.236.63.99
+104.236.65.234
+104.236.66.5
  104.236.69.31
  104.236.7.135
  104.236.7.176
  104.236.70.126
  104.236.70.198
  104.236.71.82
+104.236.72.182
  104.236.72.216
  104.236.74.213
  104.236.77.169
@@ -4944,6 +5699,7 @@
  104.236.9.214
  104.236.90.210
  104.236.93.151
+104.236.93.241
  104.236.95.128
  104.236.95.170
  104.236.96.48
@@ -4951,6 +5707,7 @@
  104.237.121.67
  104.237.129.105
  104.237.130.171
+104.237.132.169
  104.237.138.78
  104.237.139.99
  104.237.140.220
@@ -4979,6 +5736,11 @@
  104.238.111.150
  104.238.111.218
  104.238.116.19
+104.238.120.13
+104.238.120.31
+104.238.120.51
+104.238.120.7
+104.238.120.73
  104.238.128.197
  104.238.129.228
  104.238.131.42
@@ -5008,15 +5770,19 @@
  104.238.220.196
  104.238.220.199
  104.238.220.24
+104.238.220.94
  104.238.223.126
  104.238.235.186
  104.238.44.103
  104.238.45.22
+104.238.47.26
  104.238.59.12
  104.238.80.237
  104.238.81.186
  104.238.83.242
+104.238.95.46
  104.238.97.215
+104.238.98.243
  104.239.149.183
  104.239.164.100
  104.239.165.55
@@ -5030,6 +5796,7 @@
  104.243.21.202
  104.243.21.205
  104.243.24.211
+104.243.31.81
  104.243.44.219
  104.244.117.234
  104.244.72.104
@@ -5071,6 +5838,7 @@
  104.244.76.170
  104.244.76.181
  104.244.76.189
+104.244.76.245
  104.244.76.36
  104.244.76.69
  104.244.77.101
@@ -5090,48 +5858,62 @@
  104.244.79.131
  104.244.79.187
  104.244.79.196
+104.244.79.211
  104.244.79.43
  104.245.125.251
  104.245.144.58
  104.245.145.41
  104.245.228.65
+104.245.41.113
+104.245.41.139
  104.245.42.120
  104.245.42.220
+104.245.44.233
  104.245.99.48
  104.247.159.123
  104.247.231.60
  104.248.0.135
+104.248.1.92
  104.248.114.130
  104.248.114.137
-104.248.114.239
+104.248.114.67
  104.248.115.231
  104.248.115.246
  104.248.116.140
  104.248.118.63
  104.248.122.140
  104.248.122.79
+104.248.123.197
  104.248.123.76
+104.248.129.112
+104.248.129.226
  104.248.129.91
  104.248.130.10
  104.248.131.11
+104.248.133.143
  104.248.133.160
+104.248.133.62
  104.248.133.8
  104.248.136.155
  104.248.136.163
  104.248.136.82
  104.248.137.80
+104.248.138.120
  104.248.139.211
  104.248.14.71
  104.248.140.108
  104.248.142.140
-104.248.142.79
+104.248.143.105
  104.248.143.83
+104.248.145.11
  104.248.145.89
  104.248.146.199
+104.248.147.105
  104.248.147.78
  104.248.148.129
  104.248.149.130
  104.248.149.132
+104.248.150.157
  104.248.151.180
  104.248.151.229
  104.248.153.6
@@ -5147,16 +5929,19 @@
  104.248.163.35
  104.248.165.25
  104.248.166.156
+104.248.170.169
  104.248.172.238
  104.248.176.46
  104.248.181.156
+104.248.182.98
  104.248.183.73
-104.248.185.167
+104.248.186.42
  104.248.19.228
  104.248.191.247
  104.248.192.182
  104.248.192.249
  104.248.193.0
+104.248.193.78
  104.248.196.198
  104.248.196.233
  104.248.196.244
@@ -5168,6 +5953,9 @@
  104.248.200.145
  104.248.200.235
  104.248.202.160
+104.248.205.225
+104.248.205.24
+104.248.205.253
  104.248.206.51
  104.248.208.227
  104.248.208.33
@@ -5180,6 +5968,7 @@
  104.248.231.44
  104.248.231.46
  104.248.233.34
+104.248.236.10
  104.248.236.112
  104.248.236.250
  104.248.238.116
@@ -5188,6 +5977,7 @@
  104.248.24.202
  104.248.240.244
  104.248.241.234
+104.248.244.119
  104.248.245.250
  104.248.248.126
  104.248.248.77
@@ -5209,6 +5999,7 @@
  104.248.38.48
  104.248.38.5
  104.248.39.81
+104.248.41.56
  104.248.42.186
  104.248.45.204
  104.248.48.161
@@ -5227,14 +6018,18 @@
  104.248.50.207
  104.248.52.119
  104.248.53.72
+104.248.55.220
  104.248.57.27
  104.248.59.156
+104.248.6.235
  104.248.60.35
+104.248.61.192
  104.248.61.198
  104.248.63.116
  104.248.63.15
  104.248.63.17
  104.248.63.18
+104.248.63.30
  104.248.63.49
  104.248.64.160
  104.248.65.129
@@ -5243,9 +6038,11 @@
  104.248.73.101
  104.248.75.224
  104.248.76.28
+104.248.79.138
  104.248.88.112
  104.248.90.45
  104.248.94.72
+104.249.63.34
  104.250.102.143
  104.250.102.145
  104.250.102.146
@@ -5312,6 +6109,7 @@
  104.36.182.197
  104.36.71.132
  104.37.104.44
+104.37.186.38
  104.37.187.23
  104.37.212.5
  104.37.212.67
@@ -5325,6 +6123,9 @@
  104.41.202.71
  104.41.203.153
  104.41.205.252
+104.41.31.12
+104.41.34.120
+104.41.34.60
  104.41.52.218
  104.41.60.236
  104.42.48.216
@@ -5347,6 +6148,7 @@
  104.47.147.196
  104.47.152.29
  104.47.167.206
+104.50.180.85
  104.50.201.209
  104.53.220.173
  104.54.203.174
@@ -5363,25 +6165,33 @@
  104722155613106546.002.sh.cn
  105.101.86.13
  105.103.160.197
+105.103.201.113
  105.105.162.145
  105.107.36.211
  105.108.115.4
  105.112.1.166
  105.112.10.244
+105.112.25.1
  105.112.91.234
  105.154.151.250
  105.154.191.59
  105.155.159.11
+105.156.87.229
  105.158.91.157
  105.159.149.193
  105.159.194.58
+105.159.253.46
+105.162.40.142
  105.163.1.173
  105.174.38.250
+105.178.104.181
  105.184.173.107
  105.184.253.170
  105.184.253.56
+105.185.177.76
  105.187.233.22
  105.208.44.183
+105.209.180.19
  105.209.235.113
  105.209.239.55
  105.21.40.54
@@ -5392,10 +6202,14 @@
  105.213.126.116
  105.213.82.167
  105.213.97.206
+105.226.178.136
  105.226.188.16
+105.227.167.212
+105.229.20.19
  105.229.22.206
  105.233.34.9
  105.235.106.59
+105.235.134.163
  105.235.197.150
  105.235.197.162
  105.235.201.234
@@ -5421,11 +6235,18 @@
  105.29.67.20
  105.30.250.109
  105.73.83.18
+105.96.11.65
  105.96.13.17
+105.96.3.198
  1051a2e8-48cf-4f98-988c-b1aa7ec7e290.htmlcomponentservice.com
  1052068-dot-n-e-w-me-ss-age-po-rt-al.wl.r.appspot.com
  106-365.net
+106.0.38.73
+106.0.57.144
+106.0.57.147
+106.0.59.201
  106.104.151.142
+106.104.166.45
  106.104.193.155
  106.109.112.zoom-lab.com
  106.110.104.29
@@ -5442,6 +6263,8 @@
  106.110.124.14
  106.110.129.163
  106.110.14.134
+106.110.165.50
+106.110.167.96
  106.110.196.80
  106.110.203.244
  106.110.206.21
@@ -5463,45 +6286,98 @@
  106.111.41.140
  106.111.47.138
  106.111.47.40
+106.111.53.92
  106.111.55.123
  106.111.85.197
+106.113.125.66
  106.116.16.77
+106.12.10.54
+106.12.102.202
+106.12.102.210
  106.12.105.130
+106.12.105.161
  106.12.107.252
  106.12.107.61
+106.12.108.87
  106.12.111.189
+106.12.111.201
  106.12.112.236
+106.12.113.155
+106.12.113.204
+106.12.113.223
+106.12.114.101
  106.12.115.110
+106.12.115.169
  106.12.116.133
  106.12.118.184
  106.12.119.242
  106.12.119.8
+106.12.122.100
+106.12.123.239
+106.12.128.48
+106.12.130.224
  106.12.130.83
  106.12.131.102
  106.12.132.224
  106.12.133.103
+106.12.133.38
  106.12.134.102
+106.12.134.106
+106.12.134.187
+106.12.136.154
  106.12.137.97
+106.12.140.168
  106.12.140.211
  106.12.141.142
  106.12.141.71
+106.12.144.189
+106.12.152.28
  106.12.153.211
  106.12.158.133
  106.12.159.112
+106.12.16.82
+106.12.160.130
  106.12.160.17
+106.12.162.205
+106.12.162.222
  106.12.166.107
  106.12.167.146
+106.12.172.184
  106.12.172.48
  106.12.173.47
+106.12.174.182
+106.12.180.52
  106.12.185.16
+106.12.192.240
  106.12.193.217
  106.12.194.154
+106.12.195.70
+106.12.199.117
  106.12.199.30
+106.12.200.225
+106.12.200.239
+106.12.201.95
+106.12.202.119
+106.12.202.180
  106.12.204.25
+106.12.204.81
+106.12.206.3
+106.12.207.236
  106.12.208.211
  106.12.209.134
+106.12.210.127
+106.12.211.254
+106.12.213.58
+106.12.213.89
+106.12.215.238
  106.12.216.155
+106.12.217.204
+106.12.217.78
  106.12.218.171
+106.12.218.202
+106.12.219.184
+106.12.220.109
+106.12.220.84
  106.12.221.83
  106.12.24.182
  106.12.241.8
@@ -5510,74 +6386,176 @@
  106.12.38.109
  106.12.45.214
  106.12.46.26
+106.12.5.190
  106.12.50.249
  106.12.54.16
+106.12.55.129
+106.12.7.40
+106.12.96.23
  106.12.96.91
+106.12.97.46
  106.12.98.175
+106.12.99.135
  106.120.75.98
+106.121.4.223
+106.121.70.150
  106.123.60.134
  106.124.129.115
  106.124.130.114
+106.124.131.214
+106.124.131.70
+106.124.132.105
+106.124.135.232
  106.124.137.130
+106.124.139.161
+106.124.140.36
+106.124.141.108
  106.124.188.160
  106.124.205.42
  106.125.139.76
  106.127.178.188
+106.13.1.239
  106.13.10.242
  106.13.100.103
+106.13.102.197
  106.13.102.83
+106.13.103.158
+106.13.104.41
  106.13.113.91
  106.13.115.28
  106.13.123.29
+106.13.123.73
  106.13.124.215
+106.13.125.248
+106.13.126.15
+106.13.128.71
  106.13.130.17
  106.13.131.132
  106.13.137.195
  106.13.137.49
  106.13.139.79
+106.13.140.138
  106.13.142.161
+106.13.142.49
+106.13.142.93
+106.13.144.207
  106.13.147.89
  106.13.16.113
  106.13.17.16
  106.13.173.103
  106.13.178.195
+106.13.18.86
+106.13.180.85
+106.13.19.6
+106.13.19.75
+106.13.19.92
+106.13.195.32
+106.13.196.51
+106.13.196.54
+106.13.196.66
+106.13.197.35
  106.13.202.191
+106.13.203.240
+106.13.203.62
  106.13.205.239
  106.13.206.111
+106.13.206.183
+106.13.207.219
  106.13.208.101
  106.13.208.37
+106.13.212.145
+106.13.215.207
+106.13.215.215
+106.13.215.90
+106.13.216.115
+106.13.217.10
  106.13.217.124
+106.13.22.169
+106.13.221.213
  106.13.222.160
+106.13.222.42
+106.13.223.163
  106.13.228.207
  106.13.232.61
+106.13.245.17
+106.13.25.242
+106.13.26.62
  106.13.27.134
  106.13.27.156
+106.13.3.125
+106.13.30.226
+106.13.31.93
+106.13.32.128
+106.13.32.45
  106.13.33.80
+106.13.34.131
+106.13.34.173
+106.13.35.121
  106.13.35.232
+106.13.36.215
  106.13.39.183
  106.13.39.52
+106.13.4.132
+106.13.40.23
  106.13.42.140
+106.13.45.120
+106.13.46.123
+106.13.46.235
  106.13.47.10
  106.13.49.27
  106.13.50.219
+106.13.52.107
+106.13.52.192
+106.13.52.237
+106.13.58.240
  106.13.6.214
  106.13.6.70
  106.13.60.148
  106.13.60.62
+106.13.61.120
+106.13.62.26
+106.13.62.64
  106.13.63.215
+106.13.63.96
+106.13.65.207
+106.13.65.237
+106.13.68.142
+106.13.69.159
  106.13.70.63
  106.13.71.1
+106.13.73.235
+106.13.73.59
  106.13.74.61
+106.13.78.198
+106.13.78.210
+106.13.78.235
  106.13.79.113
+106.13.8.193
  106.13.8.46
  106.13.81.54
+106.13.82.231
+106.13.83.202
+106.13.84.151
  106.13.85.247
+106.13.86.50
  106.13.87.131
  106.13.88.158
+106.13.88.44
  106.13.89.74
+106.13.9.153
  106.13.9.244
  106.13.9.29
+106.13.90.60
+106.13.93.250
+106.13.93.60
+106.13.93.92
+106.13.94.131
+106.13.94.193
+106.13.94.96
  106.13.95.100
+106.13.97.37
+106.13.98.94
+106.13.99.107
  106.14.1.209
  106.14.13.172
  106.14.135.136
@@ -5603,6 +6581,7 @@
  106.185.48.84
  106.186.112.160
  106.186.122.96
+106.186.235.1
  106.186.30.11
  106.187.35.148
  106.187.35.173
@@ -5612,37 +6591,68 @@
  106.187.49.249
  106.187.51.204
  106.187.99.130
+106.193.86.204
+106.198.129.153
+106.198.194.249
+106.2.207.106
+106.200.73.228
+106.200.73.234
+106.201.160.224
  106.201.193.54
+106.201.217.204
+106.204.198.147
+106.206.3.43
+106.206.41.156
+106.206.62.92
+106.206.71.226
+106.210.172.244
+106.211.79.18
  106.212.244.107
+106.213.185.210
  106.214.13.84
+106.214.170.23
+106.217.84.20
  106.240.131.5
  106.240.86.211
  106.240.89.60
+106.241.33.158
+106.241.54.211
  106.242.20.219
  106.242.35.34
  106.242.5.206
+106.242.86.221
  106.243.144.238
  106.243.87.162
  106.244.77.149
+106.245.160.140
  106.245.183.58
  106.245.183.60
  106.245.197.234
+106.245.95.116
  106.247.210.55
  106.247.232.252
  106.247.237.179
  106.248.143.195
  106.248.143.198
+106.248.237.218
  106.250.11.246
  106.250.187.82
  106.250.34.36
+106.251.42.40
  106.255.222.195
-106.255.248.19
+106.255.253.178
  106.3.129.209
  106.3.38.73
  106.3.40.140
+106.37.223.54
+106.37.72.234
+106.38.112.196
+106.38.121.162
  106.38.205.205
  106.39.63.53
  106.46.169.193
+106.46.5.160
+106.51.106.161
  106.51.164.41
  106.51.2.158
  106.51.2.56
@@ -5650,93 +6660,225 @@
  106.51.234.102
  106.51.255.21
  106.51.3.214
+106.51.36.64
+106.51.48.117
  106.51.63.3
+106.51.72.221
+106.51.73.204
  106.51.76.223
+106.51.78.18
  106.51.80.198
+106.51.80.86
  106.51.81.136
  106.51.85.115
+106.51.85.16
  106.51.86.27
+106.51.87.141
  106.52.101.33
+106.52.105.158
  106.52.105.178
+106.52.107.167
  106.52.111.175
+106.52.114.125
+106.52.115.154
  106.52.115.36
+106.52.117.111
  106.52.12.165
+106.52.12.21
+106.52.122.20
+106.52.122.203
+106.52.128.100
+106.52.128.121
+106.52.130.172
+106.52.132.186
+106.52.133.87
  106.52.135.118
+106.52.135.44
+106.52.135.88
+106.52.139.223
  106.52.140.195
+106.52.141.222
  106.52.141.36
  106.52.141.46
+106.52.141.88
  106.52.148.185
  106.52.15.196
+106.52.150.93
  106.52.152.16
+106.52.152.168
+106.52.152.237
+106.52.152.75
+106.52.162.140
  106.52.166.154
+106.52.166.245
  106.52.167.107
  106.52.177.213
+106.52.178.166
+106.52.181.236
+106.52.184.143
+106.52.196.163
+106.52.197.126
  106.52.198.174
  106.52.20.112
  106.52.200.171
+106.52.201.203
+106.52.203.17
  106.52.208.181
+106.52.209.36
  106.52.209.98
  106.52.210.175
+106.52.210.90
+106.52.214.183
+106.52.22.230
+106.52.222.11
+106.52.228.221
  106.52.231.38
+106.52.231.46
+106.52.239.66
+106.52.244.46
+106.52.248.150
+106.52.249.134
+106.52.251.114
+106.52.251.30
+106.52.26.50
  106.52.28.75
+106.52.30.184
  106.52.33.78
  106.52.38.242
+106.52.48.30
+106.52.52.114
+106.52.52.52
  106.52.53.206
+106.52.54.192
  106.52.55.146
  106.52.56.171
+106.52.56.26
  106.52.62.56
+106.52.63.246
+106.52.63.37
+106.52.63.61
+106.52.64.125
  106.52.64.203
  106.52.69.167
+106.52.69.233
+106.52.70.240
  106.52.83.245
+106.52.89.104
  106.52.89.135
+106.52.9.154
+106.52.93.106
+106.52.98.89
  106.53.103.194
  106.53.105.168
  106.53.108.154
  106.53.108.16
+106.53.110.251
  106.53.112.52
+106.53.114.5
+106.53.117.149
  106.53.117.74
+106.53.119.143
  106.53.123.63
+106.53.125.253
+106.53.127.190
  106.53.127.49
+106.53.134.73
  106.53.135.98
  106.53.143.227
+106.53.148.9
  106.53.181.242
+106.53.19.38
+106.53.192.15
+106.53.192.246
+106.53.2.215
+106.53.2.93
  106.53.201.239
+106.53.207.227
  106.53.210.12
+106.53.219.165
  106.53.219.247
  106.53.220.198
  106.53.220.55
  106.53.222.24
+106.53.227.104
  106.53.227.141
  106.53.229.213
+106.53.231.104
+106.53.232.163
+106.53.232.38
+106.53.236.114
  106.53.236.220
+106.53.236.9
  106.53.237.190
  106.53.237.30
+106.53.238.111
  106.53.239.180
  106.53.239.200
  106.53.239.28
+106.53.240.126
+106.53.245.89
  106.53.249.112
+106.53.249.98
  106.53.254.85
+106.53.26.197
+106.53.5.85
+106.53.55.86
+106.53.56.213
+106.53.61.167
  106.53.63.248
+106.53.81.17
+106.53.82.107
  106.53.88.144
+106.53.9.163
+106.53.91.250
+106.53.92.85
+106.54.101.141
+106.54.104.8
+106.54.105.9
+106.54.108.8
+106.54.112.173
+106.54.117.51
+106.54.126.152
+106.54.139.117
  106.54.140.165
  106.54.141.196
+106.54.144.22
  106.54.163.204
+106.54.166.168
+106.54.167.68
+106.54.17.221
  106.54.171.167
  106.54.174.159
  106.54.182.137
+106.54.182.32
+106.54.183.246
+106.54.184.180
  106.54.188.101
+106.54.189.18
+106.54.194.189
  106.54.202.131
  106.54.206.184
+106.54.217.12
  106.54.238.208
  106.54.241.104
  106.54.247.167
  106.54.253.41
  106.54.253.9
  106.54.32.21
+106.54.44.202
+106.54.48.208
+106.54.48.241
  106.54.57.113
+106.54.57.203
  106.54.64.26
+106.54.65.139
+106.54.65.144
+106.54.67.25
+106.54.7.118
  106.54.71.95
+106.54.72.168
  106.54.72.65
+106.54.73.26
  106.54.74.188
  106.54.74.253
  106.54.74.83
@@ -5744,27 +6886,75 @@
  106.54.83.253
  106.54.84.127
  106.54.84.17
+106.54.86.111
+106.54.87.169
+106.54.89.231
+106.54.90.60
+106.54.92.214
+106.54.93.84
  106.54.94.167
+106.54.95.76
+106.54.96.55
+106.54.98.89
+106.55.12.217
+106.55.13.222
  106.55.13.61
+106.55.145.106
  106.55.145.120
  106.55.145.178
+106.55.146.113
+106.55.146.46
+106.55.146.67
  106.55.148.138
+106.55.149.162
+106.55.15.66
+106.55.150.24
+106.55.151.103
+106.55.155.167
  106.55.159.141
  106.55.160.91
  106.55.161.191
+106.55.162.60
+106.55.167.165
  106.55.168.150
+106.55.168.173
+106.55.168.232
+106.55.170.47
+106.55.171.77
  106.55.236.107
+106.55.236.71
+106.55.239.33
  106.55.24.87
+106.55.240.205
  106.55.240.252
  106.55.242.220
+106.55.242.70
+106.55.243.175
+106.55.244.161
+106.55.249.5
  106.55.253.247
+106.55.254.57
+106.55.26.195
+106.55.31.210
  106.55.34.241
+106.55.35.111
  106.55.36.125
+106.55.37.171
  106.55.37.174
+106.55.4.113
  106.55.4.71
+106.55.44.136
+106.55.47.184
+106.55.47.205
+106.55.49.141
+106.55.54.23
+106.55.58.118
+106.55.9.52
  106.55.93.246
+106.55.94.189
  106.58.169.162
-106.58.215.201
+106.58.178.14
+106.58.179.217
  106.66.3.226
  106.66.36.49
  106.68.158.60
@@ -5772,37 +6962,94 @@
  106.72.36.96
  106.72.39.130
  106.75.10.4
+106.75.103.83
  106.75.104.110
+106.75.110.207
  106.75.114.98
+106.75.116.95
+106.75.119.13
+106.75.119.202
  106.75.122.38
+106.75.132.248
+106.75.132.3
+106.75.133.250
  106.75.137.63
+106.75.138.62
+106.75.141.160
+106.75.141.22
  106.75.142.30
  106.75.146.217
+106.75.147.233
+106.75.148.228
+106.75.15.152
+106.75.152.83
+106.75.153.166
  106.75.156.107
+106.75.156.124
+106.75.156.90
+106.75.157.9
+106.75.162.164
+106.75.163.101
+106.75.165.225
+106.75.167.133
+106.75.169.106
+106.75.169.24
+106.75.174.6
+106.75.174.87
  106.75.182.51
  106.75.19.147
+106.75.209.179
  106.75.211.130
+106.75.211.166
+106.75.211.173
+106.75.211.48
  106.75.214.198
+106.75.214.72
  106.75.215.151
  106.75.218.56
+106.75.218.71
+106.75.223.219
+106.75.224.132
+106.75.230.208
  106.75.230.69
  106.75.232.123
  106.75.233.199
+106.75.236.116
  106.75.24.157
+106.75.240.86
+106.75.246.129
  106.75.246.203
  106.75.247.8
+106.75.249.21
  106.75.249.8
+106.75.250.31
  106.75.251.140
+106.75.251.169
  106.75.253.112
  106.75.254.114
+106.75.254.204
  106.75.26.64
  106.75.29.102
  106.75.29.239
+106.75.31.135
+106.75.34.226
+106.75.50.173
  106.75.52.178
+106.75.57.20
+106.75.61.147
+106.75.66.120
  106.75.66.70
  106.75.67.6
+106.75.71.244
+106.75.8.12
+106.75.8.186
+106.75.9.141
  106.75.91.171
  106.75.92.94
+106.75.99.14
+106.76.13.238
+106.76.86.84
+106.76.95.170
  106.8.208.1
  106.8.208.102
  106.8.208.11
@@ -5885,6 +7132,7 @@
  106.8.223.25
  106.8.223.44
  106.8.223.74
+106.91.252.90
  106373423597656-dot-hi0-492-net.appspot.com
  106b.com
  107.0.135.4
@@ -5924,9 +7172,18 @@
  107.150.89.66
  107.151.152.210
  107.151.190.19
+107.151.190.20
  107.151.190.21
  107.151.190.22
+107.151.190.23
+107.151.190.24
+107.151.190.25
  107.151.190.26
+107.151.190.27
+107.151.190.28
+107.151.190.29
+107.151.190.30
+107.151.197.16
  107.151.218.131
  107.151.231.108
  107.152.101.213
@@ -5986,6 +7243,7 @@
  107.155.48.36
  107.155.65.34
  107.155.69.26
+107.158.104.51
  107.158.154.111
  107.158.154.121
  107.158.154.126
@@ -6042,12 +7300,16 @@
  107.167.64.4
  107.167.98.190
  107.170.10.239
+107.170.100.124
  107.170.102.171
  107.170.104.125
  107.170.108.22
+107.170.113.190
  107.170.122.252
  107.170.129.218
  107.170.130.14
+107.170.131.23
+107.170.134.125
  107.170.135.29
  107.170.14.209
  107.170.160.61
@@ -6061,7 +7323,9 @@
  107.170.196.82
  107.170.197.213
  107.170.197.47
+107.170.2.119
  107.170.20.192
+107.170.20.247
  107.170.200.113
  107.170.200.19
  107.170.208.126
@@ -6087,6 +7351,8 @@
  107.170.240.244
  107.170.241.10
  107.170.248.56
+107.170.249.6
+107.170.250.177
  107.170.251.238
  107.170.27.84
  107.170.32.181
@@ -6107,7 +7373,10 @@
  107.170.8.24
  107.170.9.195
  107.170.96.6
+107.170.99.119
+107.171.251.16
  107.172.100.204
+107.172.110.199
  107.172.13.68
  107.172.131.188
  107.172.131.201
@@ -6125,6 +7394,7 @@
  107.172.150.56
  107.172.150.88
  107.172.156.153
+107.172.156.224
  107.172.157.125
  107.172.157.131
  107.172.188.107
@@ -6147,8 +7417,11 @@
  107.172.235.154
  107.172.238.104
  107.172.238.8
+107.172.248.168
  107.172.255.63
+107.172.29.108
  107.172.3.146
+107.172.30.12
  107.172.39.27
  107.172.43.152
  107.172.43.217
@@ -6171,6 +7444,8 @@
  107.173.122.10
  107.173.135.157
  107.173.141.130
+107.173.149.104
+107.173.155.28
  107.173.159.74
  107.173.171.123
  107.173.176.100
@@ -6187,6 +7462,7 @@
  107.173.201.244
  107.173.204.16
  107.173.209.238
+107.173.209.241
  107.173.213.43
  107.173.219.103
  107.173.219.51
@@ -6210,8 +7486,10 @@
  107.173.251.100
  107.173.27.180
  107.173.28.55
+107.173.34.130
  107.173.48.253
  107.173.49.10
+107.173.49.26
  107.173.50.207
  107.173.50.213
  107.173.51.246
@@ -6229,6 +7507,7 @@
  107.173.91.164
  107.174.13.220
  107.174.133.119
+107.174.142.107
  107.174.143.54
  107.174.144.133
  107.174.144.155
@@ -6239,7 +7518,10 @@
  107.174.149.88
  107.174.150.45
  107.174.150.57
+107.174.204.122
+107.174.205.104
  107.174.206.110
+107.174.206.147
  107.174.224.150
  107.174.224.169
  107.174.233.248
@@ -6249,6 +7531,7 @@
  107.174.244.102
  107.174.245.119
  107.174.245.4
+107.174.250.122
  107.174.255.62
  107.174.26.181
  107.174.33.130
@@ -6274,6 +7557,7 @@
  107.175.153.245
  107.175.154.129
  107.175.155.196
+107.175.156.144
  107.175.158.110
  107.175.158.210
  107.175.158.68
@@ -6281,12 +7565,14 @@
  107.175.184.3
  107.175.189.235
  107.175.189.41
+107.175.194.108
  107.175.194.25
  107.175.197.150
  107.175.197.164
  107.175.224.177
  107.175.224.188
  107.175.236.254
+107.175.33.240
  107.175.33.29
  107.175.34.25
  107.175.34.32
@@ -6297,7 +7583,11 @@
  107.175.36.163
  107.175.37.68
  107.175.39.77
+107.175.44.89
+107.175.61.32
  107.175.61.58
+107.175.62.163
+107.175.64.101
  107.175.64.188
  107.175.65.251
  107.175.67.188
@@ -6320,31 +7610,47 @@
  107.178.75.114
  107.178.91.53
  107.178.98.66
+107.179.58.88
  107.179.95.6
  107.179.96.11
  107.180.100.223
  107.180.100.224
+107.180.102.143
+107.180.103.185
+107.180.106.60
  107.180.108.32
  107.180.108.7
+107.180.111.13
+107.180.111.21
+107.180.120.35
+107.180.120.41
  107.180.120.45
+107.180.120.47
+107.180.120.52
  107.180.120.55
  107.180.120.61
+107.180.120.67
+107.180.120.69
  107.180.121.26
  107.180.122.10
+107.180.122.7
  107.180.239.203
  107.180.44.78
  107.180.72.207
  107.180.72.246
  107.180.73.164
+107.180.73.192
  107.180.77.245
  107.180.78.139
  107.180.78.5
  107.180.84.251
  107.180.88.189
+107.180.88.41
  107.180.95.70
  107.181.112.15
  107.181.174.175
  107.181.175.112
+107.181.180.164
  107.181.180.176
  107.181.187.132
  107.181.187.141
@@ -6353,16 +7659,22 @@
  107.181.189.45
  107.181.246.211
  107.181.58.56
+107.182.16.25
  107.182.17.72
  107.182.173.131
  107.182.176.142
+107.182.177.38
  107.182.182.216
+107.182.183.163
  107.182.19.193
  107.182.191.156
+107.182.191.188
  107.182.191.189
+107.182.22.64
  107.182.22.83
  107.182.23.139
  107.182.23.162
+107.182.25.146
  107.186.120.130
  107.189.10.119
  107.189.10.143
@@ -6384,6 +7696,7 @@
  107.189.11.170
  107.189.11.207
  107.189.11.80
+107.189.30.100
  107.189.31.181
  107.190.148.202
  107.190.169.128
@@ -6414,6 +7727,7 @@
  107.20.68.131
  107.20.70.144
  107.20.73.48
+107.20.77.74
  107.20.78.81
  107.20.96.34
  107.21.11.242
@@ -6541,12 +7855,15 @@
  1073.co.jp
  108-365.net
  108.12.213.236
+108.15.44.30
+108.16.0.72
  108.160.130.18
  108.160.138.55
  108.160.141.213
  108.161.129.14
  108.161.131.10
  108.161.134.112
+108.162.11.58
  108.162.219.24
  108.162.219.74
  108.162.229.139
@@ -6597,6 +7914,7 @@
  108.178.75.172
  108.179.219.114
  108.179.54.171
+108.18.131.20
  108.183.77.12
  108.185.97.172
  108.186.6.161
@@ -6605,6 +7923,7 @@
  108.190.109.107
  108.190.190.48
  108.191.2.72
+108.195.190.242
  108.20.175.197
  108.20.186.210
  108.20.207.31
@@ -6626,9 +7945,12 @@
  108.31.18.221
  108.31.26.131
  108.33.213.8
+108.35.101.86
+108.36.253.227
  108.4.207.148
  108.41.188.197
  108.41.2.202
+108.41.58.146
  108.48.169.20
  108.48.201.44
  108.48.3.171
@@ -6640,6 +7962,8 @@
  108.53.71.98
  108.53.88.101
  108.56.134.33
+108.58.123.210
+108.59.0.39
  108.59.192.147
  108.59.8.80
  108.6.140.26
@@ -8752,6 +10076,8 @@
  109.102.254.170
  109.103.55.145
  109.104.118.194
+109.104.118.197
+109.104.118.205
  109.104.151.10
  109.104.164.105
  109.104.74.88
@@ -8764,6 +10090,7 @@
  109.108.136.103
  109.108.87.136
  109.108.88.156
+109.110.199.137
  109.110.52.77
  109.110.73.106
  109.110.81.90
@@ -8771,9 +10098,14 @@
  109.111.237.38
  109.115.62.166
  109.116.245.80
+109.116.41.238
  109.116.7.179
  109.117.250.76
  109.117.53.230
+109.118.109.210
+109.118.113.226
+109.118.96.249
+109.118.98.35
  109.12.99.127
  109.120.141.160
  109.120.141.220
@@ -8793,9 +10125,12 @@
  109.123.66.206
  109.124.65.86
  109.125.128.53
+109.125.130.123
  109.125.136.233
+109.128.161.8
  109.133.28.158
  109.134.232.81
+109.144.21.161
  109.145.190.110
  109.146.170.113
  109.148.140.120
@@ -8803,6 +10138,7 @@
  109.149.177.137
  109.153.169.149
  109.155.126.183
+109.160.20.203
  109.160.55.202
  109.160.88.135
  109.160.97.49
@@ -8817,6 +10153,7 @@
  109.167.132.201
  109.167.133.227
  109.167.134.253
+109.167.200.10
  109.167.207.72
  109.167.210.163
  109.167.226.107
@@ -8837,6 +10174,8 @@
  109.170.97.146
  109.172.57.250
  109.172.57.64
+109.173.116.185
+109.173.207.145
  109.173.41.43
  109.173.41.95
  109.173.96.209
@@ -8850,6 +10189,7 @@
  109.184.206.115
  109.184.218.150
  109.185.141.61
+109.185.159.147
  109.185.180.87
  109.185.44.56
  109.186.228.62
@@ -8863,6 +10203,7 @@
  109.191.203.153
  109.192.75.21
  109.193.134.138
+109.193.159.228
  109.193.211.227
  109.194.17.181
  109.194.174.78
@@ -8871,15 +10212,18 @@
  109.194.244.248
  109.195.177.136
  109.195.179.88
+109.195.187.14
  109.195.194.79
  109.195.215.210
  109.195.23.223
+109.195.234.167
  109.195.38.201
  109.196.127.35
  109.196.172.197
  109.196.254.52
  109.196.68.236
  109.196.82.214
+109.197.194.157
  109.197.93.133
  109.198.191.22
  109.199.164.195
@@ -8904,15 +10248,19 @@
  109.202.17.4
  109.205.115.234
  109.206.168.240
+109.206.246.149
+109.206.246.94
  109.207.102.183
  109.207.46.111
  109.207.79.248
  109.207.99.207
+109.208.205.40
  109.21.2.25
  109.210.97.157
  109.215.254.226
  109.215.90.55
  109.219.187.84
+109.221.9.129
  109.224.1.210
  109.224.12.170
  109.224.12.174
@@ -8936,9 +10284,12 @@
  109.227.4.230
  109.227.5.25
  109.228.12.92
+109.228.168.80
  109.228.21.246
+109.228.48.129
  109.228.50.121
  109.228.53.116
+109.228.57.242
  109.229.0.136
  109.229.15.176
  109.229.210.6
@@ -8953,6 +10304,7 @@
  109.230.251.8
  109.231.194.188
  109.232.106.236
+109.232.109.58
  109.233.212.105
  109.234.161.21
  109.234.161.25
@@ -8968,6 +10320,7 @@
  109.236.137.88
  109.236.213.1
  109.236.52.86
+109.236.63.195
  109.236.81.124
  109.236.81.138
  109.236.81.159
@@ -8977,11 +10330,20 @@
  109.236.88.245
  109.236.90.117
  109.236.91.15
+109.237.109.188
  109.237.147.213
  109.237.214.201
  109.237.214.77
  109.237.26.218
  109.237.92.138
+109.237.96.154
+109.237.96.155
+109.237.96.16
+109.237.96.160
+109.237.96.161
+109.237.96.17
+109.237.96.24
+109.237.96.25
  109.238.11.95
  109.238.208.130
  109.238.208.138
@@ -9002,9 +10364,11 @@
  109.241.203.171
  109.244.105.42
  109.244.35.46
+109.244.35.48
  109.244.97.187
  109.244.97.210
  109.244.99.17
+109.244.99.6
  109.245.214.49
  109.245.220.205
  109.245.229.130
@@ -9013,6 +10377,7 @@
  109.245.241.89
  109.245.242.105
  109.247.106.144
+109.248.11.91
  109.248.14.110
  109.248.14.178
  109.248.14.33
@@ -9033,13 +10398,16 @@
  109.248.175.204
  109.248.176.238
  109.248.200.191
+109.248.203.139
  109.248.206.13
  109.248.62.207
  109.248.9.32
  109.250.135.242
  109.251.252.123
+109.251.55.235
  109.251.76.229
  109.252.108.237
+109.252.123.74
  109.252.126.74
  109.252.2.50
  109.252.202.140
@@ -9049,6 +10417,9 @@
  109.255.152.153
  109.255.170.221
  109.31.234.155
+109.40.65.140
+109.40.66.72
+109.51.230.53
  109.61.10.121
  109.61.112.10
  109.61.112.33
@@ -9056,12 +10427,14 @@
  109.61.112.53
  109.61.14.0
  109.61.2.166
+109.62.224.142
  109.63.184.54
  109.64.229.66
  109.64.231.189
  109.68.189.22
  109.68.212.165
  109.69.0.69
+109.69.1.178
  109.69.1.212
  109.69.1.234
  109.69.10.116
@@ -9134,6 +10507,7 @@
  109.74.206.146
  109.74.5.95
  109.74.51.83
+109.74.56.170
  109.75.140.158
  109.75.178.101
  109.75.185.95
@@ -9141,12 +10515,14 @@
  109.75.34.183
  109.75.36.93
  109.75.43.17
+109.75.45.34
  109.76.184.112
  109.76.27.47
  109.80.128.210
  109.86.121.118
  109.86.134.93
  109.86.182.203
+109.86.187.241
  109.86.190.92
  109.86.198.220
  109.86.219.161
@@ -9154,6 +10530,7 @@
  109.86.219.4
  109.86.224.182
  109.86.225.146
+109.86.226.133
  109.86.244.225
  109.86.71.186
  109.87.11.192
@@ -9163,6 +10540,7 @@
  109.87.183.226
  109.87.78.144
  109.9.175.65
+109.90.104.232
  109.90.2.70
  109.90.59.133
  109.92.131.90
@@ -9175,12 +10553,15 @@
  109.92.205.35
  109.92.222.102
  109.92.222.170
+109.93.179.235
+109.93.236.27
  109.94.115.108
  109.94.172.43
  109.94.182.128
  109.94.182.9
  109.94.220.160
  109.95.255.82
+109.96.66.75
  109.99.146.210
  109.99.37.97
  109.99.63.159
@@ -9223,14 +10604,22 @@
  110.10.178.251
  110.10.179.64
  110.10.179.65
+110.11.234.191
  110.12.64.96
  110.133.240.208
  110.136.105.45
  110.136.129.228
+110.136.188.201
  110.136.241.180
  110.136.247.104
+110.137.36.125
  110.137.77.8
+110.138.10.244
+110.138.150.71
+110.138.150.91
  110.138.203.243
+110.138.218.224
+110.139.1.160
  110.139.128.232
  110.139.162.111
  110.139.206.102
@@ -9247,6 +10636,7 @@
  110.145.77.103
  110.153.66.128
  110.153.72.123
+110.153.9.210
  110.154.150.247
  110.154.175.68
  110.154.208.185
@@ -9264,16 +10654,23 @@
  110.156.65.88
  110.157.217.111
  110.157.28.43
+110.16.95.6
  110.164.101.129
+110.164.126.99
  110.164.64.243
+110.164.76.59
  110.164.86.203
  110.164.91.50
+110.164.93.99
  110.165.19.77
  110.166.80.105
  110.167.30.50
  110.168.171.41
  110.169.137.205
  110.169.33.130
+110.169.42.85
+110.169.68.70
+110.169.70.204
  110.17.41.183
  110.17.41.93
  110.17.42.234
@@ -9284,6 +10681,9 @@
  110.171.110.120
  110.171.154.126
  110.171.226.67
+110.172.101.138
+110.172.101.141
+110.172.147.35
  110.172.160.42
  110.172.162.216
  110.172.162.249
@@ -9296,7 +10696,9 @@
  110.174.144.138
  110.174.148.117
  110.174.223.95
+110.174.96.220
  110.175.118.246
+110.175.128.62
  110.175.146.103
  110.175.183.5
  110.175.48.129
@@ -9315,13 +10717,22 @@
  110.182.107.42
  110.182.62.68
  110.183.108.189
+110.185.106.91
  110.185.125.117
  110.185.147.217
+110.185.170.135
  110.185.174.154
+110.188.23.57
  110.188.70.99
+110.191.210.94
  110.191.212.248
+110.224.137.70
+110.224.138.249
+110.224.173.85
+110.225.207.60
  110.227.118.199
  110.227.232.30
+110.228.196.199
  110.228.219.153
  110.228.91.170
  110.230.233.20
@@ -9330,6 +10741,7 @@
  110.232.249.226
  110.232.252.145
  110.232.252.207
+110.232.255.50
  110.232.66.162
  110.232.74.55
  110.232.76.39
@@ -9339,6 +10751,7 @@
  110.232.82.229
  110.232.83.117
  110.232.87.3
+110.235.237.253
  110.235.249.162
  110.235.250.71
  110.240.205.93
@@ -9346,6 +10759,8 @@
  110.243.178.147
  110.243.21.44
  110.243.24.153
+110.244.24.72
+110.244.242.230
  110.244.97.221
  110.247.16.64
  110.248.227.181
@@ -9353,9 +10768,9 @@
  110.250.43.103
  110.251.11.220
  110.251.132.10
-110.251.181.103
  110.251.5.169
  110.253.124.93
+110.253.229.58
  110.253.237.246
  110.253.48.64
  110.255.126.185
@@ -9372,27 +10787,45 @@
  110.35.235.57
  110.35.29.85
  110.35.43.14
+110.36.218.22
+110.36.221.82
+110.36.225.58
+110.36.226.118
  110.36.228.157
+110.36.232.46
  110.36.234.146
  110.36.235.118
+110.36.238.218
  110.36.239.234
+110.37.200.239
  110.37.216.118
  110.37.224.243
  110.37.226.83
  110.37.227.139
+110.38.7.172
+110.38.7.174
+110.38.7.197
+110.39.146.98
+110.39.160.132
  110.39.160.38
  110.39.162.2
  110.39.174.58
+110.39.187.110
  110.4.27.27
  110.4.45.150
  110.42.10.141
  110.43.241.63
  110.43.49.112
  110.43.52.158
+110.43.52.211
+110.43.52.246
+110.44.113.187
+110.44.113.2
  110.44.117.26
  110.44.118.8
  110.44.123.116
  110.44.124.220
+110.44.126.149
  110.44.126.235
  110.45.139.12
  110.45.145.165
@@ -9400,6 +10833,7 @@
  110.45.146.84
  110.45.147.246
  110.45.147.248
+110.45.147.77
  110.45.155.101
  110.47.218.84
  110.49.101.58
@@ -9413,6 +10847,7 @@
  110.50.84.231
  110.50.85.162
  110.50.86.203
+110.50.86.227
  110.52.208.141
  110.53.182.126
  110.54.126.94
@@ -9420,11 +10855,13 @@
  110.55.117.248
  110.72.251.22
  110.74.131.125
+110.74.177.198
  110.74.193.108
  110.74.193.200
  110.74.195.64
  110.74.198.122
  110.74.199.16
+110.74.203.249
  110.74.208.154
  110.74.221.18
  110.74.221.89
@@ -9440,7 +10877,9 @@
  110.77.135.131
  110.77.135.70
  110.77.137.213
+110.77.138.12
  110.77.145.159
+110.77.148.247
  110.77.149.227
  110.77.154.36
  110.77.159.208
@@ -9493,6 +10932,7 @@
  110.78.143.125
  110.78.145.178
  110.78.145.228
+110.78.145.230
  110.78.145.82
  110.78.146.112
  110.78.146.133
@@ -9530,6 +10970,7 @@
  110.78.168.217
  110.78.170.235
  110.78.173.33
+110.78.178.151
  110.78.179.188
  110.78.184.14
  110.78.186.116
@@ -9543,10 +10984,13 @@
  110.78.186.31
  110.78.186.91
  110.78.20.62
+110.78.208.28
+110.8.67.146
  110.8.71.166
  110.8.84.231
  110.80.36.202
  110.80.46.90
+110.81.179.43
  110.82.166.250
  110.82.166.48
  110.83.135.10
@@ -9560,9 +11004,16 @@
  110.93.13.33
  110.93.14.8
  110.93.214.37
+110.93.246.171
+110.93.246.222
  110.93.87.254
  111.0.124.232
+111.0.31.2
+111.0.31.6
+111.0.80.195
+111.1.165.12
  111.108.18.89
+111.11.102.172
  111.118.104.86
  111.118.105.57
  111.118.117.93
@@ -9578,32 +11029,50 @@
  111.118.65.24
  111.118.88.61
  111.118.96.2
+111.119.177.24
  111.119.178.175
+111.119.187.14
+111.119.187.40
  111.119.187.52
  111.119.187.63
  111.119.210.10
  111.119.233.65
+111.119.236.42
  111.119.245.114
+111.12.52.219
  111.123.64.229
+111.125.70.22
  111.125.87.199
  111.125.88.186
  111.125.88.188
+111.13.102.171
  111.132.5.132
+111.132.7.174
+111.14.221.8
  111.160.204.110
  111.161.72.99
+111.161.74.100
+111.161.74.106
+111.161.74.112
+111.161.74.113
+111.161.74.117
+111.161.74.118
+111.161.74.125
  111.162.224.114
  111.165.242.26
  111.165.9.204
+111.166.128.219
  111.167.160.161
-111.167.48.230
+111.17.201.197
  111.170.84.160
  111.170.85.31
  111.171.34.250
  111.172.167.137
-111.172.38.82
+111.173.223.244
  111.175.186.150
  111.176.46.94
  111.177.192.44
+111.177.21.178
  111.177.22.4
  111.177.22.5
  111.178.109.96
@@ -9611,39 +11080,83 @@
  111.182.236.65
  111.182.237.131
  111.185.177.85
+111.185.4.94
  111.185.49.223
+111.186.57.17
  111.186.58.181
  111.19.157.70
-111.19.171.137
+111.19.198.4
+111.196.123.143
  111.198.29.247
+111.198.48.204
+111.199.248.132
+111.200.216.72
  111.200.52.194
+111.201.66.132
  111.202.106.13
  111.202.106.14
+111.202.106.5
  111.202.106.6
+111.202.130.168
+111.202.190.0
+111.202.190.10
+111.202.190.14
+111.204.176.209
+111.204.204.72
  111.204.244.192
+111.205.14.12
  111.205.6.222
+111.206.16.235
+111.206.198.31
+111.206.221.23
+111.206.221.40
+111.207.49.186
  111.207.92.209
+111.21.255.3
+111.21.99.227
  111.22.120.137
  111.220.71.156
+111.221.44.203
+111.222.16.148
  111.223.3.83
  111.224.160.9
  111.224.162.111
+111.224.167.169
+111.225.93.40
  111.229.1.180
+111.229.101.155
  111.229.109.26
  111.229.110.107
+111.229.110.148
  111.229.113.64
+111.229.118.46
  111.229.123.124
+111.229.123.86
  111.229.125.54
+111.229.128.169
+111.229.13.242
  111.229.130.226
  111.229.135.152
+111.229.135.171
+111.229.137.13
+111.229.143.243
  111.229.145.231
+111.229.147.229
+111.229.156.53
+111.229.158.93
+111.229.160.86
  111.229.161.199
  111.229.167.200
  111.229.170.213
+111.229.181.175
  111.229.181.50
  111.229.187.216
  111.229.188.72
  111.229.19.222
+111.229.191.150
+111.229.192.199
+111.229.192.233
+111.229.193.164
  111.229.194.156
  111.229.196.252
  111.229.198.182
@@ -9652,30 +11165,66 @@
  111.229.204.148
  111.229.205.92
  111.229.206.250
+111.229.208.88
  111.229.209.34
+111.229.211.66
+111.229.212.104
+111.229.215.184
  111.229.216.130
  111.229.217.211
+111.229.218.192
  111.229.219.39
  111.229.220.63
+111.229.221.142
+111.229.222.118
+111.229.227.125
  111.229.227.184
+111.229.229.16
+111.229.234.57
+111.229.235.119
+111.229.237.241
  111.229.237.32
  111.229.239.8
+111.229.241.24
+111.229.242.108
  111.229.242.119
+111.229.242.150
+111.229.250.170
  111.229.253.130
+111.229.253.8
  111.229.26.25
  111.229.3.206
+111.229.34.121
+111.229.35.95
+111.229.4.247
  111.229.44.68
+111.229.48.141
  111.229.50.25
  111.229.63.21
  111.229.64.120
+111.229.65.253
+111.229.67.3
  111.229.70.125
+111.229.73.244
+111.229.75.27
+111.229.77.190
+111.229.78.120
+111.229.79.118
  111.229.82.6
  111.229.84.133
+111.229.85.157
  111.229.89.115
+111.229.89.117
  111.229.90.233
  111.229.93.65
  111.229.95.77
+111.23.58.253
+111.230.104.169
  111.230.105.142
+111.230.135.188
+111.230.136.231
+111.230.141.155
+111.230.157.123
  111.230.157.95
  111.230.167.190
  111.230.170.95
@@ -9685,32 +11234,70 @@
  111.230.181.82
  111.230.19.79
  111.230.197.61
+111.230.200.128
  111.230.201.59
+111.230.203.203
+111.230.204.113
+111.230.209.21
  111.230.210.176
  111.230.210.78
+111.230.219.156
+111.230.221.203
  111.230.228.235
  111.230.23.206
+111.230.231.196
  111.230.234.180
  111.230.241.110
+111.230.25.75
+111.230.29.17
+111.230.73.133
  111.230.90.144
  111.230.92.241
+111.231.103.64
+111.231.108.204
  111.231.110.149
  111.231.115.43
+111.231.116.149
+111.231.119.188
+111.231.119.203
+111.231.119.93
+111.231.120.22
  111.231.132.135
+111.231.14.205
  111.231.140.184
+111.231.164.168
  111.231.18.208
  111.231.190.106
  111.231.190.163
  111.231.194.239
+111.231.195.159
+111.231.198.139
+111.231.202.118
+111.231.206.166
+111.231.215.244
  111.231.226.216
+111.231.241.201
+111.231.52.108
+111.231.54.212
+111.231.54.33
+111.231.55.75
  111.231.59.18
  111.231.61.176
+111.231.68.153
+111.231.71.235
  111.231.71.53
  111.231.75.5
+111.231.75.83
+111.231.76.214
+111.231.77.115
+111.231.79.227
+111.231.88.39
+111.231.89.140
  111.231.93.35
  111.241.60.105
  111.243.90.102
  111.246.44.92
+111.248.151.232
  111.248.27.77
  111.250.132.76
  111.250.140.113
@@ -9718,11 +11305,13 @@
  111.251.220.162
  111.251.31.2
  111.252.155.184
+111.252.64.209
  111.255.37.224
  111.26.165.80
  111.30.107.154
  111.30.11.58
  111.31cf4fdae.com
+111.33.112.172
  111.38.10.161
  111.38.103.114
  111.38.103.114bin.sh
@@ -9759,9 +11348,13 @@
  111.38.30.47
  111.38.8.71
  111.38.8.81
+111.38.88.218
  111.38.9.114
  111.38.9.115
+111.39.46.47
  111.40.111.206
+111.40.161.166
+111.40.217.92
  111.40.45.33
  111.40.79.79
  111.42.102.113
@@ -9790,6 +11383,7 @@
  111.42.67.31
  111.42.67.92
  111.42.89.137
+111.43.10.128
  111.43.223.100
  111.43.223.120
  111.43.223.121
@@ -9808,29 +11402,51 @@
  111.43.223.52
  111.43.223.59
  111.43.223.80
+111.47.18.22
  111.48.132.225
+111.50.82.24
  111.53.13.253
+111.57.0.90
+111.61.122.78
  111.65.255.131
  111.67.12.221
  111.67.192.149
  111.67.193.163
  111.67.193.67
  111.67.193.97
+111.67.194.199
+111.67.194.36
+111.67.194.41
  111.67.194.94
  111.67.195.119
  111.67.195.77
  111.67.197.156
+111.67.198.184
  111.67.198.214
+111.67.199.142
+111.67.199.85
  111.67.20.202
  111.67.200.148
+111.67.200.179
+111.67.201.13
+111.67.202.104
+111.67.203.82
  111.67.204.137
+111.67.204.199
+111.67.204.202
+111.67.204.220
+111.67.204.237
  111.67.204.254
  111.67.204.9
  111.67.205.5
  111.67.205.93
  111.67.206.173
+111.67.206.20
  111.67.206.51
+111.67.207.202
  111.67.207.218
+111.67.207.33
+111.67.207.54
  111.67.74.242
  111.67.92.66
  111.68.104.157
@@ -9838,14 +11454,26 @@
  111.68.15.226
  111.68.2.58
  111.68.27.38
+111.68.46.68
  111.68.98.152
  111.69.49.124
  111.73.45.204
  111.73.46.99
+111.74.11.82
  111.75.149.221
+111.75.190.6
+111.76.127.1
+111.76.140.116
  111.77.250.65
  111.79.45.186
+111.8.57.61
+111.85.96.173
+111.88.172.221
+111.88.226.37
  111.88.249.25
+111.88.43.25
+111.88.68.255
+111.90.133.10
  111.90.138.208
  111.90.140.179
  111.90.140.207
@@ -9866,6 +11494,7 @@
  111.90.149.233
  111.90.149.244
  111.90.149.250
+111.90.149.90
  111.90.150.108
  111.90.150.48
  111.90.150.64
@@ -9878,14 +11507,18 @@
  111.90.159.120
  111.90.177.130
  111.90.187.94
+111.90.190.52
  111.91.161.51
+111.92.104.177
  111.92.164.238
  111.92.164.245
  111.92.164.246
  111.92.164.251
  111.92.189.91
  111.92.240.134
+111.92.240.5
  111.92.52.171
+111.92.61.220
  111.92.80.127
  111.92.80.143
  111.92.80.156
@@ -9908,16 +11541,20 @@
  111.92.81.72
  111.92.81.73
  111.92.81.85
+111.93.10.213
  111.93.121.26
  111.93.145.146
  111.93.169.90
  111.93.200.50
+111.93.205.186
+111.93.214.67
  111.93.24.98
  111.93.30.66
  111.93.38.226
  111.93.53.62
  111.93.58.18
  111.93.71.219
+111.94.51.141
  111.95.108.234
  111.95.141.34
  111.95.203.73
@@ -9930,7 +11567,10 @@
  112-111-vip888.com
  112-365.net
  112.1.17.70
+112.10.26.33
  112.109.198.106
+112.109.92.147
+112.111.0.245
  112.111.119.237
  112.111.162.117
  112.111.162.131
@@ -9941,6 +11581,7 @@
  112.119.173.237
  112.119.179.221
  112.121.164.154
+112.122.51.13
  112.122.58.155
  112.122.58.205
  112.122.63.102
@@ -9954,6 +11595,7 @@
  112.123.62.154
  112.125.89.61
  112.126.65.178
+112.132.0.7
  112.132.130.183
  112.132.144.159
  112.132.144.221
@@ -9965,8 +11607,11 @@
  112.133.195.55
  112.133.219.171
  112.133.230.89
+112.133.245.181
  112.133.26.29
  112.134.70.134
+112.135.194.103
+112.135.253.195
  112.135.3.80
  112.137.164.101
  112.14.158.86
@@ -9974,25 +11619,36 @@
  112.14.59.120
  112.140.185.101
  112.145.215.200
+112.146.109.225
+112.15.50.218
  112.151.170.214
+112.158.127.39
  112.16.211.200
+112.16.97.234
  112.160.228.146bin.sh
  112.160.238.138
  112.160.60.84
+112.161.172.211
  112.161.211.65
  112.161.241.200
+112.162.112.56
  112.162.153.65bin.sh
+112.162.210.71
  112.163.19.153
  112.163.245.186
  112.164.139.12
  112.164.225.19
  112.164.225.19bin.sh
+112.164.242.29
  112.164.25.228
  112.165.0.158
  112.165.209.225
  112.165.209.227
  112.165.75.57
+112.165.89.170
+112.166.133.216
  112.166.159.199
+112.166.221.151
  112.168.0.84bin.sh
  112.17.104.45
  112.17.106.99
@@ -10004,6 +11660,7 @@
  112.17.166.210
  112.17.166.50
  112.17.170.163
+112.17.182.19
  112.17.183.239
  112.17.190.176
  112.17.66.38
@@ -10028,25 +11685,36 @@
  112.172.129.96
  112.172.135.239
  112.172.173.99
+112.172.88.190
  112.175.137.20
  112.175.184.36
  112.175.232.169
+112.184.134.76
  112.185.114.225
  112.186.17.231
  112.186.78.13
  112.187.6.59
+112.19.174.226
  112.192.159.136
  112.192.159.4
  112.193.144.126
  112.193.146.225
+112.196.1.75
  112.196.16.50
+112.196.163.172
  112.196.163.33
+112.196.26.203
  112.196.43.202
-112.196.72.178
+112.196.54.35
+112.196.59.146
  112.196.72.188
  112.196.74.82
  112.196.76.140
+112.196.9.88
+112.197.118.28
  112.198.103.183
+112.198.15.5
+112.198.27.40
  112.198.64.19
  112.198.77.219
  112.199.118.195
@@ -10054,6 +11722,12 @@
  112.199.65.118
  112.199.76.44
  112.199.98.42
+112.2.52.115
+112.200.110.130
+112.200.174.103
+112.200.198.182
+112.200.200.55
+112.200.201.164
  112.201.176.54
  112.201.91.20
  112.202.160.210
@@ -10062,14 +11736,22 @@
  112.203.97.204
  112.204.112.151
  112.204.183.90
+112.204.93.96
  112.205.10.148
  112.205.132.16
  112.206.85.168
+112.206.97.151
  112.207.220.102
  112.207.248.247
  112.207.254.54
  112.208.72.136
+112.21.188.235
+112.21.191.10
+112.21.191.244
  112.210.59.106
+112.211.130.99
+112.211.132.242
+112.211.217.13
  112.211.85.172
  112.213.124.220
  112.213.179.18
@@ -10078,15 +11760,19 @@
  112.213.97.106
  112.214.127.42
  112.214.127.42bin.sh
+112.215.113.10
+112.215.113.11
  112.216.153.186
  112.216.7.50
  112.217.11.203
  112.217.169.138
  112.217.184.90
+112.217.207.130
  112.217.41.237
  112.218.127.140
  112.218.231.43
  112.218.245.11
+112.218.53.179
  112.218.66.90
  112.218.73.138
  112.219.201.124
@@ -10095,7 +11781,6 @@
  112.222.150.126
  112.222.61.180
  112.225.186.20
-112.225.187.19
  112.225.204.1
  112.225.226.91
  112.225.29.179
@@ -10126,22 +11811,26 @@
  112.228.178.129
  112.228.229.83
  112.229.188.86
+112.230.87.213
+112.231.185.227
  112.233.61.230bin.sh
  112.233.88.214
  112.233.90.58
  112.234.194.23
+112.234.195.89
  112.234.198.115
  112.235.210.15
  112.235.234.75
+112.235.43.50
  112.237.105.199
  112.237.105.36
-112.237.117.186
  112.237.124.69
  112.237.127.98bin.sh
  112.237.136.133
  112.237.140.181
  112.237.168.32
  112.237.17.226bin.sh
+112.237.182.97
  112.237.210.126
  112.237.210.126bin.sh
  112.237.216.146
@@ -10157,10 +11846,12 @@
  112.238.13.28
  112.238.135.78
  112.238.14.107
+112.238.148.91
  112.238.150.137
  112.238.152.67
  112.238.16.209
  112.238.174.240
+112.238.18.66
  112.238.190.28
  112.238.216.117
  112.238.22.22
@@ -10170,7 +11861,14 @@
  112.238.29.24
  112.238.63.223
  112.239.115.195
+112.239.20.131
+112.239.20.24
  112.240.173.23
+112.240.177.74
+112.240.178.165
+112.240.183.193
+112.240.183.69
+112.240.183.94
  112.242.1.245bin.sh
  112.242.117.66
  112.242.119.70bin.sh
@@ -10181,6 +11879,8 @@
  112.242.163.6
  112.242.191.222
  112.242.241.18
+112.242.241.25
+112.242.37.226
  112.242.41.208
  112.242.53.15
  112.242.58.230
@@ -10188,73 +11888,86 @@
  112.242.76.95
  112.242.80.2
  112.243.167.181
+112.244.0.7
  112.244.161.224
  112.245.108.219
  112.245.115.241
  112.245.162.48
+112.245.209.145
  112.245.235.93
  112.245.51.48
  112.246.16.56
  112.246.160.53
  112.246.162.10
-112.246.20.76
+112.246.162.50
  112.246.23.135
+112.246.35.254
  112.246.42.101
-112.247.147.78
+112.247.100.58
  112.247.158.19
  112.247.174.45
  112.247.191.75bin.sh
  112.247.210.121
-112.247.247.199
+112.247.237.11
  112.247.251.238
  112.247.44.51
-112.247.59.124
+112.247.46.47
+112.247.59.42
  112.247.80.248
  112.247.82.27
  112.247.83.243
  112.247.87.225
  112.248.102.109
  112.248.102.109bin.sh
+112.248.108.182
  112.248.112.139
  112.248.115.154
  112.248.115.180
+112.248.12.125
+112.248.12.177
+112.248.12.206
  112.248.125.144
+112.248.13.170
+112.248.13.225
+112.248.13.55
  112.248.169.138bin.sh
  112.248.184.99
  112.248.195.208
  112.248.212.95
  112.248.47.171
+112.248.63.88
+112.248.8.51
+112.248.8.54
  112.248.85.54
  112.249.114.118
-112.249.118.72
  112.249.207.89
  112.249.232.239
  112.249.239.249
  112.249.34.188
-112.249.41.142
  112.249.44.140
  112.249.6.180
  112.249.61.143
  112.249.64.120
+112.249.68.235
  112.249.7.128
  112.249.79.230
  112.249.82.57
-112.250.135.234
-112.250.151.254
  112.250.187.128
  112.251.219.229
  112.251.221.45
+112.251.35.96
  112.252.122.52
-112.252.154.156
+112.252.142.223
+112.252.148.133
  112.252.199.225
  112.252.213.72
  112.252.221.244
  112.252.74.188
+112.253.31.178
  112.254.177.210
-112.254.177.9
  112.254.180.220
  112.254.201.248
-112.254.213.60
+112.254.32.243
  112.254.68.30
  112.254.94.5
  112.255.130.20
@@ -10264,11 +11977,14 @@
  112.255.32.166
  112.255.35.70
  112.255.72.130
+112.255.8.235
  112.255.83.242
  112.255.92.233
  112.255.93.3
  112.26.113.106
  112.26.160.67
+112.26.169.105
+112.26.44.112
  112.27.115.8
  112.27.121.163
  112.27.121.163bin.sh
@@ -10339,6 +12055,7 @@
  112.27.124.179
  112.27.124.180
  112.27.124.182
+112.27.124.202
  112.27.124.71
  112.27.125.109
  112.27.126.243
@@ -10371,6 +12088,7 @@
  112.27.91.236
  112.27.91.241
  112.27.91.247
+112.28.104.177
  112.28.209.79
  112.28.209.80
  112.28.98.52
@@ -10500,20 +12218,28 @@
  112.35.30.107
  112.35.79.100
  112.4.79.70
+112.48.5.1
+112.5.102.203
  112.53.227.57
  112.53.227.57bin.sh
  112.53.227.65
  112.53.227.66
+112.53.68.114
  112.6.132.95
+112.64.33.38
  112.64.52.87
+112.64.67.35
  112.64.67.36
+112.64.67.37
  112.65.125.190
  112.65.63.62
+112.66.254.26
  112.67.184.112
  112.67.252.27
  112.72.133.118
  112.72.137.94
  112.72.14.40
+112.72.15.26
  112.72.162.159
  112.72.162.53
  112.72.175.124
@@ -10523,17 +12249,22 @@
  112.72.195.47
  112.72.245.132
  112.74.203.41
+112.74.30.95
  112.74.44.120
  112.78.0.37
  112.78.1.134
+112.78.1.240
+112.78.132.30
  112.78.134.154
  112.78.134.229
  112.78.134.230
  112.78.136.108
+112.78.136.74
  112.78.141.211
  112.78.142.170
  112.78.144.58
  112.78.15.3
+112.78.15.5
  112.78.160.109
  112.78.160.110
  112.78.160.206
@@ -10552,9 +12283,12 @@
  112.78.166.197
  112.78.166.251
  112.78.167.230
+112.78.167.234
  112.78.170.27
  112.78.186.110
+112.78.188.194
  112.78.193.229
+112.78.3.40
  112.78.39.198
  112.78.43.58
  112.78.44.142
@@ -10562,8 +12296,10 @@
  112.78.8.133
  112.80.215.101
  112.80.238.37
+112.80.24.44
+112.81.102.82
+112.81.210.19
  112.81.24.144
-112.81.43.99
  112.82.138.66
  112.82.142.161
  112.82.142.25
@@ -10577,23 +12313,43 @@
  112.84.21.184
  112.85.42.110
  112.85.42.119
+112.85.42.120
  112.85.42.122
+112.85.42.13
  112.85.42.151
  112.85.42.172
+112.85.42.174
+112.85.42.176
  112.85.42.180
+112.85.42.181
+112.85.42.183
+112.85.42.184
+112.85.42.196
+112.85.42.200
+112.85.42.230
+112.85.42.47
  112.85.42.53
+112.85.42.81
+112.85.42.85
+112.85.42.96
+112.85.42.98
  112.86.132.95
-112.86.154.13
  112.86.163.224
+112.86.164.168
  112.86.164.46
  112.86.252.154
  112.87.136.109
+112.9.158.247
+112.90.145.103
  112.91.109.103
  112.91.135.184
+112.91.145.58
  112.91.215.218
  112.94.101.174
+112.94.224.249
  112.94.5.2
  112.94.96.213
+112.94.96.37
  112.94.96.51
  112.94.97.40
  112.94.98.118
@@ -10601,8 +12357,7 @@
  112.94.98.18
  112.94.99.206
  112.95.135.77
-112.95.23.110
-112.95.27.21
+112.95.225.158
  112.95.70.109
  112.98.126.100
  112.98.126.98
@@ -10610,15 +12365,23 @@
  1123351-dot-n-e-w-me-ss-age-po-rt-al.wl.r.appspot.com
  112sarj.com
  113-365.net
+113.0.97.93
+113.1.52.213
  113.10.154.11
-113.101.246.221
+113.100.70.57
+113.102.128.101
+113.102.128.124
+113.102.35.222
  113.103.57.113
+113.104.251.28
  113.105.174.4
  113.105.180.62
  113.105.247.21
  113.105.94.66
  113.106.111.50
  113.106.9.248
+113.107.244.124
+113.108.195.242
  113.109.76.234
  113.11.110.46
  113.11.136.28
@@ -10633,53 +12396,88 @@
  113.11.35.52
  113.11.35.54
  113.11.64.62
+113.110.165.147
+113.110.165.88
+113.110.167.115
+113.110.167.137
  113.110.200.205
+113.111.230.64
+113.111.80.103
+113.113.124.225
+113.113.81.174
+113.116.104.127
  113.116.129.181
+113.116.131.74
+113.116.156.236
  113.116.159.29
-113.116.193.1
  113.116.204.146
-113.116.224.159
-113.116.224.163
-113.116.244.229
+113.116.245.210
  113.116.246.204
-113.116.247.42
-113.116.43.231
+113.116.34.31
+113.116.6.220
  113.116.88.237
  113.116.89.225
  113.118.122.183
  113.118.13.101
-113.118.248.43
+113.118.14.20
+113.118.44.245
+113.118.86.236
  113.119.164.109
+113.119.196.27
+113.12.64.58
  113.120.142.241
+113.120.33.230
  113.120.33.35
  113.120.61.189
  113.121.188.93
+113.121.241.94
+113.121.46.8
+113.124.84.51
  113.125.21.66
  113.128.15.170
+113.128.56.148
  113.130.126.154
  113.130.68.58
  113.133.170.196
+113.133.176.204
  113.133.224.68
+113.134.14.107
  113.134.240.218
  113.14.111.246
+113.140.11.6
  113.140.48.82
+113.140.80.174
+113.141.165.235
+113.141.169.192
+113.141.70.199
+113.142.58.155
+113.145.168.250
  113.15.205.127
  113.160.102.105
  113.160.112.201
+113.160.12.134
  113.160.130.116
  113.160.131.53
  113.160.142.10
  113.160.142.68
+113.160.154.218
  113.160.158.183
  113.160.166.49
  113.160.172.248
  113.160.180.109
  113.160.184.60
  113.160.188.21
+113.160.198.217
+113.160.20.42
+113.160.202.185
  113.160.206.37
+113.160.208.114
+113.160.208.15
  113.160.219.210
+113.160.221.108
  113.160.234.147
  113.160.234.160
+113.160.234.21
  113.160.235.49
  113.160.245.89
  113.160.247.115
@@ -10688,81 +12486,143 @@
  113.160.248.80
  113.160.251.43
  113.160.58.230
+113.160.96.0
  113.160.98.123
  113.161.128.192
  113.161.128.28
  113.161.129.13
  113.161.132.29
  113.161.148.81
+113.161.151.29
+113.161.160.174
  113.161.176.235
+113.161.176.83
  113.161.186.101
  113.161.207.105
  113.161.207.99
+113.161.210.203
+113.161.212.23
+113.161.220.55
  113.161.237.248
+113.161.37.216
  113.161.39.18
+113.161.39.209
  113.161.43.81
+113.161.45.89
+113.161.50.231
  113.161.52.89
  113.161.53.147
+113.161.55.228
  113.161.58.249
  113.161.62.31
  113.161.68.146
  113.161.70.172
+113.161.78.14
  113.161.78.86
+113.161.82.42
  113.161.88.235
  113.161.92.91
+113.161.94.155
  113.162.101.73
  113.162.232.255
+113.162.36.247
  113.162.53.125
  113.162.55.10
  113.162.66.15
  113.163.157.250
+113.163.202.22
+113.163.221.222
  113.164.79.127
  113.164.79.177
  113.165.122.210
+113.165.189.158
+113.165.229.218
  113.167.137.44
  113.168.106.126
  113.168.5.245
+113.169.42.170
  113.170.128.242
  113.170.221.199
+113.172.105.223
+113.172.139.113
+113.172.180.51
+113.172.202.84
+113.172.223.47
  113.172.77.33
  113.173.191.219
+113.173.198.91
+113.174.246.185
+113.174.26.182
+113.175.134.34
  113.175.251.206
+113.176.118.54
  113.176.195.145
  113.176.58.77
  113.176.88.10
  113.176.88.18
+113.176.89.116
  113.177.185.199
  113.177.27.217
+113.178.56.181
+113.180.115.1
+113.180.229.136
+113.180.58.24
  113.181.20.41
  113.181.26.60
+113.182.73.40
+113.182.79.77
+113.183.100.52
  113.183.114.179
+113.183.199.54
+113.184.237.108
  113.184.58.239
  113.185.0.13
+113.186.180.15
+113.186.19.88
  113.186.31.119
+113.186.95.254
+113.187.113.215
  113.188.101.28
  113.190.181.117
  113.190.189.100
  113.190.233.83
+113.190.234.34
+113.190.235.173
+113.190.235.39
+113.190.252.2
  113.190.252.217
  113.190.254.165
  113.190.254.245
+113.190.255.158
+113.190.36.2
  113.190.40.199
+113.190.42.153
  113.191.219.206
  113.193.200.2
+113.193.240.109
  113.194.128.81
-113.194.141.232
+113.194.130.64
  113.194.30.175
  113.195.153.138
  113.195.165.157
  113.195.165.77
  113.195.207.146
+113.20.108.40
+113.20.108.5
  113.200.105.23
+113.200.156.180
  113.200.60.74
-113.201.231.192
+113.203.199.227
+113.203.236.211
  113.203.238.130
  113.205.138.153
  113.205.51.241
+113.206.196.43
  113.206.45.80
+113.208.112.148
+113.208.119.154
+113.209.128.114
+113.21.123.213
  113.21.231.98
  113.21.70.127
  113.212.162.155
@@ -11280,22 +13140,38 @@
  113.212.70.98
  113.212.70.99
  113.214.13.1
+113.214.28.246
+113.215.181.54
+113.218.168.197
+113.219.122.194
  113.219.201.155
+113.22.146.5
+113.22.4.10
  113.221.13.204
  113.221.23.161
  113.221.50.64
-113.227.209.16
-113.227.33.73
  113.227.42.149bin.sh
+113.229.114.221
  113.229.81.108
-113.233.116.181
+113.23.144.50
+113.23.54.34
+113.231.41.37
+113.231.42.36
  113.233.130.111
+113.237.130.78
  113.237.197.229
+113.237.248.231
+113.237.253.109
+113.237.253.30
+113.237.255.50
+113.237.255.80
  113.238.142.208
+113.24.57.84
  113.24.59.151
  113.240.184.183
  113.240.186.132
  113.243.130.13
+113.244.136.0
  113.245.191.254
  113.246.243.65
  113.246.51.197
@@ -11304,6 +13180,7 @@
  113.247.250.238
  113.248.192.30
  113.249.197.33
+113.249.199.14
  113.25.117.189
  113.252.222.73
  113.254.178.224
@@ -11311,12 +13188,36 @@
  113.30.66.24
  113.30.66.5
  113.31.102.234
+113.31.102.8
  113.31.104.160
  113.31.104.8
+113.31.104.89
  113.31.105.250
+113.31.107.34
+113.31.107.85
+113.31.109.63
+113.31.111.225
+113.31.113.230
+113.31.114.207
  113.31.116.238
+113.31.117.151
+113.31.117.154
+113.31.117.196
  113.31.117.79
  113.31.118.137
+113.31.118.242
+113.31.118.68
+113.31.119.60
+113.31.125.11
+113.31.125.177
+113.31.144.153
+113.31.146.115
+113.31.147.43
+113.31.147.54
+113.31.148.18
+113.31.152.36
+113.31.153.157
+113.36.142.98
  113.41.194.235
  113.52.122.6
  113.52.135.125
@@ -11328,13 +13229,13 @@
  113.53.152.96
  113.53.154.32
  113.53.180.69
-113.53.185.133
  113.53.194.24
  113.53.21.236
  113.53.21.70
  113.53.223.100
  113.53.230.200
  113.53.231.198
+113.53.238.195
  113.53.247.221
  113.53.247.222
  113.53.255.222
@@ -11344,6 +13245,8 @@
  113.53.29.88
  113.53.3.63
  113.53.31.193
+113.53.43.138
+113.53.47.192
  113.53.53.155
  113.53.60.16
  113.53.60.224
@@ -11358,9 +13261,11 @@
  113.53.91.12
  113.53.91.214
  113.53.94.235
+113.55.4.28
  113.57.101.30
  113.57.109.73
  113.57.153.83
+113.57.170.50
  113.57.252.72
  113.57.85.204
  113.58.228.48
@@ -11375,40 +13280,69 @@
  113.59.224.170
  113.61.66.94
  113.65.108.121
+113.65.206.133
+113.65.208.159
  113.65.21.108
+113.65.229.103
+113.65.229.67
+113.65.67.202
+113.66.124.152
+113.66.124.18
  113.66.41.128
  113.67.75.147
  113.68.142.196
+113.69.204.15
+113.69.204.220
+113.7.62.71
  113.72.25.247
  113.74.26.114
  113.77.240.199
  113.81.232.8
+113.81.233.245
  113.81.9.249
+113.87.130.254
+113.87.144.16
  113.87.145.248
+113.87.147.127
+113.87.165.143
  113.87.174.121
-113.87.194.100
-113.87.226.151
-113.87.32.185
-113.87.90.187
-113.88.124.33
-113.88.210.29
+113.87.91.127
+113.88.104.136
+113.88.142.101
+113.88.165.120
+113.88.208.207
+113.88.38.171
  113.88.87.244
-113.89.244.195
+113.89.245.151
+113.89.33.59
+113.89.35.69
+113.9.135.218
  113.9.233.14
+113.90.177.238
  113.90.208.203
  113.90.208.239
+113.90.208.77
  113.90.245.165
+113.92.197.181
  113.93.224.56
  113.96.154.17
  113.96.154.24
  113.96.154.26
  113.96.154.27
+113.96.44.90
  113.96.83.20
  113.96.83.25
+113.98.193.58
+113.98.62.154
  1133ko2.us-south.cf.appdomain.cloud
  1139.31cf4fdae.com
  114-results-realestate-properties-in-your-city.estate
+114.100.116.85
  114.101.250.177
+114.102.180.99
+114.103.137.220
+114.103.87.100
+114.104.159.233
  114.104.189.119
  114.108.130.135
  114.108.140.37
@@ -11422,10 +13356,14 @@
  114.110.21.121
  114.110.21.50
  114.110.21.54
+114.112.161.155
+114.112.69.102
  114.112.70.150
  114.113.225.121
+114.113.237.67
  114.113.238.11
  114.116.67.193
+114.118.10.141
  114.118.12.230
  114.118.16.78
  114.119.183.219
@@ -11438,12 +13376,16 @@
  114.134.186.59
  114.134.187.130
  114.134.191.194
+114.141.132.88
  114.141.167.190
  114.141.168.123
  114.141.196.221
  114.141.49.149
+114.141.52.251
+114.142.173.39
  114.143.100.102
  114.143.118.242
+114.143.230.186
  114.143.25.156
  114.173.201.110
  114.179.127.48
@@ -11455,17 +13397,28 @@
  114.199.123.211
  114.199.159.159
  114.199.215.31
+114.201.54.70
  114.204.218.154
  114.206.60.98
  114.207.139.203
  114.215.103.83
  114.215.184.51
-114.216.107.209
+114.216.17.245
+114.216.206.43
+114.216.49.6
+114.217.105.222
+114.217.106.216
  114.218.217.235
  114.219.116.116
  114.219.127.116
+114.219.154.119
+114.219.157.97
  114.219.18.147
+114.219.64.206
+114.220.17.25
  114.220.26.198
+114.220.74.62
+114.221.86.115
  114.223.121.90
  114.223.48.158
  114.224.212.99
@@ -11482,6 +13435,7 @@
  114.226.249.248
  114.226.255.129
  114.226.26.52
+114.226.26.61
  114.226.26.86
  114.226.80.165
  114.226.81.133
@@ -11492,8 +13446,14 @@
  114.226.85.114
  114.226.85.180
  114.226.89.111
+114.226.89.203
  114.227.0.27
  114.227.1.22
+114.227.111.106
+114.227.111.45
+114.227.159.190
+114.227.159.30
+114.227.171.94
  114.227.26.138
  114.227.28.178
  114.227.30.70
@@ -11514,6 +13474,7 @@
  114.228.30.181
  114.228.31.101
  114.228.31.19
+114.228.54.111
  114.228.57.156
  114.228.63.106
  114.228.74.112
@@ -11541,7 +13502,10 @@
  114.233.158.143
  114.233.167.108
  114.233.189.183
+114.233.216.199
  114.233.237.38
+114.233.51.216
+114.233.51.230
  114.234.104.158
  114.234.104.187
  114.234.123.3
@@ -11614,13 +13578,14 @@
  114.235.7.118
  114.235.81.53
  114.235.81.96
-114.235.91.14
  114.236.152.230
  114.236.16.158
  114.236.17.66
  114.236.17.8
  114.236.20.161
  114.236.23.186
+114.237.134.156
+114.237.209.119
  114.238.167.163
  114.238.171.204
  114.238.212.247
@@ -11671,12 +13636,26 @@
  114.242.184.198
  114.242.236.140
  114.242.245.32
-114.242.25.132
  114.242.68.28
+114.245.243.18
+114.246.34.145
  114.247.79.179
+114.247.84.127
+114.247.84.143
+114.247.84.147
+114.247.84.161
+114.247.84.166
+114.247.84.171
+114.247.84.22
+114.247.84.241
+114.247.84.246
+114.247.84.38
+114.247.84.41
  114.25.133.159
  114.250.149.214
  114.27.160.69
+114.29.237.161
+114.29.237.99
  114.29.238.53
  114.29.66.139
  114.30.121.123
@@ -11684,15 +13663,21 @@
  114.30.55.54
  114.31.15.158
  114.31.15.22
+114.31.156.7
  114.31.20.2
  114.31.4.122
  114.31.5.154
  114.32.205.167
+114.32.236.99
+114.32.31.1
+114.32.31.146
  114.32.89.199
  114.32.93.245
  114.33.206.143
+114.34.239.33
  114.34.53.250
  114.34.81.132
+114.35.104.177
  114.35.118.32
  114.35.188.117
  114.35.237.73
@@ -11702,8 +13687,10 @@
  114.37.173.103
  114.37.173.123
  114.37.220.186
+114.37.87.230
  114.4.121.90
  114.4.192.17
+114.4.227.194
  114.4.8.14
  114.4.98.150
  114.40.189.44
@@ -11731,19 +13718,38 @@
  114.6.87.177
  114.6.88.238
  114.6.94.94
+114.64.255.242
+114.67.103.151
+114.67.105.220
  114.67.106.197
  114.67.108.60
+114.67.110.126
+114.67.110.227
+114.67.122.61
+114.67.123.3
+114.67.127.240
+114.67.168.0
+114.67.168.173
+114.67.179.254
+114.67.181.192
  114.67.198.134
+114.67.199.133
  114.67.224.239
  114.67.229.212
+114.67.245.161
  114.67.250.30
+114.67.253.227
+114.67.254.244
  114.67.68.255
  114.67.69.0
  114.67.72.164
  114.67.77.148
  114.67.77.150
  114.67.85.74
+114.67.87.255
  114.67.90.104
+114.67.92.150
+114.67.95.121
  114.67.95.61
  114.69.232.101
  114.69.232.121
@@ -11778,13 +13784,18 @@
  114.69.243.89
  114.69.243.93
  114.69.244.210
+114.69.244.238
  114.69.244.66
+114.69.245.73
  114.69.249.161
+114.69.249.194
  114.69.32.65
  114.7.112.118
  114.7.15.146
+114.7.162.198
  114.7.162.6
  114.7.162.98
+114.7.165.150
  114.7.192.254
  114.7.194.132
  114.7.202.171
@@ -11792,18 +13803,39 @@
  114.7.96.178
  114.7.97.193
  114.77.56.186
+114.79.164.131
+114.79.188.185
  114.80.156.113
  114.80.157.205
  114.80.96.138
+114.84.212.242
+114.84.31.218
  114.86.88.138
+114.87.232.237
  114.88.182.89
  114.88.92.236
  114.95.158.41
+114.98.231.143
+114.98.236.124
+114.99.10.23
+114.99.10.238
+114.99.13.68
+114.99.130.109
+114.99.130.198
+114.99.130.224
+114.99.130.245
+114.99.131.229
+114.99.131.29
+114.99.14.105
  114.99.14.143
+114.99.16.231
+114.99.5.48
+114.99.63.220
  1147.org
  114oldest.com
  115.100.249.238
  115.111.91.67
+115.113.156.66
  115.124.102.10
  115.124.64.234
  115.124.64.33
@@ -11829,22 +13861,42 @@
  115.127.78.138
  115.127.92.179
  115.133.12.166
+115.133.243.120
  115.133.55.73
+115.134.128.90
+115.134.130.53
+115.134.151.149
  115.134.184.104
  115.134.194.190
+115.134.237.192
  115.134.44.42
-115.134.81.10
  115.135.154.242
+115.135.30.9
  115.135.93.107
  115.137.112.89
  115.144.111.239
+115.144.166.59
  115.144.238.26
  115.144.238.94
  115.144.69.105
  115.146.122.237
+115.148.100.214
+115.148.72.216
+115.148.72.56
  115.149.138.108
+115.150.106.8
+115.150.22.163
+115.150.22.236
  115.150.59.162
+115.159.0.160
+115.159.102.123
+115.159.105.200
+115.159.106.132
  115.159.107.41
+115.159.112.66
+115.159.113.142
+115.159.114.146
+115.159.117.250
  115.159.117.88
  115.159.118.95
  115.159.120.232
@@ -11855,34 +13907,67 @@
  115.159.145.240
  115.159.147.107
  115.159.147.151
+115.159.149.106
  115.159.150.172
  115.159.151.171
+115.159.155.33
+115.159.157.126
+115.159.157.154
+115.159.161.81
  115.159.191.199
+115.159.194.90
+115.159.195.53
  115.159.197.21
  115.159.197.34
+115.159.199.238
+115.159.200.183
  115.159.201.15
+115.159.205.225
  115.159.206.101
+115.159.206.137
+115.159.208.207
+115.159.209.172
  115.159.209.204
  115.159.212.230
+115.159.212.30
  115.159.213.101
  115.159.213.195
  115.159.214.208
  115.159.216.109
  115.159.226.89
+115.159.24.96
+115.159.25.60
  115.159.3.211
  115.159.3.29
  115.159.33.157
  115.159.33.215
+115.159.34.134
  115.159.39.248
+115.159.42.64
  115.159.44.135
+115.159.47.78
  115.159.48.34
+115.159.5.58
+115.159.56.151
  115.159.58.171
+115.159.65.146
+115.159.65.25
  115.159.66.188
+115.159.66.78
  115.159.67.200
+115.159.71.95
+115.159.76.52
  115.159.85.147
+115.159.90.137
+115.159.90.184
  115.159.92.26
+115.159.95.57
+115.159.98.28
+115.159.99.113
  115.160.242.62
  115.160.51.31
+115.164.201.95
+115.164.84.171
  115.165.135.210
  115.166.128.230
  115.167.65.238
@@ -11891,11 +13976,17 @@
  115.178.103.226
  115.178.98.62
  115.182.105.68
+115.186.147.208
+115.187.37.199
+115.187.40.156
  115.187.45.172
+115.187.88.82
  115.195.214.241
+115.196.21.128
  115.197.173.196
  115.197.83.141
  115.198.37.149
+115.201.117.186
  115.201.37.74
  115.201.42.185
  115.201.47.10
@@ -11904,63 +13995,94 @@
  115.202.87.191
  115.206.40.187
  115.206.60.63
+115.207.159.36
  115.207.199.11
  115.207.9.109
+115.208.102.203
  115.208.117.143
  115.208.126.111
  115.208.134.3
  115.208.192.204
+115.208.22.147
  115.208.50.106
+115.208.81.156
  115.21.224.117
+115.216.218.218
  115.216.26.149
  115.22.82.128
+115.220.1.204
  115.220.157.20
+115.220.4.84
  115.220.59.32
+115.221.11.25
  115.224.88.245
+115.226.151.6
+115.227.246.216
  115.229.249.129
  115.23.196.182
  115.23.90.25
  115.230.124.125
+115.230.127.176
  115.230.23.133
+115.231.0.56
  115.231.175.80
  115.231.51.10
+115.231.67.2
  115.231.96.152
  115.233.210.218
  115.236.119.139
  115.236.136.33
+115.236.136.55
+115.236.182.186
  115.236.185.227
+115.236.67.42
+115.236.8.253
  115.236.89.211
+115.238.37.132
  115.238.38.10
  115.238.61.222
+115.238.62.154
  115.238.65.122
+115.238.75.13
+115.238.97.2
+115.239.161.134
  115.239.202.98
+115.239.226.46
  115.239.227.106
+115.239.76.67
+115.239.79.189
  115.241.1.66
+115.241.1.85
  115.243.116.202
  115.243.35.98
  115.248.223.180
  115.249.31.3
  115.254.63.50
+115.28.211.230
  115.29.104.26
-115.29.246.243
  115.29.7.25
  115.29.7.45
  115.38.178.51
-115.40.25.180
+115.4.56.5
+115.42.121.222
+115.42.123.26
+115.42.127.133
+115.42.151.75
  115.42.32.106
+115.42.71.15
  115.44.108.114
  115.45.104.103
-115.45.178.23
  115.47.53.34
+115.48.132.113
+115.48.133.240
  115.48.147.72
-115.48.149.226
  115.48.149.252
-115.48.150.125
  115.48.180.233
-115.48.210.90
-115.48.232.158
-115.48.34.35
+115.48.182.249
+115.48.188.10
+115.48.201.61
  115.48.46.61
+115.48.86.142
  115.49.210.221
  115.49.215.114
  115.49.227.139
@@ -11968,41 +14090,38 @@
  115.49.37.204bin.sh
  115.49.72.68
  115.49.78.108
+115.49.79.203
  115.49.96.91
  115.49.97.55
  115.50.0.131
+115.50.128.33
  115.50.158.179
  115.50.165.64
  115.50.187.9
-115.50.201.166
  115.50.203.67
  115.50.219.28
-115.50.229.68
-115.50.234.45
+115.50.226.186
  115.50.247.130
-115.50.3.47
-115.50.4.221
+115.50.44.19
  115.50.56.92
-115.50.64.87
-115.50.83.157
-115.50.89.30
+115.50.63.172
+115.50.72.150
+115.50.75.186
  115.50.92.156
+115.51.108.24
  115.51.110.122
+115.51.19.28
  115.51.47.80
-115.51.93.137
  115.52.12.28
+115.52.17.159
  115.52.58.160
-115.53.234.153
-115.54.128.3
+115.53.226.169
  115.54.129.10
  115.54.183.113
  115.54.198.41
-115.54.205.60
  115.54.214.163
-115.54.222.126
-115.54.69.18
-115.54.70.247
-115.55.108.161
+115.54.239.241
+115.54.70.23
  115.55.130.195
  115.55.130.55
  115.55.131.30
@@ -12022,10 +14141,11 @@
  115.55.159.46
  115.55.159.76
  115.55.161.184
+115.55.177.28
  115.55.182.172
  115.55.202.175
  115.55.208.186
-115.55.246.234
+115.55.242.81
  115.55.32.190
  115.55.41.246
  115.55.90.41
@@ -12037,27 +14157,33 @@
  115.56.131.111
  115.56.131.72
  115.56.132.235
-115.56.133.255
  115.56.134.247
  115.56.135.103bin.sh
  115.56.135.247
+115.56.136.22
  115.56.136.245
  115.56.137.47
+115.56.138.138
+115.56.138.249
  115.56.140.64
+115.56.141.87
  115.56.142.140
+115.56.142.66
  115.56.143.125
  115.56.143.13
+115.56.143.51
  115.56.146.213
  115.56.147.73
-115.56.149.104
-115.56.152.88
+115.56.153.206
  115.56.153.210bin.sh
+115.56.158.78
  115.56.161.84
+115.56.178.159
+115.56.180.139
  115.56.181.204
  115.56.181.237
  115.56.182.87
  115.56.189.174
-115.56.190.90
  115.56.191.28
  115.56.24.68
  115.56.24.92
@@ -12066,48 +14192,59 @@
  115.58.133.121
  115.58.135.221
  115.58.141.145
-115.58.141.186
  115.58.2.34
  115.58.209.70
-115.58.95.103
-115.59.159.200
+115.58.21.251
+115.58.4.122
+115.58.68.145
+115.59.164.168
  115.59.18.137
-115.59.196.248
+115.59.193.178
  115.59.199.35
-115.59.2.127
  115.59.202.88
-115.59.213.158
  115.59.223.241
  115.59.230.79
-115.59.252.181
  115.59.255.40
  115.59.76.195
  115.59.82.114
  115.60.201.21
  115.61.10.132
  115.61.102.167
+115.61.103.60
+115.61.108.196
  115.61.110.213
+115.61.113.103
+115.61.114.44
+115.61.117.248
  115.61.118.77
  115.61.121.109
  115.61.137.57
  115.61.144.220
-115.61.186.207
  115.61.187.154
  115.61.98.191
  115.62.134.206
  115.62.144.135
-115.63.132.230
+115.62.144.234
+115.62.184.122
+115.63.134.112
  115.63.139.114
  115.63.148.75
+115.63.161.66
  115.63.183.92
  115.63.186.148
  115.63.189.176
  115.63.19.124
+115.63.36.253
  115.63.53.166
+115.66.110.249
+115.66.180.253
+115.66.219.106
  115.68.109.9
+115.68.177.78
  115.68.182.197
  115.68.190.124
  115.68.2.144
+115.68.232.221
  115.68.232.45
  115.68.49.169
  115.68.52.240
@@ -12121,24 +14258,34 @@
  115.70.193.142
  115.70.208.17
  115.70.28.209
+115.71.236.98
+115.71.237.56
+115.71.238.18
+115.71.239.208
  115.72.129.67
  115.72.133.106
  115.72.133.213
  115.73.170.163
  115.73.213.182
+115.73.213.31
  115.73.215.192
+115.73.35.105
+115.74.100.11
  115.74.17.157
+115.74.192.95
  115.74.217.2
  115.75.1.184
+115.75.153.9
  115.75.154.248
  115.75.181.168
  115.75.34.141
+115.75.60.151
  115.75.88.125
+115.75.88.151
  115.76.162.74
  115.76.164.44
  115.76.164.51
  115.76.165.248
-115.76.166.169
  115.76.166.71
  115.76.168.68
  115.76.171.139
@@ -12147,43 +14294,69 @@
  115.76.173.130
  115.76.175.18
  115.76.175.191
+115.76.50.105
  115.77.116.39
  115.77.187.194
+115.77.187.240
  115.77.188.228
  115.77.191.180
+115.77.28.140
  115.78.0.11
  115.78.1.222
+115.78.10.78
  115.78.126.92
+115.78.131.164
  115.78.161.106
+115.78.225.232
  115.78.232.202
+115.78.238.164
+115.78.4.219
  115.78.9.145
  115.78.95.253
+115.78.96.99
  115.79.116.186
+115.79.137.56
+115.79.140.140
  115.79.195.246
+115.79.199.238
  115.79.208.56
  115.79.214.162
+115.79.219.195
  115.79.220.245
  115.79.220.47
  115.79.254.22
+115.79.35.110
+115.79.4.151
+115.79.54.34
+115.79.75.21
  115.79.80.195
+115.79.82.205
+115.79.86.127
  115.84.101.78
-115.84.114.165
+115.84.112.138
  115.84.117.222
  115.84.121.30
  115.84.178.112
  115.84.235.77
+115.84.91.211
+115.84.91.38
  115.84.92.149
  115.84.92.198
  115.84.92.214
+115.84.92.243
  115.84.92.51
+115.84.92.66
  115.84.96.40
+115.84.99.3
  115.85.43.170
+115.85.53.91
  115.85.65.94
  115.85.79.242
  115.85.83.197
  115.85.86.234
  115.85.86.235
  115.87.98.17
+115.87.99.103
  115.88.138.251
  115.88.240.91
  115.88.60.251
@@ -12199,19 +14372,22 @@
  115.94.207.99
  115.95.173.174
  115.96.135.5
+115.97.234.135
  115.97.248.20
  115.97.31.199
+115.97.64.40
  115.97.83.137
  115.98.0.71
-115.98.12.127
  115.98.71.54
  115.99.115.105
+115.99.14.202
  115.99.148.82
  115.99.191.95
  115.99.226.224
  11515-dot-phonic-obelisk-274214.uk.r.appspot.com
  1152crump.com
  115video.com
+116.0.1.138
  116.0.2.162
  116.0.23.217
  116.0.23.221
@@ -12219,10 +14395,14 @@
  116.0.54.30
  116.0.6.14
  116.1.149.196
+116.1.180.22
  116.100.121.12
  116.101.231.124
+116.102.173.194
  116.102.207.145
  116.102.246.157
+116.102.251.245
+116.103.131.197
  116.103.210.14
  116.103.242.236
  116.104.245.202
@@ -12232,9 +14412,13 @@
  116.105.212.78
  116.105.213.98
  116.105.215.251
+116.105.216.83
  116.105.218.106
  116.105.218.253
+116.105.22.197
+116.105.220.206
  116.105.223.90
+116.105.40.71
  116.106.16.127
  116.106.16.132
  116.106.17.41
@@ -12243,6 +14427,10 @@
  116.106.18.91
  116.106.19.152
  116.106.19.247
+116.106.38.67
+116.106.48.210
+116.108.12.204
+116.109.110.147
  116.110.100.208
  116.110.114.81
  116.110.144.68
@@ -12250,7 +14438,6 @@
  116.110.19.34
  116.110.208.254
  116.110.208.64
-116.110.24.52
  116.110.28.205
  116.110.29.134
  116.110.4.247
@@ -12259,11 +14446,13 @@
  116.110.75.17
  116.110.77.211
  116.110.8.121
-116.110.82.53
  116.110.85.113
  116.110.93.52
  116.110.94.236
+116.111.219.152
  116.112.30.108
+116.112.92.5
+116.113.17.210
  116.113.180.183
  116.113.182.206
  116.114.19.204
@@ -12322,7 +14511,11 @@
  116.116.109.84
  116.116fddw.top
  116.12.180.236
+116.12.194.243
  116.12.50.133
+116.12.51.206
+116.12.52.141
+116.12.52.79
  116.120.108.26
  116.121.119.103
  116.122.158.207
@@ -12338,8 +14531,16 @@
  116.127.121.116
  116.127.121.39
  116.131.212.180
+116.132.221.30
+116.132.47.50
+116.138.146.91
  116.139.151.134
+116.14.148.129
+116.14.46.58
+116.14.5.223
  116.14.61.160
+116.14.68.85
+116.149.118.222
  116.149.119.209
  116.149.169.119
  116.149.195.56bin.sh
@@ -12351,8 +14552,10 @@
  116.149.243.161
  116.149.247.125
  116.149.247.146
+116.15.150.144
+116.15.189.70
+116.15.5.204
  116.154.20.15
-116.162.54.95
  116.177.178.206
  116.177.179.202
  116.177.179.85
@@ -12362,21 +14565,35 @@
  116.179.139.131
  116.179.139.142
  116.179.149.121
+116.179.32.153
+116.179.32.204
+116.179.32.232
+116.179.32.31
+116.179.32.36
+116.179.32.41
+116.179.32.46
+116.179.32.79
+116.179.32.96
  116.193.142.224
  116.193.172.237
  116.193.216.209
  116.193.218.18
+116.193.76.112
+116.196.101.168
  116.196.119.146
  116.196.69.144
+116.196.82.45
  116.196.85.150
  116.196.85.166
  116.196.86.28
  116.196.90.254
  116.196.94.108
+116.196.95.239
  116.197.131.18
  116.197.133.146
  116.197.134.146
  116.198.162.103
+116.198.162.181
  116.198.162.65
  116.199.168.1
  116.199.169.1
@@ -12386,6 +14603,7 @@
  116.199.172.213
  116.199.172.29
  116.199.174.1
+116.2.166.6
  116.2.40.134
  116.2.64.96
  116.202.0.237
@@ -12419,6 +14637,7 @@
  116.203.117.76
  116.203.128.117
  116.203.143.6
+116.203.144.63
  116.203.147.190
  116.203.147.199
  116.203.151.175
@@ -12444,6 +14663,7 @@
  116.203.75.230
  116.203.9.247
  116.203.92.131
+116.206.151.6
  116.206.177.50
  116.206.233.10
  116.206.233.130
@@ -12460,6 +14680,7 @@
  116.206.61.33
  116.206.94.73
  116.21.12.99
+116.21.244.30
  116.212.131.174
  116.212.152.30
  116.212.155.227
@@ -12467,24 +14688,45 @@
  116.213.52.200
  116.213.52.252
  116.213.52.253
+116.22.28.123
+116.22.29.39
+116.22.49.159
+116.22.49.39
+116.22.51.76
+116.22.75.89
+116.226.171.78
+116.228.114.182
  116.228.196.210
+116.228.233.91
+116.228.37.90
+116.228.53.227
  116.231.35.17
  116.232.151.47
+116.232.31.11
  116.232.81.158
+116.233.111.157
  116.233.21.177
  116.233.87.190
  116.234.93.136
+116.236.243.130
+116.236.55.10
  116.236.60.114
  116.236.74.78
  116.236.91.34
+116.237.116.205
  116.237.139.23
  116.237.143.152
  116.237.158.150
  116.238.33.160
  116.239.27.145
  116.239.4.130
+116.24.56.41
+116.24.58.130
+116.24.65.88
+116.24.66.70
  116.240.199.84
-116.25.250.114
+116.246.19.2
+116.247.81.99
  116.251.12.150
  116.251.211.12
  116.252.80.181
@@ -12494,16 +14736,25 @@
  116.255.129.3
  116.255.163.100
  116.255.175.72
+116.255.207.231
+116.255.213.176
  116.255.216.34
  116.255.241.7
  116.26.113.138
  116.26.114.6
+116.26.229.35
  116.26.73.42
-116.30.198.253
+116.27.149.212
+116.43.244.112
  116.48.136.128
  116.49.242.133
+116.52.1.211
+116.52.144.172
  116.52.9.220
  116.52.98.50
+116.54.31.118
+116.55.19.46
+116.55.245.26
  116.58.171.67
  116.58.224.56
  116.58.227.40
@@ -12537,15 +14788,27 @@
  116.58.43.35
  116.58.78.254
  116.58.9.10
+116.59.25.190
+116.59.25.192
+116.59.25.196
+116.59.25.200
+116.59.25.201
  116.6.107.172
+116.6.18.115
+116.6.192.200
+116.6.84.60
  116.62.11.138
+116.62.133.112
  116.62.229.19
+116.62.58.18
  116.66.191.161
  116.66.191.217
  116.66.197.148
  116.66.197.210
  116.66.207.53
+116.68.157.112
  116.68.160.114
+116.68.161.130
  116.68.162.105
  116.68.162.86
  116.68.162.99
@@ -12576,35 +14839,46 @@
  116.68.99.163
  116.68.99.218
  116.68.99.82
-116.7.11.240
  116.71.243.172
  116.72.0.99
+116.72.133.129
  116.72.242.182
+116.73.171.137
  116.73.4.196
  116.73.66.179
  116.74.112.79
  116.74.17.255
+116.74.178.167
  116.74.223.188
  116.74.51.122
  116.75.103.58
  116.75.117.40bin.sh
-116.75.164.85
  116.75.34.61
  116.76.240.151
+116.85.13.82
  116.85.26.21
+116.85.38.29
+116.85.41.190
+116.85.46.54
+116.85.66.176
  116.85.71.133
+116.86.166.199
  116.89.17.246
  116.89.71.215
  116.90.118.1
  116.90.122.234
  116.90.165.26
  116.90.229.186
+116.90.238.251
  116.90.59.223
  116.91.189.208
  116.91.240.96
  116.92.213.114
+116.92.219.162
  116.94.131.109
+116.97.163.69
  116.97.215.102
+116.97.53.76
  116.97.71.249
  116.98.122.120
  116.98.160.226
@@ -12614,16 +14888,15 @@
  116.98.163.129
  116.98.169.236
  116.98.171.61
-116.98.171.96
  116.98.174.124
  116.98.175.252
  116151147136715.002.sh.cn
  1164e4989ededf518a4.yolasite.com
  1169732-dot-phonic-obelisk-274214.uk.r.appspot.com
+117.0.187.150
  117.0.23.142
  117.1.153.251
  117.1.16.131
-117.10.191.52
  117.102.102.155
  117.102.104.44
  117.102.107.154
@@ -12637,6 +14910,7 @@
  117.102.127.130
  117.102.16.22
  117.102.224.38
+117.102.70.3
  117.102.77.2
  117.102.77.204
  117.102.82.42
@@ -12652,50 +14926,82 @@
  117.103.86.62
  117.104.181.164
  117.107.193.98
+117.107.213.244
+117.107.213.246
  117.107.213.251
+117.11.228.132
+117.114.138.246
+117.119.83.121
  117.12.52.164
  117.12.67.73
  117.120.7.93
  117.121.202.44
  117.121.204.80
+117.121.215.101
  117.123.171.105
  117.123.58.217
  117.127.16.205
  117.127.16.207
  117.127.16.208
+117.131.199.237
+117.131.43.194
+117.131.43.195
  117.131.43.196
+117.131.43.197
+117.131.43.198
  117.132.193.106
  117.135.251.235
+117.139.166.27
  117.14.20.21
  117.14.20.221
  117.14.21.88
-117.14.222.128
  117.141.155.241
  117.141.253.80
  117.141.6.222
+117.144.189.69
+117.146.48.172
  117.149.10.58
  117.149.20.18
  117.155.115.90
+117.156.119.39
  117.157.24.3
  117.158.107.107
+117.158.151.7
+117.158.198.130
  117.158.208.68
+117.158.62.70
  117.158.65.219
+117.158.87.112
  117.160.141.43
  117.169.1.47
  117.169.16.206
+117.172.253.135
  117.172.79.4
+117.173.67.119
  117.176.195.87
  117.18.4.157
  117.18.5.133
+117.18.65.22
+117.184.169.94
+117.186.244.210
  117.186.247.34
-117.192.226.173
+117.186.96.54
+117.192.116.161
+117.192.227.62
+117.192.36.105
+117.192.46.40
+117.192.51.63
  117.192.8.86
+117.193.162.210
  117.193.77.254
-117.194.160.208
-117.194.161.189
-117.194.162.165
+117.194.148.240
+117.194.149.168
+117.194.159.186
+117.194.161.17
+117.194.165.43
  117.194.181.157
  117.195.240.9
+117.196.138.61
  117.196.228.229
  117.196.229.176
  117.196.234.163
@@ -12706,12 +15012,13 @@
  117.196.239.128
  117.196.239.165
  117.196.50.168
-117.196.51.83
+117.196.9.86
  117.197.102.195
  117.197.118.141
  117.197.119.73
  117.197.126.130
  117.197.127.98
+117.197.209.108
  117.197.40.192
  117.197.41.207
  117.197.42.233
@@ -12724,8 +15031,10 @@
  117.2.133.106
  117.2.139.117
  117.2.142.64
+117.2.144.249
  117.2.165.12
  117.2.165.159
+117.2.22.85
  117.2.92.195
  117.20.192.45
  117.20.202.61
@@ -12734,12 +15043,17 @@
  117.20.56.203
  117.200.48.82
  117.200.48.94
+117.200.73.79
+117.201.226.45
  117.201.228.221
  117.202.20.66
  117.202.20.68
  117.202.20.70
-117.202.69.191
-117.202.70.146
+117.202.64.38
+117.202.68.103
+117.202.71.236
+117.202.8.55
+117.204.252.122
  117.204.252.223
  117.204.253.150
  117.204.253.240
@@ -12748,48 +15062,73 @@
  117.204.255.73
  117.205.13.189
  117.206.149.225
+117.206.152.182
  117.206.155.158
  117.206.155.82
  117.206.159.20
  117.206.83.142
-117.208.135.101
-117.208.135.78
-117.210.144.169
+117.207.149.225
+117.208.1.225
+117.208.1.31
+117.208.120.89
  117.210.144.80
+117.210.181.85
  117.210.209.147
  117.210.210.199
  117.211.126.11
  117.211.126.13
  117.211.147.57
+117.211.160.32
  117.211.166.168
+117.211.192.70
  117.212.146.114
  117.212.89.125
+117.213.114.180
  117.213.119.103
  117.213.240.156
-117.213.43.146
-117.213.45.137
-117.213.47.116
+117.213.40.248
+117.213.41.28
+117.213.45.105
+117.213.45.146
+117.213.47.154
  117.214.123.217
+117.214.4.217
+117.215.136.149
+117.215.209.54
  117.215.224.138
+117.215.249.242
  117.215.71.67
+117.217.171.246
  117.217.69.3
  117.218.245.194
+117.22.144.21
+117.22.76.92
+117.22.77.229
+117.220.15.119
  117.220.171.105
  117.220.171.209
  117.220.171.246
+117.220.203.36
  117.220.220.112
-117.222.161.87
-117.222.167.138
-117.222.167.73
-117.222.168.109
-117.222.172.112
-117.222.172.219
+117.222.161.188
+117.222.161.245
+117.222.162.216
+117.222.164.105
+117.222.164.226
+117.222.166.127
+117.222.166.172
+117.222.168.58
+117.222.170.52
  117.222.61.200
  117.222.62.222
+117.223.25.51
  117.232.113.131
  117.232.127.51
  117.232.96.204
  117.239.153.219
+117.239.209.24
+117.239.226.81
+117.239.226.85
  117.239.240.202
  117.239.39.51
  117.239.79.246
@@ -12797,8 +15136,9 @@
  117.240.238.230
  117.240.28.81
  117.240.59.115
+117.241.170.49
  117.241.248.188
-117.241.64.115
+117.241.65.104
  117.241.67.241
  117.241.98.1
  117.242.147.101
@@ -12810,26 +15150,35 @@
  117.242.188.82
  117.242.188.84
  117.242.188.86
+117.242.208.198
+117.242.208.204
+117.242.209.128
  117.242.210.154
+117.242.211.82
  117.242.36.173
  117.242.38.163
  117.242.39.208
  117.247.179.136
-117.247.202.89
  117.247.203.214
-117.247.206.127
-117.247.207.89
+117.247.205.40
+117.247.206.241
+117.247.207.134
+117.247.211.73
+117.247.236.51
+117.247.238.10
  117.247.86.58
  117.248.162.157
  117.248.248.19
-117.248.62.64
+117.248.62.101
  117.25.145.151
  117.25.154.164
-117.251.62.17
-117.251.63.183
+117.251.200.50
+117.251.56.44
+117.251.59.32
  117.252.16.12
  117.252.208.13
  117.252.209.32
+117.252.210.254
  117.252.212.166
  117.252.212.253
  117.252.214.154
@@ -12850,49 +15199,109 @@
  117.252.67.128
  117.252.68.92
  117.252.71.200
+117.253.140.107
  117.253.175.52
  117.253.232.181
+117.254.186.98
  117.254.56.62
  117.254.57.106
  117.254.59.40
  117.255.220.201
  117.26.105.26
+117.26.110.59
  117.26.179.26
  117.26.241.93
  117.26.88.25
-117.26.89.18
+117.26.88.38
  117.27.139.39
  117.27.147.135
+117.28.157.207
+117.28.251.178
  117.28.254.143
  117.3.100.178
+117.3.151.156
+117.3.170.243
+117.33.225.111
+117.33.6.67
+117.34.105.233
  117.34.109.218
  117.34.117.155
+117.34.99.31
+117.35.109.122
  117.35.118.42
  117.4.107.199
  117.4.113.14
+117.4.115.212
+117.4.122.171
  117.4.136.11
  117.4.139.62
  117.4.145.16
+117.4.165.21
+117.4.176.180
  117.4.241.135
+117.4.243.116
  117.40.159.249
+117.40.195.2
  117.40.91.118
  117.41.38.18
  117.42.141.192
+117.44.60.39
+117.48.234.141
+117.5.136.42
  117.5.136.85
-117.5.153.73
+117.5.146.140
+117.5.147.174
+117.5.160.239
  117.50.1.141
+117.50.110.19
+117.50.118.171
+117.50.119.185
+117.50.119.23
  117.50.137.13
+117.50.14.153
+117.50.16.63
+117.50.17.36
+117.50.20.103
+117.50.20.77
  117.50.20.89
+117.50.21.215
+117.50.24.202
+117.50.24.72
+117.50.25.109
+117.50.25.153
  117.50.3.175
+117.50.31.176
  117.50.34.131
+117.50.36.137
  117.50.36.250
  117.50.42.55
+117.50.43.204
+117.50.45.241
+117.50.49.57
  117.50.55.132
+117.50.60.36
  117.50.63.120
+117.50.64.141
  117.50.64.208
+117.50.64.24
+117.50.65.112
+117.50.65.22
  117.50.65.238
  117.50.82.6
+117.50.88.9
+117.50.92.209
+117.50.92.35
+117.50.97.244
+117.50.98.209
+117.51.137.82
+117.51.140.220
+117.51.140.252
+117.51.142.47
+117.51.150.202
+117.51.157.210
+117.51.158.223
  117.52.91.248
+117.52.96.99
  117.53.45.125
  117.54.112.22
  117.54.12.99
@@ -12908,14 +15317,22 @@
  117.55.209.126
  117.55.232.193
  117.55.241.179
+117.55.241.61
  117.58.240.177
  117.58.245.114
  117.58.245.66
  117.58.247.20
  117.6.128.250
+117.6.132.1
  117.6.161.118
+117.6.165.250
+117.6.196.195
+117.6.241.62
  117.6.79.105
+117.6.86.134
+117.6.99.108
  117.60.152.62
+117.60.187.94
  117.60.20.136
  117.60.204.195
  117.60.239.70
@@ -12923,7 +15340,9 @@
  117.60.8.16
  117.60.8.52
  117.60.8.70
+117.61.16.195
  117.62.89.163
+117.63.136.142
  117.63.156.234
  117.63.158.101
  117.63.159.220
@@ -12932,10 +15351,25 @@
  117.63.195.220
  117.63.223.200
  117.63.242.60
+117.63.250.181
+117.63.251.110
+117.63.252.68
+117.63.252.7
+117.63.252.77
+117.63.253.215
+117.63.254.87
+117.63.255.109
  117.63.51.128
+117.64.225.57
+117.65.1.114
+117.65.1.118
+117.68.195.185
+117.69.188.203
  117.69.231.125
  117.69.231.151
+117.7.221.82
  117.7.236.110
+117.7.52.55
  117.74.120.224
  117.74.121.65
  117.74.122.114
@@ -12943,13 +15377,36 @@
  117.74.45.247
  117.74.98.18
  117.76.1.113
+117.79.132.166
  117.79.80.90
  117.79.80.93
  117.79.80.94
+117.80.116.213
+117.80.147.217
+117.80.167.20
+117.80.176.77
+117.80.212.113
+117.80.224.192
+117.80.225.245
  117.80.3.170
+117.81.139.73
+117.81.151.16
+117.81.151.44
+117.81.207.141
  117.81.242.138
+117.81.64.52
+117.82.37.234
+117.82.37.38
+117.83.122.37
+117.83.81.126
+117.83.81.145
+117.83.81.28
+117.84.114.39
  117.84.146.251
  117.84.173.184
+117.84.59.64
+117.84.90.41
+117.84.91.126
  117.85.89.213
  117.86.212.189
  117.86.24.209
@@ -12978,15 +15435,18 @@
  117.87.72.142
  117.88.151.152
  117.88.173.4
+117.89.131.169
  117.89.90.62
  117.90.119.186
  117.90.119.63
  117.90.128.14
  117.90.162.203
  117.90.169.120
+117.90.2.41
  117.90.20.196
  117.90.21.59
  117.90.254.53
+117.90.4.102
  117.90.75.236
  117.90.89.195
  117.90.89.95
@@ -13008,6 +15468,7 @@
  117.94.50.123
  117.95.132.49
  117.95.160.220
+117.95.168.211
  117.95.173.102
  117.95.173.117
  117.95.173.64
@@ -13026,29 +15487,60 @@
  117.95.233.139
  117.95.32.19
  117.95.83.122
+117.96.200.193
+117.98.191.34
+117.99.81.32
  117.ip-51-178-82.eu
  11716-45741.ws4.pph-server.de
  1171j.projectsbit.org
  1177857-dot-n-e-w-me-ss-age-po-rt-al.wl.r.appspot.com
  117cbf81fba6f4aaa4363ed99db7fce674427f2d.info
+118.100.134.71
+118.100.134.8
+118.101.125.64
+118.101.192.62
  118.101.192.81
  118.102.168.199
+118.103.253.35
  118.107.12.23
  118.107.14.227
  118.107.14.243
  118.107.14.5
  118.107.162.36
+118.11.74.41
  118.110.236.121
+118.113.87.89
  118.113.95.60
  118.114.164.246
+118.116.107.247
+118.116.108.29
+118.116.108.48
+118.116.8.215
  118.120.145.eliterv.ca
+118.121.57.64
  118.121.61.158
+118.121.62.53
  118.122.118.189
+118.122.38.61
+118.122.73.137
  118.122.77.22
+118.123.11.175
+118.123.244.100
  118.123.246.101
+118.123.6.216
+118.125.106.12
+118.126.100.131
  118.126.105.207
+118.126.109.155
+118.126.116.101
+118.126.117.168
  118.126.65.74
+118.126.82.220
+118.126.90.104
+118.126.90.89
  118.126.97.108
+118.126.97.184
+118.126.98.159
  118.127.34.29
  118.128.29.139
  118.129.166.10
@@ -13063,11 +15555,15 @@
  118.140.142.50
  118.140.150.74
  118.140.151.98
+118.140.205.198
+118.140.252.230
  118.140.38.6
  118.144.155.104
  118.144.248.30
  118.145.4.109
+118.145.8.50
  118.151.210.242
+118.156.88.132
  118.160.230.91
  118.160.84.81
  118.161.159.142
@@ -13079,9 +15575,11 @@
  118.163.40.56
  118.163.47.37
  118.163.65.59
+118.163.68.115
  118.163.74.160
  118.163.74.161
  118.163.80.67
+118.163.91.125
  118.163.91.247
  118.163.97.19
  118.168.10.58
@@ -13091,6 +15589,9 @@
  118.169.44.151
  118.169.87.95
  118.169.90.79
+118.17.46.169
+118.171.136.250
+118.171.139.9
  118.172.0.165
  118.172.124.116
  118.172.124.35
@@ -13099,6 +15600,7 @@
  118.172.145.103
  118.172.147.135
  118.172.159.223
+118.172.163.253
  118.172.17.189
  118.172.181.147
  118.172.185.158
@@ -13108,10 +15610,10 @@
  118.172.201.49
  118.172.201.5
  118.172.201.89
-118.172.207.75
  118.172.215.17
  118.172.217.42
  118.172.228.150
+118.172.239.110
  118.172.28.4
  118.172.41.120
  118.172.44.175
@@ -13127,6 +15629,9 @@
  118.172.74.253
  118.172.83.49
  118.172.97.120
+118.173.104.8
+118.173.111.20
+118.173.121.98
  118.173.135.116
  118.173.144.57
  118.173.145.3
@@ -13160,6 +15665,7 @@
  118.173.233.80
  118.173.235.129
  118.174.121.101
+118.174.130.5
  118.174.156.49
  118.174.162.5
  118.174.172.13
@@ -13201,11 +15707,13 @@
  118.174.234.21
  118.174.234.28
  118.174.234.83
+118.174.40.250
  118.174.46.144
  118.174.46.162
  118.174.47.182
  118.174.47.2
  118.174.54.219
+118.174.57.174
  118.174.57.81
  118.174.64.144
  118.174.65.137
@@ -13223,6 +15731,7 @@
  118.175.236.208
  118.175.242.68
  118.175.244.111
+118.175.30.205
  118.175.7.114
  118.175.90.26
  118.175.93.103
@@ -13240,12 +15749,17 @@
  118.176.238.219
  118.176.7.132
  118.178.143.209
+118.178.20.28
  118.179.102.210
+118.179.121.203
  118.179.168.190
  118.179.168.202
  118.179.200.131
  118.179.208.162
  118.179.55.190
+118.179.60.62
+118.180.48.4
+118.180.63.84
  118.181.226.166
  118.184.13.225
  118.184.13.228
@@ -13259,9 +15773,13 @@
  118.185.159.137
  118.185.38.153
  118.186.227.161
+118.188.20.229
  118.189.139.212
  118.189.187.219
+118.189.74.228
  118.19.126.68
+118.190.2.195
+118.190.204.209
  118.190.60.24
  118.193.151.250
  118.193.151.253
@@ -13277,16 +15795,27 @@
  118.193.241.118
  118.193.245.4
  118.193.32.11
+118.193.34.17
+118.193.34.198
+118.193.35.172
  118.193.35.182
  118.193.35.218
+118.193.37.96
  118.193.38.5
+118.193.39.3
  118.193.41.101
  118.193.41.84
+118.193.42.99
  118.193.45.149
+118.193.47.131
+118.193.58.125
+118.200.225.155
  118.200.233.232
  118.200.233.57
  118.200.237.7
+118.200.26.234
  118.200.41.3
+118.202.255.141
  118.208.221.92
  118.210.50.3
  118.211.92.137
@@ -13308,58 +15837,124 @@
  118.233.63.194
  118.233.63.194bin.sh
  118.233.65.93
+118.236.182.168
  118.24.1.9
+118.24.100.198
+118.24.101.196
+118.24.102.189
+118.24.104.38
+118.24.104.55
+118.24.106.210
+118.24.106.33
+118.24.107.179
  118.24.108.239
  118.24.109.221
  118.24.109.222
  118.24.114.205
  118.24.115.181
  118.24.115.74
+118.24.118.97
+118.24.119.36
  118.24.119.45
  118.24.12.102
+118.24.123.136
+118.24.123.34
+118.24.124.59
  118.24.125.81
  118.24.126.55
+118.24.128.112
+118.24.13.153
+118.24.134.15
+118.24.14.106
+118.24.140.195
  118.24.142.170
+118.24.149.248
  118.24.150.193
  118.24.150.71
+118.24.151.254
+118.24.156.184
  118.24.158.103
  118.24.158.42
  118.24.163.94
  118.24.17.24
  118.24.17.28
  118.24.175.151
+118.24.181.184
+118.24.19.10
+118.24.2.141
  118.24.2.83
+118.24.202.34
  118.24.208.24
+118.24.211.170
+118.24.212.114
+118.24.214.45
  118.24.219.30
+118.24.219.84
+118.24.22.5
  118.24.23.164
  118.24.231.93
+118.24.234.79
+118.24.236.121
+118.24.237.118
+118.24.24.54
+118.24.241.217
+118.24.243.39
+118.24.243.53
+118.24.246.251
+118.24.253.100
  118.24.255.210
  118.24.30.97
+118.24.36.247
  118.24.42.37
+118.24.48.15
  118.24.48.244
+118.24.5.125
+118.24.51.199
+118.24.53.35
  118.24.54.178
  118.24.58.155
+118.24.63.50
+118.24.7.98
+118.24.70.239
+118.24.70.248
  118.24.72.18
  118.24.72.92
+118.24.79.178
  118.24.80.229
+118.24.82.81
  118.24.83.41
+118.24.89.224
+118.24.90.64
  118.24.97.147
  118.241.9.15
  118.243.22.87
+118.243.222.122
  118.249.206.100
  118.249.56.206
  118.25.1.48
+118.25.103.195
+118.25.104.200
  118.25.108.136
  118.25.11.153
  118.25.11.8
  118.25.111.131
  118.25.12.187
  118.25.125.187
+118.25.129.131
+118.25.133.121
  118.25.133.220
  118.25.139.123
+118.25.141.195
  118.25.144.105
  118.25.144.49
+118.25.155.104
+118.25.182.118
+118.25.182.61
+118.25.184.174
+118.25.192.122
  118.25.195.237
+118.25.195.244
+118.25.196.31
  118.25.2.109
  118.25.2.60
  118.25.21.149
@@ -13369,34 +15964,63 @@
  118.25.221.16
  118.25.226.152
  118.25.23.208
+118.25.24.84
+118.25.25.106
+118.25.251.14
+118.25.251.4
  118.25.251.58
  118.25.26.75
+118.25.27.67
  118.25.3.65
  118.25.35.202
+118.25.39.110
+118.25.44.66
  118.25.47.17
  118.25.48.241
  118.25.49.119
+118.25.5.184
  118.25.53.252
+118.25.53.96
+118.25.57.174
  118.25.62.164
  118.25.62.49
+118.25.63.170
+118.25.65.163
+118.25.66.61
  118.25.69.157
+118.25.74.248
+118.25.79.235
+118.25.84.146
  118.25.91.168
  118.25.91.65
+118.25.96.246
  118.250.0.166
  118.250.49.91
  118.255.57.210
+118.26.165.41
+118.26.65.146
  118.27.1.40
  118.27.103.153
+118.27.109.218
+118.27.11.126
+118.27.110.122
  118.27.113.79
  118.27.14.194
  118.27.15.173
+118.27.19.96
  118.27.20.122
  118.27.20.138
  118.27.20.149
  118.27.21.150
+118.27.23.60
+118.27.25.231
  118.27.28.16
  118.27.31.50
+118.27.33.112
+118.27.35.131
+118.27.35.3
  118.27.39.94
+118.27.4.225
  118.27.6.78
  118.27.72.122
  118.27.72.200
@@ -13426,6 +16050,7 @@
  118.27.80.234
  118.27.9.23
  118.31.164.48
+118.31.187.234
  118.31.52.208
  118.31.78.74
  118.32.210.177
@@ -13433,53 +16058,84 @@
  118.32.230.127
  118.33.129.88
  118.33.239.181
+118.34.12.117
+118.34.27.146
+118.34.86.75
  118.36.49.27
  118.36.66.178
  118.36.66.178bin.sh
  118.37.63.239
+118.38.3.75
  118.38.86.76
  118.39.135.11
  118.39.165.115
+118.40.248.20
  118.42.125.246
  118.42.206.206
  118.42.233.90
  118.43.114.17
+118.44.163.171
  118.45.190.163
  118.45.190.167
  118.47.161.102
+118.5.218.189
  118.67.201.40
  118.67.216.94
  118.67.217.41
  118.67.249.115
  118.68.165.46
+118.68.231.250
  118.69.128.181
+118.69.161.67
+118.69.183.237
+118.69.186.170
+118.69.195.215
  118.69.224.237
+118.69.225.124
  118.69.226.194
  118.69.228.63
+118.69.233.138
  118.69.50.154
  118.69.56.68
  118.69.61.212
  118.69.63.217
  118.69.68.186
+118.69.82.233
+118.70.109.119
  118.70.109.152
  118.70.12.171
+118.70.128.136
  118.70.129.93
+118.70.151.157
+118.70.169.210
+118.70.170.120
+118.70.171.49
+118.70.176.200
+118.70.180.189
+118.70.183.188
+118.70.184.13
  118.70.196.124
+118.70.21.132
  118.70.213.14
  118.70.220.116
+118.70.233.163
  118.70.233.206
+118.70.72.103
+118.70.80.170
  118.70.81.207
  118.71.120.218
+118.71.169.180
  118.71.244.226
  118.71.253.20
  118.75.119.214
-118.75.141.104
  118.75.184.240
  118.75.190.221
+118.75.193.128
  118.75.46.196
  118.75.48.151
+118.75.60.124
+118.75.68.141
  118.76.143.108
-118.79.1.181
  118.79.145.69
  118.79.146.100
  118.79.146.190
@@ -13487,35 +16143,63 @@
  118.79.163.147
  118.79.163.206
  118.79.217.110
+118.79.220.45
  118.79.226.198
  118.79.236.32
  118.79.237.9
  118.79.238.200
-118.79.3.86
  118.79.4.250
  118.79.57.139
  118.79.58.128
  118.79.61.232
-118.79.62.247
  118.79.74.237
  118.79.75.183
  118.81.81.171
  118.83.154.64
+118.83.180.76
+118.89.106.11
  118.89.108.152
  118.89.108.37
+118.89.111.225
+118.89.111.49
  118.89.135.215
  118.89.138.117
+118.89.153.180
  118.89.153.32
+118.89.157.234
+118.89.160.141
+118.89.162.187
+118.89.163.105
+118.89.164.55
  118.89.167.33
+118.89.173.215
  118.89.19.73
  118.89.219.29
+118.89.228.58
+118.89.229.84
+118.89.230.32
+118.89.230.43
+118.89.231.121
+118.89.234.9
+118.89.237.20
+118.89.237.217
+118.89.239.113
  118.89.241.19
+118.89.241.214
+118.89.243.51
+118.89.245.202
  118.89.249.225
  118.89.250.93
+118.89.27.72
+118.89.30.90
  118.89.40.228
  118.89.47.205
  118.89.52.173
+118.89.61.51
  118.89.65.15
+118.89.66.102
+118.89.78.206
+118.89.91.134
  118.91.175.210
  118.91.228.30
  118.92.41.104
@@ -13535,9 +16219,12 @@
  118.97.192.173
  118.97.203.101
  118.97.204.93
+118.97.221.211
  118.97.224.2
+118.97.23.108
  118.97.235.234
  118.97.237.171
+118.97.247.186
  118.97.251.169
  118.97.30.42
  118.97.35.218
@@ -13548,16 +16235,23 @@
  118.97.95.182
  118.97.95.19
  118.98.104.21
+118.98.121.206
  118.98.218.11
  118.98.233.226
+118.98.90.22
  118.98.96.184
  118.99.100.108
  118.99.100.109
  118.99.103.131
+118.99.104.144
  118.99.104.15
+118.99.104.156
+118.99.104.158
+118.99.104.7
  118.99.108.60
  118.99.109.25
  118.99.109.94
+118.99.118.15
  118.99.122.11
  118.99.122.153
  118.99.122.221
@@ -13573,6 +16267,8 @@
  118.99.65.176
  118.99.65.182
  118.99.65.188
+118.99.67.186
+118.99.67.86
  118.99.83.32
  118.99.88.107
  118.99.90.130
@@ -13590,7 +16286,9 @@
  118921-dot-n-e-w-me-ss-age-po-rt-al.wl.r.appspot.com
  118fk.net
  119-18-62-120.cprapid.com
+119.1.209.98
  119.10.114.137
+119.10.116.177
  119.10.177.2
  119.10.177.5
  119.10.177.90
@@ -13605,48 +16303,81 @@
  119.110.204.62
  119.110.205.66
  119.110.96.195
+119.113.255.245
+119.115.0.6
+119.115.1.235
  119.115.128.2
-119.119.35.41
+119.115.18.175
+119.115.18.195
+119.115.20.161
+119.115.21.204
+119.115.25.159
+119.115.26.162
+119.115.28.243
+119.115.30.174
+119.115.30.22
+119.115.4.68
+119.115.5.75
+119.117.25.41
+119.117.29.11
  119.121.6.127
  119.122.113.100
  119.123.0.184
-119.123.127.65
-119.123.173.203
-119.123.175.171
+119.123.102.194
+119.123.127.30
  119.123.175.179
-119.123.177.232
+119.123.176.129
  119.123.209.184
-119.123.218.29
+119.123.216.96
+119.123.217.207
+119.123.217.248
+119.123.219.176
+119.123.227.151
+119.123.238.177
+119.123.238.233
  119.123.244.77
  119.125.129.86
  119.126.157.231
  119.126.157.5
+119.130.165.143
  119.135.101.13
-119.136.90.198
+119.136.112.51
  119.146.131.247
+119.146.223.48
  119.147.137.79
  119.147.184.22
+119.147.42.82
  119.147.71.174
  119.148.36.141
+119.149.136.46
  119.15.82.17
  119.15.86.109
  119.15.89.106
  119.15.93.38
  119.15.95.158
+119.153.45.167
+119.155.138.229
+119.155.239.45
+119.155.53.38
+119.157.241.23
  119.159.150.176
  119.160.172.201
  119.160.218.110
+119.160.66.31
  119.161.137.20
  119.162.166.253
  119.162.207.34
  119.162.65.162
  119.162.65.247
+119.163.196.146
  119.163.228.106
  119.163.94.12
+119.164.171.216
  119.164.64.189
  119.164.89.226
  119.165.107.65
  119.165.135.100
+119.165.15.15
  119.165.165.210
  119.165.201.170
  119.165.226.221
@@ -13660,18 +16391,19 @@
  119.166.164.51
  119.166.169.115
  119.166.170.241
+119.166.19.254
  119.166.196.21
  119.166.226.110
  119.166.247.214bin.sh
  119.166.39.54
  119.166.79.167
  119.166.89.127
+119.167.111.174
  119.167.153.189
  119.167.18.7
  119.167.2.49
  119.167.21.135
  119.167.26.225
-119.167.31.184
  119.167.31.210
  119.167.41.123
  119.167.44.96
@@ -13681,17 +16413,25 @@
  119.176.202.206
  119.176.95.121
  119.178.144.102
-119.178.149.10
  119.178.155.49
  119.178.178.79
+119.178.202.229
+119.178.222.235
+119.178.223.40
  119.178.240.159
  119.178.246.244
  119.179.119.79
  119.179.150.233
+119.179.153.191
+119.179.155.190
  119.179.165.18
  119.179.170.212
  119.179.18.206
+119.179.208.163
  119.179.223.116
+119.179.240.167
+119.179.240.9
+119.179.247.96
  119.18.146.139
  119.18.147.125
  119.18.147.81
@@ -13699,6 +16439,7 @@
  119.18.149.58
  119.18.152.138
  119.18.152.140
+119.18.153.138
  119.18.153.154
  119.18.153.208
  119.18.153.242
@@ -13717,35 +16458,47 @@
  119.18.159.238
  119.18.159.34
  119.18.159.6
+119.18.194.168
+119.18.2.55
  119.18.34.97
  119.18.38.176
+119.18.52.177
  119.180.108.79
  119.180.134.107
  119.180.204.103
  119.180.241.61
  119.180.32.217
  119.180.5.228
+119.180.54.118
  119.180.57.115
+119.181.53.224
  119.181.54.70
  119.182.60.251
  119.182.67.204
+119.182.69.58
+119.183.103.185
  119.183.123.28
  119.183.14.177
  119.183.18.102
  119.183.46.127
  119.183.47.246
  119.183.47.246bin.sh
+119.183.5.48
  119.183.54.121
  119.183.7.242
  119.184.14.112
  119.184.154.129
+119.184.4.122
  119.184.48.147bin.sh
  119.184.53.56
  119.185.149.74
  119.185.153.86
  119.185.155.1
  119.185.34.47
+119.186.12.78
  119.186.15.123
+119.186.226.183
+119.186.46.241
  119.187.105.177
  119.187.105.31
  119.187.129.48
@@ -13757,10 +16510,13 @@
  119.187.236.84
  119.187.239.228
  119.187.29.196
-119.187.58.10
  119.187.63.132
+119.187.74.180
  119.187.77.195
+119.188.241.186
+119.188.3.66
  119.189.129.35
+119.189.167.145
  119.189.181.172
  119.189.199.222
  119.189.201.50bin.sh
@@ -13771,6 +16527,7 @@
  119.190.144.131
  119.190.155.134
  119.190.180.197
+119.190.191.46
  119.190.204.189
  119.190.216.70
  119.190.240.25
@@ -13785,6 +16542,7 @@
  119.191.206.251
  119.191.207.68
  119.191.229.239
+119.192.141.109
  119.193.152.87
  119.193.33.206
  119.194.214.43
@@ -13795,6 +16553,7 @@
  119.195.9.174
  119.195.9.174bin.sh
  119.196.115.20
+119.196.148.156
  119.196.216.112
  119.196.216.112bin.sh
  119.196.245.62
@@ -13808,6 +16567,9 @@
  119.198.87.162
  119.199.155.17bin.sh
  119.199.156.76
+119.199.226.45
+119.2.43.45
+119.2.51.138
  119.2.51.150
  119.2.53.201
  119.2.54.204
@@ -13818,10 +16580,13 @@
  119.2.7.98
  119.2.88.37
  119.2.9.129
+119.200.186.168
  119.200.30.137
  119.200.33.222
+119.200.73.32
  119.201.68.12
  119.202.76.160
+119.204.96.131
  119.205.95.101
  119.206.255.171
  119.206.62.129
@@ -13837,22 +16602,27 @@
  119.23.238.165
  119.23.31.104
  119.23.33.89
+119.235.19.66
+119.235.249.168
  119.235.27.130
  119.235.27.46
  119.235.30.89
  119.235.48.177
  119.235.48.34
+119.235.49.61
  119.235.49.81
  119.235.50.26
  119.235.50.8
  119.235.51.241
  119.235.54.45
  119.237.6.135
+119.242.92.124
  119.243.95.62
  119.245.138.143
  119.246.154.102
  119.246.156.63
  119.246.39.250
+119.247.161.177
  119.249.16.203
  119.249.17.101
  119.250.239.244
@@ -13860,26 +16630,41 @@
  119.251.177.128
  119.252.143.6
  119.252.169.173
+119.254.155.187
+119.254.155.39
  119.254.84.87
  119.27.160.85
+119.27.165.49
+119.27.166.193
  119.27.167.61
  119.27.172.62
+119.27.173.25
  119.27.174.181
  119.27.179.51
+119.27.185.241
  119.27.189.190
+119.27.189.46
  119.27.189.65
  119.27.190.106
  119.27.191.172
  119.28.100.102
  119.28.110.113
+119.28.110.122
  119.28.113.246
+119.28.128.121
+119.28.128.79
+119.28.132.211
  119.28.136.26
  119.28.137.106
  119.28.140.134
  119.28.140.54
  119.28.151.166
+119.28.151.212
+119.28.152.242
+119.28.156.31
  119.28.159.34
  119.28.16.131
+119.28.160.192
  119.28.163.72
  119.28.164.144
  119.28.164.149
@@ -13888,6 +16673,7 @@
  119.28.179.179
  119.28.187.227
  119.28.19.134
+119.28.19.167
  119.28.194.66
  119.28.2.123
  119.28.20.98
@@ -13896,87 +16682,153 @@
  119.28.222.106
  119.28.224.121
  119.28.225.211
+119.28.23.62
  119.28.235.221
+119.28.235.68
+119.28.238.101
  119.28.239.30
  119.28.26.57
+119.28.27.176
  119.28.30.211
+119.28.30.97
+119.28.32.60
  119.28.4.87
  119.28.44.92
+119.28.46.187
+119.28.47.109
  119.28.49.192
  119.28.5.109
  119.28.5.17
  119.28.5.66
  119.28.5.69
+119.28.51.32
  119.28.54.131
  119.28.55.223
  119.28.55.239
  119.28.55.81
  119.28.60.105
  119.28.61.162
+119.28.61.72
+119.28.65.231
  119.28.7.224
+119.28.71.231
+119.28.72.244
  119.28.72.63
  119.28.74.113
  119.28.74.233
+119.28.75.193
  119.28.75.244
  119.28.77.175
+119.28.83.164
  119.28.83.34
+119.28.89.228
  119.28.9.138
  119.28.9.76
+119.28.90.103
+119.28.91.154
  119.28.92.185
+119.28.92.69
+119.28.92.70
  119.28.93.152
+119.29.0.60
  119.29.1.141
+119.29.1.163
+119.29.102.152
+119.29.11.213
+119.29.110.249
+119.29.111.220
  119.29.113.233
  119.29.115.153
+119.29.116.2
  119.29.119.151
+119.29.121.229
  119.29.128.126
+119.29.13.177
+119.29.138.90
  119.29.142.34
  119.29.143.201
+119.29.143.78
+119.29.144.4
  119.29.146.13
+119.29.151.107
  119.29.155.214
  119.29.158.241
  119.29.16.190
+119.29.160.205
  119.29.161.236
  119.29.163.13
  119.29.166.249
+119.29.167.254
  119.29.168.187
+119.29.17.204
+119.29.170.235
  119.29.171.249
+119.29.173.247
+119.29.174.91
+119.29.177.222
  119.29.18.39
  119.29.18.76
+119.29.180.74
+119.29.182.185
+119.29.183.138
  119.29.184.119
  119.29.184.149
  119.29.184.55
  119.29.19.82
+119.29.191.187
+119.29.191.217
+119.29.195.187
  119.29.195.232
+119.29.197.210
  119.29.198.127
+119.29.199.247
+119.29.2.157
  119.29.216.238
  119.29.22.68
+119.29.23.193
  119.29.231.121
+119.29.237.201
  119.29.242.180
  119.29.245.130
+119.29.246.210
  119.29.247.187
+119.29.27.212
+119.29.3.45
  119.29.33.131
+119.29.34.253
+119.29.35.116
  119.29.36.75
  119.29.38.205
  119.29.38.92
+119.29.53.168
  119.29.54.159
+119.29.55.24
  119.29.56.84
  119.29.60.52
  119.29.62.131
  119.29.62.253
  119.29.63.216
  119.29.66.123
+119.29.70.143
  119.29.72.153
+119.29.73.218
  119.29.73.73
  119.29.74.28
  119.29.79.30
  119.29.83.12
+119.29.83.177
  119.29.85.229
+119.29.87.251
+119.29.91.153
  119.29.91.228
+119.29.91.38
  119.29.93.25
+119.29.98.53
  119.3.203.174
  119.3.208.236
  119.3.237.67
  119.39.54.6
+119.4.225.31
  119.4.229.15
  119.40.37.126
  119.40.82.185
@@ -13985,7 +16837,10 @@
  119.40.83.250
  119.40.92.17
  119.41.170.248
+119.41.196.204
+119.41.202.123
  119.41.236.180
+119.41.236.32
  119.42.115.64
  119.42.121.111
  119.42.121.134
@@ -14053,6 +16908,7 @@
  119.42.70.6
  119.42.70.61
  119.42.72.251
+119.42.73.16
  119.42.73.78
  119.42.79.139
  119.42.80.120
@@ -14072,64 +16928,148 @@
  119.42.95.106
  119.42.96.43
  119.42.99.125
+119.45.0.80
+119.45.10.225
+119.45.10.4
+119.45.10.5
+119.45.100.42
+119.45.105.184
+119.45.112.28
+119.45.114.133
+119.45.116.10
+119.45.117.145
  119.45.12.105
+119.45.12.219
+119.45.120.121
+119.45.122.102
  119.45.123.92
  119.45.126.213
+119.45.129.210
  119.45.13.194
+119.45.130.71
+119.45.131.232
  119.45.134.38
  119.45.137.244
+119.45.137.52
  119.45.138.160
  119.45.139.59
+119.45.140.59
  119.45.140.92
+119.45.141.115
  119.45.142.15
  119.45.142.38
+119.45.143.108
  119.45.144.250
  119.45.145.184
  119.45.148.171
+119.45.149.173
  119.45.15.27
+119.45.154.156
  119.45.156.93
  119.45.157.238
  119.45.159.172
  119.45.159.220
  119.45.16.85
  119.45.160.126
+119.45.162.248
+119.45.163.65
  119.45.164.83
+119.45.171.183
  119.45.173.117
  119.45.175.143
+119.45.176.133
+119.45.177.202
+119.45.177.219
+119.45.178.112
  119.45.178.210
+119.45.181.168
+119.45.183.194
+119.45.183.209
+119.45.184.182
+119.45.185.224
+119.45.186.155
  119.45.186.186
+119.45.186.49
  119.45.187.183
  119.45.187.6
+119.45.188.40
+119.45.189.220
  119.45.19.141
+119.45.19.201
  119.45.190.225
+119.45.191.168
+119.45.192.106
  119.45.193.252
+119.45.193.27
+119.45.193.78
+119.45.193.82
+119.45.194.126
+119.45.194.246
  119.45.194.63
  119.45.195.117
  119.45.195.57
  119.45.199.177
  119.45.199.200
+119.45.202.43
+119.45.203.170
  119.45.206.237
  119.45.206.254
+119.45.207.191
+119.45.208.191
+119.45.208.92
+119.45.209.222
+119.45.212.145
  119.45.213.242
  119.45.213.69
  119.45.214.43
+119.45.214.46
  119.45.215.155
+119.45.218.145
+119.45.218.253
  119.45.219.139
+119.45.219.203
  119.45.22.71
  119.45.220.5
+119.45.221.79
+119.45.222.118
+119.45.222.246
+119.45.222.252
+119.45.223.241
+119.45.223.42
  119.45.226.71
  119.45.229.79
+119.45.231.207
  119.45.231.71
  119.45.233.138
+119.45.234.100
+119.45.234.112
+119.45.235.14
+119.45.236.239
+119.45.236.83
+119.45.239.10
+119.45.239.252
  119.45.239.67
+119.45.239.75
+119.45.240.155
  119.45.242.149
+119.45.242.37
+119.45.243.232
  119.45.243.54
+119.45.243.74
+119.45.246.214
+119.45.246.61
  119.45.248.137
+119.45.250.197
  119.45.250.223
  119.45.252.106
  119.45.254.116
+119.45.254.159
  119.45.31.199
+119.45.32.110
+119.45.33.159
  119.45.33.183
+119.45.33.80
+119.45.34.52
  119.45.35.218
  119.45.36.123
  119.45.36.221
@@ -14138,19 +17078,39 @@
  119.45.4.37
  119.45.41.248
  119.45.42.241
+119.45.43.139
+119.45.43.61
+119.45.43.86
+119.45.45.185
  119.45.45.195
+119.45.45.41
  119.45.46.179
+119.45.46.212
+119.45.48.108
+119.45.48.161
  119.45.49.102
  119.45.49.240
  119.45.49.31
+119.45.5.55
+119.45.50.126
+119.45.51.206
  119.45.52.133
  119.45.52.194
+119.45.52.62
+119.45.54.166
  119.45.57.14
+119.45.57.90
+119.45.58.111
  119.45.59.16
+119.45.6.81
+119.45.6.9
+119.45.60.204
  119.45.60.62
  119.45.61.69
  119.45.62.172
  119.45.63.161
+119.45.63.87
+119.45.8.125
  119.45.9.65
  119.46.2.243
  119.46.2.244
@@ -14161,6 +17121,7 @@
  119.46.2.253
  119.5.1.72
  119.5.157.124
+119.50.160.253
  119.53.130.138
  119.53.130.182
  119.56.130.60
@@ -14178,22 +17139,35 @@
  119.56.199.35
  119.56.238.145
  119.56.239.38
+119.57.117.248
+119.57.117.249
+119.57.162.18
  119.57.17.20
  119.57.247.86
+119.59.103.119
  119.59.116.21
  119.59.121.163
  119.59.124.163
  119.59.124.54
  119.59.127.196
+119.6.253.101
+119.6.253.56
  119.6.54.5
+119.60.29.78
+119.61.19.84
+119.62.142.225
  119.63.130.53
  119.63.130.62
+119.63.84.130
+119.65.149.106
  119.65.195.190
  119.65.249.4
  119.68.194.119
  119.69.199.43
  119.7.237.43
+119.73.179.114
  119.76.140.113
+119.76.177.214
  119.76.190.126
  119.77.105.115
  119.8.34.6
@@ -14202,6 +17176,7 @@
  119.81.184.27
  119.81.80.58
  119.82.135.244
+119.82.141.18
  119.82.242.58
  119.82.249.4
  119.82.251.250
@@ -14219,6 +17194,11 @@
  119.82.253.24
  119.82.253.63
  119.84.128.40
+119.84.8.43
+119.86.145.140
+119.86.18.205
+119.86.19.64
+119.88.176.134
  119.9.110.100
  119.9.110.234
  119.9.131.18
@@ -14233,25 +17213,43 @@
  119.9.72.162
  119.9.74.76
  119.9.75.6
+119.92.138.162
+119.92.243.101
+119.92.72.169
  119.92.77.17
  119.93.122.233
  119.93.123.229
+119.93.128.46
  119.93.129.34
+119.93.131.165
  119.93.148.103
  119.93.175.133
  119.93.213.231
  119.93.234.41
  119.93.235.205
+119.93.52.24
  119.93.90.155
  119.94.166.6
  119.95.76.22
+119.96.118.100
  119.96.131.17
+119.96.158.238
+119.96.171.162
+119.96.172.152
+119.96.175.244
+119.96.178.132
  119.96.192.249
  119.96.200.248
+119.96.213.68
  119.96.227.154
+119.96.237.39
+119.96.239.27
  119.96.68.99
+119.97.150.32
  119.97.159.52
+119.97.252.154
  119.98.108.208
+119.98.141.186
  119.99.244.180bin.sh
  119.99.30.19
  11983914-0a5c-4955-a866-bae101828b59.htmlcomponentservice.com
@@ -14288,7 +17286,9 @@
  12.179.46.6
  12.182.181.129
  12.183.171.36
+12.186.163.3
  12.186.206.84
+12.188.54.30
  12.189.124.50
  12.191.193.202
  12.192.33.18
@@ -14297,6 +17297,7 @@
  12.218.209.130
  12.219.211.130
  12.229.155.122
+12.229.215.19
  12.231.109.141
  12.232.141.28
  12.232.141.29
@@ -14308,32 +17309,51 @@
  12.53.219.68
  12.89.124.138
  120.0.218.125
+120.12.129.104
  120.12.149.242
  120.131.1.97
+120.131.14.125
+120.131.3.191
+120.131.3.91
  120.131.9.167
  120.132.105.211
+120.132.106.211
+120.132.12.162
+120.132.13.131
+120.132.13.206
+120.132.22.92
  120.132.6.27
+120.132.68.57
  120.132.8.64
  120.132.81.130
  120.132.99.101
+120.133.136.75
  120.133.17.168
  120.133.22.121
  120.136.123.202
+120.136.29.201
  120.138.117.102
  120.138.19.16
  120.142.173.160
  120.142.222.22
+120.142.88.222
  120.144.161.12
  120.148.59.93
+120.150.216.161
  120.150.218.241
  120.150.247.164
  120.150.60.189
+120.151.90.157
  120.155.25.147
  120.155.72.14
  120.155.88.8
  120.157.105.208
  120.157.105.208bin.sh
  120.17.187.30
+120.188.83.80
+120.193.155.140
+120.193.179.86
+120.193.225.237
  120.193.91.177
  120.193.91.177bin.sh
  120.193.91.178
@@ -14373,12 +17393,18 @@
  120.193.91.215
  120.193.91.233
  120.193.93.227
+120.194.83.99
  120.195.23.27
+120.195.65.124
  120.196.182.41
  120.196.182.41bin.sh
  120.198.76.45
  120.199.0.43
  120.201.250.44
+120.202.192.126
+120.202.21.189
+120.202.24.117
+120.203.160.18
  120.209.121.243
  120.209.126.206
  120.209.126.214
@@ -14404,11 +17430,15 @@
  120.209.99.201
  120.210.89.79
  120.211.100.18
+120.211.61.239
  120.211.63.91
  120.212.210.199
  120.213.213.54
  120.221.160.125
  120.221.160.3
+120.224.129.4
+120.224.223.66
+120.229.72.140
  120.232.150.110
  120.232.175.244
  120.234.138.100
@@ -14426,48 +17456,95 @@
  120.236.255.120
  120.237.118.139
  120.237.156.248
+120.239.196.0
+120.239.196.111
+120.239.196.14
+120.239.196.17
+120.239.196.19
+120.239.196.23
+120.239.196.27
+120.239.196.3
+120.239.196.4
+120.239.196.52
+120.239.196.58
+120.239.196.59
+120.239.196.74
+120.239.196.80
+120.239.196.85
+120.239.196.87
+120.239.196.99
  120.24.148.204
  120.24.155.11
  120.24.40.26
  120.24.70.214
+120.240.95.154
+120.244.127.3
+120.246.124.254
  120.25.156.28
  120.25.231.102
  120.25.236.250
  120.25.24.30
  120.25.241.243
+120.25.60.70
  120.25.80.195
+120.253.40.91
  120.26.118.68
  120.26.199.103
  120.26.208.102
+120.26.53.205
  120.26.66.53
  120.27.114.140
  120.27.153.72
+120.28.109.188
  120.28.110.61
  120.28.196.200
  120.28.201.50
+120.28.36.59
  120.28.45.202
+120.28.45.45
+120.28.90.188
  120.29.125.240
  120.29.158.158
  120.29.20.65
  120.29.97.240
+120.31.131.172
  120.31.71.238
+120.33.137.113
  120.34.164.7
+120.35.26.129
  120.38.5.219
+120.4.148.94
  120.4.157.4
  120.40.130.70
  120.43.128.99
+120.48.12.238
+120.48.13.82
  120.48.16.20
+120.48.16.217
  120.48.16.228
  120.48.19.10
+120.48.19.88
  120.48.20.241
  120.48.20.62
+120.48.21.157
+120.48.21.252
  120.48.21.80
+120.48.22.137
+120.48.23.46
  120.48.25.100
  120.48.25.245
  120.48.25.84
-120.48.27.20
+120.48.26.6
+120.48.26.72
+120.48.27.128
+120.48.28.34
  120.48.31.111
  120.48.31.121
+120.48.31.123
+120.48.31.140
+120.48.31.193
+120.48.31.80
+120.48.4.5
  120.48.7.156
  120.48.7.60
  120.50.100.247
@@ -14480,14 +17557,40 @@
  120.51.34.254
  120.52.120.11
  120.52.136.248
+120.52.139.130
+120.52.146.211
+120.52.92.107
  120.52.93.191
+120.52.93.223
  120.53.0.176
+120.53.1.97
+120.53.10.17
+120.53.10.40
+120.53.108.58
  120.53.118.140
+120.53.121.167
+120.53.121.178
+120.53.122.208
  120.53.2.190
+120.53.21.151
+120.53.21.174
+120.53.223.186
+120.53.223.202
  120.53.225.81
+120.53.23.24
+120.53.231.189
+120.53.232.114
  120.53.233.197
  120.53.236.209
+120.53.237.161
+120.53.237.33
+120.53.238.156
  120.53.238.43
+120.53.24.160
+120.53.240.203
+120.53.243.163
+120.53.244.247
+120.53.247.204
  120.53.251.82
  120.53.27.188
  120.53.28.165
@@ -14502,10 +17605,12 @@
  120.6.151.191
  120.6.186.201
  120.6.191.231
+120.6.209.177
  120.6.233.250
  120.6.240.130
  120.6.4.196
  120.6.4.64
+120.63.135.40
  120.63.136.58
  120.68.2.66
  120.68.238.139
@@ -14517,16 +17622,27 @@
  120.69.89.50
  120.7.115.0
  120.7.163.249
-120.7.166.255
  120.7.192.80
  120.7.224.2
-120.7.244.120
+120.70.100.13
+120.70.101.85
+120.70.102.16
+120.70.102.239
  120.70.98.132
  120.71.13.11
+120.71.145.166
+120.71.145.189
+120.71.145.209
+120.71.146.45
+120.71.147.115
+120.71.7.203
  120.76.219.77
+120.77.145.154
  120.77.253.219
  120.77.36.28
  120.78.144.149
+120.78.168.214
+120.78.186.9
  120.78.2.215
  120.78.4.233
  120.78.67.152
@@ -14535,17 +17651,21 @@
  120.79.151.95
  120.79.169.174
  120.79.173.243
+120.79.188.144
+120.79.201.184
  120.79.212.174
  120.79.218.202
+120.79.222.140
  120.79.226.20
  120.79.48.236
  120.79.53.218
  120.79.92.64
  120.8.111.160
+120.82.116.30
  120.82.116.6
  120.82.117.168
  120.83.107.78
-120.83.79.218
+120.84.9.60
  120.85.112.176
  120.85.112.243
  120.85.112.49
@@ -14553,10 +17673,6 @@
  120.85.113.127
  120.85.116.14
  120.85.117.192
-120.85.172.158
-120.85.175.170
-120.85.208.132
-120.85.210.133
  120.85.91.134
  120.85.91.172
  120.85.93.26
@@ -14566,22 +17682,44 @@
  120.88.46.226
  120.89.74.73
  120.9.139.110
+120.92.10.24
+120.92.109.67
+120.92.11.9
+120.92.110.219
+120.92.111.13
+120.92.111.227
+120.92.114.71
+120.92.122.81
  120.92.132.245
  120.92.132.94
+120.92.133.133
  120.92.133.80
  120.92.134.19
  120.92.137.192
  120.92.139.183
+120.92.139.2
  120.92.148.190
+120.92.149.124
+120.92.149.231
  120.92.15.26
  120.92.158.207
  120.92.164.193
+120.92.166.166
+120.92.169.65
+120.92.169.82
  120.92.174.221
  120.92.217.33
+120.92.33.108
+120.92.34.203
+120.92.38.187
  120.92.38.249
  120.92.53.30
+120.92.74.249
+120.92.79.133
+120.92.80.120
  120.92.83.246
  120.92.89.30
+120.92.92.40
  120.97.20.106
  120.dodadubose.com
  120264-dot-n-e-w-me-ss-age-po-rt-al.wl.r.appspot.com
@@ -14602,14 +17740,21 @@
  121.101.186.242
  121.101.214.54
  121.102.98.35
+121.105.215.185
  121.11.98.127
  121.111.247.200
  121.119.179.133
  121.119.75.179
+121.12.80.140
+121.120.80.170
+121.121.149.168
+121.121.56.241
  121.121.94.60
  121.122.139.104bin.sh
+121.122.40.109
  121.122.50.157
  121.123.25.106
+121.123.94.94
  121.124.124.145
  121.124.124.200
  121.124.124.40
@@ -14625,6 +17770,7 @@
  121.130.29.11
  121.130.29.21
  121.131.193.143
+121.132.111.247
  121.132.215.233
  121.132.251.243
  121.134.159.21
@@ -14638,16 +17784,20 @@
  121.135.237.32
  121.136.176.71
  121.136.180.124
+121.137.103.81
  121.137.138.140
  121.139.172.133
  121.139.172.4
  121.139.172.4bin.sh
  121.139.176.52
+121.139.204.101
  121.139.218.165
+121.139.69.202
  121.140.0.70
  121.140.118.26
  121.141.34.205
  121.142.57.233
+121.142.87.218
  121.143.159.232
  121.143.3.57
  121.144.182.9
@@ -14659,12 +17809,16 @@
  121.15.2.178
  121.15.220.61
  121.15.245.215
+121.15.4.92
+121.15.7.26
  121.150.209.136
  121.151.78.166
  121.151.78.166bin.sh
+121.152.136.158
  121.152.221.196
  121.153.131.147
  121.153.37.78
+121.154.148.202
  121.154.229.125
  121.154.5.65
  121.155.156.93
@@ -14672,65 +17826,92 @@
  121.155.247.168
  121.156.126.101
  121.157.82.202
+121.159.101.230
  121.159.53.15
  121.159.53.15bin.sh
  121.159.95.49
  121.16.144.186
+121.160.164.83
+121.160.43.196
  121.161.20.13
  121.161.20.97
  121.161.35.243
  121.163.48.44
  121.163.94.158
+121.164.212.211
  121.165.140.242
  121.165.225.81
  121.165.73.157
  121.167.147.172
  121.168.185.22
+121.168.38.75
+121.168.8.232
  121.169.110.121
  121.169.110.121bin.sh
  121.169.222.192
  121.17.100.154
  121.17.210.114
+121.170.188.119
+121.170.19.103
  121.170.8.145
  121.171.166.170
+121.172.108.19
  121.173.238.41
  121.173.82.5
  121.173.82.5bin.sh
  121.173.85.76
  121.174.122.12
-121.174.184.65
  121.174.88.145
  121.177.236.148
-121.177.243.43
  121.178.193.2
+121.178.231.89
  121.179.41.48
+121.18.137.2
+121.18.88.186
  121.180.106.112
  121.180.106.112bin.sh
+121.180.151.59
+121.182.142.213
  121.183.75.145
  121.184.131.249
  121.184.19.115
+121.186.193.6
  121.188.43.201
  121.189.111.104bin.sh
  121.190.102.21
  121.190.192.77
+121.190.90.64
  121.191.47.134
  121.196.12.93
  121.196.147.20
  121.196.155.249
  121.196.33.118
+121.196.44.230
  121.196.59.48
+121.199.9.251
  121.20.202.25
  121.200.48.58
  121.200.48.98
+121.201.121.195
+121.201.124.176
+121.201.124.251
+121.201.125.98
  121.201.26.46
  121.201.45.212
+121.201.56.33
  121.201.57.230
+121.201.61.205
+121.201.74.154
+121.201.76.118
  121.201.76.119
  121.201.76.123
  121.201.93.66
  121.201.94.17
+121.201.95.106
+121.201.95.66
  121.203.221.85
  121.204.134.41
+121.204.148.63
  121.204.164.89
  121.204.164.96
  121.204.166.76
@@ -14740,6 +17921,10 @@
  121.21.92.217
  121.211.20.23
  121.215.45.82
+121.222.102.237
+121.224.77.121
+121.224.82.237
+121.225.24.18
  121.226.131.122
  121.226.131.146
  121.226.142.226
@@ -14760,8 +17945,15 @@
  121.226.85.10
  121.226.94.109
  121.227.153.232
+121.227.252.224
+121.227.31.13
+121.229.19.200
+121.229.20.84
+121.229.55.245
  121.229.62.94
+121.23.235.168
  121.23.88.92
+121.230.155.64
  121.230.211.141
  121.230.239.87
  121.230.24.151
@@ -14773,8 +17965,11 @@
  121.231.101.42
  121.231.102.55
  121.231.11.67
+121.231.13.195
  121.231.164.108
+121.231.8.1
  121.231.83.134
+121.232.148.133
  121.232.179.201
  121.232.39.129bin.sh
  121.233.1.189
@@ -14802,10 +17997,19 @@
  121.233.68.89
  121.233.73.203
  121.233.73.82
+121.234.244.186
  121.234.46.5
+121.235.146.76
  121.235.46.19
+121.236.175.251
+121.236.58.120
  121.237.225.11bin.sh
+121.238.187.203
+121.239.203.27
+121.239.22.25
+121.239.8.151
  121.240.212.2
+121.241.244.92
  121.241.90.242
  121.242.232.157
  121.244.147.176
@@ -14825,97 +18029,185 @@
  121.29.178.5
  121.30.208.197
  121.30.41.41
+121.32.150.82
+121.32.88.181
  121.33.220.158
+121.33.237.102
  121.34.150.176
-121.35.96.98
  121.37.208.213
  121.4.101.179
+121.4.103.11
+121.4.103.114
+121.4.108.118
  121.4.108.157
+121.4.111.232
+121.4.112.248
  121.4.12.6
+121.4.120.131
+121.4.121.128
  121.4.122.148
  121.4.123.149
  121.4.123.73
+121.4.125.228
+121.4.125.41
+121.4.125.93
+121.4.13.16
+121.4.133.10
+121.4.136.65
  121.4.138.185
  121.4.146.164
  121.4.176.113
+121.4.189.112
+121.4.192.114
+121.4.196.9
+121.4.201.201
  121.4.201.38
+121.4.203.230
+121.4.208.48
+121.4.212.169
+121.4.220.175
+121.4.26.93
+121.4.29.160
+121.4.30.187
+121.4.30.232
+121.4.31.168
+121.4.31.241
  121.4.33.51
  121.4.35.109
  121.4.35.157
  121.4.35.38
+121.4.35.86
+121.4.36.245
  121.4.39.109
  121.4.39.177
  121.4.39.231
+121.4.39.63
  121.4.41.100
+121.4.42.125
+121.4.43.247
+121.4.44.86
+121.4.45.131
  121.4.45.199
+121.4.46.241
  121.4.46.37
  121.4.46.5
+121.4.47.140
+121.4.48.221
+121.4.49.146
  121.4.49.180
+121.4.49.216
  121.4.50.217
+121.4.51.142
  121.4.51.174
  121.4.52.144
  121.4.53.226
  121.4.54.111
+121.4.54.117
+121.4.55.205
+121.4.56.32
+121.4.56.34
+121.4.58.20
  121.4.59.90
  121.4.61.150
+121.4.61.64
+121.4.61.65
  121.4.67.224
  121.4.68.147
  121.4.68.192
+121.4.68.23
  121.4.68.87
  121.4.69.135
  121.4.70.7
  121.4.72.239
+121.4.73.38
  121.4.74.101
-121.4.77.16
+121.4.74.61
+121.4.78.62
+121.4.78.77
+121.4.79.142
  121.4.80.21
+121.4.81.234
  121.4.84.172
+121.4.85.107
  121.4.86.163
  121.4.89.155
  121.4.89.195
+121.4.91.59
+121.4.92.47
+121.4.93.249
  121.4.94.81
+121.4.96.28
  121.4.97.211
+121.4.99.174
  121.40.105.124
  121.40.105.78
+121.40.128.99
  121.40.141.226
  121.40.162.239
  121.40.203.142
  121.40.51.48
  121.40.66.129
+121.41.24.64
+121.42.38.56
  121.42.8.157
  121.42.9.57
  121.43.153.120
  121.43.163.43
+121.43.186.155
  121.43.189.248
  121.45.81.77
  121.46.244.194
+121.46.26.126
  121.46.26.17
  121.46.4.194
  121.48.165.2
  121.5.19.193
  121.5.26.106
  121.5.3.212
+121.5.31.43
+121.5.36.65
+121.5.50.79
+121.5.55.30
+121.5.55.53
  121.5.57.208
  121.5.57.54
+121.5.58.19
  121.5.60.195
  121.5.61.96
+121.5.62.146
+121.5.63.185
  121.5.64.12
  121.5.64.249
  121.5.66.217
  121.5.66.62
  121.5.68.96
+121.5.70.57
+121.5.71.75
+121.5.72.122
+121.5.72.228
+121.5.9.203
  121.52.132.186
+121.52.154.36
+121.52.154.98
+121.52.159.141
  121.52.66.102
  121.54.164.151
  121.54.168.251
  121.54.168.252
  121.54.168.253
+121.54.189.15
  121.54.58.242
  121.55.117.24
  121.58.195.140
+121.58.212.108
+121.58.236.11
  121.58.243.202
  121.58.243.204
  121.58.246.247
-121.61.105.136
+121.6.157.198
+121.6.197.13
+121.6.219.179
+121.61.102.201
  121.61.106.104
  121.61.111.145
  121.61.217.18
@@ -14925,7 +18217,7 @@
  121.61.72.170
  121.61.78.91
  121.61.99.128
-121.63.72.59
+121.62.219.167
  121.63.82.89
  121.63.82.89bin.sh
  121.65.173.82
@@ -14933,7 +18225,9 @@
  121.66.154.171
  121.66.198.76
  121.66.35.37
+121.67.246.152
  121.69.44.6
+121.7.33.161
  121.75.218.237
  121.78.116.203
  121.78.116.209
@@ -14943,11 +18237,13 @@
  121.78.236.175
  121.78.60.134
  121.8.146.99
+121.8.28.34
  121.88.4.141
  121.88.4.74
  121.89.193.102
  121.89.194.147
  121.9.252.250
+121.94.25.152
  121.96.41.242
  121.98.205.102
  121.99.28.126
@@ -14959,22 +18255,38 @@
  122.10.90.18
  122.100.150.204
  122.100.188.50
+122.100.214.133
  122.102.118.14
  122.102.39.107
  122.102.43.82
  122.109.101.160
+122.11.148.38
+122.114.111.220
  122.114.149.176
+122.114.154.58
+122.114.166.8
+122.114.177.150
+122.114.177.164
  122.114.228.98
  122.114.246.149
+122.114.254.33
+122.114.37.11
  122.114.4.186
  122.114.4.187
+122.114.5.135
+122.114.5.37
+122.114.65.210
+122.114.70.12
  122.114.73.130
  122.114.75.180
+122.114.79.23
  122.114.86.186
  122.114.95.158
  122.114.96.59
  122.114.99.178
  122.115.43.119
+122.115.51.155
+122.116.104.129
  122.116.104.238
  122.116.233.207
  122.116.41.237
@@ -14991,18 +18303,27 @@
  122.14.209.13
  122.14.209.40
  122.14.210.163
+122.14.217.58
  122.14.222.202
-122.142.159.113
+122.14.250.28
  122.142.236.67
+122.144.212.144
+122.144.221.149
  122.144.4.106
+122.146.196.217
  122.15.131.65
  122.15.82.90
  122.152.194.123
-122.152.209.120
+122.152.195.84
+122.152.196.222
+122.152.199.120
+122.152.202.214
  122.152.211.187
+122.152.211.189
  122.152.215.115
  122.152.217.9
  122.152.249.135
+122.152.52.94
  122.152.55.71
  122.153.212.195
  122.154.141.244
@@ -15011,6 +18332,7 @@
  122.154.151.202
  122.154.251.22
  122.154.42.38
+122.154.56.18
  122.154.57.100
  122.154.57.103
  122.154.57.98
@@ -15021,51 +18343,83 @@
  122.155.160.151
  122.155.165.191
  122.155.166.193
+122.155.202.93
  122.155.223.20
+122.155.223.59
+122.155.223.9
  122.155.7.117
  122.155.9.169
+122.156.219.212
  122.16.180.244
  122.160.112.27
  122.160.147.53
+122.160.167.170
+122.160.31.101
  122.160.61.100
  122.160.99.22
+122.161.194.250
  122.161.196.254
-122.165.169.86
+122.162.137.248
+122.162.240.181
+122.163.176.17
+122.164.228.33
+122.165.149.75
+122.165.194.191
  122.165.20.209
  122.165.206.136
+122.165.207.151
  122.166.144.74
  122.166.192.97
  122.166.216.212
+122.166.237.117
  122.168.178.60
  122.169.114.254
+122.169.9.126
+122.170.109.61
+122.170.242.4
+122.170.4.50
+122.170.5.123
  122.170.71.33
  122.174.12.93
+122.174.181.141
+122.174.236.171
+122.174.54.70
  122.175.197.166
+122.175.47.71
  122.176.101.76
  122.176.169.143
  122.176.21.39
+122.176.28.104
+122.176.34.6
+122.176.49.139
+122.176.55.24
  122.176.56.5
  122.176.65.143
  122.176.71.127
+122.176.87.177
  122.177.43.26
  122.178.115.118
+122.180.246.91
  122.180.254.6
+122.180.48.29
  122.181.16.134
  122.183.139.104
+122.183.164.12
  122.191.189.91
-122.193.113.215
  122.193.178.233
+122.193.233.172
  122.193.58.188
  122.194.192.247
+122.194.229.122
  122.194.229.54
  122.194.229.59
  122.194.44.48
+122.194.75.234
  122.195.134.68
  122.199.112.43
  122.199.140.158
  122.199.24.75
  122.199.72.23
-122.199.79.41
  122.200.144.132
  122.200.144.249
  122.200.144.42
@@ -15097,40 +18451,62 @@
  122.201.23.45
  122.201.76.100
  122.201.82.218
+122.202.32.70
+122.202.48.251
  122.202.50.76
  122.202.51.74
+122.202.53.65
  122.205.143.89
  122.221.52.143
+122.224.167.154
+122.224.179.58
  122.224.240.106
  122.224.240.99
  122.224.65.197
  122.224.65.202
  122.224.94.188
+122.225.107.15
  122.225.112.22
  122.225.139.180
  122.225.18.194
  122.225.218.234
+122.225.230.10
+122.225.55.98
  122.226.113.66
+122.226.177.234
  122.226.177.236
  122.227.126.129
  122.227.164.71
+122.227.26.90
  122.228.19.10
+122.228.19.79
  122.228.2.3
+122.228.210.110
  122.228.246.205
  122.230.132.209
  122.230.133.47
  122.230.70.119
+122.231.25.216
  122.231.47.237
-122.232.227.198
+122.233.242.133
  122.234.77.121
  122.236.192.162
+122.237.60.217
+122.243.159.8
+122.247.191.124
+122.247.52.168
  122.247.9.96
  122.248.103.64
+122.248.108.188
  122.248.222.116
+122.248.33.1
+122.248.37.50
  122.248.38.4
  122.248.45.35
  122.248.46.26
  122.252.225.100
+122.252.225.115
+122.252.225.165
  122.252.229.3
  122.252.250.22
  122.254.29.37
@@ -15140,65 +18516,115 @@
  122.3.53.37
  122.37.68.61
  122.4.249.171
+122.47.89.188
  122.50.5.148
  122.50.5.98
+122.51.100.145
  122.51.101.136
  122.51.103.120
+122.51.125.104
  122.51.125.231
+122.51.125.71
  122.51.135.36
+122.51.137.21
+122.51.147.169
+122.51.147.194
+122.51.147.221
+122.51.149.86
+122.51.15.197
+122.51.154.84
+122.51.16.84
  122.51.167.43
  122.51.168.254
+122.51.178.89
  122.51.18.119
+122.51.187.118
+122.51.189.179
  122.51.200.223
+122.51.202.93
+122.51.204.45
  122.51.208.128
+122.51.208.60
  122.51.209.252
+122.51.211.131
  122.51.214.230
  122.51.214.44
  122.51.224.6
+122.51.228.41
+122.51.229.116
+122.51.230.155
  122.51.230.234
  122.51.231.211
+122.51.234.65
+122.51.239.82
  122.51.241.15
  122.51.241.65
  122.51.243.251
+122.51.248.146
+122.51.248.76
  122.51.250.133
+122.51.254.201
+122.51.255.33
  122.51.28.170
+122.51.32.91
  122.51.36.254
  122.51.41.36
+122.51.52.109
+122.51.52.154
  122.51.53.50
+122.51.55.171
+122.51.56.87
+122.51.64.115
+122.51.64.150
+122.51.68.7
+122.51.69.116
+122.51.72.249
+122.51.73.241
+122.51.77.182
  122.51.81.247
  122.51.82.162
  122.51.83.195
+122.51.86.120
+122.51.86.211
  122.51.90.196
  122.51.92.78
  122.51.96.57
+122.51.99.88
  122.52.107.94
  122.52.127.96
  122.52.183.184
  122.52.183.184bin.sh
  122.53.152.40
+122.53.176.250
  122.53.35.58
  122.53.86.120
+122.54.119.182
  122.54.131.137
  122.54.134.175
  122.54.134.176
+122.54.147.33
  122.54.20.213
  122.54.20.216
+122.55.190.12
  122.55.195.2
  122.55.202.100
  122.58.118.224
  122.9.67.134
  122.97.162.201
+122.97.179.131
  122177-dot-n-e-w-me-ss-age-po-rt-al.wl.r.appspot.com
  122334566789domain.weebly.com
  122572447422481-dot-wetransfer-auth-file-341.appspot.com
  122980data.danzer.site
  122uc.com
+123.0.207.189
  123.1.180.246
  123.1.187.49
  123.1.189.132
  123.1.189.70
  123.10.129.234
  123.10.130.193
+123.10.143.235
  123.10.153.139
  123.10.157.219
  123.10.159.123
@@ -15210,6 +18636,7 @@
  123.10.213.244
  123.10.28.162
  123.10.52.160
+123.10.91.52
  123.103.242.12
  123.108.189.102
  123.108.200.102
@@ -15217,9 +18644,13 @@
  123.108.201.91
  123.108.249.82
  123.108.252.170
+123.11.12.79
  123.11.13.233
+123.11.171.109
+123.11.173.236
  123.11.193.137
  123.11.195.214
+123.11.203.187
  123.11.235.95
  123.11.4.81
  123.11.6.39
@@ -15239,25 +18670,37 @@
  123.117.34.6
  123.118.176.61
  123.118.191.254
-123.12.16.143
+123.118.76.18
+123.12.100.226
  123.12.181.91
  123.12.196.134
  123.12.197.46
  123.12.221.108
+123.12.225.155
  123.12.229.211
  123.12.231.175
  123.12.233.247
  123.12.243.129
  123.12.26.141
+123.12.30.26
  123.12.65.254
  123.122.119.82
+123.122.160.104
  123.122.160.2
+123.122.160.225
  123.122.161.207
  123.122.162.173
+123.122.162.177
+123.122.162.228
  123.122.163.107
  123.122.232.190
+123.124.66.20
+123.125.194.150
  123.126.106.88
+123.126.40.65
+123.126.77.34
  123.127.198.100
+123.127.244.100
  123.128.133.231
  123.128.136.48
  123.128.168.94
@@ -15270,6 +18713,7 @@
  123.128.245.251
  123.128.245.251bin.sh
  123.128.94.220
+123.129.107.216
  123.129.130.188
  123.129.166.147
  123.129.41.68
@@ -15290,12 +18734,16 @@
  123.13.59.120
  123.13.61.43
  123.13.61.70
+123.13.62.32
  123.13.62.96
  123.13.63.148
  123.130.0.231
+123.130.112.6
+123.130.112.86
  123.130.166.151
  123.130.166.249
  123.130.178.94
+123.130.188.102
  123.130.19.225
  123.130.216.147
  123.130.236.87
@@ -15303,6 +18751,8 @@
  123.130.58.14
  123.130.92.27
  123.130.94.147
+123.131.165.105
+123.131.200.148
  123.132.129.11
  123.132.133.34
  123.132.157.4
@@ -15314,38 +18764,47 @@
  123.132.65.76
  123.133.147.228
  123.133.168.134
+123.133.197.227
+123.133.67.2
  123.134.16.254
  123.134.204.236
  123.135.10.227
  123.135.164.203
  123.135.205.139
  123.136.104.2
+123.136.128.13
+123.136.26.35
  123.136.27.202
  123.136.40.79
  123.139.56.148
  123.139.56.238
  123.14.104.224
-123.14.116.48
-123.14.150.208
+123.14.166.15
  123.14.173.33
  123.14.199.130
-123.14.249.1
+123.14.34.173
  123.14.38.70
+123.14.49.13
+123.14.49.38
  123.14.74.248
  123.140.114.196
  123.140.114.252
  123.140.250.171
+123.141.26.253
  123.142.41.244
  123.142.6.107
  123.143.203.194
+123.143.203.67
  123.143.224.42
  123.143.77.180
  123.143.98.5
+123.145.20.76
  123.146.114.40
  123.148.140.145
-123.15.178.223
+123.150.9.74
  123.150.94.82
  123.152.114.180
+123.152.42.196
  123.152.63.119
  123.154.156.170
  123.154.25.32
@@ -15354,44 +18813,62 @@
  123.155.106.210
  123.155.120.60
  123.156.201.196
+123.157.219.83
  123.158.48.232
  123.159.139.81
+123.159.51.112
+123.159.69.64
  123.159.70.163
+123.16.137.168
  123.16.15.201
  123.16.188.2
+123.16.216.234
  123.16.248.128
+123.160.10.54
  123.163.122.122
  123.163.97.210
  123.164.108.177
  123.169.102.82
  123.169.103.130
+123.169.37.63
  123.169.96.133
  123.17.12.248
  123.170.221.178
  123.171.5.112
+123.173.71.19
  123.176.158.247
  123.176.25.234
+123.176.34.229
  123.177.19.13
  123.178.150.230
  123.18.206.22
+123.18.57.56
  123.180.140.101
  123.181.235.123
  123.182.143.222
  123.182.255.52
  123.182.60.2
+123.183.120.229
+123.183.172.85
+123.188.252.34
+123.188.255.52
  123.189.2.226
+123.19.129.66
  123.19.183.127
  123.19.94.33
  123.190.135.136
-123.191.2.141
  123.191.38.5
  123.192.101.163bin.sh
+123.192.64.68
  123.193.24.121
  123.193.53.237
  123.194.52.79
  123.195.160.154
  123.195.184.77
  123.195.60.250
+123.195.99.9
+123.20.171.52
+123.20.18.83
  123.200.11.230
  123.200.143.234
  123.200.15.218
@@ -15406,60 +18883,112 @@
  123.201.165.121
  123.201.178.131
  123.201.24.38
+123.201.50.103
  123.201.55.1
  123.201.55.9
  123.202.163.232
  123.203.163.128
  123.203.64.91
+123.206.103.61
+123.206.104.110
+123.206.104.162
+123.206.111.27
  123.206.13.139
+123.206.15.204
+123.206.17.141
  123.206.183.186
+123.206.188.77
  123.206.216.65
  123.206.219.211
  123.206.228.179
+123.206.23.158
  123.206.232.235
  123.206.255.181
+123.206.26.133
  123.206.31.61
+123.206.33.56
+123.206.38.253
+123.206.41.68
  123.206.50.168
+123.206.53.230
+123.206.58.135
  123.206.62.112
+123.206.67.211
+123.206.7.96
+123.206.81.59
  123.206.83.78
+123.206.90.149
  123.207.1.67
  123.207.10.199
+123.207.107.144
  123.207.107.213
+123.207.11.65
  123.207.111.151
+123.207.115.220
+123.207.121.114
  123.207.123.143
  123.207.124.210
  123.207.144.186
  123.207.145.66
+123.207.149.181
+123.207.150.138
  123.207.151.66
  123.207.187.57
+123.207.188.111
+123.207.188.95
+123.207.19.105
  123.207.198.127
+123.207.218.163
  123.207.22.39
+123.207.221.66
  123.207.222.213
+123.207.237.163
+123.207.250.132
  123.207.251.122
  123.207.252.190
+123.207.30.148
  123.207.31.240
  123.207.36.21
+123.207.52.90
  123.207.54.49
+123.207.60.69
+123.207.65.57
  123.207.66.80
+123.207.74.24
+123.207.78.75
  123.207.78.83
  123.207.88.57
+123.207.92.183
  123.207.92.254
  123.207.94.252
  123.207.95.121
+123.207.97.250
  123.208.200.185
  123.209.202.47
  123.209.93.122
+123.21.132.243
+123.21.168.89
+123.21.173.1
  123.21.244.148
  123.212.124.25
  123.212.29.154
  123.213.1.199
  123.213.70.176
+123.22.212.99
  123.220.251.190
  123.222.204.192
+123.231.106.30
+123.231.107.47
+123.231.121.129
+123.231.121.38
+123.231.124.16
+123.231.125.175
+123.231.160.98
  123.231.230.58
  123.231.254.82
  123.231.65.170
  123.232.100.2
+123.232.127.134
  123.232.170.69
  123.232.27.237
  123.232.42.210
@@ -15467,6 +18996,8 @@
  123.234.112.149
  123.234.124.66
  123.234.124.66bin.sh
+123.234.131.230
+123.234.147.193
  123.234.184.57
  123.234.191.51
  123.234.228.85
@@ -15474,6 +19005,7 @@
  123.234.45.126
  123.235.114.182
  123.235.120.142
+123.235.151.157
  123.235.173.94
  123.235.176.55
  123.235.178.184
@@ -15485,28 +19017,37 @@
  123.235.254.223
  123.235.69.77
  123.236.91.45
+123.24.118.33
+123.24.205.125
  123.240.124.159
  123.240.181.57
  123.240.79.61
  123.241.140.20
  123.242.179.10
  123.244.144.65
+123.245.58.152
  123.245.58.235
  123.249.26.47
+123.25.1.66
+123.25.115.183
  123.25.116.228
  123.25.117.119
+123.25.121.107
  123.25.21.144
-123.25.218.229
+123.25.37.129
  123.252.173.162
  123.252.188.186
+123.252.218.62
  123.253.127.79
  123.253.36.99
  123.253.96.154
  123.253.97.118
  123.254.111.40
+123.255.46.174
  123.26.100.208
  123.26.104.83
-123.27.185.35
+123.26.161.62
+123.26.177.140
  123.27.3.246
  123.30.109.21
  123.30.111.19
@@ -15514,29 +19055,36 @@
  123.30.128.138
  123.30.143.144
  123.30.149.34
+123.30.149.76
  123.30.169.120
  123.30.186.170
+123.30.186.171
  123.30.191.186
  123.30.211.6
+123.30.236.149
+123.30.249.49
+123.31.12.113
  123.31.31.12
  123.31.32.150
  123.31.41.31
  123.31.43.121
-123.4.169.102
-123.4.203.169
+123.31.45.49
+123.4.200.102
+123.4.243.228
  123.4.249.127
  123.4.54.219
+123.4.65.213
  123.4.69.229
-123.4.73.200
  123.4.83.114
  123.4.85.69
-123.4.86.126
  123.4.87.146
+123.4.89.243
  123.4.91.169
  123.4.92.227
  123.49.41.129
  123.49.59.150
  123.5.138.170
+123.5.149.180
  123.50.145.89
  123.51.152.54
  123.51.168.240
@@ -15544,14 +19092,24 @@
  123.51.185.39
  123.51.20.62
  123.51.239.121
+123.52.17.33
+123.53.181.50
  123.56.12.117
+123.56.129.67
+123.56.185.43
  123.56.226.102
+123.56.230.82
+123.56.41.101
  123.56.41.15
  123.57.150.34
  123.57.27.201
+123.57.45.231
  123.57.61.38
  123.57.72.201
+123.58.109.42
+123.58.212.34
  123.58.4.233
+123.58.5.243
  123.58.55.162
  123.58.7.223
  123.59.1.83
@@ -15560,31 +19118,43 @@
  123.59.118.251
  123.59.120.167
  123.59.120.251
+123.59.194.227
  123.59.195.173
  123.59.209.197
  123.59.210.198
  123.59.210.240
  123.59.210.252
  123.59.213.10
+123.59.62.57
  123.59.72.15
+123.6.5.104
+123.6.90.65
  123.60.167.10
  123.63.191.69
  123.63.242.115
  123.63.54.229
  123.7.32.65
-123.7.43.223
+123.7.63.169
+123.7.63.49
+123.8.130.238
  123.8.132.120
+123.8.173.107
  123.8.189.177
  123.8.19.153
  123.8.190.0
  123.8.190.236
-123.8.69.137
  123.9.111.220
  123.9.177.30
  123.9.181.216
+123.9.199.21
  123.9.200.12
+123.9.202.16
  123.9.204.224
-123.9.216.227
+123.9.207.193
+123.9.243.56
+123.9.245.140
+123.9.83.93
+123.97.132.64
  123.97.154.113
  123.ltscr.cn
  123123123112312323.000webhostapp.com
@@ -15630,6 +19200,7 @@
  124.105.34.149
  124.105.55.176
  124.106.127.86
+124.107.165.170
  124.107.185.189
  124.109.1.146
  124.109.1.207
@@ -15638,14 +19209,18 @@
  124.109.3.193
  124.109.33.176
  124.109.44.126
+124.109.50.213
  124.109.52.72
  124.111.53.213
  124.113.217.216
+124.113.228.221
  124.114.141.46
  124.115.146.99
+124.115.205.246
  124.115.223.82
  124.115.39.135
  124.118.186.230
+124.118.31.135
  124.118.68.211
  124.118.9.75
  124.119.107.231
@@ -15656,7 +19231,6 @@
  124.119.139.245
  124.119.63.243
  124.120.187.152
-124.120.201.126
  124.120.46.157
  124.120.86.162
  124.120.86.93
@@ -15676,15 +19250,21 @@
  124.122.103.39
  124.122.12.89
  124.122.120.17
+124.122.227.63
  124.122.37.246
+124.122.45.123
  124.122.47.205
  124.122.55.202
  124.123.165.230
+124.123.175.77
  124.123.77.175
  124.124.197.72
  124.126.140.14
  124.126.140.249
  124.126.18.130
+124.127.42.42
+124.127.76.193
+124.128.39.226
  124.128.57.114
  124.129.126.228
  124.129.153.168
@@ -15696,26 +19276,37 @@
  124.129.42.135
  124.129.59.57
  124.13.20.40
+124.13.46.209
  124.130.164.91
+124.130.28.8
+124.130.40.162
+124.130.57.57
  124.131.109.149
+124.131.117.51
  124.131.131.147
  124.131.131.184
+124.131.131.35
  124.131.135.61
  124.131.139.201
  124.131.149.131
+124.131.150.24
  124.131.151.135
  124.131.152.148
+124.131.2.217
  124.131.239.254
  124.131.26.238
  124.131.51.163
-124.131.95.90
+124.133.230.74
  124.133.252.204
  124.133.34.186
+124.133.9.122
  124.135.1.194
+124.135.11.47
  124.135.165.168
  124.135.42.214
  124.135.5.0
  124.136.23.172
+124.137.205.59
  124.138.115.131
  124.138.58.3
  124.140.114.158
@@ -15727,19 +19318,32 @@
  124.150.175.133
  124.150.236.51
  124.152.109.123
+124.152.118.194
  124.152.57.24
+124.152.76.174
+124.152.76.180
  124.153.136.175
+124.156.103.155
+124.156.105.251
+124.156.107.201
  124.156.108.171
+124.156.112.181
+124.156.114.53
  124.156.133.4
  124.156.133.54
+124.156.134.69
  124.156.135.221
  124.156.135.242
  124.156.138.112
+124.156.139.91
+124.156.140.21
  124.156.143.60
+124.156.148.119
  124.156.149.43
  124.156.150.83
  124.156.154.157
  124.156.154.55
+124.156.157.84
  124.156.158.178
  124.156.168.117
  124.156.178.58
@@ -15749,27 +19353,38 @@
  124.156.214.135
  124.156.217.41
  124.156.218.50
+124.156.225.138
+124.156.225.159
  124.156.226.224
  124.156.226.238
+124.156.99.101
  124.158.105.58
+124.158.12.202
  124.158.144.186
  124.158.144.187
  124.158.150.205
  124.158.160.131
-124.158.167.154
  124.158.175.2
  124.158.179.122
  124.158.179.13
  124.158.179.158
  124.158.179.222
+124.158.183.184
+124.158.7.170
  124.158.88.56
  124.16.71.252
  124.160.126.238
+124.160.83.138
+124.160.96.242
+124.160.96.249
  124.163.131.196
+124.163.134.113
  124.163.144.140
  124.163.146.116
+124.163.191.135
  124.163.96.71
  124.165.123.7
+124.167.226.214
  124.167.248.230
  124.169.53.140
  124.17.10.2
@@ -15787,15 +19402,30 @@
  124.194.83.172
  124.199.56.198
  124.205.108.64
+124.205.84.11
+124.205.84.12
  124.205.84.14
+124.205.84.15
+124.205.84.17
+124.205.84.18
  124.205.84.20
+124.205.84.21
  124.205.84.5
+124.205.84.6
+124.205.84.8
  124.205.84.9
+124.207.165.138
+124.207.221.66
+124.207.29.72
+124.207.98.213
  124.217.230.195
  124.217.242.70
  124.217.249.34
  124.219.176.139
  124.225.66.198
+124.226.218.205
+124.226.219.166
+124.226.233.115
  124.227.115.39
  124.228.170.194
  124.229.25.21
@@ -15803,10 +19433,15 @@
  124.230.175.141
  124.230.175.167
  124.230.175.209
+124.232.163.10
+124.234.220.222
+124.234.240.103
  124.234.6.107
  124.235.155.109
+124.235.171.114
  124.235.206.59
  124.235.216.239
+124.236.22.12
  124.238.113.126
  124.238.56.102
  124.238.56.112
@@ -15836,28 +19471,45 @@
  124.238.63.119
  124.238.63.150
  124.239.149.153
+124.239.153.215
+124.239.168.74
+124.239.216.233
  124.239.77.45
  124.240.198.66
+124.244.1.158
  124.248.165.248
  124.248.177.106
  124.248.177.126
  124.248.177.14
  124.248.177.203
  124.248.177.40
+124.248.189.176
+124.248.189.68
  124.248.190.215
  124.248.191.38
  124.248.227.130
  124.248.240.40
+124.250.244.4
  124.250.50.135
+124.251.110.147
+124.251.110.148
  124.251.23.153
  124.253.204.157
  124.255.20.163
+124.28.218.130
+124.29.200.210
+124.29.200.215
  124.29.200.46
+124.29.212.121
+124.29.216.47
  124.29.236.163
+124.29.238.40
  124.35.94.234
  124.40.244.254
  124.40.248.202
  124.40.251.74
+124.40.255.186
+124.41.193.38
  124.41.211.110
  124.41.211.188
  124.41.211.196
@@ -15877,16 +19529,28 @@
  124.41.243.22
  124.41.243.67
  124.41.243.72
+124.41.248.55
+124.42.68.14
+124.43.177.160
+124.43.5.130
+124.43.9.184
+124.43.93.218
  124.45.106.173
  124.49.100.254
  124.5.74.161bin.sh
+124.5.92.20
+124.50.73.93
  124.51.247.48
  124.6.0.4
  124.6.153.84
  124.61.214.44
+124.62.228.145
  124.65.117.38
  124.65.144.38
  124.65.158.254
+124.65.181.78
+124.65.8.209
+124.65.99.130
  124.66.49.34
  124.67.89.18
  124.67.89.238
@@ -15899,18 +19563,24 @@
  124.67.89.70
  124.67.89.74
  124.67.89.76
+124.74.248.218
  124.75.27.100
  124.75.27.102
  124.75.27.67
+124.77.6.15
  124.78.41.151
  124.78.54.247
  124.81.236.122
  124.81.239.170
  124.82.119.11
+124.82.222.209
  124.89.218.25
  124.89.220.36
+124.89.9.204
+124.89.9.233
  124.9.79.244
  124.90.36.152
+124.90.49.107
  124.90.51.194
  124.91.132.236
  124.91.133.220
@@ -15919,11 +19589,13 @@
  124.91.186.192
  124.91.186.192bin.sh
  124.91.22.151
+124.91.225.117
  124.91.226.216
  124.91.236.96
  124.91.6.249
  124.93.201.59
  124.93.222.211
+124.94.23.79
  124.95.143.135
  124.cpanel.realwebsitesite.com
  1241.31cf4fdae.com
@@ -15936,31 +19608,44 @@
  125.120.149.124
  125.120.237.87
  125.122.169.110
+125.123.120.42
  125.123.239.2
  125.124.117.226
+125.124.120.123
  125.124.160.236
+125.124.215.222
+125.124.30.186
+125.124.44.135
+125.124.59.64
+125.124.69.65
+125.124.72.157
  125.124.77.104
  125.125.116.242
  125.126.254.180
  125.126.84.109
  125.126.86.109
  125.128.163.100
+125.128.225.3
  125.131.73.90
-125.131.85.51
  125.132.218.97
  125.134.140.175
  125.134.169.130
  125.134.191.228
+125.134.203.250
+125.134.55.83
+125.134.92.170
  125.135.221.94
  125.137.11.141
  125.137.18.111
  125.137.191.115
-125.137.60.235
  125.138.129.101
  125.139.190.46
  125.139.236.180
  125.140.140.218
  125.140.159.29
+125.141.133.70
+125.141.139.29
+125.141.139.9
  125.141.196.8
  125.141.200.15
  125.141.200.2
@@ -15981,32 +19666,46 @@
  125.141.200.55
  125.141.230.79
  125.141.25.178
+125.141.56.231
  125.141.59.19
  125.141.63.90
  125.141.91.138
  125.142.211.237
+125.142.5.105
+125.143.140.126
  125.143.3.230
  125.143.50.113
  125.16.134.218
+125.16.176.58
  125.16.217.170
  125.160.17.200
  125.160.195.248
  125.160.207.65
  125.160.213.234
  125.160.226.31
+125.160.228.188
  125.160.56.134
  125.160.65.89
+125.161.129.151
  125.161.129.217
+125.161.136.146
+125.161.137.111
  125.161.138.235
+125.161.139.79
  125.161.31.225
  125.161.65.27
  125.162.120.80
+125.162.136.217
+125.162.220.254
  125.162.87.59
  125.163.100.45
  125.163.118.80
  125.163.147.240
+125.163.160.229
  125.163.163.88
+125.163.249.135
  125.163.30.185
+125.163.61.30
  125.163.8.33
  125.164.105.240
  125.164.140.78
@@ -16018,17 +19717,28 @@
  125.165.105.194
  125.165.179.254
  125.165.99.249
+125.166.119.67
  125.166.146.148
+125.166.2.27
+125.166.203.83
  125.166.224.66
+125.166.4.199
+125.167.116.38
  125.167.132.165
  125.167.32.158
  125.167.52.78
+125.167.56.202
  125.167.60.58
  125.167.63.77
  125.168.10.234
  125.168.145.66bin.sh
+125.17.115.94
+125.178.227.57
+125.178.75.73
  125.18.20.150
+125.19.153.156
  125.19.99.90
+125.198.22.58
  125.20.32.22
  125.206.38.159bin.sh
  125.209.115.186
@@ -16040,26 +19750,37 @@
  125.209.235.182
  125.209.235.183
  125.209.67.74
+125.209.80.130
  125.209.82.78
  125.21.123.234
  125.21.43.82
+125.21.54.26
+125.211.133.124
  125.212.156.213
+125.212.156.54
  125.212.193.1
  125.212.193.207
  125.212.193.208
  125.212.193.46
  125.212.193.96
+125.212.207.107
  125.212.219.42
  125.212.224.103
+125.212.225.167
  125.212.227.4
+125.212.229.50
+125.212.233.50
  125.212.241.131
  125.212.251.45
  125.213.150.219
  125.215.205.180
+125.215.207.40
  125.22.246.216
-125.22.9.186
  125.227.130.2
+125.227.140.6
+125.227.149.119
  125.227.16.170
+125.227.200.196
  125.227.237.199
  125.227.60.218
  125.227.69.217
@@ -16087,6 +19808,10 @@
  125.24.68.253
  125.24.7.159
  125.24.7.220
+125.24.8.78
+125.24.85.37
+125.24.91.120
+125.240.27.103
  125.245.165.135
  125.247.211.3
  125.248.150.84
@@ -16098,12 +19823,15 @@
  125.25.165.88
  125.25.165.91
  125.25.165.97
+125.25.167.185
  125.25.184.10
  125.25.184.14
  125.25.187.225
+125.25.197.78
  125.25.203.140
  125.25.238.7
  125.25.24.97
+125.25.240.3
  125.25.246.209
  125.25.28.29
  125.25.41.126
@@ -16112,6 +19840,7 @@
  125.25.78.19
  125.25.80.86
  125.25.82.204
+125.251.116.4
  125.251.133.3
  125.251.136.194
  125.251.147.194
@@ -16124,20 +19853,22 @@
  125.26.104.236
  125.26.108.170
  125.26.113.2
-125.26.120.159
  125.26.122.124
  125.26.135.191
+125.26.15.68
  125.26.165.17
  125.26.165.244
  125.26.169.63
  125.26.183.167
  125.26.183.223
+125.26.183.54
  125.26.186.244
  125.26.195.50
  125.26.202.91
  125.26.246.86
  125.26.7.124
  125.26.7.83
+125.26.80.230
  125.26.97.158
  125.26.99.185
  125.26.99.186
@@ -16152,8 +19883,8 @@
  125.27.127.59
  125.27.136.91
  125.27.14.230
-125.27.179.185
  125.27.186.238
+125.27.205.232
  125.27.22.161
  125.27.22.242
  125.27.238.3
@@ -16177,69 +19908,80 @@
  125.27.89.151
  125.31.40.138
  125.33.226.142
+125.34.240.29
+125.34.240.33
+125.35.227.106
  125.35.92.130
  125.36.114.219
  125.36.208.161
+125.36.214.70
  125.40.1.179
  125.40.113.83
  125.40.114.24
  125.40.145.172
+125.40.34.42
  125.40.73.220
  125.40.75.47
  125.40.91.15
  125.41.1.44
  125.41.109.123
  125.41.13.34
-125.41.135.190
-125.41.142.152
-125.41.158.180
-125.41.196.149
-125.41.2.231
  125.41.204.208
  125.41.204.217
  125.41.205.24bin.sh
  125.41.215.56
  125.41.224.147
+125.41.7.175
+125.41.77.148
  125.41.80.120
  125.41.97.114
-125.42.120.101
  125.42.121.170
  125.42.121.67
+125.42.123.210
+125.42.124.212
+125.42.125.131
  125.42.192.48
  125.42.239.99
  125.42.42.75
  125.42.90.144
-125.43.106.158
  125.43.112.244
  125.43.113.1
-125.43.117.86
+125.43.113.53
+125.43.127.1
+125.43.190.51
+125.43.35.158
+125.43.38.205
  125.43.50.22
-125.43.88.36
+125.43.7.43
  125.43.93.226
  125.44.14.235
  125.44.194.40
+125.44.213.4
+125.44.215.155
  125.44.231.212
+125.44.247.182
  125.44.8.248
+125.44.9.198
  125.45.153.2
-125.45.174.134
  125.45.179.132
-125.45.186.120
  125.45.186.236bin.sh
  125.45.25.13
  125.45.67.112bin.sh
+125.45.67.97
  125.45.77.161
  125.45.78.176
  125.45.79.125
-125.45.88.200
-125.46.138.151
  125.46.163.117
-125.46.184.66
  125.46.185.118
  125.46.185.127
+125.46.196.207
+125.46.196.220
  125.46.197.224
-125.46.246.9
+125.46.202.242
+125.46.244.98
  125.46.247.103
  125.46.78.50
+125.46.81.106
  125.46.82.34
  125.46.86.134
  125.47.106.83
@@ -16249,51 +19991,77 @@
  125.47.211.71
  125.47.226.219
  125.47.234.205
+125.47.242.108
+125.47.243.177
  125.47.245.184
  125.47.249.236
  125.47.250.122
  125.47.55.90
+125.47.61.164
  125.47.65.10
  125.47.65.136
  125.47.74.248
  125.47.75.174
  125.47.85.43
+125.47.86.87
  125.47.90.241
  125.47.91.188
+125.5.180.84
+125.5.184.218
+125.5.215.20
+125.57.214.79
+125.60.148.184
  125.62.198.65
  125.62.213.18
  125.62.213.94
  125.64.16.40
  125.64.54.23
+125.64.94.139
+125.64.94.143
  125.65.112.161
  125.65.112.168
  125.65.77.120
+125.65.82.7
  125.65.92.104
  125.65.94.122
  125.66.106.2
  125.67.239.82
-125.67.35.62
  125.68.172.20
+125.69.71.33
+125.69.90.148
  125.70.244.4
+125.70.253.149
+125.74.238.42
+125.74.28.200
  125.74.55.161
+125.76.212.142
  125.76.230.10
  125.77.22.106
  125.77.25.123
  125.84.217.97
+125.85.13.40
+125.88.169.233
+125.89.7.76
  125.91.109.200
  125.91.126.92
+125.94.117.128
+125.94.236.109
+125.94.236.14
  125.94.67.142
  125.99.100.193
+125.99.110.158
  125.99.120.166
  125.99.147.56
  125.99.173.162
  125.99.242.202
+125.99.46.49
  125.99.46.50
  125.99.60.171
  125.99.61.162
  125478526j.weebly.com
  125fbe8e-c223-43d2-974f-9e171c4e36c0.htmlcomponentservice.com
  126.0.21.51
+126.0.63.53
  126.10.146.226
  126.103.172.79
  126.109.37.158
@@ -16304,6 +20072,7 @@
  126.26.199.53
  126.34.147.146
  126.4.98.212
+126.66.79.72
  126.90.59.69
  126bus.cn
  126f7b50-bfe6-4649-a622-42cb62c2a8d5.htmlcomponentservice.com
@@ -16320,18 +20089,24 @@
  128.1.223.244
  128.1.223.245
  128.1.223.246
+128.1.87.5
  128.106.136.18
  128.106.166.8
  128.106.195.126
  128.106.2.250
  128.106.234.92
  128.106.93.221
+128.116.130.101
  128.116.133.92
+128.116.154.5
  128.121.136.192
  128.121.17.146
  128.121.17.148
  128.121.17.154
  128.121.17.155
+128.124.208.94
+128.124.9.15
+128.127.186.87
  128.134.58.164
  128.136.35.30
  128.14.11.107
@@ -16340,6 +20115,7 @@
  128.14.11.110
  128.14.133.58
  128.14.134.170
+128.14.141.110
  128.14.16.156
  128.14.16.233
  128.14.163.92
@@ -16365,60 +20141,108 @@
  128.177.105.224
  128.177.105.225
  128.187.32.223
+128.193.254.44
+128.199.0.70
+128.199.1.140
+128.199.1.184
  128.199.10.155
  128.199.100.171
+128.199.101.113
  128.199.101.35
  128.199.102.242
+128.199.103.239
  128.199.103.24
+128.199.106.232
  128.199.106.97
-128.199.107.150
+128.199.107.111
+128.199.108.117
  128.199.108.203
  128.199.109.128
  128.199.11.82
+128.199.11.84
+128.199.110.201
+128.199.110.226
  128.199.114.22
  128.199.115.175
  128.199.115.180
+128.199.116.139
  128.199.117.43
  128.199.12.141
+128.199.120.132
  128.199.121.185
+128.199.121.32
+128.199.122.54
+128.199.123.0
  128.199.123.153
+128.199.123.170
+128.199.124.53
  128.199.127.0
  128.199.127.15
  128.199.127.154
  128.199.127.217
  128.199.128.169
  128.199.128.186
+128.199.128.215
  128.199.128.68
+128.199.129.68
  128.199.13.22
  128.199.130.31
+128.199.131.150
+128.199.131.6
  128.199.133.125
  128.199.133.8
  128.199.136.255
  128.199.136.56
  128.199.138.67
  128.199.139.195
+128.199.140.157
  128.199.141.181
+128.199.141.33
+128.199.142.0
  128.199.142.203
+128.199.142.33
+128.199.143.157
+128.199.143.19
+128.199.144.54
  128.199.145.214
  128.199.145.5
  128.199.145.96
+128.199.146.137
  128.199.146.28
  128.199.146.98
+128.199.148.20
+128.199.149.111
+128.199.15.205
+128.199.150.71
  128.199.151.172
  128.199.151.198
+128.199.152.105
+128.199.152.57
  128.199.154.189
  128.199.156.159
+128.199.156.25
  128.199.158.182
  128.199.16.236
  128.199.161.153
-128.199.161.238
  128.199.162.224
+128.199.163.94
+128.199.164.46
  128.199.165.98
+128.199.167.161
  128.199.167.163
+128.199.167.218
+128.199.168.172
+128.199.168.35
+128.199.170.33
+128.199.171.106
  128.199.171.183
  128.199.171.224
+128.199.173.129
+128.199.173.206
+128.199.173.208
  128.199.173.97
  128.199.174.204
+128.199.177.224
  128.199.177.249
  128.199.177.52
  128.199.178.165
@@ -16427,7 +20251,10 @@
  128.199.180.123
  128.199.180.80
  128.199.182.19
+128.199.182.51
  128.199.184.167
+128.199.184.177
+128.199.185.42
  128.199.185.97
  128.199.186.46
  128.199.192.135
@@ -16439,9 +20266,14 @@
  128.199.2.81
  128.199.20.140
  128.199.200.209
+128.199.200.77
+128.199.201.214
  128.199.202.107
  128.199.202.168
+128.199.202.206
  128.199.204.164
+128.199.204.55
+128.199.206.90
  128.199.208.93
  128.199.21.230
  128.199.210.138
@@ -16452,6 +20284,7 @@
  128.199.213.194
  128.199.213.59
  128.199.214.19
+128.199.215.116
  128.199.218.126
  128.199.219.186
  128.199.220.70
@@ -16463,27 +20296,40 @@
  128.199.224.178
  128.199.225.104
  128.199.226.44
+128.199.227.155
  128.199.227.236
  128.199.228.243
  128.199.229.21
  128.199.23.127
+128.199.231.162
  128.199.232.6
  128.199.233.143
  128.199.235.176
  128.199.239.9
+128.199.240.120
  128.199.241.165
+128.199.242.201
+128.199.243.186
  128.199.243.226
+128.199.244.150
  128.199.244.99
+128.199.247.226
  128.199.248.200
  128.199.248.35
  128.199.249.142
  128.199.249.246
  128.199.249.43
+128.199.25.223
+128.199.251.65
  128.199.253.208
+128.199.254.188
  128.199.254.45
+128.199.26.242
+128.199.26.250
  128.199.26.61
  128.199.29.226
  128.199.30.160
+128.199.30.172
  128.199.31.95
  128.199.32.51
  128.199.33.46
@@ -16494,6 +20340,7 @@
  128.199.4.104
  128.199.4.29
  128.199.41.19
+128.199.42.106
  128.199.42.166
  128.199.43.133
  128.199.43.76
@@ -16505,36 +20352,54 @@
  128.199.49.191
  128.199.5.111
  128.199.50.213
+128.199.51.115
+128.199.51.183
  128.199.52.158
  128.199.52.4
+128.199.53.53
  128.199.55.169
  128.199.55.181
  128.199.55.244
  128.199.58.60
+128.199.6.188
  128.199.6.24
  128.199.61.212
  128.199.61.84
  128.199.62.187
  128.199.63.19
  128.199.64.190
+128.199.64.71
  128.199.65.26
+128.199.68.220
  128.199.70.58
  128.199.72.121
+128.199.73.40
  128.199.74.117
+128.199.78.229
+128.199.79.158
  128.199.79.175
  128.199.80.189
  128.199.81.160
  128.199.81.8
  128.199.81.84
  128.199.85.205
+128.199.87.167
+128.199.87.28
  128.199.88.23
+128.199.89.150
+128.199.90.55
  128.199.92.162
  128.199.93.4
+128.199.94.218
  128.199.95.60
  128.199.95.74
+128.199.95.93
+128.199.96.1
  128.199.98.15
  128.199.99.204
+128.201.100.84
  128.201.161.2
+128.201.76.184
  128.201.81.160
  128.201.81.163
  128.201.82.87
@@ -16546,57 +20411,97 @@
  128.244.119.162
  128.31.0.13
  128.59.10.116
+128.65.126.240
+128.65.52.161
  128.70.137.103
  128.71.144.200
  128.71.165.79
  128.72.85.127
+128.74.116.180
  128.75.151.66
  128.90.141.10
  128.92.203.42
  128.98.26.242
  128988158812897-dot-fix-file-upstream.appspot.com
+129.0.76.118
  129.10.65.146
  129.102.9.6
  129.121.177.81
  129.122.16.156
+129.122.177.168
+129.122.30.14
  129.126.102.10
  129.126.102.14
+129.126.158.50
  129.126.65.78
  129.126.99.254
  129.13.189.206
  129.13.189.208
  129.13.189.210
  129.13.189.212
+129.144.181.142
+129.144.183.81
  129.144.32.149
+129.144.9.93
+129.145.193.194
  129.146.112.125
  129.146.122.232
  129.146.160.14
  129.146.171.254
+129.146.246.249
  129.146.249.135
+129.146.250.102
  129.146.253.35
+129.146.68.124
+129.146.81.43
  129.146.84.192
  129.146.96.214
  129.15.240.105
+129.150.176.211
  129.150.194.230
+129.152.141.71
  129.152.232.3
+129.154.67.65
  129.158.66.41
+129.158.74.141
+129.159.36.93
  129.159.38.139
  129.170.192.41
  129.204.110.114
+129.204.116.250
+129.204.121.245
+129.204.121.71
+129.204.125.231
+129.204.131.146
+129.204.131.218
  129.204.132.123
+129.204.152.84
  129.204.162.92
+129.204.17.191
+129.204.177.7
+129.204.181.118
  129.204.184.97
+129.204.186.151
  129.204.19.106
  129.204.197.29
  129.204.20.248
  129.204.201.238
+129.204.203.218
  129.204.208.231
  129.204.208.34
  129.204.209.175
+129.204.216.69
+129.204.23.5
+129.204.233.194
+129.204.233.214
  129.204.239.193
  129.204.245.6
+129.204.249.11
  129.204.249.36
+129.204.254.71
  129.204.33.26
+129.204.33.4
+129.204.35.171
  129.204.37.114
  129.204.46.170
  129.204.53.160
@@ -16606,7 +20511,9 @@
  129.204.67.133
  129.204.77.136
  129.204.77.236
+129.204.82.4
  129.204.89.159
+129.205.112.253
  129.205.138.194
  129.205.161.127
  129.205.161.237
@@ -16617,80 +20524,145 @@
  129.205.244.158
  129.205.98.54
  129.21.34.18
+129.211.10.111
+129.211.107.163
+129.211.12.60
+129.211.124.120
+129.211.124.29
  129.211.134.62
+129.211.135.174
  129.211.138.177
+129.211.14.195
  129.211.14.58
+129.211.146.50
  129.211.149.34
+129.211.16.182
+129.211.162.33
+129.211.165.102
+129.211.165.188
+129.211.167.38
  129.211.167.92
+129.211.169.241
+129.211.17.38
  129.211.171.105
  129.211.171.24
  129.211.174.106
  129.211.18.180
  129.211.185.246
+129.211.188.162
  129.211.189.231
  129.211.191.185
  129.211.205.103
  129.211.205.113
  129.211.205.136
  129.211.24.104
+129.211.25.66
  129.211.42.153
+129.211.42.49
+129.211.49.17
+129.211.49.44
  129.211.5.84
  129.211.50.239
+129.211.54.147
  129.211.67.232
+129.211.70.87
  129.211.71.55
  129.211.74.252
+129.211.75.184
  129.211.77.44
+129.211.79.208
  129.211.84.224
+129.211.91.170
+129.211.94.145
  129.211.94.30
+129.211.99.254
  129.213.117.100
  129.213.118.125
  129.213.145.100
+129.213.15.42
  129.213.161.37
+129.213.165.255
+129.213.185.254
  129.213.19.98
+129.213.203.59
  129.213.21.173
  129.213.213.245
  129.213.76.238
  129.22.143.241
  129.226.11.73
  129.226.112.41
+129.226.12.233
  129.226.125.10
+129.226.134.163
  129.226.138.179
  129.226.141.113
  129.226.15.245
+129.226.150.149
  129.226.153.90
+129.226.157.108
+129.226.164.49
+129.226.165.250
  129.226.165.90
  129.226.166.46
  129.226.170.36
+129.226.170.65
  129.226.174.57
+129.226.185.201
+129.226.188.130
+129.226.193.114
  129.226.193.66
  129.226.194.96
+129.226.225.117
  129.226.227.72
  129.226.51.112
  129.226.63.78
  129.226.64.39
+129.226.64.51
  129.226.68.181
+129.226.72.77
  129.226.73.12
+129.226.76.90
+129.226.77.190
+129.227.129.169
  129.232.208.51
  129.232.208.54
  129.232.208.55
  129.232.208.60
+129.28.103.85
  129.28.113.46
+129.28.12.228
  129.28.141.140
  129.28.142.81
+129.28.154.240
+129.28.155.113
+129.28.157.148
+129.28.157.213
  129.28.158.174
  129.28.160.215
+129.28.160.44
  129.28.162.79
+129.28.163.90
+129.28.165.182
  129.28.165.213
+129.28.169.194
  129.28.172.212
+129.28.172.220
  129.28.175.24
+129.28.176.136
+129.28.176.171
+129.28.177.29
+129.28.180.237
  129.28.183.62
  129.28.185.107
+129.28.185.31
  129.28.189.173
  129.28.192.71
+129.28.195.191
  129.28.198.205
  129.28.199.85
  129.28.203.122
  129.28.78.8
+129.28.82.148
  129.28.92.64
  129.46.232.65
  129.66.12.135
@@ -16762,6 +20734,7 @@
  13.209.102.77
  13.209.125.83
  13.209.215.189
+13.209.28.104
  13.209.66.255
  13.209.81.230
  13.210.163.7
@@ -16782,6 +20755,7 @@
  13.212.208.232
  13.212.217.254
  13.212.221.8
+13.212.25.58
  13.212.4.107
  13.212.76.15
  13.212.77.116
@@ -16842,9 +20816,13 @@
  13.233.176.4
  13.233.176.53
  13.233.182.207
+13.233.68.247
+13.233.73.212
  13.233.82.105
  13.233.97.177
+13.235.126.178
  13.236.100.67
+13.236.114.230
  13.236.132.166
  13.236.204.65
  13.236.97.169
@@ -16897,6 +20875,7 @@
  13.48.25.119
  13.48.31.194
  13.48.45.12
+13.48.53.51
  13.48.71.240
  13.48.8.80
  13.49.228.150
@@ -16950,6 +20929,7 @@
  13.58.196.60
  13.58.2.126
  13.58.210.235
+13.58.237.57
  13.58.241.222
  13.58.255.228
  13.58.30.119
@@ -16990,14 +20970,18 @@
  13.59.7.20
  13.59.71.101
  13.64.175.205
+13.64.180.238
  13.64.77.225
+13.65.0.96
  13.65.147.163
  13.65.147.40
  13.65.215.106
  13.65.246.58
  13.65.42.254
+13.65.56.62
  13.65.80.18
  13.66.128.69
+13.66.131.233
  13.66.139.100
  13.66.139.105
  13.66.139.121
@@ -17023,6 +21007,7 @@
  13.66.167.123
  13.66.18.39
  13.66.185.182
+13.66.210.3
  13.66.217.251
  13.66.243.4
  13.66.248.91
@@ -17032,26 +21017,43 @@
  13.66.39.248
  13.67.106.218
  13.67.236.36
+13.67.56.139
  13.68.153.168
+13.68.168.107
+13.68.22.157
  13.68.225.165
  13.68.229.202
  13.68.249.191
+13.69.136.34
+13.69.137.44
+13.69.139.25
+13.69.143.137
  13.69.153.185
+13.69.50.143
  13.71.136.69
  13.71.2.244
+13.71.46.226
  13.71.5.118
+13.71.68.160
+13.72.77.29
  13.72.80.225
  13.72.82.82
+13.72.86.172
  13.73.1.69
  13.73.16.128
  13.73.16.134
  13.73.23.121
  13.74.157.69
+13.74.178.7
+13.74.180.130
+13.74.46.65
  13.75.125.174
  13.75.193.159
  13.75.194.31
  13.75.220.102
+13.75.227.196
  13.76.100.168
+13.76.141.135
  13.76.142.50
  13.76.165.246
  13.76.241.217
@@ -17061,34 +21063,50 @@
  13.76.34.31
  13.76.38.173
  13.76.91.32
+13.77.144.86
  13.77.168.213
+13.77.173.99
  13.77.204.88
  13.77.205.248
  13.77.207.76
+13.77.210.119
+13.77.215.72
  13.78.126.105
  13.78.189.149
  13.78.190.103
  13.78.236.203
  13.78.237.115
+13.78.9.246
+13.79.160.121
+13.79.190.55
  13.79.242.9
  13.79.6.157
  13.80.102.70
+13.80.104.33
  13.80.123.101
  13.80.147.35
  13.80.67.162
+13.81.24.230
+13.81.41.249
+13.81.43.104
  13.81.6.165
+13.82.0.138
  13.82.102.20
  13.82.105.123
+13.82.147.112
  13.82.149.166
  13.82.179.224
  13.82.18.238
  13.82.187.131
+13.82.197.242
  13.82.198.161
  13.82.22.80
  13.82.220.196
+13.82.24.91
  13.82.29.22
  13.82.58.15
  13.82.60.6
+13.82.81.171
  13.84.135.5
  13.84.146.71
  13.84.150.149
@@ -17120,6 +21138,7 @@
  13.90.208.238
  13.90.26.128
  13.90.38.253
+13.90.95.243
  13.90.98.107
  13.90.98.3
  13.91.41.140
@@ -17142,18 +21161,25 @@
  13.93.210.251
  13.93.223.243
  13.93.238.15
+13.93.24.50
  13.93.87.165
  13.94.119.209
  13.94.200.157
  13.95.130.2
  130.0.219.242
  130.0.234.16
+130.105.168.72
  130.105.197.224
+130.105.243.149
+130.105.248.159
+130.105.248.208
+130.105.248.25
  130.111.10.87
  130.149.80.199
  130.149.80.221
  130.162.71.237
  130.180.28.106
+130.180.66.97
  130.180.99.26
  130.185.109.17
  130.185.123.21
@@ -17186,11 +21212,12 @@
  130.185.250.76
  130.185.73.131
  130.185.75.44
+130.185.76.142
  130.185.77.105
+130.185.77.218
  130.185.86.194
  130.185.90.151
  130.193.112.146
-130.193.45.10
  130.204.105.4
  130.204.161.3
  130.211.127.239
@@ -17224,6 +21251,8 @@
  130.61.118.231
  130.61.127.112
  130.61.134.151
+130.61.176.229
+130.61.227.100
  130.61.233.14
  130.61.255.187
  130.61.30.186
@@ -17237,10 +21266,12 @@
  130.61.92.43
  130.76.24.29
  130.83.160.187
+130.93.111.5
  130.zuole.ml
  1300345608.jclecardinal.com
  130163-dot-n-e-w-me-ss-age-po-rt-al.wl.r.appspot.com
  131-365.net
+131.0.112.23
  131.0.115.154
  131.0.115.214
  131.0.143.1
@@ -17250,6 +21281,8 @@
  131.0.246.157
  131.0.246.158
  131.0.87.225
+131.100.132.14
+131.100.137.152
  131.100.238.9
  131.100.239.122
  131.100.239.21
@@ -17270,16 +21303,19 @@
  131.153.22.134
  131.153.38.126
  131.153.49.120
+131.153.58.212
  131.161.10.200
  131.161.10.206
  131.161.10.232
  131.161.107.105
+131.161.108.161
  131.161.108.209
  131.161.11.198
  131.161.11.215
  131.161.11.226
  131.161.11.227
  131.161.11.234
+131.161.16.161
  131.161.189.120
  131.161.238.14
  131.161.253.190
@@ -17343,8 +21379,11 @@
  131.196.219.90
  131.196.253.95
  131.196.4.226
+131.196.86.34
  131.196.87.198
+131.196.94.26
  131.221.165.53
+131.221.167.16
  131.221.173.40
  131.221.183.5
  131.221.216.222
@@ -17356,14 +21395,20 @@
  131.221.217.152
  131.221.217.174
  131.221.217.176
+131.221.252.175
+131.221.253.104
+131.221.254.255
  131.221.42.94
  131.221.64.152
  131.221.73.86
  131.221.80.129
+131.255.202.137
+131.255.212.114
  131.255.32.45
  131.255.32.69
  131.255.4.96
  131.72.139.150
+131.72.201.88
  131.72.205.98
  131.94.129.191
  13123431043915105561.002.sh.cn
@@ -17371,16 +21416,31 @@
  1314520bet.com
  1314huadian.com
  131987449-518886016577583774.preview.editmysite.com
+132.145.111.129
  132.145.128.157
+132.145.154.95
+132.145.159.137
+132.145.165.79
  132.145.168.92
+132.145.203.69
+132.145.206.12
  132.145.210.51
+132.145.212.133
+132.145.242.131
  132.148.104.133
+132.148.104.135
+132.148.104.136
+132.148.104.29
+132.148.105.139
+132.148.121.32
  132.148.134.226
  132.148.141.147
  132.148.144.101
  132.148.153.156
  132.148.154.8
  132.148.159.44
+132.148.165.94
+132.148.166.225
  132.148.17.38
  132.148.22.79
  132.148.23.100
@@ -17389,37 +21449,70 @@
  132.148.42.109
  132.148.91.227
  132.148.99.126
+132.154.148.174
+132.157.129.169
+132.232.1.155
+132.232.10.144
  132.232.108.149
+132.232.112.96
+132.232.120.145
  132.232.137.62
  132.232.14.157
+132.232.143.211
+132.232.144.76
  132.232.155.123
  132.232.158.167
+132.232.160.102
+132.232.19.205
  132.232.2.100
+132.232.200.163
+132.232.21.175
+132.232.21.67
  132.232.230.220
  132.232.246.204
  132.232.251.171
  132.232.26.42
+132.232.3.234
+132.232.31.157
+132.232.31.9
+132.232.32.203
  132.232.33.160
+132.232.35.108
  132.232.35.70
+132.232.37.219
  132.232.38.147
+132.232.4.140
+132.232.4.33
  132.232.40.82
  132.232.46.202
  132.232.46.210
+132.232.47.203
  132.232.47.59
  132.232.49.143
  132.232.50.152
+132.232.57.135
+132.232.59.78
+132.232.6.207
+132.232.60.183
  132.232.66.128
+132.232.67.52
+132.232.68.138
  132.232.73.139
  132.232.75.211
  132.232.77.85
  132.232.79.194
+132.232.79.28
  132.232.80.76
+132.232.84.124
+132.232.84.44
  132.232.85.32
+132.232.87.247
  132.232.88.59
  132.232.89.186
  132.232.9.184
  132.232.93.220
  132.232.94.80
+132.232.97.167
  132.232.98.228
  132.248.117.152
  132.248.194.196
@@ -17431,6 +21524,7 @@
  132.255.109.228
  132.255.109.230
  132.255.110.195
+132.255.164.194
  132.255.21.58
  132.255.44.48
  132.255.94.2
@@ -17442,16 +21536,24 @@
  133.130.114.137
  133.130.115.132
  133.130.118.55
+133.130.118.86
+133.130.119.178
  133.130.121.37
  133.130.124.174
+133.130.124.231
  133.130.127.253
+133.130.55.94
  133.130.91.37
  133.130.97.166
  133.167.100.251
  133.167.105.83
  133.167.95.209
+133.18.66.114
+133.186.162.41
  133.205.118.202
  133.208.23.52
+133.242.155.85
+133.242.231.162
  133.242.48.68
  133.27.228.131
  133.86.253.49
@@ -17467,20 +21569,25 @@
  134.0.63.134
  134.102.228.73
  134.119.179.146
+134.119.189.121
  134.119.193.63
  134.119.218.243
  134.119.220.165
  134.119.220.174
  134.122.0.192
+134.122.1.37
  134.122.100.130
  134.122.103.69
  134.122.103.82
  134.122.11.47
+134.122.111.15
  134.122.112.132
  134.122.113.222
  134.122.115.191
  134.122.117.77
  134.122.118.167
+134.122.124.193
+134.122.126.36
  134.122.127.24
  134.122.13.183
  134.122.130.38
@@ -17490,9 +21597,14 @@
  134.122.15.36
  134.122.17.13
  134.122.17.146
+134.122.17.251
  134.122.177.32
+134.122.177.53
  134.122.178.61
  134.122.18.5
+134.122.19.204
+134.122.19.255
+134.122.20.138
  134.122.22.241
  134.122.25.101
  134.122.25.139
@@ -17506,23 +21618,35 @@
  134.122.38.58
  134.122.40.106
  134.122.40.31
+134.122.43.105
+134.122.44.197
+134.122.44.93
+134.122.46.215
  134.122.47.206
  134.122.5.122
  134.122.5.185
  134.122.54.200
  134.122.58.96
+134.122.62.253
+134.122.64.219
+134.122.69.50
  134.122.69.7
  134.122.72.221
+134.122.72.53
  134.122.77.215
+134.122.78.89
  134.122.81.145
  134.122.87.117
  134.122.9.108
  134.122.9.180
  134.122.90.113
+134.122.90.115
  134.122.94.113
  134.122.94.183
  134.122.95.167
  134.169.32.26
+134.17.128.171
+134.17.210.24
  134.17.26.116
  134.17.26.161
  134.17.5.55
@@ -17530,45 +21654,74 @@
  134.175.111.215
  134.175.118.218
  134.175.120.106
+134.175.121.80
  134.175.129.204
+134.175.13.243
+134.175.13.51
  134.175.130.52
+134.175.136.207
  134.175.137.69
  134.175.146.231
+134.175.147.117
+134.175.161.251
+134.175.17.32
+134.175.19.39
  134.175.197.170
  134.175.199.232
+134.175.2.7
+134.175.206.145
  134.175.217.161
  134.175.218.169
+134.175.218.239
  134.175.221.36
  134.175.223.22
+134.175.224.105
+134.175.227.112
+134.175.236.132
  134.175.236.187
+134.175.24.254
  134.175.244.158
  134.175.245.162
  134.175.28.62
  134.175.32.235
+134.175.37.159
+134.175.55.42
  134.175.59.225
  134.175.64.60
+134.175.70.122
  134.175.85.103
  134.175.90.111
  134.175.93.231
+134.19.146.45
  134.19.179.147
  134.19.254.2
  134.208.10.111
  134.209.100.103
  134.209.101.196
+134.209.102.56
  134.209.103.101
  134.209.103.181
  134.209.104.197
+134.209.106.118
  134.209.106.190
  134.209.107.228
+134.209.108.118
  134.209.109.149
  134.209.110.165
  134.209.112.164
+134.209.113.59
  134.209.114.69
  134.209.115.165
  134.209.117.155
  134.209.117.181
+134.209.123.101
+134.209.124.129
+134.209.126.170
+134.209.127.128
  134.209.144.106
  134.209.146.100
+134.209.148.107
+134.209.149.43
  134.209.150.87
  134.209.151.126
  134.209.151.96
@@ -17577,9 +21730,15 @@
  134.209.158.132
  134.209.158.177
  134.209.158.4
+134.209.159.76
  134.209.163.219
+134.209.164.184
+134.209.172.2
  134.209.176.202
+134.209.178.93
+134.209.179.57
  134.209.181.49
+134.209.181.85
  134.209.185.191
  134.209.185.4
  134.209.188.212
@@ -17602,13 +21761,17 @@
  134.209.223.214
  134.209.224.98
  134.209.226.191
+134.209.227.182
+134.209.228.253
  134.209.23.58
+134.209.234.130
  134.209.234.186
  134.209.236.154
  134.209.236.185
  134.209.236.191
  134.209.238.164
  134.209.241.217
+134.209.241.227
  134.209.241.87
  134.209.247.16
  134.209.248.200
@@ -17619,14 +21782,18 @@
  134.209.38.215
  134.209.39.6
  134.209.41.198
+134.209.53.17
  134.209.67.135
  134.209.67.45
  134.209.69.207
+134.209.7.179
  134.209.71.190
+134.209.72.96
  134.209.74.26
  134.209.75.47
  134.209.76.144
  134.209.79.199
+134.209.81.185
  134.209.82.166
  134.209.83.193
  134.209.84.223
@@ -17639,6 +21806,7 @@
  134.209.94.132
  134.209.96.131
  134.209.97.199
+134.209.98.180
  134.213.138.127
  134.213.138.137
  134.213.138.161
@@ -17651,6 +21819,7 @@
  134.236.0.243
  134.236.0.34
  134.236.116.176
+134.236.16.14
  134.236.16.234
  134.236.2.140
  134.236.2.231
@@ -17690,6 +21859,7 @@
  134.255.225.20
  134.3.227.7
  134.35.0.189
+134.35.0.45
  134.35.113.182
  134.35.117.108
  134.35.163.22
@@ -17705,11 +21875,18 @@
  134.41.59.199
  134.56.2.9
  134.73.199.154
+134.73.55.160
  134.90.149.147
+134.90.254.237
+134.93.54.61
  13453765871837679316.googlegroups.com
  134d384annuyy.000webhostapp.com
+135.0.15.16
  135.125.10.145
  135.125.137.236
+135.125.139.230
+135.125.140.11
+135.125.141.79
  135.125.20.71
  135.125.24.240
  135.125.91.32
@@ -17870,6 +22047,7 @@
  135.181.5.233
  135.181.92.33
  135.19.9.91
+135.23.117.89
  135.23.203.70
  135.23.228.90
  135.23.67.54
@@ -17877,6 +22055,7 @@
  135athome.com
  136.1.1.165
  136.1.1.173
+136.143.190.106
  136.143.43.222
  136.144.174.206
  136.144.174.208
@@ -17893,11 +22072,17 @@
  136.144.250.90
  136.144.54.195
  136.145.1.16
+136.158.29.39
+136.158.32.110
+136.158.32.233
+136.158.33.54
+136.158.34.141
  136.169.169.185
  136.169.169.203
  136.169.194.113
  136.169.224.150
  136.169.224.97
+136.185.56.115
  136.2.1.104
  136.2.1.164
  136.2.1.169
@@ -17908,12 +22093,17 @@
  136.228.129.48
  136.228.131.104
  136.228.160.250
+136.228.161.27
+136.228.161.67
  136.228.168.53
+136.232.124.14
  136.232.199.210
  136.232.209.70
+136.232.226.202
  136.232.236.6
  136.232.53.166
  136.233.23.226
+136.233.25.125
  136.24.119.249
  136.24.133.49
  136.24.8.157
@@ -17924,6 +22114,7 @@
  136.243.103.156
  136.243.103.164
  136.243.103.92
+136.243.105.202
  136.243.114.28
  136.243.117.85
  136.243.134.81
@@ -17938,6 +22129,7 @@
  136.243.174.119
  136.243.176.210
  136.243.201.249
+136.243.201.88
  136.243.203.184
  136.243.204.72
  136.243.21.253
@@ -17959,6 +22151,7 @@
  136.243.6.84
  136.243.60.74
  136.243.68.226
+136.243.70.135
  136.243.70.195
  136.243.88.216
  136.243.89.196
@@ -17983,10 +22176,12 @@
  136.33.238.17
  136.34.203.180
  136.34.243.158
+136.35.218.192
  136.35.54.2
  136.36.137.179
  136.37.176.126
  136.49.100.117
+136.49.130.150
  136.49.140.142
  136.49.222.221
  136.49.96.161
@@ -18011,15 +22206,19 @@
  136710.txtplug.com
  13699.wang
  137.101.44.149
+137.116.129.17
  137.116.133.111
  137.116.144.63
  137.116.84.38
+137.117.110.171
  137.117.168.216
+137.117.178.120
  137.117.21.137
  137.117.212.72
  137.117.226.185
  137.119.36.33
  137.119.52.140
+137.119.55.25
  137.135.101.9
  137.175.13.129
  137.175.13.130
@@ -18029,8 +22228,10 @@
  137.175.29.34
  137.175.30.220
  137.175.9.65
+137.186.222.112
  137.220.137.51
  137.220.175.190
+137.220.175.64
  137.220.178.33
  137.220.232.221
  137.220.233.54
@@ -18045,7 +22246,6 @@
  137.59.187.107
  137.59.187.126
  137.59.19.132
-137.59.228.108
  137.59.243.42
  137.59.253.52
  137.59.50.225
@@ -18057,17 +22257,23 @@
  137.74.112.95
  137.74.118.26
  137.74.119.116
+137.74.119.50
  137.74.130.174
  137.74.137.211
  137.74.148.93
  137.74.168.174
  137.74.169.241
+137.74.171.160
+137.74.173.182
  137.74.198.84
  137.74.199.180
  137.74.202.216
  137.74.206.56
+137.74.206.80
  137.74.21.195
+137.74.219.112
  137.74.219.113
+137.74.219.114
  137.74.219.115
  137.74.227.71
  137.74.230.184
@@ -18076,11 +22282,15 @@
  137.74.243.161
  137.74.254.198
  137.74.254.242
+137.74.28.175
  137.74.35.119
  137.74.4.69
+137.74.41.119
  137.74.64.237
  137.74.77.15
  137.74.80.246
+137.74.82.35
+137.74.82.45
  137.74.85.74
  13741.url.snwxn.com
  137645-securecheck-pp.icu
@@ -18089,31 +22299,41 @@
  138.0.207.18
  138.0.210.114
  138.0.219.62
+138.0.230.2
  138.0.230.49
  138.0.231.66
  138.117.143.226
  138.117.37.244
+138.117.78.75
  138.117.85.17
  138.117.85.97
  138.118.213.213
  138.118.224.36
+138.121.105.196
  138.121.113.164
  138.121.113.182
+138.121.128.19
  138.121.128.34
  138.121.170.141
+138.121.170.194
  138.121.198.90
+138.121.245.93
  138.121.32.133
  138.121.32.182
  138.121.73.54
  138.122.105.118
+138.122.108.87
+138.122.143.40
  138.122.148.209
  138.122.148.213
  138.122.192.199
  138.122.192.210
  138.122.192.22
  138.122.240.1
+138.122.39.237
  138.122.7.25
  138.122.7.33
+138.122.8.159
  138.122.8.49
  138.124.183.214
  138.128.0.236
@@ -18165,6 +22385,7 @@
  138.128.84.158
  138.128.84.159
  138.134.102.16
+138.185.193.33
  138.185.56.166
  138.186.122.105
  138.186.138.192
@@ -18177,6 +22398,7 @@
  138.186.138.65
  138.186.165.181
  138.186.4.153
+138.19.115.117
  138.197.10.226
  138.197.101.210
  138.197.102.39
@@ -18190,14 +22412,18 @@
  138.197.108.185
  138.197.109.6
  138.197.11.190
+138.197.110.170
  138.197.117.200
  138.197.12.159
  138.197.12.16
  138.197.12.166
  138.197.123.217
+138.197.129.38
  138.197.13.103
  138.197.13.47
  138.197.130.102
+138.197.130.138
+138.197.131.66
  138.197.132.117
  138.197.132.55
  138.197.135.102
@@ -18209,6 +22435,7 @@
  138.197.141.158
  138.197.141.162
  138.197.142.249
+138.197.142.81
  138.197.145.133
  138.197.146.121
  138.197.146.138
@@ -18216,20 +22443,27 @@
  138.197.148.66
  138.197.149.107
  138.197.149.119
+138.197.149.97
  138.197.15.19
  138.197.15.250
+138.197.15.40
  138.197.150.132
+138.197.151.125
+138.197.151.129
  138.197.151.213
  138.197.153.117
  138.197.153.151
  138.197.153.4
+138.197.157.206
  138.197.157.80
+138.197.159.143
  138.197.159.227
  138.197.161.118
  138.197.161.96
  138.197.162.193
  138.197.162.209
  138.197.163.127
+138.197.163.247
  138.197.163.59
  138.197.163.84
  138.197.165.64
@@ -18241,8 +22475,10 @@
  138.197.171.138
  138.197.171.66
  138.197.171.79
+138.197.172.32
  138.197.178.85
  138.197.179.100
+138.197.180.102
  138.197.180.164
  138.197.181.95
  138.197.183.168
@@ -18254,6 +22490,7 @@
  138.197.187.166
  138.197.187.241
  138.197.188.134
+138.197.19.166
  138.197.19.197
  138.197.190.145
  138.197.190.221
@@ -18263,7 +22500,9 @@
  138.197.2.46
  138.197.2.69
  138.197.200.113
+138.197.200.16
  138.197.200.62
+138.197.202.50
  138.197.202.82
  138.197.203.33
  138.197.204.28
@@ -18273,13 +22512,17 @@
  138.197.21.245
  138.197.211.83
  138.197.212.153
+138.197.212.204
+138.197.213.192
  138.197.213.248
  138.197.213.78
  138.197.215.116
  138.197.215.19
  138.197.215.65
  138.197.216.234
+138.197.217.164
  138.197.221.218
+138.197.222.211
  138.197.225.93
  138.197.231.81
  138.197.233.230
@@ -18293,19 +22536,24 @@
  138.197.3.159
  138.197.30.13
  138.197.35.217
+138.197.35.84
  138.197.38.119
+138.197.4.141
  138.197.41.104
  138.197.46.78
  138.197.47.199
  138.197.5.192
  138.197.62.15
+138.197.66.124
  138.197.66.68
  138.197.67.172
  138.197.67.193
+138.197.69.184
  138.197.7.123
  138.197.7.128
  138.197.7.63
  138.197.70.156
+138.197.71.27
  138.197.73.155
  138.197.77.159
  138.197.78.167
@@ -18316,12 +22564,14 @@
  138.197.96.114
  138.197.96.224
  138.197.97.134
+138.197.97.212
  138.197.97.88
  138.197.99.250
  138.199.14.134
  138.199.14.135
  138.199.14.136
  138.199.14.137
+138.199.14.142
  138.199.14.145
  138.199.18.113
  138.199.18.187
@@ -18363,12 +22613,18 @@
  138.201.58.141
  138.201.72.117
  138.201.92.208
+138.204.100.70
  138.204.127.1
  138.204.140.199
+138.204.143.82
+138.204.143.84
+138.204.143.85
  138.204.171.108
  138.204.179.162
  138.204.185.98
+138.204.195.185
  138.204.59.166
+138.204.78.248
  138.210.192.120
  138.210.193.11
  138.210.193.84
@@ -18385,6 +22641,8 @@
  138.229.234.41
  138.229.26.42
  138.238.248.233
+138.255.0.27
+138.255.148.35
  138.255.207.124
  138.255.227.17
  138.255.227.2
@@ -18392,7 +22650,10 @@
  138.255.227.9
  138.255.240.66
  138.36.158.61
+138.36.2.182
  138.36.22.108
+138.36.3.180
+138.36.3.4
  138.36.40.54
  138.36.41.116
  138.36.98.107
@@ -18403,6 +22664,7 @@
  138.59.143.203
  138.59.143.206
  138.59.168.70
+138.59.17.40
  138.59.176.243
  138.59.176.254
  138.59.18.110
@@ -18414,6 +22676,7 @@
  138.68.106.253
  138.68.106.62
  138.68.106.82
+138.68.109.96
  138.68.11.111
  138.68.110.166
  138.68.110.7
@@ -18429,6 +22692,7 @@
  138.68.137.177
  138.68.138.89
  138.68.14.104
+138.68.140.190
  138.68.140.38
  138.68.143.47
  138.68.148.177
@@ -18437,6 +22701,7 @@
  138.68.160.17
  138.68.162.85
  138.68.163.6
+138.68.167.109
  138.68.167.224
  138.68.167.64
  138.68.169.78
@@ -18452,6 +22717,7 @@
  138.68.181.0
  138.68.181.171
  138.68.182.102
+138.68.184.70
  138.68.187.12
  138.68.19.195
  138.68.2.156
@@ -18461,17 +22727,21 @@
  138.68.21.125
  138.68.224.230
  138.68.225.199
+138.68.226.175
  138.68.226.40
  138.68.227.243
  138.68.227.57
  138.68.23.64
  138.68.231.196
+138.68.232.19
+138.68.233.112
  138.68.234.185
  138.68.234.74
  138.68.236.111
  138.68.236.147
  138.68.236.50
  138.68.237.102
+138.68.238.242
  138.68.239.219
  138.68.24.249
  138.68.24.88
@@ -18483,6 +22753,7 @@
  138.68.245.255
  138.68.247.194
  138.68.250.106
+138.68.250.12
  138.68.250.124
  138.68.251.176
  138.68.251.30
@@ -18490,18 +22761,22 @@
  138.68.251.70
  138.68.253.149
  138.68.254.64
+138.68.255.120
  138.68.255.152
+138.68.255.17
  138.68.26.102
  138.68.27.152
  138.68.29.144
  138.68.30.47
  138.68.31.242
  138.68.4.8
+138.68.40.92
  138.68.43.106
  138.68.44.18
  138.68.45.97
  138.68.47.77
  138.68.48.244
+138.68.49.191
  138.68.50.177
  138.68.52.183
  138.68.52.34
@@ -18521,10 +22796,14 @@
  138.68.64.178
  138.68.65.159
  138.68.66.69
+138.68.68.141
  138.68.70.116
  138.68.72.162
+138.68.72.167
+138.68.75.113
  138.68.75.252
  138.68.76.39
+138.68.8.198
  138.68.8.225
  138.68.80.235
  138.68.81.162
@@ -18532,25 +22811,33 @@
  138.68.83.14
  138.68.84.249
  138.68.87.218
+138.68.87.65
  138.68.88.11
+138.68.88.243
  138.68.88.246
  138.68.89.69
  138.68.9.190
  138.68.9.246
+138.68.92.121
  138.68.93.12
  138.68.93.153
  138.68.93.86
+138.68.94.173
+138.68.95.204
  138.68.96.252
  138.68.97.63
  138.68.97.8
  138.68.98.102
  138.68.99.110
+138.68.99.131
+138.91.120.191
  138.91.145.18
  138.91.159.185
  138.91.162.26
  138.91.186.213
  138.91.255.66
  138.91.29.108
+138.91.35.54
  138.91.41.216
  138.91.48.77
  138.94.160.161
@@ -18592,8 +22879,15 @@
  138.97.244.130
  138.97.60.140
  138.97.60.141
-138.99.216.151
+138.97.64.20
+138.97.92.65
+138.97.93.248
+138.97.93.86
+138.97.93.9
+138.97.94.240
+138.97.94.65
  138.99.224.223
+138.99.6.177
  138.99.6.198
  138.99.7.29
  138.99.7.75
@@ -18612,43 +22906,84 @@
  139.0.6.36
  139.0.77.165
  139.129.206.8
+139.129.230.217
  139.130.206.73
  139.130.228.72
  139.130.233.254
  139.130.242.43
  139.153.255.107
+139.155.11.173
+139.155.11.230
  139.155.127.59
+139.155.13.21
+139.155.17.13
+139.155.17.18
+139.155.17.233
  139.155.17.74
+139.155.174.181
+139.155.175.148
+139.155.175.230
  139.155.180.144
  139.155.180.154
  139.155.181.145
  139.155.181.27
  139.155.182.156
+139.155.2.15
+139.155.2.183
+139.155.2.190
+139.155.2.218
+139.155.2.51
+139.155.2.6
+139.155.204.28
  139.155.225.13
+139.155.226.188
+139.155.229.38
+139.155.23.172
  139.155.231.29
+139.155.236.207
+139.155.236.78
+139.155.236.88
  139.155.237.8
  139.155.238.47
+139.155.24.139
+139.155.240.73
  139.155.242.183
+139.155.243.48
+139.155.243.80
  139.155.247.50
  139.155.248.142
+139.155.248.228
+139.155.251.145
+139.155.254.25
  139.155.254.64
  139.155.26.47
  139.155.29.40
+139.155.30.122
  139.155.34.16
+139.155.34.181
  139.155.35.220
  139.155.39.22
  139.155.42.189
+139.155.46.147
  139.155.5.247
  139.155.5.75
  139.155.54.93
  139.155.58.158
  139.155.59.176
  139.155.68.39
+139.155.69.205
+139.155.73.184
+139.155.73.2
  139.155.73.60
  139.155.74.147
+139.155.76.42
+139.155.77.44
  139.155.79.7
+139.155.84.160
+139.155.86.214
  139.155.87.149
  139.155.88.85
+139.155.89.13
  139.155.90.129
  139.159.1.1
  139.159.1.129
@@ -18676,6 +23011,7 @@
  139.162.121.170
  139.162.122.33
  139.162.124.224
+139.162.124.249
  139.162.127.185
  139.162.128.239
  139.162.13.177
@@ -18751,6 +23087,7 @@
  139.162.7.42
  139.162.70.46
  139.162.71.110
+139.162.75.112
  139.162.75.91
  139.162.76.176
  139.162.80.119
@@ -18763,6 +23100,12 @@
  139.162.90.81
  139.162.91.117
  139.162.97.52
+139.170.150.189
+139.170.150.250
+139.170.150.251
+139.170.150.252
+139.170.150.253
+139.170.150.254
  139.170.172.133
  139.170.174.16
  139.170.174.93
@@ -18798,42 +23141,93 @@
  139.180.229.61
  139.186.122.124
  139.186.122.17
+139.186.122.214
+139.186.132.63
  139.186.132.77
+139.186.136.121
  139.186.136.85
  139.186.141.11
  139.186.143.194
+139.186.155.116
+139.186.155.253
+139.186.161.167
  139.186.165.246
+139.186.171.130
+139.186.24.82
  139.186.4.114
  139.186.67.188
  139.186.67.94
  139.186.68.53
+139.186.71.117
  139.186.73.140
  139.186.74.211
+139.186.76.101
+139.186.77.46
+139.186.78.122
+139.186.82.39
+139.192.125.228
  139.193.151.58
  139.194.162.113
+139.196.202.131
  139.198.121.63
+139.198.122.116
+139.198.122.76
+139.198.125.248
  139.198.126.22
+139.198.17.31
+139.198.176.198
+139.198.177.151
+139.198.18.230
  139.198.188.180
  139.198.190.246
+139.198.191.86
+139.198.5.138
+139.198.5.79
  139.198.9.164
+139.199.1.166
  139.199.103.55
+139.199.106.235
+139.199.115.210
  139.199.119.76
  139.199.123.152
+139.199.126.221
  139.199.14.128
  139.199.16.213
  139.199.16.48
  139.199.160.102
  139.199.164.31
+139.199.18.200
+139.199.189.158
  139.199.200.182
  139.199.22.202
+139.199.223.208
  139.199.228.133
+139.199.23.233
+139.199.25.110
+139.199.29.155
+139.199.32.57
+139.199.35.168
+139.199.4.191
+139.199.4.219
+139.199.45.83
+139.199.5.50
+139.199.62.142
  139.199.65.226
+139.199.74.92
+139.199.80.67
+139.199.80.75
  139.199.87.1
  139.201.215.67
+139.210.243.37
  139.210.98.218
+139.213.220.70
+139.215.208.125
+139.215.217.180
+139.217.115.144
  139.217.119.86
  139.217.129.158
  139.217.134.138
+139.217.218.93
  139.217.7.111
  139.217.98.200
  139.219.0.158
@@ -18841,9 +23235,11 @@
  139.219.10.21
  139.219.109.226
  139.219.11.248
+139.219.11.254
  139.219.111.150
  139.219.12.104
  139.219.13.130
+139.219.130.173
  139.219.14.115
  139.219.14.180
  139.219.15.1
@@ -18875,6 +23271,7 @@
  139.219.9.60
  139.224.210.214
  139.224.72.224
+139.224.81.41
  139.227.201.157
  139.255.11.147
  139.255.116.122
@@ -18895,21 +23292,28 @@
  139.255.58.94
  139.255.69.149
  139.255.86.189
+139.255.87.213
  139.255.91.122
  139.255.94.122
  139.255.94.123
+139.28.219.244
+139.28.222.85
  139.28.38.80
  139.47.135.215
+139.47.90.78
  139.5.101.203
  139.5.132.105
  139.5.145.154
+139.5.151.78
  139.5.159.37
  139.5.16.174
  139.5.177.10
  139.5.177.73
  139.5.237.163
+139.5.26.224
  139.5.29.97
  139.5.75.3
+139.59.1.159
  139.59.1.162
  139.59.1.195
  139.59.10.90
@@ -18922,25 +23326,33 @@
  139.59.104.33
  139.59.105.246
  139.59.106.180
+139.59.107.167
  139.59.107.34
  139.59.108.233
+139.59.108.41
  139.59.109.146
  139.59.109.223
  139.59.11.101
  139.59.11.154
  139.59.11.82
  139.59.111.188
+139.59.112.146
  139.59.112.158
+139.59.112.44
+139.59.112.58
+139.59.114.231
  139.59.115.127
  139.59.115.44
  139.59.115.54
  139.59.116.242
  139.59.117.113
  139.59.118.220
+139.59.118.225
  139.59.118.3
  139.59.12.133
  139.59.12.197
  139.59.12.63
+139.59.12.65
  139.59.121.221
  139.59.121.225
  139.59.122.188
@@ -18948,13 +23360,18 @@
  139.59.123.2
  139.59.123.235
  139.59.125.61
+139.59.127.178
  139.59.128.39
  139.59.129.216
  139.59.129.44
+139.59.129.45
  139.59.130.184
  139.59.130.236
  139.59.133.198
+139.59.133.22
+139.59.134.64
  139.59.135.148
+139.59.135.84
  139.59.136.64
  139.59.136.84
  139.59.14.210
@@ -18965,6 +23382,7 @@
  139.59.145.220
  139.59.145.231
  139.59.146.28
+139.59.147.218
  139.59.148.209
  139.59.150.32
  139.59.152.176
@@ -18975,6 +23393,7 @@
  139.59.156.228
  139.59.158.239
  139.59.16.118
+139.59.161.78
  139.59.162.225
  139.59.162.37
  139.59.166.223
@@ -18993,6 +23412,7 @@
  139.59.182.171
  139.59.182.229
  139.59.183.231
+139.59.183.93
  139.59.185.173
  139.59.186.110
  139.59.186.178
@@ -19004,50 +23424,77 @@
  139.59.196.82
  139.59.197.250
  139.59.2.146
+139.59.2.181
  139.59.20.81
  139.59.209.158
+139.59.21.160
+139.59.212.98
+139.59.213.25
  139.59.215.185
+139.59.215.241
  139.59.22.194
  139.59.22.201
  139.59.225.255
  139.59.226.129
+139.59.226.224
+139.59.228.156
  139.59.228.20
+139.59.229.141
+139.59.230.202
  139.59.231.169
+139.59.233.36
  139.59.234.147
  139.59.234.48
  139.59.236.151
+139.59.236.25
  139.59.238.136
  139.59.239.13
  139.59.239.193
  139.59.239.38
  139.59.241.66
+139.59.241.75
  139.59.242.22
  139.59.242.50
+139.59.243.181
+139.59.244.237
  139.59.244.238
+139.59.245.17
  139.59.247.235
-139.59.248.103
  139.59.248.126
+139.59.248.243
+139.59.249.95
  139.59.25.153
+139.59.250.118
  139.59.251.156
  139.59.251.222
+139.59.253.117
+139.59.253.210
  139.59.255.101
  139.59.255.97
  139.59.26.39
+139.59.26.6
  139.59.27.80
  139.59.29.55
  139.59.3.114
+139.59.31.173
  139.59.31.28
+139.59.32.156
  139.59.35.52
  139.59.37.245
+139.59.38.252
  139.59.39.109
  139.59.39.169
  139.59.39.170
+139.59.39.185
  139.59.4.21
  139.59.40.187
  139.59.40.233
  139.59.43.246
  139.59.43.75
+139.59.44.143
  139.59.45.128
+139.59.46.124
+139.59.46.243
  139.59.46.79
  139.59.46.88
  139.59.47.192
@@ -19055,39 +23502,54 @@
  139.59.56.121
  139.59.56.149
  139.59.57.2
+139.59.57.39
  139.59.59.187
  139.59.60.154
  139.59.60.244
  139.59.61.103
  139.59.61.186
  139.59.61.215
+139.59.61.77
  139.59.62.222
  139.59.65.77
+139.59.66.145
  139.59.66.248
  139.59.66.79
  139.59.67.118
+139.59.67.82
  139.59.68.61
+139.59.68.67
+139.59.69.76
+139.59.7.177
  139.59.7.208
+139.59.7.251
  139.59.70.186
+139.59.70.21
  139.59.70.248
  139.59.70.72
  139.59.72.96
+139.59.73.64
+139.59.75.162
  139.59.78.248
  139.59.79.207
  139.59.79.56
-139.59.8.10
  139.59.80.147
+139.59.80.88
  139.59.81.182
  139.59.83.117
+139.59.84.29
  139.59.85.160
  139.59.85.252
  139.59.87.254
  139.59.88.246
+139.59.88.86
  139.59.90.148
+139.59.92.213
  139.59.92.53
  139.59.92.87
  139.59.94.33
  139.59.95.250
+139.59.96.50
  139.59.99.11
  139.60.123.89
  139.60.183.10
@@ -19113,12 +23575,15 @@
  139.99.133.150
  139.99.133.189
  139.99.133.226
+139.99.148.4
  139.99.155.187
  139.99.156.128
  139.99.158.11
  139.99.172.11
  139.99.176.63
  139.99.180.74
+139.99.185.81
+139.99.196.183
  139.99.20.49
  139.99.20.51
  139.99.210.46
@@ -19126,7 +23591,10 @@
  139.99.219.208
  139.99.236.237
  139.99.237.109
+139.99.237.135
  139.99.237.60
+139.99.239.230
+139.99.248.195
  139.99.26.68
  139.99.37.27
  139.99.40.151
@@ -19134,14 +23602,20 @@
  139.99.42.75
  139.99.43.235
  139.99.48.136
+139.99.49.202
  139.99.5.210
  139.99.54.20
+139.99.61.82
  139.99.66.231
  139.99.69.189
  139.99.79.185
  139.99.8.31
  139.99.89.202
+139.99.90.180
+139.99.91.136
+139.99.96.147
  139.99.98.191
+139.99.98.248
  13960999999.mer.lstest.siquality.com
  139644804765798-dot-we-secure-file-sh4456.appspot.com
  139banjia.com
@@ -19157,10 +23631,13 @@
  13r.lg.ua
  13stages.com
  13suntrust4.7m.pl
+14.0.18.201
+14.0.18.254
  14.102.113.39
  14.102.121.156
  14.102.150.246
  14.102.154.66
+14.102.30.157
  14.102.39.33
  14.102.40.169
  14.102.41.253
@@ -19178,6 +23655,12 @@
  14.102.73.254
  14.102.74.99
  14.102.97.204
+14.11.128.0
+14.116.149.110
+14.116.155.53
+14.118.212.141
+14.118.214.55
+14.120.35.139
  14.128.33.3
  14.128.9.199
  14.128.9.202
@@ -19190,6 +23673,7 @@
  14.128.9.48
  14.128.9.51
  14.128.9.53
+14.136.104.38
  14.136.192.222
  14.136.201.82
  14.136.204.41
@@ -19206,58 +23690,119 @@
  14.139.244.116
  14.139.56.14
  14.139.57.195
+14.140.244.64
+14.140.95.157
  14.141.175.107
  14.141.232.124
  14.141.61.171
  14.141.73.10
  14.141.93.162
  14.142.128.237
+14.142.143.138
  14.142.20.142
+14.143.137.18
+14.143.3.30
+14.146.95.68
  14.152.101.53
-14.154.30.133
+14.153.79.23
  14.154.30.138
+14.154.31.31
  14.155.221.44
+14.156.201.80
+14.160.224.54
  14.160.23.139
+14.160.25.250
+14.160.70.178
  14.160.93.230
  14.161.0.62
+14.161.1.128
  14.161.14.44
  14.161.22.255
  14.161.22.85
  14.161.29.242
  14.161.30.236
+14.161.43.183
  14.161.44.120
  14.161.45.187
  14.161.46.132
+14.161.47.101
  14.161.47.128
  14.161.47.64
  14.161.48.145
  14.161.48.201
  14.161.48.4
+14.161.50.104
+14.161.50.23
+14.161.6.201
+14.162.136.147
  14.162.144.102
  14.162.145.182
  14.162.146.128
+14.162.146.216
+14.162.146.31
  14.162.146.38
+14.162.167.216
+14.162.171.221
+14.162.222.247
+14.163.12.30
+14.163.249.24
  14.165.164.42
  14.165.185.60
  14.165.187.233
+14.165.207.61
+14.166.6.86
  14.167.113.121
+14.167.16.108
+14.167.92.236
+14.169.152.6
+14.169.215.58
+14.169.236.33
+14.17.114.29
+14.17.114.65
+14.172.33.115
+14.174.55.174
  14.176.168.170
+14.177.146.143
  14.177.156.159
+14.177.220.214
+14.177.230.27
+14.177.232.93
  14.177.235.178
+14.177.66.248
+14.177.69.17
+14.178.138.246
  14.178.31.182
  14.178.39.68
  14.179.187.49
  14.179.224.67
+14.179.78.219
+14.18.144.234
+14.180.253.160
+14.183.193.209
+14.185.61.97
  14.185.75.76
  14.185.95.87
  14.186.170.4
+14.186.237.237
+14.186.239.111
+14.186.50.78
+14.186.62.70
+14.187.150.77
  14.188.208.138
  14.188.30.156
+14.188.49.204
  14.189.198.194
+14.189.235.86
  14.189.39.219
  14.190.200.107
+14.191.175.31
+14.191.18.10
+14.191.70.24
+14.191.87.4
+14.191.92.215
  14.192.10.189
-14.192.2.131
+14.192.192.17
+14.192.213.169
  14.192.248.5
  14.192.31.17
  14.192.31.4
@@ -19265,12 +23810,13 @@
  14.198.163.2
  14.200.1.238
  14.200.103.203
+14.200.136.36
  14.200.197.130
  14.201.234.2
  14.202.250.110
  14.203.57.50
+14.204.145.108
  14.204.5.250
-14.205.201.218
  14.207.125.162
  14.207.127.163
  14.207.137.230
@@ -19281,6 +23827,7 @@
  14.207.178.61
  14.207.182.87
  14.207.203.53
+14.207.204.183
  14.207.21.31
  14.207.23.83
  14.207.30.249
@@ -19298,24 +23845,38 @@
  14.212.249.100
  14.213.136.17
  14.213.138.194
+14.215.113.59
  14.215.158.100
  14.215.166.15
  14.215.166.17
  14.215.166.18
  14.215.166.25
  14.215.237.205
+14.219.237.90
+14.221.97.232
  14.225.17.9
+14.225.27.115
  14.225.27.184
  14.225.3.47
+14.225.5.46
  14.225.5.81
  14.225.7.144
  14.225.7.177
  14.225.7.199
+14.226.215.155
+14.226.92.14
  14.227.60.248
  14.227.89.44
-14.229.30.241
  14.229.62.205
+14.23.109.6
+14.23.170.234
  14.23.44.10
+14.230.253.146
+14.231.110.106
+14.231.173.82
+14.232.152.158
+14.232.152.66
+14.232.155.202
  14.232.155.45
  14.232.160.197
  14.232.160.247
@@ -19323,31 +23884,75 @@
  14.232.161.29
  14.232.163.52
  14.232.214.138
+14.232.214.184
  14.232.244.96
  14.232.245.245
+14.232.42.59
+14.232.99.42
  14.233.12.221
  14.233.138.195
+14.233.186.178
+14.234.120.242
+14.234.74.126
+14.236.15.20
+14.237.144.252
+14.238.1.202
+14.239.103.236
+14.239.18.97
+14.239.74.99
  14.240.250.212
  14.240.78.4
  14.241.142.119
  14.241.209.27
+14.241.226.240
  14.241.236.73
+14.241.238.27
  14.241.239.2
+14.241.239.89
+14.241.240.0
+14.241.244.139
+14.241.245.179
+14.241.252.19
  14.241.38.109
  14.241.91.96
+14.243.225.159
  14.244.215.32
  14.244.24.204
+14.244.252.41
+14.244.39.69
  14.245.127.181
+14.245.186.73
+14.245.205.115
+14.245.81.123
+14.245.95.156
+14.246.178.111
+14.247.17.201
  14.248.137.211
+14.248.144.143
+14.248.155.2
+14.248.72.21
  14.248.83.2
+14.249.53.238
+14.250.17.149
+14.251.159.93
  14.252.170.203
+14.253.130.98
+14.253.228.5
  14.253.57.18
+14.254.54.109
  14.254.87.195
  14.29.126.53
+14.29.162.139
+14.29.184.45
  14.29.247.69
+14.29.249.7
  14.29.254.239
  14.29.64.91
+14.32.164.26
+14.33.45.230
  14.33.77.170
+14.34.110.33
+14.36.52.211
  14.37.160.130
  14.37.43.23
  14.37.55.165
@@ -19360,39 +23965,54 @@
  14.42.89.179
  14.43.139.13
  14.43.191.134
+14.44.12.71
+14.45.11.198
  14.46.12.180
  14.46.12.180bin.sh
  14.46.190.42bin.sh
  14.46.230.78
  14.46.98.250
  14.47.124.192
-14.48.216.78
  14.48.96.34
  14.49.126.121
  14.49.37.103
  14.49.37.250
+14.50.240.77
  14.51.6.13
  14.51.6.13bin.sh
  14.52.178.230
+14.52.249.27
  14.54.148.146
  14.54.16.206
  14.55.129.168
+14.56.180.103
  14.63.1.108
  14.63.160.219
+14.63.162.167
+14.63.162.98
  14.63.165.206
+14.63.168.68
+14.63.174.149
  14.63.175.171
  14.63.214.76
  14.63.218.195
+14.63.222.63
  14.63.228.217
  14.63.55.164
  14.63.68.207
  14.63.9.114
  14.80.204.79
+14.9.128.160
  14.91.62.163
  14.97.1.154
+14.98.112.142
  14.98.4.82
  14.98.82.230
+14.99.117.194
+14.99.117.230
  14.99.140.82
+14.99.154.242
+14.99.176.210
  14.99.233.222
  14.99.81.218
  14.ip-51-178-42.eu
@@ -19403,49 +24023,102 @@
  140.115.50.187
  140.128.85.2
  140.136.131.230
+140.143.0.121
+140.143.10.69
+140.143.10.92
+140.143.11.127
+140.143.12.140
+140.143.122.89
  140.143.134.171
+140.143.136.103
  140.143.136.41
  140.143.136.89
  140.143.14.232
  140.143.14.71
  140.143.144.140
+140.143.152.200
+140.143.155.17
  140.143.167.250
+140.143.18.2
+140.143.183.71
+140.143.186.138
+140.143.187.21
  140.143.187.54
  140.143.189.29
+140.143.19.214
  140.143.19.237
  140.143.19.50
  140.143.193.52
+140.143.195.157
+140.143.195.181
  140.143.195.189
  140.143.20.42
  140.143.200.251
+140.143.201.190
+140.143.206.191
  140.143.207.57
  140.143.208.113
+140.143.210.92
  140.143.222.87
+140.143.226.19
  140.143.228.18
+140.143.228.67
  140.143.229.224
+140.143.230.109
+140.143.230.28
  140.143.231.143
+140.143.231.85
+140.143.233.218
  140.143.233.29
+140.143.235.78
  140.143.236.227
+140.143.239.72
+140.143.239.86
  140.143.24.254
+140.143.244.192
  140.143.244.87
  140.143.248.32
+140.143.249.226
+140.143.249.234
+140.143.251.239
  140.143.28.158
  140.143.30.191
  140.143.31.202
+140.143.31.73
+140.143.32.232
+140.143.33.147
  140.143.35.181
+140.143.35.68
+140.143.39.177
+140.143.39.200
+140.143.46.240
+140.143.5.181
+140.143.56.61
  140.143.57.159
+140.143.57.195
+140.143.57.203
+140.143.57.32
+140.143.88.110
  140.143.9.175
+140.143.90.154
+140.143.95.102
  140.147.236.194
  140.186.212.146
  140.190.17.138
  140.190.21.8
  140.203.155.11
+140.206.118.82
  140.206.157.242
+140.206.223.29
  140.206.242.34
+140.206.72.238
  140.206.86.124
  140.206.86.125
+140.207.100.82
+140.207.232.13
  140.207.232.28
  140.207.96.235
+140.210.92.148
  140.210.92.82
  140.213.179.250
  140.227.127.173
@@ -19461,14 +24134,26 @@
  140.227.236.123
  140.237.12.41
  140.237.255.239
+140.238.14.170
+140.238.152.228
  140.238.177.23
  140.238.177.83
  140.238.188.191
  140.238.229.179
+140.238.240.36
+140.238.244.154
+140.238.49.143
  140.238.69.224
  140.238.96.22
+140.240.114.43
+140.240.38.247
  140.240.81.70
+140.249.17.94
+140.249.19.110
+140.249.193.85
  140.249.205.149
+140.249.213.243
+140.249.48.49
  140.255.142.216
  140.78.60.4
  140.82.28.35
@@ -19478,6 +24163,8 @@
  140.82.43.118
  140.82.56.206
  140.82.8.73
+140.86.12.31
+140.86.39.162
  140168.com
  1405531464.rsc.cdn77.org
  14062015.yolasite.com
@@ -19521,10 +24208,15 @@
  141.101.99.61
  141.105.132.43
  141.105.65.254
+141.105.65.99
  141.105.68.25
  141.105.69.69
  141.108.255.109
+141.134.106.82
  141.135.2.95
+141.138.136.175
+141.138.32.172
+141.138.46.183
  141.151.238.103
  141.154.76.46
  141.164.56.244
@@ -19535,6 +24227,8 @@
  141.223.82.138
  141.223.82.61
  141.226.122.122
+141.226.151.32
+141.226.9.44
  141.239.148.100
  141.255.146.43
  141.255.147.75
@@ -19542,10 +24236,10 @@
  141.255.151.143
  141.255.152.33
  141.255.153.173
+141.255.155.25
  141.255.155.71
  141.255.157.130
  141.255.166.190
-141.255.186.135
  141.8.143.138
  141.8.143.163
  141.8.143.191
@@ -19556,22 +24250,50 @@
  141.8.225.190
  141.8.55.249bin.sh
  141.89.97.31
+141.98.10.0
+141.98.10.136
+141.98.10.143
+141.98.10.183
+141.98.10.209
  141.98.10.210
+141.98.10.211
+141.98.10.212
+141.98.10.213
+141.98.10.214
+141.98.10.43
  141.98.10.59
  141.98.100.74
  141.98.100.78
  141.98.100.86
  141.98.100.93
+141.98.103.140
  141.98.103.39
  141.98.252.163
  141.98.252.168
  141.98.255.143
+141.98.80.100
+141.98.80.101
  141.98.80.102
-141.98.80.242
+141.98.80.29
+141.98.80.59
+141.98.80.60
+141.98.80.63
+141.98.80.64
+141.98.80.65
+141.98.80.68
  141.98.80.69
+141.98.80.70
  141.98.80.71
  141.98.80.82
+141.98.80.83
  141.98.80.85
+141.98.80.88
+141.98.80.89
+141.98.80.90
+141.98.80.91
+141.98.80.92
+141.98.80.93
+141.98.80.99
  1412studiodm.com
  14170.8wix.com
  14198.com
@@ -19621,9 +24343,12 @@
  142.11.245.80
  142.11.249.206
  142.11.249.56
+142.11.65.48
  142.111.93.88
  142.111.93.92
  142.112.212.166
+142.112.81.183
+142.113.242.241
  142.118.170.95
  142.126.166.36
  142.126.189.53
@@ -19634,6 +24359,7 @@
  142.162.94.149
  142.165.133.55
  142.169.145.97
+142.179.224.4
  142.190.28.198
  142.202.191.182
  142.202.205.28
@@ -19642,35 +24368,51 @@
  142.4.109.196
  142.4.119.11
  142.4.16.20
+142.4.197.12
+142.4.197.80
  142.4.209.205
  142.4.211.170
+142.4.212.121
+142.4.214.151
  142.4.215.194
+142.4.223.125
  142.4.223.249
  142.4.23.62
  142.4.26.59
+142.4.4.229
+142.4.6.57
  142.4.9.189
  142.44.133.80
  142.44.139.12
  142.44.142.126
  142.44.146.33
  142.44.156.131
+142.44.160.40
+142.44.161.132
  142.44.161.141
+142.44.162.161
  142.44.162.232
  142.44.166.21
  142.44.167.113
  142.44.173.131
  142.44.173.134
  142.44.175.134
+142.44.179.150
  142.44.184.205
  142.44.211.179
+142.44.211.27
  142.44.211.57
+142.44.218.192
  142.44.222.33
  142.44.222.35
  142.44.232.99
+142.44.234.249
  142.44.241.142
  142.44.246.156
  142.44.247.154
+142.44.247.57
  142.44.247.60
+142.47.219.175
  142.47.96.16
  142.54.161.10
  142.54.164.58
@@ -19700,6 +24442,7 @@
  142.93.1.168
  142.93.100.171
  142.93.101.111
+142.93.101.148
  142.93.102.204
  142.93.104.92
  142.93.105.212
@@ -19707,6 +24450,7 @@
  142.93.106.171
  142.93.106.250
  142.93.106.56
+142.93.107.175
  142.93.108.8
  142.93.109.2
  142.93.109.28
@@ -19719,6 +24463,9 @@
  142.93.116.106
  142.93.116.254
  142.93.118.23
+142.93.118.252
+142.93.120.178
+142.93.121.47
  142.93.122.167
  142.93.122.58
  142.93.124.101
@@ -19730,9 +24477,11 @@
  142.93.137.184
  142.93.138.116
  142.93.143.85
+142.93.145.85
  142.93.146.198
  142.93.147.210
  142.93.148.250
+142.93.152.19
  142.93.159.172
  142.93.160.101
  142.93.162.220
@@ -19741,7 +24490,9 @@
  142.93.172.70
  142.93.178.254
  142.93.179.74
+142.93.18.203
  142.93.181.21
+142.93.181.37
  142.93.182.82
  142.93.183.4
  142.93.187.214
@@ -19750,9 +24501,11 @@
  142.93.191.96
  142.93.193.198
  142.93.194.76
+142.93.195.157
  142.93.196.13
  142.93.197.100
  142.93.197.12
+142.93.197.186
  142.93.198.209
  142.93.200.9
  142.93.201.1
@@ -19760,16 +24513,23 @@
  142.93.202.228
  142.93.202.94
  142.93.203.102
+142.93.205.234
  142.93.206.202
  142.93.207.94
  142.93.208.24
  142.93.21.188
  142.93.210.229
+142.93.211.36
+142.93.212.10
+142.93.212.91
  142.93.213.254
  142.93.213.91
+142.93.215.19
  142.93.215.211
+142.93.216.97
  142.93.222.121
  142.93.223.118
+142.93.223.152
  142.93.224.234
  142.93.225.68
  142.93.228.111
@@ -19792,10 +24552,13 @@
  142.93.245.253
  142.93.248.50
  142.93.250.60
+142.93.251.1
+142.93.253.189
  142.93.255.200
  142.93.3.119
  142.93.30.86
  142.93.32.85
+142.93.34.237
  142.93.35.169
  142.93.35.230
  142.93.37.1
@@ -19811,12 +24574,14 @@
  142.93.49.148
  142.93.50.179
  142.93.50.47
+142.93.52.3
  142.93.57.255
  142.93.58.103
  142.93.58.113
  142.93.58.235
  142.93.6.38
  142.93.60.249
+142.93.63.163
  142.93.65.9
  142.93.67.236
  142.93.68.136
@@ -19825,9 +24590,12 @@
  142.93.70.115
  142.93.70.145
  142.93.72.101
+142.93.72.20
  142.93.72.206
  142.93.72.250
+142.93.78.168
  142.93.79.125
+142.93.8.99
  142.93.85.123
  142.93.85.206
  142.93.85.97
@@ -19842,14 +24610,19 @@
  142.93.98.195
  142.ip-164-132-197.eu
  1423-thurman.com
+143.0.177.189
  143.0.177.198
  143.0.178.142
  143.0.179.55
  143.0.85.206
  143.0.87.101
  143.110.128.19
+143.110.137.82
+143.110.144.139
+143.110.146.52
  143.110.147.13
  143.110.151.242
+143.110.153.150
  143.110.157.115
  143.110.157.215
  143.110.158.176
@@ -19863,8 +24636,13 @@
  143.110.178.115
  143.110.178.161
  143.110.179.108
+143.110.182.219
+143.110.182.228
  143.110.182.24
-143.110.191.207
+143.110.182.53
+143.110.184.88
+143.110.188.7
+143.110.190.26
  143.110.208.158
  143.110.210.25
  143.110.216.174
@@ -19880,13 +24658,17 @@
  143.110.240.26
  143.110.240.87
  143.110.240.88
+143.110.242.178
  143.110.245.138
  143.110.246.46
+143.110.248.206
+143.110.248.63
  143.110.250.161
  143.110.252.118
  143.110.252.124
  143.110.252.127
  143.110.253.196
+143.110.255.26
  143.125.235.2
  143.137.125.74
  143.137.125.82
@@ -19896,8 +24678,10 @@
  143.137.127.46
  143.137.130.1
  143.159.142.54
+143.159.15.103
  143.159.73.171
  143.176.224.104
+143.178.100.54
  143.178.139.0
  143.178.39.248
  143.178.44.93
@@ -19907,6 +24691,7 @@
  143.202.136.55
  143.202.154.37
  143.202.160.10
+143.202.189.217
  143.202.226.149
  143.202.226.151
  143.202.226.21
@@ -19915,8 +24700,11 @@
  143.202.227.191
  143.202.227.34
  143.202.227.4
+143.202.78.71
  143.202.97.193
  143.208.236.204
+143.208.248.135
+143.208.249.223
  143.208.71.174
  143.225.81.253
  143.244.39.158
@@ -19927,16 +24715,24 @@
  143.244.41.59
  143.244.43.151
  143.244.43.91
+143.244.51.84
  143.244.54.16
  143.244.54.160
  143.244.54.36
  143.244.54.86
+143.244.56.227
+143.244.57.105
+143.244.57.113
+143.244.57.115
+143.244.57.123
  143.244.57.155
+143.244.57.74
  143.248.144.60
  143.248.194.113
  143.255.108.173
  143.255.111.32
  143.255.128.38
+143.255.130.2
  143.255.140.164
  143.255.140.232
  143.255.142.80
@@ -19948,20 +24744,27 @@
  143.255.52.67
  143.255.54.245
  143.255.86.242
+143.59.208.91
  143.89.60.134
  143.92.36.9
+143.92.46.176
+143.92.47.107
+143.92.47.28
  143.92.51.12
  143.92.51.14
  143.92.51.20
+143.92.51.26
  143.92.51.87
  143.92.51.90
  143.92.51.91
  143.92.51.93
  143.92.61.230
  143.95.101.72
+143.95.146.76
  143.95.156.174
  144.121.29.100
  144.123.160.137
+144.123.160.165
  144.123.5.178
  144.126.197.136
  144.126.199.235
@@ -20004,6 +24807,7 @@
  144.168.41.158
  144.168.45.117
  144.168.56.130
+144.168.57.89
  144.168.60.97
  144.168.62.196
  144.168.62.56
@@ -20063,17 +24867,26 @@
  144.208.65.145
  144.217.10.149
  144.217.101.245
+144.217.103.195
  144.217.105.118
  144.217.105.209
  144.217.117.146
+144.217.117.22
  144.217.12.237
  144.217.12.95
  144.217.128.227
+144.217.129.123
+144.217.129.132
+144.217.129.143
+144.217.129.146
+144.217.129.148
  144.217.13.109
  144.217.13.183
  144.217.13.40
  144.217.145.161
  144.217.145.167
+144.217.146.173
+144.217.15.88
  144.217.156.94
  144.217.160.111
  144.217.161.136
@@ -20087,10 +24900,13 @@
  144.217.207.37
  144.217.240.89
  144.217.241.5
+144.217.243.216
+144.217.243.76
  144.217.245.243
  144.217.252.18
  144.217.29.74
  144.217.32.16
+144.217.50.88
  144.217.54.7
  144.217.60.211
  144.217.60.239
@@ -20104,25 +24920,35 @@
  144.217.83.225
  144.217.84.164
  144.217.84.165
+144.217.85.4
  144.217.87.192
  144.217.87.197
  144.217.89.55
-144.255.242.195
+144.34.130.253
  144.34.144.21
  144.34.161.44
  144.34.161.65
  144.34.162.249
+144.34.163.191
  144.34.172.241
+144.34.178.90
+144.34.182.70
  144.34.184.20
+144.34.192.10
  144.34.192.154
+144.34.193.3
  144.34.193.83
  144.34.196.101
  144.34.201.197
+144.34.226.207
+144.34.234.6
+144.34.240.47
  144.34.248.219
  144.48.106.61
  144.48.109.179
  144.48.109.180
  144.48.109.182
+144.48.168.133
  144.48.170.146
  144.48.220.43
  144.48.220.44
@@ -20130,6 +24956,7 @@
  144.48.221.29
  144.48.221.49
  144.48.221.67
+144.48.227.74
  144.48.241.192
  144.48.242.129
  144.48.242.97
@@ -20137,6 +24964,7 @@
  144.48.243.234
  144.48.9.159
  144.48.9.207
+144.64.59.185
  144.7.116.1
  144.76.1.155
  144.76.1.20
@@ -20230,7 +25058,6 @@
  144.76.99.207
  144.91.101.253
  144.91.104.155
-144.91.106.227
  144.91.110.244
  144.91.111.114
  144.91.116.126
@@ -20239,10 +25066,12 @@
  144.91.117.153
  144.91.120.44
  144.91.121.51
+144.91.125.183
  144.91.66.137
  144.91.67.109
  144.91.67.228
  144.91.69.193
+144.91.70.164
  144.91.70.224
  144.91.73.41
  144.91.80.213
@@ -20250,6 +25079,7 @@
  144.91.82.22
  144.91.89.19
  144.91.90.131
+144.91.94.247
  144.91.95.185
  1441518k4-85975353079.us-south.cf.appdomain.cloud
  1445.3190cfdae.com
@@ -20262,8 +25092,10 @@
  145.14.25.172
  145.239.0.81
  145.239.1.94
+145.239.10.50
  145.239.103.151
  145.239.11.53
+145.239.116.202
  145.239.119.216
  145.239.120.129
  145.239.121.218
@@ -20275,20 +25107,27 @@
  145.239.144.2
  145.239.144.32
  145.239.168.121
+145.239.174.59
  145.239.176.47
  145.239.184.38
  145.239.188.142
  145.239.19.186
+145.239.205.26
  145.239.209.0
  145.239.21.235
  145.239.211.242
  145.239.22.247
+145.239.224.31
  145.239.225.127
  145.239.23.224
+145.239.233.162
  145.239.237.15
  145.239.25.92
  145.239.252.230
  145.239.254.226
+145.239.28.197
+145.239.29.217
+145.239.31.157
  145.239.35.192
  145.239.41.151
  145.239.41.157
@@ -20306,13 +25145,17 @@
  145.239.82.168
  145.239.82.192
  145.239.82.229
+145.239.87.224
+145.239.88.43
  145.239.9.3
+145.239.91.134
  145.239.91.191
  145.239.91.37
  145.239.91.73
  145.239.92.26
  145.239.95.15
  145.239.95.219
+145.239.95.241
  145.24.145.107
  145.249.104.36
  145.249.105.152
@@ -20333,12 +25176,14 @@
  145.255.4.150
  145.31cf4fdae.com
  145.40.27.154
+145.40.33.205
  145.53.202.234
  145.90.67.113
  145.90.90.231
  1451.31cf4fdae.com
  1455signinservice.com
  14577.000webhostapp.com
+146.0.228.30
  146.0.36.43
  146.0.36.52
  146.0.43.105
@@ -20371,6 +25216,7 @@
  146.148.22.0
  146.148.34.127
  146.148.53.217
+146.148.60.173
  146.148.62.138
  146.148.74.142
  146.148.81.93
@@ -20378,7 +25224,10 @@
  146.148.86.107
  146.148.88.9
  146.148.90.200
+146.148.94.196
  146.158.130.171
+146.158.16.71
+146.158.214.53
  146.158.4.134
  146.164.54.5
  146.168.111.70
@@ -20386,6 +25235,7 @@
  146.185.128.152
  146.185.129.107
  146.185.129.182
+146.185.130.101
  146.185.130.42
  146.185.131.234
  146.185.131.246
@@ -20405,6 +25255,7 @@
  146.185.146.99
  146.185.147.204
  146.185.147.59
+146.185.148.200
  146.185.149.93
  146.185.150.186
  146.185.151.234
@@ -20414,6 +25265,7 @@
  146.185.157.163
  146.185.158.100
  146.185.158.146
+146.185.159.124
  146.185.160.47
  146.185.163.122
  146.185.163.81
@@ -20424,6 +25276,7 @@
  146.185.169.12
  146.185.170.116
  146.185.170.225
+146.185.172.229
  146.185.180.57
  146.185.182.59
  146.185.200.104
@@ -20483,8 +25336,10 @@
  146.185.253.157
  146.196.108.78
  146.196.32.68
+146.196.33.169
  146.196.52.200
  146.196.55.156
+146.196.60.58
  146.196.63.192
  146.196.63.66
  146.196.63.89
@@ -20501,39 +25356,60 @@
  146.247.158.29
  146.247.158.29bin.sh
  146.255.24.28
+146.255.74.174
  146.255.96.214
  146.255.97.121
  146.52.147.127
  146.52.16.170
+146.56.192.231
  146.56.195.192
  146.56.197.217
  146.56.198.246
  146.56.201.178
  146.56.201.34
+146.56.203.31
  146.56.205.154
+146.56.206.116
+146.56.216.83
  146.56.219.98
+146.56.221.75
  146.56.222.82
+146.56.226.92
+146.56.229.128
  146.56.231.240
  146.56.244.190
+146.56.246.34
+146.56.247.206
+146.56.248.232
  146.56.248.37
  146.59.146.249
  146.59.150.236
  146.59.153.183
+146.59.153.186
  146.59.153.187
+146.59.153.189
  146.59.153.190
  146.59.153.192
+146.59.154.120
+146.59.154.68
+146.59.155.106
  146.59.155.27
  146.59.155.42
  146.59.158.228
  146.59.159.162
+146.59.16.121
  146.59.17.99
+146.59.196.252
+146.59.203.78
  146.59.225.194
  146.59.225.195
  146.59.225.221
  146.59.234.220
  146.59.235.27
+146.59.236.232
  146.59.3.125
  146.59.3.161
+146.59.3.182
  146.66.194.20
  146.71.112.18
  146.71.77.244
@@ -20542,7 +25418,6 @@
  146.71.79.230
  146.83.216.186
  146.83.222.25
-146.88.240.4
  1469-squid.com
  147.114.226.194
  147.135.1.79
@@ -20554,18 +25429,24 @@
  147.135.113.178
  147.135.115.212
  147.135.131.7
+147.135.132.179
  147.135.133.88
+147.135.135.111
  147.135.136.241
  147.135.136.53
+147.135.143.46
  147.135.147.28
  147.135.153.152
  147.135.156.72
+147.135.157.67
  147.135.165.147
  147.135.173.134
+147.135.173.235
  147.135.173.238
  147.135.203.181
  147.135.207.246
  147.135.211.59
+147.135.211.73
  147.135.231.210
  147.135.233.28
  147.135.252.43
@@ -20574,23 +25455,52 @@
  147.135.6.179
  147.135.76.206
  147.135.79.86
+147.139.134.59
+147.139.135.160
  147.139.138.116
  147.139.160.218
+147.139.163.83
+147.139.168.106
  147.139.168.137
+147.139.168.215
  147.139.169.213
+147.139.172.122
+147.139.177.71
+147.139.180.46
+147.139.181.138
+147.139.181.53
+147.139.182.9
+147.139.184.149
+147.139.189.77
  147.139.192.26
+147.139.195.117
+147.139.29.173
+147.139.30.243
  147.139.31.203
+147.139.31.22
  147.139.32.95
+147.139.33.16
  147.139.34.79
+147.139.37.49
+147.139.4.177
+147.139.40.48
+147.139.5.254
+147.139.6.198
+147.139.6.41
+147.139.6.68
  147.139.6.81
+147.147.231.166
  147.154.85.145
-147.219.24.24
  147.229.146.52
  147.229.75.77
  147.231.106.250
  147.251.68.32
  147.27.70.36
+147.30.82.136
  147.32.117.195
+147.75.114.170
+147.75.118.236
+147.75.124.130
  147.78.65.253
  147.83.195.55
  147.83.72.199
@@ -20599,6 +25509,7 @@
  1477304571.storage.googleapis.com
  148.0.237.76
  148.0.40.231
+148.101.169.71
  148.102.22.76
  148.103.51.2
  148.103.9.41
@@ -20612,16 +25523,25 @@
  148.170.212.44
  148.202.223.222
  148.204.63.249
+148.215.30.116
  148.217.94.54
  148.222.44.20
+148.223.120.122
+148.223.143.69
  148.228.214.141
  148.235.173.233
  148.235.42.146
  148.235.42.147
+148.235.57.183
+148.235.82.68
+148.240.70.42
  148.240.94.2
  148.240.94.5
  148.243.72.112
  148.244.221.148
+148.245.13.21
+148.245.79.114
+148.245.79.115
  148.251.105.254
  148.251.110.53
  148.251.110.54
@@ -20641,6 +25561,7 @@
  148.251.186.36
  148.251.19.205
  148.251.2.82
+148.251.205.45
  148.251.208.48
  148.251.22.104
  148.251.22.209
@@ -20665,10 +25586,14 @@
  148.251.83.196
  148.251.84.22
  148.251.87.112
+148.255.117.29
+148.255.32.77
  148.3.247.160
  148.63.215.173
+148.66.129.194
  148.66.132.190
  148.66.134.158
+148.66.143.140
  148.66.143.78
  148.66.145.132
  148.66.145.135
@@ -20676,6 +25601,7 @@
  148.66.146.23
  148.66.146.42
  148.66.147.12
+148.66.147.22
  148.66.147.35
  148.66.17.82
  148.66.17.83
@@ -20688,29 +25614,47 @@
  148.66.63.202
  148.69.222.213
  148.70.100.119
+148.70.102.225
  148.70.102.24
+148.70.102.69
+148.70.107.49
  148.70.108.21
  148.70.112.177
+148.70.123.42
  148.70.129.112
  148.70.14.121
+148.70.149.39
+148.70.152.56
  148.70.153.21
  148.70.154.166
+148.70.178.70
+148.70.185.36
  148.70.195.242
  148.70.201.162
  148.70.208.108
  148.70.209.112
  148.70.229.221
+148.70.250.254
+148.70.251.58
+148.70.29.243
  148.70.29.56
  148.70.31.188
  148.70.33.136
  148.70.38.183
  148.70.53.219
+148.70.70.55
+148.70.76.237
+148.70.77.116
+148.70.84.202
  148.72.105.246
+148.72.108.218
  148.72.160.176
  148.72.170.171
  148.72.202.188
+148.72.207.250
  148.72.208.210
  148.72.209.9
+148.72.211.177
  148.72.211.251
  148.72.212.161
  148.72.214.23
@@ -20718,6 +25662,8 @@
  148.72.22.191
  148.72.23.181
  148.72.23.29
+148.72.232.104
+148.72.232.107
  148.72.232.125
  148.72.232.128
  148.72.232.141
@@ -20726,6 +25672,9 @@
  148.72.232.36
  148.72.232.39
  148.72.232.63
+148.72.248.42
+148.72.64.192
+148.72.65.173
  148.72.65.90
  148.74.194.80
  148.77.34.194
@@ -20733,23 +25682,54 @@
  148.77.34.200
  148117-dot-n-e-w-me-ss-age-po-rt-al.wl.r.appspot.com
  149.107.0.76
+149.115.56.169
  149.129.101.217
  149.129.102.110
+149.129.106.113
  149.129.118.133
+149.129.129.91
+149.129.136.55
+149.129.137.193
+149.129.139.95
  149.129.173.204
+149.129.174.48
+149.129.176.46
+149.129.181.53
+149.129.182.216
+149.129.184.49
  149.129.188.225
  149.129.190.133
+149.129.191.88
+149.129.220.95
  149.129.222.49
+149.129.222.60
+149.129.226.135
  149.129.227.63
+149.129.232.41
  149.129.233.28
  149.129.234.168
  149.129.236.66
  149.129.237.83
+149.129.242.144
+149.129.244.83
  149.129.246.35
+149.129.248.95
+149.129.249.105
  149.129.251.152
+149.129.251.229
+149.129.252.182
+149.129.254.65
  149.129.255.180
+149.129.34.80
+149.129.36.10
  149.129.48.241
+149.129.54.136
+149.129.56.121
  149.129.57.134
+149.129.57.246
+149.129.59.96
+149.129.61.164
+149.129.62.226
  149.129.69.210
  149.129.90.72
  149.129.95.189
@@ -20763,15 +25743,22 @@
  149.202.115.3
  149.202.12.9
  149.202.125.153
+149.202.136.235
+149.202.155.146
+149.202.160.188
+149.202.160.192
  149.202.161.210
+149.202.161.57
  149.202.161.61
  149.202.162.73
  149.202.173.144
+149.202.175.11
  149.202.175.255
  149.202.175.3
  149.202.180.136
  149.202.185.84
  149.202.188.177
+149.202.189.5
  149.202.19.84
  149.202.19.93
  149.202.190.73
@@ -20788,12 +25775,18 @@
  149.202.29.73
  149.202.3.113
  149.202.38.124
+149.202.45.107
  149.202.47.128
+149.202.47.15
  149.202.48.176
  149.202.48.192
  149.202.48.246
+149.202.50.155
+149.202.52.152
  149.202.54.225
  149.202.55.18
+149.202.56.228
+149.202.59.123
  149.202.60.88
  149.202.63.237
  149.202.7.202
@@ -20802,9 +25795,11 @@
  149.202.75.239
  149.202.8.66
  149.202.81.92
+149.202.82.84
  149.202.83.78
  149.202.87.175
  149.202.89.125
+149.202.93.136
  149.202.99.18
  149.210.143.165
  149.210.155.74
@@ -20820,14 +25815,19 @@
  149.248.8.73
  149.248.9.85
  149.255.154.62
+149.255.210.18
  149.255.36.133
  149.255.36.156
+149.255.59.10
+149.255.60.161
+149.255.60.167
  149.255.62.89
  149.28.112.35
  149.28.113.236
  149.28.117.43
  149.28.118.60
  149.28.129.59
+149.28.130.171
  149.28.132.214
  149.28.132.27
  149.28.137.189
@@ -20884,20 +25884,29 @@
  149.3.170.244
  149.3.36.210
  149.3.73.242
+149.3.75.172
  149.3.85.81
  149.31.6.24
  149.34.6.162
  149.56.1.48
+149.56.100.209
+149.56.100.237
  149.56.101.170
+149.56.102.43
  149.56.108.38
  149.56.110.140
  149.56.110.240
  149.56.115.70
  149.56.115.99
+149.56.12.88
+149.56.128.135
+149.56.13.111
+149.56.130.248
  149.56.131.140
  149.56.132.202
  149.56.133.137
  149.56.133.146
+149.56.134.106
  149.56.141.170
  149.56.147.33
  149.56.151.196
@@ -20911,15 +25920,17 @@
  149.56.223.241
  149.56.228.38
  149.56.229.16
+149.56.232.133
  149.56.26.173
+149.56.31.218
  149.56.38.93
  149.56.41.33
  149.56.43.106
+149.56.44.101
  149.56.44.47
  149.56.47.75
  149.56.70.122
  149.56.79.215
-149.56.80.31
  149.56.97.139
  149.56.97.144
  149.56.97.145
@@ -20927,11 +25938,16 @@
  149.62.172.62
  149.62.173.247
  149.62.41.187
+149.71.33.181
  149.71.33.45
+149.72.139.182
+149.72.198.96
+149.72.242.87
  149.74.120.231
  149.81.153.3
  149.81.157.0
  149.90.226.69
+149.91.177.214
  149.91.80.7
  1493-security-dispatch.com
  14978.gucac.com
@@ -20958,6 +25974,7 @@
  15.164.169.212
  15.164.181.146
  15.164.203.130
+15.164.229.245
  15.164.241.150
  15.164.27.100
  15.165.33.136
@@ -20976,6 +25993,7 @@
  15.188.90.29
  15.206.146.144
  15.206.84.150
+15.207.100.181
  15.207.108.70
  15.207.111.189
  15.207.116.17
@@ -20997,6 +26015,7 @@
  15.4buyuklergazete.com
  150.101.163.151
  150.107.103.64
+150.107.118.172
  150.107.137.181
  150.107.137.54
  150.107.142.17
@@ -21007,23 +26026,37 @@
  150.107.205.20
  150.107.205.22
  150.107.207.137
+150.107.26.168
  150.107.31.176
  150.107.42.160
+150.107.92.209
  150.109.100.65
+150.109.104.153
+150.109.113.116
  150.109.113.254
  150.109.115.128
+150.109.115.15
  150.109.118.237
  150.109.145.30
  150.109.146.235
+150.109.147.250
  150.109.148.108
  150.109.15.69
+150.109.151.206
+150.109.167.41
+150.109.34.205
  150.109.37.160
+150.109.51.175
+150.109.57.43
  150.109.58.69
  150.109.63.146
+150.109.64.153
  150.109.66.212
+150.109.69.128
  150.109.70.217
  150.109.76.59
  150.109.78.53
+150.109.99.243
  150.129.115.118
  150.129.148.88
  150.129.148.99
@@ -21039,52 +26072,99 @@
  150.129.52.74
  150.129.54.111
  150.129.55.121
+150.129.62.128
  150.129.8.10
  150.129.8.32
  150.129.8.7
+150.136.116.126
+150.136.12.28
+150.136.127.89
+150.136.132.142
  150.136.137.192
  150.136.142.165
  150.136.152.190
  150.136.160.141
+150.136.172.1
  150.136.192.92
  150.136.208.168
+150.136.21.3
  150.136.21.93
+150.136.220.58
+150.136.241.199
  150.136.246.125
+150.136.248.42
  150.136.31.34
  150.136.37.217
+150.136.40.83
+150.136.45.46
  150.136.62.105
  150.138.106.174
+150.138.118.252
  150.138.178.18
  150.138.253.71
  150.138.253.72
  150.138.253.73
  150.139.210.20
  150.158.106.129
+150.158.110.112
  150.158.110.142
+150.158.112.154
+150.158.113.106
+150.158.114.97
+150.158.115.213
  150.158.120.81
  150.158.123.221
+150.158.152.163
+150.158.153.22
  150.158.153.78
+150.158.157.110
+150.158.158.34
  150.158.159.248
  150.158.159.25
  150.158.161.204
+150.158.161.245
+150.158.161.89
+150.158.162.230
  150.158.162.240
+150.158.163.228
  150.158.165.134
+150.158.165.46
  150.158.168.214
  150.158.169.136
+150.158.169.168
+150.158.170.246
+150.158.172.248
+150.158.173.114
+150.158.173.249
+150.158.173.59
+150.158.174.229
+150.158.174.230
  150.158.175.66
+150.158.176.46
  150.158.178.63
  150.158.179.122
+150.158.179.131
+150.158.181.16
+150.158.184.139
  150.158.185.176
+150.158.186.50
+150.158.187.126
  150.158.190.76
+150.158.193.115
  150.158.194.184
  150.158.198.131
  150.158.213.73
  150.158.214.144
+150.158.214.155
  150.158.4.230
  150.158.5.97
+150.185.10.125
+150.185.9.190
  150.187.5.100
+150.223.13.155
  150.238.224.237
  150.238.79.79
+150.242.14.126
  150.242.182.98
  150.242.219.5
  150.242.24.152
@@ -21100,8 +26180,12 @@
  150.95.113.198
  150.95.131.174
  150.95.132.74
+150.95.138.39
+150.95.148.208
  150.95.152.96
+150.95.153.82
  150.95.156.45
+150.95.175.155
  150.95.177.195
  150.95.177.30
  150.95.180.105
@@ -21121,9 +26205,15 @@
  150.95.223.41
  150.95.223.60
  150.95.25.165
+150.95.26.228
+150.95.27.32
+150.95.30.158
  150.95.31.150
  150.95.52.70
  150.95.54.138
+150.95.64.26
+150.95.82.145
+150.95.82.240
  150.95.82.42
  15006000001.mer.lstest.siquality.com
  150100.cn
@@ -21142,6 +26232,7 @@
  151.106.30.102
  151.106.34.139
  151.106.38.210
+151.106.38.74
  151.106.40.217
  151.106.40.23
  151.106.56.234
@@ -21165,15 +26256,19 @@
  151.124.247.200
  151.13.11.231
  151.16.130.78
+151.16.51.170
  151.177.55.66
  151.182.44.17
+151.192.146.239
  151.196.45.109
+151.197.62.250
  151.20.160.72
  151.205.188.39
  151.21.25.125
  151.217.31.131
  151.226.56.87
  151.228.114.115
+151.236.193.195
  151.236.218.195
  151.236.38.234
  151.236.58.222
@@ -21191,28 +26286,58 @@
  151.237.189.246
  151.237.36.220
  151.237.80.166
+151.247.244.199
  151.248.114.191
  151.248.116.116
  151.248.116.75
  151.248.157.162
  151.248.168.243
+151.248.63.172
+151.248.63.232
+151.248.63.87
+151.25.79.95
+151.251.4.31
  151.253.125.136
+151.253.125.137
  151.253.128.234
  151.27.234.155
  151.31.95.207
+151.34.136.46
+151.34.198.112
+151.34.205.22
+151.34.81.81
+151.34.94.165
+151.36.34.194
+151.36.62.86
+151.36.67.0
+151.38.75.253
+151.38.86.112
  151.40.192.170
  151.41.170.30
  151.42.253.255
+151.44.11.72
+151.46.48.164
+151.46.56.202
+151.48.178.239
  151.50.97.232
  151.51.121.187
+151.54.127.27
  151.55.117.0
  151.55.84.241
+151.62.10.149
+151.62.133.224
  151.62.29.168
+151.62.32.182
+151.62.73.67
  151.64.209.157
+151.68.133.73
  151.69.170.146
+151.69.206.10
  151.70.64.197
+151.76.192.38
  151.80.100.80
  151.80.111.52
+151.80.118.30
  151.80.140.166
  151.80.140.233
  151.80.142.33
@@ -21239,13 +26364,18 @@
  151.80.148.59
  151.80.148.64
  151.80.148.90
+151.80.149.223
  151.80.149.75
+151.80.152.125
+151.80.155.98
  151.80.159.18
  151.80.162.250
+151.80.173.36
  151.80.178.67
  151.80.18.236
  151.80.18.77
  151.80.181.64
+151.80.183.134
  151.80.186.129
  151.80.19.210
  151.80.194.190
@@ -21265,9 +26395,11 @@
  151.80.26.121
  151.80.29.98
  151.80.34.113
+151.80.38.19
  151.80.38.48
  151.80.40.72
  151.80.41.169
+151.80.41.64
  151.80.44.115
  151.80.44.163
  151.80.46.19
@@ -21290,6 +26422,7 @@
  151.80.9.153
  151.80.96.140
  151.80.99.2
+151.84.122.105
  151.rs
  151051-dot-n-e-w-me-ss-age-po-rt-al.wl.r.appspot.com
  151114327519139.002.sh.cn
@@ -21298,93 +26431,164 @@
  152.0.4.193
  152.114.1.50
  152.115.191.196
+152.136.101.207
+152.136.101.65
+152.136.104.227
+152.136.107.190
+152.136.109.235
  152.136.11.211
+152.136.110.246
+152.136.112.251
+152.136.114.118
  152.136.116.72
+152.136.122.172
  152.136.125.31
  152.136.125.49
+152.136.128.30
  152.136.130.218
  152.136.131.242
  152.136.131.68
+152.136.133.109
+152.136.134.77
+152.136.137.130
+152.136.138.231
  152.136.139.211
  152.136.145.200
  152.136.145.235
+152.136.149.160
  152.136.151.70
  152.136.152.45
+152.136.17.25
  152.136.179.135
  152.136.183.147
+152.136.184.156
+152.136.187.161
  152.136.19.170
  152.136.195.211
+152.136.196.155
+152.136.203.208
  152.136.204.118
+152.136.204.182
+152.136.206.143
  152.136.209.192
  152.136.209.33
  152.136.212.92
+152.136.213.45
+152.136.215.222
+152.136.220.127
  152.136.224.146
  152.136.224.192
+152.136.224.227
+152.136.226.15
+152.136.227.172
+152.136.229.197
+152.136.229.52
  152.136.230.126
+152.136.234.179
  152.136.236.159
  152.136.237.47
  152.136.25.133
+152.136.252.237
+152.136.254.204
+152.136.29.104
+152.136.34.209
  152.136.41.189
  152.136.43.147
  152.136.54.176
  152.136.71.133
+152.136.90.196
  152.136.97.217
  152.136.98.165
  152.136.98.80
  152.165.38.171
  152.168.115.218
  152.168.198.221
+152.168.79.196
  152.169.106.145
  152.169.132.194
+152.169.169.235
  152.169.204.66
  152.169.22.67
  152.169.32.143
+152.170.144.179
  152.170.66.244
  152.170.79.100
+152.171.152.2
  152.179.67.70
+152.182.83.182
+152.182.83.199
  152.182.83.213
  152.182.83.253
+152.200.143.218
  152.204.128.190
  152.204.128.46
  152.208.62.236
  152.231.120.138
+152.231.140.150
  152.231.29.72
+152.231.68.18
  152.231.89.226
  152.231.93.130
+152.242.78.67
  152.250.165.189
  152.26.66.140
  152.30.238.184
+152.32.112.199
+152.32.128.103
+152.32.128.40
  152.32.129.119
+152.32.129.40
  152.32.130.121
  152.32.130.79
+152.32.133.119
  152.32.141.108
+152.32.144.26
  152.32.145.9
  152.32.150.232
  152.32.154.39
+152.32.159.80
  152.32.172.162
  152.32.173.36
+152.32.186.206
+152.32.190.172
+152.32.201.49
+152.32.209.98
+152.32.211.39
  152.32.212.164
+152.32.212.72
  152.32.214.84
  152.32.215.75
+152.32.222.239
+152.32.226.205
  152.32.239.166
+152.32.240.177
+152.32.243.114
  152.32.251.88
  152.32.253.211
  152.32.75.74
  152.32.78.24
  152.32.92.86
+152.32.99.169
+152.44.135.18
  152.57.210.118
  152.67.0.123
+152.67.1.245
  152.67.16.49
  152.67.166.99
  152.67.173.121
  152.67.188.191
  152.67.188.75
+152.67.224.67
  152.67.24.187
+152.67.25.98
  152.67.35.185
  152.67.48.62
+152.67.58.141
+152.67.7.93
  152.89.162.39
  152.89.239.104
  152.89.239.115
+152.89.239.120
  152.89.239.197
  152.89.239.85
  152.89.245.248
@@ -21392,19 +26596,27 @@
  152asyabahis.com
  153.0.225.56
  153.101.146.183
+153.101.29.178
  153.101.37.132
+153.101.57.34
+153.101.57.40
  153.120.135.16
  153.120.135.253
  153.120.33.139
  153.122.103.35
+153.122.13.133
  153.122.8.97
  153.126.156.217
  153.126.179.109
  153.126.180.38
  153.126.183.214
  153.126.187.46
+153.126.196.88
  153.127.253.219
+153.127.38.250
+153.127.41.194
  153.127.6.218
+153.127.63.142
  153.127.67.228
  153.127.68.121
  153.129.15.63
@@ -21414,39 +26626,50 @@
  153.183.25.24
  153.19.105.97
  153.19.33.231
+153.19.70.33
  153.228.254.113
+153.246.145.238
  153.3.118.131
  153.3.124.100
  153.3.124.101
  153.3.124.234
  153.3.126.225
+153.3.250.234
  153.3.37.6
  153.3.39.83
  153.3.45.8
+153.3.97.127
  153.3.99.51
  153.3.99.51bin.sh
+153.34.214.210
  153.34.52.54
  153.34.65.168
  153.34.65.168bin.sh
  153.34.67.119bin.sh
-153.35.38.126
+153.35.110.21
+153.35.93.175
+153.36.112.104
  153.36.134.186
  153.36.134.88
  153.36.14.49
  153.36.169.227
+153.36.19.36
  153.36.23.219
  153.37.181.92
  153.92.127.168
  153.92.4.153
  153.92.93.114
+153.99.181.89
  153284594738391.statictab.com
  15333291-5189-4750-a96c-2f9deb7920f7.htmlcomponentservice.com
  153884c0b3f5e35925a6a8b37e6eccb3-dot-maintance-online-pass.ey.r.appspot.com
  154.0.168.252
  154.0.175.203
  154.0.8.2
+154.113.1.142
  154.113.16.226
  154.117.143.126
+154.117.154.86
  154.117.155.42
  154.117.157.180
  154.117.159.228
@@ -21458,10 +26681,17 @@
  154.120.227.206
  154.120.232.182
  154.124.113.255
+154.124.202.71
+154.124.217.118
+154.126.32.138
  154.127.113.242
  154.127.120.18
  154.127.32.105
+154.127.42.50
+154.127.43.68
  154.127.52.102
+154.127.82.66
+154.127.89.100
  154.16.113.203
  154.16.136.119
  154.16.137.132
@@ -21494,7 +26724,15 @@
  154.16.70.152
  154.16.84.179
  154.16.86.188
+154.160.11.99
+154.160.7.217
+154.160.73.154
  154.160.74.186
+154.160.74.91
+154.176.144.71
+154.178.111.157
+154.181.185.106
+154.198.2.4
  154.20.227.115
  154.202.3.44
  154.204.26.130
@@ -21505,6 +26743,7 @@
  154.209.5.156
  154.209.69.123
  154.211.14.244
+154.213.22.34
  154.213.58.193
  154.213.58.194
  154.213.58.195
@@ -21756,12 +26995,24 @@
  154.221.17.208
  154.221.18.154
  154.221.18.237
+154.221.19.204
+154.221.20.14
+154.221.21.119
  154.221.21.94
+154.221.22.234
  154.221.25.187
+154.221.26.69
+154.221.27.252
  154.221.30.33
+154.221.81.198
  154.223.189.86
  154.232.45.195
  154.236.168.187
+154.238.60.129
+154.239.165.212
+154.239.183.48
+154.239.204.244
+154.239.238.26
  154.27.78.81
  154.3.40.111
  154.3.40.211
@@ -21773,23 +27024,30 @@
  154.61.227.8
  154.65.14.19
  154.66.107.148
+154.66.107.189
  154.66.109.105
  154.66.122.130
  154.66.125.18
  154.66.193.57
  154.66.208.12
+154.66.218.218
  154.66.240.106
  154.66.241.27
  154.66.245.47
+154.67.123.189
  154.67.128.72
  154.67.143.229
+154.67.232.141
  154.70.158.97
+154.70.208.66
  154.70.236.33
  154.70.236.34
  154.70.236.36
  154.70.32.103
  154.72.154.74
+154.72.160.13
  154.72.187.26
+154.72.192.26
  154.72.197.106
  154.72.199.38
  154.72.201.190
@@ -21798,9 +27056,11 @@
  154.72.204.122
  154.72.204.78
  154.72.21.96
+154.72.25.129
  154.72.48.214
  154.72.63.84
  154.72.87.166
+154.73.10.33
  154.73.109.83
  154.73.129.124
  154.73.132.44
@@ -21808,6 +27068,7 @@
  154.73.137.157
  154.73.159.138
  154.73.53.186
+154.73.81.106
  154.73.84.249
  154.73.84.37
  154.73.85.1
@@ -21834,31 +27095,54 @@
  154.79.254.176
  154.79.254.178
  154.79.254.206
+154.8.136.57
+154.8.137.54
+154.8.144.203
  154.8.146.181
  154.8.146.223
+154.8.147.238
+154.8.148.102
  154.8.149.4
  154.8.151.146
  154.8.151.45
+154.8.151.81
+154.8.159.252
+154.8.161.99
+154.8.167.100
  154.8.176.223
+154.8.178.67
  154.8.183.204
  154.8.192.65
+154.8.195.36
+154.8.196.197
  154.8.219.226
  154.8.228.67
+154.8.229.57
+154.8.232.15
  154.8.232.212
  154.83.13.13
+154.83.13.189
+154.83.13.81
  154.83.14.199
+154.83.15.91
  154.83.17.77
  154.83.17.97
  154.85.48.199
  154.85.48.8
  154.85.50.239
+154.85.55.166
  154.85.58.45
  154.85.63.225
  154.90.14.41
  154.91.144.44
  154.91.2.187
+154.92.14.223
+154.92.16.125
+154.92.22.190
+154.92.22.70
  154.92.22.81
  154.94.7.143
+154.99.58.113
  155.0.18.12
  155.0.181.254
  155.0.202.254
@@ -21877,6 +27161,7 @@
  155.138.164.14
  155.138.197.254
  155.138.217.118
+155.138.221.19
  155.138.222.174
  155.138.224.233
  155.138.234.174
@@ -21885,16 +27170,22 @@
  155.186.0.121
  155.186.9.160
  155.230.25.100
+155.235.128.55
+155.235.128.9
  155.254.28.168
  155.254.35.8
  155.254.49.4
  155.4.111.189
  155.4.116.169
+155.4.70.11
  155.93.108.170
  155.93.109.218
+155.94.129.148
  155.94.131.150
  155.94.145.193
+155.94.156.150
  155.94.166.23
+155.94.178.96
  155.94.194.105
  155.94.224.207
  155.94.240.231
@@ -21914,19 +27205,30 @@
  156.146.37.43
  156.146.37.57
  156.146.51.128
+156.146.51.20
  156.146.57.38
  156.146.59.76
  156.155.163.232
  156.17.36.188
  156.19.19.90
+156.193.129.132
+156.202.225.129
+156.203.200.221
+156.204.201.135
+156.204.99.14
+156.205.250.242
  156.212.108.176
+156.215.94.148
  156.219.87.189
  156.220.253.28
+156.222.176.52
  156.223.27.113
+156.234.193.161
  156.234.201.139
  156.236.70.73
  156.236.71.155
  156.236.71.22
+156.236.72.209
  156.236.73.68
  156.236.74.201
  156.237.198.42
@@ -21934,24 +27236,32 @@
  156.247.12.91
  156.247.13.134
  156.247.14.227
+156.248.12.207
  156.248.12.58
  156.253.5.120
  156.255.213.198
  156.34.231.124
+156.38.91.121
  156.54.148.152
  156.67.106.36
  156.67.115.5
  156.67.214.80
+156.67.216.41
  156.67.221.92
+156.67.222.71
+156.96.114.73
  156.96.118.179
  156.96.118.48
  156.96.118.58
  156.96.150.5
  156.96.151.236
-156.96.156.224
+156.96.155.227
+156.96.155.239
+156.96.155.248
  156.96.157.99
  156.96.48.136
  156.96.48.220
+156.96.58.77
  15688c.com
  1569webappssupport.com
  157.0.1.211
@@ -22002,46 +27312,69 @@
  157.191.147.146
  157.230.1.157
  157.230.100.112
+157.230.100.192
  157.230.106.184
+157.230.109.166
  157.230.109.55
+157.230.109.64
  157.230.111.209
  157.230.113.8
+157.230.115.139
  157.230.115.150
+157.230.116.65
+157.230.118.118
  157.230.118.87
+157.230.12.188
+157.230.12.231
  157.230.120.201
  157.230.121.242
  157.230.122.80
  157.230.123.7
+157.230.125.104
  157.230.125.168
+157.230.125.204
  157.230.125.207
+157.230.128.135
  157.230.13.133
  157.230.132.100
  157.230.133.189
  157.230.14.14
  157.230.141.185
+157.230.143.1
  157.230.144.234
  157.230.147.252
  157.230.151.23
  157.230.151.241
  157.230.153.75
+157.230.16.205
  157.230.16.91
  157.230.163.6
  157.230.166.98
  157.230.180.187
  157.230.189.177
  157.230.19.72
+157.230.190.90
  157.230.2.161
+157.230.2.208
  157.230.209.141
+157.230.209.186
  157.230.210.84
+157.230.211.219
  157.230.216.126
  157.230.219.122
  157.230.22.158
  157.230.22.160
  157.230.221.126
+157.230.224.52
  157.230.225.72
+157.230.229.23
+157.230.23.190
+157.230.231.39
  157.230.232.67
  157.230.233.211
+157.230.234.93
  157.230.238.19
+157.230.24.117
  157.230.244.46
  157.230.245.91
  157.230.249.202
@@ -22049,30 +27382,43 @@
  157.230.251.115
  157.230.251.239
  157.230.251.62
+157.230.252.123
  157.230.252.128
-157.230.254.15
  157.230.26.210
  157.230.30.126
+157.230.33.158
  157.230.34.152
+157.230.35.130
  157.230.35.44
  157.230.36.200
+157.230.38.102
  157.230.38.150
+157.230.42.155
  157.230.42.191
+157.230.42.76
  157.230.43.113
+157.230.45.31
  157.230.47.159
+157.230.47.241
  157.230.47.57
  157.230.48.181
  157.230.48.243
+157.230.5.169
  157.230.54.248
  157.230.55.177
+157.230.57.43
  157.230.58.223
+157.230.6.213
  157.230.62.50
+157.230.63.81
  157.230.7.236
-157.230.83.145
+157.230.80.232
  157.230.89.219
  157.230.9.227
  157.230.90.18
  157.230.93.62
+157.230.94.116
+157.230.94.83
  157.230.97.11
  157.231.110.14
  157.231.113.130
@@ -22084,25 +27430,41 @@
  157.245.103.90
  157.245.104.163
  157.245.104.19
+157.245.106.153
+157.245.108.35
+157.245.109.207
+157.245.109.222
  157.245.113.214
+157.245.12.107
  157.245.122.166
  157.245.123.197
  157.245.123.27
+157.245.124.160
  157.245.124.217
  157.245.127.232
  157.245.130.232
+157.245.130.255
  157.245.131.226
+157.245.137.145
  157.245.140.69
  157.245.140.86
  157.245.143.128
  157.245.145.87
  157.245.150.18
+157.245.163.0
+157.245.166.197
  157.245.167.237
+157.245.168.11
+157.245.168.191
  157.245.172.236
  157.245.178.223
+157.245.178.61
  157.245.181.18
  157.245.184.148
+157.245.186.133
  157.245.186.182
+157.245.186.41
+157.245.189.95
  157.245.201.109
  157.245.201.119
  157.245.203.130
@@ -22113,22 +27475,29 @@
  157.245.227.165
  157.245.230.59
  157.245.230.64
+157.245.231.45
  157.245.233.164
  157.245.235.243
+157.245.238.196
  157.245.241.179
  157.245.242.125
  157.245.242.172
  157.245.244.123
  157.245.246.132
+157.245.252.154
  157.245.252.34
  157.245.253.245
+157.245.32.33
  157.245.35.47
  157.245.39.243
  157.245.5.133
  157.245.5.202
+157.245.53.23
+157.245.54.200
  157.245.55.32
  157.245.6.58
  157.245.60.215
+157.245.63.101
  157.245.64.140
  157.245.64.189
  157.245.69.233
@@ -22139,19 +27508,37 @@
  157.245.81.242
  157.245.86.248
  157.245.91.36
+157.245.91.72
  157.245.91.88
  157.245.92.141
  157.245.94.69
  157.245.97.107
  157.245.98.151
+157.245.98.160
  157.245.98.161
+157.245.98.68
  157.245.99.39
  157.25.197.74
  157.25.23.231
+157.32.183.125
+157.32.248.104
+157.35.239.150
  157.38.18.55
+157.38.38.149
+157.41.107.4
+157.41.143.186
+157.41.30.224
+157.42.102.41
+157.42.118.237
+157.42.206.1
  157.44.64.76
+157.47.248.178
  157.52.151.84
+157.52.185.94
  157.52.252.12
+157.52.252.141
+157.52.252.4
+157.55.165.3
  157.55.175.69
  157.55.188.111
  157.55.192.131
@@ -22278,9 +27665,12 @@
  157.7.106.170
  157.7.143.24
  157.7.164.178
+157.7.166.26
  157.7.188.97
  157.7.211.107
  157.90.21.130
+157.92.13.105
+157.92.13.155
  157.92.49.151
  157.97.2.215
  157.97.7.24
@@ -22289,8 +27679,10 @@
  15780.url.7878j.com
  1579850.xyz
  158.101.108.255
+158.101.12.235
  158.101.165.14
  158.101.19.129
+158.101.227.39
  158.101.7.100
  158.106.211.78
  158.106.67.181
@@ -22299,6 +27691,7 @@
  158.110.145.243
  158.129.140.201
  158.130.48.250
+158.140.137.186
  158.140.144.78
  158.140.169.104
  158.140.173.212
@@ -22329,6 +27722,7 @@
  158.222.6.143
  158.222.6.61
  158.248.198.75
+158.248.41.12
  158.255.213.71
  158.255.23.146
  158.255.249.58
@@ -22347,31 +27741,45 @@
  158.58.133.106
  158.58.133.187
  158.58.168.61
+158.58.184.51
+158.58.187.198
+158.58.191.163
  158.58.197.227
  158.69.0.200
  158.69.100.192
  158.69.100.194
  158.69.110.31
  158.69.116.169
+158.69.118.130
  158.69.126.135
  158.69.127.117
+158.69.128.126
+158.69.128.56
  158.69.137.105
  158.69.138.17
  158.69.153.243
  158.69.158.101
  158.69.158.103
+158.69.162.69
+158.69.162.70
+158.69.165.176
  158.69.170.217
  158.69.170.61
  158.69.173.134
  158.69.192.200
+158.69.192.35
  158.69.195.248
  158.69.197.236
  158.69.197.49
+158.69.199.225
  158.69.202.69
  158.69.208.5
  158.69.211.201
  158.69.212.126
  158.69.218.145
+158.69.220.32
+158.69.220.67
+158.69.222.2
  158.69.223.85
  158.69.225.34
  158.69.225.35
@@ -22383,6 +27791,7 @@
  158.69.236.151
  158.69.236.40
  158.69.238.138
+158.69.238.140
  158.69.240.159
  158.69.242.115
  158.69.243.148
@@ -22396,14 +27805,19 @@
  158.69.27.201
  158.69.31.229
  158.69.35.227
+158.69.38.243
  158.69.42.209
+158.69.48.64
  158.69.54.200
  158.69.59.241
+158.69.60.138
  158.69.62.6
  158.69.63.54
  158.69.69.187
  158.69.72.200
  158.69.72.5
+158.69.74.240
+158.69.78.207
  158.69.79.136
  158.69.87.231
  158.69.87.97
@@ -22445,15 +27859,21 @@
  159.148.65.178
  159.192.104.53
  159.192.105.152
+159.192.114.231
+159.192.114.232
  159.192.120.228
  159.192.121.240
  159.192.136.141
  159.192.136.166
+159.192.137.4
  159.192.141.89
  159.192.142.42
+159.192.143.249
  159.192.148.4
  159.192.164.87
  159.192.169.199
+159.192.220.186
+159.192.224.119
  159.192.227.218
  159.192.229.232
  159.192.229.79
@@ -22475,8 +27895,10 @@
  159.192.250.54
  159.192.250.98
  159.192.253.210
-159.192.69.146
+159.192.68.122
+159.192.72.208
  159.192.74.70
+159.192.8.4
  159.192.88.205
  159.192.97.156
  159.192.97.181
@@ -22489,7 +27911,9 @@
  159.203.102.47
  159.203.106.106
  159.203.107.65
+159.203.108.17
  159.203.109.81
+159.203.11.100
  159.203.11.194
  159.203.11.3
  159.203.110.112
@@ -22506,6 +27930,7 @@
  159.203.118.70
  159.203.119.216
  159.203.119.28
+159.203.119.85
  159.203.12.18
  159.203.120.151
  159.203.120.196
@@ -22526,17 +27951,24 @@
  159.203.152.90
  159.203.160.47
  159.203.162.190
+159.203.162.215
+159.203.163.107
  159.203.163.149
  159.203.163.19
  159.203.165.13
+159.203.165.156
  159.203.166.192
  159.203.166.93
  159.203.167.242
+159.203.168.167
  159.203.17.75
+159.203.173.26
+159.203.173.55
  159.203.173.97
  159.203.174.1
  159.203.174.224
  159.203.176.120
+159.203.176.82
  159.203.176.86
  159.203.177.216
  159.203.177.227
@@ -22548,13 +27980,16 @@
  159.203.181.94
  159.203.182.42
  159.203.182.57
+159.203.184.19
  159.203.186.23
  159.203.188.141
  159.203.188.173
+159.203.188.175
  159.203.188.51
  159.203.189.23
  159.203.189.74
  159.203.19.228
+159.203.190.189
  159.203.191.2
  159.203.196.79
  159.203.2.227
@@ -22571,6 +28006,7 @@
  159.203.232.29
  159.203.234.176
  159.203.241.242
+159.203.242.122
  159.203.242.199
  159.203.25.14
  159.203.254.187
@@ -22581,15 +28017,19 @@
  159.203.30.113
  159.203.30.127
  159.203.30.226
+159.203.30.50
  159.203.33.48
  159.203.34.81
+159.203.35.141
  159.203.36.176
  159.203.36.241
+159.203.37.43
  159.203.39.156
  159.203.4.15
  159.203.40.143
  159.203.41.170
  159.203.41.178
+159.203.41.19
  159.203.42.143
  159.203.42.15
  159.203.42.169
@@ -22611,6 +28051,7 @@
  159.203.63.152
  159.203.63.22
  159.203.64.53
+159.203.65.130
  159.203.65.139
  159.203.65.196
  159.203.67.100
@@ -22619,9 +28060,13 @@
  159.203.67.177
  159.203.69.42
  159.203.7.112
+159.203.70.169
  159.203.71.167
  159.203.72.104
+159.203.72.111
+159.203.72.14
  159.203.72.210
+159.203.73.181
  159.203.75.59
  159.203.8.223
  159.203.80.22
@@ -22630,6 +28075,7 @@
  159.203.82.146
  159.203.82.173
  159.203.82.176
+159.203.82.179
  159.203.82.183
  159.203.82.201
  159.203.84.241
@@ -22647,6 +28093,7 @@
  159.203.95.154
  159.203.95.4
  159.203.96.11
+159.203.96.131
  159.203.96.147
  159.203.98.128
  159.217.146.76
@@ -22657,8 +28104,11 @@
  159.224.226.164
  159.224.243.185
  159.224.244.11
+159.224.26.214
  159.224.37.181
  159.226.73.77
+159.242.234.108
+159.242.234.117
  159.242.234.165
  159.242.234.209
  159.246.29.101
@@ -22682,6 +28132,7 @@
  159.246.29.98
  159.246.29.99
  159.250.153.179
+159.250.154.24
  159.253.133.19
  159.253.143.53
  159.253.145.175
@@ -22692,32 +28143,41 @@
  159.253.7.218
  159.255.167.89
  159.255.250.241
+159.65.1.41
+159.65.10.193
  159.65.100.45
  159.65.100.95
  159.65.101.201
  159.65.107.84
  159.65.108.19
  159.65.11.115
+159.65.11.5
  159.65.110.10
  159.65.110.27
  159.65.111.89
+159.65.113.228
  159.65.116.48
  159.65.12.108
  159.65.120.158
  159.65.121.183
+159.65.123.164
+159.65.124.47
  159.65.125.52
-159.65.126.229
  159.65.128.182
+159.65.13.233
  159.65.130.158
  159.65.130.198
  159.65.130.72
  159.65.131.226
  159.65.132.97
+159.65.133.150
  159.65.133.176
  159.65.133.234
  159.65.133.50
  159.65.135.148
  159.65.136.194
+159.65.136.44
+159.65.137.122
  159.65.137.48
  159.65.139.163
  159.65.139.237
@@ -22726,17 +28186,24 @@
  159.65.141.206
  159.65.142.192
  159.65.142.92
+159.65.143.187
+159.65.144.102
  159.65.144.219
  159.65.144.233
  159.65.146.132
+159.65.147.235
  159.65.148.176
  159.65.149.253
  159.65.149.54
+159.65.15.143
  159.65.150.135
+159.65.150.151
  159.65.151.183
  159.65.152.148
  159.65.152.201
+159.65.153.147
  159.65.154.238
+159.65.154.48
  159.65.155.229
  159.65.156.139
  159.65.169.25
@@ -22756,7 +28223,6 @@
  159.65.186.147
  159.65.187.247
  159.65.19.77
-159.65.192.164
  159.65.195.15
  159.65.195.31
  159.65.196.143
@@ -22767,6 +28233,7 @@
  159.65.199.114
  159.65.199.205
  159.65.203.17
+159.65.203.182
  159.65.203.77
  159.65.203.86
  159.65.204.131
@@ -22779,12 +28246,14 @@
  159.65.216.84
  159.65.218.161
  159.65.220.170
+159.65.220.18
  159.65.220.54
  159.65.221.193
  159.65.221.28
  159.65.222.75
  159.65.224.8
  159.65.226.229
+159.65.228.149
  159.65.229.162
  159.65.233.97
  159.65.234.71
@@ -22802,17 +28271,24 @@
  159.65.254.144
  159.65.254.174
  159.65.3.24
+159.65.30.66
  159.65.33.28
  159.65.34.36
  159.65.4.159
+159.65.41.159
+159.65.5.164
  159.65.50.162
+159.65.51.82
  159.65.52.196
  159.65.52.66
  159.65.53.246
  159.65.54.221
  159.65.57.197
+159.65.6.99
  159.65.63.101
  159.65.64.70
+159.65.64.76
+159.65.65.170
  159.65.65.54
  159.65.65.60
  159.65.66.113
@@ -22824,16 +28300,25 @@
  159.65.77.254
  159.65.77.99
  159.65.78.139
+159.65.78.3
  159.65.79.191
+159.65.8.21
  159.65.8.71
  159.65.81.246
+159.65.81.49
+159.65.83.68
+159.65.84.183
+159.65.86.130
  159.65.86.35
  159.65.88.193
  159.65.88.97
  159.65.9.142
+159.65.9.211
  159.65.90.138
  159.65.91.105
  159.65.95.133
+159.65.97.211
+159.65.98.176
  159.65.99.102
  159.65.99.15
  159.69.123.234
@@ -22841,34 +28326,54 @@
  159.69.139.246
  159.69.167.252
  159.69.167.254
+159.69.242.227
+159.69.242.241
+159.69.243.19
  159.69.57.170
  159.69.72.58
  159.69.73.223
  159.69.85.172
  159.69.85.209
+159.75.0.175
+159.75.138.89
  159.75.14.88
+159.75.16.106
  159.75.16.134
+159.75.17.64
+159.75.18.68
  159.75.2.55
  159.75.20.251
  159.75.202.34
+159.75.203.31
+159.75.21.113
+159.75.21.36
+159.75.28.167
+159.75.29.95
  159.75.3.66
  159.8.64.60
  159.8.93.184
  159.82.166.133
  159.89.1.19
+159.89.10.234
+159.89.10.77
  159.89.101.140
  159.89.102.206
  159.89.104.48
  159.89.104.5
  159.89.104.55
+159.89.106.247
  159.89.107.47
  159.89.108.149
  159.89.108.74
  159.89.11.198
  159.89.11.236
  159.89.110.115
+159.89.110.200
+159.89.112.44
+159.89.114.40
  159.89.115.126
  159.89.115.74
+159.89.115.75
  159.89.120.240
  159.89.121.240
  159.89.121.86
@@ -22880,7 +28385,9 @@
  159.89.126.84
  159.89.13.131
  159.89.13.151
+159.89.13.244
  159.89.13.80
+159.89.130.126
  159.89.130.178
  159.89.131.205
  159.89.132.200
@@ -22904,10 +28411,19 @@
  159.89.159.97
  159.89.16.226
  159.89.162.191
+159.89.163.158
+159.89.163.226
  159.89.163.42
  159.89.164.104
  159.89.165.127
+159.89.167.183
+159.89.168.42
+159.89.170.100
+159.89.171.165
+159.89.171.81
+159.89.172.207
  159.89.172.219
+159.89.173.232
  159.89.174.9
  159.89.18.157
  159.89.18.80
@@ -22918,17 +28434,24 @@
  159.89.187.165
  159.89.188.167
  159.89.19.171
+159.89.194.103
  159.89.196.41
+159.89.197.1
  159.89.197.38
  159.89.198.117
  159.89.199.105
+159.89.199.182
  159.89.199.76
+159.89.199.80
  159.89.2.220
  159.89.20.160
  159.89.20.86
  159.89.200.182
+159.89.200.236
  159.89.202.113
+159.89.202.95
  159.89.205.186
+159.89.207.44
  159.89.21.232
  159.89.210.220
  159.89.22.152
@@ -22942,6 +28465,7 @@
  159.89.230.175
  159.89.231.85
  159.89.235.15
+159.89.236.71
  159.89.237.254
  159.89.237.57
  159.89.239.14
@@ -22954,25 +28478,34 @@
  159.89.30.109
  159.89.34.234
  159.89.36.114
+159.89.38.228
  159.89.41.118
  159.89.42.118
  159.89.42.205
  159.89.44.62
+159.89.46.105
+159.89.47.106
  159.89.48.18
  159.89.48.31
  159.89.48.69
  159.89.49.225
  159.89.5.228
+159.89.5.237
  159.89.51.183
  159.89.53.183
+159.89.54.88
  159.89.55.36
  159.89.7.14
  159.89.7.225
+159.89.80.140
+159.89.82.134
  159.89.82.29
  159.89.85.200
  159.89.89.191
  159.89.89.44
  159.89.9.140
+159.89.91.67
+159.89.91.92
  159.89.92.217
  159.89.93.130
  159.89.96.26
@@ -23020,47 +28553,78 @@
  160.119.130.130
  160.119.131.114
  160.119.211.15
+160.119.235.162
  160.119.254.19
  160.119.50.93
  160.120.150.163
+160.120.177.106
+160.124.14.211
  160.124.140.153
  160.124.156.68
+160.124.157.76
  160.124.236.218
  160.124.236.219
  160.124.236.220
  160.124.236.221
  160.124.236.222
+160.124.49.249
+160.124.50.93
  160.153.146.164
  160.153.146.165
  160.153.146.79
  160.153.147.141
  160.153.147.142
+160.153.147.143
+160.153.147.152
+160.153.147.154
+160.153.147.155
+160.153.147.158
  160.153.147.16
+160.153.147.161
+160.153.147.162
  160.153.147.23
+160.153.147.35
+160.153.147.37
+160.153.153.157
  160.153.153.29
  160.153.153.30
  160.153.153.31
+160.153.154.10
+160.153.154.18
  160.153.154.19
  160.153.154.2
  160.153.154.21
+160.153.154.24
  160.153.154.26
  160.153.154.31
+160.153.154.5
  160.153.154.6
  160.153.154.7
  160.153.154.8
+160.153.156.129
+160.153.156.131
+160.153.156.134
  160.153.156.135
+160.153.156.136
  160.153.156.137
+160.153.156.141
  160.153.203.129
  160.153.234.236
+160.153.235.106
  160.153.244.20
+160.153.245.175
  160.153.249.218
  160.153.251.133
+160.153.252.9
  160.154.137.125
+160.155.224.146
  160.16.0.30
  160.16.101.124
+160.16.106.15
  160.16.110.6
  160.16.126.155
  160.16.133.38
+160.16.136.28
  160.16.145.25
  160.16.198.89
  160.16.219.87
@@ -23068,11 +28632,17 @@
  160.16.63.41
  160.16.76.83
  160.16.84.152
+160.174.128.172
+160.176.101.217
+160.176.46.86
  160.177.19.217
+160.178.104.90
  160.19.246.57
  160.2.52.234
+160.20.200.234
  160.202.106.209
  160.202.145.35
+160.202.156.157
  160.202.162.186
  160.202.162.48
  160.202.163.100
@@ -23099,23 +28669,36 @@
  160.251.21.74
  160.251.3.228
  160.251.7.180
+160.251.8.225
+160.251.9.131
  160.251.9.25
  160.36.130.180
  160.39.192.136
  160.39.48.77
  160holiganbet.com
+161.0.153.184
  161.0.153.60
+161.0.158.231
  161.0.72.11
+161.10.238.226
  161.117.0.66
  161.117.10.46
+161.117.11.53
  161.117.176.46
+161.117.191.130
  161.117.254.85
+161.117.255.189
  161.117.49.174
+161.117.51.35
+161.117.56.255
+161.117.7.172
  161.117.9.99
  161.129.35.214
  161.129.67.114
  161.132.181.238
+161.132.219.125
  161.132.78.98
+161.148.21.224
  161.156.175.40
  161.189.111.230
  161.200.98.10
@@ -23127,11 +28710,15 @@
  161.35.1.155
  161.35.1.55
  161.35.10.226
+161.35.101.70
+161.35.103.43
  161.35.106.253
  161.35.108.141
  161.35.109.122
  161.35.11.118
+161.35.110.226
  161.35.116.30
+161.35.118.14
  161.35.120.184
  161.35.121.130
  161.35.127.147
@@ -23140,16 +28727,24 @@
  161.35.13.123
  161.35.130.95
  161.35.134.6
+161.35.136.38
  161.35.137.181
+161.35.138.131
  161.35.141.244
  161.35.141.82
  161.35.142.244
+161.35.143.163
+161.35.143.180
+161.35.143.198
  161.35.143.38
+161.35.148.121
  161.35.148.134
+161.35.148.75
  161.35.15.187
  161.35.15.34
  161.35.154.24
  161.35.156.92
+161.35.161.13
  161.35.161.170
  161.35.167.148
  161.35.173.212
@@ -23159,36 +28754,50 @@
  161.35.187.61
  161.35.188.60
  161.35.189.1
+161.35.190.246
  161.35.193.16
  161.35.193.6
  161.35.195.211
+161.35.195.30
  161.35.197.166
  161.35.205.180
  161.35.212.246
  161.35.224.185
  161.35.225.155
+161.35.227.204
  161.35.23.222
  161.35.233.130
  161.35.235.27
  161.35.237.200
  161.35.24.244
  161.35.4.201
+161.35.45.62
  161.35.47.220
  161.35.49.47
+161.35.49.78
  161.35.5.47
+161.35.50.221
  161.35.53.134
  161.35.53.44
  161.35.54.110
+161.35.54.180
+161.35.57.121
+161.35.58.35
  161.35.6.188
+161.35.6.6
  161.35.60.129
  161.35.70.5
+161.35.72.39
  161.35.82.220
  161.35.84.235
  161.35.86.23
+161.35.9.18
  161.35.9.202
  161.35.90.45
  161.35.98.45
+161.35.98.96
  161.35.99.173
+161.35.99.73
  161.47.70.199
  161.49.84.2
  161.53.179.226
@@ -23199,10 +28808,13 @@
  161.53.240.18
  161.53.240.25
  161.53.81.21
+161.81.220.80
  161.81.36.21
  161.82.246.91
+161.97.100.170
  161.97.101.31
  161.97.101.36
+161.97.103.183
  161.97.107.17
  161.97.109.229
  161.97.125.222
@@ -23215,8 +28827,12 @@
  161.97.131.71
  161.97.133.225
  161.97.137.189
+161.97.140.161
+161.97.145.43
  161.97.157.241
  161.97.160.72
+161.97.161.23
+161.97.162.121
  161.97.176.229
  161.97.178.101
  161.97.179.222
@@ -23227,6 +28843,7 @@
  161.97.68.59
  161.97.69.170
  161.97.70.157
+161.97.70.30
  161.97.74.111
  161.97.76.191
  161.97.78.179
@@ -23248,6 +28865,7 @@
  162.0.227.56
  162.0.227.68
  162.0.228.57
+162.0.230.32
  162.0.231.190
  162.0.233.227
  162.0.234.152
@@ -23288,9 +28906,19 @@
  162.134.72.6
  162.14.18.58
  162.14.23.147
+162.142.125.121
+162.142.125.128
+162.142.125.37
+162.142.125.38
+162.142.125.39
+162.142.125.40
+162.142.125.53
+162.142.125.54
+162.142.125.55
  162.144.104.137
  162.144.107.199
  162.144.108.177
+162.144.127.197
  162.144.128.76
  162.144.141.141
  162.144.145.58
@@ -23298,6 +28926,8 @@
  162.144.152.46
  162.144.212.120
  162.144.221.185
+162.144.235.199
+162.144.236.55
  162.144.34.109
  162.144.34.147
  162.144.35.84
@@ -23306,10 +28936,12 @@
  162.144.39.157
  162.144.42.60
  162.144.49.154
+162.144.50.132
  162.144.50.197
  162.144.51.3
  162.144.57.196
  162.144.60.237
+162.144.66.89
  162.144.76.55
  162.144.79.7
  162.144.91.33
@@ -23418,15 +29050,20 @@
  162.158.91.54
  162.158.92.107
  162.158.92.185
+162.17.103.5
  162.17.134.125
  162.17.143.229
  162.17.143.234
  162.17.252.5
+162.17.6.147
  162.191.197.222
+162.191.33.164
  162.198.193.52
+162.198.89.189
  162.199.19.25
  162.204.50.89
  162.208.12.122
+162.208.213.133
  162.209.1.233
  162.209.102.100
  162.209.106.135
@@ -23439,6 +29076,8 @@
  162.210.196.100
  162.210.196.129
  162.210.97.60
+162.211.225.98
+162.211.226.228
  162.211.89.50
  162.212.112.139
  162.212.112.175
@@ -23518,6 +29157,7 @@
  162.213.24.40
  162.213.25.67
  162.213.251.24
+162.213.252.92
  162.213.255.135
  162.213.255.198
  162.213.27.198
@@ -23533,7 +29173,9 @@
  162.214.3.98
  162.214.54.162
  162.214.64.156
+162.214.66.32
  162.214.68.171
+162.214.70.137
  162.214.74.253
  162.214.77.143
  162.214.77.153
@@ -23545,6 +29187,7 @@
  162.216.19.80
  162.216.204.146
  162.216.46.117
+162.217.146.250
  162.217.152.182
  162.217.175.208
  162.217.77.15
@@ -23576,6 +29219,7 @@
  162.227.78.128
  162.229.183.99
  162.239.57.201
+162.241.115.216
  162.241.117.105
  162.241.117.179
  162.241.117.37
@@ -23586,6 +29230,7 @@
  162.241.125.112
  162.241.148.33
  162.241.148.86
+162.241.149.137
  162.241.149.45
  162.241.153.151
  162.241.154.215
@@ -23599,6 +29244,7 @@
  162.241.242.173
  162.241.244.134
  162.241.41.111
+162.241.44.26
  162.241.65.37
  162.241.72.243
  162.241.72.87
@@ -23619,6 +29265,7 @@
  162.243.102.191
  162.243.106.242
  162.243.114.242
+162.243.116.41
  162.243.118.14
  162.243.118.76
  162.243.123.157
@@ -23645,6 +29292,7 @@
  162.243.144.210
  162.243.144.85
  162.243.145.53
+162.243.15.192
  162.243.151.28
  162.243.153.69
  162.243.153.85
@@ -23657,17 +29305,20 @@
  162.243.161.222
  162.243.163.122
  162.243.164.40
+162.243.166.183
  162.243.171.112
  162.243.172.179
  162.243.173.29
  162.243.174.115
  162.243.174.206
+162.243.18.87
  162.243.185.137
  162.243.186.46
  162.243.209.154
  162.243.209.240
  162.243.210.81
  162.243.217.240
+162.243.22.191
  162.243.221.238
  162.243.224.222
  162.243.225.74
@@ -23675,6 +29326,7 @@
  162.243.231.148
  162.243.232.174
  162.243.233.102
+162.243.237.90
  162.243.237.95
  162.243.241.183
  162.243.243.223
@@ -23690,6 +29342,7 @@
  162.243.35.41
  162.243.39.60
  162.243.40.123
+162.243.42.225
  162.243.45.7
  162.243.49.119
  162.243.5.209
@@ -23711,6 +29364,7 @@
  162.243.92.165
  162.243.93.167
  162.243.96.238
+162.243.99.164
  162.244.10.211
  162.244.10.216
  162.244.15.146
@@ -23754,15 +29408,16 @@
  162.248.242.254
  162.248.243.41
  162.248.55.137
+162.249.106.26
  162.249.220.190
  162.249.248.218
  162.249.6.128
-162.250.123.72
  162.250.126.186
  162.250.188.194
  162.250.189.53
  162.250.235.127
  162.252.241.118
+162.253.131.131
  162.253.66.50
  162.253.66.76
  162.254.250.6
@@ -23783,10 +29438,12 @@
  162783-dot-n-e-w-me-ss-age-po-rt-al.wl.r.appspot.com
  162840-dot-n-e-w-me-ss-age-po-rt-al.wl.r.appspot.com
  163.121.188.3
+163.125.18.255
+163.125.192.203
  163.125.193.101
-163.125.194.178
  163.125.226.237
-163.125.244.176
+163.125.248.140
+163.125.251.237
  163.13.182.105
  163.131.167.23
  163.139.169.79
@@ -23795,6 +29452,7 @@
  163.158.173.243
  163.158.202.112
  163.158.243.230
+163.158.60.179
  163.171.130.78
  163.171.132.59
  163.171.132.60
@@ -23805,8 +29463,11 @@
  163.172.109.132
  163.172.113.108
  163.172.113.177
+163.172.114.82
  163.172.115.25
  163.172.117.155
+163.172.119.84
+163.172.121.98
  163.172.123.92
  163.172.124.156
  163.172.128.177
@@ -23814,13 +29475,16 @@
  163.172.129.30
  163.172.130.111
  163.172.132.199
+163.172.133.23
  163.172.136.226
+163.172.136.227
  163.172.138.78
  163.172.138.81
  163.172.139.91
  163.172.142.149
  163.172.147.94
  163.172.148.62
+163.172.149.32
  163.172.151.250
  163.172.151.47
  163.172.152.52
@@ -23835,11 +29499,16 @@
  163.172.167.225
  163.172.171.163
  163.172.177.98
+163.172.178.167
  163.172.180.18
  163.172.181.191
  163.172.185.11
  163.172.189.32
  163.172.190.160
+163.172.193.209
+163.172.195.78
+163.172.197.147
+163.172.198.85
  163.172.201.184
  163.172.202.116
  163.172.204.173
@@ -23852,12 +29521,16 @@
  163.172.217.103
  163.172.219.130
  163.172.220.221
+163.172.228.214
  163.172.229.188
  163.172.234.206
  163.172.234.207
  163.172.234.209
  163.172.234.210
+163.172.234.212
  163.172.237.18
+163.172.24.40
+163.172.242.102
  163.172.25.234
  163.172.27.213
  163.172.27.234
@@ -23866,10 +29539,12 @@
  163.172.31.79
  163.172.32.190
  163.172.35.247
+163.172.40.200
  163.172.40.218
  163.172.41.115
  163.172.41.228
  163.172.42.123
+163.172.44.194
  163.172.44.42
  163.172.46.195
  163.172.47.182
@@ -23887,6 +29562,7 @@
  163.172.62.252
  163.172.73.194
  163.172.76.63
+163.172.77.205
  163.172.80.52
  163.172.82.118
  163.172.86.64
@@ -23895,7 +29571,9 @@
  163.172.97.112
  163.172.97.118
  163.172.98.25
+163.179.47.250
  163.179.47.252
+163.18.46.176
  163.198.132.31
  163.198.132.37
  163.198.132.58
@@ -23920,16 +29598,24 @@
  163.24.142.52
  163.27.127.131
  163.44.149.20
+163.44.149.204
  163.44.149.215
  163.44.150.123
  163.44.151.109
  163.44.151.92
  163.44.152.32
+163.44.158.143
+163.44.159.154
+163.44.168.207
+163.44.193.158
  163.44.193.95
  163.44.194.47
  163.44.196.132
+163.44.197.129
+163.44.197.71
  163.44.198.43
  163.44.198.59
+163.44.239.70
  163.47.146.118
  163.47.146.74
  163.47.15.168
@@ -23954,6 +29640,7 @@
  163.mailcn.org
  163b7da4b400d8de32f3d9b7df9737c6-dot-dbenitonline.ey.r.appspot.com
  163s.ddns.net
+164.100.6.145
  164.109.80.134
  164.115.22.45
  164.115.241.74
@@ -23962,18 +29649,24 @@
  164.115.43.209
  164.115.5.63
  164.125.234.121
+164.132.103.232
  164.132.107.245
  164.132.108.204
+164.132.108.73
  164.132.126.140
  164.132.148.184
  164.132.151.175
+164.132.155.14
  164.132.159.58
  164.132.160.230
+164.132.177.218
  164.132.195.231
  164.132.195.233
  164.132.199.114
  164.132.205.148
  164.132.222.249
+164.132.224.68
+164.132.228.134
  164.132.229.117
  164.132.23.43
  164.132.230.244
@@ -23985,36 +29678,57 @@
  164.132.236.239
  164.132.24.255
  164.132.38.166
+164.132.40.238
+164.132.42.32
  164.132.44.25
+164.132.44.97
  164.132.46.129
  164.132.46.14
  164.132.47.67
+164.132.48.179
  164.132.54.215
+164.132.56.243
  164.132.57.16
+164.132.70.6
  164.132.73.220
+164.132.74.177
  164.132.9.199
  164.132.92.168
  164.132.92.173
  164.132.92.180
  164.132.95.220
+164.132.96.120
  164.132.98.75
  164.138.236.227
  164.155.104.184
+164.155.104.9
  164.155.231.247
  164.155.231.251
  164.155.88.65
+164.155.89.7
+164.155.90.50
+164.155.95.28
  164.160.128.100
  164.160.128.104
  164.160.128.90
  164.160.161.85
  164.163.21.10
+164.163.224.230
+164.163.23.19
+164.163.24.13
  164.163.250.18
  164.163.250.80
+164.163.3.240
+164.163.3.243
  164.163.99.10
  164.177.104.186
+164.177.42.146
  164.39.202.75
  164.52.24.164
+164.52.24.168
+164.52.24.172
  164.52.25.162
+164.52.89.94
  164.58.29.186
  164.68.104.88
  164.68.106.226
@@ -24031,8 +29745,10 @@
  164.68.123.135
  164.68.124.225
  164.68.126.94
+164.68.97.107
  164.68.97.131
  164.68.97.15
+164.77.114.165
  164.77.114.237
  164.77.117.10
  164.77.133.220
@@ -24040,17 +29756,22 @@
  164.77.135.175
  164.77.135.3
  164.77.147.93
+164.77.154.146
+164.77.156.106
  164.77.175.246
+164.77.188.106
  164.77.221.98
  164.90.146.175
  164.90.148.76
+164.90.150.154
  164.90.151.31
  164.90.164.165
-164.90.186.5
  164.90.191.170
  164.90.198.71
  164.90.208.125
+164.90.212.168
  164.90.214.238
+164.90.215.39
  164.90.217.133
  164.90.217.167
  164.90.225.28
@@ -24060,11 +29781,13 @@
  164.90.241.64
  1643.31cf4fdae.com
  165.132.30.11
+165.138.4.47
  165.138.55.107
  165.139.252.55
  165.16.203.55
  165.16.23.17
  165.16.25.18
+165.16.27.90
  165.16.42.92
  165.16.54.199
  165.16.54.205
@@ -24088,15 +29811,25 @@
  165.169.173.85
  165.194.27.141
  165.22.0.113
+165.22.1.151
  165.22.10.136
  165.22.103.169
  165.22.103.235
  165.22.110.2
  165.22.112.46
  165.22.113.168
+165.22.113.66
+165.22.116.240
  165.22.120.146
+165.22.120.56
  165.22.121.12
+165.22.121.56
+165.22.123.86
  165.22.125.82
+165.22.126.183
+165.22.126.191
+165.22.126.195
+165.22.126.213
  165.22.13.122
  165.22.13.160
  165.22.13.92
@@ -24106,19 +29839,33 @@
  165.22.163.18
  165.22.17.5
  165.22.176.200
+165.22.179.177
  165.22.179.40
  165.22.18.45
+165.22.184.212
  165.22.186.178
  165.22.187.44
+165.22.193.137
  165.22.205.45
+165.22.206.182
  165.22.207.116
+165.22.209.132
+165.22.209.168
+165.22.21.136
  165.22.210.35
  165.22.210.69
  165.22.213.4
  165.22.213.55
+165.22.213.86
+165.22.213.9
+165.22.216.228
+165.22.217.96
  165.22.219.167
+165.22.22.250
  165.22.22.92
+165.22.221.230
  165.22.223.100
+165.22.223.121
  165.22.224.165
  165.22.224.212
  165.22.224.53
@@ -24129,7 +29876,9 @@
  165.22.23.23
  165.22.231.74
  165.22.233.194
+165.22.234.248
  165.22.235.29
+165.22.236.96
  165.22.237.13
  165.22.237.253
  165.22.238.167
@@ -24137,7 +29886,9 @@
  165.22.24.32
  165.22.24.71
  165.22.242.174
+165.22.242.228
  165.22.246.219
+165.22.247.221
  165.22.249.223
  165.22.250.142
  165.22.250.229
@@ -24145,17 +29896,20 @@
  165.22.255.213
  165.22.26.88
  165.22.28.119
-165.22.30.190
  165.22.30.31
  165.22.30.70
  165.22.33.243
  165.22.33.32
+165.22.35.21
  165.22.35.80
+165.22.40.128
  165.22.43.247
  165.22.44.115
  165.22.44.194
+165.22.48.140
  165.22.49.42
  165.22.50.136
+165.22.50.164
  165.22.50.208
  165.22.53.233
  165.22.57.164
@@ -24164,6 +29918,7 @@
  165.22.60.7
  165.22.61.205
  165.22.61.82
+165.22.63.151
  165.22.65.188
  165.22.66.112
  165.22.69.21
@@ -24175,6 +29930,9 @@
  165.22.73.254
  165.22.75.225
  165.22.75.227
+165.22.76.190
+165.22.76.96
+165.22.77.163
  165.22.77.219
  165.22.79.227
  165.22.80.124
@@ -24185,14 +29943,18 @@
  165.22.94.141
  165.22.95.50
  165.22.95.53
+165.22.98.186
  165.22.99.12
+165.22.99.216
  165.227.10.238
  165.227.100.181
  165.227.101.132
+165.227.101.226
  165.227.101.78
  165.227.102.121
  165.227.105.69
  165.227.105.86
+165.227.106.20
  165.227.106.28
  165.227.107.217
  165.227.108.49
@@ -24204,8 +29966,10 @@
  165.227.11.158
  165.227.11.196
  165.227.11.254
+165.227.110.132
  165.227.110.218
  165.227.111.252
+165.227.114.134
  165.227.115.226
  165.227.116.136
  165.227.116.183
@@ -24220,6 +29984,7 @@
  165.227.121.90
  165.227.122.212
  165.227.122.24
+165.227.124.168
  165.227.124.80
  165.227.126.48
  165.227.127.126
@@ -24228,7 +29993,9 @@
  165.227.130.157
  165.227.130.73
  165.227.131.127
+165.227.132.233
  165.227.132.8
+165.227.132.96
  165.227.136.116
  165.227.137.216
  165.227.139.148
@@ -24238,6 +30005,7 @@
  165.227.141.145
  165.227.141.246
  165.227.141.85
+165.227.142.62
  165.227.145.138
  165.227.148.98
  165.227.151.167
@@ -24248,16 +30016,20 @@
  165.227.163.238
  165.227.163.85
  165.227.163.91
+165.227.165.102
  165.227.165.22
+165.227.166.125
  165.227.166.128
  165.227.166.247
  165.227.167.31
  165.227.169.12
+165.227.169.7
  165.227.172.118
  165.227.173.181
  165.227.174.92
  165.227.175.240
  165.227.175.52
+165.227.176.208
  165.227.180.243
  165.227.180.91
  165.227.182.136
@@ -24266,6 +30038,7 @@
  165.227.19.191
  165.227.193.157
  165.227.193.66
+165.227.195.122
  165.227.195.204
  165.227.195.71
  165.227.196.229
@@ -24280,7 +30053,9 @@
  165.227.201.198
  165.227.201.25
  165.227.203.131
+165.227.203.141
  165.227.204.47
+165.227.205.128
  165.227.206.114
  165.227.207.17
  165.227.209.252
@@ -24317,6 +30092,7 @@
  165.227.30.126
  165.227.30.130
  165.227.30.203
+165.227.30.47
  165.227.31.17
  165.227.31.71
  165.227.33.50
@@ -24324,9 +30100,13 @@
  165.227.38.68
  165.227.4.30
  165.227.4.60
+165.227.43.226
  165.227.45.150
+165.227.46.89
  165.227.48.100
+165.227.49.156
  165.227.5.45
+165.227.50.84
  165.227.50.96
  165.227.53.107
  165.227.53.241
@@ -24335,19 +30115,30 @@
  165.227.6.20
  165.227.61.152
  165.227.61.35
+165.227.62.103
  165.227.62.249
+165.227.63.165
  165.227.63.41
+165.227.67.105
+165.227.67.106
+165.227.67.110
+165.227.67.118
  165.227.68.198
+165.227.69.177
  165.227.69.193
  165.227.7.187
  165.227.7.218
  165.227.7.29
  165.227.71.30
  165.227.71.60
+165.227.72.166
  165.227.72.37
+165.227.72.48
  165.227.75.121
+165.227.75.135
  165.227.76.73
  165.227.76.8
+165.227.78.191
  165.227.78.77
  165.227.8.84
  165.227.80.194
@@ -24355,6 +30146,7 @@
  165.227.81.93
  165.227.82.23
  165.227.84.172
+165.227.85.21
  165.227.85.253
  165.227.86.155
  165.227.87.251
@@ -24366,6 +30158,8 @@
  165.227.92.243
  165.227.94.232
  165.227.97.158
+165.227.99.167
+165.228.226.87
  165.231.103.110
  165.231.103.114
  165.231.103.133
@@ -24391,6 +30185,10 @@
  165.231.120.74
  165.231.120.96
  165.231.130.233
+165.231.143.106
+165.231.143.132
+165.231.143.133
+165.231.143.179
  165.231.163.20
  165.231.212.222
  165.231.212.250
@@ -24428,6 +30226,9 @@
  165.232.122.135
  165.232.122.187
  165.232.37.59
+165.232.61.116
+165.232.65.66
+165.232.66.234
  165.232.70.243
  165.232.98.175
  165.232.99.140
@@ -24439,7 +30240,6 @@
  165.255.88.133
  165.255.89.81
  165.255.99.4
-165.3.86.108
  165.3.87.110
  165.3.87.121
  165.3.87.123
@@ -24448,6 +30248,7 @@
  165.3.87.249
  165.3.87.253
  165.3.87.4
+165.3.88.211
  165.3.89.175
  165.3.89.178
  165.3.89.187
@@ -24457,11 +30258,15 @@
  165.3.89.254
  165.3.92.2
  165.3.93.81
+165.51.202.182
  165.73.89.75
  165.73.99.36
+165.84.180.12
  165.84.180.33
+165.84.180.37
  165.84.180.38
  165.84.180.46
+165.84.180.47
  165.84.180.66
  165.90.243.26
  165.90.51.222
@@ -24511,8 +30316,10 @@
  166.170.5.47
  166.216.165.124
  166.216.165.58
+166.62.100.200
  166.62.103.156
  166.62.117.176
+166.62.177.210
  166.62.37.57
  166.62.39.186
  166.62.45.148
@@ -24539,10 +30346,12 @@
  167.114.103.140
  167.114.113.219
  167.114.115.33
+167.114.116.5
  167.114.118.135
  167.114.118.31
  167.114.12.138
  167.114.122.37
+167.114.127.122
  167.114.129.9
  167.114.136.27
  167.114.144.159
@@ -24568,20 +30377,32 @@
  167.114.224.6
  167.114.23.185
  167.114.235.41
+167.114.237.46
+167.114.25.102
+167.114.251.164
  167.114.254.142
  167.114.29.88
  167.114.3.105
+167.114.3.158
  167.114.34.134
  167.114.35.12
+167.114.41.137
  167.114.43.93
  167.114.44.146
  167.114.45.110
+167.114.48.108
  167.114.49.252
  167.114.52.115
+167.114.64.16
  167.114.64.60
  167.114.65.240
  167.114.85.125
+167.114.96.156
+167.114.97.215
  167.114.98.229
+167.114.98.233
+167.114.98.234
+167.114.98.96
  167.132.252.225
  167.160.12.178
  167.160.184.54
@@ -24592,57 +30413,79 @@
  167.160.74.248
  167.160.76.56
  167.172.0.218
+167.172.107.219
  167.172.108.60
  167.172.109.12
  167.172.110.159
  167.172.111.114
  167.172.124.2
  167.172.126.253
+167.172.130.49
  167.172.131.194
  167.172.133.221
  167.172.135.255
  167.172.138.176
+167.172.138.255
  167.172.138.53
  167.172.139.248
  167.172.141.89
  167.172.142.103
  167.172.142.125
+167.172.142.20
  167.172.145.148
  167.172.145.168
+167.172.145.53
  167.172.146.98
+167.172.150.57
  167.172.151.135
  167.172.151.136
  167.172.153.14
+167.172.153.173
+167.172.154.44
  167.172.155.86
  167.172.156.12
  167.172.158.68
+167.172.16.47
  167.172.161.10
+167.172.161.169
  167.172.161.171
+167.172.163.162
  167.172.163.167
+167.172.164.37
+167.172.164.73
  167.172.165.34
  167.172.165.68
  167.172.166.193
+167.172.167.211
  167.172.167.26
  167.172.169.169
  167.172.169.236
  167.172.169.44
  167.172.169.97
+167.172.170.145
  167.172.171.189
  167.172.173.54
  167.172.179.135
+167.172.180.190
  167.172.185.17
  167.172.185.34
  167.172.186.163
  167.172.191.249
  167.172.194.16
+167.172.194.231
+167.172.195.99
  167.172.201.94
  167.172.204.125
+167.172.207.139
+167.172.208.194
  167.172.209.140
  167.172.209.209
  167.172.209.22
  167.172.212.197
+167.172.215.83
  167.172.216.125
  167.172.226.175
+167.172.227.174
  167.172.229.168
  167.172.23.70
  167.172.235.137
@@ -24651,13 +30494,19 @@
  167.172.242.210
  167.172.242.89
  167.172.246.182
+167.172.246.195
  167.172.246.23
+167.172.246.245
+167.172.246.83
  167.172.248.117
  167.172.248.19
+167.172.249.178
  167.172.25.123
  167.172.25.213
  167.172.250.115
  167.172.251.74
+167.172.252.62
+167.172.29.44
  167.172.31.31
  167.172.33.229
  167.172.38.238
@@ -24666,12 +30515,16 @@
  167.172.45.225
  167.172.54.27
  167.172.55.6
+167.172.56.36
  167.172.60.40
  167.172.61.145
  167.172.63.17
+167.172.64.157
+167.172.78.207
  167.172.78.73
  167.172.96.42
  167.172.97.140
+167.172.98.89
  167.179.106.112
  167.179.109.215
  167.179.117.213
@@ -24694,47 +30547,83 @@
  167.179.96.172
  167.179.97.17
  167.179.99.242
+167.248.133.37
+167.248.133.39
+167.248.133.40
+167.248.133.53
+167.248.133.54
  167.249.170.26
  167.249.181.236
+167.249.181.245
  167.249.212.17
+167.249.66.0
  167.249.9.37
+167.250.127.235
  167.250.160.206
  167.250.206.195
  167.250.49.155
  167.250.65.246
+167.250.96.75
  167.56.252.192
  167.56.7.75
+167.58.109.36
  167.68.23.251
  167.71.10.37
  167.71.102.102
+167.71.102.201
+167.71.104.1
+167.71.105.58
+167.71.108.96
  167.71.109.120
  167.71.11.57
+167.71.111.16
  167.71.112.8
  167.71.114.229
  167.71.115.245
+167.71.117.84
  167.71.119.18
+167.71.127.113
+167.71.127.147
+167.71.128.229
  167.71.128.64
  167.71.130.169
  167.71.130.205
+167.71.139.119
+167.71.143.11
  167.71.143.138
+167.71.143.39
+167.71.143.42
+167.71.145.201
  167.71.147.212
  167.71.148.58
  167.71.15.69
  167.71.152.101
  167.71.153.244
  167.71.159.219
+167.71.16.200
+167.71.162.16
  167.71.162.228
  167.71.164.131
  167.71.166.140
+167.71.167.194
  167.71.167.243
  167.71.167.33
+167.71.172.111
+167.71.172.131
  167.71.172.39
  167.71.174.63
  167.71.176.154
+167.71.184.82
+167.71.185.113
+167.71.196.176
  167.71.202.109
  167.71.202.40
+167.71.203.215
  167.71.204.250
  167.71.209.115
+167.71.209.158
+167.71.209.193
+167.71.210.7
  167.71.212.154
  167.71.213.125
  167.71.213.179
@@ -24744,45 +30633,65 @@
  167.71.218.243
  167.71.219.179
  167.71.219.86
+167.71.223.147
  167.71.224.129
+167.71.224.234
  167.71.225.204
+167.71.226.130
  167.71.227.113
  167.71.227.169
+167.71.228.224
  167.71.228.241
  167.71.228.31
  167.71.229.33
  167.71.230.124
+167.71.230.67
  167.71.232.129
  167.71.232.89
  167.71.234.29
+167.71.236.220
  167.71.236.26
  167.71.239.181
+167.71.241.109
  167.71.243.10
+167.71.34.115
  167.71.34.243
+167.71.36.193
  167.71.39.132
  167.71.4.0
  167.71.40.51
  167.71.42.21
+167.71.43.36
+167.71.44.43
  167.71.46.139
  167.71.46.162
+167.71.5.86
  167.71.50.123
  167.71.51.223
  167.71.52.95
+167.71.53.124
  167.71.56.93
+167.71.58.244
  167.71.59.56
+167.71.6.91
+167.71.63.47
  167.71.69.173
  167.71.7.109
  167.71.72.70
  167.71.73.244
+167.71.74.3
  167.71.74.39
  167.71.81.215
+167.71.81.29
  167.71.83.150
+167.71.86.88
  167.71.9.180
  167.71.91.219
  167.71.91.58
  167.71.95.157
  167.71.96.148
  167.71.98.172
+167.71.99.196
  167.78.4.18
  167.86.100.11
  167.86.100.98
@@ -24790,6 +30699,7 @@
  167.86.102.174
  167.86.104.203
  167.86.105.53
+167.86.109.151
  167.86.109.171
  167.86.110.76
  167.86.113.5
@@ -24802,16 +30712,19 @@
  167.86.67.67
  167.86.73.56
  167.86.78.148
+167.86.79.129
  167.86.80.173
  167.86.81.74
  167.86.87.90
  167.86.90.214
  167.86.90.239
  167.86.94.107
+167.86.95.160
  167.86.96.135
  167.86.98.148
  167.86.98.81
  167.86.99.118
+167.86.99.19
  167.88.15.198
  167.88.177.213
  167.88.178.19
@@ -24821,6 +30734,12 @@
  167.88.181.200
  167.88.181.219
  167.88.7.134
+167.89.10.200
+167.89.104.248
+167.89.16.130
+167.89.24.42
+167.98.71.52
+167.99.10.128
  167.99.10.176
  167.99.101.191
  167.99.101.77
@@ -24830,24 +30749,33 @@
  167.99.11.20
  167.99.110.102
  167.99.110.154
+167.99.110.179
  167.99.112.243
  167.99.13.63
  167.99.13.90
+167.99.132.132
  167.99.134.58
+167.99.137.75
+167.99.138.137
  167.99.139.208
  167.99.139.43
+167.99.14.237
  167.99.141.124
  167.99.142.69
  167.99.143.31
+167.99.143.45
  167.99.144.235
  167.99.146.95
+167.99.148.145
  167.99.148.91
+167.99.155.36
  167.99.159.142
  167.99.160.9
  167.99.161.236
  167.99.164.171
  167.99.166.74
  167.99.167.135
+167.99.169.17
  167.99.170.160
  167.99.174.205
  167.99.179.226
@@ -24862,6 +30790,7 @@
  167.99.189.132
  167.99.189.195
  167.99.194.170
+167.99.194.216
  167.99.195.219
  167.99.195.45
  167.99.199.139
@@ -24871,6 +30800,7 @@
  167.99.204.250
  167.99.204.251
  167.99.206.172
+167.99.208.146
  167.99.208.93
  167.99.208.94
  167.99.209.134
@@ -24878,9 +30808,11 @@
  167.99.209.6
  167.99.210.122
  167.99.210.58
+167.99.210.7
  167.99.211.208
  167.99.212.138
  167.99.213.209
+167.99.214.186
  167.99.215.8
  167.99.216.145
  167.99.216.19
@@ -24898,13 +30830,18 @@
  167.99.222.245
  167.99.223.105
  167.99.223.249
+167.99.224.109
+167.99.226.56
  167.99.228.58
  167.99.230.48
+167.99.231.236
  167.99.234.199
  167.99.234.59
  167.99.236.253
  167.99.240.241
+167.99.241.111
  167.99.242.205
+167.99.247.235
  167.99.251.192
  167.99.254.43
  167.99.28.116
@@ -24927,6 +30864,7 @@
  167.99.40.161
  167.99.40.38
  167.99.40.42
+167.99.41.0
  167.99.42.220
  167.99.42.83
  167.99.42.89
@@ -24941,6 +30879,7 @@
  167.99.52.178
  167.99.53.63
  167.99.59.91
+167.99.6.106
  167.99.6.209
  167.99.6.31
  167.99.6.43
@@ -24949,27 +30888,36 @@
  167.99.64.181
  167.99.64.81
  167.99.65.231
+167.99.65.64
+167.99.66.2
+167.99.66.74
  167.99.67.142
  167.99.67.42
  167.99.68.226
+167.99.68.65
  167.99.7.190
  167.99.7.239
  167.99.7.240
  167.99.7.52
+167.99.70.135
  167.99.70.45
  167.99.70.54
  167.99.72.149
  167.99.75.174
  167.99.75.240
+167.99.77.94
  167.99.82.226
  167.99.82.91
  167.99.87.4
+167.99.88.37
  167.99.90.243
  167.99.90.25
  167.99.91.116
  167.99.95.227
+167.99.96.114
  167.99.96.163
  167.99.98.92
+167.99.99.10
  168.0.155.138
  168.103.128.133
  168.103.129.86
@@ -25016,6 +30964,7 @@
  168.119.176.229
  168.119.18.7
  168.119.202.71
+168.119.229.72
  168.119.238.100
  168.119.247.58
  168.119.249.19
@@ -25030,22 +30979,29 @@
  168.119.86.22
  168.119.88.108
  168.119.96.193
+168.121.104.115
  168.121.137.64
  168.121.139.199
  168.121.139.31
+168.121.216.37
+168.121.45.208
  168.121.54.29
+168.121.67.44
  168.121.97.67
  168.126.28.24
  168.126.85.182
  168.128.130.59
  168.138.14.139
  168.138.202.98
+168.138.213.119
  168.138.221.133
  168.138.230.95
  168.138.238.2
+168.138.243.247
  168.138.33.79
  168.138.38.230
  168.138.40.90
+168.138.43.165
  168.143.19.89
  168.144.170.33
  168.144.91.77
@@ -25057,21 +31013,27 @@
  168.151.228.228
  168.151.229.17
  168.151.229.76
+168.151.98.51
  168.167.85.255
  168.181.121.195
  168.181.121.197
  168.181.134.119
+168.181.145.242
  168.181.196.33
  168.181.242.81
  168.181.245.129
+168.181.255.75
  168.181.48.205
  168.184.14.14
  168.187.77.177
  168.194.13.4
  168.194.14.126
+168.194.154.139
+168.194.162.170
  168.194.164.46
  168.194.165.74
  168.194.201.6
+168.194.207.58
  168.194.83.25
  168.194.83.45
  168.195.182.62
@@ -25081,14 +31043,22 @@
  168.195.196.29
  168.195.205.154
  168.195.229.60
+168.195.37.135
  168.196.114.201
  168.196.114.205
  168.196.114.241
  168.196.114.7
+168.196.12.27
+168.196.148.131
  168.196.52.80
+168.196.96.37
+168.197.176.8
+168.197.26.139
  168.197.52.224
+168.205.111.43
  168.205.139.13
  168.205.140.224
+168.205.183.241
  168.205.217.14
  168.205.217.144
  168.205.217.164
@@ -25112,6 +31082,7 @@
  168.215.65.71
  168.226.214.98
  168.227.106.100
+168.227.109.6
  168.227.146.34
  168.227.147.243
  168.227.15.229
@@ -25132,8 +31103,11 @@
  168.227.158.61
  168.227.158.9
  168.227.212.130
+168.227.212.154
  168.227.78.94
+168.227.99.11
  168.228.118.25
+168.228.119.121
  168.228.150.5
  168.228.192.13
  168.228.204.250
@@ -25153,6 +31127,7 @@
  168.232.197.36
  168.232.198.149
  168.232.198.195
+168.232.198.246
  168.232.20.155
  168.232.214.26
  168.232.214.29
@@ -25163,12 +31138,18 @@
  168.235.83.139
  168.235.90.188
  168.235.98.150
+168.245.120.69
+168.245.65.6
+168.61.18.166
  168.61.55.120
+168.62.174.233
  168.62.175.22
-168.62.180.189
+168.62.21.233
  168.62.218.152
  168.62.248.25
  168.63.137.51
+168.63.151.21
+168.63.253.109
  168.63.54.181
  168.70.42.15
  168.70.62.18
@@ -25198,6 +31179,7 @@
  168.90.199.210
  168.90.199.45
  168.90.199.71
+168.90.22.119
  168.90.28.62
  168.90.29.245
  168.90.34.148
@@ -25208,6 +31190,7 @@
  168.90.88.40
  168.90.89.125
  168.90.89.238
+168.90.89.35
  168.90.90.30
  168.90.90.57
  168.90.92.34
@@ -25236,6 +31219,8 @@
  168ob.com
  169-239-129-63.cprapid.com
  169.0.67.26
+169.0.86.80
+169.1.71.161
  169.149.133.127
  169.239.129.63
  169.239.166.134
@@ -25254,11 +31239,13 @@
  169.255.139.5
  169.255.189.57
  169.255.190.18
+169.255.216.36
  169.255.234.166
  169.255.28.154
  169.255.6.26
  169.255.65.254
  169.255.75.117
+169.44.153.122
  169.44.34.203
  169.48.163.176
  169.48.179.124
@@ -25290,19 +31277,27 @@
  170.0.52.6
  170.0.54.253
  170.106.107.32
+170.106.108.240
  170.106.142.211
  170.106.151.211
  170.106.151.247
+170.106.151.97
  170.106.153.172
  170.106.153.18
  170.106.154.245
  170.106.155.226
  170.106.155.75
+170.106.155.8
  170.106.159.113
+170.106.202.252
+170.106.33.223
+170.106.33.94
  170.106.34.245
  170.106.34.74
+170.106.35.43
  170.106.39.134
  170.106.39.246
+170.106.5.200
  170.106.50.105
  170.106.50.166
  170.106.65.54
@@ -25311,8 +31306,36 @@
  170.130.126.96
  170.130.172.40
  170.130.172.42
+170.130.187.2
  170.130.205.117
  170.130.31.177
+170.130.46.226
+170.130.46.227
+170.130.46.229
+170.130.46.230
+170.130.46.231
+170.130.46.232
+170.130.46.233
+170.130.46.234
+170.130.46.235
+170.130.46.236
+170.130.46.237
+170.130.46.238
+170.130.46.239
+170.130.46.240
+170.130.46.241
+170.130.46.242
+170.130.46.243
+170.130.46.244
+170.130.46.245
+170.130.46.246
+170.130.46.247
+170.130.46.248
+170.130.46.250
+170.130.46.251
+170.130.46.252
+170.130.46.253
+170.130.46.254
  170.130.55.65
  170.130.55.97
  170.130.58.166
@@ -25333,34 +31356,47 @@
  170.150.103.192
  170.150.103.244
  170.150.103.77
+170.150.139.138
+170.150.139.139
+170.150.139.148
  170.150.52.210
  170.150.52.5
  170.150.52.65
+170.150.53.96
+170.150.72.28
  170.151.0.4
  170.185.68.14
  170.210.136.56
  170.210.192.78
  170.210.203.201
+170.210.203.215
  170.210.214.50
  170.210.4.222
+170.210.71.10
  170.231.187.209
  170.231.232.97
  170.231.56.3
+170.231.58.183
  170.233.115.90
  170.233.117.32
  170.233.120.98
  170.233.122.134
  170.233.123.130
+170.233.189.136
+170.233.68.169
  170.238.102.162
  170.238.115.177
  170.238.117.187
  170.238.119.77
+170.238.14.133
  170.238.141.101
+170.238.142.146
  170.238.156.30
  170.238.212.135
  170.238.255.90
  170.238.74.61
  170.239.108.10
+170.239.201.3
  170.239.222.182
  170.244.0.178
  170.244.0.179
@@ -25372,6 +31408,9 @@
  170.244.64.198
  170.244.64.225
  170.244.88.67
+170.245.200.100
+170.245.245.194
+170.246.3.242
  170.246.69.110
  170.246.69.58
  170.246.85.106
@@ -25379,6 +31418,7 @@
  170.246.85.38
  170.246.85.9
  170.247.1.130
+170.247.112.103
  170.247.112.121
  170.247.112.125
  170.247.112.171
@@ -25392,11 +31432,14 @@
  170.247.202.96
  170.247.203.1
  170.247.203.235
+170.247.41.191
  170.247.43.142
  170.249.191.114
  170.250.84.130
+170.253.30.172
  170.254.148.94
  170.254.224.7
+170.254.226.157
  170.254.248.61
  170.254.92.198
  170.39.212.245
@@ -25410,6 +31453,7 @@
  170.78.39.132
  170.78.39.58bin.sh
  170.78.96.1
+170.78.96.2
  170.79.148.21
  170.79.181.118
  170.79.181.146
@@ -25420,12 +31464,14 @@
  170.79.181.74
  170.79.181.82
  170.79.233.162
+170.79.251.203
  170.79.45.184
  170.79.87.178
  170.79.9.54
  170.79.91.98
  170.79.94.110
  170.79.94.208
+170.80.225.16
  170.80.36.150
  170.80.36.2
  170.80.49.114
@@ -25443,12 +31489,14 @@
  170.81.141.254
  170.81.141.49
  170.81.141.97
+170.81.245.86
  170.81.34.54
  170.81.35.26
  170.81.37.33
  170.81.48.2
  170.81.92.102
  170.81.93.44
+170.82.189.152
  170.82.52.48
  170.82.54.39
  170.83.115.4
@@ -25517,6 +31565,7 @@
  170.84.183.193
  170.84.183.196
  170.84.183.2
+170.84.224.240
  170.84.48.105
  170.84.48.106
  170.84.48.118
@@ -25526,6 +31575,8 @@
  170.84.48.48
  170.84.50.192
  170.84.50.193
+170.84.56.142
+170.84.58.5
  170.84.82.62
  1700restaurant.com
  1702525-dot-n-e-w-me-ss-age-po-rt-al.wl.r.appspot.com
@@ -25537,32 +31588,49 @@
  171.101.102.20
  171.101.131.133
  171.101.99.79
+171.103.174.222
+171.103.195.250
+171.103.195.50
+171.103.195.62
+171.103.197.10
+171.103.197.42
+171.103.197.46
+171.103.197.58
+171.103.199.14
+171.103.200.46
+171.103.78.130
  171.103.9.22
  171.104.126.183
  171.106.205.135
  171.107.184.213
+171.111.153.216
  171.111.183.16
+171.112.195.200
+171.112.44.234
  171.112.45.160
  171.113.40.47
  171.118.24.229
  171.119.192.151
  171.119.209.26
-171.119.215.96
-171.119.217.215
  171.119.223.219
-171.119.238.103
  171.121.122.102
  171.121.255.11
  171.121.255.12
  171.123.109.137
  171.123.120.177
  171.123.15.218
+171.124.255.248
  171.125.104.190
+171.125.115.96
  171.125.195.122
+171.125.4.52
  171.125.50.166
  171.125.72.224
  171.125.82.145
  171.125.95.175
+171.125.95.56
+171.15.17.161
+171.211.25.217
  171.22.122.109
  171.22.123.12
  171.22.123.156
@@ -25582,12 +31650,16 @@
  171.22.24.185
  171.22.253.189
  171.22.255.146
+171.221.151.111
  171.221.200.175
+171.221.210.158
  171.221.217.145
  171.221.254.175
  171.224.178.150
  171.224.178.161
+171.224.181.170
  171.224.237.178
+171.225.251.100
  171.225.254.189
  171.226.1.242
  171.226.1.56
@@ -25598,6 +31670,7 @@
  171.226.3.244
  171.226.3.46
  171.226.4.221
+171.226.41.72
  171.226.5.79
  171.226.6.91
  171.227.20.221
@@ -25606,7 +31679,6 @@
  171.227.209.195
  171.227.210.220
  171.227.212.113
-171.227.212.72
  171.227.213.227
  171.227.213.89
  171.227.214.20
@@ -25615,22 +31687,31 @@
  171.227.215.226
  171.227.23.165
  171.227.26.217
+171.228.196.238
  171.228.211.13
  171.228.220.53
  171.228.69.230
+171.229.182.29
+171.229.39.167
+171.229.80.179
+171.231.119.140
+171.231.169.179
+171.231.210.65
  171.231.5.16
+171.232.136.139
  171.232.244.141
  171.235.50.243
  171.235.51.218
  171.235.54.188
-171.235.58.202
  171.235.63.50
  171.235.81.248
  171.235.82.228
  171.235.84.29
  171.235.86.129
  171.235.87.27
+171.237.10.194
  171.237.152.11
+171.238.154.69
  171.239.184.178
  171.239.248.237
  171.239.248.84
@@ -25646,35 +31727,49 @@
  171.240.195.82
  171.240.196.176
  171.240.197.61
+171.240.201.2
  171.240.204.189
  171.240.204.28
  171.240.205.195
  171.240.205.2
  171.240.207.76
  171.240.9.241
+171.241.25.125
+171.241.50.164
+171.242.32.3
  171.243.245.147
  171.244.1.84
  171.244.132.198
+171.244.139.178
  171.244.139.236
  171.244.139.67
  171.244.140.174
  171.244.142.202
+171.244.15.38
+171.244.16.85
  171.244.18.14
+171.244.18.197
  171.244.188.205
  171.244.19.212
  171.244.21.74
+171.244.38.56
  171.244.45.137
+171.244.51.114
+171.245.228.120
  171.247.100.133
  171.247.102.124
  171.247.102.54
  171.247.102.66
  171.247.103.103
+171.249.108.223
  171.249.137.166
  171.249.137.191
  171.249.138.136
  171.249.138.191
-171.249.139.103
  171.249.139.98
+171.249.192.22
+171.249.219.22
+171.249.223.148
  171.249.38.210
  171.25.193.131
  171.25.193.20
@@ -25682,24 +31777,31 @@
  171.25.193.25
  171.25.193.77
  171.25.193.78
+171.25.209.203
  171.251.17.214
  171.251.19.13
  171.251.20.155
  171.251.20.190
+171.251.235.227
+171.251.239.49
  171.251.25.186
  171.251.25.44
  171.251.26.168
  171.251.30.163
+171.252.155.49
  171.252.22.163
  171.255.199.129
  171.34.113.168
  171.34.115.101
+171.34.115.87
+171.34.173.17
  171.34.176.117
  171.34.177.12
  171.34.177.75
  171.34.178.93
  171.34.179.192
  171.34.70.28
+171.34.78.107
  171.35.140.59
  171.35.160.80
  171.35.166.11
@@ -25709,15 +31811,18 @@
  171.35.173.215
  171.35.174.233
  171.35.213.57
-171.36.186.177
  171.38.144.250
-171.38.222.9
+171.38.151.225
+171.38.219.190
+171.4.94.2
  171.42.161.164bin.sh
  171.42.17.114
  171.42.32.127
  171.42.61.245
  171.44.141.4
  171.44.143.233
+171.49.193.228
+171.49.206.225
  171.5.16.34
  171.5.162.113
  171.5.165.29
@@ -25727,7 +31832,9 @@
  171.5.25.179
  171.5.25.41
  171.5.29.34
+171.50.244.173
  171.6.229.229
+171.6.233.32
  171.6.49.208
  171.6.6.190
  171.6.73.53
@@ -25736,23 +31843,37 @@
  171.7.25.191
  171.7.26.24
  171.7.27.245
+171.76.15.169
+171.78.157.154
+171.78.189.92
+171.78.199.48
+171.80.162.7
  171.81.105.212
+171.84.2.6
+171.88.53.97
  171.95.87.35
  171.96.138.44
+171.96.158.8
  171.96.159.150
  171.96.220.134
  171.96.220.220
  171.96.247.18
  171.97.107.112
+171.97.112.24
  171.97.129.201
+171.97.169.36
+171.97.177.49
  171.97.239.246
  171.97.40.29
  171.97.42.16
  171.97.42.82
+171.97.48.119
  171.97.67.81
  171.97.85.142
  171.98.73.6
+171.98.76.80
  171.99.147.202
+171.99.157.37
  171.99.167.98
  171.99.205.75
  171298-dot-n-e-w-me-ss-age-po-rt-al.wl.r.appspot.com
@@ -25830,6 +31951,7 @@
  172.104.251.75
  172.104.253.228
  172.104.27.206
+172.104.28.96
  172.104.33.72
  172.104.35.203
  172.104.36.119
@@ -25853,6 +31975,7 @@
  172.104.7.181
  172.104.75.136
  172.104.81.87
+172.104.88.113
  172.104.9.251
  172.104.90.95
  172.104.92.108
@@ -26054,6 +32177,7 @@
  172.107.1.96
  172.107.1.99
  172.107.51.66
+172.111.170.210
  172.111.170.211
  172.111.203.232
  172.114.161.190
@@ -26067,6 +32191,8 @@
  172.193.14.201
  172.218.182.132
  172.221.213.190
+172.221.34.69
+172.222.125.46
  172.241.192.46
  172.241.242.110
  172.241.242.187
@@ -26148,6 +32274,7 @@
  172.245.92.147
  172.245.97.184
  172.249.171.9
+172.250.7.113
  172.254.154.243
  172.255.125.138
  172.255.80.215
@@ -26199,6 +32326,7 @@
  172.69.34.30
  172.69.35.111
  172.69.63.53
+172.74.126.241
  172.74.184.175
  172.81.129.154
  172.81.129.226
@@ -26208,14 +32336,21 @@
  172.81.177.66
  172.81.182.34
  172.81.183.236
+172.81.203.33
  172.81.209.199
  172.81.210.122
+172.81.211.207
  172.81.212.86
  172.81.215.201
  172.81.227.243
+172.81.235.238
+172.81.239.224
+172.81.241.252
+172.81.241.92
  172.81.242.40
  172.81.243.195
  172.81.246.239
+172.81.251.217
  172.81.252.123
  172.82.128.202
  172.82.149.130
@@ -26245,7 +32380,6 @@
  172.93.166.135
  172.93.38.228
  172.93.39.189
-172.93.40.173
  172.93.49.142
  172.94.109.43
  172.94.23.69
@@ -26255,21 +32389,34 @@
  172.94.34.82
  172.94.34.84
  172.94.34.85
+172.94.63.58
  172.94.69.79
+172.95.161.66
+172.96.14.66
+172.96.16.214
  172.96.161.244
  172.96.166.188
  172.96.172.68
  172.96.176.129
  172.96.184.39
+172.96.185.68
  172.96.190.154
  172.96.191.17
+172.96.196.185
+172.96.208.126
  172.96.210.122
  172.96.214.107
  172.96.217.110
+172.96.219.239
+172.96.220.171
+172.96.223.81
  172.96.227.148
  172.96.227.95
+172.96.234.93
  172.96.238.154
  172.96.242.6
+172.96.251.203
+172.96.253.176
  172.96.95.213
  172.98.193.43
  172.98.193.62
@@ -26285,6 +32432,7 @@
  1725studio.com
  172910209315.ip-dynamic.com
  172princessbet.com
+173.0.136.70
  173.0.49.138
  173.10.184.69
  173.10.184.70
@@ -26300,12 +32448,17 @@
  173.15.162.156
  173.15.162.157
  173.15.28.165
+173.15.85.9
+173.161.156.201
  173.161.208.193
+173.161.87.170
  173.163.39.49
  173.163.92.117
  173.164.157.29
  173.164.210.49
+173.167.46.61
  173.167.85.89
+173.17.36.31
  173.17.69.206
  173.173.254.105
  173.174.105.66
@@ -26340,7 +32493,18 @@
  173.199.143.137
  173.199.186.15
  173.199.71.150
+173.200.213.46
+173.201.196.104
  173.201.196.116
+173.201.196.172
+173.201.196.174
+173.201.196.175
+173.201.196.176
+173.201.196.184
+173.201.196.207
+173.201.196.220
+173.201.196.4
+173.201.196.59
  173.201.196.67
  173.201.196.7
  173.201.196.97
@@ -26387,6 +32551,7 @@
  173.202.27.25
  173.202.29.183
  173.202.30.177
+173.202.30.19
  173.202.80.16
  173.203.126.125
  173.203.215.83
@@ -26407,7 +32572,6 @@
  173.208.153.130
  173.208.155.34
  173.208.157.186
-173.208.164.250
  173.208.166.82
  173.208.168.194
  173.208.169.26
@@ -26435,6 +32599,7 @@
  173.208.40.42
  173.208.46.67
  173.209.44.34
+173.211.25.153
  173.212.192.195
  173.212.197.167
  173.212.197.237
@@ -26455,6 +32620,7 @@
  173.212.214.113
  173.212.215.253
  173.212.216.52
+173.212.219.223
  173.212.219.49
  173.212.220.9
  173.212.221.11
@@ -26470,7 +32636,9 @@
  173.212.232.122
  173.212.235.121
  173.212.235.237
+173.212.239.217
  173.212.239.226
+173.212.240.196
  173.212.240.54
  173.212.241.51
  173.212.242.27
@@ -26490,14 +32658,18 @@
  173.214.181.39
  173.214.185.62
  173.215.38.143
+173.216.214.223
  173.216.245.75
  173.217.255.36
+173.217.97.76
  173.218.65.200
  173.219.43.147
  173.219.86.196
+173.219.89.135
  173.220.222.227
  173.221.41.47
  173.224.106.235
+173.225.104.57
  173.225.106.37
  173.227.0.76
  173.230.129.187
@@ -26514,6 +32686,7 @@
  173.231.192.43
  173.231.200.117
  173.231.200.98
+173.231.59.195
  173.231.63.88
  173.232.146.105
  173.232.146.141
@@ -27300,6 +33473,7 @@
  173.234.227.99
  173.234.48.138
  173.234.48.69
+173.236.144.16
  173.236.144.241
  173.236.144.82
  173.236.152.135
@@ -27442,6 +33616,7 @@
  173.236.183.61
  173.236.183.73
  173.236.183.84
+173.236.193.48
  173.236.194.65
  173.236.224.16
  173.236.61.20
@@ -27453,9 +33628,11 @@
  173.239.33.90
  173.239.71.130
  173.24.113.136
+173.240.15.11
  173.240.248.38
  173.242.112.93
  173.242.118.66
+173.242.122.149
  173.243.112.231
  173.244.165.27
  173.244.165.29
@@ -27466,6 +33643,7 @@
  173.244.48.66
  173.245.202.152
  173.245.203.69
+173.245.219.130
  173.245.36.254
  173.246.13.149
  173.246.159.134
@@ -27492,6 +33670,7 @@
  173.248.242.211
  173.249.0.164
  173.249.0.235
+173.249.0.88
  173.249.1.160
  173.249.12.221
  173.249.2.204
@@ -27511,6 +33690,7 @@
  173.249.42.83
  173.249.45.75
  173.249.46.22
+173.249.47.173
  173.249.48.168
  173.249.48.175
  173.249.48.41
@@ -27566,6 +33746,7 @@
  173.255.240.205
  173.255.248.135
  173.255.250.144
+173.30.96.81
  173.31.204.211
  173.35.147.204
  173.44.123.163
@@ -27638,6 +33819,7 @@
  173.69.174.252
  173.69.200.104
  173.70.12.86
+173.70.24.15
  173.70.61.180
  173.73.115.178
  173.73.201.171
@@ -27648,6 +33830,7 @@
  173.78.219.97
  173.79.107.81
  173.79.252.210
+173.8.134.217
  173.81.218.65
  173.82.105.129
  173.82.119.161
@@ -27694,6 +33877,7 @@
  173.82.97.235
  173.82.97.243
  173.89.28.137
+173.89.68.61
  173.91.11.142
  173.92.22.111
  173.94.178.164
@@ -27707,12 +33891,14 @@
  174.100.141.37
  174.100.209.2
  174.100.27.229
+174.102.201.18
  174.102.48.180
  174.104.40.238
  174.105.122.60
  174.106.122.139
  174.106.163.226
  174.109.212.183
+174.110.88.87
  174.111.19.140
  174.112.103.12
  174.112.205.57
@@ -27745,6 +33931,7 @@
  174.124.140.71
  174.124.141.209
  174.124.141.98
+174.124.142.13
  174.124.143.109
  174.124.143.90
  174.124.144.16
@@ -27801,6 +33988,7 @@
  174.124.53.4
  174.124.54.100
  174.124.54.108
+174.124.54.114
  174.124.55.64
  174.125.112.150
  174.125.112.180
@@ -27902,6 +34090,7 @@
  174.136.47.243
  174.136.47.244
  174.137.50.72
+174.137.56.118
  174.137.60.247
  174.138.0.164
  174.138.0.201
@@ -27914,13 +34103,17 @@
  174.138.15.47
  174.138.16.109
  174.138.16.99
+174.138.178.194
  174.138.18.194
  174.138.2.113
  174.138.2.114
+174.138.20.105
+174.138.20.169
  174.138.20.237
  174.138.22.37
  174.138.22.97
  174.138.26.171
+174.138.27.165
  174.138.3.159
  174.138.32.113
  174.138.32.22
@@ -27931,10 +34124,13 @@
  174.138.35.229
  174.138.36.47
  174.138.36.6
+174.138.37.30
  174.138.39.59
+174.138.40.185
  174.138.40.233
  174.138.40.60
  174.138.41.169
+174.138.42.143
  174.138.42.16
  174.138.44.201
  174.138.44.34
@@ -27952,6 +34148,8 @@
  174.138.61.227
  174.138.61.46
  174.138.63.232
+174.138.64.163
+174.138.65.206
  174.138.67.137
  174.138.67.79
  174.138.7.28
@@ -28055,6 +34253,7 @@
  174.19.115.110
  174.19.116.94
  174.19.117.15
+174.19.118.51
  174.19.119.113
  174.19.12.60
  174.19.12.7
@@ -28076,6 +34275,7 @@
  174.19.14.174
  174.19.14.97
  174.19.15.129
+174.19.15.208
  174.19.15.61
  174.19.16.171
  174.19.16.208
@@ -28482,6 +34682,7 @@
  174.30.75.216
  174.30.76.136
  174.30.76.138
+174.30.77.122
  174.30.77.192
  174.30.78.230
  174.30.80.121
@@ -28538,6 +34739,7 @@
  174.59.3.38
  174.59.9.9
  174.6.100.50
+174.62.76.244
  174.64.199.79
  174.64.199.82
  174.64.199.87
@@ -28551,6 +34753,8 @@
  174.70.241.27
  174.70.241.7
  174.70.241.8
+174.71.185.194
+174.71.185.203
  174.71.60.232
  174.72.49.29
  174.74.15.121
@@ -28568,15 +34772,20 @@
  174.76.48.252
  174.77.111.196
  174.77.111.197
+174.77.111.220
  174.80.197.141
  174.84.148.29
+174.84.183.72
  174.86.246.167
+174.87.100.122
+174.87.176.64
  174.88.134.233
  174.88.140.40
  174.88.159.10
  174.88.165.121
  174.89.185.50
  174.89.83.6
+174.91.192.106
  174.91.5.72
  174.92.142.223
  174.93.55.80
@@ -28600,17 +34809,22 @@
  175.100.151.50
  175.100.16.20
  175.100.18.45
+175.100.181.190
  175.100.30.156
  175.100.47.144
  175.100.5.52
  175.100.72.95
  175.100.73.206
+175.101.11.198
+175.101.117.8
  175.101.13.125
  175.103.38.146
+175.103.46.82
  175.103.47.1
  175.106.10.164
  175.106.10.226
  175.106.12.182
+175.106.17.102
  175.106.17.222
  175.106.17.62
  175.106.17.93
@@ -28622,8 +34836,8 @@
  175.107.14.5
  175.107.185.3
  175.107.19.227
+175.107.200.187
  175.107.206.134
-175.11.133.240
  175.11.192.170
  175.11.192.189
  175.11.193.10
@@ -28631,31 +34845,59 @@
  175.11.194.56
  175.11.195.108
  175.11.195.90
+175.11.202.78
+175.11.213.253
+175.11.216.114
+175.11.216.117
  175.11.64.170
+175.11.65.35
  175.11.94.110
+175.110.107.2
  175.110.80.86
  175.111.119.42
  175.111.181.246
  175.111.181.26
  175.111.91.143
+175.113.50.47
  175.116.222.106
  175.116.222.47
  175.117.144.37
  175.117.145.166
+175.117.145.202
  175.118.126.20
+175.118.126.99
+175.118.152.100
  175.121.184.46
+175.123.253.188
+175.123.253.220
+175.123.253.79
  175.123.98.240
+175.125.14.1
  175.125.216.117
  175.125.94.166
+175.125.95.160
+175.126.167.148
+175.126.176.21
+175.126.38.47
  175.126.62.28
+175.126.73.16
  175.136.2.222
  175.136.226.231
+175.136.97.58
  175.137.121.75
+175.137.246.152
+175.137.4.228
+175.138.108.78
  175.138.188.97
  175.138.233.116
  175.138.48.167
+175.138.49.82
+175.138.80.201
+175.139.161.55
  175.139.179.65
+175.139.188.181
  175.139.252.193
+175.139.76.167
  175.140.138.193
  175.140.184.75
  175.140.217.55
@@ -28663,27 +34905,52 @@
  175.140.89.82
  175.141.69.201
  175.142.212.123
+175.143.114.242
+175.143.143.56
+175.143.184.208
+175.143.210.131
  175.143.51.221
  175.143.79.81
  175.143.94.120
+175.144.163.195
  175.144.198.13
  175.144.198.225
  175.144.198.226
  175.144.244.240
  175.144.45.221
  175.144.57.167
+175.144.70.244
  175.145.109.202
  175.145.178.96
  175.145.200.216
  175.145.234.102
  175.147.21.193
  175.150.183.63
+175.158.170.213
+175.158.38.68
+175.162.0.98
+175.162.1.57
+175.162.10.162
+175.162.2.105
+175.162.221.130
+175.162.77.71
  175.169.118.51
-175.170.68.40
+175.169.26.13
+175.170.142.136
+175.170.149.29
+175.172.51.94
  175.175.68.20
+175.175.69.153
+175.176.18.138
+175.176.18.243
  175.176.184.5
  175.176.185.106
+175.176.19.157
+175.176.19.208
  175.176.223.133
+175.176.81.40
+175.176.83.10
+175.176.89.193
  175.182.175.145
  175.182.177.163
  175.182.177.8
@@ -28691,16 +34958,27 @@
  175.183.16.206
  175.184.232.74
  175.184.233.23
+175.186.0.161
+175.19.187.234
+175.19.209.244
+175.192.85.39
+175.193.13.3
  175.193.2.152
  175.193.2.152bin.sh
  175.193.97.249
  175.194.54.93
+175.195.186.163
+175.195.197.176
  175.195.33.102
  175.196.10.125
+175.196.178.187
  175.197.233.197
+175.198.80.24
+175.198.99.146
  175.199.229.203
  175.199.229.203bin.sh
  175.199.33.139
+175.200.10.28
  175.201.64.37
  175.202.14.244
  175.203.179.215
@@ -28708,17 +34986,20 @@
  175.205.126.190
  175.205.136.127
  175.206.182.103
-175.206.2.147
  175.206.9.92
+175.207.13.22
+175.207.13.56
  175.207.44.68
  175.207.55.232
  175.208.184.133
+175.208.191.37
  175.208.251.15
  175.209.141.227
  175.210.137.145
  175.211.44.107
  175.211.69.151
  175.212.180.131
+175.212.225.71
  175.213.81.178
  175.213.81.184
  175.213.81.19
@@ -28726,34 +35007,72 @@
  175.215.141.197
  175.215.202.131
  175.24.1.203
+175.24.100.238
+175.24.101.37
  175.24.102.153
  175.24.103.72
+175.24.106.253
  175.24.107.175
+175.24.116.15
+175.24.117.78
+175.24.119.184
+175.24.122.139
+175.24.123.109
+175.24.123.25
+175.24.125.23
+175.24.125.231
+175.24.126.194
+175.24.127.209
+175.24.147.126
  175.24.152.153
+175.24.152.35
+175.24.17.53
  175.24.18.134
+175.24.185.31
+175.24.187.87
  175.24.188.43
  175.24.189.167
+175.24.19.17
  175.24.191.251
  175.24.2.195
+175.24.21.18
  175.24.232.126
+175.24.28.241
  175.24.29.104
  175.24.35.40
+175.24.41.45
+175.24.42.244
+175.24.45.137
+175.24.45.144
  175.24.46.21
+175.24.49.210
+175.24.49.95
  175.24.50.107
  175.24.51.66
  175.24.57.24
  175.24.62.141
+175.24.62.199
+175.24.63.117
  175.24.67.124
  175.24.67.217
  175.24.68.241
  175.24.70.126
+175.24.72.167
+175.24.8.247
+175.24.81.123
  175.24.81.207
+175.24.85.191
+175.24.95.240
+175.24.97.62
  175.27.128.235
  175.27.157.206
+175.27.187.38
  175.28.14.2
  175.29.183.2
  175.29.188.27
  175.29.188.9
+175.30.204.158
+175.36.126.63
  175.41.167.83
  175.41.191.216
  175.41.218.218
@@ -28762,7 +35081,6 @@
  175.41.44.51
  175.41.45.129
  175.42.100.24
-175.42.40.75
  175.42.44.57
  175.43.176.182
  175.43.240.43
@@ -28776,14 +35094,28 @@
  175.45.187.182
  175.45.187.30
  175.6.102.248
+175.6.108.125
+175.6.130.39
+175.6.146.207
  175.6.254.57
+175.6.32.134
+175.6.35.140
+175.6.35.166
  175.6.35.207
+175.6.35.46
+175.6.35.52
  175.6.35.82
+175.6.35.93
+175.6.36.97
  175.6.40.14
+175.6.6.147
  175.6.73.4
+175.6.76.71
+175.6.99.102
  175.8.142.21
  175.8.41.237
  175.8.61.45
+175.97.132.101
  175.97.135.16
  175.97.136.186
  175.97.161.8
@@ -28792,6 +35124,7 @@
  176.10.107.180
  176.10.125.5
  176.10.208.98
+176.10.254.10
  176.10.44.190
  176.10.99.196
  176.10.99.200
@@ -28809,6 +35142,7 @@
  176.103.56.70
  176.103.74.89
  176.103.91.193
+176.104.107.20
  176.104.16.58
  176.104.176.188
  176.104.180.238
@@ -28816,6 +35150,7 @@
  176.104.52.46
  176.104.54.43
  176.105.202.158
+176.105.212.242
  176.106.122.21
  176.106.126.217
  176.106.186.35
@@ -28847,16 +35182,30 @@
  176.108.104.84
  176.108.106.25
  176.108.106.5
+176.108.124.150
  176.108.176.181
  176.110.121.90
  176.110.125.233
  176.110.130.150
+176.111.173.11
+176.111.173.12
+176.111.173.13
+176.111.173.14
+176.111.173.15
+176.111.173.17
+176.111.173.18
+176.111.173.19
+176.111.173.22
+176.111.173.23
+176.111.173.46
+176.111.173.48
  176.111.180.209
  176.111.208.100
  176.111.51.85
  176.111.60.55
  176.111.73.57
  176.112.113.20
+176.112.77.134
  176.112.79.111
  176.113.157.149
  176.113.161.101
@@ -28910,8 +35259,12 @@
  176.113.161.94
  176.113.161.95
  176.113.209.13
+176.113.226.68
+176.113.227.67
+176.113.234.112
  176.113.72.133
  176.113.80.252
+176.113.87.196
  176.114.0.74
  176.114.131.205
  176.114.153.102
@@ -28950,9 +35303,11 @@
  176.119.26.12
  176.119.29.70
  176.119.29.8
+176.12.69.77
  176.120.211.250
  176.120.216.143
  176.120.220.199
+176.120.28.140
  176.120.37.114
  176.120.37.82
  176.120.59.85
@@ -28961,7 +35316,12 @@
  176.122.129.114
  176.122.142.162
  176.122.156.32
+176.122.158.234
+176.122.160.85
+176.122.161.175
+176.122.164.94
  176.122.166.91
+176.122.172.102
  176.122.174.22
  176.122.175.66
  176.122.188.28
@@ -28993,6 +35353,8 @@
  176.123.7.102
  176.123.7.115
  176.123.7.119
+176.123.7.186
+176.123.7.188
  176.123.7.23
  176.123.7.234
  176.123.7.238
@@ -29015,15 +35377,29 @@
  176.14.153.168
  176.14.153.182
  176.14.156.48
+176.14.243.96
+176.142.216.192
  176.143.111.17
  176.144.197.191
  176.145.11.22
+176.150.173.131
+176.152.127.47
+176.163.6.57
+176.165.60.67
+176.168.131.91
  176.168.170.82
+176.169.144.248
+176.170.212.136
  176.174.199.40
+176.175.186.14
  176.181.56.34
+176.184.131.5
+176.187.207.104
  176.191.182.3
  176.192.8.206
  176.193.18.170
+176.194.189.39
+176.194.231.105
  176.196.240.34
  176.196.84.138
  176.197.100.134
@@ -29033,16 +35409,27 @@
  176.197.5.218
  176.197.86.2
  176.197.95.2
+176.198.215.108
  176.198.40.56
+176.198.94.109
+176.20.249.211
  176.20.60.141
  176.202.169.139
+176.202.232.137
+176.202.233.154
+176.202.233.70
+176.205.22.4
  176.206.121.23
+176.206.148.218
  176.210.99.14
  176.212.185.153
  176.212.36.226
  176.212.40.60
  176.212.59.84
+176.215.114.232
+176.215.255.141
  176.215.97.160
+176.218.1.105
  176.221.104.2
  176.221.116.10
  176.221.188.104
@@ -29057,13 +35444,13 @@
  176.221.242.166
  176.221.242.18
  176.221.242.71
-176.221.251.147
  176.221.251.238
  176.221.251.87
  176.221.42.32
  176.223.1.70
  176.223.111.116
  176.223.111.190
+176.223.121.235
  176.223.135.96
  176.223.137.37
  176.223.139.243
@@ -29076,6 +35463,8 @@
  176.227.188.16
  176.227.188.66
  176.227.246.168
+176.227.246.5
+176.232.184.206
  176.235.137.2
  176.235.139.114
  176.235.164.177
@@ -29085,6 +35474,9 @@
  176.235.178.187
  176.235.182.79
  176.235.191.132
+176.235.192.133
+176.235.216.155
+176.235.221.83
  176.235.90.242
  176.235.93.0
  176.235.94.75
@@ -29101,6 +35493,7 @@
  176.236.37.160
  176.236.37.168
  176.236.37.175
+176.236.86.162
  176.237.4.193
  176.239.0.210
  176.241.141.167
@@ -29122,11 +35515,14 @@
  176.31.110.229
  176.31.117.8
  176.31.119.145
+176.31.123.203
  176.31.124.223
  176.31.127.152
  176.31.134.160
  176.31.141.20
  176.31.156.47
+176.31.162.82
+176.31.163.192
  176.31.165.144
  176.31.17.187
  176.31.18.148
@@ -29135,6 +35531,7 @@
  176.31.200.15
  176.31.200.19
  176.31.202.70
+176.31.211.103
  176.31.215.59
  176.31.224.214
  176.31.228.46
@@ -29148,12 +35545,15 @@
  176.31.240.198
  176.31.242.225
  176.31.249.106
+176.31.249.167
  176.31.252.148
  176.31.253.13
  176.31.253.42
  176.31.253.73
  176.31.255.164
  176.31.255.223
+176.31.255.63
+176.31.31.185
  176.31.33.66
  176.31.46.178
  176.31.46.240
@@ -29171,11 +35571,14 @@
  176.36.147.195
  176.36.20.67
  176.36.37.21
+176.37.248.76
  176.37.44.170
  176.37.96.163
  176.37.99.111
  176.38.7.43
+176.41.24.102
  176.42.114.128
+176.44.21.199
  176.52.200.130
  176.52.219.6
  176.52.253.14
@@ -29184,6 +35587,7 @@
  176.53.160.170
  176.53.180.124
  176.53.186.86
+176.53.84.179
  176.53.90.26
  176.56.107.101
  176.56.107.126
@@ -29203,6 +35607,7 @@
  176.56.107.72
  176.56.107.79
  176.56.107.87
+176.56.136.137
  176.56.225.110
  176.56.225.111
  176.56.236.158
@@ -29221,6 +35626,8 @@
  176.58.65.6
  176.58.89.182
  176.58.93.123
+176.59.1.36
+176.59.10.130
  176.61.137.230
  176.61.140.118
  176.61.140.143
@@ -29254,11 +35661,15 @@
  176.67.86.52
  176.74.11.254
  176.74.136.237
+176.74.153.104
+176.78.2.47
  176.78.83.96
  176.79.52.126
  176.83.175.246
  176.84.177.68
  176.86.165.85
+176.88.31.110
+176.88.81.118
  176.9.1.234
  176.9.10.227
  176.9.101.122
@@ -29327,10 +35738,13 @@
  176.95.164.155
  176.95.184.111
  176.95.67.190
+176.96.238.185
+176.96.238.201
  176.96.238.223
  176.96.241.1
  176.96.241.253
  176.97.247.9
+176.97.36.132
  176.98.156.64
  176.98.75.120
  176.98.75.229
@@ -29348,6 +35762,7 @@
  176blcq.com
  176win.com
  177-365.net
+177.0.108.210
  177.0.56.204
  177.1.213.19
  177.1.214.207
@@ -29361,9 +35776,13 @@
  177.10.201.170
  177.10.211.198
  177.10.212.166
+177.10.240.102
+177.10.46.19
  177.10.84.121
+177.101.124.34
  177.101.125.251
  177.101.172.14
+177.101.85.114
  177.102.143.23
  177.103.157.126
  177.103.159.44
@@ -29420,28 +35839,39 @@
  177.105.68.80
  177.105.68.86
  177.105.68.98
+177.106.43.88
  177.106.94.77
  177.107.134.94
+177.107.26.255
  177.107.50.18
+177.107.68.19
+177.107.68.22
+177.11.118.197
  177.11.156.246
+177.11.167.50
+177.11.22.76
  177.11.65.126
-177.11.71.135
  177.11.75.18
  177.11.85.77
  177.11.85.9
  177.118.129.140
+177.12.2.53
  177.12.227.131
  177.12.241.50
  177.12.244.28
  177.12.244.3
  177.12.28.118
+177.124.10.140
  177.124.10.53
  177.124.101.103
  177.124.102.135
  177.124.184.72
  177.124.185.0
+177.124.201.61
+177.124.210.124
  177.124.217.185
  177.124.225.106
+177.124.23.147
  177.125.160.101
  177.125.160.250
  177.125.162.58
@@ -29451,14 +35881,21 @@
  177.125.166.127
  177.125.166.147
  177.125.169.6
+177.125.20.102
  177.125.204.200
  177.125.204.85
  177.125.205.116
  177.125.206.4
  177.125.207.147
+177.125.62.46
  177.126.123.82
+177.126.153.253
+177.126.200.66
+177.126.200.83
+177.126.200.85
  177.126.208.56
  177.126.210.111
+177.126.220.190
  177.126.77.47
  177.126.78.10
  177.126.81.33
@@ -29466,6 +35903,7 @@
  177.126.89.59
  177.126.93.170
  177.128.212.30
+177.128.216.2
  177.128.232.30
  177.128.35.51
  177.128.42.122
@@ -29473,10 +35911,12 @@
  177.129.17.52
  177.129.202.92
  177.129.202.97
+177.129.206.236
  177.129.207.23
  177.129.207.36
  177.129.48.34
  177.129.8.18
+177.129.8.26
  177.129.90.94
  177.130.110.87
  177.130.140.155
@@ -29490,12 +35930,16 @@
  177.131.22.186
  177.133.125.26
  177.133.43.161
+177.133.78.210
  177.135.101.101
  177.135.103.54
+177.135.192.210
+177.135.250.32
  177.136.121.145
  177.136.14.178
  177.136.168.82
  177.136.185.200
+177.136.194.172
  177.136.209.236
  177.136.210.135
  177.136.213.194
@@ -29539,27 +35983,43 @@
  177.139.130.157
  177.139.163.80
  177.139.169.206
+177.139.172.160
  177.139.176.122
  177.140.140.36
+177.140.196.172
  177.140.40.11
+177.141.243.225
  177.143.194.63
  177.144.130.105
  177.144.135.2
  177.152.124.19
+177.152.124.20
+177.152.124.21
+177.152.124.24
  177.152.64.35
  177.154.16.102
  177.154.224.206
+177.154.226.210
+177.154.234.179
+177.154.236.179
+177.154.236.189
+177.154.237.120
+177.154.237.182
  177.154.52.34
  177.154.55.114
  177.155.214.139
  177.155.232.15
  177.155.248.159
+177.17.174.190
  177.170.134.239
+177.179.226.123
+177.181.116.57
  177.184.137.165
  177.184.139.81
  177.184.140.222
  177.184.192.50
  177.184.207.125
+177.184.62.59
  177.184.64.2
  177.184.67.1
  177.184.67.13
@@ -29579,12 +36039,18 @@
  177.184.67.89
  177.184.67.93
  177.184.72.22
+177.184.75.130
  177.184.93.254
+177.185.141.100
  177.185.151.27
  177.185.156.241
  177.185.32.1
  177.188.121.26
  177.189.244.193
+177.19.164.149
+177.19.165.26
+177.19.187.79
+177.19.226.178
  177.19.238.230
  177.190.145.196
  177.190.145.43
@@ -29594,34 +36060,54 @@
  177.190.196.170
  177.190.254.18
  177.190.77.225
+177.190.82.41
+177.190.82.61
+177.191.18.204
+177.191.20.16
+177.193.240.80
+177.20.209.234
+177.20.209.238
  177.200.189.205
+177.200.219.114
  177.200.247.235
+177.200.64.234
  177.200.72.214
  177.200.82.126
  177.200.89.62
  177.200.94.150
+177.202.108.18
  177.202.118.44
+177.203.153.25
  177.204.167.141
+177.205.166.154
+177.205.238.141
  177.207.192.137
  177.21.120.102
  177.21.19.87
+177.21.213.98
  177.21.30.184
  177.21.30.32
  177.21.33.193
  177.21.36.73
  177.21.37.106
  177.21.96.222
+177.215.108.194
  177.22.225.200
+177.22.35.126
  177.220.133.158
  177.220.141.134
  177.220.161.250
+177.220.173.170
  177.220.174.58
  177.220.175.68
  177.220.178.225
+177.220.178.231
  177.220.188.213
  177.220.226.122
+177.221.108.198
  177.221.176.66
  177.221.202.246
+177.221.73.75
  177.222.248.168
  177.223.226.253
  177.223.48.126
@@ -29631,30 +36117,60 @@
  177.223.63.26
  177.224.90.29
  177.226.25.78
+177.228.70.43
  177.23.16.17
  177.23.16.73
  177.23.184.166
  177.23.227.136
+177.23.58.23
  177.23.7.151
+177.23.74.75
+177.23.75.190
+177.23.77.111
+177.23.77.174
  177.230.20.38
  177.234.154.77
+177.235.108.253
  177.238.248.101
  177.239.160.121
  177.239.51.129
  177.240.174.84
+177.240.195.235
  177.240.204.200
  177.241.245.226
+177.243.161.11
+177.243.170.156
+177.243.175.63
  177.244.36.134
  177.247.70.91
+177.249.160.187
+177.25.243.152
+177.255.11.229
+177.30.47.9
+177.30.79.51
  177.32.8.85
+177.33.25.121
  177.34.59.115
  177.36.128.162
  177.36.159.34
  177.36.221.11
  177.36.246.159
  177.36.248.221
+177.36.251.0
+177.36.251.11
+177.36.251.15
+177.36.251.20
+177.36.251.21
+177.36.251.23
+177.36.251.3
+177.36.251.36
+177.36.251.39
+177.36.251.44
+177.36.251.46
+177.36.251.5
  177.36.37.116
  177.36.37.241
+177.37.157.237
  177.37.159.240
  177.37.161.4
  177.37.162.57
@@ -29694,10 +36210,13 @@
  177.38.5.97
  177.38.69.111
  177.39.126.238
+177.39.129.116
  177.39.187.70
  177.39.188.114
+177.39.218.94
  177.4.125.22
  177.42.118.254
+177.43.249.42
  177.44.175.198
  177.44.18.114
  177.44.18.124
@@ -29705,17 +36224,22 @@
  177.44.74.59
  177.44.82.232
  177.44.88.168
+177.45.53.82
  177.45.80.157
  177.46.141.143
  177.46.147.89
  177.46.147.94
+177.47.135.246
  177.47.224.1
  177.47.27.234
  177.52.173.62
  177.52.249.220
  177.52.26.194
  177.52.26.234
+177.52.28.116
  177.52.48.225
+177.52.62.41
+177.52.74.43
  177.53.144.63
  177.53.152.36
  177.53.16.84
@@ -29729,7 +36253,11 @@
  177.54.201.168
  177.54.224.222
  177.54.224.245
+177.54.251.104
+177.54.52.163
  177.55.143.141
+177.56.184.47
+177.57.2.10
  177.6.254.194
  177.63.213.122
  177.66.118.20
@@ -29738,6 +36266,7 @@
  177.66.195.116
  177.66.195.118
  177.66.221.5
+177.66.223.151
  177.66.247.233
  177.66.247.81
  177.66.31.42
@@ -29745,6 +36274,7 @@
  177.67.10.15
  177.67.162.42
  177.67.162.43
+177.67.203.135
  177.67.217.30
  177.67.219.1
  177.67.46.99
@@ -29758,7 +36288,9 @@
  177.69.196.51
  177.69.196.61
  177.69.237.57
+177.69.237.60
  177.69.45.188
+177.69.67.253
  177.7.17.230
  177.70.172.242
  177.71.141.222
@@ -29787,6 +36319,7 @@
  177.73.106.102
  177.73.107.174
  177.73.107.229
+177.73.112.200
  177.73.160.254
  177.73.169.222
  177.73.188.110
@@ -29810,20 +36343,27 @@
  177.74.115.37
  177.74.117.158
  177.74.119.222
+177.74.136.194
  177.74.143.175
  177.74.143.97
+177.74.180.40
  177.74.2.10
  177.74.228.34
+177.74.254.113
  177.74.63.197
  177.75.143.112
  177.75.15.162
+177.75.150.77
  177.75.159.200
  177.75.69.142
+177.75.92.190
  177.76.224.57
  177.76.8.131
  177.8.169.172
  177.8.170.122
+177.8.172.137
  177.8.216.114
+177.8.247.23
  177.81.228.212
  177.84.108.76
  177.84.109.10
@@ -29839,13 +36379,19 @@
  177.84.219.9
  177.84.222.254
  177.85.121.36
+177.85.157.232
+177.85.157.235
+177.85.157.238
  177.85.167.10
+177.85.19.37
  177.85.200.241
  177.85.200.45
+177.85.61.169
  177.85.66.254
  177.85.66.82
  177.85.70.42
  177.85.75.8
+177.85.98.168
  177.85.98.19
  177.86.115.2
  177.86.115.65
@@ -29871,14 +36417,21 @@
  177.87.10.186
  177.87.108.93
  177.87.168.10
+177.87.221.172
  177.87.223.194
  177.87.230.1
  177.87.230.29
  177.87.230.31
  177.87.36.193
+177.87.40.62
+177.87.68.154
+177.87.68.158
+177.87.68.82
  177.9.179.25
  177.91.186.60
+177.91.19.172
  177.91.214.89
+177.91.218.20
  177.91.33.131
  177.91.33.17
  177.91.35.21
@@ -29887,8 +36440,11 @@
  177.91.64.37
  177.91.75.107
  177.91.75.193
+177.91.80.11
  177.91.80.8
  177.91.9.17
+177.92.141.164
+177.92.141.241
  177.92.160.254
  177.92.165.73
  177.92.249.112
@@ -29906,6 +36462,8 @@
  177.94.194.249
  177.94.204.150
  177.94.206.67
+177.94.227.188
+177.95.75.169
  177.95.93.99
  177.99.175.58
  1770122162.jclecardinal.com
@@ -29913,16 +36471,24 @@
  1775114384.jclecardinal.com
  177momo.com
  178-365.net
+178.10.192.85
  178.116.213.31
+178.116.86.211
  178.116.96.223
  178.12.221.130
  178.120.22.2
  178.120.48.199
  178.121.128.17
+178.121.181.25
  178.121.69.188
  178.121.69.232
+178.122.125.208
  178.122.148.122
  178.122.205.228
+178.123.182.2
+178.123.212.242
+178.123.215.161
+178.123.80.100
  178.124.131.178
  178.124.162.209
  178.124.209.209
@@ -29932,41 +36498,59 @@
  178.125.17.15
  178.125.183.115
  178.125.221.124
+178.125.235.254
  178.128.1.194
  178.128.1.219
  178.128.100.167
  178.128.105.135
  178.128.105.25
  178.128.105.253
+178.128.105.7
  178.128.106.68
  178.128.107.65
  178.128.108.166
  178.128.11.149
  178.128.11.189
  178.128.111.172
+178.128.111.193
+178.128.115.138
  178.128.116.50
  178.128.116.73
  178.128.117.191
+178.128.117.67
  178.128.117.84
  178.128.118.202
  178.128.118.26
+178.128.119.140
+178.128.12.65
  178.128.120.124
  178.128.120.178
  178.128.120.33
  178.128.120.8
+178.128.121.137
+178.128.122.111
+178.128.123.111
+178.128.124.89
  178.128.125.16
  178.128.125.4
  178.128.126.101
  178.128.127.126
  178.128.127.62
+178.128.13.61
  178.128.131.130
+178.128.14.102
  178.128.14.47
+178.128.144.81
  178.128.146.154
+178.128.146.170
  178.128.146.87
  178.128.147.114
  178.128.148.98
+178.128.15.57
+178.128.150.146
  178.128.150.21
  178.128.152.19
+178.128.155.164
  178.128.157.227
  178.128.157.240
  178.128.158.246
@@ -29974,11 +36558,13 @@
  178.128.160.25
  178.128.161.170
  178.128.162.115
+178.128.162.42
  178.128.163.3
  178.128.164.145
  178.128.166.156
  178.128.167.11
  178.128.167.192
+178.128.169.213
  178.128.169.88
  178.128.17.153
  178.128.178.187
@@ -29986,25 +36572,37 @@
  178.128.180.162
  178.128.180.252
  178.128.181.61
+178.128.183.90
  178.128.188.190
  178.128.189.108
  178.128.196.198
+178.128.197.132
+178.128.20.19
  178.128.205.229
+178.128.206.34
  178.128.206.59
+178.128.208.128
  178.128.208.38
  178.128.209.139
  178.128.209.253
  178.128.209.81
+178.128.21.180
  178.128.21.38
+178.128.212.164
  178.128.215.134
  178.128.215.16
+178.128.215.76
  178.128.216.9
+178.128.217.42
  178.128.218.188
  178.128.218.70
+178.128.22.249
  178.128.22.88
  178.128.221.162
+178.128.222.96
  178.128.224.143
  178.128.225.74
+178.128.226.2
  178.128.230.35
  178.128.230.50
  178.128.232.28
@@ -30022,6 +36620,8 @@
  178.128.240.80
  178.128.242.13
  178.128.242.16
+178.128.242.233
+178.128.243.225
  178.128.243.250
  178.128.244.128
  178.128.244.143
@@ -30045,6 +36645,7 @@
  178.128.252.63
  178.128.252.68
  178.128.252.69
+178.128.254.128
  178.128.255.2
  178.128.255.205
  178.128.255.228
@@ -30053,9 +36654,12 @@
  178.128.26.38
  178.128.28.166
  178.128.28.241
+178.128.28.51
  178.128.29.15
+178.128.31.47
  178.128.33.192
  178.128.34.116
+178.128.34.254
  178.128.35.139
  178.128.38.146
  178.128.38.146.dsl.dyn.forthnet.gr
@@ -30069,7 +36673,11 @@
  178.128.48.87
  178.128.49.224
  178.128.50.52
+178.128.51.162
+178.128.52.193
+178.128.52.226
  178.128.53.79
+178.128.55.198
  178.128.55.215
  178.128.58.12
  178.128.58.95
@@ -30084,16 +36692,22 @@
  178.128.70.115
  178.128.72.117
  178.128.72.80
+178.128.72.84
  178.128.75.169
  178.128.75.212
  178.128.76.123
+178.128.76.176
  178.128.77.147
  178.128.77.226
  178.128.8.160
  178.128.8.241
  178.128.8.41
  178.128.80.85
+178.128.83.209
+178.128.83.28
+178.128.84.47
  178.128.87.73
+178.128.88.244
  178.128.89.170
  178.128.89.95
  178.128.91.117
@@ -30107,6 +36721,7 @@
  178.128.97.48
  178.128.98.103
  178.128.98.15
+178.130.154.27
  178.130.65.249
  178.130.72.41
  178.130.85.193
@@ -30403,14 +37018,15 @@
  178.137.89.28
  178.137.93.24
  178.137.95.244
+178.140.137.233
  178.141.130.232
-178.141.131.129
  178.141.165.37
  178.141.223.11
  178.141.4.175
  178.142.56.12
  178.143.12.103
  178.143.52.84
+178.147.233.236
  178.148.172.209
  178.148.226.180
  178.148.24.50
@@ -30456,6 +37072,7 @@
  178.158.16.249
  178.158.17.83
  178.158.18.130
+178.158.185.167
  178.158.32.149
  178.158.34.123
  178.158.34.201
@@ -30470,6 +37087,8 @@
  178.159.242.73
  178.159.242.91
  178.159.245.55
+178.159.3.167
+178.159.3.177
  178.159.36.172
  178.159.37.104
  178.159.37.12
@@ -30519,11 +37138,15 @@
  178.164.153.62
  178.164.216.151
  178.165.103.188
+178.165.128.170
+178.165.128.183
  178.165.21.58
  178.165.44.122
  178.165.48.209
  178.165.72.177
  178.165.91.245
+178.166.102.94
+178.166.54.39
  178.168.120.136
  178.168.19.139
  178.168.21.28
@@ -30550,6 +37173,7 @@
  178.17.171.197
  178.17.171.22
  178.17.171.39
+178.17.171.53
  178.17.171.78
  178.17.174.10
  178.17.174.13
@@ -30566,8 +37190,11 @@
  178.170.220.162
  178.172.147.45
  178.173.171.10
+178.173.192.253
+178.174.148.58
  178.174.159.163
  178.174.245.153
+178.174.31.62
  178.175.119.165
  178.175.129.41
  178.175.129.42
@@ -30580,7 +37207,14 @@
  178.175.132.72
  178.175.148.148
  178.175.148.224
+178.175.225.29
+178.175.234.9
  178.176.169.154
+178.176.174.55
+178.176.174.62
+178.176.175.128
+178.176.175.80
+178.176.224.36
  178.176.61.193
  178.176.72.37
  178.176.77.66
@@ -30605,14 +37239,18 @@
  178.191.190.75
  178.193.226.120
  178.194.110.8
+178.194.193.94
  178.195.53.244
  178.196.1.133
  178.196.1.210
+178.197.227.246
  178.198.130.101
+178.198.148.79
  178.199.108.65
  178.199.129.214
  178.20.100.35
  178.20.137.178
+178.20.189.62
  178.20.227.53
  178.20.37.143
  178.20.38.171
@@ -30620,13 +37258,19 @@
  178.20.55.18
  178.20.74.212
  178.200.152.49
+178.200.66.234
  178.201.247.152
+178.202.44.20
  178.203.120.68
  178.203.146.227
+178.203.16.15
  178.204.52.119
  178.205.101.67
  178.205.136.73
+178.205.141.180
  178.205.254.106
+178.208.143.150
+178.208.172.21
  178.208.75.227
  178.209.170.75
  178.209.42.84
@@ -30636,6 +37280,7 @@
  178.210.44.131
  178.210.66.37
  178.211.45.66
+178.211.57.114
  178.212.176.82
  178.212.192.118
  178.212.54.137
@@ -30643,6 +37288,7 @@
  178.213.0.207
  178.213.130.101
  178.213.130.159
+178.213.249.32
  178.214.243.19
  178.214.244.105
  178.214.244.107
@@ -30658,12 +37304,17 @@
  178.215.190.240
  178.216.0.168
  178.216.2.229
+178.216.2.9
  178.216.200.48
+178.216.232.173
+178.216.234.94
  178.216.49.147
  178.216.50.212
  178.217.106.245
+178.217.152.234
  178.217.169.10
  178.217.172.234
+178.217.173.54
  178.217.216.184
  178.217.40.208
  178.217.43.135
@@ -30690,8 +37341,11 @@
  178.23.244.208
  178.233.208.145
  178.234.35.26
+178.234.35.42
  178.234.37.197
+178.235.190.2
  178.236.137.63
+178.236.232.8
  178.236.87.138
  178.238.133.232
  178.238.224.166
@@ -30703,13 +37357,19 @@
  178.238.235.196
  178.238.237.56
  178.238.238.241
+178.238.78.15
+178.239.160.203
+178.239.161.214
  178.239.168.57
  178.239.169.130
+178.239.173.176
+178.239.198.86
  178.239.50.139
  178.239.50.140
  178.239.59.82
  178.239.62.113
  178.242.41.26
+178.242.91.27
  178.248.108.51
  178.248.200.16
  178.248.57.92
@@ -30719,6 +37379,10 @@
  178.250.156.229
  178.250.157.177
  178.250.54.208
+178.251.12.147
+178.251.12.177
+178.251.12.198
+178.251.12.6
  178.251.140.3
  178.252.122.139
  178.252.127.236
@@ -30726,6 +37390,8 @@
  178.252.199.46
  178.252.75.13
  178.252.80.226
+178.253.101.193
+178.253.198.2
  178.253.248.146
  178.254.138.82
  178.254.139.33
@@ -30735,11 +37401,14 @@
  178.254.148.37
  178.254.149.33
  178.254.149.37
+178.254.171.32
  178.254.171.41
  178.254.174.196
+178.254.22.25
  178.254.34.108
  178.254.35.104
  178.254.36.182
+178.254.40.132
  178.254.6.27
  178.255.154.57
  178.255.215.69
@@ -30750,17 +37419,25 @@
  178.26.166.118
  178.27.103.45
  178.27.122.202
+178.27.198.142
  178.27.202.90
+178.3.145.208
+178.3.210.163
  178.30.241.242
  178.30.75.243
  178.32.1.128
+178.32.109.161
  178.32.121.17
  178.32.123.182
+178.32.144.167
  178.32.167.73
  178.32.181.66
  178.32.189.89
  178.32.192.85
+178.32.197.82
+178.32.197.87
  178.32.198.183
+178.32.205.2
  178.32.216.133
  178.32.218.149
  178.32.219.210
@@ -30769,9 +37446,11 @@
  178.32.244.169
  178.32.248.127
  178.32.251.97
+178.32.53.209
  178.32.58.209
  178.32.79.49
  178.32.88.23
+178.32.90.162
  178.33.122.96
  178.33.131.26
  178.33.132.215
@@ -30789,6 +37468,7 @@
  178.33.164.224
  178.33.167.120
  178.33.18.165
+178.33.188.207
  178.33.207.147
  178.33.209.195
  178.33.228.210
@@ -30796,22 +37476,26 @@
  178.33.233.230
  178.33.251.230
  178.33.38.55
+178.33.67.12
  178.33.68.20
  178.33.68.21
  178.33.70.40
  178.33.93.88
  178.34.146.222
  178.38.132.54
+178.38.49.155
  178.38.71.231
  178.41.165.5
  178.42.48.18
  178.46.163.191
+178.46.164.5
  178.46.199.220
  178.47.131.202
  178.47.139.151
  178.47.139.50
  178.47.141.128
  178.47.141.196
+178.47.143.198
  178.47.65.105
  178.48.165.143
  178.48.31.141
@@ -30821,7 +37505,10 @@
  178.49.192.210
  178.57.115.124
  178.57.125.78
+178.60.12.198
  178.60.28.98
+178.61.158.242
+178.62.1.145
  178.62.10.18
  178.62.101.135
  178.62.101.95
@@ -30830,11 +37517,17 @@
  178.62.104.85
  178.62.106.182
  178.62.106.78
+178.62.106.98
+178.62.108.152
  178.62.111.226
  178.62.114.26
+178.62.114.33
  178.62.115.45
+178.62.115.86
+178.62.117.106
  178.62.117.223
  178.62.119.91
+178.62.12.140
  178.62.12.192
  178.62.124.26
  178.62.125.239
@@ -30845,14 +37538,20 @@
  178.62.158.205
  178.62.17.143
  178.62.18.29
+178.62.182.246
+178.62.183.92
+178.62.187.136
  178.62.19.106
  178.62.19.66
  178.62.190.222
  178.62.192.87
+178.62.193.178
+178.62.193.6
  178.62.194.248
  178.62.195.55
  178.62.195.58
  178.62.198.108
+178.62.199.240
  178.62.2.80
  178.62.203.116
  178.62.203.118
@@ -30862,6 +37561,7 @@
  178.62.209.102
  178.62.210.151
  178.62.211.224
+178.62.212.178
  178.62.212.233
  178.62.212.26
  178.62.213.120
@@ -30898,25 +37598,32 @@
  178.62.247.57
  178.62.25.71
  178.62.250.186
+178.62.251.156
  178.62.253.153
  178.62.253.169
  178.62.254.156
+178.62.255.152
  178.62.255.217
  178.62.26.232
  178.62.27.101
+178.62.27.144
  178.62.29.24
  178.62.29.94
  178.62.32.11
  178.62.32.59
  178.62.33.222
  178.62.35.23
+178.62.37.78
  178.62.40.33
+178.62.42.116
  178.62.43.171
  178.62.43.64
  178.62.44.102
  178.62.47.147
  178.62.47.207
  178.62.48.33
+178.62.5.48
+178.62.50.191
  178.62.52.150
  178.62.52.213
  178.62.53.135
@@ -30928,6 +37635,8 @@
  178.62.59.36
  178.62.6.215
  178.62.6.217
+178.62.60.233
+178.62.63.15
  178.62.68.245
  178.62.69.100
  178.62.69.165
@@ -30937,6 +37646,7 @@
  178.62.77.137
  178.62.77.224
  178.62.78.193
+178.62.79.64
  178.62.8.113
  178.62.8.62
  178.62.80.20
@@ -30947,9 +37657,11 @@
  178.62.86.172
  178.62.86.6
  178.62.87.246
+178.62.88.90
  178.62.89.173
  178.62.89.199
  178.62.9.122
+178.62.9.160
  178.62.9.39
  178.62.92.247
  178.62.96.23
@@ -30982,6 +37694,7 @@
  178.63.98.228
  178.65.166.186
  178.66.182.76
+178.67.169.218
  178.67.195.64
  178.67.205.104
  178.68.53.8
@@ -31011,12 +37724,15 @@
  178.72.68.72
  178.72.68.74
  178.72.68.89
+178.72.69.112
  178.72.69.131
  178.72.69.143
  178.72.69.144
  178.72.69.155
+178.72.69.166
  178.72.69.168
  178.72.69.182
+178.72.69.220
  178.72.69.227
  178.72.69.231
  178.72.69.40
@@ -31042,6 +37758,7 @@
  178.72.70.4
  178.72.70.43
  178.72.70.63
+178.72.70.84
  178.72.70.85
  178.72.70.99
  178.72.71.135
@@ -31085,6 +37802,7 @@
  178.79.187.33
  178.79.189.74
  178.79.24.36
+178.80.41.103
  178.82.50.84
  178.84.195.232
  178.84.197.175
@@ -31094,6 +37812,7 @@
  178.85.82.198
  178.86.163.62
  178.89.32.171
+178.90.54.157
  178.93.12.109
  178.93.14.91
  178.93.15.192
@@ -31127,11 +37846,14 @@
  179.106.150.7
  179.106.159.204
  179.106.223.27
+179.107.11.195
+179.107.189.61
  179.107.190.83
  179.107.191.179
  179.107.191.187
  179.107.191.231
  179.107.34.178
+179.107.53.126
  179.107.56.67
  179.107.56.78
  179.107.56.86
@@ -31155,6 +37877,8 @@
  179.108.184.131
  179.108.19.202
  179.108.19.207
+179.108.19.214
+179.108.19.222
  179.108.249.116
  179.108.249.118
  179.108.249.177
@@ -31163,12 +37887,14 @@
  179.108.56.40
  179.108.57.238
  179.108.94.75
+179.109.2.90
  179.109.38.42
  179.109.60.87
  179.110.109.165
  179.110.133.235
  179.111.212.162
  179.111.41.21
+179.116.194.59
  179.124.137.83
  179.124.137.84
  179.124.137.86
@@ -31178,52 +37904,82 @@
  179.125.172.210
  179.125.25.218
  179.125.39.230
+179.125.6.178
  179.127.140.113
  179.127.140.142
+179.127.147.65
+179.127.167.201
  179.127.175.202
+179.127.229.213
+179.127.229.240
+179.127.249.213
  179.127.35.17
+179.131.10.103
+179.131.11.234
+179.157.155.114
  179.157.206.101
  179.157.4.188
+179.157.66.64
+179.171.20.50
+179.171.35.50
  179.176.1.21
  179.176.243.182
  179.177.186.121
  179.178.122.5
+179.179.173.124
  179.179.53.106
+179.180.11.37
+179.180.66.87
  179.180.98.209
  179.181.111.8
  179.184.161.221
  179.184.230.194
  179.184.246.10
  179.184.88.117
+179.184.89.228
  179.185.50.182
  179.185.66.242
+179.186.110.131
+179.186.16.39
  179.189.125.222
  179.189.229.82
  179.189.253.122
  179.189.27.28
+179.190.110.83
  179.191.15.59
  179.191.150.163
  179.191.245.58
  179.191.32.43
  179.191.53.235
+179.191.68.86
+179.191.69.146
  179.210.120.225
  179.213.33.206
  179.213.95.241
  179.216.180.76
+179.219.96.172
+179.219.99.144
  179.222.67.144
  179.225.253.69
+179.228.128.37
  179.228.43.74
+179.228.74.3
  179.232.75.13
  179.233.129.76
+179.233.3.103
  179.233.3.89
+179.234.1.38
  179.234.232.150
  179.234.40.169
  179.27.214.238
+179.27.60.34
  179.27.66.106
+179.27.66.74
  179.27.73.234
  179.27.83.222
  179.40.75.1
  179.41.4.149
+179.42.196.78
  179.43.101.47
  179.43.128.245
  179.43.134.154
@@ -31240,6 +37996,7 @@
  179.43.149.19
  179.43.149.24
  179.43.149.25
+179.43.151.219
  179.43.157.119
  179.43.157.77
  179.43.160.204
@@ -31261,14 +38018,19 @@
  179.43.80.6
  179.43.97.40
  179.48.251.188
+179.49.134.186
  179.49.57.150
  179.5.118.12
+179.51.253.190
+179.51.59.56
  179.52.118.143
  179.53.73.70
  179.54.115.180
  179.55.196.169
  179.56.248.64
+179.6.32.61
  179.60.127.45
+179.60.215.37
  179.60.229.168
  179.60.243.38
  179.61.128.12
@@ -31295,16 +38057,21 @@
  179.61.191.94
  179.61.251.117
  179.63.254.90
+179.67.62.158
+179.7.192.197
+179.83.114.31
  179.9.160.50
  179.93.148.210
  179.93.149.17
  179.93.57.86
  179.93.59.246
+179.95.143.134
  179.95.232.131
  179.96.184.70
  179.96.20.138
  179.96.28.225
  179.96.62.105
+179.97.166.129
  179.97.229.35
  179.97.241.202
  179.97.241.247
@@ -31464,12 +38231,14 @@
  18.191.190.27
  18.191.214.193
  18.191.215.120
+18.191.219.102
  18.191.227.63
  18.191.233.36
  18.191.24.139
  18.191.253.121
  18.191.38.156
  18.191.42.193
+18.191.73.205
  18.191.78.80
  18.191.83.211
  18.191.83.33
@@ -31485,6 +38254,7 @@
  18.194.121.64
  18.194.124.47
  18.194.146.215
+18.194.196.202
  18.194.221.29
  18.194.36.11
  18.194.54.219
@@ -31495,6 +38265,7 @@
  18.195.243.254
  18.195.33.5
  18.195.51.22
+18.195.55.205
  18.196.206.35
  18.196.240.197
  18.196.57.155
@@ -31524,6 +38295,7 @@
  18.205.139.250
  18.205.155.198
  18.205.180.185
+18.205.239.65
  18.205.243.73
  18.206.158.128
  18.206.201.164
@@ -31649,6 +38421,7 @@
  18.221.143.49
  18.221.162.186
  18.221.162.53
+18.221.168.157
  18.221.206.247
  18.221.223.108
  18.221.226.11
@@ -31667,6 +38440,7 @@
  18.222.167.188
  18.222.168.15
  18.222.178.110
+18.222.183.66
  18.222.186.97
  18.222.192.100
  18.222.21.252
@@ -31708,6 +38482,7 @@
  18.228.59.8
  18.228.67.12
  18.229.148.50
+18.229.73.207
  18.230.135.138
  18.230.154.141
  18.230.191.224
@@ -31755,9 +38530,14 @@
  18.237.9.108
  18.27.197.252
  18.27.79.17
+180.100.206.226
+180.100.206.35
+180.100.243.210
+180.101.147.147
  180.101.202.30
  180.101.221.152
  180.102.132.248
+180.103.218.129
  180.104.13.145
  180.104.13.50
  180.104.175.217
@@ -31783,23 +38563,49 @@
  180.104.79.77
  180.104.85.70
  180.104.9.150
+180.106.122.26
+180.106.194.89
+180.106.236.105
+180.106.238.21
+180.106.81.168
+180.106.87.170
  180.107.109.21
+180.107.115.45
+180.107.128.227
+180.107.128.51
+180.107.135.117
  180.107.50.6
+180.107.58.136
+180.107.58.189
  180.107.76.147
+180.108.121.161
+180.109.130.174
+180.109.32.215
  180.109.34.10
  180.110.240.226
+180.111.223.24
  180.111.90.68
  180.112.138.132
  180.112.185.135
  180.112.191.24
+180.113.140.150
+180.113.142.158
+180.113.143.131
+180.113.147.174
+180.113.147.240
+180.113.60.210
  180.114.101.116
+180.114.150.209
+180.114.151.5
  180.114.169.253
+180.114.176.157
  180.114.194.102
  180.114.77.193
  180.115.100.182
  180.115.112.173
  180.115.117.241
  180.115.117.55
+180.115.182.28
  180.115.3.162
  180.115.66.239
  180.115.89.203
@@ -31834,6 +38640,8 @@
  180.117.115.213
  180.117.163.230
  180.117.18.244
+180.117.182.169
+180.117.188.119
  180.117.195.21
  180.117.216.111
  180.117.217.64
@@ -31916,14 +38724,19 @@
  180.125.245.38
  180.125.249.94
  180.125.44.203
+180.125.97.143
  180.125.98.225
+180.127.109.12
+180.127.77.148
  180.128.0.237
  180.128.1.30
  180.128.1.87
+180.131.110.155
  180.136.96.44
  180.137.45.182
  180.139.113.231
  180.142.130.246
+180.148.214.178
  180.148.215.101
  180.148.33.203
  180.148.4.130
@@ -31934,6 +38747,7 @@
  180.149.96.131
  180.150.19.243
  180.150.21.41
+180.150.226.214
  180.150.226.44
  180.150.226.99
  180.150.227.149
@@ -31949,25 +38763,51 @@
  180.150.73.103
  180.150.86.215
  180.151.198.70
+180.151.246.58
+180.151.56.124
+180.151.56.99
+180.151.58.106
+180.151.58.108
  180.152.235.82
  180.153.60.142
+180.153.91.15
+180.153.91.17
+180.156.116.205
  180.157.10.59
+180.157.250.73
  180.158.2.122
+180.158.6.168
  180.164.19.89
  180.164.221.112
+180.166.114.14
  180.166.117.254
+180.166.208.56
  180.166.220.177
  180.166.220.179
  180.166.229.4
+180.167.111.38
+180.167.126.126
  180.167.168.2
  180.167.195.218
+180.167.207.234
+180.167.225.118
+180.167.240.222
+180.167.53.18
  180.167.60.22
+180.167.67.133
+180.168.141.246
  180.168.168.58
  180.168.191.197
+180.168.201.126
  180.168.212.6
+180.168.47.238
+180.168.95.234
  180.169.214.21
+180.171.11.223
+180.171.58.166
  180.175.196.51
  180.175.224.230
+180.175.225.180
  180.176.214.171
  180.176.214.171bin.sh
  180.176.34.51
@@ -31975,6 +38815,9 @@
  180.177.180.6
  180.177.243.251
  180.178.127.39
+180.178.134.162
+180.178.135.98
+180.178.159.197
  180.178.37.186
  180.178.63.10
  180.178.97.90
@@ -31987,8 +38830,8 @@
  180.180.112.186
  180.180.114.48
  180.180.119.40
+180.180.123.227
  180.180.123.41
-180.180.136.251
  180.180.141.131
  180.180.151.137
  180.180.151.184
@@ -32002,6 +38845,7 @@
  180.180.152.98
  180.180.156.15
  180.180.161.239
+180.180.162.193
  180.180.170.188
  180.180.170.218
  180.180.171.113
@@ -32023,6 +38867,8 @@
  180.180.218.12
  180.180.241.93
  180.180.26.182
+180.180.35.182
+180.180.36.209
  180.180.68.132
  180.180.7.31
  180.180.71.150
@@ -32041,17 +38887,29 @@
  180.183.129.22
  180.183.13.188
  180.183.131.130
-180.183.132.30
  180.183.139.12
+180.183.152.253
  180.183.153.246
+180.183.154.94
  180.183.155.146
+180.183.155.221
  180.183.156.164
+180.183.159.173
+180.183.159.210
+180.183.159.77
  180.183.17.83
+180.183.174.186
  180.183.180.18
+180.183.19.225
  180.183.19.94
+180.183.226.205
+180.183.227.213
  180.183.228.148
  180.183.229.154
  180.183.229.57
+180.183.244.34
+180.183.247.248
+180.183.249.175
  180.183.25.163
  180.183.29.100
  180.183.29.125
@@ -32069,6 +38927,10 @@
  180.188.241.130
  180.188.241.145
  180.188.241.173
+180.190.10.145
+180.190.10.17
+180.190.174.202
+180.190.179.27
  180.191.157.220
  180.191.158.111
  180.210.201.54
@@ -32102,9 +38964,9 @@
  180.210.222.253
  180.210.33.5
  180.211.102.186
-180.211.102.85
  180.211.115.155
  180.211.120.61
+180.211.135.118
  180.211.141.158
  180.211.158.122
  180.211.162.114
@@ -32127,12 +38989,15 @@
  180.211.92.42
  180.211.95.234
  180.211.97.204
+180.214.236.190
  180.214.236.98
  180.214.237.13
+180.214.237.247
  180.214.238.5
  180.214.239.54
  180.215.197.146
  180.215.199.158
+180.215.202.138
  180.215.204.163
  180.215.214.77
  180.215.214.88
@@ -32140,11 +39005,16 @@
  180.215.223.247
  180.215.227.16
  180.215.227.32
+180.215.64.98
  180.216.14.147
+180.216.167.26
  180.216.238.148
  180.218.5.171
  180.218.6.90
  180.222.161.85
+180.229.240.161
+180.229.5.108
+180.231.222.41
  180.232.123.251
  180.233.106.140
  180.234.83.202
@@ -32156,28 +39026,46 @@
  180.241.159.90
  180.241.175.183
  180.241.252.45
+180.241.47.52
  180.241.75.230
+180.242.12.254
+180.242.2.154
  180.242.232.78
+180.242.235.108
  180.242.70.73
  180.242.72.201
  180.244.202.227
  180.244.235.155
  180.244.68.29
+180.246.110.70
+180.246.148.55
+180.246.148.79
  180.246.17.93
  180.246.175.238
+180.247.148.113
+180.247.178.201
  180.247.194.247
  180.247.197.34
  180.247.61.132
+180.247.63.198
  180.248.0.149
  180.248.1.196
+180.248.120.254
+180.248.123.185
+180.248.200.174
  180.248.27.89
+180.248.43.196
  180.248.98.249
  180.249.111.97
+180.249.164.215
+180.249.167.204
+180.249.184.27
  180.249.231.79
  180.250.101.146
  180.250.111.86
  180.250.115.121
  180.250.12.10
+180.250.124.227
  180.250.131.94
  180.250.136.138
  180.250.159.21
@@ -32197,6 +39085,9 @@
  180.250.247.123
  180.250.247.124
  180.250.247.126
+180.250.247.45
+180.250.248.169
+180.250.248.170
  180.250.49.138
  180.250.50.253
  180.250.54.161
@@ -32205,16 +39096,25 @@
  180.250.68.154
  180.250.77.218
  180.250.88.165
+180.250.97.19
+180.251.11.194
  180.251.126.211
  180.251.146.136
-180.252.124.41
+180.252.115.32
+180.252.122.250
+180.252.126.182
  180.252.157.188
  180.253.138.182
+180.253.163.148
+180.253.164.125
  180.253.165.166
+180.253.166.181
  180.253.166.55
+180.253.225.34
  180.254.12.125
  180.254.34.139
  180.254.40.151
+180.254.46.171
  180.33.192.153
  180.52.66.193
  180.59.248.202
@@ -32222,34 +39122,73 @@
  180.66.102.25
  180.66.53.93
  180.68.49.93
+180.71.47.198
  180.71.58.134
+180.76.101.229
+180.76.103.247
+180.76.104.101
+180.76.105.165
+180.76.111.247
+180.76.111.55
  180.76.114.156
+180.76.117.206
  180.76.121.95
  180.76.124.53
  180.76.133.173
  180.76.133.88
  180.76.134.199
+180.76.141.248
  180.76.147.52
  180.76.150.139
+180.76.152.17
+180.76.152.65
  180.76.158.36
  180.76.160.35
+180.76.167.13
+180.76.167.16
+180.76.171.20
+180.76.171.230
+180.76.173.240
+180.76.174.102
+180.76.174.59
+180.76.175.161
  180.76.175.234
+180.76.180.231
+180.76.181.47
  180.76.184.227
+180.76.188.98
+180.76.227.138
+180.76.227.202
  180.76.231.116
  180.76.231.121
  180.76.232.118
  180.76.232.167
  180.76.235.75
  180.76.235.96
+180.76.238.183
  180.76.238.69
+180.76.238.70
+180.76.242.204
  180.76.243.124
+180.76.244.253
+180.76.245.55
+180.76.246.101
+180.76.246.205
+180.76.246.38
  180.76.248.220
+180.76.250.18
+180.76.50.249
  180.76.51.143
+180.76.53.241
  180.76.54.70
+180.76.56.138
+180.76.56.69
  180.76.57.171
+180.76.57.58
  180.76.96.164
  180.76.99.171
  180.87.195.22
+180.89.58.27
  180.92.233.82
  180.92.238.251
  180.92.239.110
@@ -32257,10 +39196,16 @@
  180.94.170.166
  180.94.64.114
  180.95.139.169
+180.96.11.20
+180.96.63.162
+180.97.182.111
  180.97.182.226
  180.97.197.171
  180.97.207.15
  180.97.31.28
+180.97.80.12
+180.97.80.246
+180.97.90.14
  18013.url.789msw.com
  180betper.blogspot.com
  180clubrealestate.com
@@ -32329,36 +39274,48 @@
  181.113.34.86
  181.113.35.6
  181.113.37.86
+181.113.64.190
  181.113.66.146
  181.113.67.54
+181.114.110.217
+181.114.195.137
+181.114.211.110
  181.114.212.131
  181.114.222.252
+181.115.146.34
  181.115.168.69
  181.115.204.74
  181.115.239.250
  181.115.38.146
+181.116.50.170
  181.118.101.22
  181.119.20.201
  181.119.27.62
  181.119.30.26
+181.12.32.101
  181.120.232.66
  181.121.72.54
  181.121.98.154
+181.122.125.17
  181.124.152.197
  181.126.70.117
  181.126.83.37
+181.128.15.7
  181.129.104.139
  181.129.134.18
+181.129.136.226
  181.129.144.59
  181.129.147.27
  181.129.16.74
  181.129.164.230
  181.129.167.166
+181.129.175.59
  181.129.181.250
  181.129.183.19
  181.129.30.18
  181.129.30.20
  181.129.30.22
+181.129.33.76
  181.129.36.138
  181.129.42.26
  181.129.49.4
@@ -32377,6 +39334,7 @@
  181.129.98.146
  181.13.110.44
  181.130.133.135
+181.131.171.178
  181.134.21.219
  181.134.9.162
  181.135.153.203
@@ -32392,17 +39350,22 @@
  181.143.213.202
  181.143.221.76
  181.143.223.139
+181.143.251.154
  181.143.28.157
  181.143.28.158
  181.143.69.27
  181.143.73.34
  181.143.79.154
+181.143.81.52
  181.15.154.154
  181.15.154.156
  181.16.136.1
  181.16.136.41
  181.16.17.210
+181.16.198.177
+181.16.198.78
  181.164.131.51
+181.164.132.26
  181.164.210.228
  181.164.9.131
  181.165.200.185
@@ -32420,6 +39383,7 @@
  181.174.194.62
  181.176.161.19
  181.176.164.179
+181.176.222.68
  181.176.241.142
  181.176.242.168
  181.177.111.2
@@ -32430,6 +39394,7 @@
  181.177.20.15
  181.177.231.245
  181.177.237.61
+181.177.245.165
  181.177.96.129
  181.177.96.183
  181.177.96.185
@@ -32448,17 +39413,24 @@
  181.191.180.110
  181.191.82.196bin.sh
  181.191.85.114
+181.196.0.142
+181.196.0.78
+181.196.138.134
  181.196.142.114
  181.196.176.22
  181.196.181.146
+181.196.2.172
  181.196.205.250
  181.196.207.202
  181.196.242.126
  181.196.244.182
  181.196.246.246
  181.196.254.202
+181.196.3.47
+181.196.51.14
  181.196.57.150
  181.196.57.230
+181.197.101.27
  181.197.108.171
  181.198.2.22
  181.198.203.45
@@ -32471,7 +39443,11 @@
  181.199.170.205
  181.199.170.222
  181.199.170.230
+181.199.210.219
+181.206.20.11
  181.209.134.138
+181.209.159.166
+181.209.23.195
  181.209.71.22
  181.209.74.234
  181.209.75.66
@@ -32479,6 +39455,7 @@
  181.209.82.154
  181.209.86.130
  181.209.86.133
+181.21.159.119
  181.211.101.90
  181.211.11.78
  181.211.167.206
@@ -32490,18 +39467,25 @@
  181.211.6.34
  181.211.8.34
  181.214.156.26
+181.214.158.179
  181.214.87.25
  181.214.89.231
  181.214.89.252
  181.214.92.100
  181.215.114.160
+181.215.121.255
  181.215.4.242
  181.223.160.231
+181.223.176.108
+181.223.88.209
  181.224.161.168
  181.224.161.173
+181.224.253.233
  181.225.65.106
  181.225.65.242
  181.225.65.244
+181.225.70.142
+181.226.166.148
  181.228.55.57
  181.229.35.35
  181.230.116.163
@@ -32515,14 +39499,21 @@
  181.238.51.152
  181.239.208.122
  181.28.101.14
+181.28.152.133
+181.29.90.48
  181.30.101.242
  181.30.12.67
  181.30.126.66
+181.30.28.174
+181.30.28.198
+181.30.28.201
  181.30.28.219
  181.30.28.46
  181.30.30.166
  181.30.61.163
  181.30.69.50
+181.30.8.146
+181.30.99.114
  181.31.211.181
  181.31.213.158
  181.36.42.205
@@ -32530,11 +39521,14 @@
  181.39.139.68
  181.40.122.102
  181.40.122.2
+181.40.73.86
  181.40.84.38
  181.40.84.50
  181.41.241.164
+181.41.82.85
  181.45.71.86
  181.45.99.149
+181.46.164.33
  181.48.105.6
  181.48.111.246
  181.48.120.220
@@ -32543,7 +39537,9 @@
  181.48.139.118
  181.48.15.227
  181.48.155.149
+181.48.28.13
  181.48.36.42
+181.48.46.195
  181.48.54.202
  181.48.58.74
  181.48.7.146
@@ -32552,12 +39548,17 @@
  181.49.106.227
  181.49.106.228
  181.49.107.180
+181.49.118.185
  181.49.131.82
  181.49.145.38
+181.49.154.26
+181.49.226.121
  181.49.236.4
+181.49.246.20
  181.49.254.230
  181.49.38.43
  181.49.43.210
+181.49.50.202
  181.49.50.226
  181.49.53.106
  181.49.54.250
@@ -32583,15 +39584,21 @@
  181.52.121.54
  181.52.220.38
  181.52.237.106
+181.52.249.181
  181.52.249.213
  181.52.85.249
  181.53.251.181
  181.53.251.199
  181.53.255.145
  181.55.188.218
+181.57.100.178
  181.57.151.214
+181.57.184.218
+181.57.77.77
  181.57.97.189
  181.57.98.228
+181.58.189.155
+181.58.245.84
  181.6.0.165
  181.6.101.89
  181.6.108.15
@@ -32643,13 +39650,17 @@
  181.6.70.254
  181.6.87.73
  181.6.91.206
+181.60.79.253
  181.62.245.247
+181.63.248.149
  181.64.160.234
+181.64.233.43
  181.65.138.218
  181.65.142.122
  181.65.142.125
  181.65.155.20
  181.65.157.134
+181.66.188.23
  181.7.197.81
  181.7.200.180
  181.7.205.218
@@ -32677,14 +39688,19 @@
  181.83.231.13
  181.83.236.222
  181.88.176.122
+181.89.48.60
  181.94.221.15
  181.94.226.236
  181.94.244.133
  18141190156-xxyyzzaa.azurewebsites.net
  18190.8wix.com
  182.101.207.11
+182.106.189.57
  182.112.52.174
  182.112.9.196
+182.113.12.220
+182.113.193.96
+182.113.205.213
  182.113.205.251
  182.113.207.37
  182.113.211.248
@@ -32692,31 +39708,38 @@
  182.113.228.239
  182.113.43.246
  182.113.58.37
+182.114.123.83
  182.114.20.91
  182.114.254.27
  182.114.254.79
  182.114.64.33
-182.114.80.192
+182.114.70.130
  182.114.90.88
  182.114.92.204
+182.114.93.238
  182.115.175.177
  182.115.199.21
-182.116.100.226
+182.115.204.58
  182.116.101.36
  182.116.102.170
  182.116.103.91
+182.116.105.89
+182.116.106.57
  182.116.108.16
  182.116.109.252
+182.116.109.39
  182.116.110.177
+182.116.111.20
  182.116.115.46
  182.116.115.78
  182.116.118.247
  182.116.38.160
-182.116.47.33
+182.116.40.227
  182.116.60.73
  182.116.66.118
  182.116.70.143
  182.116.71.231
+182.116.87.195
  182.116.96.194
  182.116.98.31
  182.116.99.66
@@ -32726,11 +39749,12 @@
  182.117.155.49
  182.117.207.206
  182.117.227.55
+182.117.230.190
  182.117.230.78
  182.117.27.218
  182.117.28.104
-182.117.28.11
-182.117.49.42
+182.117.28.67
+182.117.50.161
  182.117.6.167
  182.117.67.215
  182.117.71.196
@@ -32742,82 +39766,79 @@
  182.117.91.235
  182.117.94.187
  182.117.96.14
-182.118.140.196
-182.119.106.253
+182.119.106.139
  182.119.12.199
-182.119.138.37
+182.119.155.43
  182.119.160.254
  182.119.164.83
  182.119.167.42
+182.119.185.248
  182.119.189.90
  182.119.207.145
  182.119.207.54
  182.119.208.233
-182.119.209.55
  182.119.215.94
  182.119.219.132
-182.119.227.185
+182.119.226.145
  182.119.32.89
  182.119.58.36
-182.119.62.30
+182.119.6.195
+182.119.62.16
  182.119.73.141
  182.119.9.51
  182.120.16.115
  182.120.33.50
+182.120.35.202
  182.120.36.28bin.sh
+182.120.36.83
  182.120.40.42
  182.120.5.105
  182.120.86.249
-182.121.103.175
-182.121.103.252
+182.121.113.115
  182.121.117.254
-182.121.135.118
+182.121.128.69
  182.121.155.186
  182.121.157.170
-182.121.157.69
-182.121.187.247
  182.121.202.164
  182.121.21.220
-182.121.224.198
-182.121.229.32
+182.121.211.0
  182.121.233.40
  182.121.238.143
  182.121.241.224
  182.121.248.160
  182.121.25.182
-182.121.53.39
+182.121.33.151
  182.121.82.225
+182.121.84.238
  182.121.85.60
-182.121.86.209
+182.121.87.32
+182.121.9.247
  182.122.160.137
  182.122.249.8
  182.122.25.85
  182.122.251.231bin.sh
-182.122.251.52
-182.122.254.20
+182.122.252.42
  182.122.56.237
+182.122.57.76
+182.123.167.49
  182.123.208.31
  182.123.210.106
  182.123.210.25
  182.123.211.164
-182.123.243.106
  182.123.251.182
  182.124.159.26
-182.124.191.49
-182.124.20.3
+182.124.190.173
  182.124.217.212
  182.124.5.172
-182.124.72.32
  182.126.101.85
  182.126.112.44
  182.126.112.63
  182.126.118.161
  182.126.118.167
-182.126.127.36
-182.126.192.85
-182.126.193.202
+182.126.123.31
+182.126.125.228
+182.126.125.58
  182.126.193.96
-182.126.215.50
  182.126.234.24
  182.126.65.75
  182.126.66.40
@@ -32826,32 +39847,40 @@
  182.126.69.88
  182.126.71.233
  182.126.73.51
-182.126.80.145
  182.126.86.25
  182.126.92.184
+182.126.92.238
  182.126.96.21
  182.126.97.223
+182.127.115.160
+182.127.120.110
  182.127.152.142
  182.127.155.174
  182.127.156.246
-182.127.167.117
  182.127.171.4
-182.127.180.220
-182.127.211.7
+182.127.213.139
  182.127.29.87
-182.127.76.231
-182.127.88.183
+182.127.84.129
  182.142.112.88
  182.142.115.84
  182.142.118.25
  182.142.96.246
  182.145.110.181
+182.150.117.234
+182.150.191.123
+182.150.57.34
  182.150.63.191
  182.150.63.195
+182.151.16.46
+182.151.2.98
  182.151.204.23
+182.151.28.254
  182.151.3.137
  182.151.52.16
-182.155.216.15
+182.151.57.115
+182.156.209.222
+182.156.213.183
+182.156.214.14
  182.16.10.90
  182.16.10.91
  182.16.10.94
@@ -32880,29 +39909,52 @@
  182.160.110.178
  182.160.117.130
  182.160.119.155
+182.160.123.148
  182.160.124.26
+182.160.125.174
  182.160.127.53
  182.160.163.131
  182.161.19.122
+182.162.104.239
  182.163.112.194
  182.163.120.84
  182.165.90.235
+182.168.21.206
  182.171.246.142
  182.172.36.95
  182.176.102.157
+182.176.110.189
+182.176.148.203
+182.176.171.52
+182.176.222.232
+182.176.96.22
+182.18.144.99
  182.18.152.36
  182.18.153.206
+182.18.206.122
+182.180.128.132
  182.180.128.134
+182.180.82.28
+182.183.226.2
  182.184.111.206
+182.184.122.101
+182.185.107.7
  182.185.139.224
+182.185.158.209
  182.185.194.231
  182.185.240.197
+182.186.145.244
+182.186.34.22
+182.188.46.64
  182.189.32.68
  182.19.41.145
  182.19.65.177
  182.19.88.253
  182.191.84.39
+182.201.242.20
  182.208.124.155
+182.208.252.91
+182.208.98.210
  182.222.195.145
  182.222.195.192
  182.222.195.217
@@ -32910,6 +39962,7 @@
  182.23.103.6
  182.23.12.194
  182.23.2.100
+182.23.2.118
  182.23.2.98
  182.23.35.242
  182.23.54.0
@@ -32917,30 +39970,39 @@
  182.23.54.210
  182.23.62.195
  182.23.79.162
+182.23.91.200
+182.23.93.140
  182.232.131.209
+182.232.136.10
  182.232.179.186
+182.232.25.221
  182.232.37.55
  182.241.226.68
+182.242.143.78
  182.245.15.219
+182.253.102.102
  182.253.105.42
  182.253.105.44
  182.253.106.13
  182.253.106.14
  182.253.107.226
+182.253.107.34
  182.253.108.50
  182.253.108.82
  182.253.114.66
  182.253.115.66
  182.253.115.90
+182.253.117.99
  182.253.119.34
+182.253.119.50
  182.253.141.27
  182.253.142.21
+182.253.154.38
  182.253.16.170
  182.253.16.172
  182.253.16.173
  182.253.16.174
  182.253.16.3
-182.253.163.117
  182.253.169.128
  182.253.172.19
  182.253.172.191
@@ -32951,15 +40013,18 @@
  182.253.175.23
  182.253.175.44
  182.253.18.141
+182.253.190.154
  182.253.191.106
  182.253.192.11
  182.253.192.186
  182.253.197.100
+182.253.197.44
  182.253.197.60
  182.253.201.214
  182.253.201.26
  182.253.201.66
  182.253.201.76
+182.253.22.2
  182.253.220.190
  182.253.223.75
  182.253.224.100
@@ -32982,6 +40047,7 @@
  182.253.235.26
  182.253.244.152
  182.253.34.49
+182.253.43.24
  182.253.6.234
  182.253.60.170
  182.253.62.194
@@ -32989,41 +40055,70 @@
  182.253.66.206
  182.253.68.18
  182.253.78.34
+182.253.80.134
  182.253.92.177
  182.253.93.5
  182.254.130.92
  182.254.134.57
  182.254.134.77
+182.254.137.75
+182.254.139.226
  182.254.140.133
+182.254.140.176
  182.254.146.173
+182.254.149.130
+182.254.149.99
+182.254.151.2
  182.254.153.138
+182.254.153.41
+182.254.155.254
+182.254.155.85
  182.254.158.205
+182.254.164.34
  182.254.165.138
+182.254.166.97
+182.254.168.205
+182.254.172.63
  182.254.174.101
  182.254.176.58
  182.254.180.213
  182.254.184.127
+182.254.197.12
+182.254.209.120
  182.254.209.28
+182.254.211.79
  182.254.212.32
  182.254.215.218
  182.254.218.176
  182.254.219.240
+182.254.220.148
+182.254.220.192
  182.254.220.230
  182.254.221.155
  182.254.221.82
+182.254.223.219
+182.254.223.220
  182.254.225.13
  182.254.225.214
  182.254.225.85
+182.254.226.225
+182.254.228.49
  182.254.229.35
  182.254.240.149
  182.254.240.238
  182.254.241.71
  182.254.243.11
+182.254.244.109
+182.254.245.23
+182.254.247.241
+182.254.247.245
  182.255.61.31
  182.30.113.249
  182.30.116.192
+182.42.47.133
+182.43.218.252
  182.46.158.85
-182.47.91.185
+182.48.211.228
  182.48.70.145
  182.48.70.154
  182.48.81.222
@@ -33031,9 +40126,19 @@
  182.48.87.170
  182.48.88.114
  182.48.88.205
+182.50.130.1
+182.50.130.115
+182.50.130.134
+182.50.130.147
  182.50.130.173
+182.50.130.192
+182.50.130.223
+182.50.130.226
+182.50.130.7
  182.50.132.101
+182.50.132.113
  182.50.132.79
+182.50.135.32
  182.50.135.52
  182.50.135.54
  182.50.135.59
@@ -33045,6 +40150,7 @@
  182.50.151.9
  182.50.169.65
  182.50.169.78
+182.52.103.135
  182.52.108.104
  182.52.110.216
  182.52.110.225
@@ -33072,6 +40178,7 @@
  182.52.238.52
  182.52.30.228
  182.52.30.235
+182.52.30.239
  182.52.30.38
  182.52.32.20
  182.52.32.235
@@ -33092,6 +40199,7 @@
  182.52.70.117
  182.52.74.76
  182.52.87.34
+182.52.90.164
  182.52.90.42
  182.53.112.50
  182.53.118.22
@@ -33111,9 +40219,11 @@
  182.53.206.26
  182.53.206.40
  182.53.206.44
+182.53.21.191
  182.53.241.68
-182.53.30.74
  182.53.5.68
+182.53.55.221
+182.53.55.44
  182.53.63.58
  182.53.90.6
  182.53.92.140
@@ -33128,83 +40238,153 @@
  182.54.172.11
  182.54.207.74
  182.55.245.25
-182.56.108.88
-182.56.125.108
-182.56.129.99
-182.57.58.58
+182.56.202.34
+182.56.212.160
+182.57.66.60
  182.58.49.77
  182.59.2.193
+182.59.222.42
  182.59.3.33
+182.61.10.28
+182.61.12.9
  182.61.13.54
+182.61.130.51
  182.61.132.205
  182.61.133.15
  182.61.136.149
+182.61.136.17
+182.61.14.93
  182.61.144.110
  182.61.144.129
  182.61.144.31
+182.61.146.29
+182.61.146.37
  182.61.147.176
+182.61.147.252
+182.61.149.138
+182.61.15.196
  182.61.15.79
+182.61.150.202
+182.61.150.42
+182.61.17.16
  182.61.17.86
  182.61.179.157
+182.61.18.154
  182.61.19.134
  182.61.2.19
+182.61.21.155
+182.61.21.209
+182.61.22.46
+182.61.25.156
+182.61.26.86
  182.61.27.149
+182.61.28.204
  182.61.3.13
  182.61.30.218
+182.61.30.224
+182.61.30.43
+182.61.34.119
+182.61.35.85
+182.61.36.134
  182.61.36.149
+182.61.36.169
+182.61.36.44
+182.61.37.144
+182.61.38.212
+182.61.39.203
+182.61.40.124
  182.61.40.161
  182.61.40.198
+182.61.40.227
+182.61.40.252
+182.61.41.102
+182.61.43.196
  182.61.43.226
+182.61.43.33
  182.61.44.194
  182.61.49.107
+182.61.50.174
  182.61.52.98
-182.61.60.233
+182.61.61.58
+182.64.105.143
  182.64.115.245
+182.64.131.210
  182.64.212.140
  182.64.4.50
  182.68.251.215
+182.69.88.235
+182.71.116.54
  182.71.121.58
  182.71.138.178
+182.71.188.10
  182.71.197.195
  182.71.223.194
+182.71.26.235
+182.71.46.37
  182.71.6.158
  182.71.85.94
  182.71.90.202
+182.72.141.202
  182.72.142.62
  182.72.147.170
+182.72.161.90
  182.72.162.16
  182.72.171.242
  182.72.235.174
  182.72.30.66
+182.72.39.130
  182.72.94.146
+182.73.141.2
  182.73.143.146
+182.73.147.154
+182.73.39.13
+182.73.65.182
  182.73.7.59
  182.73.95.218
-182.74.53.90
+182.74.145.118
+182.74.215.50
+182.74.31.182
+182.74.37.226
+182.74.51.206
+182.74.92.178
  182.75.115.59
  182.75.125.50
  182.75.128.246
  182.75.130.222
  182.75.135.46
  182.75.139.222
+182.75.139.26
  182.75.216.74
  182.75.220.186
  182.75.249.98
  182.75.35.100
+182.75.82.158
  182.75.90.137
+182.76.128.36
  182.76.142.58
  182.76.169.195
+182.76.204.237
+182.76.23.134
  182.76.237.118
  182.76.28.148
+182.76.40.26
  182.77.114.89
+182.78.141.50
  182.78.194.78
+182.84.124.208
+182.84.162.89
+182.87.130.182
  182.92.113.148
  182.92.160.8
+182.92.225.82
+182.92.238.80
  182.92.242.11
+182.92.79.23
  182.92.81.194
  182.92.84.176
  182.93.222.39
  182.93.77.46
+182.93.79.111
  182.93.80.11
  182.93.80.28
  182.93.80.3
@@ -33213,50 +40393,73 @@
  182.93.84.136
  182.93.94.80
  182.93.95.146
+182.99.206.129
+182.99.206.175
  1821456.dg398993.web.hosting-test.net
  182elexusbet.com
  183.100.146.84
  183.100.31.47
  183.101.176.223
  183.101.185.36
+183.102.114.251
  183.102.227.174
  183.102.238.69
  183.103.86.116
+183.103.9.171
  183.104.248.85
  183.105.189.193
  183.106.158.235
  183.106.163.80
  183.107.64.187
+183.109.124.137
  183.109.149.38
+183.109.79.253
  183.109.80.156
+183.11.72.195
  183.110.220.210
  183.111.204.148
+183.111.206.111
  183.111.206.113
  183.111.96.44
  183.111.96.46
+183.112.132.12
  183.128.115.93
+183.129.159.211
  183.129.163.142
+183.129.174.68
  183.13.105.124
  183.130.23.147
  183.131.180.89
  183.131.231.135
  183.131.249.58
  183.131.85.50
+183.132.21.109
+183.134.209.42
+183.134.209.44
  183.134.65.197
  183.134.66.124
  183.134.73.32
+183.134.76.75
+183.136.194.146
  183.136.221.35
+183.136.221.37
  183.136.221.38
  183.136.221.41
  183.136.221.45
  183.136.221.47
+183.136.223.226
+183.136.225.42
  183.136.225.46
-183.14.82.30
+183.136.225.56
+183.136.239.218
+183.14.133.111
+183.14.212.220
+183.14.31.131
+183.141.42.123
+183.141.43.9
  183.146.213.157
  183.146.213.198
-183.15.89.14
-183.15.91.216
-183.15.91.49
+183.151.119.59
  183.151.96.3
  183.156.2.119
  183.158.55.229
@@ -33264,17 +40467,33 @@
  183.16.211.113
  183.162.230.169
  183.162.79.39
+183.165.40.245
+183.165.60.142
+183.166.177.124
+183.167.199.12
  183.167.205.82
+183.167.229.180
  183.17.144.89
+183.17.51.228
+183.17.62.33
+183.171.185.95
+183.171.19.240
+183.171.22.79
+183.171.71.17
+183.171.97.14
  183.178.60.201
+183.18.52.27
  183.181.164.180
  183.181.168.48
  183.181.174.169
  183.181.88.119
  183.182.101.32
+183.182.116.103
  183.186.84.54
  183.187.195.161
+183.188.100.58
  183.188.103.56
+183.188.133.244
  183.188.134.235
  183.188.175.11
  183.188.198.118
@@ -33282,8 +40501,10 @@
  183.188.207.37
  183.188.54.100
  183.188.55.170
-183.188.94.13
+183.188.6.192
+183.188.97.70
  183.190.148.241
+183.194.212.16
  183.196.132.209
  183.196.233.193
  183.197.56.100
@@ -33410,35 +40631,57 @@
  183.199.125.90
  183.203.157.188
  183.207.176.78
+183.215.136.245
+183.22.24.103
+183.220.1.118
  183.220.144.87
+183.221.100.79
  183.221.125.206
  183.224.38.56
+183.225.111.56
  183.226.57.105
  183.230.37.179
  183.230.91.108
+183.232.250.154
+183.233.169.210
+183.233.183.70
  183.234.58.41
  183.234.64.3
+183.236.25.188
  183.236.68.194
  183.237.190.19
+183.237.191.186
  183.238.72.82
  183.239.156.146
+183.239.21.44
  183.239.212.246
  183.242.4.146
  183.246.176.179
+183.251.87.5
  183.4.28.24
  183.4.30.105
  183.4.30.251
  183.47.14.74
+183.48.25.19
+183.56.167.10
+183.6.107.248
  183.6.107.44
+183.6.107.68
  183.6.152.11
+183.6.159.35
+183.6.177.234
  183.60.110.85
  183.60.244.37
  183.61.164.182
+183.62.139.167
+183.62.150.75
  183.62.167.10
+183.62.197.115
  183.62.222.10
  183.62.224.89
  183.62.25.218
  183.62.36.66
+183.62.48.226
  183.62.69.34
  183.63.125.86
  183.63.148.219
@@ -33451,6 +40694,7 @@
  183.77.72.44
  183.78.10.31
  183.78.10.31bin.sh
+183.80.199.151
  183.81.152.82
  183.81.152.85
  183.81.154.113
@@ -33460,11 +40704,25 @@
  183.81.155.81
  183.81.157.217
  183.81.158.105
+183.81.185.205
  183.82.0.15
  183.82.0.21
+183.82.102.66
+183.82.115.221
+183.82.121.34
+183.82.144.225
+183.82.157.180
  183.82.32.153
+183.82.34.162
  183.82.34.94
+183.82.42.67
+183.82.42.98
  183.82.97.25
+183.83.122.188
+183.83.146.159
+183.83.153.77
+183.83.211.9
+183.83.217.190
  183.83.89.226
  183.86.194.68
  183.86.194.79
@@ -33473,6 +40731,7 @@
  183.87.110.22
  183.87.114.130
  183.87.14.125
+183.87.14.202
  183.87.14.250
  183.87.153.182
  183.87.153.98
@@ -33484,10 +40743,15 @@
  183.87.69.233
  183.87.70.210
  183.87.76.17
+183.88.10.106
  183.88.108.27
  183.88.109.250
  183.88.130.151
+183.88.133.164
+183.88.135.159
+183.88.14.22
  183.88.17.76
+183.88.19.47
  183.88.20.233
  183.88.212.141
  183.88.212.247
@@ -33506,6 +40770,7 @@
  183.88.7.39
  183.88.74.115
  183.88.85.53
+183.88.94.31
  183.89.112.114
  183.89.113.31
  183.89.116.224
@@ -33526,9 +40791,12 @@
  183.89.178.234
  183.89.181.192
  183.89.188.122
+183.89.188.32
+183.89.190.61
  183.89.196.190
  183.89.196.207
  183.89.196.57
+183.89.237.171
  183.89.25.38
  183.89.42.58
  183.89.6.13
@@ -33544,15 +40812,21 @@
  183.91.11.21
  183.91.3.63
  183.91.33.41
+183.91.4.119
  183.91.68.148
+183.91.78.211
  183.91.82.88
  183.92.205.130
+183.92.214.38
  183.93.10.57
  183.95.144.236
+183.95.147.27
  183.95.246.160
  183.96.65.145
  183.96.89.113
+183.98.48.163
  183.99.179.218
+183.99.212.215
  183.99.59.168
  1830488.synergyglobal.one
  1834.31cf4fdae.com
@@ -33567,6 +40841,7 @@
  184.0.121.139
  184.0.121.67
  184.0.123.174
+184.0.123.204
  184.0.124.196
  184.0.128.172
  184.0.131.89
@@ -33594,6 +40869,7 @@
  184.100.20.173
  184.100.219.130
  184.100.220.65
+184.100.223.69
  184.100.227.197
  184.100.227.232
  184.100.236.8
@@ -33671,10 +40947,12 @@
  184.102.129.231
  184.102.131.1
  184.102.132.34
+184.102.133.16
  184.102.133.48
  184.102.134.121
  184.102.134.195
  184.102.134.53
+184.102.138.177
  184.102.138.22
  184.102.141.32
  184.102.147.61
@@ -33696,6 +40974,7 @@
  184.102.185.208
  184.102.193.156
  184.102.193.159
+184.102.193.89
  184.102.194.206
  184.102.195.127
  184.102.195.15
@@ -33787,6 +41066,7 @@
  184.103.162.182
  184.103.164.113
  184.103.164.209
+184.103.194.32
  184.103.195.156
  184.103.200.160
  184.103.202.174
@@ -33822,10 +41102,12 @@
  184.105.242.147
  184.105.242.154
  184.105.70.100
+184.144.131.159
  184.144.204.194
  184.145.167.92
  184.147.0.8
  184.148.38.190
+184.149.56.146
  184.153.135.2
  184.153.247.218
  184.154.109.10
@@ -33876,6 +41158,7 @@
  184.158.250.196
  184.158.32.131
  184.158.32.23
+184.158.32.97
  184.158.33.114
  184.158.33.162
  184.158.34.241
@@ -33896,9 +41179,11 @@
  184.158.44.108
  184.158.44.42
  184.158.47.190
+184.158.47.196
  184.158.47.70
  184.158.48.6
  184.158.49.237
+184.158.50.24
  184.158.51.45
  184.158.52.194
  184.158.52.206
@@ -33927,18 +41212,51 @@
  184.163.72.52
  184.164.89.183
  184.168.146.10
+184.168.152.128
+184.168.152.14
+184.168.152.142
  184.168.152.162
  184.168.152.182
+184.168.152.186
+184.168.152.20
+184.168.152.201
+184.168.152.64
+184.168.152.7
  184.168.152.75
+184.168.152.95
+184.168.193.10
+184.168.193.101
  184.168.193.155
+184.168.193.156
+184.168.193.163
+184.168.193.168
+184.168.193.172
+184.168.193.199
+184.168.193.204
+184.168.193.205
+184.168.193.59
  184.168.193.60
+184.168.193.72
  184.168.193.98
  184.168.200.173
  184.168.200.205
+184.168.27.108
+184.168.27.112
  184.168.27.144
+184.168.27.161
+184.168.27.169
+184.168.27.26
+184.168.46.100
+184.168.46.111
  184.168.46.129
  184.168.46.187
+184.168.46.200
+184.168.46.207
+184.168.46.22
  184.168.46.220
+184.168.46.82
+184.168.46.84
+184.169.212.158
  184.170.145.60
  184.170.212.94
  184.170.242.191
@@ -33950,13 +41268,29 @@
  184.173.190.42
  184.173.222.71
  184.175.42.20
+184.176.69.170
+184.178.125.242
+184.178.172.11
  184.178.172.13
  184.178.172.18
+184.178.172.24
  184.178.172.25
  184.178.172.28
  184.178.172.5
+184.179.216.134
+184.179.216.135
+184.179.216.138
+184.179.216.139
+184.179.216.141
+184.179.216.143
+184.179.216.144
+184.179.216.146
+184.179.216.147
+184.179.216.150
+184.179.216.151
  184.180.129.98
  184.180.181.202
+184.183.14.151
  184.185.2.149
  184.187.22.44
  184.188.101.157
@@ -33973,8 +41307,10 @@
  184.2.87.207
  184.2.87.63
  184.22.2.103
+184.22.212.252
  184.22.234.114
  184.22.4.224
+184.3.103.69
  184.3.110.232
  184.3.112.180
  184.3.116.136
@@ -34052,8 +41388,10 @@
  184.5.250.79
  184.5.46.192
  184.55.177.112
+184.56.104.242
  184.57.184.168
  184.57.66.197
+184.58.151.71
  184.59.224.76
  184.6.10.2
  184.6.12.87
@@ -34091,13 +41429,16 @@
  184.7.242.215
  184.7.244.208
  184.7.55.99
+184.70.244.67
  184.70.33.190
+184.71.9.2
  184.72.116.54
  184.72.147.110
  184.72.177.210
  184.72.194.73
  184.72.80.129
  184.73.116.131
+184.73.142.227
  184.73.162.27
  184.73.171.204
  184.73.222.214
@@ -34140,9 +41481,12 @@
  184.82.29.169
  184.82.70.173
  184.82.92.72
+184.88.136.19
+184.90.175.92
  184.95.32.130
  184.95.32.132
  184.95.32.134
+184.95.38.138
  184.95.48.13
  184.96.128.47
  184.96.157.28
@@ -34255,11 +41599,13 @@
  185.10.68.147
  185.10.68.156
  185.10.68.175
+185.10.68.22
  185.10.68.231
  185.10.68.24
  185.10.68.40
  185.10.68.66
  185.10.73.233
+185.100.13.156
  185.100.84.149
  185.100.85.101
  185.100.85.61
@@ -34267,6 +41613,7 @@
  185.100.86.154
  185.100.86.167
  185.100.86.182
+185.100.87.203
  185.100.87.206
  185.100.87.207
  185.100.87.240
@@ -34373,8 +41720,10 @@
  185.11.167.190
  185.11.180.171
  185.11.240.175
+185.110.134.7
  185.110.187.33
  185.110.189.208
+185.110.214.234
  185.110.216.1
  185.110.237.34
  185.110.91.235
@@ -34397,6 +41746,7 @@
  185.114.137.14
  185.114.157.61
  185.114.23.40
+185.114.80.201
  185.116.214.194
  185.116.254.15
  185.116.254.18
@@ -34417,6 +41767,7 @@
  185.117.72.94
  185.117.73.241
  185.118.143.47
+185.118.15.137
  185.118.48.206
  185.118.65.230
  185.118.66.114
@@ -34444,16 +41795,24 @@
  185.122.174.176
  185.122.174.180
  185.122.174.182
+185.122.200.20
  185.122.44.218
  185.123.164.52
+185.123.164.54
  185.123.194.28
  185.124.183.102
+185.125.207.12
  185.125.231.156
+185.126.131.37
  185.126.178.243
+185.126.183.127
+185.126.218.30
  185.126.218.9
  185.127.255.92
  185.128.126.18
  185.128.245.68
+185.128.25.236
+185.128.26.215
  185.128.37.4
  185.128.38.100
  185.128.38.146
@@ -34546,6 +41905,7 @@
  185.135.157.120
  185.135.157.138
  185.135.157.44
+185.135.224.140
  185.135.72.124
  185.136.150.201
  185.136.150.252
@@ -34555,9 +41915,12 @@
  185.136.204.206
  185.136.204.3
  185.136.204.42
+185.136.205.136
+185.136.205.146
  185.136.219.79
  185.136.242.193
  185.136.85.228
+185.136.95.193
  185.137.13.136
  185.137.175.25
  185.137.234.101
@@ -34589,9 +41952,12 @@
  185.14.248.98
  185.14.251.4
  185.14.28.54
+185.14.29.150
  185.14.29.188
  185.14.29.202
  185.14.29.22
+185.14.30.131
+185.14.30.30
  185.14.31.11
  185.14.31.113
  185.140.242.82
@@ -34606,6 +41972,8 @@
  185.141.10.67
  185.141.105.60
  185.141.11.202
+185.141.206.203
+185.141.207.235
  185.141.24.195
  185.141.24.198
  185.141.25.150
@@ -34664,6 +42032,7 @@
  185.148.145.92
  185.148.147.2
  185.148.147.47
+185.148.216.9
  185.148.3.227
  185.148.44.65
  185.15.92.18
@@ -34673,6 +42042,7 @@
  185.151.204.9
  185.151.242.196
  185.151.243.250
+185.151.247.94
  185.151.51.123
  185.152.12.49
  185.152.12.68
@@ -34680,9 +42050,10 @@
  185.152.44.51
  185.153.151.23
  185.153.196.209
+185.153.196.230
  185.153.196.45
+185.153.197.101
  185.153.197.110
-185.153.197.146
  185.153.198.177
  185.153.198.223
  185.153.198.234
@@ -34701,9 +42072,7 @@
  185.156.179.233
  185.156.214.34
  185.156.35.156
-185.156.73.57
-185.156.73.60
-185.156.73.67
+185.156.74.65
  185.157.79.3
  185.158.105.151
  185.158.114.14
@@ -34723,7 +42092,23 @@
  185.159.81.162
  185.16.204.58
  185.16.32.203
+185.16.38.105
+185.16.38.107
+185.16.38.109
+185.16.38.123
+185.16.38.42
+185.16.38.47
+185.16.38.48
  185.16.38.52
+185.16.38.57
+185.16.38.59
+185.16.38.60
+185.16.38.61
+185.16.38.63
+185.16.38.75
+185.16.38.76
+185.16.38.84
+185.16.38.89
  185.161.145.71
  185.161.208.127
  185.161.208.97
@@ -34745,6 +42130,8 @@
  185.162.141.236
  185.162.142.81
  185.162.235.150
+185.162.235.64
+185.162.235.66
  185.162.65.109
  185.162.8.125
  185.162.9.191
@@ -34788,11 +42175,16 @@
  185.165.88.222
  185.166.239.49
  185.166.25.134
+185.166.86.106
+185.166.86.93
+185.166.86.95
+185.166.86.99
  185.166.87.198
  185.167.113.59
  185.167.116.211
  185.167.116.61
  185.167.163.103
+185.167.58.170
  185.167.96.145
  185.167.99.245
  185.169.17.254
@@ -34889,6 +42281,7 @@
  185.172.111.226
  185.172.111.235
  185.173.104.47
+185.173.227.95
  185.173.245.127
  185.173.92.119
  185.174.100.242
@@ -34923,10 +42316,12 @@
  185.174.43.8
  185.174.43.9
  185.174.63.59
+185.175.158.178
  185.175.95.46
  185.176.136.141
  185.176.145.194
  185.176.220.175
+185.176.220.239
  185.176.221.101
  185.176.221.61
  185.176.223.32
@@ -34939,17 +42334,22 @@
  185.177.59.184
  185.178.220.126
  185.179.132.117
+185.18.245.66
  185.18.6.65
+185.18.60.39
+185.18.69.201
  185.180.196.143
  185.180.220.33
  185.180.221.201
  185.180.221.7
+185.180.92.248
  185.181.10.234
  185.181.176.246
  185.181.230.74
  185.181.246.154
  185.181.246.180
  185.181.61.140
+185.181.9.76
  185.182.56.123
  185.182.82.133
  185.183.106.3
@@ -34965,6 +42365,7 @@
  185.183.98.244
  185.183.99.214
  185.183.99.215
+185.184.0.175
  185.184.12.132
  185.184.221.66
  185.185.170.27
@@ -35039,14 +42440,16 @@
  185.193.227.36
  185.193.233.248
  185.193.70.71
-185.193.91.238
-185.193.91.250
+185.193.91.162
  185.194.143.172
  185.194.25.23
  185.194.25.77
+185.194.49.132
  185.195.18.107
  185.196.2.251
+185.196.8.229
  185.197.160.169
+185.197.241.45
  185.197.243.90
  185.197.33.254
  185.198.184.14
@@ -35057,6 +42460,8 @@
  185.198.58.199
  185.198.58.47
  185.199.197.148
+185.2.140.155
+185.2.150.186
  185.2.154.15
  185.2.4.105
  185.2.4.110
@@ -35076,10 +42481,16 @@
  185.20.185.247
  185.20.187.20
  185.20.187.23
+185.20.44.244
  185.20.90.50
  185.200.116.185
+185.200.117.169
+185.200.117.172
+185.200.240.237
  185.200.36.91
+185.201.114.220
  185.201.47.155
+185.201.89.122
  185.201.9.197
  185.202.1.194
  185.202.1.6
@@ -35093,14 +42504,19 @@
  185.203.240.247
  185.203.242.41
  185.203.243.88
+185.204.0.87
  185.204.1.74
+185.204.117.28
  185.204.56.34
  185.205.209.166
  185.205.209.205
  185.205.209.241
  185.205.210.245
+185.205.250.253
  185.205.251.212.zt.hu
  185.205.251.234
+185.205.82.90
+185.206.118.62
  185.206.145.66
  185.206.146.141
  185.206.172.210
@@ -35113,7 +42529,9 @@
  185.206.224.199
  185.206.224.213
  185.206.224.221
+185.206.225.244
  185.206.225.51
+185.206.91.42
  185.206.93.87
  185.207.177.148
  185.207.177.16
@@ -35135,6 +42553,7 @@
  185.209.162.108
  185.209.22.137
  185.209.22.86
+185.209.59.29
  185.21.188.151
  185.21.39.42
  185.21.39.46
@@ -35145,6 +42564,7 @@
  185.210.217.249
  185.210.217.8
  185.210.224.102
+185.211.244.132
  185.211.246.135
  185.211.48.17
  185.211.59.50
@@ -35162,6 +42582,24 @@
  185.212.47.150
  185.213.155.163
  185.213.155.169
+185.213.191.200
+185.213.191.201
+185.213.191.202
+185.213.191.203
+185.213.191.204
+185.213.191.205
+185.213.191.206
+185.213.191.208
+185.213.191.209
+185.213.191.224
+185.213.191.226
+185.213.191.227
+185.213.191.229
+185.213.191.230
+185.213.191.232
+185.213.191.44
+185.213.191.57
+185.213.191.60
  185.214.165.113
  185.214.187.38
  185.215.113.207
@@ -35173,7 +42611,7 @@
  185.215.227.77
  185.216.119.235
  185.216.140.41
-185.216.140.6
+185.216.177.182
  185.216.178.231
  185.216.179.32
  185.216.179.80
@@ -35186,6 +42624,7 @@
  185.217.1.246
  185.217.1.30
  185.217.117.220
+185.217.162.188
  185.217.241.142
  185.217.68.142
  185.217.90.140
@@ -35353,6 +42792,8 @@
  185.223.28.89
  185.223.29.137
  185.224.128.41
+185.224.129.142
+185.224.138.48
  185.224.171.130
  185.224.80.108
  185.225.137.206
@@ -35378,7 +42819,9 @@
  185.227.82.32
  185.227.82.42
  185.228.137.238
+185.228.140.104
  185.228.235.25
+185.229.251.47
  185.23.128.180
  185.23.151.171
  185.230.125.36
@@ -35396,6 +42839,7 @@
  185.232.21.143
  185.232.52.65
  185.232.65.171
+185.232.68.229
  185.232.70.140
  185.232.71.197
  185.233.100.23
@@ -35443,17 +42887,20 @@
  185.234.218.86
  185.234.219.140
  185.234.72.64
+185.235.165.146
+185.235.165.147
+185.235.165.165
+185.235.165.176
+185.235.165.18
+185.235.165.184
+185.235.165.186
+185.235.165.188
  185.235.165.237
+185.235.165.24
+185.235.165.41
  185.235.165.51
+185.235.165.83
  185.235.165.93
-185.236.11.2
-185.236.11.3
-185.236.11.4
-185.236.11.5
-185.236.11.6
-185.236.11.7
-185.236.11.8
-185.236.11.9
  185.236.202.151
  185.236.203.208
  185.236.203.49
@@ -35468,6 +42915,7 @@
  185.236.39.157
  185.236.39.180
  185.236.39.195
+185.236.42.119
  185.236.77.144
  185.236.77.195
  185.236.77.62
@@ -35478,13 +42926,17 @@
  185.238.128.48
  185.238.129.113
  185.238.131.19
+185.238.29.11
  185.239.220.210
  185.239.226.19
  185.239.227.63
  185.239.238.27
  185.239.242.104
+185.239.242.108
  185.239.242.109
+185.239.242.117
  185.239.242.136
+185.239.242.138
  185.239.242.157
  185.239.242.158
  185.239.242.162
@@ -35498,16 +42950,20 @@
  185.239.242.249
  185.239.242.251
  185.239.242.29
+185.239.242.40
  185.239.242.76
  185.239.242.79
  185.239.242.86
  185.239.242.92
+185.239.42.88
  185.239.68.18
  185.239.70.31
  185.24.233.209
+185.24.233.48
  185.24.234.230
  185.24.235.206
  185.24.92.236
+185.240.224.117
  185.241.100.1
  185.241.101.5
  185.241.102.1
@@ -35532,7 +42988,12 @@
  185.243.113.221
  185.243.113.24
  185.243.115.28
+185.243.174.72
  185.243.215.254
+185.243.241.142
+185.243.241.182
+185.243.241.196
+185.243.241.220
  185.243.241.234
  185.243.57.211
  185.244.100.106
@@ -35569,6 +43030,9 @@
  185.244.39.166
  185.244.41.10
  185.244.41.12
+185.244.41.14
+185.244.41.32
+185.244.41.33
  185.244.41.34
  185.244.41.35
  185.244.41.36
@@ -35576,13 +43040,16 @@
  185.244.41.38
  185.244.41.39
  185.244.41.40
+185.244.41.41
  185.244.41.42
  185.244.41.43
  185.244.41.44
  185.244.41.45
  185.244.41.46
+185.244.41.7
  185.245.2.168
  185.245.84.153
+185.245.84.180
  185.245.85.11
  185.245.85.146
  185.245.85.23
@@ -35609,6 +43076,7 @@
  185.249.198.100
  185.249.198.73
  185.249.199.106
+185.249.89.146
  185.25.148.240
  185.25.151.159
  185.25.224.202
@@ -35631,6 +43099,8 @@
  185.250.46.108
  185.251.161.54
  185.251.39.230
+185.251.45.64
+185.251.91.218
  185.252.41.232
  185.252.77.220
  185.253.160.132
@@ -35652,24 +43122,28 @@
  185.255.47.115
  185.255.47.27
  185.255.47.50
+185.255.9.34
  185.255.96.99
  185.26.113.95
  185.26.181.241
  185.26.219.34
  185.26.28.170
  185.26.28.173
+185.27.127.100
  185.27.192.68
  185.27.252.85
  185.27.44.23
  185.27.60.83
  185.28.20.7
  185.29.11.145
+185.29.11.20
  185.29.11.233
  185.29.11.241
  185.29.11.253
  185.29.11.32
  185.29.254.250
  185.29.255.26
+185.29.8.30
  185.29.9.154
  185.29.9.155
  185.29.9.171
@@ -35679,9 +43153,12 @@
  185.3.216.79
  185.3.95.81
  185.30.166.38
+185.30.177.233
+185.30.177.236
  185.30.32.183
  185.30.46.136
  185.30.46.83
+185.30.88.238
  185.30.96.198
  185.31.166.155
  185.32.153.2
@@ -35690,6 +43167,7 @@
  185.32.222.171
  185.32.222.172
  185.32.222.173
+185.32.45.78
  185.32.63.21
  185.33.114.5
  185.33.200.156
@@ -35701,6 +43179,7 @@
  185.34.20.1
  185.34.20.209
  185.34.20.65
+185.34.219.59
  185.34.22.225
  185.34.33.2
  185.34.52.203
@@ -35711,6 +43190,7 @@
  185.35.137.219
  185.35.142.70
  185.35.202.222
+185.35.217.51
  185.35.222.181
  185.35.67.109
  185.35.78.77
@@ -35721,6 +43201,7 @@
  185.36.63.212
  185.36.81.174
  185.36.81.39
+185.36.81.62
  185.37.161.129
  185.37.211.222
  185.37.213.76
@@ -35731,6 +43212,7 @@
  185.38.175.71
  185.38.175.72
  185.38.227.41
+185.38.3.138
  185.39.10.73
  185.39.79.146
  185.4.132.135
@@ -35738,8 +43220,13 @@
  185.4.135.135
  185.4.142.87
  185.4.227.194
+185.4.252.63
+185.40.241.166
+185.40.4.115
  185.40.4.175
+185.41.212.214
  185.41.213.142
+185.41.28.20
  185.41.52.94
  185.41.99.109
  185.42.170.203
@@ -35763,6 +43250,7 @@
  185.44.229.227
  185.44.231.63
  185.45.12.126
+185.45.14.165
  185.45.193.123
  185.45.193.173
  185.45.193.194
@@ -35777,6 +43265,7 @@
  185.46.11.239
  185.46.170.253
  185.46.18.99
+185.46.186.153
  185.46.189.11
  185.46.223.198
  185.46.84.212
@@ -35800,6 +43289,7 @@
  185.5.55.219
  185.5.55.45
  185.5.55.62
+185.50.197.66
  185.50.250.114
  185.50.250.175
  185.50.250.193
@@ -35817,6 +43307,8 @@
  185.52.1.89
  185.52.55.237
  185.53.152.189
+185.53.168.96
+185.53.169.22
  185.53.173.64
  185.53.88.106
  185.53.88.182
@@ -35834,6 +43326,8 @@
  185.59.101.51
  185.59.122.69
  185.59.139.99
+185.59.223.86
+185.59.44.23
  185.60.135.103
  185.61.137.165
  185.61.148.69
@@ -35844,6 +43338,7 @@
  185.61.149.67
  185.61.149.8
  185.61.152.8
+185.61.246.148
  185.61.92.178
  185.61.92.207
  185.61.92.228
@@ -35860,6 +43355,7 @@
  185.62.190.112
  185.62.190.156
  185.62.190.55
+185.62.194.253
  185.62.56.101
  185.63.188.200
  185.63.191.226
@@ -35891,6 +43387,7 @@
  185.66.143.190
  185.66.180.33
  185.66.228.149
+185.66.233.61
  185.66.56.3
  185.66.57.106
  185.66.57.110
@@ -35957,6 +43454,7 @@
  185.67.101.35
  185.67.45.160
  185.67.82.114
+185.67.92.8
  185.67.95.179
  185.68.93.27
  185.69.54.231
@@ -35964,12 +43462,18 @@
  185.7.145.88
  185.7.214.22
  185.70.107.239
+185.70.180.41
  185.70.184.44
  185.70.184.80
  185.70.185.34
  185.70.185.56
+185.70.52.1
+185.70.55.30
  185.73.235.114
+185.74.4.17
  185.74.4.189
+185.74.4.20
+185.74.5.253
  185.75.117.124
  185.75.181.219
  185.75.5.158
@@ -36004,6 +43508,7 @@
  185.80.21.93
  185.80.219.132
  185.80.222.96
+185.80.224.219
  185.80.53.147
  185.81.106.52
  185.81.157.102
@@ -36013,6 +43518,7 @@
  185.81.157.136
  185.81.157.142
  185.81.157.167
+185.81.157.175
  185.81.157.189
  185.81.157.208
  185.81.157.236
@@ -36021,9 +43527,11 @@
  185.81.157.58
  185.81.157.59
  185.81.157.66
+185.81.157.73
  185.81.166.77
  185.81.96.201
  185.82.127.125
+185.82.177.147
  185.82.202.109
  185.82.202.132
  185.82.202.17
@@ -36059,14 +43567,18 @@
  185.86.150.192
  185.86.151.146
  185.86.151.152
+185.86.231.10
  185.87.123.170
+185.87.123.34
  185.87.45.95
  185.87.48.123
  185.87.51.159
  185.87.70.237
  185.88.100.152
  185.88.101.53
+185.88.178.116
  185.88.179.172
+185.88.233.144
  185.88.36.101
  185.88.36.112
  185.88.36.124
@@ -36083,7 +43595,9 @@
  185.89.101.98
  185.89.159.178
  185.89.161.157bin.sh
+185.89.64.136
  185.9.51.4
+185.90.102.12
  185.90.161.92
  185.91.142.202
  185.91.166.37
@@ -36093,6 +43607,7 @@
  185.92.73.98
  185.92.73.99
  185.93.182.138
+185.93.2.40
  185.94.191.18
  185.94.191.94
  185.94.192.214
@@ -36133,12 +43648,14 @@
  185.96.162.23
  185.96.162.27
  185.96.6.106
+185.96.71.109
  185.97.114.233
  185.97.12.130
  185.97.134.4
  185.98.1.60
  185.98.1.62
  185.98.26.21
+185.99.184.147
  1851kitchen.com
  18552beguni.000webhostapp.com
  1856.31cf4fdae.com
@@ -36172,16 +43689,23 @@
  186.103.215.118
  186.103.220.234
  186.103.234.75
+186.107.76.68
+186.108.227.4
  186.109.81.112
  186.113.21.156
  186.113.46.198
  186.116.78.2
+186.117.164.208
  186.119.116.226
  186.119.122.11
+186.121.204.10
  186.121.206.234
  186.121.206.237
  186.121.206.241
  186.121.206.253
+186.122.148.216
+186.122.148.9
+186.122.149.191
  186.125.171.245
  186.125.59.8
  186.126.0.137
@@ -36277,22 +43801,30 @@
  186.126.97.77
  186.136.45.239
  186.137.79.39
+186.137.85.76
+186.138.103.63
  186.138.186.74
+186.139.250.54
  186.145.120.68
  186.145.239.222
+186.145.254.158
  186.146.1.186
  186.146.13.184
  186.146.2.111
  186.146.229.172
+186.146.76.6
+186.147.129.110
  186.147.160.161
  186.147.161.171
  186.147.237.3
+186.147.35.76
  186.148.162.100
  186.148.172.19
  186.148.190.78
  186.149.243.229
  186.15.116.27
  186.15.152.87
+186.15.156.121
  186.15.233.218
  186.15.25.50
  186.15.49.12
@@ -36300,8 +43832,12 @@
  186.150.207.141
  186.151.122.187
  186.151.160.174
+186.151.197.189
+186.151.57.137
+186.153.222.137
  186.154.197.178
  186.154.241.229
+186.155.150.213
  186.155.226.43
  186.156.79.6
  186.159.1.217
@@ -36314,20 +43850,49 @@
  186.159.3.193
  186.159.3.41
  186.159.8.218
+186.16.203.170
+186.16.209.222
  186.16.210.34
  186.167.33.244
  186.168.166.37
+186.170.28.46
  186.177.165.196
  186.177.174.163
+186.178.61.199
+186.179.100.105
+186.179.100.115
+186.179.100.118
+186.179.100.134
+186.179.100.167
+186.179.100.176
+186.179.100.184
+186.179.100.20
+186.179.100.214
+186.179.100.217
+186.179.100.228
+186.179.100.23
+186.179.100.237
+186.179.100.241
+186.179.100.255
+186.179.100.55
+186.179.100.83
+186.179.100.88
  186.179.18.145
  186.179.18.192
  186.179.18.238
  186.179.18.63
  186.179.18.75
+186.179.192.194
+186.179.194.12
+186.179.194.2
  186.179.243.77
  186.179.40.84
  186.18.224.149
  186.183.199.203
+186.189.193.207
+186.19.156.154
+186.190.167.196
+186.190.226.141
  186.192.17.242
  186.192.236.58
  186.192.253.111
@@ -36351,12 +43916,15 @@
  186.193.8.124
  186.193.8.126
  186.195.108.66
+186.195.218.222
  186.195.90.16
  186.20.154.22
+186.20.208.239
  186.200.205.170
  186.200.68.34
  186.201.31.186
  186.201.43.66
+186.204.247.29
  186.204.78.90
  186.204.83.32
  186.206.157.14
@@ -36382,9 +43950,11 @@
  186.208.6.48
  186.208.6.53
  186.209.67.23
+186.209.69.141
  186.209.91.72
  186.211.105.202
  186.211.106.227
+186.211.107.194
  186.211.110.178
  186.211.176.190
  186.211.180.154
@@ -36396,13 +43966,21 @@
  186.211.2.54
  186.211.6.137
  186.211.8.1
+186.211.96.100
  186.212.158.219
  186.213.111.186
  186.213.24.136
+186.214.234.27
  186.215.100.50
+186.215.197.15
+186.215.198.137
  186.215.199.65
  186.215.202.34
+186.216.138.218
+186.216.154.19
+186.216.176.97
  186.216.81.21
+186.216.91.127
  186.219.210.86
  186.219.211.6
  186.219.211.9
@@ -36415,11 +43993,13 @@
  186.219.96.193
  186.219.96.225
  186.219.96.47
+186.22.245.39
  186.220.212.101
  186.224.225.98
  186.224.238.32
  186.224.240.53
  186.224.27.227
+186.225.106.146
  186.225.124.90
  186.225.135.54
  186.225.146.173
@@ -36438,18 +44018,24 @@
  186.225.52.105
  186.225.54.138
  186.225.63.134
+186.225.87.52
  186.225.98.234
  186.226.145.228
+186.226.170.186
  186.226.171.94
  186.226.172.1
  186.226.172.165
  186.226.183.170
+186.226.216.2
  186.226.37.125
  186.227.148.107
+186.227.46.68
  186.227.55.102
  186.227.55.78
  186.228.147.58
+186.23.19.160
  186.232.119.58
+186.232.141.23
  186.232.15.9
  186.232.161.234
  186.232.200.51
@@ -36458,14 +44044,17 @@
  186.232.57.18
  186.232.57.24
  186.232.57.26
+186.233.175.26
  186.233.176.26
  186.233.96.246
  186.233.98.146
  186.233.98.173
+186.234.249.196
  186.235.184.194
  186.235.184.9
  186.235.53.196
  186.235.54.10
+186.236.29.25
  186.237.131.122
  186.237.161.142
  186.237.161.50
@@ -36479,6 +44068,11 @@
  186.237.223.237
  186.237.223.42
  186.238.23.10
+186.238.31.10
+186.239.134.158
+186.239.178.94
+186.24.14.92
+186.24.218.195
  186.24.50.164
  186.24.6.36
  186.248.111.102
@@ -36489,6 +44083,7 @@
  186.248.175.131
  186.248.175.133
  186.248.175.138
+186.248.175.139
  186.248.175.152
  186.248.175.3
  186.249.13.62
@@ -36504,6 +44099,15 @@
  186.249.240.146
  186.249.83.86
  186.250.115.52
+186.250.157.116
+186.250.157.146
+186.250.158.252
+186.250.200.77
+186.250.202.151
+186.250.202.195
+186.250.203.2
+186.250.203.233
+186.250.244.138
  186.250.52.226
  186.250.53.118
  186.250.53.145
@@ -36571,6 +44175,8 @@
  186.29.143.70
  186.29.163.97
  186.29.34.136
+186.29.69.68
+186.29.70.82
  186.3.147.10
  186.30.148.162
  186.30.156.1
@@ -36578,32 +44184,28 @@
  186.30.158.52
  186.30.171.213
  186.30.178.91
+186.30.31.214
  186.31.36.242
  186.31.40.183
  186.32.212.112
  186.33.104.102
+186.33.104.107
+186.33.104.109
+186.33.104.129
  186.33.104.145
  186.33.104.156
-186.33.104.195
  186.33.104.209
-186.33.104.24
  186.33.104.30
  186.33.104.38
-186.33.104.40
  186.33.104.51
-186.33.104.57
-186.33.104.66
  186.33.104.67
  186.33.104.79
  186.33.104.84
  186.33.105.11
  186.33.105.8
-186.33.122.105
  186.33.122.109
-186.33.122.113
-186.33.122.12
+186.33.122.128
  186.33.122.129
-186.33.122.138
  186.33.122.142
  186.33.122.149
  186.33.122.151
@@ -36611,46 +44213,43 @@
  186.33.122.16
  186.33.122.161
  186.33.122.166
-186.33.122.180
  186.33.122.191
-186.33.122.197
  186.33.122.210
  186.33.122.220
-186.33.122.232
-186.33.122.236
+186.33.122.233
  186.33.122.243
  186.33.122.41
+186.33.122.46
  186.33.122.5
-186.33.122.61
  186.33.122.66
-186.33.122.69
  186.33.122.70
  186.33.123.0
  186.33.123.114
  186.33.123.118
+186.33.123.12
  186.33.123.127
  186.33.123.142
-186.33.123.143
-186.33.123.15
-186.33.123.3
+186.33.123.148
  186.33.123.32
  186.33.123.46
  186.33.123.47
  186.33.123.49
-186.33.123.5
-186.33.123.80
+186.33.123.58
+186.33.123.7
  186.33.123.81
-186.33.123.91
  186.33.167.11
  186.34.12.201
  186.34.92.253
  186.35.50.22
+186.38.26.5
  186.38.38.2
+186.4.136.153
  186.4.148.195
  186.4.172.5
  186.4.179.78
  186.4.192.202
  186.4.222.45
+186.4.225.203
  186.4.235.4
  186.4.242.37
  186.42.120.170
@@ -36659,12 +44258,12 @@
  186.42.174.162
  186.42.174.218
  186.42.175.138
-186.42.184.58
  186.42.186.202
  186.42.198.70
  186.45.188.4
  186.46.120.230
  186.46.136.70
+186.46.159.194
  186.46.184.182
  186.46.187.26
  186.46.222.226
@@ -36674,8 +44273,8 @@
  186.46.85.194
  186.47.102.166
  186.47.208.50
-186.47.209.222
  186.47.212.166
+186.47.213.34
  186.47.81.50
  186.47.82.6
  186.47.83.126
@@ -36689,19 +44288,26 @@
  186.53.148.112
  186.58.191.87
  186.58.248.40
+186.58.36.137
  186.59.132.129
  186.61.13.196
  186.61.21.177
+186.64.116.65
  186.64.118.125
+186.64.119.245
  186.64.119.85
+186.64.95.116
  186.67.13.244
  186.67.130.162
  186.67.159.100
  186.67.159.101
  186.67.164.77
  186.67.224.156
+186.67.27.174
  186.68.141.218
  186.68.93.46
+186.69.246.194
+186.7.7.105
  186.71.71.44
  186.73.102.132
  186.73.132.114
@@ -36711,14 +44317,21 @@
  186.74.221.210
  186.75.130.46
  186.75.241.230
+186.77.196.176
+186.77.204.26
+186.79.180.71
  186.80.27.227
  186.82.235.14
+186.83.41.2
  186.84.173.153
  186.84.174.13
+186.85.159.135
  186.86.247.169
  186.88.44.220
  186.89.212.45
  186.9.11.188
+186.90.135.253
+186.90.184.92
  186.90.29.228
  186.91.189.243
  186.91.201.210
@@ -36727,6 +44340,7 @@
  186.95.24.89
  186.96.109.181
  186.96.110.5
+186.96.112.250
  186.96.127.221
  186.96.170.61
  186.96.178.5
@@ -36738,10 +44352,15 @@
  186login-amazon.serveirc.com
  187.0.172.10
  187.0.195.66
+187.0.85.199
  187.1.178.102
  187.1.188.158
+187.1.81.161
  187.10.131.224
+187.10.132.171
+187.10.35.207
  187.102.13.140
+187.102.16.166
  187.102.16.70
  187.102.71.1
  187.102.96.95
@@ -36751,14 +44370,19 @@
  187.103.81.39
  187.103.82.116
  187.103.82.123
+187.103.82.78
  187.103.82.91
  187.103.82.95
  187.104.145.210
  187.108.38.170
  187.108.46.204
+187.108.48.22
+187.108.76.147
  187.108.86.40
+187.109.10.100
  187.109.116.64
  187.109.181.77
+187.109.253.246
  187.109.34.243
  187.109.36.251
  187.109.40.9
@@ -36791,15 +44415,19 @@
  187.111.193.80
  187.111.195.0
  187.111.195.6
+187.111.39.5
+187.111.46.199
  187.115.10.50
  187.116.125.80
  187.119.191.48
  187.12.157.82
  187.12.167.85
  187.12.181.106
+187.120.15.26
  187.120.221.165
  187.120.253.119
  187.120.253.137
+187.120.29.45
  187.121.105.52
  187.121.109.248
  187.121.110.17
@@ -36810,6 +44438,7 @@
  187.121.125.25
  187.121.127.180
  187.121.127.56
+187.121.75.253
  187.121.80.76
  187.121.86.142
  187.121.87.50
@@ -36820,13 +44449,28 @@
  187.123.56.57
  187.125.30.122
  187.133.59.220
+187.134.213.153
+187.134.246.133
+187.135.123.100
  187.137.159.55
+187.138.162.31
+187.138.71.204
+187.141.128.42
  187.141.129.86
  187.141.138.200
+187.141.143.180
+187.143.169.208
  187.143.75.193
+187.144.248.15
  187.144.50.63
  187.145.225.49
+187.148.3.156
+187.149.110.136
  187.149.60.246
+187.149.71.247
+187.150.131.94
+187.151.201.205
+187.155.132.119
  187.16.109.209
  187.16.255.199
  187.16.4.126
@@ -36843,28 +44487,65 @@
  187.17.19.90
  187.170.230.209
  187.170.243.251
+187.172.202.196
  187.174.65.4
  187.177.155.123
  187.178.241.208
+187.18.108.73
  187.18.125.34
+187.18.254.159
  187.18.47.210
  187.184.98.222
+187.187.230.145
  187.188.107.115
+187.188.111.161
+187.188.127.180
+187.188.141.220
  187.188.166.192
+187.188.174.78
  187.188.182.87
+187.188.183.82
+187.188.187.140
+187.188.188.231
  187.188.190.217
  187.188.200.2
  187.188.200.20
+187.188.202.106
+187.188.202.186
+187.188.213.38
  187.188.213.4
  187.188.236.198
+187.188.240.7
+187.188.34.157
+187.188.34.193
+187.188.34.227
+187.188.90.141
+187.189.111.113
+187.189.122.67
+187.189.170.100
+187.189.175.4
+187.189.178.16
  187.189.195.208
+187.189.211.33
+187.189.225.148
+187.189.225.85
+187.189.230.108
+187.189.230.143
+187.189.231.218
+187.189.232.175
+187.189.234.239
  187.189.235.42
+187.189.237.7
  187.189.243.167
  187.189.51.115
+187.189.52.132
  187.189.60.10
  187.189.74.203
+187.189.75.245
  187.189.81.144
  187.189.81.246
+187.189.97.254
+187.189.99.216
  187.19.114.2
  187.19.127.178
  187.19.127.180
@@ -36877,19 +44558,37 @@
  187.19.203.194
  187.19.204.23
  187.19.205.226
+187.190.10.175
+187.190.102.83
  187.190.109.158
+187.190.192.215
+187.190.197.38
  187.190.205.58
+187.190.221.53
+187.190.227.62
  187.190.236.88
  187.190.237.69
  187.190.237.71
+187.190.239.112
+187.190.239.216
+187.190.255.230
  187.190.40.95
+187.190.45.106
+187.190.48.20
+187.191.38.74
  187.191.39.189
  187.191.4.88
+187.191.96.60
  187.192.119.193
  187.194.80.233
  187.195.74.33
  187.20.214.78
+187.200.186.144
+187.202.83.41
  187.205.136.76
+187.207.203.240
+187.207.217.122
+187.211.82.147
  187.212.190.44
  187.216.81.178
  187.216.81.180
@@ -36899,30 +44598,40 @@
  187.216.81.188
  187.216.81.189
  187.216.81.190
+187.216.81.82
  187.216.93.20
  187.217.246.82
  187.217.39.84
+187.220.43.45
  187.223.162.79
+187.223.244.150
  187.224.196.70
  187.228.153.58
  187.237.103.210
  187.237.16.197
  187.237.164.212
  187.237.164.37
+187.237.217.18
  187.243.240.54
  187.243.250.222
+187.243.251.154
  187.243.253.182
  187.243.253.2
  187.243.255.174
+187.245.95.138
  187.248.21.27
  187.250.149.15
  187.252.154.90
+187.26.221.189
+187.26.33.157
  187.32.175.203
  187.32.212.208
  187.32.225.177
+187.32.235.50
  187.32.58.98
  187.32.92.129
  187.33.160.252
+187.33.162.112
  187.33.70.110
  187.33.86.101
  187.33.87.98
@@ -36942,6 +44651,12 @@
  187.44.1.206
  187.44.110.157
  187.44.126.204
+187.44.138.149
+187.44.138.150
+187.44.138.151
+187.44.138.153
+187.44.138.154
+187.44.138.155
  187.44.14.19
  187.44.160.174
  187.44.167.78
@@ -36951,6 +44666,7 @@
  187.44.213.166
  187.44.252.106
  187.44.254.62
+187.44.99.182
  187.45.106.54
  187.45.123.110
  187.45.123.137
@@ -36959,12 +44675,16 @@
  187.45.170.142
  187.45.193.159
  187.49.207.65
+187.5.96.149
+187.50.136.210
+187.53.5.247
  187.54.225.76
  187.54.74.23
  187.54.81.117
  187.57.12.226
  187.58.107.81
  187.58.131.11
+187.58.151.15
  187.60.34.234
  187.60.34.86
  187.60.36.164
@@ -36985,8 +44705,11 @@
  187.65.12.111
  187.65.55.231
  187.67.128.35
+187.68.195.85
+187.72.177.131
  187.72.231.193
  187.72.239.185
+187.72.53.91
  187.72.66.1
  187.72.66.10
  187.72.66.16
@@ -36994,6 +44717,7 @@
  187.72.66.5
  187.72.66.9
  187.72.89.126
+187.73.192.200
  187.73.201.76
  187.73.214.155
  187.73.214.161
@@ -37005,6 +44729,7 @@
  187.74.132.64
  187.75.209.161
  187.76.190.74
+187.8.113.122
  187.8.182.30
  187.8.226.10
  187.8.78.101
@@ -37023,21 +44748,30 @@
  187.84.191.41
  187.84.191.50
  187.84.191.9
+187.84.80.239
  187.85.130.98
  187.85.150.148
+187.85.164.7
+187.85.229.190
  187.85.84.202
  187.86.129.122
  187.86.129.132
  187.86.129.134
  187.86.201.4
+187.87.1.238
  187.87.204.202
  187.87.204.205
  187.87.208.230
+187.9.119.44
  187.9.86.122
  187.94.16.59
  187.94.221.0
+187.95.11.195
+187.95.110.153
  187.95.114.125
  187.95.119.2
+187.95.124.103
+187.95.190.169
  187.95.34.16
  187.95.80.137
  187.95.80.141
@@ -37061,8 +44795,10 @@
  188.0.240.38
  188.10.161.2
  188.10.210.132
+188.101.49.228
  188.104.156.80
  188.112.145.230
+188.112.194.6
  188.113.106.183
  188.113.158.18
  188.113.166.222
@@ -37073,7 +44809,10 @@
  188.114.111.215
  188.114.128.173
  188.114.155.58
+188.116.29.37
+188.117.176.56
  188.119.113.201
+188.119.150.229
  188.119.30.71
  188.119.30.72
  188.119.30.80
@@ -37096,11 +44835,13 @@
  188.120.245.247
  188.121.2.186
  188.121.252.236
+188.121.41.158
  188.121.57.10
  188.121.57.5
  188.122.2.55
  188.123.126.172
  188.124.181.6
+188.124.245.195
  188.124.36.153
  188.124.42.107
  188.124.42.119
@@ -37131,35 +44872,59 @@
  188.126.89.154
  188.126.89.158
  188.126.89.16
+188.126.89.28
  188.126.89.36
  188.126.89.4
  188.126.94.72
  188.127.170.26
  188.127.188.23
+188.127.225.2
  188.127.229.105
  188.127.249.210
  188.127.251.245
  188.128.202.35.bc.googleusercontent.com
+188.128.39.127
  188.128.39.28
+188.128.50.217
  188.129.161.55
+188.129.34.213
  188.130.129.138
+188.130.138.105
  188.130.142.167
  188.130.185.151
  188.130.185.220
  188.130.210.243
  188.130.211.213
  188.130.7.221
+188.131.130.86
  188.131.131.210
+188.131.133.196
+188.131.133.91
+188.131.135.161
+188.131.135.188
+188.131.135.227
+188.131.142.109
  188.131.143.95
  188.131.144.29
  188.131.146.143
+188.131.146.238
  188.131.146.4
+188.131.149.215
+188.131.150.74
  188.131.151.197
+188.131.155.179
  188.131.172.48
+188.131.177.57
  188.131.177.59
+188.131.179.87
+188.131.183.242
+188.131.185.145
  188.131.192.68
  188.131.193.154
+188.131.193.231
+188.131.233.36
  188.131.235.218
+188.131.247.56
  188.131.249.145
  188.132.169.90
  188.132.219.172
@@ -37186,11 +44951,13 @@
  188.138.136.146
  188.138.192.154
  188.138.235.56
+188.138.25.85
  188.138.250.83
  188.138.254.218
  188.138.40.166
  188.138.84.69
  188.138.88.184
+188.14.85.21
  188.141.34.156
  188.141.79.43
  188.143.126.183
@@ -37709,17 +45476,25 @@
  188.143.233.99
  188.143.235.21
  188.143.75.103
+188.148.227.92
  188.149.149.142
  188.149.233.118
+188.152.189.220
  188.152.7.140
  188.154.189.151
  188.154.38.35
  188.155.210.117
  188.155.91.186
+188.156.113.87
+188.156.179.10
  188.156.240.240
+188.156.43.228
+188.157.65.153
  188.16.100.56
+188.161.62.114
  188.162.142.192
  188.162.41.226
+188.162.43.125
  188.163.104.113
  188.163.109.142
  188.163.170.130
@@ -37728,6 +45503,7 @@
  188.163.42.254
  188.163.46.254
  188.163.47.9
+188.163.57.66
  188.163.74.184
  188.165.11.196
  188.165.113.29
@@ -37738,8 +45514,11 @@
  188.165.140.127
  188.165.141.114
  188.165.16.230
+188.165.166.72
+188.165.17.91
  188.165.179.58
  188.165.180.120
+188.165.194.99
  188.165.196.203
  188.165.198.108
  188.165.201.139
@@ -37751,6 +45530,8 @@
  188.165.214.98
  188.165.218.62
  188.165.222.158
+188.165.228.188
+188.165.228.82
  188.165.228.9
  188.165.229.5
  188.165.230.116
@@ -37762,14 +45543,20 @@
  188.165.244.143
  188.165.245.53
  188.165.246.50
+188.165.247.31
  188.165.25.196
  188.165.250.115
  188.165.29.122
+188.165.34.119
  188.165.4.88
+188.165.42.223
+188.165.44.214
  188.165.73.28
+188.165.78.87
  188.165.89.65
  188.165.95.14
  188.166.0.135
+188.166.1.95
  188.166.10.218
  188.166.10.79
  188.166.102.232
@@ -37780,7 +45567,10 @@
  188.166.105.10
  188.166.105.84
  188.166.109.215
+188.166.109.87
  188.166.11.150
+188.166.110.18
+188.166.114.8
  188.166.116.147
  188.166.119.231
  188.166.12.196
@@ -37803,10 +45593,15 @@
  188.166.153.62
  188.166.154.203
  188.166.158.134
+188.166.159.127
+188.166.16.36
  188.166.161.142
+188.166.164.10
  188.166.165.121
  188.166.170.70
+188.166.172.189
  188.166.177.20
+188.166.177.99
  188.166.178.39
  188.166.18.102
  188.166.180.165
@@ -37816,17 +45611,24 @@
  188.166.183.237
  188.166.185.112
  188.166.185.157
+188.166.185.16
+188.166.185.236
  188.166.185.245
  188.166.187.179
  188.166.188.247
+188.166.19.131
  188.166.190.146
  188.166.190.154
  188.166.190.166
  188.166.190.187
+188.166.190.221
+188.166.190.225
+188.166.191.96
  188.166.193.249
  188.166.197.9
  188.166.20.136
  188.166.208.194
+188.166.208.66
  188.166.21.143
  188.166.21.245
  188.166.21.247
@@ -37839,25 +45641,35 @@
  188.166.211.7
  188.166.212.238
  188.166.212.31
+188.166.216.75
+188.166.218.105
+188.166.218.227
  188.166.22.22
  188.166.220.180
  188.166.220.74
  188.166.223.102
+188.166.224.24
  188.166.224.51
  188.166.225.221
  188.166.225.238
+188.166.225.37
  188.166.226.188
  188.166.227.153
  188.166.229.193
+188.166.23.215
  188.166.232.159
  188.166.233.216
+188.166.234.253
  188.166.236.56
  188.166.236.57
+188.166.238.73
  188.166.24.63
+188.166.240.30
  188.166.241.194
  188.166.242.30
  188.166.244.121
  188.166.244.203
+188.166.246.158
  188.166.246.32
  188.166.247.170
  188.166.247.82
@@ -37866,13 +45678,16 @@
  188.166.250.107
  188.166.250.4
  188.166.251.155
+188.166.251.87
  188.166.253.195
  188.166.254.248
  188.166.254.66
  188.166.255.227
+188.166.255.49
  188.166.27.111
  188.166.3.185
  188.166.3.215
+188.166.30.39
  188.166.31.157
  188.166.32.250
  188.166.33.15
@@ -37881,12 +45696,14 @@
  188.166.35.206
  188.166.35.81
  188.166.38.40
+188.166.4.178
  188.166.43.209
  188.166.46.210
  188.166.48.223
  188.166.49.115
  188.166.5.210
  188.166.5.50
+188.166.5.84
  188.166.56.221
  188.166.56.50
  188.166.58.130
@@ -37896,11 +45713,14 @@
  188.166.58.240
  188.166.58.96
  188.166.6.130
+188.166.60.138
+188.166.60.25
  188.166.60.92
  188.166.61.49
  188.166.63.236
  188.166.64.245
  188.166.65.239
+188.166.69.54
  188.166.69.56
  188.166.71.168
  188.166.71.170
@@ -37908,6 +45728,7 @@
  188.166.72.240
  188.166.73.180
  188.166.77.247
+188.166.8.121
  188.166.8.86
  188.166.80.133
  188.166.81.188
@@ -37925,12 +45746,14 @@
  188.166.99.160
  188.166.99.74
  188.167.158.203
+188.168.248.23
  188.168.27.71
  188.168.27.73
  188.168.56.31
  188.168.56.82
  188.168.75.254
  188.168.81.158
+188.168.82.246
  188.168.96.34
  188.169.142.196
  188.169.167.204
@@ -37955,6 +45778,8 @@
  188.169.45.114
  188.169.45.115
  188.169.45.140
+188.169.45.223
+188.169.45.232
  188.169.45.237
  188.169.45.239
  188.169.45.92
@@ -37968,16 +45793,20 @@
  188.17.148.154
  188.170.122.155
  188.170.129.251
+188.170.13.225
  188.170.183.138
  188.170.208.210
+188.170.28.69
  188.170.33.57
  188.170.41.6
  188.170.63.9
  188.170.8.109
  188.172.220.70
+188.172.246.67
  188.172.94.56
  188.173.14.99
  188.174.35.38
+188.174.55.139
  188.175.191.162
  188.18.225.106
  188.18.54.130
@@ -37985,7 +45814,9 @@
  188.181.73.110
  188.186.180.135
  188.186.220.33
+188.187.0.42
  188.187.0.44
+188.187.108.131
  188.187.62.173
  188.19.152.17
  188.19.191.178
@@ -38003,35 +45834,51 @@
  188.191.232.66
  188.191.28.109
  188.192.12.35
+188.192.175.128
  188.193.103.156
+188.193.167.54
+188.193.172.17
  188.193.44.23
+188.194.188.88
  188.194.5.121
+188.194.58.118
  188.195.169.0
+188.2.16.112
  188.2.217.94
  188.205.25.124
  188.208.111.62
+188.208.121.7
  188.209.155.250
  188.209.49.164
  188.212.100.2
  188.213.170.40
  188.213.34.12
  188.213.49.139
+188.213.49.166
  188.213.49.176
  188.213.49.210
  188.213.49.243
  188.214.104.146
+188.214.104.33
+188.214.104.59
  188.214.128.192
  188.214.132.45
  188.214.133.114
  188.214.133.181
  188.214.152.109
+188.214.30.149
  188.214.30.78
  188.215.70.115
+188.216.254.72
  188.217.109.25
+188.217.181.18
+188.217.97.1
  188.218.232.45
  188.218.47.5
+188.219.117.26
  188.219.31.12
  188.220.144.162
+188.220.249.149
  188.223.123.122
  188.225.177.37
  188.225.178.130
@@ -38039,8 +45886,15 @@
  188.225.202.1
  188.225.32.231
  188.225.46.245
+188.225.82.76
+188.225.83.14
+188.225.83.3
+188.225.83.41
+188.225.83.5
+188.225.84.102
  188.226.128.122
  188.226.130.128
+188.226.131.171
  188.226.131.23
  188.226.132.27
  188.226.134.223
@@ -38057,6 +45911,9 @@
  188.226.176.113
  188.226.179.232
  188.226.180.234
+188.226.188.45
+188.226.189.117
+188.226.192.115
  188.226.233.196
  188.226.250.187
  188.227.193.27
@@ -38074,6 +45931,7 @@
  188.230.72.160
  188.234.216.99
  188.234.218.19
+188.234.247.110
  188.234.251.138
  188.235.0.42
  188.235.128.166
@@ -38088,10 +45946,12 @@
  188.237.135.3
  188.237.148.12
  188.24.108.129
+188.24.40.110
  188.240.136.75
  188.240.191.163
  188.240.208.26
  188.240.208.4
+188.241.25.165
  188.241.39.65
  188.241.45.61
  188.241.45.85
@@ -38102,6 +45962,7 @@
  188.241.82.160
  188.241.82.22
  188.242.133.111
+188.242.27.95
  188.242.5.172
  188.242.68.214
  188.243.102.12
@@ -38118,17 +45979,27 @@
  188.247.144.165
  188.247.144.62
  188.247.39.14
+188.247.65.179
  188.25.168.172
+188.25.17.89
  188.25.224.74
  188.251.196.56
  188.251.213.180
+188.252.14.236
  188.252.64.154
  188.252.97.34
+188.253.2.168
+188.253.231.179
  188.254.0.111
+188.254.0.116
+188.254.0.160
  188.254.0.172
+188.254.0.182
  188.254.172.147
  188.254.172.151
+188.255.118.20
  188.255.120.9
+188.255.145.164
  188.255.208.1
  188.255.208.10
  188.255.208.105
@@ -38171,18 +46042,29 @@
  188.255.214.121
  188.255.214.5
  188.255.214.9
+188.255.237.215
  188.26.5.254
  188.27.137.163
  188.27.36.71
+188.27.59.198
+188.3.195.184
  188.32.128.29
  188.32.145.79
  188.34.140.122
  188.34.142.109
  188.34.144.180
  188.34.152.77
+188.34.165.172
+188.34.165.183
+188.34.166.17
+188.34.166.31
+188.34.194.155
  188.35.167.7
+188.36.167.248
  188.37.24.190
  188.38.97.58
+188.4.196.139
+188.4.75.117
  188.40.114.21
  188.40.136.208
  188.40.155.227
@@ -38197,6 +46079,7 @@
  188.43.225.109
  188.43.5.49
  188.43.52.166
+188.49.251.138
  188.50.127.101
  188.53.7.172
  188.53.88.202
@@ -38219,8 +46102,11 @@
  188.68.56.168
  188.68.56.223
  188.69.135.214
+188.69.197.0
+188.72.187.212
  188.72.202.147
  188.72.6.98
+188.72.98.85
  188.75.138.234
  188.75.139.60
  188.75.173.148
@@ -38228,9 +46114,12 @@
  188.75.186.162
  188.79.164.163
  188.81.227.188
+188.81.254.135
  188.82.39.247
  188.85.143.170
+188.87.95.97
  188.92.190.38
+188.92.243.82
  188.92.244.38
  188.92.73.91
  188.93.104.2
@@ -38243,10 +46132,12 @@
  188.94.42.24
  188.94.66.42
  188.95.234.6
+188.97.94.168
  18850306919.mer.lstest.siquality.com
  18850306929.mer.lstest.siquality.com
  188elexusbet.blogspot.com
  188winerium.com
+189.1.10.46
  189.1.11.66
  189.1.123.19
  189.1.152.26
@@ -38261,6 +46152,7 @@
  189.1.4.129
  189.100.253.150
  189.107.23.86
+189.108.178.6
  189.108.236.148
  189.109.252.155
  189.109.32.234
@@ -38268,19 +46160,32 @@
  189.112.125.209
  189.112.125.212
  189.112.126.65
+189.112.179.115
+189.112.196.1
  189.112.223.113
+189.112.228.153
  189.112.89.17
+189.113.186.219
+189.113.187.98
  189.113.2.23
  189.113.217.35
+189.114.1.52
+189.114.140.70
+189.114.67.195
  189.114.67.217
  189.115.171.132
+189.115.210.172
  189.122.185.116
  189.122.185.23
  189.123.173.24
+189.123.232.5
  189.124.17.106
+189.124.171.30
  189.124.180.40
+189.124.220.31
  189.124.94.171
  189.126.195.70
+189.126.202.121
  189.126.205.53
  189.126.67.230
  189.126.71.203
@@ -38288,6 +46193,7 @@
  189.127.107.43
  189.127.128.226
  189.128.56.231
+189.129.43.161
  189.130.230.223
  189.131.190.173
  189.131.217.49
@@ -38299,12 +46205,18 @@
  189.135.59.24
  189.138.59.0
  189.138.94.69
+189.139.130.239
+189.139.78.219
  189.14.193.111
  189.14.193.242
  189.14.193.94
  189.14.194.113
  189.14.233.26
  189.14.96.74
+189.140.160.101
+189.142.120.23
+189.146.131.206
+189.146.156.58
  189.148.103.223
  189.15.17.127
  189.150.164.106
@@ -38313,21 +46225,32 @@
  189.152.61.86
  189.153.95.182
  189.154.161.142
+189.154.220.90
  189.155.9.184
+189.159.210.106
+189.159.56.189
  189.16.123.100
  189.162.123.139
  189.162.183.59
  189.166.212.235
  189.167.14.31
+189.167.45.102
+189.17.228.136
  189.171.65.89
+189.172.180.188
  189.172.34.21
  189.174.130.74
  189.174.83.178
  189.174.9.172
  189.177.110.65
+189.177.189.116
  189.177.80.175
+189.178.112.205
+189.178.164.109
+189.178.73.157
  189.18.181.92
  189.187.128.178
+189.189.0.152
  189.191.3.53
  189.192.133.225
  189.194.58.119
@@ -38336,9 +46259,11 @@
  189.199.106.202
  189.2.127.243
  189.2.127.244
+189.2.141.83
  189.2.177.210
  189.2.218.179
  189.2.65.162
+189.20.55.148
  189.20.98.204
  189.200.81.82
  189.201.189.2
@@ -38351,24 +46276,41 @@
  189.201.242.186
  189.201.242.24
  189.201.250.173
+189.203.139.51
+189.203.142.241
+189.203.144.231
+189.203.161.45
+189.203.162.20
+189.203.163.161
+189.203.163.236
  189.203.194.2
+189.203.235.215
  189.203.26.46
+189.203.37.79
+189.203.45.199
  189.203.73.102
  189.204.242.178
  189.204.49.40
+189.204.52.235
  189.206.160.153
+189.206.165.62
  189.206.166.12
  189.206.166.9
  189.206.216.18
  189.206.216.20
+189.207.242.90
  189.207.46.32
  189.209.110.202
  189.209.217.49
+189.209.7.168
+189.211.179.115
  189.212.103.237
  189.212.199.126
+189.212.249.122
  189.213.228.237
  189.213.228.57
  189.214.64.34
+189.216.94.83
  189.218.107.128
  189.218.156.138
  189.218.165.63
@@ -38376,22 +46318,32 @@
  189.219.69.229
  189.219.72.148
  189.22.180.250
+189.22.55.34
  189.220.226.38
  189.222.175.66
+189.222.39.151
  189.223.19.109
  189.223.208.162
  189.231.48.145
  189.231.97.160
+189.232.17.219
  189.235.87.72
  189.236.122.23
  189.236.212.18
  189.236.32.128
  189.236.73.159
+189.237.100.42
+189.240.117.236
  189.240.225.205
+189.240.50.226
+189.240.62.227
  189.241.124.20
  189.241.145.77
+189.241.235.106
  189.242.130.16
  189.243.159.109
+189.243.25.216
+189.244.76.49
  189.244.92.231
  189.248.93.110
  189.250.126.76
@@ -38400,18 +46352,29 @@
  189.254.232.61
  189.254.242.60
  189.254.255.180
+189.254.255.3
  189.26.128.138
  189.26.78.155
  189.27.79.166
  189.28.186.26
+189.28.249.101
  189.30.181.98
  189.38.90.83
+189.39.102.67
  189.39.127.118
  189.39.29.119
+189.4.1.12
  189.4.11.237
+189.4.128.122
  189.4.3.44
  189.41.137.1
+189.41.212.76
+189.41.215.72
+189.41.241.111
+189.41.66.86
+189.41.90.107
  189.44.178.170
+189.44.20.193
  189.45.144.26
  189.45.199.37
  189.47.112.65
@@ -38421,6 +46384,7 @@
  189.51.101.126
  189.51.101.145
  189.51.103.125
+189.51.103.95
  189.51.108.23
  189.51.116.5
  189.51.127.1
@@ -38432,6 +46396,7 @@
  189.52.154.213
  189.52.165.134
  189.52.165.84
+189.52.24.146
  189.54.62.128
  189.55.194.94
  189.57.121.10
@@ -38439,8 +46404,12 @@
  189.6.28.187
  189.6.78.34
  189.61.87.178
+189.62.148.166
  189.63.87.20
+189.69.0.153
+189.7.81.29
  189.75.115.204
+189.76.49.165
  189.78.145.44
  189.78.156.8
  189.79.193.173
@@ -38448,6 +46417,7 @@
  189.80.111.66
  189.80.219.58
  189.80.3.187
+189.81.1.39
  189.81.220.139
  189.84.14.58
  189.84.21.44
@@ -38464,6 +46434,7 @@
  189.89.170.234
  189.89.18.86
  189.89.187.162
+189.89.221.81
  189.89.242.122
  189.89.27.17
  189.9.25.66
@@ -38471,13 +46442,16 @@
  189.9.25.89
  189.9.25.92
  189.9.25.94
+189.90.208.193
  189.90.244.46
  189.90.244.82
  189.90.248.112
  189.91.100.50
  189.91.101.54
  189.91.115.6
+189.91.239.194
  189.91.84.25
+189.93.152.225
  189cj.cn
  189zx.com
  18a.buzz
@@ -38510,9 +46484,11 @@
  190.0.53.213
  190.0.61.18
  190.0.8.134
+190.1.203.180
  190.100.117.152
  190.101.168.19
  190.102.59.117
+190.103.1.146
  190.103.125.194
  190.103.125.199
  190.103.187.54
@@ -38520,14 +46496,21 @@
  190.103.28.14
  190.103.28.76
  190.103.29.236
+190.104.124.162
+190.104.149.194
  190.104.17.3
  190.104.17.4
+190.104.175.34
  190.104.205.1
  190.104.205.65
+190.104.235.8
  190.104.237.148
  190.104.24.109
+190.104.245.28
  190.104.247.220
  190.104.249.44
+190.104.25.210
+190.104.254.194
  190.104.254.198
  190.104.26.227
  190.104.64.242
@@ -38535,10 +46518,14 @@
  190.104.68.246
  190.104.69.241
  190.105.213.165
+190.105.250.198
  190.106.103.250
  190.106.104.2
+190.106.146.44
  190.106.97.230
  190.107.118.125
+190.107.177.238
+190.107.177.240
  190.108.226.1
  190.108.228.48
  190.108.84.166
@@ -38552,6 +46539,7 @@
  190.109.178.180
  190.109.196.41
  190.109.196.44
+190.109.43.139
  190.109.67.22
  190.109.72.10
  190.109.72.21
@@ -38563,8 +46551,11 @@
  190.11.15.14
  190.11.168.226
  190.11.198.89
+190.11.21.43
+190.11.24.36
  190.110.197.18
  190.110.86.134
+190.111.151.225
  190.111.231.8
  190.112.136.149
  190.112.136.153
@@ -38588,6 +46579,7 @@
  190.115.218.2
  190.115.219.249
  190.117.126.169
+190.117.147.185
  190.117.148.237
  190.117.206.153
  190.119.197.210
@@ -38597,6 +46589,8 @@
  190.12.37.142
  190.12.39.194
  190.12.47.246
+190.12.66.27
+190.12.67.9
  190.12.8.146
  190.12.8.206
  190.12.86.98
@@ -38609,11 +46603,13 @@
  190.120.253.66
  190.120.254.17
  190.120.254.37
+190.120.254.76
  190.120.96.33
  190.120.96.37
  190.120.96.41
  190.120.96.45
  190.120.96.49
+190.121.136.3
  190.121.142.158
  190.121.142.166
  190.121.142.202
@@ -38626,8 +46622,10 @@
  190.122.112.42
  190.122.112.57
  190.122.112.69
-190.122.112.70
  190.122.112.72
+190.122.128.196
+190.123.197.168
+190.123.230.168
  190.123.35.138
  190.123.35.139
  190.123.35.140
@@ -38646,20 +46644,36 @@
  190.123.90.242
  190.123.90.246
  190.124.164.78
+190.124.29.37
  190.124.34.221
  190.128.135.130
+190.128.137.90
  190.128.148.198
+190.128.169.222
  190.128.226.122
+190.128.234.230
  190.128.237.142
  190.128.238.26
+190.128.239.146
  190.128.26.98
+190.128.68.123
+190.128.80.50
  190.128.88.4
+190.129.143.30
+190.129.49.62
+190.129.69.101
  190.13.138.50
+190.13.173.67
  190.13.82.242
+190.13.83.125
  190.13.84.221
  190.131.167.50
+190.131.196.18
  190.131.220.101
  190.131.229.126
+190.132.77.44
+190.133.223.104
+190.136.109.66
  190.136.176.89
  190.136.178.52
  190.138.206.15
@@ -38668,19 +46682,32 @@
  190.14.170.109
  190.14.225.117
  190.14.231.212
+190.14.235.115
  190.14.39.239
+190.140.131.14
+190.140.182.89
+190.140.92.234
  190.141.196.80
+190.143.137.114
  190.143.39.211
  190.144.100.58
  190.144.114.162
+190.144.135.118
+190.144.139.76
+190.144.14.170
+190.144.182.86
  190.144.187.188
  190.144.224.182
  190.144.44.36
  190.144.60.138
  190.144.70.74
+190.144.79.157
  190.144.81.94
+190.144.82.194
  190.144.91.252
  190.144.99.11
+190.145.12.233
+190.145.123.26
  190.145.132.250
  190.145.133.206
  190.145.136.186
@@ -38688,15 +46715,21 @@
  190.145.156.58
  190.145.159.26
  190.145.174.26
+190.145.192.106
  190.145.200.126
  190.145.203.98
+190.145.224.18
+190.145.254.138
  190.145.255.246
+190.145.33.211
  190.145.38.91
+190.145.5.170
  190.145.60.229
  190.145.69.123
  190.145.77.219
  190.145.81.37
  190.145.92.18
+190.146.13.180
  190.146.131.105
  190.147.137.153
  190.147.137.66
@@ -38704,11 +46737,14 @@
  190.147.179.6
  190.147.19.117
  190.147.215.53
+190.147.33.171
  190.147.81.16
  190.148.39.222
  190.148.69.74
  190.149.165.162
  190.149.216.74
+190.149.56.251
+190.151.100.10
  190.151.94.2
  190.151.94.3
  190.152.12.54
@@ -38732,32 +46768,44 @@
  190.152.71.46
  190.152.8.146
  190.152.88.114
+190.153.152.56
  190.153.222.250
+190.153.249.99
  190.156.227.27
  190.156.229.215
  190.156.231.182
+190.156.231.245
+190.156.238.155
+190.16.182.142
+190.16.183.189
  190.160.53.126
  190.161.67.63
  190.162.135.242
  190.162.232.138
  190.163.31.26
  190.164.232.254
+190.164.43.178
  190.166.28.179
  190.166.90.2
  190.167.215.170
  190.167.220.7
  190.17.195.202
+190.17.206.93
  190.17.44.48
  190.17.51.132
+190.171.133.10
  190.171.153.139
  190.171.180.162
  190.171.218.40
+190.171.240.51
  190.177.114.135
  190.178.147.248
  190.18.184.113
  190.18.207.58
  190.18.3.250
  190.18.63.166
+190.18.79.110
+190.180.27.177
  190.181.113.202
  190.181.122.225
  190.181.122.233
@@ -38777,30 +46825,40 @@
  190.186.1.46
  190.186.144.99
  190.186.170.82
+190.186.253.86
  190.186.36.22
  190.186.36.74
  190.186.76.19
  190.186.89.150
+190.187.100.17
+190.187.112.66
+190.187.240.84
+190.188.242.188
  190.188.245.242
+190.188.80.109
  190.189.170.52
  190.189.59.211
  190.19.169.69
  190.190.159.143
  190.190.219.184
+190.190.229.75
  190.191.127.2
  190.191.163.147
  190.191.171.72
  190.191.8.220
  190.192.39.136
+190.193.158.220
  190.193.8.28
  190.194.12.132
  190.194.139.28
+190.194.176.228
  190.195.129.227
  190.195.148.163
  190.195.static.wline.lns.sme.cust.swisscom-ipv6.ch
  190.196.150.40
  190.196.161.110
  190.196.20.166
+190.196.226.145
  190.196.23.170
  190.196.231.245
  190.196.60.122
@@ -38809,6 +46867,7 @@
  190.196.66.78
  190.196.8.154
  190.196.9.155
+190.197.113.149
  190.198.118.138
  190.2.109.108
  190.2.130.195
@@ -38824,17 +46883,30 @@
  190.2.150.132
  190.2.152.163
  190.2.16.178
+190.2.18.77
  190.2.21.153
+190.2.210.106
  190.2.31.172
  190.20.97.244
+190.200.187.230
+190.202.0.214
+190.202.124.93
+190.202.147.253
  190.202.22.129
  190.202.24.66
+190.202.32.2
+190.202.44.194
+190.202.54.12
+190.202.84.129
  190.205.156.139
+190.205.48.29
  190.206.113.156
  190.207.108.147
  190.207.60.130
  190.208.17.136
+190.21.57.120
  190.210.15.194
+190.210.164.141
  190.210.182.179
  190.210.184.138
  190.210.231.34
@@ -38846,9 +46918,11 @@
  190.211.254.191
  190.211.254.193
  190.211.254.196
+190.213.161.17
  190.213.226.63
  190.213.71.109
  190.214.1.190
+190.214.12.202
  190.214.12.34
  190.214.13.2
  190.214.13.90
@@ -38864,13 +46938,22 @@
  190.214.52.226
  190.214.53.134
  190.214.55.138
+190.214.77.181
+190.214.77.220
+190.214.78.233
+190.214.78.53
+190.214.79.166
  190.214.9.10
  190.215.117.69
  190.215.155.196
+190.215.170.124
+190.215.18.121
  190.215.220.34
  190.215.220.36
  190.215.220.38
+190.215.48.118
  190.216.140.123
+190.216.147.229
  190.216.166.200
  190.216.244.132
  190.217.1.101
@@ -38888,14 +46971,23 @@
  190.217.68.210
  190.217.68.211
  190.217.68.212
+190.218.15.60
+190.218.150.191
+190.218.192.201
+190.218.237.244
  190.219.149.236
  190.219.159.3
  190.219.179.200
+190.219.33.109
  190.220.16.92
  190.220.17.34
  190.221.152.130
+190.221.46.78
+190.223.26.38
  190.224.35.254
+190.224.35.31
  190.225.247.196
+190.226.244.9
  190.226.46.114
  190.226.46.116
  190.228.171.12
@@ -38915,12 +47007,17 @@
  190.234.135.32
  190.234.135.55
  190.234.135.88
+190.234.204.30
+190.235.15.118
+190.236.239.88
+190.237.15.221
  190.239.1.225
  190.239.199.130
  190.24.131.38
  190.24.243.186
  190.24.50.205
  190.24.50.238
+190.24.6.162
  190.240.194.77
  190.242.119.220
  190.242.41.133
@@ -38934,6 +47031,7 @@
  190.248.134.106
  190.248.153.162
  190.248.68.18
+190.249.137.158
  190.249.150.97
  190.25.168.216
  190.25.189.178
@@ -38960,12 +47058,15 @@
  190.29.96.187
  190.3.117.18
  190.3.194.209
+190.3.205.213
  190.3.23.35
+190.30.103.216
  190.31.53.131
  190.34.149.226
  190.34.204.10
  190.37.208.145
  190.38.14.52
+190.39.51.246
  190.4.0.246
  190.4.204.163
  190.4.205.226
@@ -38973,14 +47074,21 @@
  190.40.85.200
  190.43.172.170
  190.43.172.210
+190.44.157.81
+190.45.149.187
  190.45.24.210
+190.45.90.233
  190.5.118.42
  190.5.122.174
  190.5.162.204
+190.5.228.74
  190.5.241.140
+190.5.242.114
  190.5.85.242
  190.52.168.20
+190.52.183.173
  190.52.187.226
+190.52.191.49
  190.52.193.102
  190.52.193.90
  190.52.193.97
@@ -39001,20 +47109,24 @@
  190.57.236.124
  190.57.240.29
  190.57.30.140
+190.58.130.230
  190.6.193.152
  190.6.200.193
  190.6.200.205
  190.6.202.13
  190.6.206.77
  190.60.110.240
+190.62.251.96
  190.63.144.26
  190.63.144.29
  190.63.160.62
  190.63.7.166
  190.64.142.122
  190.64.147.19
+190.64.213.156
  190.64.64.75
  190.64.68.106
+190.64.68.178
  190.64.88.186
  190.66.10.152
  190.7.141.66
@@ -39037,31 +47149,46 @@
  190.73.12.20
  190.75.150.153
  190.77.210.230
+190.77.242.181
  190.77.66.130
+190.79.114.25
  190.79.131.206
  190.8.117.5
  190.8.169.206
  190.8.43.19
+190.8.61.36
+190.80.159.189
  190.80.159.210
  190.80.243.251
+190.80.50.153
  190.80.61.113
+190.81.117.218
  190.82.80.2
  190.83.31.2
  190.83.84.209
  190.83.84.211
+190.83.84.98
+190.84.116.32
+190.84.118.155
  190.84.232.82
  190.85.10.147
  190.85.102.124
+190.85.108.186
  190.85.115.78
  190.85.12.42
  190.85.130.174
  190.85.18.130
+190.85.186.254
  190.85.213.51
+190.85.239.59
+190.85.34.140
  190.85.46.52
  190.85.54.158
  190.85.65.50
+190.85.67.171
  190.86.203.60
  190.88.250.85
+190.89.144.18
  190.89.28.0
  190.89.28.10
  190.89.28.103
@@ -39123,6 +47250,8 @@
  190.93.176.70
  190.94.144.157
  190.94.148.130
+190.94.18.2
+190.94.3.227
  190.95.231.98
  190.96.117.106
  190.96.118.15
@@ -39139,6 +47268,7 @@
  190.99.76.98
  191-365.net
  191.100.20.127
+191.100.24.91
  191.100.28.217
  191.101.109.187
  191.101.117.125
@@ -39187,7 +47317,15 @@
  191.101.99.11
  191.101.99.15
  191.102.106.1
+191.102.120.10
+191.102.120.117
+191.102.120.13
  191.102.120.160
+191.102.120.175
+191.102.120.33
+191.102.120.50
+191.102.120.85
+191.102.122.180
  191.102.126.147
  191.102.131.146
  191.102.131.181
@@ -39215,17 +47353,36 @@
  191.102.167.38
  191.102.189.107
  191.102.189.191
+191.102.65.132
+191.102.78.240
+191.102.83.167
+191.102.83.31
  191.102.88.218
  191.102.95.171
+191.102.96.5
  191.103.219.225
  191.103.254.125
  191.103.254.145
  191.113.244.94
+191.125.174.94
+191.13.251.209
  191.13.62.106
+191.143.210.64
+191.162.211.179
+191.162.211.98
+191.162.215.114
+191.162.216.124
+191.182.144.80
  191.182.6.118
  191.183.21.190
+191.185.102.199
+191.185.45.228
  191.186.143.99
+191.186.80.43
+191.189.31.176
  191.19.52.183
+191.20.191.130
+191.205.136.34
  191.205.248.196
  191.209.114.90
  191.209.21.188
@@ -39238,37 +47395,57 @@
  191.223.36.170
  191.232.136.43
  191.232.136.87
+191.232.161.19
+191.232.162.153
  191.232.169.208
  191.232.172.50
  191.232.176.226
+191.232.197.39
  191.232.211.168
  191.232.211.83
+191.232.241.128
+191.232.246.6
  191.232.247.86
+191.232.251.219
+191.232.54.142
  191.233.137.53
  191.233.192.40
  191.233.193.6
+191.233.193.8
  191.233.196.96
  191.233.198.107
  191.233.232.243
+191.234.160.112
  191.234.163.9
  191.234.169.163
  191.234.169.243
+191.234.175.191
+191.234.176.158
+191.235.103.162
  191.235.112.72
  191.235.64.156
+191.235.71.26
  191.235.72.144
  191.235.72.169
  191.236.119.223
  191.237.253.183
+191.237.255.177
  191.237.42.132
+191.238.208.183
  191.239.242.192
  191.239.243.104
+191.239.249.178
  191.239.255.175
+191.240.113.194
  191.240.152.129
  191.240.152.132
  191.240.152.134
+191.240.154.122
  191.240.157.186
  191.240.28.25
+191.240.89.61
  191.240.99.142
+191.241.160.76
  191.241.226.173
  191.241.226.230
  191.241.233.198
@@ -39289,13 +47466,24 @@
  191.243.54.245
  191.243.72.2
  191.243.72.34
+191.246.74.113
+191.248.27.31
  191.250.238.185
  191.252.113.123
  191.252.205.120
+191.252.223.175
  191.252.56.65
  191.253.80.114
  191.253.89.73
+191.255.210.82
  191.255.232.53
+191.31.104.17
+191.31.172.222
+191.31.175.8
+191.31.18.203
+191.31.228.19
+191.31.27.129
+191.31.5.71
  191.34.128.108
  191.36.173.34
  191.37.0.214
@@ -39305,8 +47493,22 @@
  191.37.220.93
  191.37.79.238
  191.43.35.67
+191.47.236.218
+191.47.242.220
  191.5.102.13
+191.5.55.7
+191.5.82.140
+191.53.104.154
  191.53.112.170
+191.53.134.16
+191.53.220.237
+191.53.236.119
+191.54.131.97
+191.55.190.63
+191.55.191.126
+191.55.191.9
+191.55.219.32
+191.55.229.138
  191.6.132.105
  191.6.132.126
  191.6.133.166
@@ -39317,6 +47519,7 @@
  191.6.134.20
  191.6.135.90
  191.6.135.93
+191.6.60.63
  191.6.91.244
  191.6.93.191
  191.7.172.49
@@ -39360,18 +47563,26 @@
  191.96.28.147
  191.96.52.251
  191.96.63.169
+191.96.82.220
+191.97.10.25
+191.97.11.121
+191.97.12.212
  191.97.3.195
+191.97.4.238
  191.97.53.43
  191.97.7.165
  191.98.144.217
+191.98.177.177
  191.98.181.218
  191.98.184.122
  191.98.184.126
+191.98.186.219
  191.98.192.145
  191.98.192.229
  191.98.192.253
  191.98.192.53
  191.98.192.65
+191.98.192.75
  191.98.192.85
  191.98.193.17
  191.98.193.193
@@ -39386,6 +47597,8 @@
  191.99.160.58
  191gm.com
  192-168-1-45.000webhostapp.com
+192.0.102.194
+192.0.91.201
  192.100.213.83
  192.109.110.108
  192.109.110.137
@@ -39407,6 +47620,7 @@
  192.111.138.29
  192.111.139.165
  192.111.146.37
+192.111.152.117
  192.116.142.153
  192.117.146.110
  192.119.106.9
@@ -39419,6 +47633,7 @@
  192.119.111.47
  192.119.111.66
  192.119.111.84
+192.119.117.111
  192.119.144.142
  192.119.151.196
  192.119.151.48
@@ -39468,12 +47683,19 @@
  192.140.42.81
  192.140.42.83
  192.140.91.133
+192.141.107.58
  192.141.12.70
+192.141.129.219
  192.141.208.1
+192.142.218.11
+192.142.219.231
  192.144.104.1
  192.144.104.33
  192.144.129.98
  192.144.130.54
+192.144.138.102
+192.144.140.20
+192.144.141.35
  192.144.148.220
  192.144.156.36
  192.144.156.70
@@ -39482,16 +47704,29 @@
  192.144.171.119
  192.144.172.241
  192.144.185.202
+192.144.190.178
+192.144.198.189
+192.144.204.6
  192.144.205.87
  192.144.207.37
+192.144.210.27
+192.144.215.146
  192.144.216.116
+192.144.217.143
+192.144.218.101
+192.144.218.21
  192.144.218.38
  192.144.218.46
+192.144.227.36
  192.144.228.40
+192.144.230.43
  192.144.232.129
+192.144.232.215
  192.144.234.119
  192.144.234.61
  192.144.236.197
+192.144.237.48
+192.144.254.245
  192.144.254.35
  192.145.125.122
  192.145.205.74
@@ -39529,6 +47764,7 @@
  192.160.102.168
  192.160.102.169
  192.160.102.170
+192.161.165.180
  192.161.172.215
  192.161.190.171
  192.161.48.61
@@ -39541,7 +47777,9 @@
  192.162.193.243
  192.162.27.108
  192.162.27.155
+192.162.51.100
  192.162.62.197
+192.162.68.185
  192.162.96.79
  192.163.192.224
  192.163.199.254
@@ -39556,6 +47794,7 @@
  192.169.189.120
  192.169.193.54
  192.169.201.143
+192.169.201.24
  192.169.227.134
  192.169.243.124
  192.169.6.101
@@ -39699,6 +47938,7 @@
  192.210.217.94
  192.210.226.106
  192.210.226.125
+192.210.228.229
  192.210.230.137
  192.210.230.140
  192.210.231.101
@@ -39715,6 +47955,7 @@
  192.226.183.184
  192.226.85.58
  192.227.134.70
+192.227.134.71
  192.227.137.250
  192.227.137.251
  192.227.137.253
@@ -39738,6 +47979,7 @@
  192.227.158.230
  192.227.158.238
  192.227.158.239
+192.227.158.61
  192.227.159.102
  192.227.171.45
  192.227.172.139
@@ -39782,9 +48024,11 @@
  192.227.253.235
  192.227.69.80
  192.227.80.83
+192.228.100.100
  192.228.100.222
  192.228.100.250
  192.228.107.187
+192.232.204.242
  192.232.205.102
  192.232.206.199
  192.232.229.53
@@ -39798,10 +48042,12 @@
  192.236.147.67
  192.236.154.89
  192.236.155.130
+192.236.160.138
  192.236.160.186
  192.236.160.24
  192.236.161.206
  192.236.161.98
+192.236.162.179
  192.236.162.32
  192.236.162.48
  192.236.163.200
@@ -39830,20 +48076,26 @@
  192.241.113.206
  192.241.129.176
  192.241.130.65
+192.241.131.150
  192.241.132.169
  192.241.133.195
+192.241.133.99
  192.241.134.102
  192.241.135.146
  192.241.137.219
  192.241.138.236
+192.241.139.236
  192.241.141.131
  192.241.141.168
+192.241.141.197
  192.241.142.27
  192.241.143.186
  192.241.143.52
  192.241.145.8
  192.241.146.155
  192.241.146.84
+192.241.147.184
+192.241.147.98
  192.241.148.219
  192.241.150.222
  192.241.151.77
@@ -39862,19 +48114,27 @@
  192.241.167.114
  192.241.171.169
  192.241.172.229
+192.241.173.142
  192.241.173.157
  192.241.173.18
  192.241.174.101
  192.241.174.106
+192.241.174.114
+192.241.174.44
  192.241.175.149
  192.241.175.203
+192.241.175.250
  192.241.175.26
  192.241.177.62
  192.241.179.98
+192.241.182.13
  192.241.182.61
  192.241.183.101
+192.241.184.22
  192.241.184.220
+192.241.185.120
  192.241.185.214
+192.241.195.30
  192.241.195.43
  192.241.196.148
  192.241.196.201
@@ -39883,31 +48143,60 @@
  192.241.198.37
  192.241.200.176
  192.241.200.243
+192.241.200.41
  192.241.201.157
  192.241.201.181
  192.241.201.227
+192.241.202.169
  192.241.203.105
-192.241.205.251
+192.241.205.166
+192.241.205.216
  192.241.206.246
  192.241.206.48
+192.241.209.148
+192.241.209.221
  192.241.210.14
  192.241.210.178
-192.241.212.205
+192.241.211.126
+192.241.211.78
  192.241.213.38
+192.241.214.34
  192.241.215.116
  192.241.215.124
+192.241.215.188
  192.241.215.189
+192.241.216.41
+192.241.216.90
+192.241.217.147
  192.241.217.190
  192.241.217.60
+192.241.217.61
  192.241.218.151
+192.241.218.229
+192.241.218.40
+192.241.218.42
+192.241.218.58
  192.241.218.69
+192.241.219.158
  192.241.220.155
+192.241.220.171
  192.241.220.183
  192.241.220.227
-192.241.221.236
+192.241.221.112
  192.241.221.76
+192.241.222.110
+192.241.222.158
  192.241.222.89
+192.241.223.212
+192.241.223.235
+192.241.223.25
+192.241.224.105
+192.241.224.33
+192.241.224.66
+192.241.224.78
+192.241.225.11
  192.241.225.203
+192.241.225.38
  192.241.226.82
  192.241.227.59
  192.241.229.67
@@ -39946,6 +48235,7 @@
  192.241.84.117
  192.243.100.114
  192.243.102.171
+192.243.114.21
  192.243.116.123
  192.243.116.235
  192.243.119.81
@@ -39962,6 +48252,7 @@
  192.243.55.138
  192.243.97.11
  192.248.144.91
+192.249.120.54
  192.249.47.172
  192.249.53.158
  192.249.53.67
@@ -40254,6 +48545,7 @@
  192.3.136.75
  192.3.139.145
  192.3.139.159
+192.3.139.56
  192.3.139.71
  192.3.140.202
  192.3.141.134
@@ -40306,6 +48598,7 @@
  192.3.214.5
  192.3.214.58
  192.3.215.247
+192.3.22.50
  192.3.23.41
  192.3.240.199
  192.3.240.200
@@ -40314,6 +48607,7 @@
  192.3.247.119
  192.3.25.135
  192.3.251.67
+192.3.255.142
  192.3.255.169
  192.3.26.105
  192.3.28.114
@@ -40330,6 +48624,7 @@
  192.3.67.106
  192.3.7.118
  192.3.8.178
+192.3.81.166
  192.3.9.199
  192.3.99.28
  192.34.56.82
@@ -40338,9 +48633,11 @@
  192.34.58.174
  192.34.58.211
  192.34.59.22
+192.34.60.204
  192.34.62.193
  192.34.62.208
  192.34.80.176
+192.35.168.64
  192.36.27.4
  192.40.95.118
  192.40.95.121
@@ -40381,6 +48678,7 @@
  192.43.209.197
  192.44.77.205
  192.46.223.151
+192.46.231.240
  192.46.232.37
  192.46.237.154
  192.52.166.9
@@ -40395,10 +48693,13 @@
  192.64.114.84
  192.64.118.132
  192.64.52.124
+192.64.80.135
  192.65.170.15
+192.69.180.182
  192.69.235.189
  192.71.213.69
  192.71.247.215
+192.73.238.101
  192.81.129.60
  192.81.129.82
  192.81.135.190
@@ -40411,6 +48712,7 @@
  192.81.212.110
  192.81.212.234
  192.81.213.42
+192.81.214.168
  192.81.215.123
  192.81.215.138
  192.81.217.100
@@ -40423,6 +48725,8 @@
  192.81.38.31
  192.82.64.219
  192.82.76.215
+192.92.97.227
+192.92.97.230
  192.95.12.175
  192.95.18.190
  192.95.2.165
@@ -40431,55 +48735,78 @@
  192.95.29.97
  192.95.30.137
  192.95.30.185
+192.95.30.65
  192.95.31.71
  192.95.31.9
+192.95.36.229
  192.95.37.160
  192.95.49.93
  192.95.6.110
  192.96.206.186
  192.96.206.197
  192.96.24.1
+192.99.0.98
  192.99.1.38
  192.99.101.152
  192.99.11.13
+192.99.11.195
  192.99.11.224
  192.99.11.48
+192.99.12.24
  192.99.12.35
  192.99.13.28
  192.99.13.29
+192.99.132.25
  192.99.135.207
  192.99.137.85
  192.99.14.159
  192.99.14.187
+192.99.14.189
  192.99.141.252
+192.99.145.203
  192.99.145.57
  192.99.149.195
  192.99.15.139
+192.99.151.29
+192.99.152.234
  192.99.152.38
  192.99.159.183
  192.99.159.52
  192.99.16.146
  192.99.160.45
  192.99.166.42
+192.99.167.221
+192.99.168.9
  192.99.169.223
  192.99.174.110
+192.99.184.200
  192.99.19.154
+192.99.2.41
  192.99.200.213
  192.99.200.69
+192.99.204.2
+192.99.223.191
+192.99.245.135
+192.99.247.102
  192.99.252.90
+192.99.31.122
  192.99.32.109
  192.99.34.142
  192.99.35.135
  192.99.35.149
  192.99.36.177
+192.99.4.179
  192.99.4.59
  192.99.4.63
  192.99.42.246
  192.99.47.10
  192.99.47.125
  192.99.5.123
+192.99.5.14
  192.99.5.94
+192.99.55.64
  192.99.70.54
+192.99.70.67
  192.99.71.52
  192.99.8.102
  192.99.8.157
@@ -40494,22 +48821,26 @@
  193.1.101.222
  193.10.203.23
  193.104.41.59
+193.105.134.198
  193.105.154.146
  193.105.206.253
  193.105.62.11
  193.105.7.24
+193.105.83.6
  193.106.130.249
  193.106.175.103
+193.106.229.186
  193.106.231.145
  193.106.28.8
  193.106.29.2
  193.106.29.98
  193.106.30.90
  193.106.30.99
+193.106.31.138
+193.106.31.146
  193.106.31.42
  193.106.58.51
  193.106.60.145
-193.106.99.241
  193.107.16.111
  193.107.16.183
  193.107.19.203
@@ -40517,6 +48848,10 @@
  193.107.236.167
  193.107.48.3
  193.107.75.42
+193.107.76.146
+193.107.76.211
+193.107.76.220
+193.107.76.242
  193.107.85.56
  193.108.249.107
  193.109.140.14
@@ -40529,51 +48864,91 @@
  193.111.152.64
  193.111.152.71
  193.111.156.2
+193.111.38.178
  193.111.4.165
+193.112.1.26
  193.112.100.26
  193.112.102.52
  193.112.102.75
  193.112.108.11
+193.112.108.135
+193.112.109.108
  193.112.110.35
+193.112.111.207
+193.112.118.19
  193.112.123.100
+193.112.126.64
+193.112.127.245
+193.112.139.159
  193.112.140.108
  193.112.144.168
+193.112.16.245
  193.112.160.226
  193.112.160.70
+193.112.162.48
  193.112.169.87
+193.112.18.214
  193.112.181.237
  193.112.187.205
+193.112.191.228
+193.112.192.63
+193.112.195.121
+193.112.196.101
  193.112.201.103
+193.112.202.61
+193.112.203.134
  193.112.208.73
+193.112.209.128
  193.112.213.187
  193.112.213.227
  193.112.213.248
+193.112.213.38
  193.112.218.159
+193.112.23.105
+193.112.247.98
  193.112.248.85
  193.112.250.77
+193.112.251.36
  193.112.39.179
+193.112.4.12
+193.112.49.125
  193.112.49.216
+193.112.5.66
  193.112.54.76
  193.112.58.246
  193.112.63.109
  193.112.66.187
  193.112.69.40
  193.112.70.95
+193.112.72.251
  193.112.73.244
  193.112.78.90
+193.112.79.20
+193.112.8.113
  193.112.85.35
+193.112.86.231
+193.112.9.233
+193.112.93.94
  193.112.94.225
  193.112.98.79
+193.114.142.226
+193.12.104.89
+193.122.10.91
+193.122.104.122
+193.122.120.19
  193.122.123.5
+193.122.124.119
  193.122.134.181
  193.122.144.192
  193.122.163.242
+193.124.136.211
  193.124.181.169
  193.124.182.77
  193.124.183.165
  193.124.183.187
  193.125.67.164
  193.135.153.242
+193.135.9.84
  193.137.208.199
  193.138.204.251
  193.138.218.162
@@ -40588,6 +48963,7 @@
  193.142.30.161
  193.142.30.73
  193.142.58.38
+193.142.59.149
  193.142.59.150
  193.142.59.169
  193.142.59.18
@@ -40595,6 +48971,7 @@
  193.148.18.100
  193.148.70.165
  193.148.70.4
+193.148.70.87
  193.148.71.10
  193.148.71.236
  193.149.225.181
@@ -40602,10 +48979,13 @@
  193.149.225.228
  193.15.16.4
  193.150.121.66
+193.150.13.100
+193.150.13.106
  193.150.153.32
  193.150.170.204
  193.150.233.115
  193.151.12.117
+193.151.98.112
  193.154.222.77
  193.159.131.215
  193.160.10.242
@@ -40637,14 +49017,15 @@
  193.169.245.81
  193.169.245.87
  193.169.252.142
-193.169.252.159
-193.169.252.59
  193.169.252.81
  193.169.252.82
  193.169.252.83
+193.169.253.156
+193.169.253.167
  193.169.253.168
  193.169.253.28
  193.169.253.35
+193.169.253.69
  193.169.254.116
  193.169.254.63
  193.169.5.14
@@ -40661,6 +49042,7 @@
  193.176.85.109
  193.176.85.76
  193.176.85.87
+193.176.86.108
  193.178.169.252
  193.183.216.28
  193.188.254.67
@@ -40675,6 +49057,7 @@
  193.19.118.78
  193.19.165.222
  193.19.243.246
+193.190.253.145
  193.192.122.65
  193.193.194.194
  193.193.240.34
@@ -40733,6 +49116,7 @@
  193.227.16.160
  193.227.49.81
  193.227.5.230
+193.228.108.122
  193.228.53.78
  193.228.57.184
  193.228.57.194
@@ -40767,6 +49151,7 @@
  193.234.50.227
  193.238.152.198
  193.238.152.67
+193.238.171.212
  193.239.101.6
  193.239.101.99
  193.239.102.12
@@ -40776,6 +49161,7 @@
  193.239.147.125
  193.239.147.139
  193.239.147.192
+193.239.147.195
  193.239.147.22
  193.239.147.226
  193.239.147.229
@@ -40796,24 +49182,36 @@
  193.242.213.18
  193.243.164.24
  193.243.164.29
+193.243.164.34
  193.243.164.60
+193.247.213.196
  193.248.180.212
+193.248.188.227
+193.248.247.215
  193.25.197.129
  193.251.6.236
  193.252.149.16
+193.252.189.37
  193.252.54.240
  193.252.8.76
  193.254.184.188
  193.26.159.199
  193.27.13.180
  193.27.19.92
+193.27.228.164
+193.27.229.200
  193.27.229.219
-193.27.229.224
-193.27.229.47
  193.27.23.83
+193.29.106.108
  193.29.107.249
  193.29.13.84
-193.29.14.107
+193.29.14.105
+193.29.14.113
+193.29.14.122
+193.29.14.126
+193.29.14.132
+193.29.14.133
+193.29.14.134
  193.29.187.214
  193.29.187.218
  193.29.187.226
@@ -40831,17 +49229,21 @@
  193.32.126.161
  193.32.126.162
  193.32.127.215
+193.32.129.34
+193.32.129.36
  193.32.161.77
  193.32.164.27
+193.34.136.16
  193.34.144.138
  193.34.161.137
  193.34.166.216
  193.34.166.96
  193.34.167.192
-193.34.187.77
  193.34.55.64
+193.34.8.49
  193.34.93.221
  193.36.15.173
+193.36.225.22
  193.36.225.37
  193.36.225.45
  193.37.152.138
@@ -40852,7 +49254,9 @@
  193.37.214.49
  193.37.215.67
  193.37.252.231
+193.37.255.114
  193.38.51.25
+193.38.55.24
  193.39.185.214
  193.39.245.144
  193.40.10.82
@@ -40866,6 +49270,8 @@
  193.41.87.171
  193.41.87.243
  193.42.110.30
+193.42.122.25
+193.42.6.247
  193.42.96.108
  193.43.118.179
  193.43.92.40
@@ -40873,20 +49279,36 @@
  193.46.199.225
  193.46.2.17
  193.46.202.3
+193.47.69.8
+193.47.69.95
  193.53.168.218
  193.56.240.213
  193.56.252.231
  193.56.252.250
  193.56.252.251
  193.56.252.252
+193.56.252.76
  193.56.255.131
  193.56.255.179
  193.56.255.180
  193.56.28.119
  193.56.28.122
+193.56.28.160
+193.56.28.168
  193.56.28.177
+193.56.28.205
+193.56.28.242
+193.56.28.33
+193.56.28.36
  193.56.29.102
+193.56.29.104
+193.56.29.106
+193.56.29.22
+193.56.29.23
  193.56.29.251
+193.56.29.29
+193.56.29.36
+193.56.29.44
  193.57.40.55
  193.58.168.177
  193.58.169.203
@@ -40900,18 +49322,24 @@
  193.68.200.227
  193.68.41.17
  193.68.47.76
+193.70.0.42
  193.70.107.179
  193.70.125.186
+193.70.2.6
  193.70.21.87
  193.70.32.13
  193.70.34.209
  193.70.38.187
  193.70.39.203
  193.70.39.41
+193.70.7.73
  193.70.72.249
  193.70.73.115
  193.70.77.132
+193.70.84.104
+193.70.84.113
  193.70.88.213
+193.70.91.79
  193.77.159.82
  193.77.242.110
  193.8.231.8
@@ -40935,10 +49363,15 @@
  193.9.158.50
  193.9.158.52
  193.9.21.34
+193.90.12.121
+193.90.12.122
+193.90.12.20
  193.90.12.86
  193.90.12.87
  193.90.146.39
+193.90.4.130
  193.91.131.237
+193.92.222.64
  193.93.192.223
  193.93.192.46
  193.93.193.106
@@ -40962,6 +49395,7 @@
  194.1.247.250
  194.1.249.27
  194.102.40.134
+194.105.205.42
  194.105.25.25
  194.105.58.135
  194.105.60.210
@@ -40975,6 +49409,9 @@
  194.110.115.211
  194.110.115.217
  194.110.115.230
+194.110.84.105
+194.110.84.113
+194.110.84.179
  194.113.107.233
  194.12.121.100
  194.124.213.78
@@ -40985,6 +49422,7 @@
  194.126.113.130
  194.126.113.135
  194.126.183.171
+194.127.172.77
  194.127.172.92
  194.127.179.119
  194.135.135.69
@@ -41030,50 +49468,29 @@
  194.146.13.143
  194.146.200.51
  194.146.225.214
+194.147.115.80
  194.147.115.84
  194.147.115.86
+194.147.115.95
  194.147.140.101
  194.147.140.102
-194.147.140.103
-194.147.140.104
-194.147.140.105
-194.147.140.106
  194.147.140.107
  194.147.140.109
-194.147.140.20
-194.147.140.21
  194.147.140.22
-194.147.140.23
  194.147.140.24
  194.147.140.25
-194.147.140.26
-194.147.140.27
-194.147.140.28
-194.147.140.29
-194.147.140.30
-194.147.140.31
  194.147.140.32
+194.147.140.40
+194.147.140.41
  194.147.140.48
  194.147.140.50
  194.147.140.52
-194.147.140.60
  194.147.140.61
-194.147.140.62
-194.147.140.63
  194.147.140.64
  194.147.140.65
-194.147.140.75
-194.147.140.76
-194.147.140.80
-194.147.140.81
-194.147.140.82
  194.147.140.88
-194.147.140.92
-194.147.140.93
  194.147.140.94
-194.147.140.96
-194.147.140.97
-194.147.140.98
+194.147.34.66
  194.147.34.74
  194.147.35.224
  194.15.36.10
@@ -41091,6 +49508,7 @@
  194.15.36.183
  194.15.36.19
  194.15.36.212
+194.15.36.228
  194.15.36.240
  194.15.36.242
  194.15.36.245
@@ -41107,8 +49525,74 @@
  194.15.36.78
  194.15.36.96
  194.15.36.97
+194.150.118.7
+194.150.214.114
+194.150.214.119
+194.150.214.120
+194.150.214.122
+194.150.214.133
+194.150.214.135
+194.150.214.136
+194.150.214.138
+194.150.214.142
+194.150.215.101
+194.150.215.108
+194.150.215.109
+194.150.215.115
+194.150.215.116
+194.150.215.117
+194.150.215.124
+194.150.215.125
+194.150.215.130
+194.150.215.131
+194.150.215.132
+194.150.215.133
+194.150.215.135
+194.150.215.152
+194.150.215.177
+194.150.215.34
+194.150.215.35
+194.150.215.40
+194.150.215.41
+194.150.215.45
+194.150.215.56
+194.150.215.60
+194.150.215.67
+194.150.215.70
+194.150.215.97
+194.150.215.99
+194.150.235.150
+194.150.235.165
+194.150.235.171
+194.150.235.173
+194.150.235.180
+194.150.235.182
+194.150.235.184
+194.150.235.187
+194.150.235.188
+194.150.235.189
+194.150.235.224
+194.150.235.225
+194.150.235.228
+194.150.235.229
+194.150.235.237
+194.150.235.238
+194.150.235.241
+194.150.235.243
+194.150.235.247
+194.150.235.249
+194.150.235.250
+194.150.235.82
+194.150.235.85
  194.150.253.204
  194.150.255.200
+194.152.206.103
+194.152.206.17
+194.152.206.47
+194.152.206.93
+194.152.214.213
+194.152.214.252
+194.152.220.157
  194.154.148.69
  194.156.123.30
  194.156.123.56
@@ -41125,11 +49609,14 @@
  194.156.95.245
  194.156.97.183
  194.156.97.193
+194.158.201.236
+194.158.208.75
  194.158.210.79
  194.158.216.104
  194.160.76.5
  194.166.147.195
  194.166.33.176
+194.170.156.9
  194.176.118.175
  194.179.99.145
  194.18.111.54
@@ -41155,8 +49642,11 @@
  194.182.72.214
  194.183.15.230
  194.183.170.59
+194.183.174.14
  194.183.244.147
+194.186.138.214
  194.186.168.50
+194.186.187.70
  194.186.234.162
  194.186.249.22
  194.187.110.38
@@ -41188,14 +49678,18 @@
  194.187.249.56
  194.187.249.76
  194.187.251.150
+194.190.143.48
  194.190.67.75
  194.190.93.136
  194.190.96.114
+194.201.253.190
  194.201.253.5
+194.204.194.11
  194.206.36.150
  194.208.43.43
  194.213.43.166
  194.219.62.23
+194.225.58.214
  194.226.61.18
  194.226.61.26
  194.228.129.189
@@ -41207,7 +49701,6 @@
  194.250.91.157
  194.254.163.71
  194.26.180.142
-194.26.25.108
  194.26.25.147
  194.26.29.152
  194.27.68.207
@@ -41215,6 +49708,7 @@
  194.28.222.1
  194.28.223.242
  194.31.168.253
+194.31.54.3
  194.32.229.12
  194.32.229.123
  194.32.237.152
@@ -41224,7 +49718,11 @@
  194.34.248.155
  194.35.113.156
  194.35.12.125
+194.35.233.43
  194.35.248.23
+194.36.167.122
+194.36.167.37
+194.36.169.51
  194.36.188.112
  194.36.188.12
  194.36.189.177
@@ -41245,34 +49743,46 @@
  194.38.146.73
  194.39.127.40
  194.4.58.192
+194.4.58.215
  194.42.16.25
  194.44.146.181
  194.44.172.254
  194.44.20.22
+194.44.20.28
  194.44.230.115
  194.44.230.122
  194.44.230.135
  194.44.243.186
  194.44.244.187
+194.44.29.226
  194.44.61.82
  194.44.77.226
  194.44.86.243
  194.44.94.103
+194.44.96.4
  194.48.152.60
  194.49.60.74
  194.5.159.197
+194.5.176.112
  194.5.177.111
+194.5.177.174
+194.5.177.98
+194.5.178.148
  194.5.193.13
  194.5.195.70
  194.5.79.166
  194.5.96.60
+194.53.177.142
  194.54.160.248
  194.58.182.73
  194.58.32.79
+194.58.98.196
  194.59.204.187
  194.59.246.232
  194.59.250.145
  194.6.200.222
+194.6.233.138
+194.6.251.175
  194.60.236.56
  194.60.239.80
  194.61.24.102
@@ -41282,6 +49792,7 @@
  194.61.54.51
  194.61.9.144
  194.62.1.123
+194.62.6.156
  194.62.6.190
  194.62.6.90
  194.63.143.79
@@ -41295,7 +49806,9 @@
  194.71.130.93
  194.72.112.130
  194.79.157.171
+194.79.20.247
  194.79.60.106
+194.79.62.217
  194.8.136.62
  194.8.146.167
  194.84.0.85
@@ -41344,6 +49857,7 @@
  194.90.160.133
  194.90.73.231
  194.99.20.29
+195.101.67.42
  195.103.51.22
  195.110.147.194
  195.110.35.115
@@ -41353,6 +49867,7 @@
  195.112.252.180
  195.112.64.53
  195.114.121.46
+195.114.19.59
  195.114.9.19
  195.117.107.182
  195.117.107.190
@@ -41360,6 +49875,7 @@
  195.117.56.56
  195.12.49.210
  195.120.185.218
+195.122.226.164
  195.123.188.186
  195.123.209.106
  195.123.212.86
@@ -41374,9 +49890,11 @@
  195.128.118.44
  195.128.119.233
  195.128.119.244
+195.128.126.36
  195.128.174.132
  195.13.201.98
  195.130.152.71
+195.130.197.37
  195.130.73.229
  195.133.197.78
  195.133.220.18
@@ -41389,18 +49907,25 @@
  195.138.73.54
  195.138.83.218
  195.138.90.121
+195.138.91.220
  195.138.92.152
  195.138.95.113
  195.14.0.12
+195.140.213.34
  195.140.232.216
+195.141.179.119
+195.141.234.38
  195.142.222.154
+195.144.205.25
  195.144.21.161
  195.144.21.219
+195.144.21.56
  195.144.219.155
  195.146.133.84
  195.146.37.19
  195.146.50.252
  195.146.81.144
+195.147.15.176
  195.151.45.246
  195.154.102.122
  195.154.102.211
@@ -41411,6 +49936,7 @@
  195.154.112.155
  195.154.113.90
  195.154.114.115
+195.154.114.117
  195.154.134.100
  195.154.150.150
  195.154.163.75
@@ -41418,9 +49944,11 @@
  195.154.166.219
  195.154.168.155
  195.154.168.82
+195.154.169.168
  195.154.17.225
  195.154.171.54
  195.154.173.28
+195.154.174.88
  195.154.177.139
  195.154.179.3
  195.154.181.15
@@ -41429,10 +49957,12 @@
  195.154.182.201
  195.154.183.114
  195.154.183.162
+195.154.184.174
  195.154.185.20
  195.154.187.115
  195.154.187.6
  195.154.188.9
+195.154.191.12
  195.154.191.64
  195.154.191.97
  195.154.194.111
@@ -41466,16 +49996,22 @@
  195.154.242.89
  195.154.250.133
  195.154.251.131
+195.154.251.15
  195.154.251.86
  195.154.255.110
  195.154.29.215
  195.154.33.70
+195.154.40.254
  195.154.41.150
+195.154.42.133
  195.154.42.43
  195.154.43.1
  195.154.43.44
  195.154.45.133
+195.154.49.222
+195.154.49.84
  195.154.50.29
+195.154.50.81
  195.154.54.229
  195.154.60.148
  195.154.61.206
@@ -41487,6 +50023,8 @@
  195.158.109.248
  195.158.248.44
  195.158.26.238
+195.158.28.62
+195.158.5.11
  195.158.8.206
  195.159.180.19
  195.159.28.229
@@ -41496,7 +50034,6 @@
  195.161.114.175
  195.161.114.23
  195.161.114.231
-195.161.162.46
  195.161.2.66
  195.162.4.15
  195.162.4.5
@@ -41516,6 +50053,7 @@
  195.178.56.33
  195.18.224.6
  195.18.33.130
+195.181.128.156
  195.181.170.225
  195.181.170.226
  195.181.170.69
@@ -41523,13 +50061,16 @@
  195.181.172.78
  195.181.175.106
  195.181.215.65
+195.181.37.52
  195.182.131.101
  195.182.152.238
  195.186.64.163
  195.186.81.204
  195.189.227.48
  195.189.71.187
+195.19.102.173
  195.19.36.84
+195.19.96.236
  195.19.99.83
  195.190.123.236
  195.190.166.35
@@ -41553,11 +50094,15 @@
  195.201.171.162
  195.201.202.225
  195.201.217.17
+195.201.22.197
+195.201.22.232
  195.201.236.56
  195.201.236.61
  195.201.236.64
  195.201.24.22
  195.201.240.107
+195.201.25.135
+195.201.25.183
  195.201.56.56
  195.201.56.70
  195.201.71.60
@@ -41568,18 +50113,26 @@
  195.202.169.149
  195.204.173.39
  195.205.173.1
+195.205.179.251
+195.205.179.73
  195.206.105.217
  195.206.105.27
  195.206.105.42
  195.206.106.73
  195.206.107.147
+195.206.169.184
+195.206.183.122
  195.206.34.215
  195.206.36.25
  195.206.55.154
  195.207.15.79
+195.208.17.70
+195.208.170.75
  195.209.131.19
  195.209.236.77
+195.21.141.52
  195.210.172.43
+195.210.172.44
  195.210.172.46
  195.211.1.114
  195.211.154.177
@@ -41593,6 +50146,7 @@
  195.211.30.115
  195.211.84.104
  195.214.214.253
+195.214.223.84
  195.214.252.110
  195.214.253.108
  195.216.155.103
@@ -41617,6 +50171,8 @@
  195.222.44.54
  195.223.211.242
  195.223.215.190
+195.223.86.254
+195.224.138.61
  195.224.39.199
  195.225.168.186
  195.225.48.113
@@ -41626,8 +50182,11 @@
  195.225.49.131
  195.225.49.134
  195.225.49.136
+195.226.207.109
  195.226.227.73
  195.228.133.203
+195.228.148.10
+195.228.171.245
  195.228.45.47
  195.228.65.108
  195.228.75.149
@@ -41638,6 +50197,7 @@
  195.230.141.68
  195.230.154.2
  195.231.8.43
+195.231.81.208
  195.231.82.44
  195.234.171.80
  195.234.215.26
@@ -41647,11 +50207,17 @@
  195.238.71.52
  195.239.115.106
  195.239.178.110
+195.239.183.214
+195.239.183.246
  195.239.185.251
+195.239.235.134
+195.239.243.84
  195.239.248.205
  195.239.26.38
  195.239.48.166
  195.239.7.18
+195.239.91.210
+195.24.129.234
  195.24.207.199
  195.24.49.142
  195.24.61.7
@@ -41690,8 +50256,13 @@
  195.254.135.76
  195.28.56.56
  195.29.102.29
+195.29.102.42
  195.29.106.2
  195.29.155.98
+195.29.51.133
+195.29.51.134
+195.29.51.135
+195.29.51.136
  195.29.51.137
  195.3.144.125
  195.3.144.84
@@ -41699,12 +50270,14 @@
  195.3.144.92
  195.3.195.8
  195.32.106.250
+195.33.206.179
  195.33.206.195
  195.33.246.1
  195.34.221.33
  195.34.221.81
  195.34.242.131
  195.34.78.110
+195.36.209.249
  195.37.209.9
  195.38.35.58
  195.38.98.224
@@ -41720,7 +50293,7 @@
  195.53.165.150
  195.53.237.122
  195.53.49.11
-195.54.160.155
+195.54.160.134
  195.54.160.20
  195.54.161.122
  195.54.162.38
@@ -41736,8 +50309,10 @@
  195.58.38.146
  195.60.174.123
  195.60.190.235
+195.62.16.111
  195.62.32.188
  195.62.32.218
+195.62.46.153
  195.62.53.253
  195.67.139.54
  195.69.135.78
@@ -41749,6 +50324,7 @@
  195.7.9.141
  195.7.9.186
  195.70.32.203
+195.70.60.100
  195.78.112.235
  195.78.94.193
  195.8.105.201
@@ -41757,6 +50333,7 @@
  195.81.112.162
  195.81.20.71
  195.81.35.186
+195.81.54.192
  195.81.66.65
  195.82.116.230
  195.83.197.222
@@ -41771,11 +50348,14 @@
  195.88.152.77
  195.88.184.186
  195.88.208.35
+195.88.209.156
  195.88.4.18
  195.9.114.222
  195.9.192.52
  195.9.209.10
+195.9.225.238
  195.9.61.22
+195.9.68.154
  195.9.80.22
  195.9.89.66
  195.9.89.68
@@ -41795,12 +50375,20 @@
  196.0.111.194
  196.0.113.10
  196.0.34.142
+196.0.58.214
+196.1.238.130
+196.1.238.2
+196.1.238.58
+196.1.250.74
  196.11.80.154
  196.112.9.69
  196.12.186.34
+196.121.47.134
  196.14.130.164
  196.15.133.177
  196.15.168.146
+196.15.211.91
+196.15.211.92
  196.15.247.77
  196.15.249.151
  196.16.1.193
@@ -41813,6 +50401,8 @@
  196.17.163.208
  196.17.236.20
  196.17.240.15
+196.179.227.47
+196.179.232.49
  196.18.157.252
  196.18.225.232
  196.18.225.43
@@ -41823,12 +50413,16 @@
  196.183.230.199
  196.184.35.117
  196.188.73.98
+196.189.91.162
  196.189.91.166
  196.19.244.53
  196.19.244.83
  196.192.181.235
  196.196.112.3
+196.196.116.69
+196.196.116.95
  196.196.117.102
+196.196.117.122
  196.196.147.155
  196.196.147.167
  196.196.147.171
@@ -41857,6 +50451,7 @@
  196.196.198.109
  196.196.198.176
  196.196.198.182
+196.196.203.20
  196.196.216.138
  196.196.216.151
  196.196.216.170
@@ -41888,20 +50483,30 @@
  196.199.122.55
  196.199.122.7
  196.2.13.12
+196.20.171.13
  196.20.68.81
  196.200.181.2
+196.200.39.184
+196.201.224.30
+196.202.152.18
  196.202.202.197
  196.202.220.95
  196.203.182.166
  196.203.219.138
+196.203.251.14
+196.204.230.226
+196.206.227.105
  196.206.83.31
  196.206.87.210
+196.207.176.215
  196.207.184.14
  196.207.205.84
  196.213.65.166
  196.215.192.62
  196.216.220.196
  196.216.220.204
+196.216.73.90
+196.217.100.123
  196.218.180.49
  196.218.23.67
  196.219.79.182
@@ -41921,6 +50526,7 @@
  196.223.161.150
  196.223.234.136
  196.23.22.27
+196.235.88.45
  196.240.104.104
  196.240.105.190
  196.240.105.246
@@ -42005,6 +50611,8 @@
  196.242.200.66
  196.242.21.105
  196.242.21.220
+196.242.244.235
+196.242.244.239
  196.242.3.115
  196.242.3.153
  196.242.3.163
@@ -42056,23 +50664,29 @@
  196.247.5.129
  196.247.5.163
  196.25.237.218
+196.25.67.186
  196.25.94.134
-196.250.150.244
  196.250.39.65
  196.27.106.112
  196.27.107.173
  196.27.107.231
  196.27.127.170
  196.27.127.58
+196.27.127.61
  196.28.226.33
  196.28.234.66
  196.3.100.45
  196.3.171.138
  196.3.171.145
+196.3.192.125
+196.3.193.70
  196.3.97.34
  196.3.97.70
  196.3.99.197
  196.3.99.210
+196.30.31.59
+196.35.41.109
+196.37.111.217
  196.38.150.104
  196.38.70.24
  196.40.97.14
@@ -42081,11 +50695,19 @@
  196.41.130.159
  196.41.17.62
  196.41.2.166
+196.43.169.12
  196.44.10.207
  196.44.176.55
+196.44.182.183
+196.46.202.238
+196.46.202.68
  196.46.39.53
+196.47.67.180
+196.49.1.16
+196.49.1.5
  196.49.1.6
  196.50.196.82
+196.50.247.254
  196.52.10.12
  196.52.10.29
  196.52.10.7
@@ -42097,28 +50719,43 @@
  196.6.112.70
  196.6.232.32
  196.64.126.227
+196.65.248.216
+196.70.252.2
+196.70.33.28
  196.71.250.48
  196.74.122.57
+196.75.122.152
+196.75.80.170
+196.77.8.223
  196.89.211.129
+196.92.5.195
  19618-dot-n-e-w-me-ss-age-po-rt-al.wl.r.appspot.com
  197.1.100.46
  197.1.142.52
  197.1.6.184
  197.1.94.79
  197.115.19.200
+197.115.33.95
  197.13.2.215
  197.136.142.5
  197.14.199.24
  197.14.216.207
+197.14.22.63
  197.14.82.93
  197.149.128.25
  197.149.148.110
  197.153.160.42
+197.153.75.189
+197.153.79.154
+197.155.137.129
  197.155.193.115
  197.155.194.194
  197.155.6.43
+197.156.139.69
  197.156.234.164
  197.156.65.138
+197.156.77.45
+197.156.97.73
  197.157.17.86
  197.157.219.168
  197.157.219.169
@@ -42129,9 +50766,17 @@
  197.159.12.167
  197.159.23.174
  197.159.3.35
+197.182.94.162
+197.185.103.229
+197.185.104.41
+197.185.97.226
+197.188.150.11
+197.188.165.176
  197.2.143.125
  197.2.148.6
  197.206.139.101
+197.207.168.30
+197.210.10.19
  197.210.114.50
  197.210.114.58
  197.210.117.38
@@ -42170,11 +50815,16 @@
  197.231.198.172
  197.231.202.106
  197.231.221.211
+197.232.115.197
+197.232.18.249
  197.232.21.22
+197.232.26.137
  197.232.36.108
+197.232.36.64
  197.232.41.216
  197.232.47.102
  197.232.55.224
+197.232.61.209
  197.232.76.135
  197.232.88.167
  197.234.13.13
@@ -42214,8 +50864,13 @@
  197.234.13.94
  197.234.13.96
  197.234.179.102
+197.234.221.31
+197.234.247.203
  197.234.35.82
  197.234.48.242
+197.237.137.20
+197.237.151.38
+197.237.18.14
  197.237.90.67
  197.240.209.56
  197.240.76.29
@@ -42225,6 +50880,7 @@
  197.242.203.246
  197.242.205.65
  197.242.206.64
+197.245.154.235
  197.245.230.122
  197.245.25.228
  197.245.30.24
@@ -42234,7 +50890,11 @@
  197.248.136.250
  197.248.184.157
  197.248.190.170
+197.248.2.229
+197.248.236.134
+197.25.164.13
  197.250.8.162
+197.251.193.152
  197.254.115.162
  197.254.29.22
  197.254.38.250
@@ -42255,26 +50915,40 @@
  197.39.210.11
  197.40.158.14
  197.40.196.212
+197.41.222.184
  197.45.163.117
  197.45.47.140
+197.5.145.102
+197.5.145.106
+197.5.145.112
  197.5.145.116
+197.5.145.12
  197.5.145.27
  197.5.145.30
+197.5.145.68
+197.5.145.69
  197.5.145.75
  197.5.145.88
+197.5.145.93
  197.51.182.118
  197.51.184.22
  197.51.225.43
  197.52.30.33
  197.52.93.117
  197.53.218.213
+197.55.8.93
+197.57.61.13
  197.59.31.230
  197.81.132.193
  197.81.192.73
+197.82.208.133
+197.83.228.25
  197.83.238.2
  197.85.185.156
  197.88.32.60
  197.89.103.103
+197.89.166.124
+197.89.35.201
  197.89.38.191
  197.89.73.107
  197.89.73.157
@@ -42297,10 +50971,12 @@
  198.100.146.132
  198.100.146.191
  198.100.146.22
+198.100.146.67
  198.100.146.76
  198.100.147.36
  198.100.148.81
  198.100.149.153
+198.100.153.228
  198.100.155.37
  198.100.158.202
  198.100.159.54
@@ -42316,7 +50992,13 @@
  198.12.123.154
  198.12.125.228
  198.12.125.237
+198.12.224.76
+198.12.225.100
  198.12.227.90
+198.12.229.101
+198.12.248.100
+198.12.249.249
+198.12.250.116
  198.12.250.187
  198.12.64.100
  198.12.64.118
@@ -42335,6 +51017,8 @@
  198.12.80.166
  198.12.80.175
  198.12.83.181
+198.12.84.18
+198.12.84.221
  198.12.87.153
  198.12.97.66
  198.13.33.52
@@ -42345,6 +51029,7 @@
  198.13.57.8
  198.13.61.18
  198.133.139.5
+198.136.62.152
  198.137.202.175
  198.143.115.198
  198.143.185.202
@@ -42416,7 +51101,9 @@
  198.199.65.87
  198.199.65.93
  198.199.66.10
+198.199.66.196
  198.199.67.168
+198.199.68.76
  198.199.69.181
  198.199.69.192
  198.199.70.131
@@ -42432,14 +51119,17 @@
  198.199.83.17
  198.199.83.58
  198.199.85.178
+198.199.89.152
  198.199.89.155
  198.199.89.226
  198.199.91.213
  198.199.91.215
  198.199.91.6
+198.199.92.41
  198.199.94.96
  198.199.95.124
  198.199.96.229
+198.199.97.218
  198.199.97.78
  198.199.98.100
  198.2.193.227
@@ -42491,7 +51181,6 @@
  198.204.235.28
  198.204.238.194
  198.204.240.227
-198.204.240.90
  198.204.244.90
  198.204.245.202
  198.204.248.226
@@ -42506,15 +51195,20 @@
  198.204.253.50
  198.204.253.51
  198.206.243.23
+198.21.1.157
  198.211.100.174
  198.211.102.110
  198.211.102.227
  198.211.104.28
  198.211.105.114
+198.211.107.224
  198.211.109.14
+198.211.110.186
  198.211.110.89
  198.211.113.207
  198.211.114.136
+198.211.115.226
+198.211.116.13
  198.211.116.68
  198.211.117.96
  198.211.120.41
@@ -42537,12 +51231,14 @@
  198.211.98.165
  198.211.98.90
  198.211.99.227
+198.211.99.24
  198.211.99.79
  198.23.137.142
  198.23.145.200
  198.23.145.205
  198.23.145.208
  198.23.145.82
+198.23.148.137
  198.23.167.27
  198.23.172.146
  198.23.172.148
@@ -42568,6 +51264,7 @@
  198.23.176.210
  198.23.177.47
  198.23.182.246
+198.23.188.74
  198.23.197.47
  198.23.197.52
  198.23.197.57
@@ -42579,6 +51276,7 @@
  198.23.206.134
  198.23.207.238
  198.23.212.138
+198.23.212.27
  198.23.213.30
  198.23.213.57
  198.23.217.200
@@ -42606,7 +51304,9 @@
  198.245.49.14
  198.245.49.215
  198.245.49.22
+198.245.50.81
  198.245.51.20
+198.245.53.163
  198.245.60.109
  198.245.60.212
  198.245.60.28
@@ -42623,15 +51323,20 @@
  198.245.76.247
  198.245.76.249
  198.251.117.82
+198.251.77.254
+198.251.80.157
+198.251.80.213
  198.251.83.193
  198.251.83.248
  198.251.84.216
+198.251.84.74
  198.251.89.80
  198.252.110.55
  198.255.92.170
  198.27.108.198
  198.27.123.127
  198.27.66.144
+198.27.66.37
  198.27.68.223
  198.27.68.80
  198.27.70.45
@@ -42639,13 +51344,17 @@
  198.27.79.180
  198.27.80.123
  198.27.80.144
+198.27.80.212
  198.27.80.38
  198.27.81.24
  198.27.81.94
+198.27.82.155
  198.27.83.13
  198.27.83.210
  198.27.83.216
  198.27.87.203
+198.27.90.106
+198.35.47.13
  198.38.82.127
  198.38.92.65
  198.41.85.5
@@ -42704,8 +51413,10 @@
  198.50.163.192
  198.50.163.90
  198.50.164.161
+198.50.171.216
  198.50.176.147
  198.50.176.72
+198.50.177.42
  198.50.177.44
  198.50.179.97
  198.50.180.172
@@ -42718,6 +51429,8 @@
  198.50.186.212
  198.50.189.124
  198.50.192.36
+198.50.212.208
+198.50.212.209
  198.50.222.102
  198.50.224.232
  198.50.234.102
@@ -42725,6 +51438,7 @@
  198.50.234.107
  198.50.234.111
  198.50.240.58
+198.50.245.218
  198.50.251.198
  198.52.100.36
  198.52.119.103
@@ -42738,12 +51452,15 @@
  198.54.123.68
  198.54.128.108
  198.54.128.68
+198.55.103.156
  198.55.107.164
  198.55.109.115
  198.55.109.130
  198.55.109.72
  198.55.109.96
+198.55.96.241
  198.57.168.206
+198.57.200.100
  198.57.203.63
  198.57.209.229
  198.57.247.135
@@ -42777,31 +51494,54 @@
  198.71.231.31
  198.71.231.35
  198.71.231.4
+198.71.231.76
+198.71.234.40
+198.71.235.21
  198.71.235.50
  198.71.235.70
+198.71.236.11
  198.71.236.12
  198.71.236.25
  198.71.236.32
  198.71.236.46
  198.71.237.24
  198.71.237.9
+198.71.238.12
+198.71.238.15
  198.71.238.16
  198.71.238.17
  198.71.238.18
  198.71.238.19
+198.71.238.20
  198.71.238.21
+198.71.238.22
  198.71.238.3
+198.71.238.4
+198.71.238.6
+198.71.238.7
  198.71.238.8
  198.71.238.9
+198.71.239.13
  198.71.239.14
  198.71.239.17
+198.71.239.19
  198.71.239.20
+198.71.239.26
+198.71.239.30
+198.71.239.34
+198.71.239.36
  198.71.239.38
  198.71.239.39
+198.71.239.40
  198.71.239.41
+198.71.239.44
+198.71.239.46
+198.71.239.6
+198.71.239.7
  198.71.240.42
  198.71.241.14
  198.71.241.40
+198.71.50.212
  198.71.58.92
  198.71.60.177
  198.71.63.95
@@ -42824,6 +51564,7 @@
  198.96.95.65
  198.98.48.175
  198.98.48.77
+198.98.49.134
  198.98.49.178
  198.98.49.187
  198.98.50.112
@@ -42892,6 +51633,7 @@
  199.167.138.22
  199.168.100.74
  199.168.102.13
+199.168.138.203
  199.168.139.173
  199.168.143.102
  199.168.143.58
@@ -42922,15 +51664,18 @@
  199.19.213.228
  199.19.224.253
  199.19.224.46
+199.19.224.51
  199.19.225.16
  199.19.225.212
  199.19.226.170
  199.19.226.67
  199.19.75.198
+199.19.76.101
  199.192.18.146
  199.192.18.162
  199.192.19.76
  199.192.20.201
+199.192.211.30
  199.192.228.77
  199.192.24.69
  199.192.25.207
@@ -42948,9 +51693,11 @@
  199.195.250.170
  199.195.250.61
  199.195.250.77
+199.195.251.227
  199.195.251.32
  199.195.251.84
  199.195.252.137
+199.195.252.176
  199.195.252.230
  199.195.253.25
  199.195.253.26
@@ -42973,12 +51720,14 @@
  199.223.236.90
  199.229.250.50
  199.229.250.94
+199.231.166.82
  199.231.185.79
  199.231.188.237
  199.231.189.251
  199.231.189.99
  199.233.246.195
  199.241.145.219
+199.246.25.93
  199.247.15.234
  199.247.18.38
  199.247.18.42
@@ -43081,13 +51830,17 @@
  199.34.87.81
  199.34.90.43
  199.4.18.206
+199.47.54.200
  199.48.147.141
+199.48.225.58
  199.48.92.184
  199.58.86.206
  199.58.86.209
  199.58.86.211
+199.66.90.63
  199.68.196.66
  199.76.13.106
+199.76.38.123
  199.79.62.115
  199.79.62.144
  199.83.200.208
@@ -43180,7 +51933,6 @@
  1checkapp.000webhostapp.com
  1choicepizzacurry.com
  1cibc.com
-1cigv.app.link
  1claimdiamond.000webhostapp.com
  1clbc-set1acc.com
  1clogin9capital.one
@@ -43369,6 +52121,7 @@
  2.132.91.60
  2.133.189.92
  2.133.61.161
+2.136.116.101
  2.136.95.251
  2.137.162.255
  2.137.233.117
@@ -43387,21 +52140,29 @@
  2.15.159.201
  2.152.78.124
  2.153.80.222
+2.154.110.116
  2.154.20.238
+2.176.153.143
+2.177.157.211
  2.178.255.157
  2.179.167.112
  2.180.29.55
  2.183.8.121
  2.183.9.187
  2.196.193.181
+2.20.49.50
  2.200.165.88
  2.200.83.134
  2.201.135.143
  2.201.42.176
+2.204.71.195
  2.205.169.96
+2.205.22.78
  2.206.153.205
+2.206.193.188
  2.217.44.77
  2.217.45.18
+2.223.239.114
  2.224.246.80
  2.225.249.9
  2.228.87.194
@@ -43413,12 +52174,17 @@
  2.230.199.35
  2.232.248.6
  2.232.250.91
+2.233.125.227
  2.233.236.201
  2.233.76.23
  2.234.122.191
  2.237.76.249
  2.238.115.47
+2.238.147.10
  2.238.18.160
+2.247.244.230
+2.247.249.229
+2.247.249.34
  2.25.93.113
  2.26.38.161
  2.27.217.164
@@ -43426,27 +52192,34 @@
  2.30.116.253
  2.30.234.171
  2.32.38.166
+2.32.92.118
  2.34.230.209
  2.35.41.59
  2.36.67.194
  2.37.111.40
  2.37.145.113
+2.37.22.242
  2.38.152.84
  2.38.2.58
  2.38.99.79
  2.39.173.126
+2.4.78.202
  2.42.112.242
  2.42.173.240
  2.42.62.17
+2.44.166.148
  2.44.83.70
  2.45.185.2
  2.45.191.223
  2.47.112.152
  2.49.23.89
  2.4buyuklergazete.com
+2.50.134.11
  2.50.159.186
+2.50.19.133
  2.50.223.242
  2.51.26.64
+2.55.89.193
  2.56.101.149
  2.56.102.177
  2.56.102.57
@@ -43463,8 +52236,14 @@
  2.57.122.167
  2.57.122.186
  2.57.122.196
+2.57.122.20
  2.57.122.202
+2.57.122.21
  2.57.122.223
+2.57.122.23
+2.57.122.26
+2.57.122.31
+2.57.122.9
  2.57.19.137
  2.58.12.128
  2.58.12.151
@@ -43480,17 +52259,28 @@
  2.58.16.86
  2.58.16.88
  2.58.16.89
+2.58.46.202
  2.59.21.200
  2.59.23.102
  2.6.185.246
  2.7.248.51
  2.80.112.146
+2.80.67.235
+2.82.167.249
+2.82.170.124
  2.82.75.215
+2.82.84.56
  2.84.232.100
  2.89.82.192
+2.89.87.54
+2.90.235.91
+2.90.255.190
+2.90.68.10
  2.92.39.39
  2.92.51.124
  2.94.17.97
+2.94.244.220
+2.95.250.114
  2.95.55.65
  2.96.22.155
  2.96.36.182
@@ -43504,17 +52294,28 @@
  20-31-102-75.com
  20-groups.cf
  20.151.19.163
+20.151.2.8
  20.184.15.116
  20.185.193.185
  20.185.247.149
  20.185.39.51
+20.185.67.88
+20.185.71.208
+20.185.82.14
  20.186.110.157
  20.186.32.122
  20.186.72.33
+20.188.107.54
  20.188.108.164
  20.188.60.188
+20.191.119.145
  20.194.200.87
+20.194.50.237
+20.195.50.97
  20.197.92.22
+20.198.136.200
+20.198.178.215
+20.199.24.203
  20.36.46.115
  20.37.50.97
  20.39.190.208
@@ -43528,32 +52329,51 @@
  20.43.39.32
  20.43.59.45
  20.43.60.99
+20.46.114.59
  20.46.224.110
+20.46.225.105
+20.46.250.169
+20.48.0.101
+20.48.104.18
  20.49.178.57
  20.49.186.22
  20.4buyuklergazete.com
  20.50.114.95
+20.51.200.190
  20.52.133.134
  20.52.152.124
  20.52.157.170
  20.52.237.102
+20.53.160.120
+20.55.21.29
+20.55.48.1
  20.55.74.2
  20.57.10.194
+20.57.168.34
+20.58.32.226
  20.62.200.252
  20.62.40.13
+20.63.72.228
+20.64.0.165
+20.64.157.95
  20.65.160.35
  20.72.208.156
+20.77.24.137
  20.79.40.254
  20.80.171.99
  20.80.242.73
  20.81.225.98
+20.84.80.78
  200-365.net
  200.0.118.29
  200.0.46.50
  200.10.37.12
  200.10.37.138
  200.10.85.251
+200.10.96.157
+200.100.203.219
  200.100.80.161
+200.101.209.240
  200.101.66.170
  200.102.104.30
  200.103.16.43
@@ -43561,16 +52381,21 @@
  200.104.147.51
  200.105.157.218
  200.105.179.250
+200.105.183.118
+200.105.194.242
  200.105.201.198
  200.105.209.170
+200.105.212.96
  200.105.242.58
+200.105.248.182
  200.105.74.140
  200.106.147.35
-200.107.119.130
-200.107.119.132
  200.107.12.194
  200.107.253.130
  200.107.253.138
+200.107.62.10
+200.108.135.82
+200.108.139.242
  200.108.143.6
  200.108.196.108
  200.108.196.110
@@ -43583,6 +52408,7 @@
  200.110.187.74
  200.110.188.187
  200.110.188.188
+200.111.120.180
  200.111.167.170
  200.111.182.6
  200.111.232.234
@@ -43592,7 +52418,9 @@
  200.115.157.211
  200.115.48.82
  200.115.53.225
+200.116.110.25
  200.116.145.225
+200.116.195.124
  200.116.198.140
  200.116.198.160
  200.116.198.177
@@ -43606,11 +52434,13 @@
  200.119.40.13
  200.119.85.93
  200.120.188.167
+200.121.154.187
  200.121.169.156
  200.122.128.162
  200.122.181.2
  200.122.202.107
  200.122.226.154
+200.122.249.203
  200.123.101.90
  200.123.150.89
  200.123.2.171
@@ -43627,14 +52457,20 @@
  200.127.1.233
  200.127.14.97
  200.128.62.2
+200.129.82.10
  200.13.160.125
  200.13.253.154
+200.133.38.233
+200.133.39.84
  200.135.228.230
+200.137.5.195
  200.14.234.180
  200.141.100.54
+200.141.166.170
  200.141.248.186
  200.142.120.234
  200.142.120.90
+200.142.124.30
  200.144.94.24
  200.146.227.146
  200.146.229.129
@@ -43649,11 +52485,13 @@
  200.149.232.242
  200.149.244.202
  200.150.114.227
+200.150.121.212
  200.150.77.238
  200.150.86.130
  200.150.86.138
  200.152.49.163
  200.152.78.48
+200.155.188.173
  200.155.57.213
  200.158.124.146
  200.159.105.20
@@ -43662,13 +52500,19 @@
  200.162.128.211
  200.162.171.247
  200.163.38.163
+200.164.133.114
  200.165.165.6
  200.165.79.34
  200.167.191.101
  200.169.218.172
  200.17.13.3
+200.170.127.133
+200.170.160.246
  200.174.158.26
+200.174.29.2
+200.175.104.103
  200.175.172.189
+200.175.180.116
  200.175.239.226
  200.178.251.146
  200.18.248.196
@@ -43684,6 +52528,7 @@
  200.195.156.242
  200.195.55.186
  200.195.85.142
+200.196.249.170
  200.198.46.15
  200.199.114.226
  200.199.38.234
@@ -43691,15 +52536,22 @@
  200.199.8.114
  200.199.8.116
  200.199.8.118
+200.2.182.114
  200.20.186.254
+200.201.155.2
  200.201.180.130
+200.202.216.74
  200.203.104.18
  200.203.123.32
  200.203.123.34
  200.203.126.15
  200.203.239.188
  200.204.150.216
+200.204.174.163
+200.204.190.244
+200.205.134.107
  200.206.63.34
+200.206.81.154
  200.207.169.7
  200.21.51.38
  200.212.2.125
@@ -43709,10 +52561,14 @@
  200.212.2.88
  200.212.2.94
  200.215.171.238
+200.216.30.196
+200.216.31.148
  200.216.77.154
  200.217.168.98
  200.217.191.130
  200.218.255.242
+200.219.207.42
+200.219.222.25
  200.220.202.1
  200.222.29.10
  200.223.6.54
@@ -43725,8 +52581,12 @@
  200.229.90.211
  200.232.72.50
  200.233.136.249
+200.233.163.65
  200.233.186.57
+200.233.204.200
+200.233.204.47
  200.238.102.225
+200.24.138.2
  200.24.80.13
  200.24.80.2
  200.24.84.12
@@ -43751,17 +52611,22 @@
  200.27.18.138
  200.27.18.242
  200.27.212.22
+200.29.105.12
  200.29.109.112
+200.29.109.193
  200.29.111.71
  200.29.112.252
+200.29.120.94
  200.29.139.11
  200.29.176.174
  200.29.191.151
  200.29.248.57
  200.29.254.1
  200.29.90.110
+200.31.122.174
  200.31.16.164
  200.31.164.82
+200.31.19.206
  200.31.81.25
  200.31.99.35
  200.33.152.207
@@ -43783,6 +52648,8 @@
  200.41.121.69
  200.41.150.83
  200.41.182.243
+200.41.79.230
+200.41.86.59
  200.42.174.109
  200.44.158.226
  200.44.50.155
@@ -43790,9 +52657,11 @@
  200.45.187.90
  200.46.22.187
  200.46.235.146
+200.46.252.35
  200.48.129.124
  200.48.210.5
  200.48.37.67
+200.49.168.198
  200.49.34.50
  200.49.37.178
  200.5.203.58
@@ -43805,14 +52674,19 @@
  200.52.140.145
  200.52.140.148
  200.52.144.170
+200.52.147.93
  200.52.228.19
  200.52.228.26
+200.52.80.34
  200.53.216.153
  200.53.217.25
  200.54.108.54
+200.54.170.198
  200.54.183.234
  200.54.221.202
  200.54.247.98
+200.54.37.211
+200.54.51.124
  200.54.56.107
  200.54.56.108
  200.54.72.148
@@ -43821,13 +52695,18 @@
  200.55.208.196
  200.55.218.202
  200.55.243.138
+200.56.17.5
+200.56.58.221
  200.56.60.157
  200.57.102.71
  200.57.183.176
  200.57.8.74
+200.58.118.226
+200.58.118.26
  200.58.171.51
  200.58.83.144
  200.58.83.179
+200.59.41.132
  200.6.122.228
  200.6.168.86
  200.6.169.122
@@ -43844,22 +52723,33 @@
  200.60.97.194
  200.60.97.196
  200.61.185.200
+200.62.146.174
  200.62.96.66
+200.63.105.129
+200.66.117.246
+200.66.123.15
  200.66.68.145
+200.66.77.178
  200.68.13.26
+200.68.136.10
+200.68.136.159
+200.68.158.250
+200.68.187.92
  200.68.230.193
  200.68.230.197
+200.68.60.131
  200.68.8.77
  200.68.87.164
+200.69.141.210
  200.69.210.185
  200.69.224.73
-200.69.71.22
  200.69.77.34
  200.69.78.21
  200.69.78.22
  200.69.81.10
  200.69.81.198
  200.69.83.54
+200.69.85.13
  200.69.87.109
  200.7.102.76
  200.7.118.10
@@ -43870,6 +52760,7 @@
  200.7.252.118
  200.7.98.102
  200.70.22.77
+200.70.56.204
  200.71.122.54
  200.71.72.14
  200.71.72.201
@@ -43877,16 +52768,26 @@
  200.71.72.245
  200.71.73.222
  200.71.73.242
+200.73.113.217
+200.73.128.100
+200.73.128.148
  200.73.128.173
  200.73.128.175
+200.73.128.181
+200.73.128.183
  200.73.128.198
+200.73.128.252
  200.73.129.102
  200.73.129.128
  200.73.129.33
+200.73.129.37
+200.73.130.156
  200.73.130.187
+200.73.130.213
  200.73.130.226
  200.73.130.252
  200.73.131.100
+200.73.131.129
  200.73.131.239
  200.73.6.198
  200.74.243.12
@@ -43923,6 +52824,7 @@
  200.82.170.231
  200.83.202.237
  200.84.172.252
+200.84.56.105
  200.85.137.33
  200.85.137.34
  200.85.137.36
@@ -43940,10 +52842,14 @@
  200.85.95.234
  200.86.175.183
  200.87.180.226
+200.87.233.68
+200.87.73.51
+200.87.90.39
  200.89.114.58
  200.89.125.254
  200.89.125.94
  200.89.129.233
+200.89.159.190
  200.89.159.240
  200.89.174.105
  200.89.178.104
@@ -43955,6 +52861,8 @@
  200.89.99.226
  200.91.160.238
  200.91.192.60
+200.91.192.89
+200.92.226.50
  200.93.147.154
  200.93.148.14
  200.93.162.51
@@ -43967,6 +52875,7 @@
  200.98.1.251
  200.98.163.13
  200.98.2.2
+200.98.200.147
  200.98.200.78
  200.98.4.119
  200.98.4.163
@@ -43983,17 +52892,24 @@
  2009-ford-f150.xyz
  2009941992.z13.web.core.windows.net
  2009sanchezsupplicate.com
+201.103.130.28
  201.105.162.249
  201.105.209.194
+201.105.92.77
  201.105.98.239
  201.106.32.171
  201.108.204.88
  201.111.106.35
+201.111.143.168
  201.116.184.243
+201.116.194.210
  201.116.227.194
  201.116.52.104
  201.122.102.21
+201.122.212.15
  201.122.212.30
+201.123.172.44
+201.127.78.53
  201.128.204.26
  201.130.79.47
  201.131.126.17
@@ -44006,6 +52922,7 @@
  201.139.88.58
  201.139.90.117
  201.14.128.223
+201.140.10.243
  201.140.103.33
  201.140.123.130
  201.140.176.114
@@ -44013,24 +52930,33 @@
  201.141.53.87
  201.142.225.244
  201.143.224.27
+201.143.245.191
  201.143.32.82
+201.144.122.243
  201.144.206.244
  201.144.234.22
+201.144.51.200
  201.145.253.185
  201.147.144.89
  201.148.126.202
  201.148.126.38
  201.148.127.209
  201.148.127.57
+201.148.246.11
  201.148.71.65
  201.149.119.133
+201.149.20.161
  201.149.26.51
  201.149.44.237
+201.149.49.146
+201.149.49.162
  201.149.83.179
  201.15.121.73
+201.151.0.135
  201.151.6.30
  201.155.182.49
  201.155.192.248
+201.158.105.3
  201.158.106.71
  201.158.120.40
  201.159.112.70
@@ -44048,16 +52974,20 @@
  201.161.223.150
  201.161.37.93
  201.162.150.226
+201.162.197.124
+201.163.162.179
  201.163.180.183
  201.163.239.132
  201.163.74.202
  201.163.74.204
  201.163.98.162
  201.164.220.56
+201.165.215.183
  201.165.52.129
  201.166.149.154
  201.166.199.205
  201.167.56.18
+201.17.108.8
  201.17.130.156
  201.170.246.166
  201.171.150.41
@@ -44072,13 +53002,19 @@
  201.173.64.98
  201.173.74.158
  201.173.92.212
+201.174.110.126
  201.174.122.29
+201.174.225.130
  201.175.113.237
  201.175.17.129
  201.175.73.218
+201.178.196.79
+201.179.35.103
  201.18.13.154
  201.18.88.150
+201.180.235.57
  201.182.120.230
+201.182.181.39
  201.182.66.18
  201.182.88.10
  201.182.88.13
@@ -44098,6 +53034,7 @@
  201.184.175.90
  201.184.188.122
  201.184.237.42
+201.184.241.243
  201.184.242.26
  201.184.244.186
  201.184.75.210
@@ -44123,10 +53060,10 @@
  201.20.92.102
  201.20.99.46
  201.204.168.106
+201.204.43.38
  201.204.46.10
  201.207.53.62
  201.208.10.38
-201.208.98.227
  201.210.246.136
  201.211.31.45
  201.212.29.93
@@ -44138,6 +53075,7 @@
  201.216.222.155
  201.216.238.41
  201.217.143.51
+201.217.159.155
  201.217.195.226
  201.217.245.229
  201.217.39.23
@@ -44146,6 +53084,7 @@
  201.217.55.97
  201.217.71.122
  201.218.108.46
+201.218.215.106
  201.218.228.226
  201.218.237.98
  201.219.197.138
@@ -44159,6 +53098,7 @@
  201.221.133.86
  201.221.134.74
  201.222.48.42
+201.222.49.238
  201.222.55.238
  201.222.55.93
  201.222.57.21
@@ -44167,16 +53107,19 @@
  201.229.250.74
  201.230.178.154
  201.230.29.84
+201.231.60.38
  201.232.239.198
  201.232.54.48
  201.234.204.140
  201.234.224.223
  201.234.227.221
  201.234.253.3
+201.234.66.133
  201.234.81.181
  201.235.10.215
  201.235.19.122
  201.236.1.51
+201.236.134.154
  201.236.143.243
  201.236.200.242
  201.236.250.28
@@ -44191,13 +53134,18 @@
  201.244.213.9
  201.244.214.162
  201.248.226.181
+201.249.146.101
  201.249.57.132
  201.249.61.60
  201.249.75.13
  201.249.88.38
+201.250.104.217
  201.251.63.208
  201.26.174.39
  201.26.179.96
+201.28.105.213
+201.28.135.246
+201.28.187.217
  201.28.225.242
  201.28.87.42
  201.28.87.43
@@ -44217,28 +53165,38 @@
  201.43.219.213
  201.46.28.100
  201.46.28.222
+201.46.29.184
  201.46.65.125
  201.46.81.249
  201.48.121.65
  201.48.184.157
+201.48.192.60
+201.48.222.45
+201.48.25.161
  201.48.28.2
  201.48.34.199
  201.48.36.33
+201.48.40.153
  201.48.62.65
  201.49.115.117
  201.49.22.14
  201.49.89.221
+201.49.94.216
  201.50.47.169
  201.54.113.170
  201.55.103.34
+201.55.158.133
  201.59.201.92
  201.6.101.122
  201.6.247.90
  201.6.253.172
  201.62.56.49
+201.62.73.92
  201.65.121.66
  201.66.199.247
+201.67.65.87
  201.67.77.216
+201.68.188.66
  201.68.34.23
  201.68.35.148
  201.71.185.171
@@ -44246,9 +53204,11 @@
  201.72.190.101
  201.72.190.98
  201.72.59.162
+201.75.13.14
  201.75.45.49
  201.75.62.86
  201.76.9.56
+201.77.105.24
  201.80.20.243
  201.80.45.116
  201.82.6.49
@@ -44256,15 +53216,19 @@
  201.87.154.127
  201.87.154.128
  201.87.243.22
+201.9.208.113
  201.90.148.195
  201.91.194.218
  201.91.210.130
  201.91.82.155
  201.93.159.234
+201.93.182.173
  201.93.243.183
+201.93.94.50
  201.95.72.128
  201.95.72.2
  201.99.106.67
+201.99.109.2
  2010-honda-civic-gx-autof12c76f7-dae5-486a-812e-e303461184c1.site
  2012-presidentielles.com
  2012ui.com
@@ -44281,20 +53245,33 @@
  20191113t071621-dot-wetransfer-auth-file334.appspot.com
  202.10.33.102
  202.10.33.98
+202.100.188.108
  202.101.102.200
+202.101.186.218
  202.101.58.115
  202.101.87.61
  202.102.126.37
+202.102.90.21
  202.103.10.202
  202.104.101.27
  202.104.112.217
  202.104.188.147
+202.104.45.85
+202.105.184.66
+202.105.98.210
  202.108.211.135
+202.110.125.188
  202.110.125.190
-202.111.131.205
+202.110.125.199
+202.110.125.217
+202.110.8.164
  202.111.131.236
+202.118.32.62
  202.12.74.243
+202.120.13.51
  202.121.138.74
+202.122.8.50
+202.123.183.188
  202.124.242.10
  202.124.46.100
  202.124.46.102
@@ -44308,6 +53285,7 @@
  202.125.46.31
  202.126.123.54
  202.126.98.42
+202.127.0.116
  202.129.0.27
  202.129.184.10
  202.129.189.58
@@ -44320,6 +53298,7 @@
  202.131.226.52
  202.131.233.202
  202.131.234.142
+202.131.254.118
  202.133.4.49
  202.133.4.53
  202.133.4.57
@@ -44336,16 +53315,27 @@
  202.136.123.254
  202.136.124.38
  202.136.127.14
+202.136.127.221
  202.136.127.254
  202.136.88.68
  202.137.10.179
  202.137.10.180
+202.137.131.107
+202.137.134.139
  202.137.134.190
  202.137.141.11
+202.137.141.98
+202.137.142.103
+202.137.142.138
  202.137.154.138
  202.137.154.154
  202.137.154.62
+202.137.155.142
+202.137.155.146
  202.137.155.168
+202.137.155.181
+202.137.155.212
+202.137.155.234
  202.137.159.132
  202.137.26.10
  202.137.26.12
@@ -44355,11 +53345,14 @@
  202.138.233.162
  202.138.234.18
  202.138.239.102
+202.138.241.97
+202.138.242.116
  202.138.242.22
  202.138.242.6
  202.138.242.8
  202.138.248.85
  202.138.254.154
+202.139.192.25
  202.14.4.190
  202.14.5.165
  202.14.6.131
@@ -44374,11 +53367,11 @@
  202.141.233.166
  202.141.242.3
  202.142.102.138
-202.142.110.103
  202.142.137.92
  202.142.147.162
  202.142.153.179
  202.142.153.181
+202.142.155.102
  202.142.155.146
  202.142.158.114
  202.142.159.204
@@ -44388,6 +53381,7 @@
  202.142.184.166
  202.142.193.72
  202.142.215.25
+202.142.69.161
  202.143.111.42
  202.143.121.245
  202.144.201.129
@@ -44401,9 +53395,11 @@
  202.144.201.34
  202.144.201.36
  202.144.201.38
+202.144.77.4
  202.146.218.45
  202.146.222.249
  202.146.245.156
+202.146.85.2
  202.147.169.66
  202.147.192.134
  202.147.198.115
@@ -44416,27 +53412,34 @@
  202.148.31.172
  202.148.31.174
  202.149.199.194
+202.150.141.134
  202.150.148.218
  202.150.151.85
  202.150.176.100
+202.150.177.141
  202.150.181.58
  202.150.216.211
  202.151.15.80
  202.151.163.10
+202.151.231.71
  202.152.149.26
+202.152.33.132
  202.152.38.74
  202.152.38.76
  202.152.40.28
  202.152.55.67
  202.152.56.170
+202.152.60.50
  202.153.103.135
  202.153.37.194
+202.153.37.203
  202.154.180.53
  202.154.186.25
  202.154.191.106
  202.154.191.58
  202.155.208.243
  202.155.211.226
+202.155.228.207
  202.158.11.92
  202.158.49.138
  202.158.49.140
@@ -44450,6 +53453,7 @@
  202.159.121.209
  202.159.121.225
  202.159.19.213
+202.159.24.35
  202.159.30.129
  202.159.30.153
  202.159.30.65
@@ -44494,6 +53498,7 @@
  202.162.214.250
  202.162.219.10
  202.162.219.12
+202.164.136.191
  202.164.138.10
  202.164.138.102
  202.164.138.112
@@ -44550,6 +53555,7 @@
  202.164.138.92
  202.164.138.93
  202.164.138.98
+202.164.138.99
  202.164.139.1
  202.164.139.102
  202.164.139.103
@@ -44610,15 +53616,22 @@
  202.164.139.96
  202.164.152.229
  202.164.152.233
+202.164.210.65
  202.164.211.116
  202.164.211.118
  202.164.211.51
  202.164.222.41
+202.164.39.25
  202.165.22.177
  202.165.22.2
+202.165.22.203
+202.165.22.227
+202.165.22.235
  202.165.22.247
  202.165.228.161
  202.165.228.225
+202.165.66.103
+202.166.163.195
  202.166.170.43
  202.166.174.218
  202.166.196.34
@@ -44634,6 +53647,7 @@
  202.166.207.229
  202.166.207.58
  202.166.210.122
+202.166.210.49
  202.166.211.48
  202.166.212.249
  202.166.213.156
@@ -44651,6 +53665,7 @@
  202.168.146.98
  202.168.151.102
  202.168.159.54
+202.168.201.123
  202.168.225.141
  202.169.106.230
  202.169.240.54
@@ -44662,6 +53677,7 @@
  202.169.44.140
  202.169.45.20
  202.169.59.118
+202.170.57.253
  202.170.69.12
  202.171.253.105
  202.171.253.74
@@ -44673,7 +53689,10 @@
  202.178.118.110
  202.178.121.152
  202.178.121.220
+202.179.185.130
  202.179.21.58
+202.179.86.229
+202.179.91.28
  202.180.54.211
  202.180.54.97
  202.182.100.165
@@ -44698,12 +53717,16 @@
  202.183.32.185
  202.184.0.102
  202.184.197.236
+202.185.164.139
+202.185.198.77
  202.186.199.15
+202.188.101.106
  202.188.101.4
  202.188.20.123
  202.188.20.126
  202.191.120.12
  202.191.121.12
+202.191.122.129
  202.191.122.62
  202.191.126.100
  202.191.126.60
@@ -44712,6 +53735,7 @@
  202.202.32.40
  202.208.223.251
  202.21.115.94
+202.21.123.124
  202.21.123.185
  202.21.124.226
  202.21.32.158
@@ -44722,12 +53746,14 @@
  202.228.204.224
  202.239.42.192
  202.28.10.20
+202.28.221.106
  202.28.247.202
  202.28.33.169
  202.28.7.138
  202.28.77.46
  202.29.18.25
  202.29.211.11
+202.29.214.13
  202.29.215.114
  202.29.220.202
  202.29.226.134
@@ -44740,9 +53766,12 @@
  202.29.243.250
  202.29.243.252
  202.29.243.254
+202.29.243.58
  202.29.245.46
+202.29.33.245
  202.29.4.97
  202.29.57.22
+202.29.80.133
  202.29.86.7
  202.29.95.12
  202.3.72.17
@@ -44751,6 +53780,7 @@
  202.36.55.19
  202.38.181.171
  202.39.237.188
+202.39.245.247
  202.4.173.49
  202.4.186.49
  202.40.139.165
@@ -44770,17 +53800,23 @@
  202.43.190.11
  202.43.191.10
  202.43.191.14
+202.43.228.206
  202.43.34.50
  202.44.199.62
  202.44.210.20
  202.44.251.225
  202.44.251.241
  202.44.52.78
+202.44.8.48
  202.44.9.1
  202.45.146.210
  202.46.3.22
  202.46.3.26
+202.47.116.107
  202.47.116.121
+202.47.118.107
+202.47.34.236
+202.47.52.112
  202.5.17.28
  202.5.36.215
  202.5.36.232
@@ -44828,6 +53864,7 @@
  202.53.167.144
  202.53.174.17
  202.53.8.82
+202.55.175.236
  202.55.176.12
  202.55.87.45
  202.56.203.226
@@ -44869,10 +53906,12 @@
  202.59.173.204
  202.6.224.50
  202.6.224.52
+202.6.237.26
  202.60.225.49
  202.60.227.65
  202.60.72.107
  202.60.94.104
+202.61.133.80
  202.61.135.185
  202.61.49.52
  202.62.10.250
@@ -44889,6 +53928,7 @@
  202.62.39.111
  202.62.45.17
  202.62.45.53
+202.62.48.112
  202.62.50.81
  202.62.51.25
  202.62.51.45
@@ -44907,17 +53947,24 @@
  202.65.171.67
  202.67.153.114
  202.69.105.18
+202.69.36.45
  202.69.38.237
  202.69.48.126
  202.70.136.160
  202.70.34.82
  202.70.44.195
+202.70.66.227
+202.70.72.217
  202.70.84.201
  202.71.108.26
  202.71.185.90
+202.71.27.60
  202.72.209.3
+202.72.225.17
  202.72.233.18
  202.72.242.242
+202.72.243.198
+202.72.244.198
  202.72.245.125
  202.73.14.205
  202.73.51.102
@@ -44941,10 +53988,16 @@
  202.79.56.168
  202.79.56.90
  202.8.102.18
+202.80.112.81
  202.80.118.90
  202.80.213.188
  202.80.216.126
+202.83.167.42
  202.83.172.218
+202.83.54.167
+202.83.54.228
+202.83.56.41
+202.83.59.87
  202.85.222.190
  202.86.217.90
  202.87.105.41
@@ -44952,12 +54005,15 @@
  202.87.248.50
  202.87.249.45
  202.88.150.74
+202.88.154.70
  202.88.239.11
  202.88.241.107
  202.88.241.181
  202.89.73.94
  202.9.38.20
  202.9.39.139
+202.91.10.123
+202.91.34.32
  202.91.35.253
  202.91.69.53
  202.91.82.81
@@ -44982,6 +54038,7 @@
  202.94.175.42
  202.95.11.253
  202.95.8.227
+202.99.48.140
  2020-attupgrade.weebly.com
  2020-giveaway.com
  2020-updater-secure-pay.com
@@ -45236,9 +54293,12 @@
  203.11.71.1
  203.110.164.139
  203.110.211.90
+203.110.89.253
+203.110.91.77
  203.111.254.243
  203.112.212.114
  203.112.218.83
+203.113.102.178
  203.113.174.47
  203.114.108.46
  203.114.111.242
@@ -45260,6 +54320,9 @@
  203.115.73.4
  203.115.73.46
  203.115.73.92
+203.116.81.254
+203.117.138.190
+203.122.19.101
  203.122.225.70
  203.122.226.250
  203.122.26.98
@@ -45275,6 +54338,7 @@
  203.128.83.130
  203.128.84.61
  203.129.113.142
+203.129.197.98
  203.129.218.76
  203.129.220.182
  203.130.0.69
@@ -45282,12 +54346,16 @@
  203.130.215.147
  203.130.227.189
  203.130.236.211
+203.130.255.2
  203.131.229.187
  203.131.252.210
  203.132.92.216
  203.132.95.10
  203.134.194.240
+203.135.20.36
+203.135.33.202
  203.135.98.5
+203.137.195.133
  203.142.34.36
  203.142.38.26
  203.142.66.26
@@ -45297,17 +54365,23 @@
  203.143.119.196
  203.144.133.5
  203.144.233.115
+203.146.112.146
  203.146.127.133
  203.146.208.208
  203.147.62.92
+203.147.78.171
+203.148.87.154
  203.150.107.77
  203.150.113.129
  203.150.113.179
  203.150.113.89
  203.150.168.100
+203.150.179.210
  203.150.180.183
  203.150.225.2
+203.150.228.180
  203.151.166.124
+203.151.169.108
  203.151.20.19
  203.151.215.130
  203.152.210.122
@@ -45325,8 +54399,11 @@
  203.154.32.185
  203.154.75.141
  203.157.152.9
+203.159.249.215
+203.159.80.118
  203.160.1.76
  203.160.167.243
+203.160.180.146
  203.160.57.193
  203.160.57.39
  203.160.57.43
@@ -45353,10 +54430,13 @@
  203.162.123.109
  203.162.130.73
  203.162.21.216
+203.162.230.150
  203.163.236.249bin.sh
  203.163.245.14
+203.163.247.42
  203.169.225.68
  203.170.115.82
+203.170.58.241
  203.170.66.1
  203.170.66.161
  203.170.66.173
@@ -45404,15 +54484,22 @@
  203.176.135.98
  203.176.176.130
  203.176.180.194
+203.176.75.99
  203.177.135.133
  203.177.140.42
  203.177.156.130
  203.177.156.145
  203.177.159.170
  203.177.230.116
+203.177.71.254
  203.177.83.179
+203.183.68.135
+203.184.132.189
  203.184.132.190
+203.184.132.191
  203.185.129.36
+203.186.105.153
+203.186.54.237
  203.187.177.34
  203.188.242.222
  203.188.245.98
@@ -45435,27 +54522,46 @@
  203.190.116.140
  203.190.117.232
  203.190.14.105
+203.190.148.180
  203.190.34.39
  203.190.37.133
  203.190.53.45
  203.190.53.6
  203.190.55.213
+203.192.219.7
+203.192.241.206
  203.192.25.1
  203.194.21.241
+203.195.130.233
  203.195.138.190
+203.195.141.177
+203.195.144.114
  203.195.144.157
  203.195.148.210
  203.195.150.131
+203.195.151.11
  203.195.157.137
+203.195.164.81
  203.195.171.47
+203.195.184.33
+203.195.191.74
+203.195.202.128
+203.195.204.122
+203.195.204.47
+203.195.205.202
  203.195.206.243
  203.195.211.173
+203.195.214.173
+203.195.224.229
  203.195.245.241
  203.197.88.53
  203.198.246.86
  203.198.94.132
  203.199.238.249
+203.2.118.84
+203.2.162.41
  203.200.95.142
+203.201.173.114
  203.202.240.74
  203.202.243.198
  203.202.243.199
@@ -45491,6 +54597,9 @@
  203.217.169.89
  203.217.173.206
  203.217.176.244
+203.217.56.33
+203.217.9.84
+203.218.156.243
  203.219.101.156
  203.219.151.169
  203.219.157.41
@@ -45503,6 +54612,7 @@
  203.227.217.27
  203.227.222.112
  203.230.220.19
+203.230.6.175
  203.234.139.138
  203.234.248.190
  203.234.62.129
@@ -45516,11 +54626,18 @@
  203.24.188.242
  203.24.188.59
  203.243.142.45
+203.243.32.129
+203.245.29.148
  203.245.30.248
+203.245.41.96
  203.246.79.115
  203.248.175.71
  203.248.175.72
+203.248.18.156
+203.248.18.158
+203.249.76.225
  203.25.159.3
+203.250.190.90
  203.251.225.101
  203.252.90.80
  203.253.25.15
@@ -45532,22 +54649,24 @@
  203.46.223.176
  203.56.191.129
  203.56.240.254
+203.56.4.47
  203.58.26.70
  203.6.149.115
  203.62.185.131
  203.64.20.2
  203.66.14.161
+203.66.168.81
  203.66.57.117
  203.69.91.190
  203.71.2.73
  203.71.220.140
  203.73.150.177
-203.73.62.97
  203.74.190.196
  203.76.109.178
  203.76.110.186
  203.76.110.190
  203.76.115.246
+203.76.121.150
  203.76.148.2
  203.77.210.161
  203.77.214.49
@@ -45564,7 +54683,9 @@
  203.80.190.162
  203.80.190.242
  203.80.191.18
+203.81.241.191
  203.81.75.37
+203.81.83.199
  203.81.87.186
  203.81.95.70
  203.82.204.154
@@ -45574,14 +54695,19 @@
  203.83.184.54
  203.83.189.126
  203.84.159.59
+203.86.7.110
  203.90.61.133
  203.91.118.71
  203.91.121.70
  203.91.121.71
+203.92.47.40
+203.93.19.36
  203.94.24.114
  203.94.243.59
  203.95.193.100
+203.95.212.41
  203.95.220.33
+203.95.7.164
  203.97.30.12
  203.99.110.214
  203.99.123.25
@@ -45621,6 +54747,7 @@
  204.13.201.163
  204.13.239.221
  204.132.129.234
+204.137.191.245
  204.14.245.176
  204.145.94.123
  204.145.94.154
@@ -45680,9 +54807,12 @@
  204.48.20.154
  204.48.20.47
  204.48.21.36
+204.48.22.232
  204.48.23.96
  204.48.26.63
  204.48.29.122
+204.48.30.227
+204.48.30.64
  204.52.167.22
  204.60.23.203
  204.61.221.178
@@ -45695,6 +54825,7 @@
  204.9.243.81
  204.93.113.108
  204.93.154.211
+204.93.180.13
  204.93.180.3
  204.93.197.85
  204.98.164.243
@@ -45708,6 +54839,7 @@
  205.134.182.106
  205.134.255.225
  205.141.197.38
+205.144.212.237
  205.157.156.10
  205.164.3.143
  205.172.134.229
@@ -45718,10 +54850,13 @@
  205.185.113.151
  205.185.113.55
  205.185.113.76
+205.185.114.174
  205.185.114.216
  205.185.114.231
  205.185.114.29
+205.185.114.71
  205.185.115.100
+205.185.115.150
  205.185.115.93
  205.185.116.126
  205.185.116.160
@@ -45809,6 +54944,7 @@
  206.123.139.237
  206.123.139.41
  206.123.153.8
+206.123.233.250
  206.124.149.66
  206.125.169.164
  206.126.81.103
@@ -45820,10 +54956,14 @@
  206.126.81.49
  206.126.81.82
  206.126.81.92
+206.130.139.29
  206.138.29.96
  206.166.251.64
  206.173.219.10
+206.174.117.24
+206.174.214.90
  206.176.81.44
+206.180.134.35
  206.183.31.221
  206.188.207.19
  206.189.0.110
@@ -45854,9 +54994,13 @@
  206.189.119.230
  206.189.119.255
  206.189.12.13
+206.189.121.234
  206.189.121.29
+206.189.122.104
+206.189.122.115
  206.189.125.33
  206.189.125.59
+206.189.127.6
  206.189.128.215
  206.189.129.144
  206.189.130.143
@@ -45864,17 +55008,25 @@
  206.189.131.211
  206.189.132.108
  206.189.132.204
+206.189.132.8
  206.189.134.204
+206.189.135.130
  206.189.135.186
  206.189.136.160
+206.189.136.185
+206.189.136.246
  206.189.137.124
  206.189.137.199
+206.189.138.29
  206.189.138.99
  206.189.140.139
  206.189.144.129
+206.189.146.142
  206.189.147.137
  206.189.147.45
+206.189.147.87
  206.189.15.220
+206.189.151.151
  206.189.151.16
  206.189.151.26
  206.189.153.222
@@ -45886,25 +55038,32 @@
  206.189.16.138
  206.189.16.199
  206.189.160.192
+206.189.160.233
  206.189.162.136
  206.189.162.99
  206.189.165.77
  206.189.166.172
+206.189.166.89
  206.189.167.164
  206.189.168.8
  206.189.169.6
  206.189.17.179
  206.189.171.111
  206.189.171.114
+206.189.171.204
  206.189.171.239
  206.189.171.241
  206.189.172.126
  206.189.172.90
  206.189.173.15
  206.189.173.185
+206.189.173.188
+206.189.174.127
  206.189.18.129
+206.189.18.40
  206.189.180.178
  206.189.180.73
+206.189.181.12
  206.189.181.87
  206.189.182.117
  206.189.183.229
@@ -45913,9 +55072,11 @@
  206.189.188.223
  206.189.189.192
  206.189.189.81
+206.189.19.194
  206.189.190.18
  206.189.190.29
  206.189.191.112
+206.189.194.249
  206.189.196.17
  206.189.198.145
  206.189.198.237
@@ -45930,8 +55091,10 @@
  206.189.208.80
  206.189.209.253
  206.189.213.113
+206.189.213.126
  206.189.213.150
  206.189.213.201
+206.189.214.165
  206.189.216.37
  206.189.217.165
  206.189.217.82
@@ -45946,28 +55109,39 @@
  206.189.225.85
  206.189.23.189
  206.189.23.60
+206.189.231.196
  206.189.232.10
  206.189.232.2
  206.189.232.31
  206.189.232.51
+206.189.234.114
  206.189.234.238
  206.189.237.94
  206.189.238.171
+206.189.238.213
+206.189.24.87
  206.189.25.102
  206.189.26.219
  206.189.27.201
  206.189.28.79
+206.189.3.176
  206.189.30.133
  206.189.31.125
  206.189.32.48
  206.189.32.77
+206.189.35.67
  206.189.36.195
  206.189.38.237
+206.189.4.55
  206.189.42.116
  206.189.45.137
  206.189.45.138
  206.189.45.96
+206.189.46.50
+206.189.46.85
+206.189.47.166
  206.189.47.179
+206.189.51.168
  206.189.54.247
  206.189.54.71
  206.189.55.42
@@ -45993,6 +55167,8 @@
  206.189.85.218
  206.189.85.88
  206.189.87.108
+206.189.88.253
+206.189.88.65
  206.189.88.91
  206.189.91.211
  206.189.91.219
@@ -46026,10 +55202,12 @@
  206.221.176.149
  206.221.176.87
  206.221.191.237
+206.221.80.253
  206.225.23.4
  206.225.95.33
  206.248.174.129
  206.248.184.127
+206.251.179.2
  206.252.192.12
  206.252.192.14
  206.252.192.5
@@ -46037,6 +55215,7 @@
  206.252.192.8
  206.253.224.74
  206.253.226.7
+206.255.113.29
  206.29.180.76
  206.31.242.26
  206.41.173.108
@@ -46071,6 +55250,7 @@
  206.47.41.166
  206.54.209.61
  206.55.74.0
+206.63.239.142
  206.71.228.129
  206.71.228.193
  206.72.195.231
@@ -46080,9 +55260,12 @@
  206.81.1.200
  206.81.10.215
  206.81.11.129
+206.81.12.141
  206.81.13.189
  206.81.149.147
+206.81.16.252
  206.81.17.70
+206.81.18.5
  206.81.19.217
  206.81.20.218
  206.81.23.70
@@ -46090,7 +55273,9 @@
  206.81.24.91
  206.81.31.173
  206.81.31.24
+206.81.5.49
  206.81.6.142
+206.81.8.136
  2063696-dot-n-e-w-me-ss-age-po-rt-al.wl.r.appspot.com
  206betasus.com
  207-365.net
@@ -46144,6 +55329,7 @@
  207.118.180.91
  207.118.181.117
  207.118.181.119
+207.118.181.138
  207.118.182.172
  207.118.182.196
  207.118.183.151
@@ -46253,6 +55439,7 @@
  207.148.97.0
  207.148.98.111
  207.150.188.54
+207.154.194.217
  207.154.195.134
  207.154.196.1
  207.154.196.105
@@ -46268,17 +55455,21 @@
  207.154.207.214
  207.154.208.77
  207.154.209.140
+207.154.215.3
  207.154.216.122
  207.154.216.13
  207.154.216.143
  207.154.217.89
  207.154.218.141
+207.154.218.43
  207.154.219.42
  207.154.220.234
  207.154.221.19
  207.154.224.103
  207.154.224.149
  207.154.225.14
+207.154.227.114
+207.154.228.201
  207.154.229.94
  207.154.230.25
  207.154.230.59
@@ -46289,6 +55480,8 @@
  207.154.235.64
  207.154.236.232
  207.154.240.23
+207.154.241.112
+207.154.243.194
  207.154.244.110
  207.154.246.170
  207.154.247.141
@@ -46306,9 +55499,11 @@
  207.180.205.117
  207.180.207.205
  207.180.217.42
+207.180.221.187
  207.180.223.239
  207.180.223.68
  207.180.225.253
+207.180.226.49
  207.180.226.90
  207.180.227.204
  207.180.229.247
@@ -46316,11 +55511,14 @@
  207.180.234.123
  207.180.239.154
  207.180.244.165
+207.180.248.85
  207.180.250.228
  207.180.251.11
+207.180.255.139
  207.182.137.218
  207.182.154.178
  207.188.41.2
+207.189.250.78
  207.191.165.8
  207.191.186.10
  207.191.26.202
@@ -46344,6 +55542,8 @@
  207.230.100.247
  207.231.235.145
  207.235.124.166
+207.236.211.36
+207.237.108.28
  207.237.127.163
  207.241.227.38
  207.241.229.212
@@ -46356,6 +55556,7 @@
  207.242.7.91
  207.244.109.182
  207.244.119.153
+207.244.127.117
  207.244.149.106
  207.244.149.107
  207.244.149.108
@@ -46368,6 +55569,8 @@
  207.244.229.168
  207.244.239.187
  207.244.240.40
+207.244.251.210
+207.244.251.23
  207.244.68.199
  207.244.70.35
  207.246.104.203
@@ -46377,6 +55580,7 @@
  207.246.120.203
  207.246.124.223
  207.246.240.116
+207.246.240.119
  207.246.240.122
  207.246.249.193
  207.246.249.195
@@ -46400,6 +55604,7 @@
  207.30.207.4
  207.30.28.244
  207.30.28.246
+207.32.219.92
  207.38.90.177
  207.46.13.0
  207.46.13.103
@@ -46499,7 +55704,9 @@
  207.46.13.98
  207.46.13.99
  207.46.145.19
+207.46.227.197
  207.5.112.195
+207.5.30.10
  207.5.32.6
  207.55.247.240
  207.55.53.96
@@ -46509,41 +55716,57 @@
  207.58.152.241
  207.59.160.181
  207.7.108.203
+207.73.213.92
  207.74.74.6
  207.74.82.103
+207.81.31.205
  207.89.22.102
  207.96.90.42
  207.97.174.134
+207.98.187.126
  207.99.28.140
  2072.ch
  20759379-1808-4ca1-8f3a-3923cb555671.htmlcomponentservice.com
  20760220.snapchatprime.com
  208.100.13.56
  208.100.170.91
+208.100.26.230
+208.100.32.120
+208.100.32.122
+208.100.32.123
  208.101.33.22
  208.101.5.28
  208.102.51.6
  208.102.7.153
+208.103.169.205
  208.105.137.2
  208.106.250.221
  208.109.100.40
+208.109.11.147
  208.109.11.24
  208.109.11.34
+208.109.12.104
  208.109.12.211
  208.109.13.144
+208.109.13.208
+208.109.14.122
+208.109.14.39
  208.109.181.72
  208.109.184.46
  208.109.190.141
  208.109.209.94
  208.109.248.165
+208.109.53.185
  208.109.8.153
  208.109.8.97
+208.109.9.14
  208.110.66.130
  208.110.71.26
  208.110.85.188
  208.110.93.52
  208.110.99.105
  208.112.122.108
+208.113.128.255
  208.113.130.13
  208.113.130.87
  208.113.131.116
@@ -46617,8 +55840,12 @@
  208.113.155.90
  208.113.162.98
  208.113.164.202
+208.113.181.151
  208.113.182.208
  208.113.182.33
+208.113.200.18
+208.113.200.240
+208.113.200.242
  208.113.220.113
  208.113.220.123
  208.113.220.139
@@ -46663,11 +55890,14 @@
  208.116.25.29
  208.116.44.162
  208.116.50.118
+208.117.117.63
  208.118.245.141
+208.123.11.85
  208.123.119.107
  208.123.119.114
  208.125.16.254
  208.125.188.74
+208.125.35.14
  208.138.24.254
  208.163.148.41
  208.163.153.205
@@ -46683,6 +55913,8 @@
  208.167.254.247
  208.176.53.58
  208.180.145.73
+208.180.145.93
+208.180.16.38
  208.180.202.147
  208.180.207.205
  208.180.33.94
@@ -46691,6 +55923,7 @@
  208.25.206.130
  208.255.161.107
  208.29.185.38
+208.30.116.46
  208.31.49.51
  208.38.133.39
  208.38.180.67
@@ -46709,10 +55942,12 @@
  208.53.34.202
  208.53.99.29
  208.54.231.218
+208.58.39.98
  208.59.132.133
  208.59.170.5
  208.6.49.2
  208.64.68.228
+208.65.181.179
  208.67.1.113
  208.67.1.194
  208.67.248.254
@@ -46723,12 +55958,14 @@
  208.68.38.182
  208.68.38.22
  208.68.39.180
+208.68.39.220
  208.68.4.129
  208.68.7.129
  208.69.30.157
  208.69.30.71
  208.70.245.126
  208.70.79.113
+208.71.173.207
  208.71.173.74
  208.73.205.14
  208.73.21.13
@@ -46756,6 +55993,7 @@
  208.88.6.140
  208.89.214.167
  208.90.15.84
+208.90.184.101
  208.91.196.170
  208.91.196.195
  208.91.197.11
@@ -46772,6 +56010,7 @@
  208.92.211.82
  208.93.231.240
  208.94.240.42
+208.94.243.228
  208.95.0.18
  208.96.137.130
  208.96.138.190
@@ -46784,6 +56023,7 @@
  209.10.105.174
  209.102.147.176
  209.105.239.88
+209.105.243.145
  209.105.243.164
  209.107.196.28
  209.107.204.103
@@ -46813,7 +56053,9 @@
  209.126.189.35
  209.126.4.134
  209.126.76.205
+209.127.178.46
  209.127.179.9
+209.127.186.196
  209.127.20.106
  209.128.84.141
  209.13.96.163
@@ -46834,8 +56076,10 @@
  209.141.36.139
  209.141.36.246
  209.141.37.101
+209.141.37.132
  209.141.37.149
  209.141.37.163
+209.141.38.117
  209.141.38.192
  209.141.39.209
  209.141.40.46
@@ -46843,7 +56087,6 @@
  209.141.41.202
  209.141.41.207
  209.141.41.225
-209.141.41.247
  209.141.42.106
  209.141.42.155
  209.141.42.182
@@ -46856,11 +56099,11 @@
  209.141.45.21
  209.141.45.212
  209.141.46.178
-209.141.46.182
  209.141.46.241
  209.141.46.38
  209.141.46.47
  209.141.46.57
+209.141.47.226
  209.141.47.92
  209.141.48.243
  209.141.50.178
@@ -46894,6 +56137,7 @@
  209.141.59.157
  209.141.59.180
  209.141.59.208
+209.141.59.217
  209.141.59.245
  209.141.59.252
  209.141.60.195
@@ -46906,6 +56150,8 @@
  209.146.23.182
  209.15.158.30
  209.15.236.190
+209.150.240.168
+209.150.252.43
  209.150.60.107
  209.151.224.239
  209.151.224.247
@@ -46915,11 +56161,15 @@
  209.16.78.27
  209.160.54.26
  209.160.64.61
+209.160.72.40
  209.163.117.86
  209.163.119.169
  209.163.160.253
  209.164.189.107
  209.169.166.148
+209.17.96.218
+209.17.96.226
+209.17.97.114
  209.172.0.85
  209.172.40.10
  209.172.50.172
@@ -46946,6 +56196,8 @@
  209.190.46.193
  209.190.5.26
  209.194.236.25
+209.195.124.216
+209.198.180.142
  209.20.64.41
  209.200.23.116
  209.200.231.134
@@ -46957,6 +56209,7 @@
  209.203.130.25
  209.203.130.59
  209.203.22.217
+209.205.221.162
  209.206.166.53
  209.208.72.217
  209.212.33.99
@@ -46990,6 +56243,7 @@
  209.235.136.115
  209.235.136.116
  209.236.117.207
+209.236.118.251
  209.236.123.42
  209.236.133.201
  209.236.228.26
@@ -47049,11 +56303,13 @@
  209.58.157.87
  209.58.168.52
  209.58.183.70
+209.59.137.137
  209.59.137.142
  209.59.138.182
  209.59.141.149
  209.59.166.114
  209.59.186.242
+209.59.199.129
  209.59.234.151
  209.6.210.179
  209.6.50.76
@@ -47062,7 +56318,9 @@
  209.61.244.6
  209.62.42.242
  209.62.56.194
+209.65.66.239
  209.65.67.201
+209.65.71.28
  209.66.128.10
  209.66.203.43
  209.73.137.141
@@ -47093,16 +56351,22 @@
  209.97.129.138
  209.97.129.2
  209.97.129.244
+209.97.130.60
+209.97.132.66
  209.97.133.56
  209.97.136.178
  209.97.137.55
+209.97.138.167
+209.97.138.179
  209.97.138.189
  209.97.140.9
+209.97.141.112
  209.97.142.132
  209.97.143.230
  209.97.143.9
  209.97.145.173
  209.97.146.3
+209.97.147.223
  209.97.149.248
  209.97.150.240
  209.97.151.184
@@ -47111,9 +56375,15 @@
  209.97.158.250
  209.97.159.10
  209.97.160.168
+209.97.160.56
  209.97.161.222
+209.97.163.175
  209.97.165.196
  209.97.168.52
+209.97.168.94
+209.97.169.33
+209.97.169.65
+209.97.169.8
  209.97.172.220
  209.97.174.166
  209.97.174.218
@@ -47126,6 +56396,7 @@
  209.97.179.111
  209.97.179.21
  209.97.183.1
+209.97.183.120
  209.97.183.188
  209.97.183.28
  209.97.186.179
@@ -47135,6 +56406,7 @@
  209.97.189.255
  209.97.189.48
  209.97.189.98
+209.97.191.190
  209.97.199.149
  209.97.212.185
  209.99.131.146
@@ -47219,32 +56491,47 @@
  210.1.225.79
  210.1.226.124
  210.1.82.194
+210.10.205.158
  210.100.217.198
+210.103.187.19
+210.104.112.207
+210.104.68.115
  210.105.193.15
  210.105.193.8
+210.105.82.53
  210.106.218.191bin.sh
  210.109.108.186
  210.11.178.95
  210.112.121.14
  210.112.121.225
+210.112.232.6
  210.113.179.42
  210.114.1.172
  210.114.17.198
+210.114.19.152
  210.118.170.11
  210.12.168.79
  210.12.27.226
+210.12.42.211
  210.12.71.170
+210.12.78.16
  210.121.223.61
  210.121.223.78
+210.123.1.78
  210.124.149.19
+210.125.92.58
  210.127.209.27
  210.127.209.30
+210.127.247.6
  210.127.249.145
  210.127.253.179
  210.127.253.247
  210.13.110.60
  210.13.110.61
+210.139.89.4
  210.14.107.43
+210.14.142.85
+210.14.69.76
  210.140.10.26
  210.140.10.35
  210.143.109.157
@@ -47255,37 +56542,45 @@
  210.153.106.106
  210.16.100.8
  210.16.101.36
+210.16.102.26
  210.16.102.68
+210.16.180.231
+210.16.187.206
+210.16.189.87
  210.16.84.102
  210.16.84.182
  210.16.85.134
  210.16.85.142
  210.16.85.98
+210.16.88.219
  210.165.156.91
  210.166.214.192
  210.166.230.64
+210.177.164.45
+210.177.243.102
  210.178.88.171bin.sh
  210.178.94.227
  210.179.11.208
  210.179.177.167
-210.18.153.150
  210.180.118.162
  210.180.237.212
  210.182.148.126
  210.182.169.25
+210.182.169.26
  210.182.189.215
  210.183.102.85
  210.183.21.48
  210.183.46.232
  210.183.89.229
-210.186.188.120
  210.186.98.58
  210.187.189.107
  210.188.218.41
  210.19.212.234
  210.190.64.68
+210.195.151.150
  210.195.187.128
  210.195.190.88
+210.196.144.26
  210.2.157.130
  210.2.86.96
  210.200.161.132
@@ -47293,24 +56588,39 @@
  210.205.6.107
  210.205.6.171
  210.205.6.233
+210.205.8.250
+210.206.92.137
+210.209.123.158
  210.209.125.65
  210.209.72.82
  210.209.89.74
  210.209.93.90
+210.21.121.200
  210.21.221.156
  210.210.130.139
  210.210.136.147
+210.210.136.170
  210.211.107.3
  210.211.111.85
+210.211.116.204
+210.211.116.80
+210.211.124.15
  210.211.126.19
+210.211.99.195
+210.212.172.182
+210.212.237.67
  210.212.253.227
+210.212.29.215
  210.212.68.213
+210.213.127.206
  210.213.146.195
+210.213.240.230
  210.216.153.142
  210.216.21.96
  210.219.173.21
  210.22.5.117
  210.220.150.170
+210.221.110.131
  210.221.124.147
  210.221.154.117
  210.222.86.19
@@ -47318,6 +56628,7 @@
  210.236.46.245
  210.240.163.95
  210.242.153.168
+210.245.110.9
  210.245.119.111
  210.245.36.154
  210.245.51.1
@@ -47338,10 +56649,13 @@
  210.245.51.76
  210.245.52.62
  210.245.54.97
+210.245.95.166
  210.246.240.254
  210.246.240.42
  210.246.243.70
  210.246.63.55
+210.251.213.165
+210.251.214.133
  210.255.240.125
  210.26.49.104
  210.26.49.89
@@ -47349,6 +56663,7 @@
  210.3.176.43
  210.3.176.44
  210.3.176.45
+210.3.40.114
  210.4.96.73
  210.4.97.107
  210.44.232.126
@@ -47358,12 +56673,14 @@
  210.48.4.48
  210.5.120.234
  210.5.172.6
+210.5.85.150
  210.51.13.174
  210.51.174.189
  210.54.37.190
  210.54.38.227
  210.54.39.238
  210.55.186.173
+210.56.23.100
  210.56.230.149
  210.56.232.56
  210.56.244.134
@@ -47383,32 +56700,49 @@
  210.57.237.70
  210.59.98.106
  210.61.216.66
+210.61.28.106
  210.61.47.79
+210.65.47.133
  210.66.100.173
  210.66.16.184
  210.68.245.55
+210.71.232.236
+210.72.91.6
+210.74.11.97
  210.76.64.46
  210.89.176.166
+210.9.47.154
+210.92.18.163
  210.92.18.172
+210.92.18.179
  210.92.18.25
  210.94.133.243
  210.96.116.236
  210.96.4.50
  210.97.192.120
  210.97.85.20
+210.99.190.130
  2101movies.online
  210676-dot-n-e-w-me-ss-age-po-rt-al.wl.r.appspot.com
  2109f.com
  210sadivorce.com
+211.1.211.59
+211.1.230.194
  211.101.18.158
  211.101.61.231
+211.103.172.114
+211.103.222.34
  211.104.160.202
  211.104.242.52
  211.105.145.212
  211.105.40.71
+211.106.56.88
  211.108.51.122
+211.108.69.103
  211.110.125.62
  211.110.229.161
+211.110.44.63
+211.112.187.197
  211.114.134.118
  211.114.178.168
  211.114.74.87
@@ -47421,9 +56755,13 @@
  211.116.217.52
  211.116.220.205
  211.117.250.107
+211.117.60.102
  211.117.60.11
+211.117.60.75
  211.121.191.53
+211.125.122.47
  211.136.100.154
+211.137.21.233
  211.137.225.102
  211.137.225.116
  211.137.225.120
@@ -47443,18 +56781,38 @@
  211.137.225.59
  211.137.225.83
  211.137.225.96
+211.140.118.18
+211.140.196.90
+211.144.221.226
+211.144.68.45
+211.144.69.249
+211.147.26.186
+211.147.65.218
  211.149.152.250
  211.152.33.24
+211.155.225.104
+211.159.146.141
+211.159.148.181
+211.159.149.29
+211.159.153.62
  211.159.160.173
+211.159.165.137
+211.159.168.145
+211.159.168.172
+211.159.169.96
+211.159.171.238
  211.159.183.117
  211.159.186.152
  211.159.219.162
+211.161.60.21
+211.171.103.130
  211.171.42.5
  211.172.225.50
  211.173.58.253
  211.174.49.229
  211.174.59.120
  211.174.63.235
+211.176.148.99
  211.179.243.103
  211.180.62.113
  211.184.131.136
@@ -47474,6 +56832,7 @@
  211.194.20.45
  211.196.195.46
  211.197.103.127
+211.197.212.3
  211.197.34.175
  211.198.174.72
  211.198.180.137
@@ -47487,6 +56846,9 @@
  211.20.145.202
  211.20.145.204
  211.20.154.102
+211.20.154.167
+211.20.176.82
+211.20.181.113
  211.20.238.33
  211.20.36.113
  211.201.33.182
@@ -47499,13 +56861,18 @@
  211.206.124.179
  211.21.104.173
  211.21.120.163
+211.21.182.37
  211.21.92.211
+211.210.219.71
  211.210.3.214
+211.211.184.191
  211.214.161.205
  211.215.18.93
  211.216.185.130
+211.216.237.11
  211.218.105.101
  211.218.126.236
+211.218.192.149
  211.218.221.35
  211.218.245.66
  211.219.18.186
@@ -47515,14 +56882,17 @@
  211.22.236.44
  211.220.195.71
  211.220.214.50
+211.220.27.191
  211.220.63.141
  211.220.63.148
  211.221.138.199
+211.221.155.6
  211.221.32.27
  211.222.69.222
  211.223.201.177
  211.223.205.250
  211.224.166.251
+211.227.155.206
  211.229.107.60
  211.229.19.45
  211.229.236.149
@@ -47539,11 +56909,14 @@
  211.233.50.192
  211.233.56.228
  211.233.58.19
+211.233.68.2
  211.233.69.41
  211.234.106.119
+211.234.119.189
  211.234.122.76
  211.235.244.38
  211.236.157.57
+211.236.240.87
  211.236.43.200
  211.237.114.96
  211.237.120.13
@@ -47556,26 +56929,38 @@
  211.24.73.223
  211.24.8.49
  211.24.95.49
+211.241.177.69
  211.242.110.197
+211.243.175.203
+211.243.86.210
  211.244.168.32
  211.245.106.41
  211.246.253.30
+211.248.236.223
  211.248.241.116
  211.248.241.236
  211.250.42.101
+211.251.234.194
  211.251.235.65
  211.251.239.72
  211.251.250.7
+211.252.87.42
+211.253.10.96
+211.253.129.225
  211.253.133.48
  211.253.202.194
+211.253.24.250
  211.253.26.117
+211.253.30.40
  211.253.9.160
  211.254.114.31
+211.254.212.59
  211.254.215.197
  211.254.215.227
  211.255.32.134
  211.255.32.19
  211.26.10.49
+211.26.187.128
  211.34.252.96
  211.35.66.57
  211.35.66.61
@@ -47591,6 +56976,7 @@
  211.35.77.62
  211.35.78.206
  211.37.0.247
+211.38.132.37
  211.38.193.69
  211.39.130.176
  211.40.128.112
@@ -47600,7 +56986,6 @@
  211.43.206.220
  211.43.8.168
  211.45.247.122
-211.47.100.51
  211.47.102.51
  211.47.118.102
  211.47.237.17
@@ -47616,17 +57001,24 @@
  211.49.225.208
  211.49.242.69
  211.5.245.2
+211.50.170.252
+211.51.179.202
  211.55.116.245
  211.55.116.245bin.sh
+211.55.202.189
  211.56.15.42
  211.56.15.44
  211.56.15.46
  211.63.60.50
  211.63.71.72
+211.72.111.146
+211.72.86.169
+211.74.78.88
  211.75.194.88
  211.75.219.214
  211.95.27.50
  211.95.47.166
+211.95.84.146
  211.99.229.3
  21112.com
  211740640418593-dot-wetransfer-auth-file-341.appspot.com
@@ -47636,12 +57028,15 @@
  212.100.129.238
  212.100.253.201
  212.100.50.142
+212.101.231.27
+212.102.118.90
  212.102.152.184
  212.102.152.6
  212.102.153.109
  212.102.33.137
  212.102.33.202
  212.102.35.106
+212.102.35.205
  212.102.36.166
  212.102.49.251
  212.102.52.201
@@ -47654,9 +57049,11 @@
  212.102.57.210
  212.103.61.157
  212.103.61.160
+212.106.240.169
  212.107.237.28
  212.107.238.101
  212.107.27.15
+212.108.146.218
  212.108.216.5
  212.108.5.60
  212.109.0.153
@@ -47673,6 +57070,7 @@
  212.111.9.245
  212.112.113.235
  212.112.124.123
+212.112.97.242
  212.112.97.27
  212.112.98.98
  212.113.35.162
@@ -47685,9 +57083,11 @@
  212.115.49.239
  212.115.51.55
  212.116.65.244
+212.116.94.217
  212.117.165.14
  212.117.170.192
  212.117.19.215
+212.119.190.162
  212.119.226.86
  212.119.44.181
  212.119.46.128
@@ -47703,15 +57103,22 @@
  212.125.128.12
  212.126.102.142
  212.126.108.172
+212.126.125.10
  212.126.97.83
  212.129.1.25
+212.129.144.231
  212.129.152.27
  212.129.16.22
  212.129.179.53
+212.129.20.162
  212.129.24.79
+212.129.24.83
+212.129.24.84
+212.129.242.171
  212.129.245.90
  212.129.246.52
  212.129.25.23
+212.129.255.123
  212.129.27.74
  212.129.32.95
  212.129.33.167
@@ -47726,9 +57133,11 @@
  212.129.5.154
  212.129.52.130
  212.129.52.198
+212.129.53.188
  212.129.54.16
  212.129.55.0
  212.129.56.216
+212.129.60.77
  212.129.8.55
  212.129.9.107
  212.129.9.233
@@ -47739,6 +57148,9 @@
  212.142.121.168
  212.143.230.27
  212.145.192.205
+212.146.195.160
+212.146.224.121
+212.146.241.36
  212.146.44.91
  212.149.202.12
  212.15.184.190
@@ -47766,7 +57178,10 @@
  212.154.83.124
  212.154.83.130
  212.154.83.99
+212.156.115.58
  212.156.133.218
+212.156.136.114
+212.156.17.218
  212.156.217.202
  212.156.55.34
  212.156.59.70
@@ -47783,6 +57198,10 @@
  212.160.66.194
  212.162.14.222
  212.162.151.144
+212.164.223.20
+212.166.14.59
+212.166.68.146
+212.166.70.184
  212.17.102.75
  212.17.24.79
  212.170.207.29
@@ -47795,6 +57214,9 @@
  212.175.87.57
  212.175.87.9
  212.179.200.192
+212.179.226.17
+212.184.132.226
+212.184.138.170
  212.185.62.33
  212.186.191.177
  212.186.222.236
@@ -47802,6 +57224,7 @@
  212.188.192.20
  212.188.66.218
  212.19.14.26
+212.19.2.69
  212.19.20.115
  212.19.20.87
  212.193.3.106
@@ -47816,6 +57239,7 @@
  212.200.212.50
  212.200.217.80
  212.200.236.42
+212.200.34.202
  212.200.89.254
  212.205.112.162
  212.205.185.170
@@ -47826,6 +57250,7 @@
  212.22.85.104
  212.220.115.246
  212.220.204.238
+212.220.99.211
  212.227.114.114
  212.227.119.183
  212.227.141.53
@@ -47833,7 +57258,6 @@
  212.227.164.228
  212.227.164.87
  212.227.210.81
-212.227.215.238
  212.227.248.216
  212.227.253.11
  212.227.39.1
@@ -47842,6 +57266,7 @@
  212.231.216.2
  212.231.60.98
  212.232.74.75
+212.233.112.134
  212.233.130.198
  212.233.132.178
  212.233.213.29
@@ -47855,6 +57280,8 @@
  212.237.0.244
  212.237.10.57
  212.237.100.181
+212.237.118.183
+212.237.134.85
  212.237.15.70
  212.237.23.60
  212.237.24.117
@@ -47874,6 +57301,7 @@
  212.237.54.93
  212.237.7.173
  212.237.96.98
+212.24.107.243
  212.24.47.68
  212.241.14.104
  212.241.70.213
@@ -47896,9 +57324,12 @@
  212.3.205.85
  212.3.209.158
  212.30.198.16
+212.30.55.161
  212.31cf4fdae.com
  212.32.229.173
  212.32.233.237
+212.33.198.171
+212.33.199.47
  212.33.205.122
  212.33.227.44
  212.33.239.50
@@ -47920,14 +57351,31 @@
  212.41.210.78
  212.42.116.29
  212.42.117.207
+212.42.199.112
  212.42.99.22
  212.42.99.32
  212.46.255.78
+212.47.136.205
+212.47.136.222
+212.47.137.44
+212.47.138.239
+212.47.139.69
+212.47.139.95
+212.47.140.150
+212.47.140.153
+212.47.140.253
+212.47.140.28
+212.47.141.184
+212.47.141.36
+212.47.142.227
+212.47.143.212
+212.47.143.8
  212.47.220.165
  212.47.229.189
  212.47.229.4
  212.47.230.238
  212.47.231.31
+212.47.232.254
  212.47.233.68
  212.47.234.231
  212.47.234.85
@@ -47943,6 +57391,8 @@
  212.48.87.19
  212.49.69.67
  212.49.70.12
+212.5.200.188
+212.5.214.210
  212.50.227.91
  212.51.132.226
  212.51.136.133
@@ -47967,38 +57417,65 @@
  212.59.11.71
  212.59.30.110
  212.59.6.16
+212.60.162.178
  212.60.21.66
  212.60.5.220
  212.62.210.176
  212.63.206.39
+212.64.1.170
  212.64.1.42
  212.64.100.82
  212.64.102.106
+212.64.111.18
+212.64.13.147
+212.64.14.185
+212.64.23.30
  212.64.25.106
  212.64.29.136
  212.64.3.194
  212.64.32.67
+212.64.33.244
  212.64.38.8
+212.64.4.3
  212.64.40.200
  212.64.47.123
  212.64.49.70
+212.64.5.28
  212.64.55.229
+212.64.60.50
  212.64.65.2
+212.64.66.135
  212.64.66.208
  212.64.67.230
  212.64.68.71
+212.64.69.175
+212.64.7.134
+212.64.71.225
+212.64.71.254
  212.64.74.214
+212.64.76.91
+212.64.77.173
  212.64.78.28
+212.64.79.154
  212.64.8.10
+212.64.83.215
  212.64.86.16
  212.64.90.129
+212.64.91.105
+212.64.91.114
+212.64.95.187
  212.66.152.231
  212.67.0.150
  212.67.205.246
  212.68.168.178
+212.68.218.36
+212.68.244.157
  212.69.19.223
  212.69.218.47
  212.7.20.104
+212.70.149.54
+212.70.149.70
+212.70.149.85
  212.71.233.31
  212.71.237.140
  212.71.238.147
@@ -48015,6 +57492,7 @@
  212.73.131.30
  212.73.150.21
  212.73.69.6
+212.75.22.200
  212.77.43.160
  212.79.169.50
  212.8.189.20
@@ -48025,6 +57503,7 @@
  212.8.250.141
  212.8.251.41
  212.80.219.11
+212.81.134.86
  212.81.208.102
  212.83.129.80
  212.83.130.32
@@ -48037,6 +57516,7 @@
  212.83.139.203
  212.83.140.195
  212.83.141.195
+212.83.144.11
  212.83.146.233
  212.83.150.172
  212.83.152.183
@@ -48060,8 +57540,12 @@
  212.83.58.216
  212.83.58.219
  212.83.58.231
+212.85.128.39
+212.85.69.14
  212.86.114.74
  212.86.32.106
+212.86.97.111
+212.87.243.90
  212.89.173.216
  212.9.185.194
  212.90.166.34
@@ -48070,6 +57554,7 @@
  212.90.58.56
  212.91.163.140
  212.91.181.154
+212.91.184.5
  212.91.188.166
  212.91.91.242
  212.91.91.246
@@ -48083,6 +57568,8 @@
  212.92.23.235
  212.93.109.186
  212.93.114.14
+212.95.110.30
+212.95.137.19
  212.95.142.64
  212.95.148.53
  212.95.41.41
@@ -48091,6 +57578,7 @@
  212.98.171.75
  212.98.171.91
  212.98.190.22
+212.98.97.152
  212.99.226.35
  2122159.cloudcommercepro.com
  213.0.86.62
@@ -48099,11 +57587,15 @@
  213.1.216.201
  213.10.100.182
  213.10.181.49
+213.100.212.187
  213.101.151.4
  213.102.68.48
+213.103.146.222
  213.105.29.14
  213.108.119.84
  213.108.18.34
+213.108.199.151
+213.108.200.11
  213.108.248.127
  213.108.249.127
  213.108.5.224
@@ -48116,6 +57608,7 @@
  213.109.238.204
  213.109.6.85
  213.110.117.154
+213.110.206.48
  213.111.123.68
  213.111.197.180
  213.111.197.81
@@ -48132,7 +57625,9 @@
  213.124.184.182
  213.125.144.146
  213.125.67.108
+213.127.100.61
  213.127.189.18
+213.128.188.23
  213.129.99.10
  213.131.7.103
  213.133.100.200
@@ -48170,6 +57665,7 @@
  213.14.6.17
  213.14.6.2
  213.14.6.5
+213.141.131.22
  213.141.157.220
  213.141.41.178
  213.141.47.155
@@ -48186,15 +57682,20 @@
  213.149.103.132
  213.149.171.218
  213.149.190.193
+213.150.206.88
  213.152.106.56
  213.152.161.101
  213.152.161.40
  213.152.176.162
  213.152.186.168
  213.154.0.120
+213.154.2.42
  213.154.3.102
+213.154.70.102
+213.154.80.21
  213.155.114.205
  213.155.3.216
+213.158.29.179
  213.159.200.3
  213.159.204.3
  213.159.251.88
@@ -48209,6 +57710,7 @@
  213.160.91.138
  213.162.112.80
  213.162.22.190
+213.163.122.206
  213.163.181.33
  213.163.73.106
  213.163.73.12
@@ -48245,6 +57747,7 @@
  213.171.225.234
  213.171.37.206
  213.171.50.48
+213.172.40.18
  213.172.49.129
  213.172.83.200
  213.172.89.227
@@ -48263,8 +57766,11 @@
  213.175.62.19
  213.176.36.147
  213.176.36.42
+213.176.60.74
  213.177.107.170
  213.178.155.74
+213.178.215.124
+213.178.252.28
  213.178.252.30
  213.178.28.118
  213.178.38.246
@@ -48299,14 +57805,19 @@
  213.190.100.135
  213.190.50.166
  213.193.19.21
+213.193.42.1
  213.193.83.251
  213.193.89.242
  213.194.129.251
  213.194.149.28
+213.194.168.204
  213.194.173.90
+213.194.99.235
+213.194.99.250
  213.195.127.45
  213.198.161.64
  213.198.67.46
+213.199.198.85
  213.200.221.94
  213.202.212.78
  213.202.255.4
@@ -48319,14 +57830,18 @@
  213.207.92.226
  213.208.164.14
  213.208.191.82
+213.208.217.206
  213.210.67.186
+213.215.0.122
  213.215.24.158
  213.216.229.245
  213.216.48.21
  213.216.48.9
  213.216.80.33
+213.217.229.34
  213.218.137.112
  213.218.154.210
+213.218.204.46
  213.219.164.208
  213.219.210.178
  213.219.210.180
@@ -48340,21 +57855,29 @@
  213.226.11.149
  213.226.114.189
  213.226.80.70
+213.227.135.173
+213.227.139.142
  213.227.154.145
  213.227.155.145
  213.227.57.58
  213.227.93.117
+213.228.74.83
  213.229.125.87
  213.229.60.50
  213.229.86.240
  213.23.12.149
+213.230.107.202
  213.230.110.39
  213.230.127.140
+213.230.67.32
  213.230.69.33
+213.230.70.146
+213.230.71.0
  213.230.77.13
  213.230.96.243
  213.231.21.109
  213.232.87.72
+213.232.87.74
  213.233.57.134
  213.234.0.242
  213.234.119.4
@@ -48385,7 +57908,9 @@
  213.241.53.122
  213.241.94.243
  213.241.94.246
+213.243.228.170
  213.244.123.182
+213.244.8.59
  213.245.241.3
  213.247.197.142
  213.248.39.163
@@ -48395,6 +57920,7 @@
  213.251.132.198
  213.251.170.122
  213.251.182.110
+213.251.184.102
  213.251.184.38
  213.251.189.204
  213.252.244.108
@@ -48411,13 +57937,19 @@
  213.26.236.146
  213.26.236.150
  213.27.152.15
+213.27.189.252
  213.3.24.104
  213.3.25.204
  213.3.26.176
  213.31.57.105
+213.32.103.2
+213.32.103.54
  213.32.108.123
+213.32.111.52
  213.32.113.159
  213.32.126.47
+213.32.22.189
+213.32.23.54
  213.32.25.91
  213.32.252.120
  213.32.252.237
@@ -48426,24 +57958,35 @@
  213.32.254.240
  213.32.27.198
  213.32.30.227
+213.32.31.108
  213.32.32.23
  213.32.46.100
  213.32.47.9
  213.32.63.123
  213.32.63.93
  213.32.71.196
+213.32.77.242
+213.32.78.219
  213.32.83.233
+213.32.91.216
  213.32.91.37
+213.32.91.71
+213.32.92.57
+213.32.96.47
  213.33.157.204
  213.33.179.242
  213.33.179.244
+213.33.73.1
  213.34.115.158
  213.35.152.193
  213.35.152.198
  213.35.233.247
  213.37.205.33
  213.37.5.133
+213.39.55.13
+213.39.63.107
  213.4.38.162
+213.4.59.226
  213.42.28.185
  213.42.95.134
  213.46.85.185
@@ -48463,7 +58006,9 @@
  213.6.101.174
  213.6.107.222
  213.6.116.222
+213.6.118.170
  213.6.122.225
+213.6.130.133
  213.6.141.114
  213.6.141.146
  213.6.144.78
@@ -48496,10 +58041,12 @@
  213.7.196.26
  213.7.96.25
  213.79.101.98
+213.8.246.218
  213.80.160.166
  213.80.166.5
  213.80.225.40
  213.81.155.129
+213.81.161.155
  213.81.178.129
  213.81.178.130
  213.81.178.133
@@ -48528,12 +58075,14 @@
  213.81.178.253
  213.81.182.29
  213.81.203.66
+213.82.39.68
  213.86.150.242
  213.86.23.219
  213.86.4.51
  213.87.245.215
  213.89.131.35
  213.89.131.53
+213.89.23.171
  213.91.187.242
  213.91.202.230
  213.91.221.54
@@ -48544,6 +58093,7 @@
  213.92.191.122
  213.93.145.183
  213.93.176.58
+213.94.55.1
  213.94.59.246
  213.95.149.22
  213.96.16.193
@@ -48561,33 +58111,40 @@
  216.10.242.97
  216.10.245.150
  216.10.247.146
+216.10.251.112
  216.104.15.130
  216.104.37.122
  216.104.40.170
  216.105.168.216
+216.105.223.199
  216.107.149.82
  216.107.238.165
  216.108.227.39
  216.108.236.43
+216.114.108.65
  216.115.153.201
  216.115.227.160
  216.117.136.95
  216.118.233.141
  216.118.233.142
+216.118.251.2
  216.12.164.110
  216.120.237.30
  216.121.123.115
  216.121.63.153
  216.126.225.148
  216.126.225.163
+216.126.239.38
  216.126.41.115
  216.126.41.89
  216.126.82.39
+216.127.164.142
  216.127.171.242
  216.13.56.89
  216.137.244.18
  216.138.32.4
  216.138.34.116
+216.14.149.135
  216.143.116.8
  216.144.120.16
  216.144.243.34
@@ -49374,6 +58931,7 @@
  216.151.183.124
  216.151.183.52
  216.151.183.70
+216.151.184.46
  216.152.249.0
  216.152.249.1
  216.152.249.10
@@ -49888,6 +59446,7 @@
  216.152.252.99
  216.154.201.132
  216.155.151.198
+216.155.90.238
  216.157.21.35
  216.157.27.59
  216.158.192.32
@@ -49906,6 +59465,7 @@
  216.160.87.37
  216.161.110.192
  216.161.155.26
+216.161.214.11
  216.164.16.190
  216.164.192.25
  216.164.252.78
@@ -49929,10 +59489,13 @@
  216.171.167.38
  216.172.109.153
  216.172.109.155
+216.172.165.70
  216.172.191.192
  216.173.146.223
  216.176.190.232
  216.177.140.4
+216.177.141.15
+216.177.187.101
  216.177.193.90
  216.18.178.238
  216.18.201.130
@@ -49973,12 +59536,16 @@
  216.191.44.114
  216.191.44.121
  216.193.128.54
+216.194.170.233
+216.195.17.30
  216.196.140.205
  216.199.232.112
  216.20.131.111
+216.200.107.94
  216.200.166.188
  216.207.207.150
  216.208.127.101
+216.208.226.25
  216.211.180.40
  216.212.243.150
  216.213.170.114
@@ -50008,6 +59575,7 @@
  216.236.164.82
  216.238.244.19
  216.238.247.140
+216.24.178.253
  216.24.193.163
  216.24.249.75
  216.24.76.65
@@ -50030,6 +59598,7 @@
  216.244.86.114
  216.244.87.179
  216.244.93.52
+216.245.193.22
  216.245.206.226
  216.245.220.19
  216.246.109.114
@@ -50061,7 +59630,9 @@
  216.47.216.113
  216.47.235.66
  216.47.42.18
+216.49.225.186
  216.49.37.157
+216.49.54.211
  216.55.141.92
  216.55.146.49
  216.56.31.99
@@ -50114,12 +59685,15 @@
  21625.xc.iziyo.com
  2162e66b18eb.ngrok.io
  217.10.103.163
+217.10.103.170
  217.10.144.19
+217.100.104.238
  217.100.189.106
  217.100.97.156
  217.103.144.253
  217.103.94.158
  217.104.75.11
+217.104.91.86
  217.106.225.134
  217.107.194.5
  217.107.197.240
@@ -50127,10 +59701,13 @@
  217.107.71.14
  217.11.157.141
  217.11.157.92
+217.11.182.59
  217.11.225.189
  217.11.249.81
  217.11.48.184
+217.110.107.176
  217.111.197.123
+217.111.239.37
  217.111.245.138
  217.112.21.78
  217.112.92.251
@@ -50151,15 +59728,17 @@
  217.12.221.131
  217.12.223.51
  217.12.57.89
+217.12.66.21
  217.12.66.26
  217.12.68.58
  217.120.202.189
  217.123.170.239
  217.126.50.212
-217.127.133.214
  217.128.133.129
  217.128.179.60
+217.128.199.182
  217.128.8.98
+217.129.143.86
  217.13.106.14
  217.13.107.26
  217.13.201.233
@@ -50170,10 +59749,12 @@
  217.131.182.240
  217.131.2.232
  217.133.12.80
+217.133.138.66
  217.133.40.144
  217.133.58.148
  217.133.95.209
  217.136.13.236
+217.138.192.28
  217.138.202.42
  217.138.205.162
  217.138.212.190
@@ -50184,8 +59765,10 @@
  217.138.252.221
  217.14.7.228
  217.14.7.228bin.sh
+217.141.89.154
  217.145.150.19
  217.145.199.45
+217.145.32.167
  217.145.94.94
  217.146.27.52
  217.146.27.53
@@ -50223,6 +59806,8 @@
  217.160.59.241
  217.160.59.64
  217.160.65.177
+217.160.69.194
+217.160.78.166
  217.163.11.111
  217.163.28.231
  217.168.76.230
@@ -50230,8 +59815,10 @@
  217.169.16.126
  217.169.210.130
  217.169.211.50
+217.169.222.210
  217.169.3.167
  217.169.46.98
+217.17.17.74
  217.17.237.197
  217.170.197.89
  217.170.204.126
@@ -50256,6 +59843,7 @@
  217.182.138.31
  217.182.138.4
  217.182.138.8
+217.182.140.117
  217.182.141.253
  217.182.142.251
  217.182.164.159
@@ -50273,22 +59861,32 @@
  217.182.197.93
  217.182.198.173
  217.182.198.228
+217.182.199.121
  217.182.201.204
  217.182.205.27
  217.182.217.24
  217.182.225.67
  217.182.23.55
+217.182.236.67
+217.182.250.191
  217.182.253.217
+217.182.253.249
  217.182.27.217
  217.182.30.160
+217.182.32.41
  217.182.37.121
  217.182.38.130
  217.182.38.147
+217.182.42.222
+217.182.45.107
  217.182.54.204
  217.182.54.205
  217.182.54.210
+217.182.66.235
+217.182.67.242
  217.182.68.147
  217.182.68.93
+217.182.70.150
  217.182.71.175
  217.182.78.180
  217.182.78.195
@@ -50297,7 +59895,6 @@
  217.182.95.74
  217.19.209.253
  217.19.216.210
-217.19.244.58
  217.194.6.58
  217.195.164.4
  217.195.202.34
@@ -50326,7 +59923,9 @@
  217.21.124.194
  217.21.125.179
  217.21.125.180
+217.21.193.74
  217.21.54.173
+217.21.54.221
  217.211.101.29
  217.211.51.143
  217.216.106.107
@@ -50334,6 +59933,7 @@
  217.218.233.164
  217.22.141.61
  217.22.60.25
+217.229.48.139
  217.23.12.100
  217.23.12.47
  217.23.3.251
@@ -50341,24 +59941,32 @@
  217.23.4.32
  217.23.5.68
  217.23.69.146
+217.23.74.198
  217.23.8.80
  217.23.81.223
+217.230.223.121
+217.230.223.180
+217.232.151.226
  217.233.46.138
  217.237.112.101
  217.24.18.226
  217.24.240.68
  217.24.72.52
+217.25.113.79
  217.25.198.133
  217.25.221.60
  217.25.229.134
  217.25.25.246
  217.25.31.20
+217.250.115.106
  217.250.115.56
  217.255.187.89
  217.26.163.82
  217.26.47.10
+217.27.117.136
  217.27.193.106
  217.27.219.14
+217.29.126.136
  217.29.18.206
  217.29.28.199
  217.31.48.13
@@ -50388,12 +59996,15 @@
  217.64.113.195
  217.64.133.220
  217.64.149.184
+217.64.2.185
  217.64.42.157
  217.64.42.35
  217.64.47.138
+217.65.127.48
  217.65.6.12
  217.66.106.216
  217.66.223.48
+217.67.152.167
  217.67.182.170
  217.67.184.186
  217.69.13.110
@@ -50409,7 +60020,9 @@
  217.70.150.8
  217.70.191.85
  217.70.30.101
+217.70.32.9
  217.72.1.254
+217.72.125.128
  217.72.207.191
  217.72.219.148
  217.72.4.157
@@ -50417,6 +60030,7 @@
  217.73.143.80
  217.75.213.26
  217.76.45.235
+217.76.75.88
  217.77.221.209
  217.77.46.38
  217.77.62.21
@@ -50424,8 +60038,10 @@
  217.78.61.143
  217.79.178.53
  217.79.182.245
+217.79.184.243
  217.79.184.43
  217.79.189.139
+217.79.197.5
  217.79.3.94
  217.8.117.10
  217.8.117.132
@@ -50448,26 +60064,38 @@
  217.87.222.191
  217.9.50.45
  217.91.215.177
+217.92.128.231
  217.92.44.164
  217.92.55.246
  217.95.160.149
+217.96.228.206
  217.97.73.173
  217538-dot-n-e-w-me-ss-age-po-rt-al.wl.r.appspot.com
  218.101.202.186
+218.103.37.55
+218.104.153.60
  218.106.167.102
  218.106.244.72
  218.108.109.90
+218.108.140.245
  218.108.31.28
  218.108.32.102
+218.108.32.210
+218.108.39.210
+218.11.10.252
+218.13.165.166
  218.14.109.42
  218.14.208.90
  218.144.62.85
  218.145.29.142
  218.146.20.61
+218.146.21.148
  218.146.246.184
  218.147.42.191
  218.148.103.136
+218.149.128.186
  218.150.109.3
+218.150.216.229
  218.150.243.158
  218.150.85.170
  218.152.150.177
@@ -50475,6 +60103,8 @@
  218.153.168.50
  218.153.89.102
  218.154.222.46
+218.155.162.71
+218.155.199.58
  218.155.48.210
  218.155.48.210bin.sh
  218.156.226.141
@@ -50484,23 +60114,34 @@
  218.158.113.142bin.sh
  218.158.113.154
  218.158.57.21
+218.159.85.196
+218.159.85.197
+218.159.85.198
  218.16.204.227
  218.161.39.151
  218.166.36.57
+218.17.162.119
  218.17.185.162
  218.17.185.223
  218.17.228.102
  218.18.101.84
+218.18.161.186
  218.18.232.29
+218.18.90.50
  218.185.20.88
  218.188.39.33
  218.188.39.51
  218.188.39.59
  218.189.19.30
+218.19.164.115
+218.192.12.166
  218.193.191.123
  218.2.106.125
  218.2.53.161
  218.203.206.137
+218.204.46.170
+218.206.233.198
+218.207.170.134
  218.208.209.217
  218.208.21.7
  218.21.170.15
@@ -50523,12 +60164,17 @@
  218.21.171.51
  218.21.171.55
  218.21.171.57
+218.21.71.36
  218.21.78.35
+218.212.171.35
  218.213.137.21
  218.217.114.239
+218.219.238.62
  218.219.99.184
  218.22.127.176
+218.22.190.133
  218.22.27.14
+218.22.36.135
  218.227.171.11
  218.23.9.170
  218.232.109.160
@@ -50539,44 +60185,70 @@
  218.236.113.49
  218.237.207.2
  218.237.207.58
+218.237.253.167
  218.237.65.52
  218.238.2.226
  218.24.16.198
  218.241.234.48
+218.242.33.29
+218.245.1.169
  218.246.20.221
  218.246.22.202
  218.247.40.100
+218.248.116.142
  218.248.232.24
+218.248.64.239
  218.249.175.227
  218.249.45.162
+218.25.130.220
+218.25.161.226
+218.25.89.99
+218.250.224.35
+218.253.81.214
  218.255.136.110
+218.255.151.12
  218.255.226.166
+218.255.240.34
  218.255.242.114
  218.255.245.10
  218.255.86.29
+218.255.94.186
  218.26.101.226
+218.26.172.61
  218.26.243.138
  218.27.202.183
  218.27.203.107
+218.28.108.237
  218.28.132.182
  218.28.133.53
  218.28.160.174
+218.28.238.162
  218.28.30.125
+218.28.83.106
+218.28.98.161
  218.29.128.195
  218.29.139.3
  218.29.16.11
+218.29.188.139
+218.29.188.169
+218.29.196.186
+218.29.239.174
  218.29.41.78
+218.29.54.108
  218.29.54.87
  218.29.85.98
  218.3.194.137
  218.3.223.134
  218.30.21.209
  218.30.5.19
+218.30.91.130
  218.31.0.109
  218.31.18.187
  218.31.2.125
  218.31.3.83
+218.31.36.22
  218.35.45.116
+218.36.86.40
  218.38.12.110
  218.38.12.29
  218.38.136.125
@@ -50589,81 +60261,157 @@
  218.38.56.83
  218.39.130.113
  218.39.91.20
+218.4.239.146
  218.4.62.141
  218.5.74.92
  218.50.52.241
+218.51.205.132
  218.53.142.200
  218.53.89.239
+218.54.123.239
  218.54.149.67
+218.54.175.51
  218.55.227.145
  218.56.11.181
+218.56.11.236
+218.56.155.106
+218.56.160.82
  218.56.226.68
  218.56.65.232
+218.56.69.11
  218.56.71.164
  218.57.118.56
  218.57.210.226
+218.57.213.9
+218.57.237.243
  218.57.51.87
  218.57.51.87bin.sh
+218.57.55.87
  218.57.81.236
+218.57.87.42
+218.58.104.202
  218.58.194.162
  218.58.83.60
  218.58.96.189
  218.59.118.11
  218.59.13.88
+218.59.139.12
  218.59.14.132
  218.59.193.14
-218.59.20.144
+218.59.235.26
  218.59.235.30
-218.59.27.35
  218.59.34.248
  218.59.46.158
  218.59.98.138bin.sh
  218.59.98.44
  218.6.106.104
+218.6.160.15
  218.60.22.20
+218.60.31.162
+218.60.41.136
  218.60.8.99
  218.61.194.13
  218.63.242.237
  218.64.252.168
+218.64.57.12
  218.64.69.79
  218.65.219.119
  218.65.221.24
  218.65.6.37
+218.66.81.90
  218.69.65.76
+218.69.91.84
  218.70.148.133
  218.70.66.187
  218.71.141.62
  218.72.248.42
+218.72.49.84
+218.73.128.154
+218.73.135.80
  218.73.60.118
+218.75.110.41
+218.75.110.51
  218.75.121.74
+218.75.156.247
+218.75.190.215
+218.75.210.46
  218.75.69.50
+218.75.72.82
  218.75.77.92
+218.76.101.25
+218.76.159.239
  218.76.223.50
+218.76.52.120
+218.76.69.43
  218.76.8.99
+218.77.108.48
  218.78.104.127
  218.78.209.1
  218.78.209.241
+218.78.46.81
+218.78.50.164
+218.78.93.40
  218.8.251.187
  218.81.48.153
+218.81.52.172
+218.82.136.117
+218.84.236.94
+218.85.119.92
  218.86.155.143
+218.86.31.67
  218.86.60.18
  218.86.87.171
  218.86.95.156
+218.87.254.235
+218.88.204.17
+218.88.205.3
+218.88.205.62
+218.88.215.49
+218.88.31.128
+218.88.31.165
+218.88.45.238
+218.89.222.16
  218.89.222.178
  218.89.81.109
  218.9.54.244
+218.90.138.98
  218.90.171.214
+218.92.0.190
+218.92.0.191
+218.92.0.192
+218.92.0.195
+218.92.0.200
+218.92.0.201
+218.92.0.202
+218.92.0.203
+218.92.0.206
+218.92.0.207
+218.92.0.210
+218.92.0.211
+218.92.0.248
+218.92.150.130
+218.92.150.134
  218.92.173.58
  218.92.175.102
  218.92.192.170
+218.92.24.69
  218.92.40.162
  218.93.119.90
+218.93.12.178
+218.93.14.42
  218.93.172.55
+218.93.208.150
+218.93.21.43
+218.93.220.102
  218.93.225.150
+218.94.136.90
  218.94.149.234
  218.94.149.235
  218.94.57.157
  218.94.71.198
+218.95.14.44
+218.95.175.166
+218.95.182.38
  218.95.37.66
  218270aa6e0294fb7a7a4f77229e10301cd5aec3.info
  218711.com
@@ -50671,73 +60419,104 @@
  21897secured.info
  218betasus.com
  219.101.192.141
+219.111.105.182
  219.111.2.38
  219.117.196.250
  219.117.223.106
  219.119.136.54
  219.121.0.60
  219.131.193.180
+219.133.177.109
+219.134.218.248
  219.135.209.164
  219.135.97.82
+219.136.249.151
+219.137.113.64
  219.137.248.236
  219.137.248.36
+219.137.52.101
+219.137.74.24
  219.138.184.228
-219.139.203.60
+219.139.191.129
+219.140.115.133
  219.140.198.51
  219.140.234.19
  219.141.231.161
+219.143.171.36
  219.143.38.232
  219.144.82.202
  219.145.93.38
  219.146.127.6
+219.146.247.126
  219.147.112.150
+219.147.206.11
+219.147.74.48
+219.147.99.190
  219.148.31.135
  219.150.93.157
  219.151.149.33
+219.151.151.202
  219.151.152.196
  219.151.248.79
  219.151.9.139
+219.152.169.167
+219.152.170.58
+219.152.170.95
+219.153.100.153
+219.153.103.46
  219.153.20.224
+219.153.33.234
  219.154.102.109
-219.154.106.202
-219.154.123.63
+219.154.104.32
+219.154.105.253
  219.154.160.74
  219.154.228.155
  219.154.81.150
+219.154.81.241
+219.154.96.248
  219.155.210.213
  219.155.215.80
  219.155.23.198
-219.155.246.9
  219.155.29.160
+219.155.37.18
+219.155.39.247
  219.155.69.108
  219.155.8.79
  219.155.96.191
-219.156.13.153
-219.156.15.147
-219.156.16.145
-219.156.16.156
+219.156.107.98
+219.156.161.4
+219.156.182.211
  219.156.188.241
  219.156.23.136
  219.156.62.111
  219.156.77.236
-219.156.90.139
-219.157.132.154
+219.156.9.204
+219.157.133.116
+219.157.133.79
  219.157.134.45
  219.157.168.233
+219.157.179.20
  219.157.180.166
  219.157.183.106
+219.157.204.252
+219.157.213.128
  219.157.214.236
  219.157.221.183
  219.157.235.93
+219.157.241.180
+219.157.246.74
  219.157.251.185
+219.157.253.44
+219.157.27.216
  219.157.32.53
  219.157.36.105
-219.157.38.1
+219.157.50.168
  219.157.54.191
  219.157.54.231
  219.232.124.237
  219.232.48.190
  219.233.217.123
+219.234.8.165
  219.235.3.182
  219.238.180.114
  219.239.83.18
@@ -50746,21 +60525,29 @@
  219.240.36.36
  219.240.39.223
  219.240.39.230
+219.240.99.108
  219.241.6.180
  219.248.137.7
+219.254.36.16
  219.255.134.109
  219.255.197.90
+219.255.230.95
  219.255.42.109
+219.59.165.54
  219.68.163.7
  219.68.2.48
  219.68.245.229
  219.69.110.49
  219.70.215.34
+219.74.195.86
  219.76.192.202
  219.76.200.27
+219.77.230.232
  219.79.154.231
+219.79.172.219
  219.80.133.57
  219.83.125.35
+219.83.191.104
  219.84.106.91
  219.84.234.73
  219.84.28.244
@@ -50774,16 +60561,24 @@
  219.85.63.226
  219.90.174.233
  219.91.110.131
+219.91.153.198
+219.91.241.15
  219.91.255.178
  219.91.255.179
+219.91.64.192
+219.92.103.234
  219.92.13.25
-219.92.19.81
  219.92.228.222
  219.92.59.93
+219.92.6.185
+219.93.110.60
+219.93.127.126
  219.94.128.174
  219.94.194.248
  219.94.198.80
  219.94.242.134
+219.94.94.161
+219.95.75.56
  219.99.169.49
  21906.8wix.com
  219236-dot-n-e-w-me-ss-age-po-rt-al.wl.r.appspot.com
@@ -50795,25 +60590,36 @@
  21ltempobet.com
  21robo.com
  220-365.net
+220.110.145.21
  220.116.55.86
  220.116.55.86bin.sh
  220.116.58.28
  220.117.141.40
+220.117.160.182
  220.118.168.155
+220.120.106.254
  220.120.15.27
+220.120.20.130
  220.121.112.170
  220.122.105.26
  220.122.253.188
  220.123.122.250bin.sh
+220.123.175.73
  220.123.235.22
  220.123.239.163
+220.123.241.30
  220.124.102.47
  220.124.192.178
+220.124.239.208
  220.125.119.207
  220.125.223.105
  220.125.237.35
+220.127.198.153
+220.128.159.121
  220.130.10.13
+220.130.148.106
  220.130.151.85
+220.130.223.252
  220.130.9.117
  220.132.135.54
  220.132.19.136
@@ -50821,11 +60627,15 @@
  220.132.27.154
  220.132.57.245
  220.132.62.188
+220.132.75.140
  220.132.86.14
  220.132.86.21
  220.133.209.253
+220.133.223.7
  220.133.230.106
  220.133.39.61
+220.133.95.68
+220.134.194.168
  220.134.38.32
  220.135.2.247
  220.135.49.221
@@ -50841,7 +60651,13 @@
  220.158.216.139
  220.158.216.15
  220.158.226.71
+220.163.200.4
  220.164.118.16
+220.164.161.201
+220.165.111.249
+220.166.42.139
+220.167.179.184
+220.167.228.95
  220.168.183.132
  220.168.209.70
  220.168.238.82bin.sh
@@ -50849,26 +60665,42 @@
  220.168.240.227
  220.168.52.245
  220.169.127.172
+220.170.89.89
  220.171.104.130
+220.171.93.62
  220.173.160.221
  220.173.160.221bin.sh
  220.177.92.227
+220.178.171.184
+220.178.221.74
+220.179.231.168
  220.179.231.197
+220.180.112.208
  220.180.119.192
  220.180.192.152
+220.180.192.77
  220.181.108.160
  220.181.108.84
  220.181.187.187
+220.181.58.12
  220.181.77.162
+220.184.68.222
  220.185.195.156
  220.185.198.208
  220.185.215.165
+220.189.70.224
+220.189.71.201
+220.189.71.212
  220.191.179.102
+220.194.140.38
  220.194.237.2
  220.194.248.144
  220.194.59.89
+220.196.1.142
  220.202.12.149
+220.210.140.71
  220.211.115.214
+220.225.126.55
  220.225.87.129
  220.226.103.254
  220.226.188.32
@@ -50882,6 +60714,8 @@
  220.240.220.194
  220.245.124.14
  220.245.198.194
+220.246.37.182
+220.246.66.166
  220.247.166.135
  220.247.174.12
  220.247.174.202
@@ -50889,12 +60723,19 @@
  220.247.174.234
  220.247.174.236
  220.247.174.238
+220.248.164.17
  220.248.188.75
+220.248.95.178
+220.249.103.44
+220.250.50.90
  220.255.1.162
+220.66.155.2
+220.67.70.6
  220.70.43.145bin.sh
  220.71.140.168
  220.71.140.168bin.sh
  220.72.113.18
+220.72.184.133
  220.72.87.151
  220.73.134.140
  220.73.144.196
@@ -50911,23 +60752,35 @@
  220.78.108.217
  220.78.170.103
  220.78.218.116
+220.78.28.68
  220.79.131.182
  220.79.180.243
  220.79.34.109
  220.80.108.150
  220.80.90.89
+220.81.113.77
+220.81.118.211
  220.81.13.97
  220.81.200.65
+220.83.67.225
  220.84.179.125
+220.85.104.202
  220.85.144.169
+220.85.233.146
+220.86.227.220
  220.86.29.35
+220.87.29.2
  220.87.94.21
  220.87.94.21bin.sh
+220.88.1.208
  220.88.67.211
  220.89.71.36
+220.90.242.49
+220.92.137.31
  220.92.208.198
  220.92.208.230
  220.92.208.35
+220.94.220.106
  220.94.53.193
  220.94.66.153bin.sh
  220.94.87.179
@@ -50940,10 +60793,13 @@
  221.0.125.22
  221.0.152.13
  221.0.190.91
+221.0.94.20
  221.1.174.251
  221.1.200.242
  221.1.220.185
  221.10.141.8
+221.118.117.219
+221.12.105.58
  221.120.189.209
  221.120.199.35
  221.120.98.49
@@ -50951,6 +60807,10 @@
  221.121.12.238
  221.121.145.137
  221.121.145.159
+221.122.119.50
+221.122.73.130
+221.122.74.126
+221.122.78.202
  221.122.91.50
  221.122.91.51
  221.122.91.59
@@ -50960,61 +60820,87 @@
  221.122.91.65
  221.122.91.66
  221.122.91.74
+221.122.93.178
  221.122.93.227
-221.13.251.89
+221.126.244.72
+221.13.183.119
+221.13.237.55
+221.131.165.119
+221.131.165.124
+221.131.165.85
+221.131.165.86
+221.131.165.87
  221.132.101.247
  221.133.60.167
  221.133.7.121
  221.138.17.241
  221.139.0.56
  221.139.0.75
+221.139.207.238
  221.139.3.168
  221.139.50.13
+221.14.11.120
  221.14.122.28
  221.14.152.158
-221.14.196.170
  221.14.7.241
  221.141.1.113
+221.141.253.171
  221.141.3.104
  221.141.86.121
+221.142.217.121
  221.143.29.189
  221.143.40.35
  221.143.40.39
+221.143.48.143
  221.143.48.34
  221.144.226.155
  221.146.152.30
  221.146.28.163
  221.146.36.121
+221.147.217.184
  221.148.107.154
  221.148.123.67
+221.148.30.225
+221.148.45.168
  221.15.11.116
+221.15.124.61
+221.15.125.205
+221.15.143.14
  221.15.145.158
+221.15.146.80
  221.15.176.96
+221.15.189.213
  221.15.196.210
  221.15.22.0
  221.15.22.137
  221.15.22.26
  221.15.224.195
  221.15.234.55
-221.15.234.66
-221.15.252.65
  221.15.254.71
  221.15.255.184
  221.15.4.174
+221.15.5.135
  221.15.54.162
  221.15.6.110
+221.15.61.136
+221.15.7.115
  221.150.22.201
+221.150.43.110
  221.151.207.173
  221.151.26.232
+221.152.34.222
  221.153.211.94
  221.154.43.88
  221.156.114.167
  221.156.126.1
+221.156.143.20
  221.156.35.214
  221.158.33.13
  221.158.33.23
+221.159.155.120
  221.159.237.189
  221.159.237.189bin.sh
+221.159.47.113
  221.160.129.2
  221.160.177.112
  221.160.177.153
@@ -51028,19 +60914,29 @@
  221.161.31.8
  221.164.122.198
  221.164.211.139bin.sh
+221.164.38.249
  221.165.13.155
  221.165.252.143
  221.166.250.205
  221.166.250.205bin.sh
  221.167.196.160
+221.178.221.214
  221.179.216.81
  221.181.185.135
  221.181.185.140
+221.181.185.141
+221.181.185.143
+221.181.185.148
+221.181.185.19
+221.181.185.198
  221.181.185.220
+221.181.185.221
  221.181.185.223
  221.181.185.29
+221.182.204.114
  221.192.138.58
  221.192.199.35
+221.192.241.97
  221.192.244.242
  221.195.1.201
  221.195.73.68
@@ -51048,13 +60944,18 @@
  221.196.121.238
  221.198.173.252
  221.199.149.66
+221.2.157.133
  221.2.35.78
+221.2.63.234
  221.200.110.249
  221.200.120.93
  221.202.168.254
+221.203.107.22
  221.203.169.50
  221.204.177.58
  221.207.122.234
+221.209.17.222
+221.210.134.9
  221.210.211.102
  221.210.211.11
  221.210.211.12
@@ -51076,7 +60977,11 @@
  221.210.211.50
  221.210.211.60
  221.210.211.8
+221.210.80.133
+221.210.82.174
+221.213.221.232
  221.213.26.61
+221.213.63.210
  221.214.110.130
  221.214.128.2
  221.214.130.215
@@ -51091,7 +60996,10 @@
  221.214.229.168
  221.214.254.224
  221.214.74.10
+221.214.9.158
  221.215.109.185
+221.215.149.34
+221.215.154.71
  221.215.167.86
  221.215.192.172
  221.215.199.46
@@ -51099,40 +61007,64 @@
  221.215.233.153
  221.215.234.14
  221.215.235.3
-221.215.237.220
  221.215.5.225
  221.215.82.167
  221.215.82.87
  221.216.142.174
  221.216.205.26
+221.216.95.120
+221.218.247.202
+221.218.6.146
  221.223.26.158
  221.224.213.156
-221.224.28.51
+221.225.126.57
  221.225.129.63
+221.225.170.96
+221.225.68.96
+221.225.81.86
+221.225.82.74
+221.225.83.45
+221.226.184.178
+221.226.196.131
+221.226.39.202
  221.226.48.102
  221.226.94.218
+221.227.106.237
+221.227.106.48
+221.227.109.59
+221.227.109.63
+221.227.111.93
  221.227.125.75
+221.228.109.146
  221.228.240.130
  221.229.144.191
  221.229.183.115
  221.229.190.64
  221.229.199.103
+221.229.200.47
  221.229.218.50
  221.229.223.2
  221.229.252.98
+221.230.133.77
  221.231.125.146
+221.231.135.2
+221.231.139.168
  221.231.72.66
+221.232.131.40
  221.232.158.106
+221.234.218.225
  221.235.184.101
+221.235.184.90
  221.235.72.170
  221.235.79.146
+221.237.189.26
  221.238.32.130
+221.238.40.98
  221.239.206.120
  221.3.105.164
-221.3.18.2
  221.3.27.182
  221.3.32.216
-221.3.40.143
+221.3.32.250
  221.3.66.153
  221.3.87.204
  221.3.89.189
@@ -51143,12 +61075,15 @@
  221.5.80.66
  221.6.114.149
  221.6.197.130
+221.6.206.14
  221.6.32.34
+221.6.45.147
  221.7.194.253
  221.7.223.18
  221.7.246.69
  221.7.255.168
  221.8.31.27
+221.8.52.73
  221102.us-south.cf.appdomain.cloud
  2214756-39975-dot-bles05.wn.r.appspot.com
  221496844.embeddedsw.org
@@ -51157,6 +61092,7 @@
  221betasus.com
  222.100.42.168
  222.101.161.15
+222.101.206.56
  222.102.125.183
  222.104.137.106
  222.104.247.109
@@ -51164,16 +61100,21 @@
  222.104.57.220
  222.105.154.124
  222.105.26.35
-222.106.165.181
+222.106.82.48
  222.107.145.100
  222.107.156.227
  222.108.213.43
+222.110.147.61
+222.112.206.112
  222.112.220.12
  222.113.146.220
  222.113.184.193
  222.113.252.68
+222.114.95.164
+222.116.208.45
  222.117.124.136
  222.117.176.100
+222.118.4.109
  222.119.28.7
  222.120.62.20
  222.122.141.47
@@ -51185,34 +61126,42 @@
  222.122.197.37
  222.122.227.121
  222.122.25.99
+222.122.31.133
  222.122.45.146
  222.122.45.223
  222.122.45.62
  222.122.60.175
+222.122.82.135
  222.124.1.226
  222.124.11.139
  222.124.155.106
  222.124.170.66
  222.124.200.250
+222.124.202.179
  222.124.30.138
+222.124.7.150
  222.126.154.49
  222.127.105.27
  222.127.133.58
  222.127.151.230
  222.127.97.91
+222.128.14.106
  222.128.41.72
  222.128.46.1
+222.128.6.99
  222.128.60.162
  222.128.9.235
  222.134.31.199
  222.134.91.170
  222.135.131.48
  222.135.176.219
-222.135.59.246
+222.135.221.54
+222.135.223.189
  222.135.81.251
+222.135.85.169
  222.136.154.89
  222.136.212.112
-222.136.27.126
+222.136.50.50
  222.137.0.44
  222.137.1.252
  222.137.120.141
@@ -51221,60 +61170,67 @@
  222.137.121.206
  222.137.122.142
  222.137.122.90
+222.137.132.164
  222.137.136.116
+222.137.136.199
  222.137.136.35
  222.137.137.238
  222.137.138.152
+222.137.138.168
  222.137.138.38
  222.137.138.5
  222.137.138.51
  222.137.138.58
  222.137.139.188
+222.137.139.21
  222.137.139.4
-222.137.154.139
-222.137.158.148
-222.137.164.17
  222.137.173.17
-222.137.174.172
+222.137.178.115
  222.137.182.57
  222.137.215.83
  222.137.233.24
  222.137.237.112
  222.137.28.196
+222.137.37.194
+222.137.5.3
  222.137.5.44
-222.137.68.142
  222.137.75.165
+222.138.114.41
  222.138.174.120
  222.138.174.182
  222.138.180.34
  222.138.181.119
  222.138.190.135
+222.138.201.95
  222.138.201.98
-222.138.53.123
+222.138.218.167
  222.138.96.76
  222.139.209.19
  222.139.224.153
  222.139.245.70
  222.139.28.84
-222.139.31.24
+222.139.59.197
  222.139.62.144
+222.140.174.228
  222.140.19.172
-222.140.211.109
  222.140.6.102
  222.140.72.174
-222.141.114.22
-222.141.61.191
-222.141.73.61
-222.141.77.165
-222.141.87.25
+222.141.171.173
+222.141.251.20
+222.141.41.27
+222.141.50.131
  222.141.9.144
  222.142.113.51
+222.142.210.245
  222.142.211.190
  222.142.223.3
-222.142.99.177
+222.153.112.136
+222.153.142.227
  222.153.237.227
  222.153.239.145
+222.161.241.78
  222.161.26.253
+222.165.182.42
  222.165.194.67
  222.165.194.68
  222.165.221.12
@@ -51282,15 +61238,28 @@
  222.165.223.137
  222.165.223.138
  222.165.223.140
+222.165.233.250
  222.165.234.147
+222.168.18.227
+222.168.44.140
+222.169.185.239
  222.170.63.27
+222.173.242.30
+222.173.82.126
+222.174.213.178
  222.174.213.180
  222.174.56.114
  222.175.171.6
+222.175.5.114
+222.179.125.77
+222.179.205.14
  222.179.215.189
  222.180.208.14
+222.180.250.42
+222.184.14.90
  222.184.254.170
  222.184.7.26
+222.185.143.82
  222.185.145.146
  222.185.146.109
  222.185.151.16
@@ -51301,12 +61270,18 @@
  222.185.19.206
  222.185.197.195
  222.185.199.202
+222.185.210.157
+222.185.212.58
+222.185.231.246
+222.185.235.186
+222.185.241.130
  222.185.42.110
  222.185.73.210
  222.185.85.228
  222.186.129.7
  222.186.13.91
  222.186.150.130
+222.186.160.114
  222.186.20.19
  222.186.21.147
  222.186.24.192
@@ -51316,6 +61291,7 @@
  222.186.26.88
  222.186.34.200
  222.186.34.82
+222.186.64.233
  222.187.1.163
  222.187.157.54
  222.187.159.166
@@ -51330,36 +61306,58 @@
  222.187.190.50
  222.187.191.224
  222.187.221.88
+222.187.222.53
  222.187.222.55
  222.187.224.132
  222.187.232.190
+222.187.238.87
+222.187.239.31
  222.187.60.56
  222.188.131.220
+222.188.136.214
  222.188.190.206
  222.188.221.118
  222.188.243.137
  222.188.243.195
  222.188.243.225
  222.188.255.95
+222.189.163.82
+222.190.145.130
+222.190.222.187
+222.190.236.140
  222.190.254.130
  222.191.156.7
+222.191.176.79
+222.191.177.82
+222.191.178.105
+222.191.234.30
  222.191.243.187
  222.195.93.60
+222.199.52.3
  222.206.231.192
  222.208.0.197
  222.208.183.195
  222.208.183.218
  222.208.3.115
+222.211.90.83
+222.212.238.30
  222.214.218.37
+222.214.48.252
  222.215.50.156
  222.217.65.112
  222.217.68.17
  222.222.185.242
+222.223.122.204
+222.223.162.77
+222.223.203.3
+222.223.212.78
  222.231.1.69
  222.231.3.128
  222.231.31.220
  222.231.60.131
+222.232.29.235
  222.234.103.90
+222.234.179.84
  222.234.2.152
  222.235.67.132
  222.236.220.146
@@ -51375,36 +61373,55 @@
  222.239.255.101
  222.239.28.177
  222.240.1.0
+222.240.148.170
  222.240.184.126
+222.240.205.13
+222.240.223.85
  222.240.228.67
+222.240.228.75
  222.240.228.76
+222.241.154.185
  222.241.252.186
  222.242.158.161
  222.242.182.166
  222.243.14.67
  222.243.213.59
+222.244.113.38
  222.244.132.94
+222.244.139.132
  222.244.142.61
+222.244.146.232
  222.246.111.216
  222.247.1.145
  222.247.84.30
  222.249.173.170
  222.251.206.176
+222.252.144.249
  222.252.148.134
  222.252.22.193
+222.252.24.124
+222.252.243.2
+222.252.249.230
  222.252.25.168
  222.252.250.137
  222.252.27.182
  222.252.27.212
  222.252.30.29
  222.252.98.12
+222.253.42.249
  222.254.34.129
+222.255.113.166
  222.255.115.237
  222.58.151.67
+222.64.159.53
+222.64.226.66
  222.70.181.55
  222.72.38.22
+222.73.114.78
  222.73.129.15
  222.73.17.7
+222.73.215.81
+222.73.62.184
  222.74.13.26
  222.74.186.134
  222.74.186.136
@@ -51415,6 +61432,7 @@
  222.74.50.141
  222.74.73.202
  222.75.1.197
+222.75.12.10
  222.80.132.148
  222.80.148.4
  222.80.170.172
@@ -51430,6 +61448,7 @@
  222.81.31.104
  222.82.213.123
  222.82.214.218
+222.82.246.162
  222.83.120.226
  222.83.120.227
  222.83.120.228
@@ -51438,17 +61457,27 @@
  222.83.120.231
  222.83.120.232
  222.83.120.233
-222.83.155.80
+222.83.154.3
  222.83.49.68
  222.83.53.212
  222.83.68.37
  222.83.71.235
+222.84.117.30
  222.84.250.43
  222.87.177.3
+222.87.198.108
+222.87.198.114
+222.87.198.78
+222.87.54.4
  222.88.236.236
  222.88.64.94
  222.90.28.99
-222.95.191.205
+222.92.139.158
+222.92.150.188
+222.93.127.231
+222.93.175.116
+222.95.248.29
+222.95.248.83
  222.96.116.190
  222.96.155.188
  222.96.156.84
@@ -51456,12 +61485,18 @@
  222.97.15.150
  222.97.15.156
  222.97.15.209
+222.98.173.216
  222.98.64.136
+222.99.52.216
  222v333.com
  223.10.0.117
+223.10.176.50
  223.10.181.67
  223.10.35.57
+223.100.140.10
  223.100.166.3
+223.100.167.105
+223.11.63.224
  223.113.4.109
  223.13.87.136
  223.130.29.100
@@ -51472,7 +61507,11 @@
  223.149.184.31
  223.149.51.208
  223.15.14.29
+223.150.112.140
+223.150.214.35
  223.150.229.1
+223.151.226.55
+223.151.228.249
  223.152.129.113
  223.152.27.141
  223.154.80.169
@@ -51480,6 +61519,7 @@
  223.154.81.219
  223.154.81.58
  223.16.229.241
+223.165.149.41
  223.165.241.9
  223.165.243.161
  223.165.243.209
@@ -51488,62 +61528,123 @@
  223.17.120.140
  223.17.215.76
  223.171.46.146
+223.171.71.50
  223.18.248.95
  223.18.5.147
  223.19.191.30
  223.19.48.25
+223.190.116.78
  223.191.34.173
+223.196.67.195
  223.197.151.55
  223.197.175.171
  223.197.175.91
  223.197.185.60
+223.197.186.7
+223.197.188.206
+223.197.193.131
  223.197.242.160
  223.197.56.102
  223.199.21.89
+223.204.179.29
  223.204.191.215
  223.204.246.106
  223.205.216.210
+223.205.222.14
  223.205.224.154
+223.205.228.172
+223.205.232.61
+223.205.90.100
+223.206.220.141
  223.206.225.175
  223.206.225.38
  223.206.226.244
+223.206.226.245
  223.206.232.92
+223.206.234.230
+223.206.236.129
  223.206.237.241
  223.206.243.39
  223.206.245.229
  223.207.224.168
  223.207.230.223
+223.207.243.168
  223.212.234.84
  223.212.5.29
  223.212.57.118bin.sh
+223.212.57.89
+223.212.73.105
  223.213.112.88
  223.213.133.38
  223.213.138.218
+223.214.71.73
+223.215.7.24
+223.216.237.61
+223.220.143.231
+223.220.251.232
+223.221.36.149
+223.223.132.235
  223.223.142.16
-223.223.148.12
  223.223.156.5
+223.223.176.184
+223.223.194.101
+223.225.169.107
+223.226.55.124
  223.229.172.223
  223.233.68.46
+223.235.136.81
  223.235.14.155
+223.236.65.236
+223.24.148.219
  223.24.157.60
  223.240.104.222
  223.240.208.44
+223.240.209.244
+223.240.65.72
+223.240.71.236
+223.241.118.11
+223.241.118.190
+223.241.214.32
+223.241.247.214
  223.241.72.197
+223.241.78.218
+223.241.78.221
+223.241.78.67
+223.244.96.55
+223.247.156.49
+223.247.185.150
  223.247.194.119
+223.247.200.251
  223.247.201.32
+223.247.207.75
+223.247.218.112
+223.247.219.165
  223.247.33.150
  223.25.101.242
  223.25.111.8
  223.25.14.66
  223.25.99.163
  223.25.99.37
+223.255.182.94
+223.255.28.203
+223.26.16.175
  223.27.194.66
-223.31.139.60
+223.27.255.174
+223.29.204.242
+223.4.66.84
  223.68.190.130
+223.70.163.118
  223.70.163.90
+223.71.127.194
+223.71.150.229
+223.71.150.78
+223.71.167.169
  223.72.51.194
+223.73.84.147
  223.75.175.52
  223.75.237.42
+223.84.208.69
+223.85.197.58
  223.9.149.141
  223.93.157.236
  223.93.157.244
@@ -51551,7 +61652,13 @@
  223.93.171.210
  223.93.188.234
  223.94.44.161
+223.95.112.107
+223.95.86.157
+223.96.91.194
  223.99.170.130
+223.99.22.139
+223.99.22.141
+223.99.22.149
  22334444.com
  224001.selcdn.ru
  224268.com
@@ -51578,16 +61685,25 @@
  23-1-23.vasdasd.repl.co
  23-227-206-171.static.hvvc.us
  23-227-206-177.static.hvvc.us
+23.100.41.141
  23.100.56.88
  23.101.11.35
+23.101.112.231
+23.101.137.61
  23.101.139.240
  23.101.164.210
+23.101.187.252
+23.101.188.151
  23.101.198.126
  23.101.2.247
  23.101.3.215
  23.102.137.83
  23.102.153.172
  23.102.155.128
+23.102.160.69
+23.102.182.181
+23.102.36.108
+23.102.68.69
  23.104.158.15
  23.104.158.53
  23.104.161.47
@@ -51621,6 +61737,7 @@
  23.106.248.103
  23.106.27.251
  23.106.27.69
+23.106.60.132
  23.107.13.123
  23.108.15.160
  23.108.2.167
@@ -51716,9 +61833,16 @@
  23.133.5.241
  23.133.5.253
  23.136.64.8
+23.141.128.239
  23.141.240.206
  23.145.80.104
  23.146.240.230
+23.146.242.148
+23.148.145.13
+23.148.145.235
+23.148.145.238
+23.148.145.240
+23.148.145.242
  23.148.145.26
  23.152.0.123
  23.152.0.162
@@ -51729,6 +61853,8 @@
  23.154.160.223
  23.154.160.226
  23.16.24.244
+23.160.192.125
+23.160.193.106
  23.163.0.100
  23.163.0.146
  23.163.0.62
@@ -51766,8 +61892,10 @@
  23.227.196.210
  23.227.201.165
  23.227.207.140
+23.228.101.16
  23.228.114.34
  23.228.125.180
+23.228.126.143
  23.228.192.206
  23.228.209.216
  23.228.232.67
@@ -51797,6 +61925,7 @@
  23.229.35.98
  23.229.40.215
  23.229.40.79
+23.229.5.66
  23.229.55.153
  23.229.56.237
  23.229.57.144
@@ -51940,6 +62069,7 @@
  23.239.7.183
  23.239.9.69
  23.241.250.252
+23.242.167.128
  23.243.213.63
  23.246.247.42
  23.247.102.10
@@ -51947,8 +62077,14 @@
  23.247.102.125
  23.247.102.18
  23.247.102.23
+23.247.11.76
+23.247.11.85
  23.247.129.202
+23.247.33.61
+23.247.42.10
+23.247.42.110
  23.247.5.46
+23.247.55.202
  23.247.97.117
  23.248.234.35
  23.249.16.10
@@ -51957,6 +62093,7 @@
  23.249.164.26
  23.249.165.196
  23.249.166.149
+23.249.172.36
  23.25.85.219
  23.25.85.221
  23.250.1.144
@@ -52048,6 +62185,7 @@
  23.254.224.102
  23.254.224.186
  23.254.225.130
+23.254.225.216
  23.254.226.235
  23.254.226.60
  23.254.227.105
@@ -52097,6 +62235,7 @@
  23.27.194.46
  23.28.102.158
  23.28.50.172
+23.29.80.56
  23.30.106.49
  23.4.43.27
  23.4buyuklergazete.com
@@ -52139,6 +62278,7 @@
  23.83.240.209
  23.83.240.210
  23.83.242.51
+23.83.247.171
  23.83.252.134
  23.83.87.112
  23.83.87.197
@@ -52160,6 +62300,7 @@
  23.90.42.41
  23.90.43.146
  23.91.66.183
+23.91.70.54
  23.92.125.21
  23.92.127.10
  23.92.127.34
@@ -52204,6 +62345,7 @@
  23.94.20.163
  23.94.20.234
  23.94.204.102
+23.94.204.232
  23.94.206.177
  23.94.206.186
  23.94.206.189
@@ -52217,6 +62359,7 @@
  23.94.4.157
  23.94.4.224
  23.94.4.96
+23.94.4.98
  23.94.43.186
  23.94.47.103
  23.94.47.123
@@ -52257,6 +62400,7 @@
  23.95.185.215
  23.95.185.219
  23.95.185.222
+23.95.185.34
  23.95.186.183
  23.95.188.172
  23.95.188.189
@@ -52284,9 +62428,14 @@
  23.95.97.187
  23.96.38.43
  23.96.53.62
+23.96.54.187
  23.96.54.209
  23.96.97.232
+23.97.154.104
+23.97.155.197
+23.97.180.45
  23.97.193.163
+23.98.140.102
  23.98.191.127
  23.98.191.58
  23.98.216.241
@@ -52296,6 +62445,7 @@
  23.99.219.238
  23.99.221.5
  23.99.7.13
+23.99.97.154
  230-365.net
  2311046.carpicsediting.com
  23124234.smtpmouse.com
@@ -52353,7 +62503,9 @@
  24.106.226.216
  24.107.23.133
  24.109.248.25
+24.11.101.35
  24.11.124.75
+24.11.203.133
  24.111.39.66
  24.113.10.158
  24.113.13.233
@@ -52372,13 +62524,18 @@
  24.113.238.213
  24.113.44.144
  24.113.92.37
+24.114.80.99
  24.116.202.31
+24.116.90.152
  24.118.165.35
  24.12.184.19
  24.12.204.206
+24.120.10.18
  24.121.219.54
+24.121.29.92
  24.122.28.67
  24.123.196.28
+24.123.20.50
  24.123.37.67
  24.124.98.230
  24.125.254.207
@@ -52389,8 +62546,10 @@
  24.132.182.110
  24.133.200.89
  24.133.7.210
+24.134.42.229
  24.134.6.165
  24.135.207.56
+24.136.52.146
  24.137.76.62
  24.139.143.210
  24.139.143.226
@@ -52409,11 +62568,14 @@
  24.155.196.246
  24.156.1.90
  24.157.130.222
+24.158.173.212
+24.159.89.85
  24.16.108.181
  24.16.58.216
  24.16.67.20
  24.160.150.173
  24.161.18.241
+24.163.113.97
  24.164.79.147
  24.167.210.124
  24.167.248.109
@@ -52422,7 +62584,9 @@
  24.172.34.114
  24.172.79.6
  24.173.166.166
+24.173.42.146
  24.173.72.38
+24.173.98.44
  24.174.198.82
  24.176.239.113
  24.177.106.85
@@ -52430,9 +62594,11 @@
  24.178.90.49
  24.179.112.4
  24.179.13.119
+24.18.163.184
  24.18.77.142
  24.180.55.125
  24.181.205.134
+24.182.52.2
  24.184.0.146
  24.184.1.41
  24.185.157.190
@@ -52460,6 +62626,8 @@
  24.203.108.165
  24.205.144.72
  24.205.215.192
+24.207.12.61
+24.209.164.31
  24.21.176.186
  24.21.229.157
  24.211.7.38
@@ -52468,6 +62636,8 @@
  24.212.51.61
  24.212.64.36
  24.214.210.83
+24.214.72.152
+24.217.134.0
  24.217.140.142
  24.217.25.147
  24.217.251.48
@@ -52475,15 +62645,19 @@
  24.22.122.39
  24.220.176.108
  24.220.5.235
+24.221.197.241
  24.222.131.233
  24.222.43.8
  24.226.68.134
+24.227.101.106
  24.227.47.162
  24.228.8.57
+24.229.161.228
  24.23.133.203
  24.23.226.178
  24.230.124.78
  24.230.133.253
+24.230.215.40
  24.231.68.53
  24.231.70.85
  24.231.88.85
@@ -52493,12 +62667,16 @@
  24.232.36.99
  24.233.245.188
  24.234.133.205
+24.234.142.118
+24.234.175.131
+24.234.197.4
  24.234.50.44
  24.234.59.162
  24.234.75.185
  24.234.75.185bin.sh
  24.237.101.250
  24.237.70.53
+24.239.67.57
  24.240.96.140
  24.241.102.26
  24.243.11.175
@@ -52521,6 +62699,7 @@
  24.252.140.29
  24.253.146.50
  24.253.226.15
+24.253.9.109
  24.254.38.127
  24.255.192.211
  24.26.156.42
@@ -52548,21 +62727,27 @@
  24.42.167.242
  24.43.32.186
  24.43.99.75
+24.45.199.162
  24.47.90.156
+24.48.12.36
  24.4buyuklergazete.com
  24.5.111.241
  24.5.246.58
  24.51.219.223
+24.51.32.49
  24.52.230.239
  24.53.245.34
  24.54.106.17
  24.54.211.91
  24.56.242.244
  24.57.227.242
+24.58.52.157
  24.6.173.249
+24.6.78.186
  24.60.104.154
  24.62.213.192
  24.64.72.174
+24.64.80.162
  24.66.35.226
  24.68.94.168
  24.69.65.8
@@ -52574,6 +62759,7 @@
  24.87.71.106
  24.89.138.156
  24.9.61.200
+24.91.41.194
  24.92.157.192
  24.92.187.245
  24.92.187.5
@@ -52697,6 +62883,7 @@
  27.1.245.16
  27.1.245.16bin.sh
  27.1.245.33
+27.100.15.106
  27.102.102.139
  27.102.127.39
  27.102.128.36
@@ -52712,19 +62899,26 @@
  27.102.70.194
  27.102.70.210
  27.102.70.211
+27.104.221.179
  27.105.152.107
  27.105.198.65
  27.106.12.218
+27.106.18.218
  27.106.84.186
+27.106.92.106
  27.109.115.140
  27.109.116.119
  27.109.116.171
  27.109.153.99
  27.11.21.238
  27.11.212.90
+27.110.177.189
  27.111.29.180
  27.111.35.13
+27.111.44.196
  27.111.47.232
+27.114.157.89
+27.116.16.118
  27.116.18.155
  27.116.51.119
  27.116.51.178
@@ -52734,6 +62928,7 @@
  27.116.51.92
  27.117.105.125
  27.117.105.125bin.sh
+27.12.223.83
  27.120.109.165
  27.122.237.243
  27.122.56.147
@@ -52741,6 +62936,7 @@
  27.122.59.100
  27.122.59.86
  27.123.1.185
+27.123.171.65
  27.123.213.170
  27.123.213.172
  27.123.254.130
@@ -52754,7 +62950,12 @@
  27.126.179.44
  27.126.179.46
  27.126.188.205
+27.128.160.79
+27.128.161.18
+27.128.168.225
  27.128.173.81
+27.128.236.189
+27.128.238.250
  27.128.244.13
  27.131.106.230
  27.131.187.222
@@ -52769,6 +62970,7 @@
  27.147.179.232
  27.147.183.49
  27.147.190.202
+27.147.202.97
  27.147.209.215
  27.147.210.35
  27.147.217.194
@@ -52776,34 +62978,48 @@
  27.147.225.202
  27.147.40.128
  27.148.165.23
+27.148.190.100
+27.148.208.14
+27.148.248.203
  27.150.170.26
  27.150.182.230
+27.150.22.155
  27.150.30.162
+27.152.73.62
  27.153.181.253
  27.153.185.196
+27.154.225.186
  27.154.32.202
  27.154.34.146
  27.154.59.202
+27.155.101.173
+27.155.101.197
+27.155.101.232
  27.155.101.233
  27.155.77.93
+27.155.83.174
  27.155.97.12
+27.156.4.179
  27.156.6.147
+27.156.72.6
  27.158.161.91
  27.159.72.85
  27.17.28.132
  27.184.217.107
-27.184.55.120
-27.187.248.206
+27.185.12.20
  27.187.248.43
  27.187.249.35
  27.187.250.184
  27.187.251.203
  27.188.62.55
+27.19.196.128
+27.19.255.221
  27.191.234.69
  27.192.137.78
  27.193.105.154
  27.193.106.206bin.sh
  27.193.119.35
+27.193.132.73
  27.193.158.32
  27.193.189.201
  27.193.201.33
@@ -52816,6 +63032,7 @@
  27.194.114.247
  27.194.129.92
  27.194.134.4
+27.194.138.66
  27.194.143.157
  27.194.157.123
  27.194.157.226
@@ -52830,17 +63047,17 @@
  27.194.36.216
  27.194.95.196
  27.197.149.195
-27.197.16.3
-27.197.198.30
+27.197.211.233
  27.197.26.190
-27.197.31.40
+27.197.28.210
  27.197.39.53
  27.197.83.147
  27.198.115.85
  27.198.22.182
-27.198.246.200
+27.198.224.171
  27.198.33.255
  27.198.51.21
+27.199.160.22
  27.199.179.102
  27.199.192.250
  27.199.198.206
@@ -52850,6 +63067,7 @@
  27.200.1.139
  27.200.105.117
  27.200.168.40
+27.200.93.1
  27.201.110.238
  27.201.118.119
  27.201.118.95
@@ -52857,9 +63075,9 @@
  27.201.191.126
  27.201.205.12
  27.201.244.14
+27.202.0.73
  27.202.137.28
  27.202.142.222
-27.202.151.37
  27.202.190.53
  27.202.2.207
  27.202.210.80
@@ -52874,13 +63092,11 @@
  27.203.128.182
  27.203.159.220
  27.203.167.160
-27.203.168.90
  27.203.185.42
  27.203.25.103
  27.203.25.103bin.sh
  27.203.250.158
  27.203.255.139
-27.203.29.1
  27.203.4.188
  27.203.42.58
  27.203.5.143
@@ -52890,12 +63106,16 @@
  27.203.97.11
  27.204.237.251
  27.204.242.5
+27.204.253.74
  27.204.254.155
  27.206.108.54
-27.206.159.65
+27.206.180.8
+27.206.183.206
+27.206.184.188
  27.206.220.118
  27.206.40.134
  27.206.66.103
+27.206.74.50
  27.207.12.223
  27.207.120.95
  27.207.180.93
@@ -52910,6 +63130,8 @@
  27.207.93.10
  27.208.11.250
  27.208.145.149
+27.208.146.188
+27.208.157.126
  27.208.163.180
  27.208.200.128
  27.208.205.154
@@ -52927,6 +63149,8 @@
  27.210.146.169
  27.210.147.237
  27.210.173.204
+27.210.206.109
+27.210.227.10
  27.210.236.134
  27.210.246.189
  27.210.255.236
@@ -52936,7 +63160,6 @@
  27.210.55.84
  27.210.82.136
  27.211.62.203
-27.213.105.17
  27.213.137.14
  27.213.148.166
  27.213.170.203bin.sh
@@ -52944,28 +63167,36 @@
  27.213.175.209
  27.213.188.221
  27.213.208.35
+27.213.237.126
  27.213.244.125
  27.213.244.152
  27.213.252.208
  27.213.6.59
-27.213.65.121
  27.213.66.238
  27.213.84.41
  27.213.95.75
  27.213.99.44
+27.215.113.23
+27.215.113.84
  27.215.122.212
  27.215.137.10
  27.215.140.240
  27.215.146.216
  27.215.148.27
+27.215.168.123
+27.215.171.138
+27.215.171.57
  27.215.176.224
-27.215.190.172
+27.215.193.110
+27.215.198.168
  27.215.216.184
  27.215.224.48
  27.215.228.253
  27.215.232.194
+27.215.245.98
  27.215.35.102
  27.215.54.234
+27.215.58.7
  27.215.61.73
  27.215.68.87
  27.215.83.51
@@ -52980,11 +63211,11 @@
  27.216.187.143
  27.216.214.166
  27.216.214.38
+27.216.225.28
  27.216.227.58
  27.216.254.180
  27.216.48.72
  27.216.55.196
-27.217.115.61
  27.217.136.68bin.sh
  27.217.138.46
  27.217.139.169
@@ -52999,6 +63230,7 @@
  27.217.54.35
  27.218.187.213
  27.219.124.153
+27.219.126.229
  27.219.126.249
  27.219.137.38bin.sh
  27.219.146.237
@@ -53006,23 +63238,30 @@
  27.219.178.44
  27.219.184.240
  27.219.184.57
+27.219.24.40
  27.219.254.146
  27.219.31.70
  27.219.67.178
  27.219.85.200
  27.219.97.176
-27.220.130.97
+27.220.123.108
+27.220.123.254
  27.220.158.71
  27.220.170.180
  27.220.174.74
  27.220.206.236
+27.220.43.39
+27.220.45.101
  27.220.87.121
  27.220.89.7
  27.220.94.247
  27.220.98.17
+27.221.18.26
  27.221.18.27
+27.221.225.186
  27.222.142.26
  27.222.143.116
+27.222.180.68
  27.222.203.117
  27.222.205.43
  27.222.242.112
@@ -53035,15 +63274,27 @@
  27.223.230.215
  27.223.254.218
  27.223.44.106
+27.223.55.163
  27.223.89.238
+27.223.99.130
  27.24.29.111bin.sh
  27.24.29.251bin.sh
  27.24.30.46
  27.252.67.85
+27.254.130.67
+27.254.150.77
+27.254.206.238
  27.254.34.177
+27.254.46.67
  27.254.60.60
+27.254.95.199
  27.255.58.34
  27.255.65.107
+27.255.75.150
+27.255.75.159
+27.255.75.163
+27.255.75.19
+27.255.75.8
  27.255.77.182
  27.255.79.116
  27.255.79.37
@@ -53051,6 +63302,7 @@
  27.255.81.140
  27.255.81.163
  27.255.94.166
+27.26.143.126
  27.28.71.118
  27.3.204.185
  27.3.41.234
@@ -53058,8 +63310,12 @@
  27.32.209.56
  27.32.42.128
  27.33.160.196
+27.34.10.217
  27.34.161.42
  27.34.20.87
+27.34.4.41
+27.34.47.231
+27.34.69.131
  27.35.100.245
  27.35.104.17
  27.35.105.206
@@ -53079,64 +63335,80 @@
  27.35.58.5
  27.38.154.199
  27.38.60.107
+27.38.60.123
  27.38.61.82
  27.38.61.86
+27.41.10.243
  27.41.157.5
  27.41.158.204
  27.41.179.202
  27.41.181.181
-27.41.181.31
  27.41.182.169
  27.41.187.171
  27.41.204.88
  27.41.206.175
  27.41.218.40
-27.41.4.39
+27.41.4.42
+27.41.6.205
  27.41.6.226
-27.41.9.237
+27.41.6.234
  27.42.168.46
+27.44.107.195
  27.46.23.251
  27.5.112.81
+27.5.126.137
  27.5.32.191
  27.5.40.9
  27.5.45.52
-27.5.47.151
  27.50.160.35
+27.50.164.114
  27.50.164.117
  27.50.164.222
  27.50.18.42
  27.50.22.30
  27.50.48.53
+27.50.63.18
  27.50.63.26
  27.54.118.235
  27.54.163.132
  27.54.166.212
+27.54.190.58
+27.56.136.65
+27.57.182.128
  27.6.104.60bin.sh
  27.6.207.11
  27.6.30.211
  27.64.14.153
  27.64.22.62
+27.67.140.152
  27.69.241.47
  27.69.247.136
  27.69.25.112
  27.7.143.136
  27.70.134.169
+27.71.227.142
+27.71.228.25
  27.71.231.25
+27.71.238.208
+27.71.80.184
  27.71.85.180
+27.72.109.15
  27.72.122.228
-27.72.25.157
+27.72.240.181
  27.72.29.159
  27.72.61.48
  27.72.72.224
  27.72.72.228
  27.72.72.48
  27.72.75.227
+27.74.245.175
  27.74.247.135
  27.74.247.140
+27.74.71.246
  27.76.251.78
  27.78.25.204
  27.78.27.110
-27.8.111.57
+27.79.147.232
  27.8.235.240
  272101.com
  27353.join78.ga
@@ -53516,6 +63788,7 @@
  3.18.213.211
  3.19.188.49
  3.19.227.221
+3.19.241.251
  3.19.30.176
  3.19.56.156
  3.208.228.221
@@ -53538,6 +63811,7 @@
  3.221.155.232
  3.222.213.197
  3.224.147.129
+3.226.108.72
  3.227.11.183
  3.228.87.114
  3.23.227.175
@@ -53560,6 +63834,7 @@
  3.237.47.155
  3.237.65.243
  3.238.8.21
+3.239.111.134
  3.248.223.135
  3.25.130.248
  3.25.97.204
@@ -53570,11 +63845,14 @@
  3.34.180.213
  3.34.189.221
  3.35.138.214
+3.35.14.53
  3.35.166.20
  3.35.168.137
  3.35.40.175
+3.6.144.180
  3.6.206.209
  3.6.251.241
+3.6.38.76
  3.7.190.231
  3.8.101.127
  3.8.101.76
@@ -53602,6 +63880,7 @@
  3.83.8.0
  3.84.141.230
  3.84.27.209
+3.85.115.251
  3.87.158.26
  3.87.177.152
  3.87.216.155
@@ -53675,6 +63954,7 @@
  31-31-199-49.ovz.vps.regruhosting.ru
  31.0.255.84
  31.10.110.132
+31.10.148.224
  31.10.15.182
  31.12.67.62
  31.124.173.255
@@ -53692,6 +63972,7 @@
  31.131.249.220
  31.131.69.14
  31.132.134.191
+31.132.156.165
  31.132.17.56
  31.132.220.2
  31.132.69.165
@@ -53703,8 +63984,10 @@
  31.135.91.9
  31.14.136.210
  31.14.201.156
+31.14.241.244
  31.14.40.154
  31.14.40.19
+31.145.111.25
  31.145.165.213
  31.145.166.27
  31.145.166.28
@@ -53753,18 +64036,23 @@
  31.163.198.162
  31.163.202.55
  31.164.104.12
-31.164.47.38
  31.166.192.183
  31.166.247.86
+31.167.240.226
+31.167.92.193
+31.168.157.167
+31.168.162.22
  31.168.168.167
  31.168.184.59
  31.168.249.37
  31.168.69.220
  31.17.180.41
  31.17.207.18
+31.17.249.196
  31.17.70.80
  31.170.123.8
  31.170.160.90
+31.170.165.53
  31.170.166.18
  31.170.173.73
  31.170.61.199
@@ -53778,9 +64066,11 @@
  31.171.71.74
  31.172.248.10
  31.173.0.249
+31.173.123.11
  31.173.13.190
  31.173.138.204
  31.173.210.36
+31.173.241.98
  31.173.48.61
  31.173.82.62
  31.173.84.98
@@ -53792,6 +64082,7 @@
  31.176.188.146
  31.176.189.219
  31.178.150.200
+31.178.168.64
  31.179.127.164
  31.179.131.246
  31.179.204.142
@@ -53800,14 +64091,18 @@
  31.179.247.161
  31.18.112.138
  31.18.117.156
+31.18.155.45
+31.18.191.17
  31.181.116.57
  31.181.128.248
+31.181.93.197
  31.182.12.3
  31.182.13.17
  31.184.195.114
  31.184.197.119
  31.184.198.75
  31.184.199.114
+31.184.204.43
  31.184.218.3
  31.184.224.90
  31.184.233.106
@@ -53815,17 +64110,24 @@
  31.185.104.19
  31.185.104.21
  31.185.167.195
+31.186.26.130
  31.186.48.216
+31.186.83.248
  31.192.105.16
  31.192.128.148
  31.192.134.193
  31.192.198.215
  31.193.124.70
+31.194.34.148
  31.195.76.3
+31.197.243.66
+31.20.193.52
+31.201.13.250
  31.201.222.51
  31.201.236.49
  31.201.50.78
  31.202.101.40
+31.202.16.98
  31.202.30.118
  31.203.250.221
  31.204.155.160
@@ -53835,12 +64137,18 @@
  31.206.38.48
  31.206.38.50
  31.206.38.55
+31.206.63.226
+31.207.33.100
  31.207.33.153
  31.207.44.34
  31.207.47.33
  31.207.47.34
+31.208.173.175
+31.208.201.79
  31.208.27.85
+31.208.90.171
  31.209.104.231
+31.209.21.17
  31.209.223.180
  31.209.33.233
  31.209.96.102
@@ -53860,8 +64168,12 @@
  31.210.43.228
  31.210.72.42
  31.211.187.230
+31.211.35.25
+31.211.82.33
  31.214.157.247
  31.214.157.73
+31.215.73.236
+31.216.85.63
  31.220.0.186
  31.220.0.202
  31.220.0.203
@@ -53884,6 +64196,7 @@
  31.220.3.99
  31.220.4.124
  31.220.4.17
+31.220.4.50
  31.220.40.163
  31.220.40.236
  31.220.40.237
@@ -53904,13 +64217,26 @@
  31.220.53.84
  31.220.55.120
  31.220.60.222
+31.220.61.75
  31.220.63.23
  31.221.95.5
+31.222.12.22
  31.222.129.14
+31.222.6.48
+31.222.6.61
+31.222.7.133
+31.222.7.246
+31.222.7.54
+31.222.7.56
+31.222.7.57
+31.222.7.59
+31.222.7.68
+31.222.8.27
  31.223.34.234
  31.223.34.237
  31.223.34.238
  31.23.161.204
+31.24.128.41
  31.24.176.249
  31.24.205.70
  31.24.230.247
@@ -53920,8 +64246,10 @@
  31.25.241.224
  31.25.246.206
  31.27.59.105
+31.28.162.4
  31.28.163.51
  31.28.163.53
+31.28.172.16
  31.28.241.117
  31.28.27.44
  31.28.99.25
@@ -53932,14 +64260,18 @@
  31.3.24.24
  31.3.242.140
  31.30.126.217
+31.30.60.19
  31.30.81.12
+31.31.11.139
  31.31.117.96
  31.31.29.169
+31.31.6.158
  31.31.72.24
  31.31.74.47
  31.31.77.107
  31.31.77.83
  31.32.16.198
+31.32.208.250
  31.40.1.60
  31.40.135.67
  31.40.208.113
@@ -53958,6 +64290,7 @@
  31.41.89.237
  31.41.92.154
  31.41.93.230
+31.42.173.15
  31.42.177.43
  31.42.177.97
  31.42.186.161
@@ -53980,6 +64313,7 @@
  31.47.252.50
  31.47.55.138
  31.48.9.90
+31.52.81.119
  31.53.191.93
  31.54.11.236
  31.6.11.120
@@ -53992,6 +64326,7 @@
  31.7.61.188
  31.7.61.189
  31.7.61.190
+31.7.62.102
  31.7.62.115
  31.7.62.118
  310051-dot-n-e-w-me-ss-age-po-rt-al.wl.r.appspot.com
@@ -54016,6 +64351,7 @@
  31qqww.com
  32.140.225.186
  32.214.183.114
+32.217.174.93
  32.64.34.139
  32.97.152.254
  3201170-dot-n-e-w-me-ss-age-po-rt-al.wl.r.appspot.com
@@ -54125,16 +64461,24 @@
  34.107.51.85
  34.107.54.119
  34.107.68.40
+34.121.149.22
  34.121.162.44
  34.121.191.59
+34.121.214.188
  34.121.220.45
+34.121.45.5
  34.121.56.218
  34.122.17.53
+34.122.18.76
+34.122.25.140
  34.122.32.203
+34.122.52.154
  34.123.157.13
  34.123.160.251
  34.123.178.160
  34.123.213.165
+34.123.223.229
+34.123.255.76
  34.123.84.183
  34.125.112.156
  34.125.126.33
@@ -54145,6 +64489,7 @@
  34.125.176.182
  34.125.177.239
  34.125.180.222
+34.125.183.133
  34.125.190.73
  34.125.46.3
  34.125.47.186
@@ -54201,6 +64546,7 @@
  34.203.227.207
  34.203.239.67
  34.203.28.190
+34.203.37.48
  34.204.104.219
  34.204.17.170
  34.205.142.211
@@ -54384,6 +64730,7 @@
  34.223.221.202
  34.223.241.172
  34.223.60.188
+34.224.100.187
  34.224.101.250
  34.224.169.11
  34.226.118.117
@@ -54469,6 +64816,7 @@
  34.236.113.58
  34.236.168.240
  34.236.169.124
+34.236.18.197
  34.236.202.207
  34.236.242.177
  34.236.44.64
@@ -54476,6 +64824,7 @@
  34.236.86.59
  34.237.15.134
  34.237.243.198
+34.237.4.205
  34.238.124.208
  34.238.127.130
  34.238.138.127
@@ -54507,6 +64856,7 @@
  34.241.50.179
  34.241.72.49
  34.241.73.35
+34.241.77.13
  34.241.82.99
  34.241.83.86
  34.241.94.237
@@ -54603,9 +64953,12 @@
  34.64.149.89
  34.64.150.100
  34.64.199.161
+34.64.203.150
  34.64.209.210
  34.64.211.116
  34.64.213.1
+34.64.218.102
+34.64.219.206
  34.64.233.186
  34.64.243.112
  34.64.249.186
@@ -54629,24 +64982,33 @@
  34.65.71.81
  34.66.68.153
  34.67.175.232
+34.67.186.17
  34.67.224.244
  34.67.51.20
+34.68.114.57
  34.68.165.103
+34.68.180.110
  34.68.210.208
  34.68.243.140
+34.68.97.70
  34.69.106.155
-34.69.117.110
  34.69.253.72
  34.69.69.205
  34.70.109.189
  34.70.138.19
  34.70.196.248
+34.70.217.179
+34.70.219.55
  34.70.49.158
  34.71.174.184
  34.71.206.168
  34.71.207.96
+34.72.111.38
  34.72.156.130
+34.72.163.246
  34.72.42.133
+34.72.53.156
+34.72.72.122
  34.72.85.73
  34.73.101.96
  34.73.71.43
@@ -54661,17 +65023,22 @@
  34.76.14.99
  34.76.203.45
  34.76.95.40
+34.77.168.63
+34.78.103.223
  34.78.14.25
  34.78.159.8
  34.78.180.55
+34.78.28.186
  34.78.48.104
  34.78.48.187
  34.78.97.138
  34.80.1.221
  34.80.134.68
  34.80.137.236
+34.80.223.251
  34.80.224.42
  34.80.90.118
+34.82.113.150
  34.82.117.252
  34.82.128.79
  34.82.170.246
@@ -54680,10 +65047,15 @@
  34.82.210.229
  34.82.26.8
  34.82.27.114
+34.82.27.159
+34.83.105.8
  34.83.108.62
+34.83.137.52
  34.83.215.245
  34.83.222.21
+34.83.43.253
  34.83.54.3
+34.83.78.86
  34.84.123.1
  34.84.157.174
  34.84.157.244
@@ -54709,6 +65081,7 @@
  34.87.117.102
  34.87.126.179
  34.87.140.178
+34.87.160.10
  34.87.160.111
  34.87.168.12
  34.87.185.77
@@ -54720,7 +65093,9 @@
  34.87.251.72
  34.87.252.166
  34.87.53.100
+34.87.6.228
  34.87.61.90
+34.87.7.26
  34.87.70.59
  34.87.75.75
  34.87.88.54
@@ -54753,9 +65128,11 @@
  34.92.205.223
  34.92.215.155
  34.92.235.236
+34.92.246.6
  34.92.247.201
  34.92.27.145
  34.92.29.25
+34.92.41.62
  34.92.87.60
  34.92.95.72
  34.93.116.89
@@ -54763,9 +65140,13 @@
  34.93.141.123
  34.93.152.123
  34.93.175.206
+34.93.177.66
+34.93.185.190
+34.93.204.215
  34.93.206.77
  34.93.21.82
  34.93.222.205
+34.93.237.166
  34.94.107.142
  34.94.120.32
  34.94.137.151
@@ -54773,6 +65154,7 @@
  34.94.187.145
  34.94.201.103
  34.94.246.180
+34.94.247.253
  34.94.255.160
  34.94.29.47
  34.94.30.169
@@ -54791,9 +65173,12 @@
  34.95.4.198
  34.95.48.40
  34.96.107.204
+34.96.155.97
+34.96.167.190
  34.96.170.247
  34.96.182.63
  34.96.185.33
+34.96.196.81
  34.96.233.167
  34.97.110.74
  34.97.114.213
@@ -54850,12 +65235,15 @@
  35-23-4532-34.com
  35-40konkatsu.net
  35.0.127.52
+35.129.134.190
  35.129.213.177
+35.134.94.153
  35.137.236.32
  35.138.248.129
  35.142.207.246
  35.143.99.174
  35.152.37.200
+35.153.102.107
  35.153.133.181
  35.153.168.135
  35.153.203.202
@@ -54950,6 +65338,7 @@
  35.164.151.193
  35.164.16.145
  35.164.161.132
+35.164.186.73
  35.164.200.151
  35.164.43.55
  35.164.45.9
@@ -55132,6 +65521,7 @@
  35.180.87.170
  35.181.112.20
  35.181.8.232
+35.181.87.238
  35.181.9.180
  35.182.136.218
  35.182.151.239
@@ -55178,6 +65568,7 @@
  35.183.60.98
  35.183.61.192
  35.184.116.118
+35.184.117.117
  35.184.128.99
  35.184.139.145
  35.184.144.99
@@ -55190,6 +65581,7 @@
  35.184.193.43
  35.184.207.37
  35.184.219.126
+35.184.248.86
  35.184.77.189
  35.184.83.249
  35.184.84.4
@@ -55202,6 +65594,8 @@
  35.185.234.202
  35.185.238.41
  35.185.246.46
+35.185.30.133
+35.185.59.105
  35.185.6.49
  35.185.66.104
  35.185.71.236
@@ -55209,12 +65603,14 @@
  35.185.80.87
  35.185.9.199
  35.185.91.64
+35.186.145.141
  35.186.158.182
  35.186.187.87
  35.186.228.86
  35.187.108.126
  35.187.177.230
  35.187.223.176
+35.187.23.223
  35.187.242.8
  35.187.46.198
  35.188.104.228
@@ -55224,6 +65620,7 @@
  35.188.134.17
  35.188.14.97
  35.188.153.75
+35.188.164.246
  35.188.186.244
  35.188.191.27
  35.188.194.225
@@ -55251,22 +65648,27 @@
  35.189.84.191
  35.190.139.73
  35.190.165.76
+35.190.196.200
  35.190.200.254
  35.192.113.118
  35.192.131.204
  35.192.132.255
  35.192.133.155
  35.192.16.224
+35.192.178.18
+35.192.180.234
  35.192.219.160
  35.192.230.214
  35.192.34.85
  35.192.39.139
+35.192.4.159
  35.192.47.188
  35.192.52.127
  35.192.72.56
  35.192.78.91
  35.192.88.64
  35.193.10.18
+35.193.104.24
  35.193.206.253
  35.193.216.14
  35.193.226.32
@@ -55293,12 +65695,14 @@
  35.195.212.194
  35.195.231.183
  35.195.234.115
+35.195.238.142
  35.195.25.89
  35.195.30.252
  35.195.64.76
  35.196.133.89
  35.196.154.26
  35.196.178.88
+35.196.182.146
  35.196.186.81
  35.196.190.215
  35.196.201.87
@@ -55310,6 +65714,7 @@
  35.196.70.139
  35.196.89.175
  35.197.124.137
+35.197.139.216
  35.197.140.219
  35.197.147.209
  35.197.151.149
@@ -55325,12 +65730,18 @@
  35.198.155.181
  35.198.162.31
  35.198.182.228
+35.198.195.1
  35.198.203.184
+35.198.205.123
+35.198.209.255
+35.198.228.240
  35.198.48.176
  35.198.49.11
+35.198.58.34
  35.199.10.191
  35.199.107.158
  35.199.117.232
+35.199.122.191
  35.199.123.23
  35.199.159.226
  35.199.190.33
@@ -55345,13 +65756,20 @@
  35.199.84.117
  35.199.86.139
  35.199.88.255
+35.199.97.42
+35.200.114.187
  35.200.167.38
+35.200.168.65
+35.200.185.127
  35.200.187.235
  35.200.187.49
  35.200.203.112
+35.200.203.6
  35.200.208.95
  35.200.231.26
+35.200.231.72
  35.200.237.93
+35.200.241.227
  35.200.252.133
  35.200.71.247
  35.200.75.228
@@ -55373,6 +65791,7 @@
  35.202.253.241
  35.202.72.149
  35.202.74.190
+35.202.99.202
  35.203.10.112
  35.203.15.57
  35.203.4.36
@@ -55380,6 +65799,7 @@
  35.203.49.27
  35.203.55.159
  35.203.64.233
+35.203.68.135
  35.203.7.188
  35.203.70.175
  35.203.9.43
@@ -55393,23 +65813,50 @@
  35.205.117.63
  35.205.22.29
  35.205.83.203
+35.206.168.27
+35.207.149.98
  35.207.65.42
+35.208.134.190
+35.208.251.120
+35.208.59.255
  35.209.158.181
+35.209.176.126
+35.209.209.15
+35.209.217.190
+35.209.29.157
+35.209.33.211
  35.209.51.212
+35.209.88.12
  35.209.9.189
+35.209.99.146
  35.211.2.103
+35.211.251.190
+35.212.180.253
+35.213.149.152
+35.213.164.234
+35.213.167.58
  35.213.18.190
+35.213.184.155
+35.213.185.189
+35.214.158.233
+35.214.183.12
+35.214.247.216
+35.216.73.53
  35.220.138.138
  35.220.147.109
  35.220.155.26
  35.220.179.119
  35.220.191.191
  35.220.199.212
+35.220.199.63
  35.220.209.206
  35.220.212.29
  35.220.221.203
+35.220.253.166
  35.221.114.222
+35.221.134.29
  35.221.158.174
+35.221.193.56
  35.221.196.29
  35.221.214.98
  35.221.223.15
@@ -55418,9 +65865,11 @@
  35.221.34.129
  35.222.103.143
  35.223.101.235
+35.223.123.222
  35.223.145.37
  35.223.167.122
  35.223.255.227
+35.223.80.237
  35.224.1.26
  35.224.107.234
  35.224.132.48
@@ -55439,11 +65888,14 @@
  35.225.15.12
  35.225.181.213
  35.225.191.140
+35.225.3.195
  35.225.94.95
  35.226.120.32
+35.226.132.241
  35.226.14.224
  35.226.172.128
  35.226.204.126
+35.226.219.78
  35.226.232.224
  35.226.50.174
  35.226.53.239
@@ -55452,6 +65904,7 @@
  35.227.169.40
  35.227.169.57
  35.227.181.98
+35.227.184.124
  35.227.19.67
  35.227.47.98
  35.227.56.24
@@ -55459,6 +65912,7 @@
  35.227.64.238
  35.227.77.27
  35.228.132.48
+35.228.169.211
  35.228.173.101
  35.228.2.58
  35.228.210.193
@@ -55514,6 +65968,7 @@
  35.232.5.209
  35.232.52.162
  35.233.101.190
+35.233.130.111
  35.233.226.183
  35.233.235.80
  35.234.130.2
@@ -55521,9 +65976,11 @@
  35.234.19.151
  35.234.52.44
  35.234.57.250
+35.234.67.163
  35.234.7.71
  35.234.78.228
  35.235.89.230
+35.235.96.109
  35.236.118.211
  35.236.12.131
  35.236.125.18
@@ -55562,6 +66019,7 @@
  35.238.86.248
  35.239.105.105
  35.239.111.81
+35.239.124.136
  35.239.143.173
  35.239.177.47
  35.239.180.180
@@ -55569,6 +66027,8 @@
  35.239.229.191
  35.239.42.76
  35.240.189.61
+35.240.204.250
+35.240.234.239
  35.240.252.177
  35.240.7.194
  35.241.116.147
@@ -55576,6 +66036,9 @@
  35.241.66.61
  35.242.148.200
  35.242.205.19
+35.242.214.242
+35.242.218.196
+35.243.156.63
  35.243.174.84
  35.243.70.255
  35.243.80.4
@@ -55585,6 +66048,7 @@
  35.244.108.75
  35.244.120.134
  35.244.234.195
+35.244.25.124
  35.244.33.53
  35.244.67.121
  35.244.9.182
@@ -55595,8 +66059,10 @@
  35.245.186.117
  35.245.193.166
  35.245.230.216
+35.245.33.180
  35.245.48.156
  35.245.67.98
+35.246.105.196
  35.246.116.88
  35.246.144.163
  35.246.175.1
@@ -55629,7 +66095,10 @@
  35sjo60r.lcrsystems-inc.com
  35tolaeaia7.visualizarfatura.me
  35y.2c8.myftpupload.com
+36.102.204.34
  36.102.208.158
+36.102.232.2
+36.103.223.61
  36.104.144.251
  36.105.15.120
  36.105.56.188
@@ -55642,7 +66111,9 @@
  36.107.26.26
  36.109.133.37
  36.109.134.42
+36.110.110.34
  36.110.111.51
+36.110.113.102
  36.110.114.32
  36.110.174.236
  36.110.197.52
@@ -55650,21 +66121,42 @@
  36.110.231.213
  36.110.239.4
  36.110.27.122
+36.110.39.217
+36.111.145.226
+36.112.104.194
+36.112.133.190
+36.112.150.9
+36.112.172.125
+36.133.112.61
+36.133.131.185
+36.133.131.190
  36.133.37.3
  36.133.37.4
  36.133.37.6
  36.133.37.7
  36.133.37.8
  36.133.37.9
+36.133.44.246
  36.133.62.154
+36.134.155.34
+36.134.27.190
+36.134.42.245
+36.134.69.8
+36.134.72.246
  36.152.142.45
  36.152.26.250
  36.152.38.149
+36.153.231.18
+36.154.110.46
  36.154.118.47
  36.154.37.158
+36.159.117.27
+36.189.253.226
+36.22.178.114
  36.22.187.34
  36.227.171.220
  36.227.175.60
+36.227.4.183
  36.229.7.108
  36.231.201.150
  36.231.69.25
@@ -55681,24 +66173,30 @@
  36.248.164.49
  36.248.168.165
  36.248.211.71
-36.249.162.101
  36.25.228.115
  36.25.243.251
  36.25.243.51
  36.250.175.95
  36.250.203.94
+36.250.229.115
  36.250.229.84
+36.250.229.92
  36.250.5.117
  36.251.157.225
  36.251.18.2
  36.251.52.129
  36.251.66.253
  36.251.68.194
+36.251.98.247
  36.255.104.1
  36.255.104.17
  36.255.104.9
  36.255.134.195
+36.255.156.126
+36.255.156.78
  36.255.211.1
+36.255.233.178
+36.255.234.20
  36.255.61.190
  36.255.85.227
  36.255.85.232
@@ -55717,15 +66215,15 @@
  36.255.87.240
  36.255.87.247
  36.255.87.250
-36.255.90.219
  36.26.194.61
  36.26.194.83
  36.26.210.57
  36.26.68.112
  36.27.114.223
  36.27.208.157
+36.27.5.237
+36.27.57.8
  36.32.110.7
-36.32.26.117
  36.32.69.140
  36.32.71.33
  36.32.88.251
@@ -55742,8 +66240,8 @@
  36.35.161.117
  36.35.161.156
  36.35.161.7
-36.35.164.111
  36.35.164.52
+36.35.218.243
  36.35.7.132
  36.36.243.67
  36.37.104.98
@@ -55754,11 +66252,13 @@
  36.37.134.18
  36.37.134.3
  36.37.139.2
+36.37.150.111
  36.37.157.250
  36.37.175.123
  36.37.177.186
  36.37.180.59
  36.37.183.214
+36.37.191.185
  36.37.242.67
  36.37.73.245
  36.37.81.135
@@ -55769,7 +66269,10 @@
  36.48.168.238
  36.5.253.214
  36.55.230.146
+36.56.152.239
+36.56.191.197
  36.57.70.137
+36.6.56.8
  36.65.16.90
  36.65.173.7
  36.65.199.190
@@ -55783,6 +66286,7 @@
  36.66.140.15
  36.66.146.93
  36.66.149.211
+36.66.151.17
  36.66.155.23
  36.66.156.125
  36.66.167.242
@@ -55790,6 +66294,7 @@
  36.66.172.121
  36.66.173.145
  36.66.177.168
+36.66.188.183
  36.66.19.10
  36.66.192.35
  36.66.205.164
@@ -55802,6 +66307,7 @@
  36.66.235.70
  36.66.242.146
  36.66.242.148
+36.66.243.115
  36.66.253.181
  36.66.36.251
  36.66.36.252
@@ -55820,6 +66326,7 @@
  36.67.105.19
  36.67.11.41
  36.67.112.11
+36.67.120.34
  36.67.123.187
  36.67.123.239
  36.67.128.145
@@ -55861,6 +66368,7 @@
  36.67.66.202
  36.67.68.21
  36.67.7.33
+36.67.70.186
  36.67.71.67
  36.67.78.53
  36.67.80.19
@@ -55879,41 +66387,63 @@
  36.68.43.152
  36.68.63.166
  36.69.62.119
+36.7.159.17
+36.7.159.60
  36.7.69.56
+36.7.87.126
  36.70.26.19
+36.71.112.49
+36.71.137.228
+36.71.139.67
+36.71.141.146
  36.71.153.178
+36.71.233.241
  36.71.233.80
+36.71.235.126
  36.71.235.183
  36.71.237.112
+36.71.239.147
+36.71.239.96
  36.71.77.77
  36.72.10.63
  36.72.14.69
+36.72.215.8
  36.72.236.35
  36.72.37.172
  36.72.48.151
  36.72.57.115
+36.73.176.235
  36.73.22.199
  36.73.247.189
  36.73.30.43
+36.73.39.31
  36.73.40.235
  36.74.101.96
  36.74.144.83
  36.74.148.66
+36.74.18.107
  36.74.27.23
+36.74.44.174
+36.74.75.31
  36.75.16.40
  36.75.19.203
  36.75.212.60
+36.75.67.161
  36.76.89.130
  36.77.109.97
+36.77.17.182
  36.77.45.165
  36.77.95.203
  36.77.95.230
  36.78.210.176
+36.78.97.35
  36.79.155.82
  36.79.20.187
-36.79.210.16
+36.79.20.214
  36.79.213.135
  36.79.223.204
+36.79.251.192
+36.79.35.210
  36.80.125.115
  36.80.139.118
  36.80.161.100
@@ -55934,6 +66464,8 @@
  36.84.100.210
  36.84.100.230
  36.84.59.53
+36.85.123.161
+36.85.130.9
  36.85.222.236
  36.85.91.95
  36.88.60.154
@@ -55944,6 +66476,7 @@
  36.89.122.240
  36.89.129.183
  36.89.135.203
+36.89.140.123
  36.89.143.171
  36.89.143.21
  36.89.143.23
@@ -55974,8 +66507,10 @@
  36.89.189.77
  36.89.190.213
  36.89.190.85
+36.89.191.119
  36.89.191.217
  36.89.193.169
+36.89.193.181
  36.89.193.73
  36.89.194.113
  36.89.205.10
@@ -55995,8 +66530,10 @@
  36.89.27.253
  36.89.32.227
  36.89.41.3
+36.89.55.95
  36.89.65.253
  36.89.68.38
+36.89.71.23
  36.89.76.119
  36.89.77.147
  36.89.77.252
@@ -56014,6 +66551,8 @@
  36.90.123.173
  36.90.123.254
  36.90.123.89
+36.90.14.64
+36.90.15.185
  36.90.16.64
  36.90.16.90
  36.90.171.214
@@ -56026,8 +66565,10 @@
  36.90.181.124
  36.90.19.89
  36.90.233.19
+36.90.234.241
  36.90.251.127
  36.90.254.189
+36.90.29.68
  36.90.36.6
  36.90.40.162
  36.90.40.216
@@ -56049,6 +66590,8 @@
  36.90.64.126
  36.90.64.209
  36.90.67.245
+36.90.68.38
+36.90.81.240
  36.90.84.61
  36.90.9.100
  36.90.90.12
@@ -56058,11 +66601,13 @@
  36.91.128.66
  36.91.143.58
  36.91.144.227
+36.91.152.234
  36.91.160.171
  36.91.192.114
  36.91.194.25
  36.91.194.29
  36.91.207.65
+36.91.218.130
  36.91.36.155
  36.91.44.183
  36.91.45.10
@@ -56074,6 +66619,7 @@
  36.92.125.37
  36.92.143.55
  36.92.147.99
+36.92.154.156
  36.92.18.179
  36.92.180.240
  36.92.181.10
@@ -56085,6 +66631,7 @@
  36.92.213.73
  36.92.222.105
  36.92.246.170
+36.92.33.194
  36.92.35.73
  36.92.43.107
  36.92.68.141
@@ -56094,12 +66641,16 @@
  36.92.83.178
  36.92.93.139
  36.92.93.61
+36.94.101.53
  36.94.110.17
+36.94.113.249
  36.94.117.133
  36.94.12.210
  36.94.13.57
  36.94.130.176
  36.94.137.167
+36.94.167.167
+36.94.202.49
  36.94.217.171
  36.94.23.90
  36.94.23.91
@@ -56108,14 +66659,21 @@
  36.94.43.130
  36.94.43.131
  36.94.43.132
+36.94.62.207
  36.94.75.202
  36.94.8.19
  36.94.81.147
  36.94.82.147
+36.95.1.161
  36.96.12.49
  36.96.184.215
+36.99.163.230
  36.99.164.90
+36.99.34.108
  36.99.35.61
+36.99.40.139
+36.99.41.29
+36.99.46.128
  360.lcy2zzx.pw
  360925443516409-dot-wetransfer-auth-file333.appspot.com
  360corona.com
@@ -56384,13 +66942,16 @@
  36scanniointeriors.com
  37-72-175-173.static.hvvc.us
  37-72-175-233.static.hvvc.us
+37.0.239.126
  37.1.200.82
+37.10.129.200
  37.104.64.3
  37.106.61.240
  37.107.67.177
  37.109.3.250
  37.110.133.102
  37.110.66.21
+37.111.136.142
  37.111.42.210
  37.112.35.163
  37.113.130.109
@@ -56437,7 +66998,9 @@
  37.120.200.41
  37.120.200.99
  37.120.203.131
+37.120.203.172
  37.120.203.71
+37.120.204.252
  37.120.205.84
  37.120.217.11
  37.120.217.42
@@ -56452,6 +67015,7 @@
  37.120.218.90
  37.120.222.44
  37.120.235.154
+37.120.60.119
  37.128.107.98
  37.130.202.92
  37.130.227.133
@@ -56469,14 +67033,20 @@
  37.133.129.0
  37.134.238.244
  37.138.200.42
+37.139.0.44
+37.139.1.197
  37.139.102.73
  37.139.11.239
  37.139.15.140
+37.139.15.205
  37.139.15.38
  37.139.16.206
+37.139.16.229
+37.139.17.137
  37.139.17.71
  37.139.19.78
  37.139.19.89
+37.139.2.140
  37.139.2.233
  37.139.2.242
  37.139.2.57
@@ -56493,8 +67063,10 @@
  37.139.31.50
  37.139.4.240
  37.139.4.69
+37.139.42.34
  37.139.43.9
  37.139.5.134
+37.139.5.94
  37.139.6.34
  37.139.6.81
  37.139.6.92
@@ -56512,6 +67084,7 @@
  37.144.247.180
  37.144.65.114
  37.146.63.79
+37.146.71.254
  37.147.174.213
  37.148.159.91
  37.15.209.166
@@ -56519,9 +67092,12 @@
  37.15.211.52
  37.152.163.35
  37.152.176.65
+37.152.181.144
  37.152.181.170
  37.152.182.65
+37.152.183.210
  37.152.183.226
+37.152.183.32
  37.152.186.65
  37.153.138.206
  37.153.174.190
@@ -56530,8 +67106,10 @@
  37.157.212.109
  37.157.253.35
  37.159.208.218
+37.159.9.197
  37.17.12.32
  37.17.12.33
+37.17.14.59
  37.17.16.61
  37.17.168.163
  37.17.169.80
@@ -56545,20 +67123,31 @@
  37.17.9.28
  37.179.206.158
  37.179.65.107
+37.182.202.122
  37.183.10.222
  37.183.188.131
+37.186.119.231
  37.186.249.90
+37.186.50.209
+37.187.0.20
  37.187.100.150
+37.187.100.50
+37.187.102.205
+37.187.102.31
  37.187.103.54
  37.187.105.104
+37.187.106.104
+37.187.107.217
  37.187.108.19
  37.187.109.60
  37.187.113.172
  37.187.113.229
+37.187.113.47
  37.187.114.171
  37.187.117.135
  37.187.117.187
  37.187.117.39
+37.187.12.126
  37.187.121.228
  37.187.121.67
  37.187.122.82
@@ -56566,7 +67155,9 @@
  37.187.124.25
  37.187.127.114
  37.187.129.166
+37.187.129.23
  37.187.130.92
+37.187.132.113
  37.187.132.31
  37.187.132.5
  37.187.134.111
@@ -56575,38 +67166,51 @@
  37.187.135.6
  37.187.148.221
  37.187.150.91
+37.187.152.177
  37.187.152.220
  37.187.152.37
  37.187.153.29
  37.187.159.92
  37.187.16.30
  37.187.162.238
+37.187.168.141
  37.187.174.201
  37.187.174.55
  37.187.180.74
  37.187.181.155
  37.187.181.182
  37.187.19.207
+37.187.19.226
  37.187.196.218
  37.187.196.70
+37.187.197.220
  37.187.2.199
  37.187.2.31
  37.187.21.2
+37.187.21.81
  37.187.22.60
+37.187.226.82
  37.187.23.106
+37.187.25.137
+37.187.252.148
+37.187.34.191
  37.187.39.210
  37.187.5.202
  37.187.50.99
  37.187.53.180
+37.187.54.45
+37.187.54.67
  37.187.56.47
  37.187.56.66
  37.187.56.76
  37.187.56.81
  37.187.61.4
  37.187.7.209
+37.187.7.95
  37.187.72.193
  37.187.74.109
  37.187.74.197
+37.187.74.49
  37.187.75.16
  37.187.78.196
  37.187.79.227
@@ -56617,8 +67221,10 @@
  37.187.96.95
  37.187.97.80
  37.191.243.119
-37.191.7.71
+37.192.133.108
+37.192.137.50
  37.192.194.50
+37.192.26.228
  37.193.125.103
  37.193.227.16
  37.195.209.169
@@ -56631,24 +67237,31 @@
  37.203.68.189
  37.204.195.90
  37.205.14.137
+37.205.37.50
  37.205.8.78
  37.205.81.41
  37.205.9.252
+37.208.181.252
  37.208.68.130
  37.209.12.181
  37.209.81.220
+37.21.119.113
  37.21.179.187
+37.211.158.240
  37.211.19.161
  37.212.136.63
  37.212.138.205
+37.212.158.16
  37.212.182.90
  37.212.224.179
  37.212.252.97
  37.212.41.233
  37.212.8.236
+37.213.122.0
  37.213.229.124
  37.214.181.208
  37.214.67.130
+37.215.244.186
  37.215.9.127
  37.218.191.190
  37.218.245.25
@@ -56679,6 +67292,7 @@
  37.229.196.220
  37.229.197.172
  37.229.209.77
+37.23.255.53
  37.230.99.119
  37.232.34.201
  37.232.4.12
@@ -56698,22 +67312,28 @@
  37.235.97.14
  37.236.146.218
  37.236.167.250
+37.236.224.225
+37.236.252.66
  37.237.65.43
  37.238.130.50
  37.238.130.84
+37.238.80.28
  37.239.46.2
  37.239.46.26
  37.24.154.70
  37.24.199.68
  37.24.240.15
  37.24.38.254
+37.24.98.190
  37.247.111.141
  37.247.209.179
  37.247.231.90
+37.248.216.194
  37.252.11.91
  37.252.15.13
  37.252.15.241
  37.252.187.140
+37.252.190.224
  37.252.64.48
  37.252.67.184
  37.252.69.70
@@ -56737,9 +67357,13 @@
  37.32.44.1
  37.34.208.91
  37.34.57.179
+37.35.66.111
+37.35.66.68
  37.36.149.249
  37.37.202.158
  37.4.227.227
+37.41.43.203
+37.44.127.207
  37.44.137.205
  37.44.238.35
  37.44.253.67
@@ -56751,6 +67375,7 @@
  37.46.150.13
  37.46.150.14
  37.46.150.142
+37.46.150.167
  37.46.150.184
  37.46.150.195
  37.46.150.206
@@ -56758,10 +67383,19 @@
  37.46.150.235
  37.46.150.243
  37.46.150.247
+37.46.150.26
+37.46.150.40
+37.46.150.48
+37.46.150.51
+37.46.150.7
+37.46.150.78
+37.46.150.81
  37.46.73.5
+37.47.173.41
  37.48.103.228
  37.48.105.203
  37.48.109.26
+37.48.120.176
  37.48.120.196
  37.48.125.238
  37.48.65.175
@@ -56809,20 +67443,41 @@
  37.49.224.98
  37.49.225.110
  37.49.225.12
+37.49.225.122
+37.49.225.134
  37.49.225.136
+37.49.225.137
+37.49.225.138
+37.49.225.140
+37.49.225.15
+37.49.225.151
  37.49.225.156
  37.49.225.157
+37.49.225.165
  37.49.225.169
  37.49.225.17
+37.49.225.170
+37.49.225.173
  37.49.225.18
+37.49.225.182
+37.49.225.19
  37.49.225.194
  37.49.225.196
+37.49.225.201
+37.49.225.205
  37.49.225.207
  37.49.225.212
  37.49.225.213
+37.49.225.218
+37.49.225.224
  37.49.225.231
+37.49.225.233
  37.49.225.235
+37.49.225.236
+37.49.225.238
+37.49.225.240
  37.49.225.245
+37.49.225.252
  37.49.226.101
  37.49.226.102
  37.49.226.112
@@ -56874,6 +67529,7 @@
  37.49.226.8
  37.49.226.88
  37.49.226.99
+37.49.229.202
  37.49.230.102
  37.49.230.103
  37.49.230.128
@@ -56924,6 +67580,7 @@
  37.57.147.41
  37.57.15.43
  37.57.169.85
+37.57.187.151
  37.57.206.219
  37.57.216.2
  37.57.216.4
@@ -56939,6 +67596,7 @@
  37.57.37.213
  37.57.40.167
  37.57.50.130
+37.57.89.52
  37.58.122.114
  37.58.148.35
  37.58.150.203
@@ -56955,9 +67613,12 @@
  37.59.205.11
  37.59.215.22
  37.59.223.107
+37.59.224.39
  37.59.31.135
+37.59.36.210
  37.59.37.74
  37.59.38.74
+37.59.39.216
  37.59.43.63
  37.59.44.40
  37.59.44.43
@@ -56971,12 +67632,14 @@
  37.59.48.36
  37.59.50.14
  37.59.50.81
+37.59.52.35
  37.59.53.126
  37.59.53.135
  37.59.55.128
  37.59.56.107
  37.59.56.124
  37.59.57.96
+37.59.58.142
  37.59.58.8
  37.59.60.115
  37.59.61.212
@@ -56990,6 +67653,7 @@
  37.59.98.31
  37.6.13.20
  37.6.14.134
+37.6.194.24
  37.61.202.71
  37.61.219.34
  37.61.219.53
@@ -57014,6 +67678,7 @@
  37.79.131.252
  37.79.139.125
  37.79.16.230
+37.79.251.238
  37.79.254.152
  37.79.255.195
  37.79.30.245
@@ -57031,6 +67696,7 @@
  37.97.190.174
  37.97.191.18
  37.97.249.17
+37.98.196.42
  37.98.226.11
  37.98.231.2
  37.99.214.45
@@ -57156,6 +67822,8 @@
  38.102.69.70
  38.109.195.42
  38.111.114.155
+38.114.83.77
+38.117.123.2
  38.121.60.2
  38.122.16.146
  38.123.64.242
@@ -57163,9 +67831,11 @@
  38.126.15.49
  38.126.254.114
  38.127.89.186
+38.130.112.144
  38.130.75.20
  38.130.75.38
  38.130.75.49
+38.131.234.45
  38.132.118.133
  38.132.124.147
  38.133.200.94
@@ -57174,11 +67844,15 @@
  38.142.63.146
  38.145.201.162
  38.145.201.41
+38.145.86.169
+38.145.92.147
  38.146.5.58
+38.17.54.101
  38.17.54.173
  38.17.54.50
  38.242.12.100
  38.242.21.27
+38.27.122.246
  38.29.147.15
  38.29.206.101
  38.39.205.6
@@ -57191,8 +67865,12 @@
  38.68.47.61
  38.69.48.2
  38.72.132.186
+38.72.132.202
+38.72.132.208
+38.73.238.134
  38.73.238.138
  38.77.14.237
+38.87.158.226
  38.87.234.241
  38.87.234.242
  38.87.54.162
@@ -57204,6 +67882,7 @@
  38.91.101.30
  38.95.167.13
  38.96.9.226
+38.99.139.90
  3808154-dot-phonic-obelisk-274214.uk.r.appspot.com
  38161-dot-n-e-w-me-ss-age-po-rt-al.wl.r.appspot.com
  381z3ubp1m.edal.cc
@@ -57213,27 +67892,38 @@
  38324.xc.05cg.com
  3833.31cf4fdae.com
  38414.gucac.com
-386f9e87.ithemeshosting.com.php73-39.lan3-1.websitetestlink.com
  387431298338020-dot-wetransfer-auth-file-343.appspot.com
  3874785889389894589-secondary.z6.web.core.windows.net
  389276365.com
  38963.xc.liaochuo.com
  38f1d44f1a954bd72362716c792b3cf7-dot-dbenitonline.ey.r.appspot.com
  38seventeen.com
+39.100.120.117
+39.100.149.197
+39.100.156.81
+39.100.210.12
+39.100.227.126
+39.100.230.115
  39.100.231.125
  39.100.234.46
+39.100.247.204
+39.100.28.79
  39.100.36.150
  39.101.136.226
  39.101.142.197
+39.101.194.214
  39.101.206.20
+39.101.213.69
  39.103.139.6
  39.104.118.116
+39.104.14.232
  39.104.77.51
  39.104.81.231
  39.105.129.219
  39.105.136.217
  39.105.192.77
  39.105.200.55
+39.105.209.58
  39.105.25.53
  39.105.46.101
  39.105.85.40
@@ -57244,6 +67934,10 @@
  39.106.223.207
  39.106.229.113
  39.106.7.117
+39.106.74.141
+39.106.9.88
+39.107.106.105
+39.107.176.14
  39.107.234.140
  39.107.236.42
  39.107.250.245
@@ -57252,7 +67946,9 @@
  39.108.141.158
  39.108.167.47
  39.108.3.76
+39.108.64.20
  39.108.68.237
+39.109.104.5
  39.109.112.98
  39.109.113.204
  39.109.123.18
@@ -57284,17 +67980,42 @@
  39.137.69.10
  39.137.69.7
  39.145.126.86
+39.152.42.235
+39.155.208.78
+39.155.215.199
  39.164.112.139
  39.164.44.148
+39.164.99.60
  39.183.132.49
+39.33.131.225
  39.33.170.49
+39.33.182.5
+39.33.210.35
+39.33.216.64
+39.33.220.56
+39.33.222.197
+39.34.187.53
  39.34.222.130
  39.34.226.168
+39.35.146.38
+39.40.201.3
+39.40.231.56
+39.42.26.227
  39.43.32.98
+39.44.237.47
+39.45.21.37
+39.45.4.184
+39.46.52.159
+39.49.95.54
  39.50.107.75
+39.50.88.150
  39.50.97.132
+39.52.130.19
  39.53.126.151
  39.57.138.131
+39.57.148.100
+39.60.26.170
+39.64.134.162
  39.64.36.1
  39.65.102.212
  39.65.133.234
@@ -57308,6 +68029,7 @@
  39.65.3.194
  39.66.149.230
  39.66.179.245
+39.66.230.54
  39.66.33.156
  39.66.85.78
  39.66.97.214
@@ -57315,14 +68037,14 @@
  39.66.99.19
  39.67.199.5
  39.68.11.133
-39.68.134.38
+39.68.144.83
  39.68.154.55
  39.68.22.7
  39.68.226.21
  39.68.37.250
  39.69.115.100
  39.69.127.21
-39.72.102.174
+39.71.194.235
  39.72.110.171
  39.72.13.11
  39.73.1.187
@@ -57332,7 +68054,6 @@
  39.73.160.208
  39.73.169.24
  39.73.17.175
-39.73.177.4
  39.73.183.14
  39.73.217.43
  39.73.243.234
@@ -57356,11 +68077,11 @@
  39.74.36.15
  39.74.48.199
  39.74.52.144
-39.76.160.148
  39.76.189.174
  39.76.22.176
  39.76.239.158
  39.76.69.95
+39.76.71.243
  39.77.106.17
  39.77.110.170
  39.77.115.171
@@ -57368,17 +68089,16 @@
  39.77.166.66
  39.77.229.131
  39.77.37.106
-39.78.158.124
  39.79.146.109
-39.79.146.225
  39.79.147.75
  39.79.149.166
  39.79.150.106
-39.79.150.178
  39.79.185.120
  39.79.185.120bin.sh
  39.79.217.51
  39.79.220.21
+39.79.226.228
+39.79.230.241
  39.79.34.245
  39.79.65.231
  39.79.95.113
@@ -57388,25 +68108,32 @@
  39.80.191.49
  39.80.191.49bin.sh
  39.80.202.13
+39.80.213.30
+39.80.29.237
  39.80.49.229
-39.80.61.19
  39.80.83.114
  39.81.129.193
  39.81.139.3
+39.81.151.137
  39.81.189.207
  39.81.211.185
  39.81.228.167
  39.81.238.18
  39.81.25.141
  39.81.25.160
+39.81.61.64
+39.81.63.80
  39.81.71.183
+39.82.126.204
+39.82.249.12
  39.82.8.36
+39.83.0.12
  39.83.185.237
  39.83.186.54
  39.83.187.141
  39.83.56.21
+39.84.161.197
  39.84.175.185
-39.84.215.151
  39.84.39.52
  39.84.83.126
  39.84.91.64
@@ -57421,21 +68148,20 @@
  39.86.249.146
  39.86.39.219
  39.86.48.26
-39.86.6.226
  39.86.62.165
  39.86.62.244
  39.86.63.244
  39.86.65.119
  39.86.66.16
+39.86.67.24
  39.86.76.213
  39.86.80.133
  39.86.82.189
  39.86.83.30
-39.87.168.104
-39.87.231.115
  39.87.237.182
  39.87.60.188
  39.87.69.253
+39.87.84.12
  39.87.98.115
  39.88.109.128
  39.88.133.23
@@ -57459,34 +68185,50 @@
  39.89.120.174bin.sh
  39.89.131.223
  39.89.140.197
-39.89.145.144
+39.89.144.241
  39.89.145.90
  39.89.147.224
  39.89.151.217
  39.89.154.226
  39.89.157.227
-39.89.170.87
  39.89.174.67
  39.89.194.231
  39.89.204.42
+39.89.206.19
+39.89.208.87
  39.89.209.81
  39.89.237.220
  39.89.30.218
+39.90.10.214
+39.90.143.105
+39.90.143.116
+39.90.143.208
  39.90.152.43
  39.90.154.220
  39.90.159.54bin.sh
+39.90.169.223
+39.90.174.219
  39.90.174.81
+39.91.27.159
+39.96.175.55
  39.96.19.171
  39.96.202.234
+39.96.21.32
  39.96.82.174
+39.96.82.217
  39.97.107.254
  39.97.212.218
  39.97.219.148
  39.97.227.7
  39.97.231.198
  39.97.244.212
+39.97.252.78
+39.98.120.161
+39.99.143.137
  39.99.203.251
+39.99.224.182
  39.99.232.25
+39.99.237.209
  39006.xc.05cg.com
  39009.xc.05cg.com
  390295j03.com
@@ -57709,11 +68451,14 @@
  4.16.101.219
  4.16.101.221
  4.16.101.222
+4.17.231.194
  4.17.231.196
  4.17.231.207
  4.17.231.208
+4.34.52.202
  4.4buyuklergazete.com
  4.53.178.206
+4.7.94.244
  4.71.37.45
  4.71.37.46
  4.79.109.106
@@ -57731,9 +68476,11 @@
  40.113.138.133
  40.113.206.182
  40.113.238.202
+40.113.99.245
  40.114.104.42
  40.114.110.198
  40.114.116.10
+40.114.116.212
  40.114.40.133
  40.114.43.252
  40.114.65.171
@@ -57741,7 +68488,16 @@
  40.114.68.106
  40.114.89.172
  40.115.137.28
+40.115.187.98
+40.115.6.17
+40.115.79.44
  40.117.133.229
+40.117.137.242
+40.117.140.117
+40.117.140.181
+40.117.141.180
+40.117.143.183
+40.117.150.31
  40.117.180.167
  40.117.191.139
  40.117.192.99
@@ -57752,6 +68508,7 @@
  40.118.168.204
  40.118.172.113
  40.118.205.218
+40.118.226.96
  40.118.236.59
  40.118.236.80
  40.118.97.71
@@ -57759,8 +68516,15 @@
  40.121.12.127
  40.121.142.168
  40.121.154.151
+40.121.16.238
  40.121.17.49
+40.121.183.0
  40.121.196.179
+40.121.20.2
+40.121.22.191
+40.121.22.88
+40.121.3.52
+40.121.52.52
  40.121.58.255
  40.121.70.33
  40.121.86.78
@@ -57785,6 +68549,7 @@
  40.124.54.157
  40.125.215.96
  40.125.65.33
+40.127.133.63
  40.127.139.82
  40.127.160.75
  40.127.177.193
@@ -57796,22 +68561,28 @@
  40.69.155.91
  40.69.91.131
  40.69.96.123
+40.70.12.248
  40.70.189.4
  40.70.72.10
  40.71.169.235
  40.71.186.171
+40.71.204.181
  40.71.205.91
  40.71.250.6
  40.71.251.58
  40.71.29.231
  40.71.41.208
  40.71.92.214
+40.72.97.26
+40.73.103.188
  40.73.120.132
  40.73.35.39
+40.73.67.85
  40.73.77.249
  40.73.79.203
  40.74.112.227
  40.74.162.43
+40.74.231.133
  40.74.235.156
  40.74.65.232
  40.74.78.199
@@ -57822,11 +68593,13 @@
  40.76.21.137
  40.76.222.119
  40.76.24.2
+40.76.243.64
  40.76.44.230
  40.76.59.137
  40.76.82.187
  40.76.92.194
  40.77.105.109
+40.77.107.169
  40.77.167.0
  40.77.167.1
  40.77.167.10
@@ -57905,20 +68678,27 @@
  40.79.253.153
  40.79.26.139
  40.79.35.48
+40.80.146.253
+40.80.89.113
  40.80.89.228
-40.81.206.69
  40.83.13.220
  40.83.181.2
  40.83.190.122
+40.83.216.122
  40.83.89.19
  40.84.128.101
+40.84.137.248
  40.84.139.252
  40.84.148.116
  40.84.157.119
  40.84.216.97
  40.84.225.234
+40.85.114.229
+40.85.115.181
+40.85.160.135
  40.85.162.35
  40.85.186.102
+40.85.187.136
  40.85.202.11
  40.85.205.219
  40.85.252.223
@@ -57930,10 +68710,19 @@
  40.86.87.161
  40.86.94.7
  40.86.99.195
+40.87.111.42
  40.87.17.154
  40.87.54.154
  40.89.137.145
+40.89.157.144
  40.89.159.38
+40.90.160.83
+40.91.192.48
+40.91.194.198
+40.91.197.81
+40.91.198.12
+40.91.198.55
+40.91.200.53
  4000095599.com
  400517034274668-dot-charming-sky-2700.appspot.com
  4006261166.com
@@ -57959,9 +68748,12 @@
  41.101.40.77
  41.102.217.22
  41.102.59.247
+41.102.69.6
  41.102.97.25
  41.103.208.28
+41.105.173.176
  41.105.60.148
+41.107.222.164
  41.107.69.41
  41.110.141.3
  41.111.123.99
@@ -57970,22 +68762,32 @@
  41.130.62.64
  41.137.19.58
  41.138.241.106
+41.138.54.13
+41.139.131.177
+41.139.134.169
+41.139.19.133
  41.139.223.242
  41.139.9.47
  41.140.157.168
+41.140.244.48
  41.140.31.106
  41.141.220.3
  41.142.232.133
+41.142.245.48
  41.142.248.91
  41.143.149.21
  41.143.249.57
  41.143.249.60
+41.143.37.128
  41.144.159.85
+41.144.82.131
+41.155.250.79
  41.157.64.105
  41.160.100.202
  41.160.100.204
  41.160.114.37
  41.160.143.99
+41.160.238.202
  41.160.252.116
  41.160.40.2
  41.160.48.202
@@ -57997,6 +68799,7 @@
  41.162.94.52
  41.164.24.243
  41.164.247.186
+41.165.88.132
  41.169.123.37
  41.169.139.2
  41.169.143.211
@@ -58007,7 +68810,9 @@
  41.169.78.42
  41.169.79.166
  41.170.12.92
+41.174.92.228
  41.175.155.78
+41.180.4.117
  41.180.64.254
  41.180.65.27
  41.180.80.27
@@ -58015,9 +68820,17 @@
  41.180.82.158
  41.180.96.110
  41.180.98.70
+41.182.131.219
+41.182.131.229
+41.182.133.154
+41.182.135.118
+41.182.146.218
+41.182.146.227
+41.182.150.112
  41.185.28.84
  41.185.29.128
  41.185.8.170
+41.186.13.157
  41.188.124.50
  41.188.46.17
  41.188.5.110
@@ -58045,6 +68858,7 @@
  41.193.5.52
  41.193.55.190
  41.194.37.106
+41.202.174.9
  41.205.13.126
  41.206.11.44
  41.206.35.222
@@ -58052,12 +68866,18 @@
  41.207.102.254
  41.207.182.133
  41.207.251.194
+41.207.252.122
  41.208.150.114
+41.208.164.253
+41.210.12.203
+41.210.140.35
  41.210.161.114
  41.211.108.123
  41.211.122.81
  41.211.125.122
  41.212.121.138
+41.212.41.144
+41.212.75.162
  41.213.13.146
  41.213.13.154
  41.215.10.6
@@ -58076,11 +68896,14 @@
  41.215.79.182
  41.215.84.170
  41.215.95.113
+41.216.102.178
  41.216.148.55
  41.216.173.222
  41.216.177.127
+41.216.177.169
  41.216.177.17
  41.216.177.3
+41.216.178.63
  41.216.225.250
  41.217.216.17
  41.217.216.45
@@ -58101,16 +68924,25 @@
  41.221.236.62
  41.221.238.5
  41.222.0.194
+41.222.157.53
+41.222.226.98
  41.222.4.146
  41.222.57.63
  41.222.58.37
  41.223.108.13
  41.223.136.40
+41.223.142.211
+41.223.192.155
  41.223.213.175
+41.223.232.115
  41.223.234.116
+41.223.4.155
  41.225.16.155
+41.225.17.53
  41.225.186.80
+41.225.239.204
  41.225.99.33
+41.226.248.98
  41.226.25.4
  41.226.25.65
  41.226.27.133
@@ -58124,7 +68956,11 @@
  41.230.230.113
  41.231.53.25
  41.233.102.53
+41.234.194.54
+41.234.66.53
+41.236.46.222
  41.238.200.222
+41.239.97.150
  41.242.117.242
  41.242.140.145
  41.242.141.134
@@ -58132,9 +68968,15 @@
  41.242.70.5
  41.242.80.29
  41.243.13.70
+41.246.26.143
+41.246.26.183
  41.248.133.186
  41.248.62.160
+41.249.158.236
  41.249.212.74
+41.249.90.125
+41.250.130.243
+41.250.214.173
  41.250.96.149
  41.251.106.8
  41.251.195.2
@@ -58142,6 +68984,7 @@
  41.254.44.62
  41.32.213.239
  41.33.212.68
+41.33.45.180
  41.33.66.227
  41.33.66.228
  41.33.66.230
@@ -58153,13 +68996,19 @@
  41.33.66.248
  41.33.66.250
  41.33.66.254
+41.33.84.42
  41.34.244.224
+41.37.120.172
  41.37.242.159
+41.38.119.243
  41.38.18.230
  41.39.153.4
+41.40.178.81
  41.41.138.9
  41.41.70.190
+41.42.154.210
  41.43.140.210
+41.45.213.110
  41.46.17.110
  41.57.104.3
  41.57.109.74
@@ -58180,9 +69029,16 @@
  41.60.239.11
  41.60.239.123
  41.60.239.193
+41.63.0.133
  41.63.0.41
+41.63.1.38
+41.63.1.39
  41.65.111.226
  41.65.146.38
+41.66.11.29
+41.66.197.90
+41.67.48.101
+41.67.48.110
  41.67.48.71
  41.71.119.195
  41.71.24.167
@@ -58191,6 +69047,7 @@
  41.71.24.190
  41.72.203.182
  41.72.203.66
+41.72.219.102
  41.73.15.130
  41.73.15.134
  41.73.15.14
@@ -58208,6 +69065,7 @@
  41.76.157.46
  41.76.168.88
  41.76.175.129
+41.76.175.130
  41.76.175.131
  41.76.201.215
  41.76.242.14
@@ -58216,10 +69074,14 @@
  41.76.246.254
  41.76.248.17
  41.77.100.129
+41.77.14.165
  41.77.14.57
+41.77.146.98
+41.78.246.118
  41.78.247.252
  41.78.26.155
  41.78.73.144
+41.78.75.45
  41.78.82.180
  41.79.138.87
  41.79.148.229
@@ -58243,34 +69105,39 @@
  41.79.66.106
  41.79.78.59
  41.79.82.46
+41.80.227.212
+41.80.233.27
+41.80.241.89
+41.82.100.8
  41.82.83.76
  41.83.109.15
+41.83.238.98
+41.83.27.249
  41.84.147.218
+41.84.193.18
  41.84.228.65
  41.85.189.66
  41.85.191.6
  41.86.18.10
  41.86.18.133
-41.86.18.147
  41.86.18.150
  41.86.18.152
-41.86.18.157
  41.86.18.174
  41.86.18.20
  41.86.18.202
  41.86.18.204
  41.86.18.207
  41.86.18.22
-41.86.18.93
  41.86.19.200
  41.86.19.205
  41.86.19.206
-41.86.19.210
  41.86.21.14
  41.86.21.23
  41.86.21.27
  41.86.21.28
+41.86.21.3
  41.86.21.44
+41.86.21.52
  41.86.21.59
  41.86.21.61
  41.86.21.62
@@ -58289,7 +69156,10 @@
  41.93.155.17
  41.93.32.89
  41.93.47.69
+41.95.17.156
+41.95.30.205
  41.96.121.202
+41.98.127.12
  41.98.84.239
  4117570-dot-n-e-w-me-ss-age-po-rt-al.wl.r.appspot.com
  413bd12fe0.nxcli.net
@@ -58300,15 +69170,24 @@
  41d976d239e293e20374502f2b2e7b67-dot-online-validation-sevice.ey.r.appspot.com
  41fde.codesandbox.io
  41r73tlc.gmz.cc
+42.106.108.13
+42.106.126.104
+42.106.127.210
+42.107.65.147
+42.107.68.47
+42.111.208.127
+42.111.212.168
  42.112.16.74
  42.112.20.32
  42.112.209.164
+42.112.224.234
+42.112.26.30
  42.112.87.166
  42.113.143.144
  42.113.184.20
+42.113.245.10
  42.114.121.237
  42.115.10.67
-42.115.143.194
  42.115.25.55
  42.115.33.152
  42.115.46.181
@@ -58317,9 +69196,16 @@
  42.115.75.31
  42.115.88.12
  42.115.91.82
+42.116.146.217
+42.116.152.22
+42.116.170.150
  42.116.18.180
+42.116.181.82
+42.116.220.35
  42.118.140.166
+42.118.242.189
  42.118.253.62
+42.119.146.228
  42.157.3.138
  42.159.10.142
  42.159.142.14
@@ -58330,62 +69216,122 @@
  42.159.80.91
  42.159.83.169
  42.159.86.108
+42.177.54.79
+42.177.55.88
+42.178.193.125
  42.178.205.97
+42.178.219.51
+42.179.174.79
  42.180.206.145
-42.180.248.86
+42.192.100.189
  42.192.117.179
  42.192.117.41
+42.192.117.93
  42.192.121.172
  42.192.123.234
  42.192.125.145
  42.192.125.230
+42.192.127.194
+42.192.128.166
+42.192.129.242
+42.192.130.153
+42.192.130.231
  42.192.130.52
+42.192.132.171
  42.192.133.81
  42.192.134.92
+42.192.135.112
+42.192.135.182
+42.192.136.151
  42.192.138.146
  42.192.14.177
+42.192.14.73
+42.192.141.160
+42.192.142.128
+42.192.142.60
+42.192.146.18
+42.192.147.125
+42.192.147.137
+42.192.147.231
  42.192.148.163
+42.192.151.49
  42.192.151.83
  42.192.152.63
  42.192.152.72
+42.192.154.179
  42.192.155.135
+42.192.157.3
+42.192.157.41
  42.192.16.24
  42.192.161.98
  42.192.164.62
+42.192.166.29
+42.192.169.11
+42.192.169.130
+42.192.170.39
  42.192.173.228
  42.192.178.163
+42.192.182.169
+42.192.183.38
+42.192.186.106
  42.192.186.182
+42.192.189.226
  42.192.190.123
  42.192.193.135
+42.192.194.122
  42.192.199.103
  42.192.20.162
  42.192.20.62
  42.192.200.149
  42.192.201.204
+42.192.205.184
  42.192.205.33
  42.192.21.140
+42.192.220.171
+42.192.220.183
+42.192.221.34
  42.192.223.129
  42.192.223.137
  42.192.223.241
  42.192.226.249
  42.192.228.144
+42.192.228.146
+42.192.228.246
+42.192.229.249
+42.192.23.131
  42.192.233.228
+42.192.234.117
  42.192.234.33
  42.192.234.71
  42.192.234.75
  42.192.235.102
+42.192.235.189
+42.192.235.19
+42.192.236.134
+42.192.236.233
+42.192.248.19
  42.192.248.23
+42.192.248.93
  42.192.249.157
+42.192.3.193
  42.192.3.9
+42.192.36.88
  42.192.37.232
  42.192.38.253
+42.192.39.29
+42.192.40.226
  42.192.42.119
  42.192.47.135
+42.192.51.95
+42.192.53.50
  42.192.54.145
+42.192.55.156
  42.192.60.130
  42.192.7.200
  42.192.75.240
  42.192.76.43
+42.192.76.45
+42.192.76.80
  42.192.78.13
  42.192.78.164
  42.192.79.202
@@ -58393,72 +69339,120 @@
  42.192.80.154
  42.192.81.213
  42.192.81.219
+42.192.81.84
  42.192.82.17
+42.192.82.21
+42.192.83.189
+42.192.83.49
+42.192.83.60
  42.192.84.124
  42.192.86.140
+42.192.86.190
+42.192.86.191
  42.192.87.163
+42.192.88.13
  42.192.88.77
+42.192.89.106
+42.192.90.188
  42.192.94.144
+42.192.94.8
+42.192.94.81
+42.193.0.63
  42.193.101.204
+42.193.106.209
+42.193.106.33
+42.193.110.36
+42.193.111.2
  42.193.112.207
+42.193.116.37
  42.193.119.53
  42.193.139.57
  42.193.141.218
  42.193.172.5
  42.193.175.249
+42.193.180.182
+42.193.181.178
+42.193.2.29
+42.193.36.43
+42.193.40.237
+42.193.46.62
  42.193.5.242
  42.193.96.159
  42.194.128.158
  42.194.129.72
+42.194.131.128
+42.194.132.178
  42.194.135.105
  42.194.136.58
+42.194.137.87
  42.194.138.78
+42.194.142.143
  42.194.142.186
+42.194.143.140
+42.194.146.118
  42.194.146.17
+42.194.146.74
  42.194.148.212
+42.194.148.24
+42.194.162.228
  42.194.168.209
+42.194.169.32
  42.194.173.211
+42.194.181.115
  42.194.184.92
  42.194.190.16
+42.194.198.187
+42.194.203.226
+42.194.204.140
+42.194.206.209
+42.194.207.190
  42.194.210.230
  42.194.214.248
+42.194.214.31
  42.194.217.197
+42.194.218.25
+42.194.218.76
  42.194.223.139
  42.194.241.192
+42.200.109.74
  42.200.142.209
  42.200.149.223
+42.200.155.72
  42.200.196.30
+42.200.196.78
  42.200.200.146
+42.200.206.225
  42.200.226.58
  42.200.35.174
  42.200.35.239
  42.200.66.164
+42.200.78.78
+42.200.80.42
+42.200.98.180
  42.201.189.212
  42.201.208.179
-42.202.97.220
  42.224.122.152
-42.224.126.92
+42.224.129.133
  42.224.141.136
-42.224.153.11
+42.224.171.133
  42.224.173.161
  42.224.174.231
  42.224.177.237
  42.224.179.175
  42.224.180.248
+42.224.209.11
  42.224.240.143
  42.224.3.26
-42.224.45.87
-42.224.5.92
-42.224.64.20
+42.224.69.71
  42.224.70.21
  42.224.98.101
  42.224.99.28
-42.225.1.242
  42.225.204.14
-42.225.206.99
+42.225.36.238
+42.225.50.217
  42.227.121.217
+42.227.153.62
  42.227.165.192
-42.227.167.163
  42.227.172.211
  42.227.184.249
  42.227.184.46
@@ -58466,34 +69460,44 @@
  42.227.25.126
  42.228.124.84
  42.228.237.138
+42.228.36.218
+42.228.37.90
  42.228.38.126
-42.228.39.162
  42.228.43.26
  42.228.45.197
  42.228.47.6
+42.228.59.226
+42.228.78.186
  42.228.79.60
  42.228.79.65
  42.228.80.137
-42.230.123.16
+42.229.192.68
+42.230.100.194
+42.230.122.229
+42.230.125.3
+42.230.14.63
+42.230.217.101
  42.230.217.131
  42.230.225.186
  42.230.244.137
  42.230.27.134
-42.230.38.150
  42.230.43.23
  42.230.50.192
+42.230.56.236
+42.230.6.86
  42.230.62.207
  42.230.84.237
  42.230.87.123
+42.230.89.236
+42.230.94.229
  42.230.98.98
-42.230.99.203
  42.231.111.173
+42.231.135.217
  42.231.161.220
+42.231.37.113
  42.231.42.217
  42.232.100.48
  42.232.101.226
-42.232.169.226
-42.232.191.252
  42.232.239.137
  42.233.143.220
  42.233.174.39
@@ -58502,30 +69506,28 @@
  42.233.248.144
  42.233.254.41
  42.233.32.16
-42.233.65.160
-42.233.89.55
+42.233.89.142
  42.234.186.167
  42.234.232.33
+42.234.234.85
  42.234.236.206
-42.234.237.228
-42.235.111.79
-42.235.127.113
+42.235.117.33
  42.235.151.97
  42.235.156.137
-42.235.156.27
-42.235.172.255
+42.235.159.171
+42.235.160.162
  42.235.20.211
-42.235.41.198
  42.235.57.48
-42.235.88.132
+42.235.84.141
  42.235.88.20
  42.235.94.208
  42.236.160.189
  42.236.161.183
  42.236.161.43
  42.236.212.209
+42.236.213.156
  42.236.213.97
-42.236.215.116
+42.236.214.23
  42.236.215.122
  42.236.215.249
  42.236.221.189
@@ -58534,39 +69536,69 @@
  42.237.197.58
  42.237.40.112
  42.237.41.14
-42.238.144.175
-42.238.16.133
-42.238.163.67
+42.237.94.1
+42.238.172.133
+42.238.224.112
  42.238.231.157
+42.238.243.249
  42.238.248.193
  42.238.5.149
  42.239.145.30
  42.239.155.94
-42.239.162.136
-42.239.169.243
+42.239.168.235
  42.239.181.224
  42.239.193.119
+42.239.233.243
  42.239.239.71
+42.239.240.187
  42.239.246.63
-42.239.253.193
+42.239.248.58
+42.239.31.165
+42.239.42.194
  42.239.94.203
  42.242.200.90
+42.242.92.45
  42.248.77.136
  42.248.78.118
  42.248.78.142
+42.248.78.144
+42.248.78.56
  42.3.139.170
+42.3.16.199
+42.5.100.169
+42.5.100.68
+42.5.101.14
+42.5.102.117
+42.5.150.236
+42.5.150.95
+42.5.151.152
  42.51.173.18
+42.51.18.107
  42.51.201.86
  42.51.26.79
  42.51.34.169
  42.52.92.136
  42.54.233.49
+42.56.62.18
  42.57.216.66
  42.58.119.2
+42.59.122.236
  42.59.204.103
+42.59.52.170
+42.59.52.74
+42.59.53.32
  42.63.24.226
+42.81.124.15
+42.86.3.146
+42.86.76.64
+42.86.77.167
+42.86.77.3
  42.87.76.172
+42.98.152.233
+42.98.78.134
+42.98.8.73
  42.99.116.139
+42.99.180.135
  420365365.com
  420marijuanalist.com
  420weeds.us
@@ -58636,18 +69668,29 @@
  43.225.67.39
  43.225.98.18
  43.225.98.22
+43.226.144.179
  43.226.144.63
  43.226.144.80
  43.226.145.228
+43.226.146.108
  43.226.147.142
+43.226.147.160
+43.226.147.226
+43.226.147.4
  43.226.152.45
  43.226.153.101
  43.226.153.158
  43.226.16.20
  43.226.22.77
+43.226.238.12
+43.226.29.168
+43.226.32.12
  43.226.33.22
+43.226.34.50
  43.226.40.176
+43.226.51.234
  43.226.53.29
+43.226.69.103
  43.227.128.6
  43.227.135.214
  43.227.253.247
@@ -58657,8 +69700,10 @@
  43.228.126.114
  43.228.130.75
  43.228.131.115
+43.228.143.88
  43.228.222.114
  43.228.222.2
+43.228.245.151
  43.229.149.83
  43.229.151.135
  43.229.153.13
@@ -58688,8 +69733,11 @@
  43.230.7.65
  43.230.89.50
  43.230.89.54
+43.231.129.193
  43.231.240.23
  43.231.56.113
+43.231.56.52
+43.231.62.98
  43.231.76.1
  43.231.76.105
  43.231.76.109
@@ -58743,6 +69791,7 @@
  43.231.79.1
  43.231.79.9
  43.239.160.241
+43.239.67.110
  43.239.75.102
  43.239.75.145
  43.239.75.189
@@ -58757,11 +69806,13 @@
  43.240.226.28
  43.240.6.86
  43.240.66.46
+43.240.66.85
  43.241.106.183
-43.241.128.140
  43.241.17.89
  43.241.196.78
  43.241.30.222
+43.241.56.15
+43.241.63.96
  43.242.128.32
  43.242.174.69
  43.242.174.70
@@ -58771,18 +69822,22 @@
  43.243.204.106
  43.243.204.134
  43.243.207.242
+43.243.87.144
  43.245.184.150
  43.245.185.66
  43.245.192.126
  43.245.192.174
  43.245.202.13
  43.245.202.15
+43.245.216.238
+43.245.222.163
  43.245.94.226
  43.246.139.33
  43.247.102.81
  43.247.102.90
  43.247.12.110
  43.247.14.122
+43.248.128.195
  43.248.24.122
  43.248.24.157
  43.248.24.158
@@ -58790,15 +69845,23 @@
  43.248.24.234
  43.248.25.6
  43.248.26.18
+43.248.71.246
  43.248.9.100
+43.249.113.220
+43.249.113.235
+43.249.113.243
+43.249.113.246
  43.249.114.36
  43.249.205.169
  43.249.52.100
+43.249.53.182
+43.249.55.42
  43.249.65.56
  43.249.83.11
  43.250.126.1
  43.250.127.98
  43.250.164.92
+43.250.186.54
  43.250.205.151
  43.250.207.92
  43.250.80.117
@@ -58813,6 +69876,7 @@
  43.252.106.58
  43.252.120.151
  43.252.120.51
+43.252.127.245
  43.252.156.161
  43.252.156.214
  43.252.159.195
@@ -58829,21 +69893,27 @@
  43.252.237.205
  43.252.237.84
  43.252.238.50
+43.252.60.40
  43.252.73.99
  43.254.151.94
+43.254.153.79
  43.254.156.209
  43.254.156.48
+43.254.158.178
  43.254.158.179
+43.254.158.189
  43.254.217.145
  43.254.217.158
  43.254.219.183
  43.254.219.3
  43.254.43.122
+43.254.64.217
  43.255.140.133
  43.255.140.38
  43.255.152.16
  43.255.217.186
  43.255.228.150
+43.255.31.78
  430lodsposlok.site
  430lodsposlok.store
  431-365.net
@@ -58852,6 +69922,7 @@
  435072835117215-dot-wetransfer-auth-file-343.appspot.com
  43512bc74be66e4dd8305d3b0d52a2616-dot-gold-cycling-287718.df.r.appspot.com
  435r4q3r.win
+4365b67f-a597-4e17-8b51-179628.godaddysites.com
  436945-dot-n-e-w-me-ss-age-po-rt-al.wl.r.appspot.com
  437.31cf4fdae.com
  43784643.weebly.com
@@ -58892,6 +69963,7 @@
  44realestates.com
  44unit.duckdns.org
  45-76-47-204.plesk.page
+45.10.1.38
  45.10.165.27
  45.10.232.104
  45.10.232.111
@@ -58918,17 +69990,23 @@
  45.10.88.124
  45.11.183.191
  45.11.20.182
+45.11.27.219
  45.11.79.19
+45.11.79.57
  45.112.0.34
  45.112.0.43
  45.112.1.161
  45.112.11.25
  45.112.127.23
  45.112.203.124
+45.112.242.105
+45.112.242.120
+45.112.242.254
  45.112.56.142
  45.112.57.230
  45.113.1.94
  45.113.238.30
+45.113.32.180
  45.113.67.66
  45.113.80.188
  45.113.80.44
@@ -58949,6 +70027,7 @@
  45.115.176.235
  45.115.211.10
  45.115.60.197
+45.115.62.131
  45.115.63.78
  45.116.14.20
  45.116.162.37
@@ -58973,12 +70052,14 @@
  45.117.102.194
  45.117.102.201
  45.117.102.238
+45.117.171.182
  45.117.228.153
  45.117.228.65
  45.117.228.81
  45.117.228.85
  45.117.228.89
  45.117.228.97
+45.117.249.175
  45.117.30.153
  45.117.30.177
  45.117.30.201
@@ -58998,19 +70079,24 @@
  45.118.144.77
  45.118.145.223
  45.118.151.85
+45.118.32.73
  45.118.35.69
  45.119.125.88
  45.119.203.170
  45.119.212.14
  45.119.212.150
+45.119.212.93
  45.119.213.240
  45.119.215.150
+45.119.80.123
  45.119.80.168
  45.119.80.98
  45.119.82.132
  45.119.82.251
+45.119.83.164
  45.119.83.68
  45.119.84.18
+45.119.85.145
  45.12.177.127
  45.12.177.199
  45.12.177.212
@@ -59018,6 +70104,7 @@
  45.12.215.204
  45.12.215.243
  45.12.223.132
+45.12.5.78
  45.120.119.55
  45.120.162.120
  45.120.224.19
@@ -59050,6 +70137,7 @@
  45.122.138.123
  45.122.138.124
  45.122.138.125
+45.122.221.30
  45.122.255.205
  45.123.197.146
  45.123.197.38
@@ -59064,6 +70152,7 @@
  45.123.43.138
  45.123.8.165
  45.124.113.6
+45.124.144.116
  45.124.169.26
  45.124.171.145
  45.124.171.146
@@ -59073,8 +70162,11 @@
  45.124.24.215
  45.124.24.38
  45.124.25.237
+45.124.86.155
+45.124.95.174
  45.125.12.170
  45.125.14.78
+45.125.222.120
  45.125.239.34
  45.125.245.104
  45.125.245.105
@@ -59085,6 +70177,7 @@
  45.125.245.89
  45.125.245.91
  45.125.63.46
+45.125.65.118
  45.125.65.119
  45.125.65.45
  45.126.11.57
@@ -59094,7 +70187,9 @@
  45.126.169.185
  45.126.169.193
  45.126.169.233
+45.127.133.61
  45.127.205.72
+45.127.96.175
  45.127.97.67
  45.128.133.233
  45.128.133.242
@@ -59103,6 +70198,7 @@
  45.129.165.136
  45.129.166.40
  45.129.180.214
+45.129.2.45
  45.129.56.200
  45.129.96.49
  45.13.228.129
@@ -59115,16 +70211,18 @@
  45.13.58.149
  45.13.58.4
  45.130.128.201
-45.130.138.11
  45.130.138.6
  45.130.229.230
  45.130.255.114
  45.130.255.126
  45.130.255.231
  45.130.255.24
+45.130.97.187
+45.131.174.78
  45.131.192.91
  45.131.194.177
  45.131.195.112
+45.131.195.132
  45.131.195.192
  45.131.47.106
  45.132.104.18
@@ -59142,20 +70240,22 @@
  45.133.119.138
  45.133.180.94
  45.133.192.140
+45.133.192.156
  45.133.193.72
  45.133.9.209
  45.133.9.21
+45.133.9.25
  45.133.9.60
+45.134.145.165
  45.134.183.202
  45.134.187.150
  45.134.187.94
  45.134.22.2
  45.135.118.144
-45.135.232.21
-45.135.232.24
  45.135.39.35
  45.135.4.143
  45.135.4.215
+45.136.0.194
  45.136.12.45
  45.136.12.47
  45.136.173.207
@@ -59171,10 +70271,14 @@
  45.138.101.178
  45.138.101.28
  45.138.102.120
+45.138.72.125
  45.138.97.46
+45.138.97.73
+45.138.98.146
  45.138.99.4
  45.139.176.170
  45.139.176.78
+45.139.186.55
  45.139.236.14
  45.139.236.5
  45.14.148.105
@@ -59205,6 +70309,7 @@
  45.14.224.66
  45.14.224.69
  45.14.224.77
+45.14.251.175
  45.14.29.133
  45.14.49.56
  45.14.50.207
@@ -59232,11 +70337,46 @@
  45.141.84.126
  45.141.84.184
  45.141.84.57
+45.142.120.11
+45.142.120.121
  45.142.120.133
+45.142.120.135
+45.142.120.137
  45.142.120.138
  45.142.120.149
+45.142.120.15
+45.142.120.166
  45.142.120.180
+45.142.120.183
+45.142.120.192
+45.142.120.20
+45.142.120.209
+45.142.120.215
+45.142.120.31
+45.142.120.32
+45.142.120.34
+45.142.120.35
+45.142.120.37
+45.142.120.38
+45.142.120.39
+45.142.120.51
+45.142.120.52
+45.142.120.54
+45.142.120.55
+45.142.120.56
+45.142.120.57
+45.142.120.58
+45.142.120.59
+45.142.120.60
+45.142.120.62
+45.142.120.63
+45.142.120.65
+45.142.120.74
+45.142.120.79
+45.142.120.82
+45.142.120.84
  45.142.120.87
+45.142.120.90
  45.142.120.99
  45.142.124.128
  45.142.214.153
@@ -59257,18 +70397,23 @@
  45.143.223.249
  45.143.223.42
  45.143.223.7
+45.143.92.168
  45.144.136.187
+45.144.215.106
  45.144.30.41
+45.144.65.49
  45.145.117.73
  45.145.118.85
  45.145.119.38
  45.145.125.90
  45.145.128.139
  45.145.128.222
+45.145.185.0
  45.145.185.106
  45.145.185.111
  45.145.185.120
  45.145.185.137
+45.145.185.156
  45.145.185.187
  45.145.185.189
  45.145.185.194
@@ -59279,6 +70424,8 @@
  45.145.185.26
  45.145.185.31
  45.145.185.36
+45.145.185.48
+45.145.185.56
  45.145.185.74
  45.145.185.75
  45.145.185.94
@@ -59286,10 +70433,9 @@
  45.145.56.88
  45.145.56.92
  45.146.15.24
-45.146.164.211
-45.146.165.171
  45.146.165.25
  45.146.166.198
+45.146.167.61
  45.146.168.173
  45.147.192.52
  45.147.192.87
@@ -59310,6 +70456,7 @@
  45.148.10.202
  45.148.10.47
  45.148.10.54
+45.148.10.61
  45.148.10.83
  45.148.10.86
  45.148.10.89
@@ -59319,14 +70466,20 @@
  45.148.10.95
  45.148.120.126
  45.148.120.155
+45.148.120.173
  45.148.120.193
  45.148.120.88
  45.148.122.113
+45.148.8.6
+45.148.8.73
  45.149.130.215
  45.149.131.202
+45.149.77.27
  45.149.78.128
+45.149.78.45
  45.149.83.208
  45.15.143.129
+45.15.143.183
  45.15.143.198
  45.15.143.218
  45.15.143.253
@@ -59336,6 +70489,7 @@
  45.15.24.48
  45.15.61.233
  45.150.206.10
+45.150.206.40
  45.150.66.158
  45.150.66.226
  45.150.66.243
@@ -59345,6 +70499,8 @@
  45.151.167.10
  45.151.28.36
  45.152.180.20
+45.152.181.20
+45.152.181.212
  45.152.199.190
  45.152.199.236
  45.152.199.254
@@ -59415,34 +70571,39 @@
  45.155.157.239
  45.155.173.239
  45.155.205.108
-45.155.205.121
-45.155.205.123
-45.155.205.148
  45.155.205.177
-45.155.205.31
-45.155.205.40
+45.155.205.24
+45.155.205.25
  45.155.205.41
  45.155.205.78
  45.155.205.86
  45.155.205.87
+45.155.89.122
  45.156.185.186
  45.156.21.219
  45.156.22.152
  45.156.23.33
+45.156.26.91
  45.156.84.236
  45.157.138.108
+45.157.60.21
+45.158.199.10
  45.158.199.156
+45.159.14.235
+45.159.184.141
  45.16.126.242
  45.16.226.117
  45.160.179.169
  45.160.179.6
  45.160.75.11
  45.161.242.102
+45.161.242.84
  45.161.255.21
  45.161.255.62
  45.162.123.9
  45.162.225.82
  45.162.231.108
+45.162.231.75
  45.162.4.175
  45.162.4.83
  45.163.117.6
@@ -59457,12 +70618,15 @@
  45.164.140.133
  45.164.140.152
  45.164.141.101
+45.164.161.10
+45.164.221.106
  45.164.247.136
  45.164.8.244
  45.165.152.26
  45.165.214.39
  45.165.68.2
  45.165.68.5
+45.165.9.245
  45.166.186.239
  45.166.35.0
  45.166.35.10
@@ -59473,6 +70637,8 @@
  45.166.35.79
  45.166.35.80
  45.166.35.9
+45.167.10.212
+45.167.178.73
  45.167.220.135
  45.167.36.35
  45.167.36.49
@@ -59502,15 +70668,25 @@
  45.169.64.208
  45.169.98.242
  45.17.72.227
+45.170.129.135
+45.170.135.67
  45.170.14.146
  45.170.14.19
  45.170.14.240
  45.170.14.30
+45.171.144.37
  45.171.144.39
+45.171.246.64
+45.172.108.72
+45.172.108.76
  45.172.133.0
  45.172.133.218
  45.172.135.230
+45.172.83.254
+45.173.138.78
  45.173.140.128
+45.173.204.32
+45.173.228.97
  45.173.28.1
  45.173.72.9
  45.173.88.33
@@ -59520,18 +70696,16 @@
  45.175.179.182
  45.175.179.229
  45.175.179.230
-45.176.108.28
-45.176.109.212
  45.176.109.28bin.sh
-45.176.110.64
-45.176.110.66
-45.176.111.111
  45.176.111.6
  45.177.108.98
+45.177.109.244
+45.177.208.9
  45.177.223.2
  45.177.233.106
  45.178.181.98
  45.179.24.234
+45.179.245.177
  45.181.222.192
  45.181.228.208
  45.181.228.212
@@ -59541,11 +70715,23 @@
  45.181.228.220
  45.181.228.222
  45.181.229.23
+45.181.30.99
+45.181.31.113
+45.181.31.250
+45.181.31.53
  45.181.47.1
+45.182.145.192
+45.183.192.14
  45.184.103.73
+45.184.24.5
  45.184.68.32
+45.184.81.228
+45.185.193.91
  45.185.40.6
  45.185.41.65
+45.186.132.130
+45.186.4.157
+45.186.4.49
  45.187.137.26
  45.187.93.26
  45.188.82.131
@@ -59574,17 +70760,26 @@
  45.201.145.76
  45.201.175.222
  45.201.209.44
+45.202.25.50
+45.207.168.104
  45.207.21.171
  45.207.21.182
  45.207.58.113
+45.22.19.58
  45.220.1.17
+45.221.11.52
  45.221.77.82
+45.224.161.134
+45.224.161.217
  45.224.173.254
  45.224.197.137
  45.224.22.162
+45.224.23.57
  45.224.43.68
  45.225.90.118
+45.225.92.93
  45.226.138.6
+45.226.228.105
  45.226.48.38
  45.226.48.54
  45.226.48.57
@@ -59597,6 +70792,8 @@
  45.227.159.7
  45.227.254.241
  45.227.254.245
+45.227.97.95
+45.228.138.18
  45.228.164.158
  45.228.189.240
  45.228.4.1
@@ -59618,6 +70815,7 @@
  45.228.96.65
  45.229.173.234
  45.229.174.32
+45.229.53.251
  45.229.54.1
  45.229.54.104
  45.229.54.108
@@ -59662,6 +70860,7 @@
  45.229.54.8
  45.229.54.83
  45.229.54.84
+45.229.54.89
  45.229.54.90
  45.229.54.92
  45.229.54.98
@@ -59689,7 +70888,11 @@
  45.230.100.238
  45.230.147.107
  45.230.228.26
+45.230.237.31
+45.230.244.20
  45.230.8.20
+45.230.80.130
+45.231.12.37
  45.231.133.196
  45.231.213.110
  45.231.29.60
@@ -59701,20 +70904,28 @@
  45.232.226.137
  45.232.226.158
  45.232.226.78
+45.232.244.5
+45.232.251.12
  45.232.64.17
  45.232.65.214
  45.232.66.66
  45.232.73.46bin.sh
+45.232.73.57
  45.232.73.83
+45.232.75.253
  45.233.169.14
+45.233.172.2
  45.233.76.160
  45.233.78.128
  45.233.79.10
  45.233.79.42
  45.234.148.1
  45.234.200.18
+45.234.212.234
+45.234.67.76
  45.235.110.153
  45.235.120.65
+45.235.21.137
  45.235.216.112
  45.235.34.16
  45.235.4.132
@@ -59722,6 +70933,9 @@
  45.235.5.163
  45.236.120.241
  45.236.129.243
+45.236.149.17
+45.236.149.37
+45.236.149.69
  45.236.152.121
  45.236.154.0
  45.236.170.6
@@ -59744,14 +70958,24 @@
  45.238.252.74
  45.238.37.177
  45.239.84.133
+45.240.88.16
  45.240.88.186
+45.240.88.20
+45.240.88.35
+45.240.88.36
+45.242.19.81
  45.247.150.190
  45.248.138.210
  45.248.139.140
+45.248.156.98
  45.248.160.133
+45.248.192.232
  45.248.192.48
+45.248.193.120
+45.248.194.75
  45.248.195.170
  45.248.195.94
+45.248.25.122
  45.248.43.33
  45.248.57.126
  45.248.85.91
@@ -59763,14 +70987,19 @@
  45.249.101.1
  45.249.122.6
  45.249.245.101
+45.249.245.148
  45.249.245.50
+45.249.247.162
  45.249.50.250
  45.249.79.105
  45.249.79.185
  45.249.79.190
+45.249.91.181
  45.250.226.136
  45.250.226.56
  45.250.244.218
+45.250.245.119
+45.250.245.154
  45.251.240.125
  45.251.240.197
  45.252.189.141
@@ -59784,7 +71013,6 @@
  45.252.248.18
  45.253.26.158
  45.254.26.239
-45.254.26.250
  45.3.204.22
  45.31.114.119
  45.32.10.111
@@ -59859,6 +71087,7 @@
  45.32.34.25
  45.32.37.138
  45.32.37.84
+45.32.38.197
  45.32.38.83
  45.32.41.117
  45.32.42.158
@@ -59894,6 +71123,7 @@
  45.33.12.226
  45.33.120.15
  45.33.122.117
+45.33.124.121
  45.33.125.57
  45.33.126.180
  45.33.126.185
@@ -59928,6 +71158,7 @@
  45.33.81.202
  45.33.86.149
  45.33.91.252
+45.33.94.33
  45.33.96.212
  45.33.98.211
  45.33.98.244
@@ -59937,7 +71168,10 @@
  45.35.86.118
  45.36.184.6
  45.4.158.22
+45.4.168.106
+45.4.170.203
  45.4.187.43
+45.4.202.109
  45.4.237.72
  45.4.254.82
  45.4.5.221
@@ -59945,19 +71179,38 @@
  45.4.55.10
  45.4.85.152
  45.40.130.40
+45.40.156.15
+45.40.164.163
+45.40.164.166
+45.40.166.139
+45.40.166.141
  45.40.166.142
  45.40.166.144
+45.40.166.146
+45.40.166.150
+45.40.166.157
+45.40.166.167
+45.40.166.172
+45.40.166.2
+45.40.167.5
  45.40.192.155
  45.40.193.40
  45.40.196.167
+45.40.199.82
+45.40.203.112
+45.40.234.156
+45.40.251.51
  45.40.253.179
  45.41.132.198
+45.41.134.130
  45.41.180.24
  45.43.129.129
+45.43.13.176
  45.43.18.171
  45.43.18.215
  45.43.27.71
  45.46.162.85
+45.46.210.164
  45.46.51.2
  45.47.94.177
  45.48.168.16
@@ -59973,6 +71226,7 @@
  45.5.208.57
  45.5.208.6
  45.5.209.14
+45.5.238.103
  45.50.46.221
  45.55.1.145
  45.55.105.105
@@ -59984,6 +71238,7 @@
  45.55.132.121
  45.55.132.29
  45.55.133.137
+45.55.134.210
  45.55.135.112
  45.55.138.178
  45.55.139.182
@@ -59999,7 +71254,9 @@
  45.55.160.193
  45.55.163.151
  45.55.163.175
+45.55.163.60
  45.55.164.112
+45.55.167.87
  45.55.17.60
  45.55.171.70
  45.55.172.231
@@ -60009,6 +71266,7 @@
  45.55.174.66
  45.55.174.85
  45.55.175.193
+45.55.176.173
  45.55.178.16
  45.55.179.219
  45.55.179.243
@@ -60017,11 +71275,13 @@
  45.55.182.159
  45.55.182.232
  45.55.183.172
+45.55.184.78
  45.55.188.143
  45.55.189.252
  45.55.195.238
  45.55.196.1
  45.55.197.129
+45.55.20.115
  45.55.200.167
  45.55.203.174
  45.55.204.230
@@ -60037,7 +71297,9 @@
  45.55.221.128
  45.55.221.172
  45.55.221.203
+45.55.222.162
  45.55.224.174
+45.55.224.209
  45.55.225.153
  45.55.227.115
  45.55.227.196
@@ -60048,9 +71310,11 @@
  45.55.231.12
  45.55.232.81
  45.55.233.181
+45.55.233.213
  45.55.233.7
  45.55.234.146
  45.55.235.146
+45.55.237.182
  45.55.239.97
  45.55.24.22
  45.55.240.206
@@ -60066,8 +71330,10 @@
  45.55.27.246
  45.55.28.53
  45.55.31.74
+45.55.36.216
  45.55.36.51
  45.55.38.140
+45.55.39.193
  45.55.39.201
  45.55.4.4
  45.55.40.194
@@ -60076,6 +71342,7 @@
  45.55.47.167
  45.55.47.212
  45.55.47.223
+45.55.47.25
  45.55.48.192
  45.55.48.4
  45.55.48.63
@@ -60085,6 +71352,7 @@
  45.55.55.74
  45.55.55.92
  45.55.56.163
+45.55.57.6
  45.55.58.10
  45.55.58.205
  45.55.58.248
@@ -60098,6 +71366,7 @@
  45.55.72.34
  45.55.73.155
  45.55.73.47
+45.55.75.215
  45.55.75.49
  45.55.76.70
  45.55.78.41
@@ -60118,8 +71387,11 @@
  45.56.122.133
  45.56.122.75
  45.56.126.93
+45.56.127.75
+45.56.142.78
  45.56.150.125
  45.56.162.8
+45.56.174.74
  45.56.180.7
  45.56.77.104
  45.56.79.249
@@ -60169,7 +71441,10 @@
  45.6.228.178
  45.6.229.224
  45.6.231.106
+45.6.27.210
+45.6.29.44
  45.6.37.241
+45.6.56.54
  45.6.92.131
  45.61.136.14
  45.61.136.31
@@ -60204,6 +71479,7 @@
  45.61.51.150
  45.62.102.128
  45.62.102.27
+45.62.112.135
  45.62.216.111
  45.62.216.203
  45.62.246.12
@@ -60260,6 +71536,7 @@
  45.64.130.147
  45.64.139.126
  45.64.160.53
+45.64.184.140
  45.64.186.122
  45.64.213.46
  45.64.237.24
@@ -60271,6 +71548,7 @@
  45.65.129.38
  45.65.131.128
  45.65.196.7
+45.65.241.229
  45.65.251.186
  45.65.65.18
  45.66.11.13
@@ -60285,6 +71563,7 @@
  45.66.209.101
  45.66.209.74
  45.66.35.35
+45.66.40.222
  45.66.9.110
  45.66.9.200
  45.67.14.154
@@ -60294,7 +71573,10 @@
  45.67.228.196
  45.67.230.130
  45.67.230.58
+45.7.107.241
+45.7.116.162
  45.7.134.138
+45.7.171.48
  45.7.176.126
  45.7.176.169
  45.7.176.42
@@ -60339,6 +71621,7 @@
  45.7.179.154
  45.7.179.158
  45.7.179.201
+45.7.196.77
  45.7.198.155
  45.7.205.103
  45.7.231.15
@@ -60358,7 +71641,9 @@
  45.70.206.33
  45.70.207.253
  45.70.208.42
+45.70.222.57
  45.70.3.30
+45.70.60.217
  45.70.84.1
  45.70.84.145
  45.70.84.32
@@ -60594,6 +71879,7 @@
  45.77.90.64
  45.77.95.108
  45.78.129.145
+45.78.185.234
  45.78.19.206
  45.78.19.3
  45.78.45.82
@@ -60686,6 +71972,8 @@
  45.79.95.107
  45.79.95.154
  45.79.99.208
+45.8.44.67
+45.8.44.71
  45.80.106.221
  45.80.106.83
  45.80.114.10
@@ -60699,12 +71987,17 @@
  45.80.210.209
  45.80.210.242
  45.80.210.32
+45.80.64.142
+45.80.64.230
+45.80.64.246
  45.81.139.48
+45.81.148.170
  45.81.226.17
  45.81.226.57
  45.81.235.31
  45.81.7.68
  45.82.120.55
+45.82.137.35
  45.82.139.34
  45.82.197.189
  45.82.197.40
@@ -60712,6 +72005,7 @@
  45.82.72.92
  45.82.81.215
  45.82.83.216
+45.83.151.69
  45.83.91.90
  45.84.196.100
  45.84.196.110
@@ -60788,6 +72082,7 @@
  45.86.201.3
  45.86.247.156
  45.86.65.210
+45.87.115.231
  45.87.184.64
  45.87.186.77
  45.87.2.128
@@ -60799,11 +72094,15 @@
  45.88.106.90
  45.88.109.161
  45.88.110.171
+45.88.12.165
  45.88.12.52
+45.88.13.92
  45.88.3.145
  45.88.3.244
  45.89.16.45
  45.89.173.98
+45.89.174.104
+45.89.174.84
  45.89.233.98
  45.9.122.225
  45.9.122.253
@@ -60825,12 +72124,14 @@
  45.90.188.142
  45.90.222.161
  45.90.57.101
+45.90.57.194
  45.91.101.18
  45.91.203.3
  45.92.156.107
  45.92.28.101
  45.92.28.122
  45.92.28.56
+45.92.32.10
  45.92.33.4
  45.92.43.12
  45.94.232.98
@@ -60950,6 +72251,7 @@
  45.95.169.232
  45.95.169.233
  45.95.169.234
+45.95.169.237
  45.95.169.238
  45.95.169.249
  45.95.169.254
@@ -61000,9 +72302,11 @@
  46.0.203.99
  46.10.199.90
  46.10.221.163
+46.100.58.5
  46.100.74.74
  46.101.0.138
  46.101.1.193
+46.101.100.227
  46.101.101.183
  46.101.101.253
  46.101.102.11
@@ -61012,30 +72316,36 @@
  46.101.111.196
  46.101.112.24
  46.101.112.251
+46.101.113.206
  46.101.114.250
  46.101.115.96
+46.101.116.212
  46.101.117.167
+46.101.117.230
  46.101.118.25
  46.101.12.160
  46.101.120.159
+46.101.120.8
  46.101.127.55
  46.101.128.55
  46.101.129.207
  46.101.13.178
  46.101.130.218
  46.101.131.239
-46.101.131.38
  46.101.131.85
-46.101.132.42
+46.101.132.88
  46.101.134.144
  46.101.134.178
  46.101.136.69
  46.101.138.202
  46.101.138.85
  46.101.139.248
+46.101.141.140
  46.101.141.96
  46.101.143.148
  46.101.144.52
+46.101.149.23
+46.101.150.11
  46.101.151.167
  46.101.152.58
  46.101.156.49
@@ -61050,6 +72360,7 @@
  46.101.168.62
  46.101.169.56
  46.101.17.224
+46.101.171.103
  46.101.173.231
  46.101.173.66
  46.101.173.84
@@ -61063,31 +72374,37 @@
  46.101.188.144
  46.101.189.20
  46.101.189.37
+46.101.19.133
  46.101.19.172
  46.101.191.77
  46.101.193.5
  46.101.193.50
  46.101.193.54
+46.101.193.68
  46.101.193.77
  46.101.194.220
  46.101.194.30
  46.101.194.37
-46.101.195.87
+46.101.195.156
  46.101.196.146
  46.101.196.96
  46.101.197.40
  46.101.201.158
  46.101.201.4
+46.101.204.20
  46.101.205.178
  46.101.205.93
  46.101.206.8
+46.101.209.178
  46.101.209.251
  46.101.211.105
  46.101.211.171
-46.101.212.43
+46.101.211.196
+46.101.213.246
  46.101.214.166
  46.101.214.201
  46.101.215.222
+46.101.220.184
  46.101.220.225
  46.101.221.84
  46.101.223.195
@@ -61096,6 +72413,7 @@
  46.101.228.241
  46.101.228.29
  46.101.23.47
+46.101.23.51
  46.101.230.89
  46.101.236.48
  46.101.237.216
@@ -61112,8 +72430,10 @@
  46.101.244.227
  46.101.245.176
  46.101.246.28
+46.101.248.180
  46.101.249.159
  46.101.249.178
+46.101.249.232
  46.101.25.149
  46.101.250.174
  46.101.252.51
@@ -61141,6 +72461,7 @@
  46.101.52.217
  46.101.53.154
  46.101.53.190
+46.101.57.241
  46.101.58.148
  46.101.58.149
  46.101.58.151
@@ -61157,6 +72478,7 @@
  46.101.80.211
  46.101.80.241
  46.101.80.43
+46.101.81.12
  46.101.81.219
  46.101.81.228
  46.101.83.196
@@ -61165,7 +72487,10 @@
  46.101.87.133
  46.101.88.10
  46.101.88.159
+46.101.90.205
  46.101.94.141
+46.101.95.65
+46.101.97.5
  46.101.97.80
  46.101.99.84
  46.102.130.230
@@ -61174,6 +72499,7 @@
  46.102.97.90
  46.105.100.149
  46.105.100.183
+46.105.100.82
  46.105.101.28
  46.105.101.95
  46.105.102.203
@@ -61194,20 +72520,29 @@
  46.105.131.69
  46.105.131.79
  46.105.131.87
+46.105.149.168
  46.105.160.91
  46.105.161.65
  46.105.17.34
+46.105.178.241
+46.105.178.244
  46.105.18.17
  46.105.226.77
  46.105.227.206
+46.105.243.22
+46.105.244.17
  46.105.250.196
  46.105.251.236
  46.105.252.253
+46.105.29.160
  46.105.31.249
  46.105.32.34
+46.105.41.136
+46.105.45.118
  46.105.46.162
  46.105.49.134
  46.105.56.193
+46.105.6.199
  46.105.75.179
  46.105.87.167
  46.105.97.40
@@ -61218,8 +72553,11 @@
  46.107.230.122
  46.107.230.156
  46.107.238.24
+46.107.238.30
  46.108.136.27
  46.109.92.121
+46.114.6.251
+46.116.168.126
  46.118.112.135
  46.118.114.118
  46.118.118.233
@@ -61234,6 +72572,7 @@
  46.119.113.162
  46.119.115.106
  46.119.121.84
+46.119.126.245
  46.119.127.129
  46.119.160.60
  46.119.172.146
@@ -61245,19 +72584,25 @@
  46.121.210.238
  46.124.169.22
  46.126.139.2
+46.126.203.45
  46.126.205.128
  46.126.230.24
  46.126.236.2
+46.126.3.28
  46.127.117.25
  46.128.140.193
  46.128.41.9
+46.128.92.113
  46.13.164.177
  46.13.45.162
  46.130.248.250
  46.132.185.169
+46.135.230.120
  46.137.102.36
  46.137.138.142
+46.138.18.241
  46.138.245.49
+46.138.91.226
  46.139.105.181
  46.142.121.203
  46.142.145.33
@@ -61281,6 +72626,7 @@
  46.148.20.25
  46.148.206.226
  46.148.89.19
+46.149.113.2
  46.149.233.190
  46.149.86.51
  46.150.160.90
@@ -61289,6 +72635,7 @@
  46.150.23.93
  46.151.150.11
  46.151.157.115
+46.151.212.38
  46.151.52.196
  46.151.52.197
  46.151.52.231
@@ -61300,8 +72647,7 @@
  46.16.228.6
  46.160.195.121
  46.160.202.162
-46.161.27.28
-46.161.27.39
+46.161.27.48
  46.161.40.104
  46.161.60.148
  46.161.61.24
@@ -61382,6 +72728,8 @@
  46.161.9.8
  46.163.144.228
  46.163.76.40
+46.163.78.153
+46.164.143.82
  46.164.152.114
  46.164.237.224
  46.164.237.75
@@ -61411,6 +72759,7 @@
  46.166.142.2
  46.166.142.216
  46.166.142.221
+46.166.143.104
  46.166.148.160
  46.166.148.177
  46.166.151.116
@@ -61449,6 +72798,8 @@
  46.167.244.59
  46.167.68.68
  46.167.73.220
+46.17.252.134
+46.17.42.156
  46.17.42.24
  46.17.99.143
  46.170.142.2
@@ -61465,6 +72816,7 @@
  46.172.69.163
  46.172.69.76
  46.172.84.203
+46.173.112.137
  46.173.175.178
  46.173.191.124
  46.173.191.94
@@ -61477,9 +72829,12 @@
  46.175.171.19
  46.175.186.24
  46.175.187.126
+46.175.21.30
  46.175.70.69
+46.176.76.193
  46.18.142.142
  46.18.202.159
+46.18.229.203
  46.18.76.4
  46.18.77.177
  46.180.141.150
@@ -61507,6 +72862,7 @@
  46.183.219.66
  46.183.219.72
  46.183.220.117
+46.183.220.14
  46.183.221.148
  46.183.221.149
  46.183.221.156
@@ -61517,11 +72873,13 @@
  46.183.221.249
  46.183.221.44
  46.183.221.48
+46.183.222.163
  46.183.223.232
  46.183.236.254
  46.183.56.107
  46.183.66.210
  46.185.114.98
+46.185.129.185
  46.185.138.163
  46.185.50.138
  46.185.50.140
@@ -61547,6 +72905,7 @@
  46.188.6.120
  46.188.82.11
  46.188.82.63
+46.19.137.135
  46.19.137.74
  46.19.141.82
  46.19.141.83
@@ -61570,21 +72929,29 @@
  46.20.2.222
  46.20.59.11
  46.20.93.83
+46.201.3.68
  46.201.5.174
  46.201.52.94
+46.204.22.160
  46.204.34.114
+46.208.193.102
  46.21.111.219
  46.21.145.91
  46.21.147.142
  46.21.147.61
  46.21.250.205
  46.21.250.85
+46.21.55.3
+46.210.121.171
  46.216.11.214
  46.216.54.244
  46.216.59.142
  46.217.18.11
+46.217.253.221
  46.217.75.156
  46.218.155.194
+46.218.7.227
+46.218.85.69
  46.219.112.33
  46.219.120.59
  46.22.173.131
@@ -61592,6 +72959,9 @@
  46.221.19.138
  46.221.46.81
  46.221.52.246
+46.223.168.10
+46.223.42.171
+46.223.79.103
  46.225.104.250
  46.225.119.60
  46.225.124.124
@@ -61632,6 +73002,7 @@
  46.227.38.2
  46.227.39.1
  46.227.39.2
+46.228.199.124
  46.228.93.242
  46.229.165.141
  46.229.165.142
@@ -61692,6 +73063,7 @@
  46.237.253.139
  46.238.164.110
  46.24.148.191
+46.24.87.236
  46.240.133.39
  46.240.151.166
  46.241.120.230
@@ -61709,9 +73081,11 @@
  46.243.189.99
  46.243.220.115
  46.243.220.120
+46.243.233.65
  46.243.236.116
  46.243.68.16
  46.244.226.30
+46.244.28.50
  46.245.222.203
  46.246.123.133
  46.246.123.151
@@ -61731,6 +73105,7 @@
  46.250.171.31
  46.250.221.18
  46.251.111.30
+46.252.205.166
  46.253.234.231
  46.253.34.177
  46.253.39.142
@@ -61772,6 +73147,7 @@
  46.29.252.70
  46.29.252.98
  46.29.254.246
+46.29.77.134
  46.29.79.57
  46.30.189.41
  46.30.245.65
@@ -61782,7 +73158,9 @@
  46.32.254.123
  46.32.50.98
  46.32.53.120
+46.32.67.0
  46.32.78.150
+46.33.100.162
  46.33.253.29
  46.33.32.1
  46.33.33.25
@@ -61793,6 +73171,7 @@
  46.35.193.240
  46.35.249.189
  46.35.27.74
+46.36.103.1
  46.36.132.68
  46.36.220.44
  46.36.27.120
@@ -61802,6 +73181,7 @@
  46.38.235.14
  46.38.235.236
  46.38.237.108
+46.38.249.161
  46.38.51.183
  46.39.129.114
  46.39.129.82
@@ -61848,6 +73228,7 @@
  46.4.71.70
  46.4.72.118
  46.4.78.148
+46.4.83.131
  46.4.87.105
  46.4.87.133
  46.4.88.46
@@ -61857,15 +73238,18 @@
  46.4.97.19
  46.40.127.164
  46.40.3.158
+46.41.141.30
  46.42.86.128
  46.43.1.22
  46.43.2.95
  46.44.166.125
  46.45.146.65
  46.45.229.159
+46.46.42.77
  46.47.255.194
  46.47.80.188bin.sh
  46.48.19.132
+46.5.23.78
  46.50.198.180
  46.52.131.207
  46.52.150.242
@@ -61886,14 +73270,17 @@
  46.59.67.69
  46.59.69.54
  46.59.94.142
+46.6.15.129
  46.6.8.128
  46.6.8.135
  46.61.48.32
  46.62.144.80
  46.63.0.17
+46.63.215.85
  46.63.53.238
  46.63.71.13
  46.63.81.195
+46.64.117.80
  46.73.33.253
  46.75.47.111
  46.75.79.138
@@ -61902,6 +73289,9 @@
  46.8.159.147
  46.8.16.235
  46.8.16.53
+46.8.172.35
+46.8.174.116
+46.8.174.212
  46.8.179.104
  46.8.22.75
  46.8.23.129
@@ -61930,6 +73320,7 @@
  46.8.56.152
  46.8.56.21
  46.80.142.29
+46.83.46.240
  46.83.64.222
  46.83.64.63
  46.83.66.63
@@ -61938,18 +73329,22 @@
  46.83.72.164
  46.83.73.54
  46.83.77.136
+46.87.182.119
  46.88.190.210
  46.89.18.146
  46.90.87.93
  46.90.93.58
  46.90.94.228
  46.91.120.206
+46.92.17.217
  46.93.99.39
+46.97.199.206
  46.97.44.18
  46.98.127.20
  46.98.212.193
  46.98.218.195
  46.98.63.124
+46.99.113.190
  46.99.133.169
  46.99.135.154
  46.99.135.237
@@ -61958,6 +73353,7 @@
  46.99.195.78
  46.99.252.42
  46.99.255.235
+46.99.47.212
  460365365.com
  4624.31cf4fdae.com
  462523db67f9.ngrok.io
@@ -61985,33 +73381,50 @@
  47.100.103.115
  47.100.106.114
  47.100.107.125
+47.100.119.112
  47.100.120.52
  47.100.162.210
  47.100.192.146
  47.100.228.93
  47.100.244.87
  47.100.3.181
+47.100.85.212
  47.100.88.65
+47.101.151.15
  47.101.187.9
  47.101.190.190
+47.101.194.15
+47.101.202.14
+47.101.207.137
  47.101.212.77
  47.101.36.129
+47.102.122.175
+47.102.145.130
  47.102.193.203
  47.102.216.176
  47.102.44.188
  47.103.1.49
+47.103.199.150
  47.103.205.33
  47.103.91.169
+47.103.93.33
+47.104.156.239
+47.104.191.32
  47.104.222.64
+47.104.252.203
  47.104.68.172
  47.104.79.149
  47.105.100.191
+47.105.127.151
  47.105.164.105
  47.105.220.149
+47.105.36.69
  47.106.124.179
  47.106.161.182
  47.106.192.167
+47.106.196.84
  47.106.197.184
+47.106.201.134
  47.106.221.116
  47.106.59.75
  47.106.82.115
@@ -62022,10 +73435,13 @@
  47.107.141.34
  47.107.147.168
  47.107.175.190
+47.107.228.241
+47.107.231.92
  47.107.244.98
  47.107.45.148
  47.107.61.8
  47.107.70.252
+47.107.92.175
  47.108.140.54
  47.108.143.117
  47.108.156.129
@@ -62047,22 +73463,33 @@
  47.110.225.78
  47.110.48.205
  47.110.49.177
+47.110.61.9
+47.110.79.249
  47.110.92.146
  47.111.12.85
  47.111.14.20
+47.111.246.143
+47.112.116.126
  47.112.122.216
  47.112.127.188
  47.112.144.63
  47.112.173.155
+47.112.231.143
  47.113.108.107
  47.113.95.224
  47.113.97.212
  47.114.96.237
  47.115.146.83
+47.115.179.69
+47.115.40.219
  47.115.52.118
  47.115.53.163
  47.12.245.148
+47.13.106.162
+47.13.235.230
+47.133.107.160
  47.134.141.179
+47.14.6.66
  47.144.21.37
  47.144.226.123
  47.144.81.151
@@ -62072,15 +73499,24 @@
  47.148.18.2
  47.149.32.120
  47.149.41.240
+47.149.67.129
  47.152.159.183
+47.152.60.174
  47.153.167.86
  47.153.183.211
  47.156.70.145
  47.157.181.214
+47.157.232.199
+47.16.121.209
  47.16.126.209
  47.16.131.51
+47.17.177.110
+47.176.104.74
  47.176.38.242
+47.176.38.253
+47.180.114.229
  47.180.15.184
+47.180.212.134
  47.180.63.37
  47.180.96.157
  47.184.146.164
@@ -62102,11 +73538,14 @@
  47.197.0.119
  47.198.209.213
  47.20.185.84
+47.203.61.229
  47.203.92.216
  47.203.93.167
+47.208.246.213
  47.21.41.254
  47.21.54.222
  47.218.222.9
+47.220.190.167
  47.221.237.222
  47.222.103.234
  47.223.138.176
@@ -62118,9 +73557,19 @@
  47.233.5.131
  47.24.185.128
  47.240.230.87
+47.240.49.58
  47.241.106.223
  47.241.116.84
+47.241.15.42
+47.241.17.34
+47.241.26.71
+47.241.29.56
+47.241.34.42
+47.241.36.77
  47.241.62.245
+47.241.63.196
+47.241.66.186
+47.241.7.56
  47.241.70.0
  47.242.128.121
  47.242.150.202
@@ -62140,10 +73589,15 @@
  47.242.87.227
  47.242.9.50
  47.244.1.172
+47.244.103.226
  47.244.107.89
  47.244.119.155
+47.244.120.6
+47.244.137.178
  47.244.151.211
+47.244.165.29
  47.244.166.23
+47.244.172.73
  47.244.175.167
  47.244.177.113
  47.244.184.204
@@ -62152,6 +73606,7 @@
  47.244.20.191
  47.244.213.73
  47.244.221.47
+47.244.228.65
  47.244.26.70
  47.244.27.17
  47.244.44.239
@@ -62159,14 +73614,19 @@
  47.244.45.245
  47.244.50.194
  47.244.50.245
+47.244.52.99
  47.244.57.253
  47.244.9.128
+47.245.26.36
  47.245.35.107
  47.245.35.30
  47.245.35.63
  47.245.52.169
+47.245.52.209
  47.245.54.201
  47.247.103.161
+47.25.66.141
+47.250.40.25
  47.251.8.182
  47.252.73.221
  47.252.80.192
@@ -62178,18 +73638,26 @@
  47.253.5.99
  47.254.133.69
  47.254.134.244
+47.254.145.104
  47.254.170.214
  47.254.172.215
+47.254.173.103
  47.254.173.87
  47.254.174.194
  47.254.174.39
+47.254.174.85
+47.254.175.100
  47.254.177.13
  47.254.178.15
+47.254.192.96
  47.254.194.27
  47.254.194.47
  47.254.20.82
  47.254.215.132
+47.254.234.70
+47.254.238.111
  47.254.240.95
+47.254.243.29
  47.254.247.217
  47.254.29.128
  47.254.73.32
@@ -62197,13 +73665,26 @@
  47.254.93.177
  47.254.95.196
  47.26.91.137
+47.28.94.84
+47.29.136.176
+47.29.141.63
+47.29.144.249
+47.29.151.88
+47.29.154.120
+47.29.159.227
+47.29.179.240
+47.29.181.241
+47.29.76.200
  47.35.236.9
  47.36.140.164
+47.36.230.241
  47.39.207.183
+47.41.196.233
  47.49.12.165
  47.49.12.168
  47.49.147.253
  47.5.170.67
+47.50.246.114
  47.52.101.94
  47.52.128.231
  47.52.134.197
@@ -62215,38 +73696,52 @@
  47.52.211.53
  47.52.227.166
  47.52.229.116
+47.52.230.235
  47.52.231.140
  47.52.232.24
+47.52.239.42
  47.52.28.179
  47.52.38.232
+47.52.39.76
  47.52.59.139
  47.52.61.250
  47.52.68.110
+47.53.17.8
  47.54.149.133
  47.54.211.232
  47.54.214.102
+47.56.126.247
  47.56.141.204
+47.56.154.54
+47.56.183.121
  47.56.192.209
  47.56.231.218
+47.56.234.187
  47.56.251.168
  47.57.152.25
  47.57.162.76
  47.6.15.79
+47.6.64.179
  47.61.20.130
  47.62.108.176
  47.62.215.108
+47.62.38.166
  47.74.175.100
+47.74.182.10
  47.74.185.172
  47.74.209.175
  47.74.228.168
  47.74.231.192
+47.74.234.121
  47.74.240.108
  47.74.241.204
  47.74.242.64
  47.74.35.128
+47.74.35.143
  47.74.44.83
  47.74.46.162
  47.74.48.82
+47.74.48.89
  47.74.62.158
  47.74.70.72
  47.74.84.115
@@ -62263,13 +73758,18 @@
  47.75.168.219
  47.75.175.59
  47.75.176.144
+47.75.177.195
+47.75.178.149
+47.75.179.199
  47.75.184.180
  47.75.199.52
  47.75.2.225
+47.75.204.149
  47.75.204.212
  47.75.253.127
  47.75.37.35
  47.75.48.133
+47.75.52.4
  47.75.55.181
  47.75.59.41
  47.75.7.170
@@ -62279,9 +73779,11 @@
  47.88.17.25
  47.88.17.253
  47.88.220.246
+47.88.228.246
  47.88.245.100
  47.88.28.221
  47.88.5.227
+47.88.54.50
  47.88.7.18
  47.88.76.141
  47.88.79.207
@@ -62296,11 +73798,15 @@
  47.89.191.37
  47.89.21.168
  47.89.246.51
+47.89.46.67
  47.89.49.161
  47.89.8.133
  47.89.8.91
+47.9.224.154
+47.9.233.81
  47.90.0.38
  47.90.120.25
+47.90.243.190
  47.90.251.173
  47.90.254.216
  47.90.4.203
@@ -62310,12 +73816,18 @@
  47.90.72.227
  47.90.87.225
  47.90.9.211
+47.90.95.192
+47.91.106.108
+47.91.165.233
  47.91.17.45
  47.91.178.158
+47.91.19.156
  47.91.196.15
  47.91.206.207
  47.91.215.113
+47.91.223.116
  47.91.228.50
+47.91.233.114
  47.91.239.118
  47.91.246.186
  47.91.253.239
@@ -62323,6 +73835,7 @@
  47.91.88.100
  47.91.89.32
  47.91.92.101
+47.92.137.121
  47.92.204.240
  47.92.212.252
  47.92.245.97
@@ -62330,6 +73843,7 @@
  47.92.78.176
  47.92.90.12
  47.92.94.125
+47.93.150.202
  47.93.150.5
  47.93.173.17
  47.93.198.131
@@ -62337,15 +73851,20 @@
  47.93.247.22
  47.93.4.61
  47.93.96.145
+47.93.97.47
  47.94.1.121
+47.94.104.165
  47.94.111.103
  47.94.148.130
  47.94.175.175
+47.94.19.128
+47.94.194.39
  47.94.196.118
  47.94.200.124
  47.94.215.35
  47.94.242.18
  47.94.243.77
+47.94.40.1
  47.94.89.87
  47.95.12.84
  47.95.143.14
@@ -62353,7 +73872,9 @@
  47.95.211.213
  47.95.213.15
  47.95.215.4
+47.95.223.118
  47.95.32.92
+47.96.101.247
  47.96.111.238
  47.96.119.168
  47.96.123.190
@@ -62361,11 +73882,17 @@
  47.96.148.248
  47.96.164.251
  47.96.5.37
+47.97.153.92
+47.97.154.202
  47.97.173.229
+47.97.204.57
+47.97.90.220
  47.98.114.56
  47.98.138.84
+47.98.166.108
  47.98.170.47
  47.98.192.141
+47.98.42.210
  47.99.149.110
  47.99.158.238
  47.99.65.77
@@ -62434,13 +73961,13 @@
  49.116.197.233
  49.116.205.198
  49.116.212.39
+49.116.212.86
  49.116.214.38
  49.116.71.58
  49.117.188.163
  49.117.188.251
  49.117.189.177
  49.117.189.79
-49.117.190.177
  49.119.213.167
  49.119.213.174
  49.119.56.2
@@ -62449,20 +73976,26 @@
  49.119.78.23
  49.12.0.103
  49.12.100.57
+49.12.103.66
  49.12.107.4
  49.12.11.16
  49.12.126.6
  49.12.163.214
+49.12.165.64
  49.12.32.67
  49.12.4.194
  49.12.47.176
  49.12.64.114
+49.12.74.93
+49.12.75.224
  49.12.83.44
  49.12.85.232
  49.12.98.122
  49.128.181.229
+49.135.34.49
  49.142.180.230
  49.142.74.124
+49.142.94.79
  49.143.0.215
  49.143.32.36
  49.143.32.59
@@ -62470,246 +74003,562 @@
  49.143.32.92
  49.144.7.160
  49.145.105.98
+49.145.107.36
+49.145.108.22
+49.145.165.217
+49.145.171.66
  49.145.206.124
  49.145.226.213
  49.145.66.194
  49.146.64.207
+49.146.66.1
+49.147.127.111
+49.147.142.16
+49.147.197.126
+49.147.198.250
+49.149.109.80
  49.149.45.236
  49.150.228.59
+49.150.240.212
+49.150.34.157
+49.150.79.148
  49.151.49.196
  49.156.151.242
  49.156.152.113
+49.156.32.8
  49.156.35.22
  49.156.44.138
  49.156.45.181
  49.156.47.61
  49.159.160.71
+49.172.28.35
  49.176.168.68
  49.195.105.206
+49.204.231.7
+49.204.81.186
  49.205.165.42
+49.205.179.20
  49.205.182.134
  49.205.216.183
  49.205.234.221
  49.205.245.84
+49.205.77.108
  49.205.79.89
  49.206.121.76
+49.206.15.109
  49.206.16.156
+49.206.18.102
  49.206.228.138
  49.206.244.236
  49.207.140.81
+49.207.142.138
  49.207.177.234
+49.207.198.117
  49.212.135.219
  49.212.151.222
+49.212.179.180
  49.212.179.58
  49.213.188.102
+49.228.10.186
  49.228.195.145
  49.228.237.222
+49.228.238.191
+49.228.240.154
+49.228.249.53
+49.228.27.23
  49.228.49.53
+49.228.74.114
+49.229.69.4
  49.230.64.223
  49.231.0.178
+49.231.145.150
+49.232.100.132
+49.232.100.177
  49.232.101.33
+49.232.103.197
+49.232.106.184
+49.232.109.242
  49.232.11.17
  49.232.112.204
+49.232.119.202
+49.232.119.253
+49.232.12.37
+49.232.126.185
  49.232.129.139
  49.232.13.22
+49.232.131.72
  49.232.135.12
+49.232.135.77
  49.232.136.228
  49.232.136.246
+49.232.136.90
+49.232.139.175
+49.232.139.183
  49.232.14.84
+49.232.143.159
  49.232.146.132
+49.232.147.189
+49.232.147.206
+49.232.148.100
  49.232.150.106
  49.232.150.213
+49.232.151.155
+49.232.151.215
+49.232.153.128
+49.232.157.216
+49.232.158.151
  49.232.160.106
  49.232.160.254
  49.232.161.159
+49.232.161.221
  49.232.163.163
+49.232.164.190
  49.232.166.52
  49.232.167.99
+49.232.168.102
  49.232.17.254
+49.232.171.88
+49.232.172.154
+49.232.172.20
+49.232.172.221
  49.232.172.23
+49.232.174.142
+49.232.174.152
+49.232.174.23
+49.232.175.137
  49.232.18.108
+49.232.191.178
  49.232.191.67
+49.232.192.91
  49.232.194.141
  49.232.196.185
+49.232.197.175
  49.232.197.54
+49.232.198.139
  49.232.198.184
+49.232.20.208
  49.232.200.247
  49.232.201.193
  49.232.201.238
  49.232.202.58
+49.232.204.241
  49.232.204.97
+49.232.205.135
+49.232.205.249
  49.232.208.242
+49.232.208.26
+49.232.209.128
+49.232.210.195
+49.232.212.5
+49.232.213.140
  49.232.214.24
+49.232.216.161
+49.232.218.129
+49.232.219.61
+49.232.221.213
  49.232.223.106
  49.232.223.123
  49.232.223.172
+49.232.223.38
  49.232.229.126
  49.232.23.20
+49.232.234.56
+49.232.247.107
  49.232.25.135
+49.232.25.179
+49.232.250.57
  49.232.251.68
+49.232.26.148
+49.232.31.85
+49.232.39.21
+49.232.41.237
+49.232.43.192
+49.232.48.213
+49.232.5.171
+49.232.50.87
+49.232.51.176
  49.232.55.26
+49.232.56.88
  49.232.58.114
+49.232.62.214
  49.232.67.184
  49.232.71.199
+49.232.72.13
+49.232.75.193
+49.232.80.105
  49.232.82.76
+49.232.83.75
+49.232.83.86
+49.232.84.172
+49.232.87.218
  49.232.89.242
  49.232.9.144
  49.232.93.95
+49.232.99.75
  49.233.100.14
+49.233.105.102
+49.233.105.223
+49.233.11.118
+49.233.117.199
  49.233.119.93
+49.233.122.40
+49.233.13.194
+49.233.14.115
+49.233.15.54
  49.233.157.204
  49.233.16.90
  49.233.160.217
  49.233.162.63
+49.233.166.113
+49.233.166.251
+49.233.168.100
+49.233.173.136
  49.233.173.90
  49.233.174.128
+49.233.177.173
  49.233.177.99
  49.233.178.247
+49.233.183.15
+49.233.184.148
  49.233.186.66
+49.233.189.161
  49.233.189.200
+49.233.189.73
+49.233.190.13
  49.233.191.127
  49.233.193.108
+49.233.195.154
+49.233.196.120
+49.233.196.165
+49.233.197.123
+49.233.2.204
  49.233.2.230
  49.233.200.37
  49.233.201.186
  49.233.203.30
  49.233.204.226
  49.233.214.16
+49.233.22.214
  49.233.23.193
+49.233.23.221
+49.233.250.147
  49.233.251.161
+49.233.254.190
  49.233.254.253
  49.233.28.77
  49.233.3.177
+49.233.30.125
+49.233.30.96
  49.233.34.26
  49.233.34.5
  49.233.34.7
+49.233.34.9
+49.233.35.206
+49.233.39.3
+49.233.4.143
+49.233.4.31
+49.233.51.48
+49.233.53.111
+49.233.54.212
  49.233.56.16
+49.233.58.73
  49.233.60.5
+49.233.68.90
+49.233.69.138
  49.233.75.234
+49.233.77.12
  49.233.77.44
+49.233.79.152
  49.233.80.20
  49.233.81.161
+49.233.84.191
  49.233.85.167
  49.233.90.175
  49.233.91.148
  49.234.100.123
+49.234.100.133
+49.234.100.169
+49.234.100.95
  49.234.101.196
  49.234.104.247
+49.234.105.100
  49.234.107.24
+49.234.111.57
+49.234.111.90
+49.234.114.62
  49.234.116.74
+49.234.117.66
  49.234.119.163
+49.234.119.42
+49.234.123.171
+49.234.124.225
+49.234.127.168
+49.234.131.237
+49.234.131.75
+49.234.132.217
+49.234.137.203
+49.234.138.20
  49.234.139.218
+49.234.142.35
  49.234.143.24
+49.234.145.57
  49.234.145.59
+49.234.150.187
+49.234.158.131
  49.234.158.16
+49.234.178.175
  49.234.18.158
+49.234.181.60
  49.234.188.57
+49.234.201.237
+49.234.208.46
+49.234.209.124
  49.234.209.4
+49.234.21.219
  49.234.21.51
+49.234.214.156
  49.234.214.72
+49.234.214.88
  49.234.215.135
+49.234.218.171
  49.234.219.217
+49.234.220.78
+49.234.224.108
  49.234.224.88
  49.234.225.128
+49.234.225.74
+49.234.227.17
+49.234.227.202
  49.234.228.195
+49.234.229.88
+49.234.230.31
+49.234.235.127
  49.234.239.210
+49.234.239.91
  49.234.24.246
+49.234.25.101
+49.234.25.89
  49.234.26.175
  49.234.26.99
  49.234.28.149
+49.234.30.113
+49.234.32.74
  49.234.33.123
+49.234.33.229
+49.234.35.79
  49.234.37.38
  49.234.38.42
  49.234.39.33
+49.234.4.252
+49.234.41.108
  49.234.41.154
+49.234.43.127
  49.234.43.224
+49.234.43.39
+49.234.45.241
+49.234.46.181
  49.234.47.124
+49.234.49.197
+49.234.50.247
+49.234.53.193
  49.234.57.117
+49.234.58.191
  49.234.60.118
+49.234.61.156
  49.234.62.183
  49.234.62.38
+49.234.64.13
  49.234.68.122
+49.234.68.42
+49.234.69.205
+49.234.71.65
+49.234.78.216
+49.234.79.129
+49.234.79.193
  49.234.80.81
+49.234.84.58
+49.234.9.92
+49.234.92.108
+49.234.94.251
+49.234.94.59
+49.234.96.30
  49.234.97.87
+49.234.99.246
+49.235.1.23
+49.235.100.147
+49.235.101.138
  49.235.103.12
+49.235.103.191
+49.235.104.204
+49.235.107.161
+49.235.107.186
  49.235.108.51
  49.235.109.216
  49.235.11.137
+49.235.110.143
+49.235.111.75
+49.235.113.101
+49.235.113.235
  49.235.117.50
+49.235.118.182
  49.235.120.117
  49.235.120.202
  49.235.124.111
+49.235.125.17
+49.235.127.199
  49.235.128.105
  49.235.129.160
+49.235.138.41
+49.235.143.244
+49.235.146.95
+49.235.153.54
  49.235.155.200
  49.235.159.133
+49.235.165.108
+49.235.167.41
+49.235.167.59
+49.235.169.74
+49.235.173.198
  49.235.175.12
+49.235.179.234
  49.235.181.51
  49.235.199.42
+49.235.202.89
+49.235.206.14
+49.235.206.172
  49.235.207.127
  49.235.213.170
  49.235.221.66
+49.235.226.192
  49.235.227.17
  49.235.232.69
  49.235.240.143
+49.235.241.211
  49.235.241.7
+49.235.251.162
+49.235.251.43
  49.235.252.236
  49.235.252.45
+49.235.254.16
+49.235.28.96
+49.235.29.185
  49.235.33.85
+49.235.35.79
+49.235.37.144
+49.235.38.46
+49.235.41.58
  49.235.48.18
+49.235.51.238
  49.235.54.129
+49.235.61.225
+49.235.65.127
  49.235.68.79
+49.235.68.90
+49.235.73.19
+49.235.73.82
+49.235.74.168
+49.235.74.192
+49.235.74.226
+49.235.74.86
+49.235.75.63
+49.235.77.193
+49.235.80.143
  49.235.80.205
  49.235.86.2
  49.235.87.70
+49.235.9.47
  49.235.90.118
  49.235.92.209
+49.235.93.192
+49.235.93.87
  49.235.94.161
  49.235.96.74
+49.235.97.241
  49.235.98.68
  49.236.195.183
+49.236.195.39
+49.236.214.144
  49.238.142.12
  49.243.9.118
  49.247.135.55
+49.247.204.78
+49.247.208.185
  49.247.21.169
+49.247.213.18
  49.247.215.43
  49.248.109.74
+49.248.110.66
  49.248.32.110
+49.249.237.226
  49.249.239.198
  49.255.35.114
  49.255.93.10
+49.34.176.218
+49.34.182.251
+49.34.192.247
+49.34.206.90
+49.34.207.210
+49.36.119.196
+49.36.137.168
  49.36.139.195
  49.36.145.145
+49.36.164.99
+49.36.165.137
+49.36.168.219
  49.36.240.199
  49.36.243.82
  49.36.6.64
+49.37.165.82
+49.37.180.127
+49.37.2.45
+49.37.213.101
+49.37.221.0
  49.37.4.108
+49.37.7.12
+49.37.7.84
+49.37.82.75
  49.37.82.77
  49.4.31.138
  49.4.67.31
+49.48.148.25
+49.48.231.117
  49.48.33.129
  49.48.90.78
  49.48.99.76
  49.49.0.79
  49.49.2.104
+49.49.217.189
+49.49.236.188
  49.49.241.26
  49.49.43.91
  49.50.105.62
  49.50.107.221
  49.50.164.24
+49.50.96.101
  49.51.138.189
  49.51.161.40
+49.51.180.170
+49.51.180.194
  49.51.182.144
  49.51.184.162
  49.51.186.183
  49.51.186.79
  49.51.188.128
  49.51.188.139
+49.51.188.155
  49.51.188.72
+49.51.189.10
  49.51.189.144
+49.51.241.68
  49.51.248.14
  49.51.249.135
  49.51.47.149
+49.51.49.254
+49.51.90.173
+49.64.159.98
+49.64.252.154
+49.64.52.200
+49.64.63.84
  49.65.134.12
  49.68.123.52
  49.68.124.248
@@ -62718,6 +74567,7 @@
  49.68.131.148
  49.68.131.194
  49.68.131.71
+49.68.144.193
  49.68.151.194
  49.68.154.105
  49.68.154.84
@@ -62735,6 +74585,7 @@
  49.68.212.86
  49.68.213.49
  49.68.221.151
+49.68.221.252
  49.68.223.89
  49.68.225.21
  49.68.226.132
@@ -62755,6 +74606,7 @@
  49.68.250.118
  49.68.251.197
  49.68.251.202
+49.68.251.31
  49.68.251.98
  49.68.41.233
  49.68.43.154
@@ -62768,12 +74620,12 @@
  49.68.77.182
  49.68.83.170
  49.68.83.240
+49.69.51.215
  49.70.106.4
  49.70.119.0
  49.70.123.252
  49.70.127.10
  49.70.127.96
-49.70.175.195
  49.70.19.92
  49.70.20.243
  49.70.22.85
@@ -62786,12 +74638,32 @@
  49.70.89.243
  49.70.95.248
  49.72.111.207
+49.72.171.111
+49.72.38.74
+49.73.124.59
+49.73.124.89
+49.73.187.114
+49.73.187.84
+49.73.235.149
+49.73.244.221
+49.73.4.159
+49.73.90.107
+49.73.98.100
  49.74.106.177
  49.74.54.214
+49.75.122.29
+49.75.138.31
+49.75.14.22
+49.75.141.12
+49.75.153.147
+49.75.194.100
+49.75.237.30
  49.75.59.242
+49.75.59.45
  49.80.122.175
  49.80.224.75
  49.80.231.237
+49.80.99.187
  49.81.100.163
  49.81.103.62
  49.81.106.68
@@ -62805,6 +74677,7 @@
  49.81.153.56
  49.81.156.134
  49.81.156.149
+49.81.171.22
  49.81.178.95
  49.81.237.96
  49.81.239.65
@@ -62840,16 +74713,39 @@
  49.84.125.254
  49.84.125.71
  49.84.127.92
+49.84.145.73
  49.85.162.210
  49.85.179.51
+49.85.195.87
+49.85.236.145
  49.85.54.87
  49.87.201.232
  49.87.250.42
  49.87.46.40
  49.87.73.77
+49.88.112.110
+49.88.112.112
+49.88.112.114
+49.88.112.115
+49.88.112.116
+49.88.112.117
+49.88.112.118
  49.88.112.4
+49.88.112.65
+49.88.112.67
+49.88.112.68
+49.88.112.72
+49.88.112.75
+49.88.112.76
+49.88.112.77
  49.88.185.144
+49.88.223.117
+49.88.64.59
+49.88.65.19
+49.88.66.111
+49.88.67.198
  49.89.103.106
+49.89.109.14
  49.89.115.124
  49.89.137.129
  49.89.137.242
@@ -62881,6 +74777,7 @@
  49.89.87.152
  49.89.89.54
  49.89.95.219
+49.89.97.180
  491-365.net
  491237431294213328.weebly.com
  49148677.kiloouno.com
@@ -62954,6 +74851,7 @@
  4g3.cc
  4g7po.codesandbox.io
  4gbinternethediye.xyz
+4gf9kiny738zry6.net
  4ghandloom.com
  4glory.net
  4gq3tkuok7dzmo6ek1ejqm.creativetutors.com
@@ -63038,6 +74936,7 @@
  4xasfasfasffa.blowewiux.com
  4xhcjscumch77fhmpszi.waysaeha.com
  4xp.com
+4yo-j01n.000webhostapp.com
  4you.by
  4youbeautysalon.com
  4zi.134mcp.com
@@ -63057,17 +74956,20 @@
  5.101.107.190
  5.101.119.90
  5.101.123.24
+5.101.136.148
  5.101.151.106
  5.101.174.40
  5.101.221.238
  5.101.77.153
  5.101.98.71
  5.101.99.155
+5.101.99.198
  5.102.168.217
  5.102.173.71
  5.102.192.60
  5.102.193.168
  5.102.205.76
+5.102.224.145
  5.102.58.41
  5.103.137.146
  5.104.105.194
@@ -63076,19 +74978,28 @@
  5.104.105.223
  5.104.105.241
  5.104.105.247
+5.107.169.55
+5.11.116.221
+5.11.134.152
  5.12.205.152
  5.12.233.12
  5.12.29.202
  5.128.100.109
  5.128.87.126
+5.130.103.126
+5.130.168.9
  5.133.11.119
+5.133.179.164
  5.133.179.243
+5.133.179.45
  5.133.24.117
  5.133.65.82
  5.135.123.36
  5.135.129.180
  5.135.14.247
  5.135.140.215
+5.135.141.147
+5.135.141.158
  5.135.156.68
  5.135.16.122
  5.135.160.228
@@ -63096,7 +75007,9 @@
  5.135.174.215
  5.135.176.208
  5.135.177.202
+5.135.177.5
  5.135.178.216
+5.135.179.178
  5.135.179.60
  5.135.180.185
  5.135.181.53
@@ -63107,23 +75020,31 @@
  5.135.184.46
  5.135.184.72
  5.135.186.15
+5.135.186.52
  5.135.189.104
  5.135.189.124
  5.135.199.2
  5.135.199.29
+5.135.23.3
  5.135.232.8
  5.135.237.216
+5.135.238.194
+5.135.238.220
+5.135.238.228
  5.135.239.81
+5.135.244.251
  5.135.34.152
  5.135.58.119
  5.135.72.184
  5.135.74.187
+5.135.94.191
  5.137.188.149
  5.137.98.199
  5.138.104.80
  5.138.159.73
  5.139.129.114
  5.139.129.188
+5.139.135.172
  5.139.142.39
  5.14.167.123
  5.140.212.175
@@ -63136,6 +75057,7 @@
  5.141.81.106
  5.141.86.233
  5.142.154.178
+5.142.163.108
  5.142.222.15
  5.143.101.195
  5.144.130.12
@@ -63161,6 +75083,7 @@
  5.150.230.8
  5.150.239.205
  5.150.240.82
+5.150.249.254
  5.152.0.210
  5.152.158.4
  5.152.174.62
@@ -63248,15 +75171,20 @@
  5.158.187.169
  5.158.236.116
  5.158.239.100
+5.158.71.129
  5.159.118.65
  5.159.50.62
  5.16.13.38
  5.160.243.112
  5.160.243.115
+5.160.243.153
  5.164.150.22
+5.164.193.127
  5.164.196.200
+5.164.197.180
  5.164.200.148
  5.164.209.113
+5.164.212.137
  5.164.212.203
  5.164.215.19
  5.164.219.136
@@ -63274,6 +75202,7 @@
  5.166.210.181
  5.166.233.3
  5.166.47.194
+5.166.56.250
  5.166.57.222
  5.167.112.196
  5.167.34.60
@@ -65327,8 +77256,10 @@
  5.167.71.98
  5.167.71.99
  5.17.89.13
+5.171.213.150
  5.172.144.154
  5.175.225.107
+5.176.108.38
  5.178.135.226
  5.178.142.58
  5.178.193.43
@@ -65336,17 +77267,22 @@
  5.178.61.121
  5.178.68.221
  5.18.246.203
+5.180.107.194
  5.180.220.142
  5.180.244.21
  5.180.244.213
  5.180.244.233
  5.180.244.25
  5.180.245.234
+5.180.79.248
  5.181.156.165
  5.181.170.164
+5.181.234.38
  5.181.4.201
  5.181.4.247
+5.182.208.67
  5.182.209.18
+5.182.210.24
  5.182.210.84
  5.182.210.95
  5.182.211.138
@@ -65357,6 +77293,7 @@
  5.182.26.119
  5.182.26.126
  5.182.26.129
+5.183.212.79
  5.183.255.129
  5.183.69.243
  5.183.92.103
@@ -65383,8 +77320,11 @@
  5.183.94.35
  5.183.94.63
  5.183.94.99
+5.184.235.70
  5.185.66.236
+5.186.116.59
  5.186.60.13
+5.187.141.37
  5.187.55.242
  5.187.69.124
  5.188.105.9
@@ -65393,8 +77333,12 @@
  5.188.11.115
  5.188.11.165
  5.188.168.127
-5.188.206.18
+5.188.206.2
  5.188.206.204
+5.188.206.3
+5.188.206.4
+5.188.206.5
+5.188.206.6
  5.188.210.10
  5.188.210.16
  5.188.210.18
@@ -65433,13 +77377,20 @@
  5.188.56.60
  5.188.62.140
  5.188.62.18
+5.188.62.214
  5.188.62.24
+5.188.84.147
+5.188.84.15
  5.188.84.186
+5.188.84.220
  5.188.84.230
+5.188.84.233
  5.188.84.24
+5.188.84.25
  5.188.84.250
+5.188.84.45
+5.188.84.65
  5.188.84.9
-5.188.86.25
  5.188.9.76
  5.188.93.31
  5.189.128.186
@@ -65449,6 +77400,7 @@
  5.189.132.254
  5.189.133.231
  5.189.136.127
+5.189.137.50
  5.189.140.133
  5.189.140.14
  5.189.144.193
@@ -65482,10 +77434,14 @@
  5.189.239.157
  5.189.239.249
  5.189.84.241
+5.19.140.86
  5.19.144.26
  5.19.164.33
+5.190.189.71
+5.190.237.95
  5.190.63.24
  5.190.65.72
+5.195.10.174
  5.196.102.86
  5.196.110.170
  5.196.148.255
@@ -65493,30 +77449,39 @@
  5.196.148.77
  5.196.167.44
  5.196.195.139
+5.196.198.147
+5.196.201.4
  5.196.215.231
  5.196.218.24
  5.196.23.219
  5.196.239.210
  5.196.255.171
+5.196.26.247
  5.196.27.37
  5.196.29.108
  5.196.29.8
  5.196.35.138
  5.196.59.57
+5.196.64.61
  5.196.68.118
  5.196.69.107
+5.196.70.107
  5.196.70.130
  5.196.72.11
  5.196.72.70
  5.196.73.52
  5.196.74.210
+5.196.75.140
  5.196.75.208
  5.196.75.231
  5.196.75.53
  5.196.75.95
+5.196.8.72
  5.196.81.99
  5.196.83.88
  5.196.88.214
+5.196.90.58
+5.196.95.80
  5.198.68.181
  5.199.130.127
  5.199.130.188
@@ -65535,6 +77500,7 @@
  5.2.64.199
  5.2.64.230
  5.2.67.21
+5.2.68.5
  5.2.68.74
  5.2.69.5
  5.2.69.6
@@ -65548,7 +77514,6 @@
  5.2.73.149
  5.2.73.178
  5.2.73.66
-5.2.74.78
  5.2.76.122
  5.2.77.146
  5.2.77.22
@@ -65640,6 +77605,7 @@
  5.225.220.76
  5.226.138.3
  5.226.70.68
+5.226.98.18
  5.228.232.101
  5.228.57.189
  5.23.102.194
@@ -65649,6 +77615,8 @@
  5.231.88.40
  5.232.118.51
  5.234.183.78
+5.237.202.200
+5.243.121.37
  5.248.164.210
  5.248.19.91
  5.248.225.172
@@ -65657,6 +77625,7 @@
  5.249.147.91
  5.249.148.162
  5.249.153.62
+5.249.9.216
  5.251.49.142
  5.252.193.211
  5.252.194.137
@@ -65668,7 +77637,9 @@
  5.253.204.14
  5.253.204.158
  5.253.204.39
+5.253.25.147
  5.253.25.217
+5.253.25.64
  5.253.86.13
  5.253.86.183
  5.254.101.226
@@ -65698,13 +77669,16 @@
  5.3.147.137
  5.3.216.168
  5.3.218.163
+5.3.220.207
  5.3.221.18
  5.3.221.85
  5.3.233.248
+5.3.6.82
  5.32.181.13
  5.34.158.102
  5.34.178.126
  5.34.180.177
+5.34.180.179
  5.34.181.13
  5.34.181.17
  5.34.183.136
@@ -65715,6 +77689,7 @@
  5.34.86.230
  5.36.123.12
  5.36.249.176
+5.36.92.161
  5.38.216.48
  5.38.244.239
  5.39.101.15
@@ -65738,17 +77713,20 @@
  5.39.74.106
  5.39.74.166
  5.39.74.233
+5.39.77.167
  5.39.78.212
  5.39.83.234
  5.39.83.33
  5.39.85.81
  5.39.86.52
  5.39.87.36
+5.39.88.60
  5.39.90.110
  5.39.90.80
  5.39.91.110
  5.39.91.73
  5.39.94.46
+5.39.95.38
  5.39.97.155
  5.42.246.46
  5.44.25.146
@@ -65776,12 +77754,15 @@
  5.56.133.57
  5.56.18.35
  5.56.253.193
+5.57.226.60
  5.57.34.34
+5.58.45.51
  5.58.49.28
  5.58.58.119
  5.58.58.209
  5.58.9.231
  5.58.95.179
+5.58.98.253
  5.59.136.226
  5.59.141.152
  5.59.143.43
@@ -65790,6 +77771,7 @@
  5.61.50.213
  5.61.57.93
  5.62.1.79
+5.62.135.213
  5.62.19.44
  5.62.19.51
  5.62.19.56
@@ -65801,13 +77783,17 @@
  5.62.39.53
  5.62.43.60
  5.62.43.61
+5.62.56.11
+5.62.58.170
+5.62.61.38
  5.63.146.172
  5.63.158.140
  5.63.158.232
  5.63.165.178
  5.63.187.116
-5.63.77.6
+5.63.65.245
  5.64.70.59
+5.67.107.143
  5.67.34.61
  5.68.53.151
  5.69.192.61
@@ -65867,12 +77853,12 @@
  5.8.16.99
  5.8.18.27
  5.8.18.31
-5.8.18.88
  5.8.202.252
  5.8.47.251
  5.8.51.104
  5.8.71.45
  5.8.88.75
+5.80.115.86
  5.83.104.130
  5.83.104.133
  5.83.104.136
@@ -65906,7 +77892,10 @@
  5.83.162.160
  5.83.163.164
  5.83.93.197
+5.88.115.5
+5.88.135.45
  5.88.155.130
+5.89.175.250
  5.9.104.23
  5.9.105.49
  5.9.105.53
@@ -65951,6 +77940,7 @@
  5.9.16.75
  5.9.16.76
  5.9.161.214
+5.9.178.143
  5.9.189.251
  5.9.19.167
  5.9.197.171
@@ -66010,14 +78000,27 @@
  5.9.94.237
  5.9.98.178
  5.9.99.120
+5.90.15.159
+5.90.18.42
+5.90.209.18
+5.90.214.233
+5.90.222.217
+5.90.37.184
+5.90.44.95
+5.90.83.118
+5.91.30.95
+5.91.6.131
  5.aba.vg
  5.top4top.io
  5.zxczj.top
  50-87-224-50.unifiedlayer.com
  50.0.51.253
+50.106.201.205
  50.107.49.234
  50.112.39.196
  50.112.66.163
+50.115.126.173
+50.115.168.18
  50.115.171.79
  50.115.172.155
  50.115.173.126
@@ -66095,10 +78098,13 @@
  50.190.116.150
  50.192.195.69
  50.192.203.171
+50.192.223.205
  50.192.49.195
  50.192.49.5
  50.193.202.81
  50.194.237.58
+50.195.128.188
+50.195.197.105
  50.195.7.180
  50.196.105.87
  50.196.126.233
@@ -66107,19 +78113,35 @@
  50.197.162.169
  50.197.210.138
  50.197.38.230
+50.199.246.133
  50.199.46.20
  50.2.13.166
+50.2.188.170
  50.2.190.18
+50.2.77.198
+50.2.77.199
+50.2.77.200
+50.2.77.203
+50.2.77.216
+50.2.77.219
+50.2.77.223
+50.2.77.226
+50.2.77.227
+50.2.77.249
  50.20.209.84
+50.20.246.172
+50.201.217.170
  50.201.51.216
  50.201.58.84
  50.202.139.150
  50.205.119.150
  50.205.151.218
  50.205.36.167
+50.206.109.218
  50.206.145.228
  50.207.130.198
  50.207.130.238
+50.209.245.86
  50.21.189.146
  50.211.156.251
  50.212.170.27
@@ -66128,10 +78150,12 @@
  50.22.53.71
  50.22.75.14
  50.220.121.222
+50.227.195.3
  50.227.46.1
  50.23.43.242
  50.23.69.44
  50.23.76.241
+50.230.160.35
  50.233.228.147
  50.233.42.98
  50.235.28.146
@@ -66139,6 +78163,7 @@
  50.235.92.65
  50.236.148.246
  50.236.148.254
+50.236.218.78
  50.236.62.30
  50.236.77.190
  50.237.206.138
@@ -66152,6 +78177,7 @@
  50.243.170.153
  50.243.2.110
  50.243.62.19
+50.244.113.98
  50.244.173.237
  50.244.9.1
  50.245.107.73
@@ -66174,15 +78200,20 @@
  50.250.34.229
  50.250.56.129
  50.250.75.153
+50.251.216.225
  50.251.29.57
  50.252.47.29
  50.253.187.214
  50.253.211.61
  50.253.49.189
  50.254.135.209
+50.254.136.133
  50.254.218.37
+50.255.183.165
  50.255.64.233
  50.26.216.137
+50.27.125.104
+50.27.91.140
  50.28.1.43
  50.28.105.15
  50.28.18.205
@@ -66191,6 +78222,7 @@
  50.28.59.10
  50.28.84.148
  50.28.9.177
+50.28.99.247
  50.3.137.162
  50.3.159.103
  50.3.159.170
@@ -66212,6 +78244,7 @@
  50.3.89.30
  50.3.89.41
  50.30.37.150
+50.30.84.233
  50.30.93.94
  50.31.10.228
  50.31.146.37
@@ -66229,7 +78262,9 @@
  50.38.32.215
  50.39.132.235
  50.4.46.52
+50.4.69.112
  50.45.232.189
+50.46.218.6
  50.5.46.195
  50.53.250.162
  50.54.141.230
@@ -66249,20 +78284,33 @@
  50.59.209.30
  50.62.133.47
  50.62.160.157
+50.62.160.218
  50.62.161.140
  50.62.161.211
+50.62.161.52
+50.62.176.148
  50.62.176.151
+50.62.176.178
  50.62.176.220
  50.62.176.236
+50.62.176.241
  50.62.176.247
+50.62.176.62
  50.62.176.75
  50.62.176.95
+50.62.177.122
+50.62.177.189
  50.62.177.223
+50.62.177.230
+50.62.177.24
  50.62.177.55
  50.62.177.91
+50.62.208.106
  50.62.208.155
+50.62.208.165
  50.62.208.166
  50.62.208.36
+50.62.208.39
  50.62.208.68
  50.62.208.86
  50.62.22.112
@@ -66270,9 +78318,24 @@
  50.62.30.5
  50.62.35.16
  50.63.12.201
+50.63.12.70
+50.63.13.108
  50.63.167.184
+50.63.194.47
+50.63.196.142
+50.63.196.183
  50.63.196.24
  50.63.196.76
+50.63.196.86
+50.63.197.101
+50.63.197.133
+50.63.197.166
+50.63.197.209
+50.63.197.21
+50.63.197.27
+50.63.197.69
+50.63.197.71
+50.63.197.88
  50.63.52.157
  50.63.58.84
  50.66.45.43
@@ -66293,6 +78356,7 @@
  50.73.92.26
  50.74.77.54
  50.75.168.170
+50.75.7.82
  50.77.133.114
  50.77.8.169
  50.80.224.218
@@ -66310,6 +78374,7 @@
  50.87.38.190
  50.88.20.178
  50.88.217.109
+50.88.93.72
  50.89.240.142
  50.90.3.116
  50.91.114.38
@@ -66345,25 +78410,38 @@
  50pyahooupdaate.weebly.com
  51-iblog.com
  51.103.130.57
+51.103.133.157
  51.103.142.75
+51.103.144.230
  51.103.151.231
+51.103.24.144
  51.103.32.47
  51.103.36.201
+51.103.36.217
  51.103.36.90
  51.104.174.140
  51.104.208.250
  51.104.242.17
+51.105.5.16
+51.105.54.98
  51.107.43.38
  51.107.76.178
  51.11.240.55
+51.116.180.215
  51.116.180.53
  51.116.183.223
  51.116.186.198
  51.116.234.251
+51.120.92.207
  51.13.64.39
  51.13.65.199
+51.132.52.203
  51.136.33.31
+51.137.150.11
  51.140.15.164
+51.140.185.84
+51.140.228.46
+51.140.29.247
  51.140.48.231
  51.140.67.211
  51.141.0.227
@@ -66371,16 +78449,23 @@
  51.141.167.27
  51.141.79.141
  51.144.106.161
+51.144.234.30
+51.144.238.134
+51.144.238.248
  51.144.73.114
  51.148.153.60
  51.15.10.158
  51.15.106.26
+51.15.108.173
  51.15.11.24
  51.15.111.251
  51.15.111.33
  51.15.113.84
  51.15.114.74
+51.15.115.236
+51.15.118.15
  51.15.124.1
+51.15.131.32
  51.15.133.6
  51.15.135.121
  51.15.136.191
@@ -66388,15 +78473,18 @@
  51.15.138.196
  51.15.138.91
  51.15.141.187
+51.15.142.107
  51.15.145.148
  51.15.147.154
  51.15.147.166
  51.15.154.16
  51.15.154.163
+51.15.154.74
  51.15.157.205
  51.15.157.211
  51.15.159.90
  51.15.162.102
+51.15.163.21
  51.15.165.15
  51.15.165.173
  51.15.166.138
@@ -66404,25 +78492,35 @@
  51.15.171.127
  51.15.171.192
  51.15.171.227
+51.15.176.55
  51.15.177.121
  51.15.177.162
+51.15.179.65
  51.15.18.144
  51.15.180.168
+51.15.181.211
  51.15.185.78
  51.15.187.128
+51.15.189.142
+51.15.191.21
  51.15.191.81
  51.15.195.121
  51.15.199.181
+51.15.2.189
+51.15.204.155
+51.15.204.27
  51.15.205.46
  51.15.207.132
  51.15.21.149
  51.15.210.208
  51.15.212.200
+51.15.214.21
  51.15.214.243
  51.15.216.35
  51.15.219.140
  51.15.219.5
  51.15.220.237
+51.15.221.90
  51.15.224.0
  51.15.225.216
  51.15.229.7
@@ -66431,7 +78529,10 @@
  51.15.233.253
  51.15.233.75
  51.15.234.207
+51.15.24.173
  51.15.240.1
+51.15.248.110
+51.15.254.2
  51.15.34.228
  51.15.35.252
  51.15.38.224
@@ -66452,6 +78553,7 @@
  51.15.53.102
  51.15.53.163
  51.15.53.83
+51.15.54.24
  51.15.54.85
  51.15.57.167
  51.15.57.90
@@ -66463,6 +78565,7 @@
  51.15.63.229
  51.15.63.43
  51.15.65.170
+51.15.67.6
  51.15.68.210
  51.15.68.66
  51.15.7.145
@@ -66477,6 +78580,7 @@
  51.15.79.107
  51.15.79.163
  51.15.80.14
+51.15.81.22
  51.15.82.176
  51.15.86.162
  51.15.89.198
@@ -66495,42 +78599,60 @@
  51.154.53.96
  51.154.57.233
  51.158.104.101
+51.158.105.98
  51.158.107.202
  51.158.108.135
  51.158.111.157
+51.158.111.168
  51.158.111.229
  51.158.111.242
+51.158.112.98
  51.158.119.88
  51.158.120.84
  51.158.123.35
+51.158.124.238
  51.158.144.140
  51.158.147.13
  51.158.148.65
  51.158.151.112
+51.158.153.18
  51.158.160.2
  51.158.165.18
+51.158.171.117
  51.158.171.35
  51.158.172.165
  51.158.175.21
+51.158.179.88
  51.158.180.179
+51.158.180.24
  51.158.182.236
  51.158.184.190
+51.158.185.32
  51.158.186.242
  51.158.188.46
+51.158.189.0
+51.158.190.194
  51.158.191.252
+51.158.20.200
  51.158.23.2
+51.158.24.101
  51.158.28.129
  51.158.29.101
  51.158.64.175
+51.158.65.150
  51.158.67.190
  51.158.68.110
  51.158.68.133
  51.158.68.26
  51.158.68.68
+51.158.70.82
  51.158.75.119
  51.158.76.106
  51.158.98.121
  51.158.99.51
+51.159.0.6
+51.159.1.34
+51.159.1.45
  51.159.139.77
  51.159.148.67
  51.159.152.167
@@ -66539,14 +78661,15 @@
  51.159.188.168
  51.159.2.240
  51.159.24.172
+51.159.29.5
  51.159.30.99
  51.159.56.104
  51.159.56.106
  51.159.56.204
  51.159.56.35
-51.159.58.184
  51.159.70.147
  51.159.94.210
+51.161.10.20
  51.161.116.175
  51.161.118.180
  51.161.31.128
@@ -66559,32 +78682,51 @@
  51.161.62.153
  51.161.68.186
  51.161.68.187
+51.161.70.116
  51.161.82.98
  51.161.84.86
  51.161.9.155
  51.174.28.217
  51.174.76.107
  51.175.126.46
+51.178.136.52
  51.178.137.106
+51.178.138.1
  51.178.139.115
+51.178.142.175
  51.178.143.70
+51.178.161.32
+51.178.17.214
  51.178.17.63
+51.178.182.104
+51.178.182.70
  51.178.184.225
  51.178.218.150
+51.178.218.163
  51.178.225.200
  51.178.24.61
  51.178.27.206
+51.178.29.191
+51.178.30.102
+51.178.31.182
+51.178.41.60
  51.178.42.14
  51.178.43.9
  51.178.45.244
  51.178.46.10
  51.178.49.77
  51.178.50.174
+51.178.50.20
+51.178.52.177
  51.178.52.245
+51.178.53.233
  51.178.60.145
  51.178.63.225
+51.178.75.140
  51.178.79.225
+51.178.80.229
  51.178.81.75
+51.178.83.124
  51.178.83.144
  51.178.85.114
  51.178.85.120
@@ -66599,33 +78741,82 @@
  51.195.103.74
  51.195.107.147
  51.195.118.213
+51.195.132.50
  51.195.136.190
  51.195.136.233
  51.195.136.73
  51.195.136.9
+51.195.137.109
+51.195.138.52
+51.195.142.38
+51.195.147.49
  51.195.148.139
  51.195.148.18
+51.195.148.74
+51.195.150.222
  51.195.166.160
  51.195.166.162
+51.195.167.137
  51.195.188.98
+51.195.195.168
+51.195.195.169
+51.195.195.170
+51.195.195.171
+51.195.195.173
+51.195.195.174
+51.195.195.175
  51.195.200.181
+51.195.201.76
  51.195.202.145
  51.195.202.7
+51.195.203.247
+51.195.205.227
+51.195.205.229
+51.195.205.230
+51.195.205.236
+51.195.205.237
+51.195.205.238
+51.195.205.239
+51.195.206.192
+51.195.206.193
+51.195.206.195
+51.195.207.172
+51.195.207.173
+51.195.207.174
+51.195.207.175
+51.195.213.226
+51.195.213.227
  51.195.221.250
+51.195.232.155
  51.195.32.4
+51.195.34.192
  51.195.4.41
  51.195.42.226
+51.195.42.58
  51.195.43.245
+51.195.47.79
+51.195.57.51
  51.195.6.99
  51.195.91.241
+51.210.103.96
+51.210.105.39
  51.210.106.68
+51.210.107.15
+51.210.107.217
+51.210.109.128
  51.210.11.153
+51.210.11.180
  51.210.127.98
+51.210.13.215
+51.210.14.124
+51.210.148.31
  51.210.15.107
  51.210.151.134
  51.210.159.130
+51.210.179.20
  51.210.182.187
  51.210.182.85
+51.210.183.168
  51.210.183.246
  51.210.183.86
  51.210.183.93
@@ -66669,41 +78860,62 @@
  51.210.242.57
  51.210.242.71
  51.210.242.83
+51.210.243.134
  51.210.243.173
+51.210.243.175
  51.210.243.185
  51.210.243.196
  51.210.243.200
  51.210.243.206
  51.210.246.100
  51.210.246.58
+51.210.247.67
  51.210.34.150
  51.210.34.62
  51.210.39.30
-51.210.4.100
  51.210.40.91
+51.210.44.198
+51.210.45.112
+51.210.5.171
  51.210.61.169
+51.210.7.166
  51.210.80.127
+51.210.83.66
+51.210.96.169
  51.210.97.105
+51.210.97.29
  51.210.98.10
  51.222.0.40
-51.222.106.155
  51.222.111.6
  51.222.121.169
  51.222.13.24
+51.222.130.20
+51.222.136.229
  51.222.139.65
  51.222.14.28
+51.222.14.78
  51.222.19.123
+51.222.24.132
  51.222.24.222
+51.222.26.176
  51.222.26.189
+51.222.29.39
+51.222.39.240
+51.222.39.241
  51.222.40.156
  51.222.56.152
  51.222.87.112
  51.254.100.220
+51.254.100.56
+51.254.101.227
  51.254.102.19
  51.254.117.33
  51.254.120.159
+51.254.120.225
  51.254.121.186
+51.254.121.200
  51.254.127.179
+51.254.129.128
  51.254.129.170
  51.254.129.90
  51.254.130.61
@@ -66717,8 +78929,11 @@
  51.254.141.247
  51.254.141.30
  51.254.141.5
+51.254.143.190
  51.254.143.24
+51.254.150.55
  51.254.156.114
+51.254.157.144
  51.254.164.244
  51.254.164.248
  51.254.167.223
@@ -66727,26 +78942,37 @@
  51.254.182.54
  51.254.182.63
  51.254.19.227
+51.254.191.215
  51.254.199.134
+51.254.207.92
  51.254.210.100
  51.254.211.231
  51.254.215.146
+51.254.22.161
  51.254.220.245
  51.254.220.97
  51.254.221.100
  51.254.221.95
+51.254.222.185
  51.254.222.68
  51.254.23.227
  51.254.235.35
  51.254.237.77
  51.254.237.78
+51.254.247.80
+51.254.248.18
+51.254.32.102
  51.254.32.6
  51.254.32.67
  51.254.32.77
+51.254.37.156
+51.254.37.237
  51.254.44.148
  51.254.47.198
  51.254.47.231
  51.254.48.93
+51.254.63.223
+51.254.71.86
  51.254.83.239
  51.254.83.80
  51.254.97.192
@@ -66760,6 +78986,8 @@
  51.255.163.60
  51.255.164.193
  51.255.165.160
+51.255.167.128
+51.255.168.254
  51.255.170.237
  51.255.171.172
  51.255.172.209
@@ -66772,6 +79000,7 @@
  51.255.201.98
  51.255.202.66
  51.255.203.164
+51.255.203.207
  51.255.207.29
  51.255.207.3
  51.255.28.53
@@ -66781,6 +79010,7 @@
  51.255.40.241
  51.255.42.170
  51.255.42.173
+51.255.42.250
  51.255.45.144
  51.255.49.59
  51.255.51.249
@@ -66793,11 +79023,19 @@
  51.255.80.230
  51.255.85.180
  51.255.87.121
+51.255.9.14
+51.255.91.64
+51.255.95.26
+51.36.11.49
+51.37.49.140
+51.37.86.176
  51.38.101.119
  51.38.103.163
  51.38.124.206
  51.38.126.75
+51.38.128.30
  51.38.129.120
+51.38.129.133
  51.38.129.49
  51.38.134.203
  51.38.135.250
@@ -66805,31 +79043,45 @@
  51.38.150.171
  51.38.162.232
  51.38.162.234
+51.38.168.26
  51.38.178.44
+51.38.179.113
  51.38.180.231
+51.38.186.53
  51.38.187.74
+51.38.188.101
+51.38.188.63
  51.38.191.126
  51.38.201.19
  51.38.212.233
  51.38.214.71
  51.38.226.94
+51.38.227.167
+51.38.227.231
+51.38.230.190
  51.38.233.93
  51.38.237.230
  51.38.238.165
  51.38.238.205
  51.38.238.3
  51.38.244.38
+51.38.32.230
+51.38.37.254
  51.38.41.205
  51.38.41.38
  51.38.42.226
  51.38.48.127
  51.38.48.186
  51.38.49.5
+51.38.50.105
+51.38.50.235
  51.38.51.198
+51.38.51.200
  51.38.56.35
  51.38.57.53
  51.38.58.134
  51.38.64.136
+51.38.65.138
  51.38.65.2
  51.38.68.83
  51.38.70.175
@@ -66858,18 +79110,27 @@
  51.6.164.145
  51.68.11.211
  51.68.11.231
+51.68.122.147
+51.68.122.155
  51.68.123.192
+51.68.137.63
  51.68.140.124
  51.68.140.234
  51.68.141.141
  51.68.141.240
+51.68.143.201
  51.68.143.212
  51.68.152.18
  51.68.172.217
+51.68.172.98
  51.68.176.52
+51.68.189.177
+51.68.189.69
  51.68.190.223
  51.68.197.96
+51.68.198.113
  51.68.198.222
+51.68.199.114
  51.68.204.150
  51.68.208.252
  51.68.212.230
@@ -66878,27 +79139,46 @@
  51.68.213.247
  51.68.214.51
  51.68.215.174
+51.68.215.178
  51.68.215.249
+51.68.224.53
+51.68.226.22
  51.68.226.27
+51.68.226.87
  51.68.229.177
+51.68.230.213
  51.68.245.130
  51.68.251.200
  51.68.253.19
  51.68.33.31
  51.68.36.57
+51.68.44.13
+51.68.44.154
  51.68.61.17
  51.68.70.237
+51.68.71.178
+51.68.71.187
  51.68.71.239
  51.68.83.78
  51.68.85.93
  51.68.86.247
+51.68.88.26
  51.68.90.171
  51.68.90.244
+51.68.91.191
+51.68.93.212
+51.68.94.206
  51.7.72.73
  51.75.103.216
+51.75.123.107
+51.75.126.115
  51.75.129.231
  51.75.131.235
+51.75.133.116
  51.75.133.14
+51.75.140.153
+51.75.140.19
+51.75.142.24
  51.75.144.43
  51.75.146.127
  51.75.147.33
@@ -66907,11 +79187,13 @@
  51.75.147.43
  51.75.147.44
  51.75.149.207
+51.75.16.138
  51.75.160.57
  51.75.161.216
  51.75.161.72
  51.75.169.151
  51.75.170.50
+51.75.18.215
  51.75.188.112
  51.75.191.176
  51.75.196.154
@@ -66923,6 +79205,9 @@
  51.75.23.214
  51.75.240.227
  51.75.242.135
+51.75.246.176
+51.75.247.232
+51.75.254.172
  51.75.255.250
  51.75.28.25
  51.75.33.122
@@ -66930,6 +79215,7 @@
  51.75.39.125
  51.75.5.52
  51.75.52.118
+51.75.53.141
  51.75.55.212
  51.75.64.18
  51.75.64.187
@@ -66937,7 +79223,10 @@
  51.75.64.23
  51.75.66.142
  51.75.66.92
+51.75.71.111
  51.75.73.21
+51.75.78.168
+51.75.78.253
  51.75.79.181
  51.75.79.248
  51.75.86.211
@@ -66945,17 +79234,29 @@
  51.75.92.67
  51.75.96.245
  51.77.103.164
+51.77.103.248
  51.77.108.33
  51.77.109.98
  51.77.11.182
+51.77.112.168
+51.77.121.96
+51.77.121.97
  51.77.135.89
  51.77.137.211
  51.77.140.110
+51.77.140.111
+51.77.140.36
  51.77.141.154
+51.77.145.124
+51.77.146.156
+51.77.147.5
  51.77.148.119
  51.77.148.7
  51.77.148.72
+51.77.149.232
+51.77.150.118
  51.77.150.147
+51.77.150.203
  51.77.150.44
  51.77.151.77
  51.77.152.20
@@ -66965,28 +79266,36 @@
  51.77.168.11
  51.77.193.204
  51.77.194.232
+51.77.200.101
  51.77.200.139
  51.77.201.36
  51.77.201.87
  51.77.202.125
+51.77.202.151
  51.77.213.160
  51.77.213.174
  51.77.214.118
  51.77.215.207
  51.77.215.227
+51.77.220.183
  51.77.222.106
+51.77.223.17
  51.77.223.230
  51.77.223.62
  51.77.226.110
  51.77.230.131
  51.77.230.49
  51.77.231.236
-51.77.234.86
  51.77.242.176
  51.77.244.29
  51.77.245.98
  51.77.246.155
+51.77.247.43
  51.77.249.201
+51.77.33.216
+51.77.33.217
+51.77.33.218
+51.77.33.219
  51.77.39.255
  51.77.52.201
  51.77.53.133
@@ -67001,13 +79310,28 @@
  51.77.94.244
  51.77.95.120
  51.79.111.220
+51.79.140.125
+51.79.141.100
+51.79.142.174
  51.79.142.211
+51.79.142.233
+51.79.145.154
+51.79.147.177
  51.79.157.109
+51.79.157.202
  51.79.157.254
+51.79.158.206
+51.79.159.176
+51.79.160.231
+51.79.164.102
  51.79.173.166
+51.79.192.244
  51.79.25.250
  51.79.38.73
  51.79.42.147
+51.79.44.52
+51.79.49.178
+51.79.51.246
  51.79.53.134
  51.79.53.139
  51.79.53.145
@@ -67015,11 +79339,14 @@
  51.79.55.141
  51.79.60.149
  51.79.65.236
+51.79.66.198
+51.79.66.92
  51.79.67.108
  51.79.68.147
  51.79.69.153
  51.79.69.241
  51.79.82.75
+51.79.84.101
  51.79.85.154
  51.79.86.173
  51.79.86.174
@@ -67028,6 +79355,7 @@
  51.79.86.180
  51.79.86.181
  51.79.86.237
+51.81.0.103
  51.81.118.2
  51.81.122.147
  51.81.122.151
@@ -67063,18 +79391,43 @@
  51.81.89.145
  51.81.89.146
  51.83.105.108
+51.83.120.92
+51.83.128.135
  51.83.128.210
  51.83.129.228
  51.83.129.84
  51.83.131.42
+51.83.132.153
+51.83.132.189
  51.83.132.19
+51.83.134.17
+51.83.134.39
+51.83.134.64
  51.83.171.11
  51.83.171.25
+51.83.176.3
+51.83.177.0
+51.83.177.12
+51.83.177.14
  51.83.180.147
  51.83.180.241
  51.83.182.185
  51.83.187.201
  51.83.189.0
+51.83.189.112
+51.83.191.217
+51.83.191.220
+51.83.191.221
+51.83.191.222
+51.83.191.223
+51.83.191.225
+51.83.191.226
+51.83.191.228
+51.83.191.229
+51.83.191.230
+51.83.193.117
+51.83.193.118
+51.83.193.119
  51.83.200.164
  51.83.200.176
  51.83.200.179
@@ -67083,6 +79436,10 @@
  51.83.210.201
  51.83.210.220
  51.83.216.201
+51.83.244.104
+51.83.244.105
+51.83.32.113
+51.83.33.202
  51.83.33.88
  51.83.41.120
  51.83.41.129
@@ -67090,58 +79447,90 @@
  51.83.45.229
  51.83.45.246
  51.83.45.33
+51.83.45.65
+51.83.47.102
  51.83.67.9
  51.83.68.128
+51.83.68.203
  51.83.68.213
+51.83.69.142
  51.83.72.194
+51.83.72.208
+51.83.72.58
  51.83.73.243
  51.83.73.57
+51.83.74.126
+51.83.74.203
+51.83.74.86
+51.83.77.224
+51.83.97.245
  51.83.98.104
  51.83.99.227
  51.89.10.253
  51.89.100.108
+51.89.103.161
  51.89.107.21
  51.89.115.248
  51.89.119.120
  51.89.119.154
  51.89.13.174
+51.89.134.87
+51.89.136.104
+51.89.148.69
+51.89.149.0
  51.89.153.76
  51.89.161.210
  51.89.165.197
+51.89.168.220
  51.89.173.199
  51.89.187.170
  51.89.188.246
  51.89.195.68
  51.89.201.9
  51.89.205.182
+51.89.207.112
+51.89.207.113
  51.89.213.95
+51.89.22.75
  51.89.22.95
  51.89.226.253
  51.89.228.61
  51.89.23.175
  51.89.23.222
  51.89.235.94
+51.89.252.167
  51.89.36.180
  51.89.40.32
+51.89.40.99
  51.89.62.241
  51.89.76.220
  51.9.138.233
+51.91.10.114
  51.91.100.109
+51.91.100.120
  51.91.105.165
  51.91.105.6
  51.91.108.57
  51.91.110.51
+51.91.111.73
  51.91.116.128
+51.91.120.67
+51.91.121.124
  51.91.121.222
  51.91.122.101
  51.91.122.205
+51.91.123.119
  51.91.123.132
  51.91.123.169
  51.91.123.213
+51.91.123.217
  51.91.123.235
+51.91.125.195
  51.91.127.200
+51.91.127.201
  51.91.140.218
  51.91.157.255
+51.91.159.46
  51.91.16.125
  51.91.185.74
  51.91.189.201
@@ -67154,12 +79543,19 @@
  51.91.239.11
  51.91.248.152
  51.91.250.197
+51.91.250.49
+51.91.255.113
+51.91.255.147
  51.91.39.84
+51.91.56.133
  51.91.66.179
  51.91.66.183
  51.91.66.27
+51.91.68.164
  51.91.73.64
+51.91.76.214
  51.91.76.3
+51.91.77.103
  51.91.8.125
  51.91.8.222
  51.91.80.172
@@ -67248,15 +79644,18 @@
  52.11.70.207
  52.11.74.157
  52.11.87.3
+52.117.13.17
  52.12.94.219
  52.128.240.42
  52.128.56.98
  52.129.47.88
  52.13.22.56
  52.130.66.150
+52.130.75.32
  52.130.78.186
  52.138.0.111
  52.138.144.107
+52.138.19.31
  52.138.20.234
  52.14.12.6
  52.14.131.222
@@ -67279,16 +79678,23 @@
  52.14.53.142
  52.14.78.244
  52.14.87.72
+52.140.103.80
  52.141.35.112
  52.141.63.69
  52.142.11.139
  52.142.150.101
  52.142.25.231
+52.143.117.67
  52.143.64.116
  52.144.114.197
  52.144.70.194
  52.144.86.82
+52.144.89.31
+52.146.42.228
+52.146.46.244
+52.148.81.50
  52.149.152.236
+52.149.180.228
  52.15.103.61
  52.15.105.94
  52.15.115.119
@@ -67308,6 +79714,7 @@
  52.15.87.18
  52.15.98.118
  52.151.117.83
+52.151.24.212
  52.151.250.126
  52.152.140.14
  52.156.134.132
@@ -67327,11 +79734,21 @@
  52.161.13.30
  52.161.29.204
  52.161.92.66
+52.161.97.190
+52.162.207.183
  52.163.121.255
+52.163.127.48
+52.163.223.126
  52.163.243.190
+52.163.53.174
  52.163.63.49
  52.164.124.121
  52.164.209.35
+52.164.251.68
+52.164.252.105
+52.164.252.241
+52.164.253.51
+52.164.253.73
  52.165.152.75
  52.165.32.203
  52.165.33.244
@@ -67340,21 +79757,27 @@
  52.166.253.112
  52.166.62.239
  52.167.12.183
+52.167.154.234
  52.167.156.52
  52.168.11.129
+52.168.122.218
+52.168.123.12
  52.168.138.134
  52.168.148.166
  52.168.168.50
  52.168.171.67
  52.168.20.76
+52.168.68.127
  52.168.87.215
  52.168.87.27
  52.168.90.133
+52.169.105.193
  52.169.122.231
  52.169.184.206
  52.169.224.12
  52.169.231.15
  52.169.238.66
+52.169.28.194
  52.169.49.191
  52.17.110.237
  52.17.137.119
@@ -67374,14 +79797,19 @@
  52.17.98.211
  52.170.1.130
  52.170.2.8
+52.170.248.124
+52.170.252.124
  52.170.44.161
  52.170.72.140
  52.171.198.169
  52.171.211.43
+52.172.153.7
+52.172.165.176
+52.172.170.61
  52.173.143.59
  52.173.37.67
  52.173.74.94
-52.174.190.191
+52.174.152.97
  52.174.236.181
  52.175.150.108
  52.175.201.251
@@ -67398,6 +79826,7 @@
  52.177.187.62
  52.178.166.4
  52.178.74.26
+52.179.188.39
  52.179.7.104
  52.18.100.70
  52.18.140.176
@@ -67425,19 +79854,25 @@
  52.183.64.107
  52.184.229.115
  52.185.160.122
+52.185.171.147
  52.185.205.1
  52.186.11.118
  52.186.13.110
+52.186.155.64
  52.186.156.78
+52.187.117.17
  52.187.130.77
+52.187.188.41
  52.187.56.107
  52.188.0.112
  52.188.113.116
  52.188.121.92
  52.188.147.170
  52.188.153.36
+52.188.158.184
  52.188.172.62
  52.188.68.29
+52.188.69.174
  52.188.9.234
  52.19.127.128
  52.19.136.130
@@ -67451,9 +79886,17 @@
  52.19.75.131
  52.19.80.88
  52.19.87.193
+52.191.112.69
+52.191.113.131
+52.191.113.62
+52.191.114.253
+52.191.115.10
+52.191.115.171
+52.191.115.99
  52.191.135.197
  52.191.137.182
  52.191.163.162
+52.191.166.171
  52.191.254.47
  52.192.233.133
  52.192.73.251
@@ -67483,6 +79926,7 @@
  52.2.152.40
  52.2.32.57
  52.2.45.196
+52.20.207.217
  52.20.250.185
  52.20.46.101
  52.20.7.202
@@ -67626,6 +80070,7 @@
  52.224.240.91
  52.224.66.246
  52.226.64.27
+52.229.159.234
  52.229.206.131
  52.23.132.187
  52.23.170.11
@@ -67636,13 +80081,20 @@
  52.23.245.243
  52.23.252.19
  52.230.3.147
+52.231.102.178
  52.231.155.199
  52.231.167.166
+52.231.216.47
+52.231.26.86
+52.231.77.116
+52.231.92.23
  52.232.246.85
  52.233.45.15
  52.234.224.154
-52.235.33.117
+52.235.32.57
  52.235.42.75
+52.236.131.152
+52.236.32.160
  52.237.166.210
  52.24.21.90
  52.24.215.24
@@ -67657,6 +80109,7 @@
  52.240.53.155
  52.240.55.118
  52.241.142.136
+52.242.91.130
  52.247.113.177
  52.247.194.12
  52.247.203.36
@@ -67672,6 +80125,7 @@
  52.25.41.202
  52.25.81.249
  52.250.19.179
+52.250.50.246
  52.251.41.13
  52.251.89.82
  52.252.0.233
@@ -67680,6 +80134,7 @@
  52.252.97.130
  52.255.143.183
  52.255.147.248
+52.255.162.142
  52.255.167.164
  52.255.199.24
  52.255.203.95
@@ -68024,6 +80479,7 @@
  52.59.8.37
  52.59.80.4
  52.59.87.74
+52.6.178.154
  52.6.203.80
  52.6.92.255
  52.60.122.59
@@ -68087,6 +80543,7 @@
  52.72.156.74
  52.73.119.192
  52.73.45.110
+52.73.70.149
  52.74.126.15
  52.74.156.128
  52.74.244.147
@@ -68099,6 +80556,7 @@
  52.77.227.135
  52.77.232.238
  52.77.233.168
+52.78.0.94
  52.78.139.36
  52.78.16.216
  52.78.163.216
@@ -68135,6 +80593,7 @@
  52.87.182.122
  52.87.182.94
  52.87.186.253
+52.87.192.166
  52.87.204.200
  52.87.214.215
  52.87.214.225
@@ -68176,6 +80635,7 @@
  52.9.71.221
  52.90.100.167
  52.90.106.50
+52.90.139.206
  52.90.212.201
  52.90.231.255
  52.90.43.54
@@ -68268,6 +80728,7 @@
  54.146.184.127
  54.146.242.46
  54.147.125.224
+54.147.137.89
  54.147.175.198
  54.147.18.154
  54.147.196.40
@@ -68406,6 +80867,7 @@
  54.169.158.55
  54.169.180.100
  54.169.2.10
+54.169.240.111
  54.169.27.112
  54.169.33.195
  54.169.76.68
@@ -68473,6 +80935,7 @@
  54.176.18.9
  54.176.188.51
  54.176.236.95
+54.176.94.7
  54.177.150.209
  54.177.177.232
  54.178.155.230
@@ -68495,6 +80958,7 @@
  54.183.161.206
  54.183.169.192
  54.183.169.241
+54.183.18.147
  54.183.187.60
  54.183.188.22
  54.183.200.90
@@ -68508,6 +80972,7 @@
  54.184.22.217
  54.185.108.174
  54.185.121.52
+54.185.215.214
  54.185.85.173
  54.186.113.48
  54.186.12.193
@@ -68522,6 +80987,7 @@
  54.186.244.149
  54.186.34.136
  54.187.117.98
+54.187.141.28
  54.187.154.214
  54.187.172.238
  54.187.209.170
@@ -68535,6 +81001,7 @@
  54.189.184.168
  54.189.196.167
  54.189.69.226
+54.190.157.26
  54.190.2.74
  54.190.218.83
  54.190.238.212
@@ -68716,6 +81183,7 @@
  54.215.117.219
  54.215.19.78
  54.215.229.110
+54.215.97.193
  54.217.136.122
  54.217.186.6
  54.218.10.179
@@ -68773,6 +81241,8 @@
  54.227.250.228
  54.227.66.57
  54.227.79.173
+54.228.252.14
+54.228.254.42
  54.229.151.112
  54.229.206.137
  54.229.239.56
@@ -68836,6 +81306,7 @@
  54.242.226.101
  54.242.3.69
  54.242.58.140
+54.242.75.41
  54.242.80.51
  54.243.100.79
  54.243.22.192
@@ -68874,12 +81345,15 @@
  54.247.100.248
  54.247.184.250
  54.249.206.111
+54.249.40.99
  54.249.44.222
  54.249.59.190
  54.250.245.105
+54.250.87.247
  54.251.134.94
  54.251.135.185
  54.251.145.112
+54.251.181.118
  54.251.181.125
  54.251.183.245
  54.251.38.138
@@ -68902,6 +81376,7 @@
  54.254.75.70
  54.255.139.92
  54.255.164.240
+54.255.166.196
  54.255.182.210
  54.255.195.80
  54.255.204.204
@@ -68912,11 +81387,18 @@
  54.36.112.254
  54.36.117.1
  54.36.120.120
+54.36.148.198
+54.36.148.210
+54.36.148.80
  54.36.149.51
+54.36.149.63
+54.36.149.89
  54.36.165.192
+54.36.165.239
  54.36.165.34
  54.36.172.26
  54.36.177.3
+54.36.180.236
  54.36.185.63
  54.36.19.138
  54.36.190.245
@@ -68924,10 +81406,14 @@
  54.36.205.105
  54.36.232.247
  54.36.244.128
+54.36.4.19
  54.36.42.250
+54.36.43.254
  54.36.61.64
  54.36.62.114
  54.36.62.47
+54.36.68.201
+54.36.89.34
  54.36.98.11
  54.36.98.133
  54.36.98.17
@@ -68944,8 +81430,12 @@
  54.36.99.6
  54.36.99.71
  54.36.99.9
+54.37.11.58
  54.37.131.204
  54.37.141.106
+54.37.143.192
+54.37.156.188
+54.37.159.12
  54.37.16.241
  54.37.19.108
  54.37.19.60
@@ -68954,15 +81444,24 @@
  54.37.19.81
  54.37.194.21
  54.37.194.43
+54.37.198.243
  54.37.204.99
  54.37.209.37
+54.37.224.163
  54.37.232.115
  54.37.232.30
+54.37.233.126
  54.37.234.152
  54.37.235.183
+54.37.237.50
  54.37.253.178
  54.37.42.48
  54.37.64.149
+54.37.68.191
+54.37.70.24
+54.37.71.203
+54.37.71.204
+54.37.71.207
  54.37.75.210
  54.37.77.236
  54.37.78.107
@@ -68972,17 +81471,25 @@
  54.38.110.35
  54.38.123.235
  54.38.123.252
+54.38.134.219
  54.38.137.36
  54.38.143.245
  54.38.143.246
+54.38.144.254
  54.38.156.28
+54.38.156.63
  54.38.157.22
  54.38.158.224
  54.38.177.175
  54.38.177.230
  54.38.178.205
+54.38.18.211
  54.38.180.93
+54.38.183.181
+54.38.185.131
  54.38.186.173
+54.38.186.60
+54.38.186.88
  54.38.190.187
  54.38.190.48
  54.38.198.240
@@ -68993,27 +81500,44 @@
  54.38.236.24
  54.38.237.0
  54.38.237.6
+54.38.240.34
+54.38.241.162
  54.38.243.187
+54.38.243.189
+54.38.248.133
  54.38.253.1
+54.38.33.178
  54.38.36.210
  54.38.37.42
+54.38.48.226
  54.38.52.137
+54.38.53.251
+54.38.56.106
  54.38.56.79
  54.38.61.50
  54.38.61.61
+54.38.65.125
+54.38.65.127
+54.38.65.215
+54.38.65.55
  54.38.81.231
  54.38.82.57
  54.38.94.63
  54.39.133.203
+54.39.145.123
  54.39.156.171
+54.39.16.153
  54.39.16.73
  54.39.18.49
+54.39.182.250
  54.39.2.124
  54.39.202.218
  54.39.22.116
+54.39.22.135
  54.39.228.109
  54.39.243.49
  54.39.50.172
+54.39.50.204
  54.39.50.28
  54.39.66.201
  54.39.94.188
@@ -69107,6 +81631,7 @@
  54.87.139.109
  54.87.176.205
  54.87.177.220
+54.87.244.162
  54.87.250.249
  54.87.80.90
  54.87.90.203
@@ -69234,6 +81759,7 @@
  58.106.192.99
  58.11.158.114
  58.11.57.98
+58.11.83.111
  58.115.174.4
  58.120.227.139
  58.120.27.153
@@ -69244,12 +81770,14 @@
  58.125.213.139
  58.126.223.166
  58.126.247.95
+58.127.186.231
  58.130.120.224
  58.132.214.152
  58.140.67.144
  58.141.122.109
  58.141.144.18
  58.141.144.18bin.sh
+58.141.226.2
  58.142.144.134
  58.142.200.124
  58.142.200.124bin.sh
@@ -69262,8 +81790,10 @@
  58.147.170.132
  58.147.170.226
  58.147.171.114
+58.147.187.38
  58.149.49.186
  58.149.52.124
+58.150.192.131
  58.150.221.203
  58.150.99.144
  58.151.80.76
@@ -69271,34 +81801,62 @@
  58.153.112.168
  58.153.255.89
  58.158.0.86
+58.16.204.238
  58.160.112.29
  58.162.143.57
  58.162.218.151
  58.162.229.173
+58.169.49.172
  58.17.185.231
+58.17.200.197
  58.171.135.242
  58.171.153.81
  58.171.38.26
+58.175.65.14
  58.176.45.132
  58.177.86.10
  58.179.192.105
+58.179.21.69
  58.184.252.3
  58.185.183.60
  58.185.69.243
+58.186.117.109
+58.186.217.27
+58.186.60.205
+58.186.61.222
+58.186.63.106
  58.20.108.76
+58.20.30.77
+58.20.54.143
+58.20.74.244
+58.20.74.31
+58.208.136.156
+58.208.172.10
+58.208.172.189
+58.208.172.58
+58.208.180.27
+58.208.73.42
+58.209.192.226
  58.209.239.23
  58.209.61.60
  58.210.235.10
  58.210.241.5
+58.210.82.250
  58.210.88.98
  58.211.134.98
+58.211.203.122
+58.211.8.182
  58.211.82.170
  58.212.59.53
  58.213.116.170
+58.213.151.122
+58.213.84.234
+58.214.36.86
  58.215.120.178
  58.215.120.180
  58.215.177.24
  58.215.201.98
+58.216.218.98
  58.216.236.42
  58.218.10.103
  58.218.127.122
@@ -69306,15 +81864,24 @@
  58.218.16.191
  58.218.16.227
  58.218.17.129
+58.218.198.153
  58.218.26.111
  58.218.30.167
  58.218.5.3
  58.218.56.93
  58.219.227.184
+58.219.60.107
  58.22.214.68
+58.22.5.85
+58.22.7.73
  58.22.95.225
  58.22.95.235
  58.22.95.36
+58.220.10.149
+58.220.10.210
+58.220.24.75
+58.220.56.64
+58.220.87.226
  58.220.95.30
  58.220.95.44
  58.220.95.54
@@ -69325,28 +81892,43 @@
  58.220.95.84
  58.220.95.86
  58.220.95.90
+58.221.101.182
+58.221.183.130
+58.221.183.210
  58.221.204.114
  58.221.62.191
  58.221.62.199
+58.221.62.204
  58.221.62.221
+58.221.62.228
  58.221.64.51
+58.222.107.253
+58.222.116.138
  58.222.20.220
+58.223.21.35
  58.225.75.151
  58.226.129.29
  58.226.23.129
  58.226.23.55
  58.227.193.198
+58.227.194.171
+58.229.114.170
  58.229.157.178
+58.229.184.242
  58.229.194.122bfac0332.moe
  58.229.208.158
+58.229.36.179
  58.229.6.137
+58.229.6.74
  58.23.247.73
  58.23.50.135
  58.230.118.81
  58.230.119.34
  58.230.123.88
+58.230.147.230
  58.233.240.94
  58.234.250.211
+58.236.111.112
  58.236.160.218
  58.236.77.157
  58.238.42.192
@@ -69358,6 +81940,8 @@
  58.240.146.154
  58.240.148.13
  58.240.148.13bin.sh
+58.240.173.205
+58.242.164.10
  58.242.169.14
  58.242.197.25
  58.242.59.139
@@ -69373,6 +81957,7 @@
  58.243.127.215
  58.243.181.70
  58.243.188.145
+58.243.189.105
  58.243.189.67
  58.243.19.107
  58.243.19.196
@@ -69384,65 +81969,107 @@
  58.244.255.45
  58.246.136.250
  58.246.140.134
+58.246.251.27
  58.246.60.162
+58.246.64.11
+58.246.68.6
+58.247.10.90
+58.247.111.70
+58.247.43.46
  58.247.51.194
-58.248.146.193
-58.248.147.59
+58.248.113.151
  58.248.193.91
-58.249.10.163
+58.248.74.23
+58.248.76.225
+58.248.84.189
+58.249.13.228
+58.249.20.140
  58.249.23.33
-58.249.85.142
-58.249.90.168
+58.249.78.56
+58.249.80.61
+58.249.81.30
  58.250.169.130
  58.250.176.94
  58.251.23.125
+58.252.16.40
+58.252.17.170
+58.252.177.40
+58.252.177.77
+58.252.2.236
  58.252.219.12
  58.254.184.102
  58.254.220.116
-58.255.134.90
-58.255.135.228
-58.255.140.190
  58.27.17.165
+58.27.215.212
  58.27.215.3
  58.27.237.218
+58.27.95.2
+58.30.77.194
+58.33.160.139
+58.33.197.82
  58.33.199.188
  58.33.242.2
  58.33.242.3
+58.33.35.82
+58.33.49.196
+58.33.84.251
  58.35.58.58
  58.35.65.177
  58.40.124.174
  58.42.30.64
  58.47.3.196
  58.48.168.166
+58.48.196.76
  58.48.199.241
  58.49.116.78
  58.49.208.18
+58.49.208.22
+58.49.94.213
  58.50.130.68
  58.52.179.215
  58.53.128.61
-58.55.37.244
+58.56.132.10
+58.56.140.62
+58.56.181.58
+58.56.32.238
+58.56.34.146
+58.56.40.210
+58.57.13.171
+58.57.15.29
+58.57.178.30
  58.57.186.106
  58.57.4.238
  58.58.213.55
+58.58.42.70
+58.58.58.114
+58.58.71.218
+58.59.17.74
  58.59.251.114
  58.6.169.109
  58.60.10.10
  58.61.143.138
+58.61.50.198
+58.62.18.194
+58.63.37.211
  58.64.129.15
  58.64.178.77
  58.64.188.26
  58.64.193.193
  58.64.193.218
  58.64.204.170
+58.65.136.170
  58.65.167.165
+58.69.147.74
+58.69.215.66
  58.69.87.58
+58.71.15.10
  58.71.5.154
  58.71.72.50
  58.75.126.235
  58.76.161.126
  58.76.180.71
-58.8.174.125
  58.8.2.250
+58.8.234.219
  58.82.170.50
  58.82.212.192
  58.82.246.65
@@ -69467,24 +82094,44 @@
  58.84.31.77
  58.84.31.81
  58.84.31.97
+58.87.106.15
+58.87.108.247
+58.87.108.77
+58.87.112.140
+58.87.114.13
+58.87.115.227
  58.87.117.152
+58.87.119.20
  58.87.120.117
+58.87.120.53
+58.87.121.166
+58.87.122.18
  58.87.126.58
+58.87.65.28
  58.87.65.57
+58.87.65.87
  58.87.66.82
  58.87.67.126
+58.87.67.226
  58.87.69.15
+58.87.71.16
+58.87.72.225
  58.87.75.219
  58.87.76.77
+58.87.78.176
  58.87.78.80
  58.87.84.31
+58.87.85.37
+58.87.90.156
  58.87.94.75
  58.9.182.62
  58.9.99.67
  58.96.175.218
  58.96.50.39
+58.97.195.223
  58.97.201.45
  58.97.206.33
+58.97.211.3
  58.97.214.5
  58.97.215.240
  58.97.72.83
@@ -69514,12 +82161,20 @@
  58yuesao.top
  58zwp.com
  59.1.146.105
+59.10.47.129
  59.100.12.173
+59.100.94.83
  59.102.148.151
  59.102.24.194
  59.102.43.21
+59.103.113.175
  59.103.114.112
+59.103.120.216
+59.103.122.22
+59.103.124.95
+59.103.125.152
  59.103.164.174
+59.103.193.189
  59.106.141.147
  59.106.171.70
  59.108.35.198
@@ -69529,12 +82184,19 @@
  59.110.12.12
  59.110.12.129
  59.110.153.239
+59.110.241.156
  59.110.50.141
  59.110.54.10
  59.110.70.236
+59.111.103.165
  59.111.93.64
+59.111.95.152
  59.115.121.228
  59.115.137.7
+59.115.139.163
+59.12.209.209
+59.120.227.134
+59.120.231.151
  59.120.5.154
  59.124.170.48
  59.124.205.214
@@ -69547,22 +82209,32 @@
  59.124.74.53
  59.124.74.56
  59.124.93.169
+59.125.2.121
  59.125.214.115
+59.125.28.51
+59.125.31.24
  59.125.75.222
  59.126.0.26
  59.126.108.147
  59.126.108.47
+59.126.172.201
+59.126.66.75
  59.127.168.43
  59.127.238.44
  59.127.27.243
  59.127.85.233
  59.128.66.213
  59.128.66.213bin.sh
+59.128.71.25
+59.13.125.142
  59.13.74.78
  59.14.147.227
+59.144.81.162
  59.145.111.67
+59.145.146.166
  59.145.221.103
  59.148.253.194
+59.149.202.226
  59.15.18.223
  59.15.18.223bin.sh
  59.15.3.197
@@ -69577,6 +82249,8 @@
  59.151.47.42
  59.152.104.54
  59.152.111.241
+59.152.229.114
+59.152.237.118
  59.152.62.40
  59.153.114.203
  59.153.121.161
@@ -69591,6 +82265,8 @@
  59.153.17.186
  59.153.18.90
  59.153.84.253
+59.154.237.20
+59.157.130.41
  59.160.171.91
  59.162.86.8
  59.167.155.59
@@ -69607,14 +82283,19 @@
  59.181.122.64bin.sh
  59.186.106.20
  59.188.133.34
+59.188.217.202
  59.188.221.251
  59.188.254.70
  59.188.71.147
  59.19.150.135
  59.19.29.102
+59.2.207.18
+59.20.252.136
  59.20.31.84
+59.20.40.127
  59.21.150.93
  59.21.235.119
+59.23.140.37
  59.23.168.115
  59.23.168.115bin.sh
  59.23.205.191
@@ -69626,11 +82307,11 @@
  59.24.93.138
  59.25.142.68
  59.25.6.100
+59.26.207.16
  59.26.209.230
  59.26.214.148
  59.26.218.228
  59.27.134.193
-59.27.177.249
  59.27.95.144
  59.28.44.229
  59.28.97.80
@@ -69643,66 +82324,106 @@
  59.30.12.254
  59.31.90.206
  59.36.136.238
+59.36.172.8
  59.36.210.233
  59.36.73.94
+59.36.75.227
+59.36.78.217
  59.37.22.82
  59.39.183.34
  59.39.63.54
  59.4.70.88
  59.4.98.61
+59.40.79.227
+59.41.131.48
  59.41.64.164
  59.42.10.71
+59.42.206.164
  59.42.207.60
+59.42.37.80
+59.42.38.38
  59.46.116.117
  59.46.124.38
+59.46.13.123
  59.46.136.139
+59.46.136.140
  59.46.136.141
+59.46.169.194
  59.48.102.174
+59.48.146.66
+59.48.149.251
  59.5.230.140bin.sh
+59.52.205.18
+59.53.227.78
+59.55.28.255
+59.55.36.121
+59.55.36.16
+59.55.36.180
+59.55.37.192
+59.55.37.77
+59.55.38.120
+59.55.38.250
+59.55.38.80
+59.55.39.112
+59.55.39.72
  59.56.106.103
  59.56.126.143
+59.56.148.35
+59.56.168.59
+59.56.62.43
  59.56.99.130
+59.57.83.94
  59.58.139.126
  59.6.180.232
  59.6.86.176
+59.63.225.99
  59.63.230.46
  59.64.129.180
  59.7.104.216
  59.7.233.94
+59.7.91.13
  59.72.109.90
+59.72.114.79
+59.72.122.148
  59.8.35.22
  59.8.41.30
+59.80.34.102
+59.83.222.82
  59.83.229.119
  59.9.77.181
+59.90.86.53
  59.91.122.1
  59.91.122.57
-59.92.179.155
-59.92.180.80
-59.92.183.190
+59.91.92.162
+59.92.178.31
+59.92.182.105
+59.92.182.116
  59.92.5.201
+59.92.69.22
  59.92.85.231
-59.93.16.224
-59.93.16.37
-59.93.17.130
  59.93.20.0
-59.94.180.30
-59.94.180.8
+59.93.22.184
+59.93.23.127
+59.93.242.221
+59.95.172.74
  59.95.173.191
-59.95.173.196
-59.95.174.220
-59.95.174.81
-59.95.175.28
-59.96.38.185
-59.97.168.214
-59.97.168.48
+59.96.104.42
+59.96.38.166
  59.97.169.36
-59.97.173.9
-59.97.174.94
-59.99.143.137
-59.99.190.201
-59.99.44.156
-59.99.44.88
-59.99.95.147
+59.97.170.98
+59.97.172.8
+59.99.139.129
+59.99.139.53
+59.99.140.11
+59.99.140.151
+59.99.142.69
+59.99.161.110
+59.99.42.64
+59.99.43.138
+59.99.43.163
+59.99.43.241
+59.99.46.144
+59.99.95.84
  590466-dot-n-e-w-me-ss-age-po-rt-al.wl.r.appspot.com
  5918062d-fb42-4707-b098-e2c266e14d95.htmlpasta.com
  591860.playcode.io
@@ -69833,8 +82554,10 @@
  60.10.9.198
  60.109.35.100
  60.113.117.109
+60.12.136.62
  60.12.214.184
  60.12.33.109
+60.126.37.246
  60.13.126.151
  60.13.251.214
  60.13.60.143
@@ -69842,43 +82565,96 @@
  60.16.237.27
  60.16.8.172
  60.161.13.44
+60.161.215.7
  60.162.123.120
  60.162.178.183
  60.162.183.254
  60.162.183.92
  60.162.187.162
-60.162.190.224
  60.162.191.86
+60.163.204.209
  60.164.130.220
  60.164.243.190
+60.165.219.14
  60.166.182.6
+60.166.84.245
+60.167.102.210
+60.167.102.239
+60.167.113.53
+60.167.118.62
+60.167.119.188
+60.167.134.58
+60.167.177.107
  60.167.177.25
+60.167.178.50
+60.167.178.69
+60.167.180.177
+60.167.180.193
+60.167.21.222
+60.167.22.104
+60.167.22.38
+60.167.22.60
  60.167.239.99
+60.167.52.198
+60.167.52.227
+60.167.52.57
+60.167.53.132
+60.167.53.173
+60.167.82.42
+60.167.82.58
+60.167.82.84
  60.168.132.85
+60.168.207.71
+60.169.115.81
  60.169.149.137
+60.169.94.19
+60.169.94.37
+60.169.94.40
+60.169.95.109
+60.169.95.20
  60.17.40.73
+60.17.42.51
  60.170.101.25
+60.170.162.110
  60.170.189.102
+60.171.163.115
+60.171.17.185
  60.171.208.199
+60.171.220.86
  60.172.152.139
+60.172.23.155
+60.173.105.206
  60.173.116.25
+60.173.161.143
+60.174.166.119
+60.174.234.57
+60.174.236.98
  60.174.242.172
  60.174.72.198
  60.175.124.27
+60.175.204.158
  60.178.10.55
+60.178.6.173
  60.183.3.161
  60.184.116.28
  60.184.95.135
  60.185.148.45
  60.185.159.249
-60.185.178.12
  60.189.30.4
  60.19.64.6
  60.190.163.182
  60.190.250.120
+60.190.37.155
  60.190.6.134
+60.190.78.114
+60.191.116.76
+60.191.119.124
+60.191.125.106
+60.191.134.34
  60.191.17.221
  60.191.187.235
+60.191.243.218
+60.191.29.210
  60.191.43.2
  60.196.60.122
  60.196.69.234
@@ -69900,9 +82676,11 @@
  60.209.244.173
  60.209.255.142
  60.209.26.70
+60.209.38.210
  60.209.57.205
  60.209.8.48
  60.209.80.102
+60.210.104.22
  60.211.110.32
  60.211.19.63
  60.211.218.78
@@ -69910,6 +82688,7 @@
  60.211.28.221
  60.211.29.18
  60.211.3.191
+60.211.4.138
  60.211.94.123
  60.211.94.184
  60.211.94.68
@@ -69917,67 +82696,82 @@
  60.212.100.83
  60.212.107.162
  60.212.107.162bin.sh
-60.212.123.142
  60.212.124.131
  60.212.140.53
  60.212.153.164
+60.212.157.210
+60.212.158.49
  60.212.180.197
+60.212.21.146
  60.212.24.148
  60.212.255.86
  60.212.26.164
  60.212.28.254
+60.212.48.55
  60.213.121.185
  60.213.171.219
  60.213.177.63
+60.213.61.36
  60.213.88.124
  60.214.239.108
  60.214.33.185
  60.214.34.129
  60.214.55.159
  60.215.161.69
+60.215.163.80
+60.215.188.174
  60.215.190.176
  60.215.202.140
  60.215.203.48
+60.215.23.218
  60.215.4.89
  60.216.101.46
  60.216.235.175
  60.217.120.44
-60.217.126.70
+60.217.125.133
  60.217.194.226
  60.217.64.237
  60.220.185.199
+60.220.185.35
  60.220.185.61
  60.220.21.128
  60.222.233.208
  60.228.245.111
  60.235.183.70
+60.235.24.222
  60.237.91.10
  60.24.124.52
-60.24.125.72
  60.24.45.226
  60.24.72.131
  60.240.17.148
  60.241.229.146
  60.241.231.114
-60.243.106.73
+60.241.53.60
  60.243.149.14
  60.244.109.18
+60.246.171.51
  60.246.65.138
  60.246.65.140
  60.246.7.4
  60.247.103.41
  60.247.27.157
  60.248.131.75
+60.248.199.194
  60.248.2.163
+60.248.249.190
  60.249.214.243
+60.249.217.225
  60.249.241.202
-60.25.115.128
-60.25.165.60
+60.249.82.121
+60.249.9.145
+60.249.94.193
  60.250.159.191
+60.250.164.169
  60.250.77.209
  60.251.109.18
  60.251.129.61
  60.251.133.227
+60.251.136.127
  60.251.153.223
  60.251.60.100
  60.253.14.166
@@ -69991,6 +82785,7 @@
  60.253.8.81
  60.254.16.200
  60.255.151.82
+60.26.13.185
  60.26.230.19
  60.26.231.21
  60.27.118.22
@@ -70003,22 +82798,33 @@
  60.48.1.149
  60.48.249.38
  60.49.0.221
-60.49.71.231
+60.5.64.189
  60.50.16.200
+60.50.178.13
  60.50.99.134
  60.51.111.99
+60.51.170.105
  60.51.228.233
  60.51.36.129
  60.51.4.203
  60.52.146.245
+60.52.37.41
  60.52.84.101
  60.53.126.184
+60.53.200.178
  60.53.203.3
  60.54.61.91
+60.6.209.7
  60.6.237.123
+60.7.145.73
  60.7.189.60
+60.7.241.77
+60.7.242.145
+60.7.246.23
  60.7.94.111
+60.8.213.170
  60.8.229.219
+60.9.4.15
  60.93.23.51
  60.93.62.64
  60112501-dot-sydneyma.appspot.com
@@ -70037,6 +82843,7 @@
  60minutesoffame.com
  60triple.com
  60xggrhtuemyoowf7.easy.co
+61.0.88.108
  61.100.181.218
  61.100.186.87
  61.100.5.136
@@ -70050,102 +82857,185 @@
  61.12.67.133
  61.12.82.102
  61.129.112.168
+61.132.170.6
+61.132.225.82
  61.132.46.219
  61.132.52.29
  61.132.52.45
+61.133.122.19
+61.133.232.248
  61.133.232.249
+61.133.232.250
+61.133.232.251
+61.133.232.252
+61.133.232.253
+61.133.232.254
  61.133.77.176
+61.135.136.184
+61.135.136.185
  61.135.155.82
  61.136.101.166
+61.136.144.41
  61.136.163.183
  61.136.163.245
  61.136.163.246
  61.136.210.238
  61.139.105.163
  61.14.228.134
+61.140.124.139
  61.140.13.161
+61.140.176.190
  61.140.25.241
  61.141.21.34
+61.141.224.191
+61.141.64.50
+61.141.86.69
  61.142.72.150
+61.145.178.134
  61.145.182.27
  61.145.185.121
  61.146.108.150
  61.147.209.29
  61.147.48.95
  61.147.67.206
+61.148.16.162
  61.148.199.206
+61.148.56.158
  61.148.90.118
+61.149.8.90
+61.150.114.203
+61.150.115.117
  61.150.76.240
+61.150.88.22
+61.150.88.32
  61.152.116.107
  61.152.122.166
  61.152.93.170
+61.153.184.111
  61.153.224.158
  61.153.237.123
  61.154.164.241
  61.155.0.253
  61.155.106.101
  61.155.106.14
+61.155.138.100
+61.155.167.4
+61.155.190.250
  61.155.194.9
+61.155.217.77
  61.155.233.227
+61.155.233.234
  61.156.208.53
+61.156.209.123
  61.156.215.57
+61.156.240.163
  61.156.31.52
+61.157.0.159
  61.157.158.250
+61.157.91.159
  61.158.114.188
  61.159.208.39
+61.160.196.102
  61.160.215.21
  61.160.216.63
  61.160.217.15
  61.160.247.216
+61.160.251.98
  61.160.45.109
+61.160.96.90
  61.161.250.202
  61.161.86.194
  61.162.168.8bin.sh
  61.162.181.59
  61.162.55.42
  61.163.136.104bin.sh
-61.163.137.223
-61.163.138.244
+61.163.140.118
+61.163.149.173
  61.163.156.160
+61.163.170.1
+61.163.179.56
+61.163.197.177
  61.163.38.30
+61.163.4.246
  61.164.145.8
  61.164.204.30
  61.164.246.45
  61.164.248.135
  61.164.34.4
+61.164.41.76
+61.164.47.132
  61.164.96.98
  61.165.32.222
  61.166.55.153
  61.168.139.52
+61.168.142.208
  61.168.222.143
  61.174.171.62
+61.174.212.58
  61.174.9.146
  61.176.223.8
+61.177.125.242
+61.177.144.130
  61.177.172.104
+61.177.172.158
  61.177.172.177
+61.177.173.10
+61.177.173.11
+61.177.173.12
+61.177.173.13
+61.177.173.14
+61.177.173.15
+61.177.173.16
+61.177.173.17
+61.177.173.18
+61.177.173.19
+61.177.173.2
+61.177.173.20
+61.177.173.21
+61.177.173.22
+61.177.173.23
+61.177.173.24
+61.177.173.25
+61.177.173.26
+61.177.173.27
+61.177.173.29
+61.177.173.5
+61.177.173.6
+61.177.173.7
+61.177.173.8
  61.177.47.214
  61.178.198.152
-61.179.193.46
  61.179.219.114
  61.179.247.228
  61.179.247.228bin.sh
  61.179.88.173
  61.179.90.225
-61.179.93.79
  61.180.184.214
+61.180.65.106
+61.180.65.237
  61.181.14.196
+61.181.80.253
  61.182.227.245
+61.182.57.161
  61.183.15.9
+61.183.41.104
  61.183.41.98
  61.184.119.32
  61.184.136.164
  61.184.196.122
  61.184.57.171
+61.185.114.130
+61.186.37.5
+61.188.18.141
  61.188.220.206
  61.189.43.58
+61.19.116.28
+61.19.123.42
  61.19.125.2
+61.19.127.228
  61.19.145.66
  61.19.146.5
+61.19.151.226
  61.19.154.78
  61.19.222.7
  61.19.244.78
@@ -70158,16 +83048,26 @@
  61.190.172.2
  61.190.91.66
  61.191.55.33
+61.191.84.182
  61.193.18.99
+61.193.242.120
  61.194.24.197
+61.2.140.193
+61.2.243.4
  61.216.107.38
  61.216.131.31
  61.216.28.103
+61.216.39.166
+61.218.122.198
  61.218.36.21
  61.218.40.121
+61.218.5.190
+61.219.114.108
  61.219.247.98
  61.219.249.103
  61.219.41.141
+61.220.55.218
+61.221.64.5
  61.222.155.229
  61.222.155.230
  61.223.78.143
@@ -70179,6 +83079,8 @@
  61.239.141.191
  61.239.162.198
  61.239.214.81
+61.239.31.134
+61.241.170.128
  61.241.170.149
  61.241.170.161
  61.241.170.204
@@ -70200,10 +83102,12 @@
  61.242.54.57
  61.242.54.73
  61.244.107.60
+61.244.114.180
  61.244.144.186
  61.244.186.33
  61.244.70.248
  61.244.80.223
+61.245.170.52
  61.246.38.248
  61.247.178.158
  61.247.25.22
@@ -70212,12 +83116,18 @@
  61.250.92.26
  61.251.191.139
  61.254.broadband2.iol.cz
+61.28.116.83
  61.3.124.147
-61.3.125.46
+61.3.126.62
+61.3.127.151
  61.32.154.211
+61.32.231.155
  61.32.6.30
+61.33.108.252
+61.33.229.139
  61.35.43.168
  61.37.212.83
+61.38.128.30
  61.39.130.75
  61.40.132.10
  61.41.45.83
@@ -70226,6 +83136,7 @@
  61.47.61.97
  61.47.7.71
  61.48.115.254
+61.51.111.187
  61.51.18.235
  61.52.100.125
  61.52.101.233
@@ -70234,32 +83145,37 @@
  61.52.11.87
  61.52.128.79
  61.52.131.12
-61.52.185.250
  61.52.193.111
  61.52.193.53
+61.52.195.105
  61.52.212.132
-61.52.236.111
  61.52.28.126
  61.52.28.79
-61.52.31.220
-61.52.35.136
  61.52.43.138
  61.52.9.115
+61.52.97.102
  61.52.98.12
  61.52.98.151
  61.52.98.32bin.sh
  61.53.11.91
+61.53.116.92
  61.53.117.57
  61.53.119.67
+61.53.12.161
+61.53.120.123
+61.53.153.105
  61.53.241.13
-61.53.5.207
-61.53.72.151
+61.53.6.252
  61.53.72.40
  61.53.96.12
  61.54.195.62
+61.54.234.48
+61.54.243.14
  61.54.248.217
  61.54.249.180
  61.54.40.78
+61.54.41.43
+61.54.43.141
  61.54.43.28
  61.54.78.161
  61.55.141.11
@@ -70289,9 +83205,12 @@
  61.7.132.237
  61.7.138.160
  61.7.138.225
+61.7.138.86
  61.7.141.34
  61.7.142.39
+61.7.144.181
  61.7.146.7
+61.7.147.29
  61.7.167.53
  61.7.183.135
  61.7.183.138
@@ -70301,17 +83220,22 @@
  61.7.184.63
  61.7.184.66
  61.7.185.166
+61.7.185.20
  61.7.185.214
+61.7.188.168
  61.7.233.195
+61.7.235.211
  61.70.104.46
  61.70.255.60
  61.72.181.146
+61.72.189.187
  61.72.211.28
  61.72.255.26
  61.72.74.81
  61.73.191.170
  61.74.246.120
  61.75.241.210
+61.76.169.138
  61.78.138.144
  61.78.210.199bin.sh
  61.78.62.22
@@ -70323,22 +83247,32 @@
  61.8.75.186
  61.8.78.130
  61.8.79.68
+61.80.179.118
+61.81.115.70
+61.82.31.167
  61.83.181.17
  61.84.196.50
  61.84.68.168
  61.85.141.135
  61.85.224.42
+61.9.102.169
+61.9.103.216
  61.9.48.102
  61.90.111.70
+61.90.160.204
  61.90.29.248
  61.91.183.86
  61.91.235.226
+61.91.59.182
+61.91.60.234
  61.91.79.40
  61.91.80.107
  61.92.159.208
  61.93.107.87
  61.93.201.198
  61.93.240.170
+61.93.240.18
+61.95.191.190
  61.95.233.61
  61.95.254.195
  61.96.111.133
@@ -70368,6 +83302,8 @@
  61jwibhbwsif.talagaremix.com
  61z39.cn
  62.1.147.90
+62.1.194.138
+62.100.92.2
  62.101.254.191
  62.102.148.154
  62.102.148.68
@@ -70390,6 +83326,8 @@
  62.109.19.103
  62.109.2.52
  62.109.31.192
+62.11.78.78
+62.110.172.102
  62.112.11.116
  62.112.11.188
  62.112.11.231
@@ -70414,6 +83352,7 @@
  62.122.201.170
  62.122.201.241
  62.122.201.246
+62.128.217.86
  62.13.193.206
  62.133.130.122
  62.133.174.247
@@ -70423,11 +83362,13 @@
  62.138.0.25
  62.138.1.43
  62.138.13.36
+62.138.14.216
  62.138.14.253
  62.138.145.62
  62.138.16.231
  62.138.162.12
  62.138.18.158
+62.138.19.30
  62.138.2.243
  62.138.206.160
  62.138.26.28
@@ -70440,7 +83381,10 @@
  62.141.47.10
  62.141.50.135
  62.141.66.110
+62.143.168.255
+62.143.39.246
  62.143.85.253
+62.147.252.120
  62.149.118.150
  62.149.143.141
  62.149.175.39
@@ -70452,22 +83396,27 @@
  62.149.29.47
  62.149.29.50
  62.149.5.18
+62.149.7.162
  62.149.7.163
  62.149.7.165
  62.149.7.169
  62.149.7.173
+62.150.170.62
  62.152.58.16
  62.153.103.153
  62.153.89.22
  62.155.146.149
  62.16.14.87
  62.16.41.210
+62.161.197.25
+62.162.111.153
  62.162.228.66
  62.162.58.40
  62.163.191.99
  62.163.24.180
  62.165.229.234
  62.168.57.109
+62.169.198.18
  62.169.209.105
  62.171.129.32
  62.171.133.27
@@ -70478,7 +83427,9 @@
  62.171.142.179
  62.171.144.155
  62.171.145.148
+62.171.145.200
  62.171.152.105
+62.171.152.242
  62.171.154.12
  62.171.154.196
  62.171.155.146
@@ -70486,6 +83437,7 @@
  62.171.160.189
  62.171.161.47
  62.171.164.69
+62.171.167.75
  62.171.170.82
  62.171.174.143
  62.171.174.192
@@ -70497,6 +83449,7 @@
  62.171.183.29
  62.171.185.159
  62.171.190.193
+62.171.191.120
  62.171.191.72
  62.173.145.48
  62.173.149.24
@@ -70511,8 +83464,10 @@
  62.182.62.35
  62.182.81.163
  62.182.81.225
+62.182.84.128
  62.182.84.191
  62.183.98.181
+62.189.71.12
  62.192.240.250
  62.193.227.12
  62.193.230.2
@@ -70531,9 +83486,11 @@
  62.201.210.134
  62.201.217.18
  62.201.233.59
+62.205.106.94
  62.205.132.245
  62.209.198.65
  62.210.103.45
+62.210.104.12
  62.210.105.112
  62.210.105.116
  62.210.107.189
@@ -70545,17 +83502,21 @@
  62.210.111.42
  62.210.111.45
  62.210.113.143
+62.210.113.228
  62.210.113.249
  62.210.115.133
  62.210.116.249
  62.210.124.248
+62.210.125.138
  62.210.125.157
  62.210.127.120
+62.210.127.14
  62.210.129.246
  62.210.131.148
  62.210.132.2
  62.210.132.30
  62.210.136.65
+62.210.136.99
  62.210.139.12
  62.210.139.243
  62.210.139.92
@@ -70586,8 +83547,11 @@
  62.210.177.53
  62.210.178.138
  62.210.178.179
+62.210.178.191
+62.210.178.59
  62.210.178.65
  62.210.180.146
+62.210.180.163
  62.210.180.164
  62.210.181.11
  62.210.181.123
@@ -70601,6 +83565,7 @@
  62.210.202.34
  62.210.202.81
  62.210.203.127
+62.210.204.60
  62.210.207.209
  62.210.207.52
  62.210.207.63
@@ -70620,6 +83585,7 @@
  62.210.29.189
  62.210.31.10
  62.210.37.82
+62.210.38.168
  62.210.5.92
  62.210.6.33
  62.210.69.173
@@ -70629,6 +83595,7 @@
  62.210.71.120
  62.210.72.181
  62.210.73.11
+62.210.75.68
  62.210.78.60
  62.210.80.2
  62.210.80.34
@@ -70641,6 +83608,7 @@
  62.210.83.206
  62.210.83.87
  62.210.83.88
+62.210.86.99
  62.210.89.128
  62.210.90.118
  62.210.91.17
@@ -70660,42 +83628,78 @@
  62.216.93.204
  62.219.194.210
  62.219.227.31
+62.221.121.185
  62.221.98.69
  62.228.152.100
  62.228.205.38
  62.23.15.92
  62.231.245.5
+62.231.64.160
  62.232.8.82
  62.233.37.237
  62.233.57.200
+62.233.73.23
  62.234.103.165
+62.234.107.104
+62.234.113.86
+62.234.114.180
+62.234.114.64
+62.234.116.144
+62.234.118.36
  62.234.118.61
  62.234.12.112
+62.234.121.61
  62.234.124.104
  62.234.127.234
  62.234.130.216
+62.234.130.87
+62.234.134.153
+62.234.137.128
  62.234.138.98
  62.234.146.45
+62.234.15.136
+62.234.151.192
+62.234.153.213
  62.234.155.108
+62.234.157.228
  62.234.167.11
  62.234.167.126
  62.234.169.68
+62.234.182.174
  62.234.188.157
  62.234.188.160
+62.234.193.119
+62.234.20.222
+62.234.20.26
+62.234.21.198
+62.234.217.203
  62.234.218.151
  62.234.22.198
+62.234.22.200
  62.234.239.134
+62.234.26.181
  62.234.33.166
+62.234.34.17
+62.234.36.219
  62.234.41.136
+62.234.42.203
  62.234.55.197
+62.234.58.195
+62.234.59.200
+62.234.6.147
  62.234.6.68
  62.234.67.135
+62.234.68.31
  62.234.78.238
  62.234.78.30
+62.234.78.62
  62.234.79.142
+62.234.8.154
  62.234.80.115
  62.234.87.242
  62.234.91.205
+62.234.94.202
+62.234.97.207
  62.238.161.92
  62.239.8.236
  62.24.109.77
@@ -70718,6 +83722,7 @@
  62.254.14.227
  62.254.157.105
  62.254.31.211
+62.255.169.34
  62.255.175.74
  62.28.102.242
  62.28.190.194
@@ -70736,6 +83741,7 @@
  62.33.207.201
  62.33.207.202
  62.33.207.98
+62.34.241.167
  62.36.8.2
  62.38.75.208
  62.38.77.184
@@ -70744,16 +83750,24 @@
  62.4.14.183
  62.4.14.198
  62.4.14.206
+62.4.15.227
  62.4.16.167
  62.4.18.68
+62.4.21.231
  62.4.23.127
  62.4.60.50
+62.44.135.55
  62.44.70.253
  62.44.82.61
+62.45.9.116
  62.45.96.7
+62.48.215.5
+62.56.250.68
  62.57.196.222
+62.57.90.188
  62.59.252.145
  62.6.237.182
+62.60.135.51
  62.63.157.106
  62.63.208.207
  62.67.212.41
@@ -70769,12 +83783,16 @@
  62.74.153.118
  62.75.141.82
  62.75.161.37
+62.75.168.106
  62.75.187.192
  62.75.191.106
  62.75.191.166
  62.75.202.55
  62.75.204.249
  62.75.216.136
+62.75.217.154
+62.75.217.161
+62.75.217.35
  62.75.222.59
  62.76.233.137
  62.76.96.6
@@ -70792,18 +83810,26 @@
  62.87.151.132
  62.87.151.138
  62.87.151.186
+62.87.195.117
  62.89.28.108
+62.90.147.250
  62.90.165.236
  62.90.175.115
  62.91.20.222
+62.92.48.242
+62.93.19.56
+62.93.7.66
  62.94.148.111
  62.94.153.133
+62.94.193.216
  62.94.202.114
  62.94.210.122
  62.96.10.98
+62.96.251.229
  62.97.116.82
  62.97.41.107
  62.99.178.46
+62.99.76.123
  62.99.90.10
  620021.com
  6200294-dot-oaao-274308.uc.r.appspot.com
@@ -70869,6 +83895,7 @@
  63.143.38.226
  63.143.45.19
  63.143.96.181
+63.143.98.57
  63.145.54.201
  63.145.54.202
  63.145.54.203
@@ -70900,6 +83927,7 @@
  63.153.134.18
  63.153.146.141
  63.153.146.253
+63.153.165.143
  63.153.178.14
  63.153.241.58
  63.155.101.172
@@ -70933,6 +83961,7 @@
  63.225.84.55
  63.226.58.155
  63.227.116.162
+63.227.147.118
  63.227.15.40
  63.227.245.220
  63.228.117.99
@@ -70955,6 +83984,7 @@
  63.234.49.48
  63.235.160.54
  63.240.155.81
+63.240.240.74
  63.243.252.246
  63.245.178.211
  63.245.66.76
@@ -70989,6 +84019,7 @@
  63.250.47.241
  63.250.56.84
  63.250.59.50
+63.251.107.216
  63.32.134.196
  63.32.157.30
  63.32.178.253
@@ -71002,7 +84033,109 @@
  63.32.65.43
  63.33.204.91
  63.41.9.210
+63.46.157.165
  63.80.184.72
+63.81.82.100
+63.81.82.101
+63.81.82.102
+63.81.82.103
+63.81.82.104
+63.81.82.105
+63.81.82.106
+63.81.82.107
+63.81.82.123
+63.81.82.134
+63.81.82.14
+63.81.82.151
+63.81.82.152
+63.81.82.153
+63.81.82.154
+63.81.82.155
+63.81.82.156
+63.81.82.157
+63.81.82.158
+63.81.82.159
+63.81.82.16
+63.81.82.160
+63.81.82.161
+63.81.82.162
+63.81.82.163
+63.81.82.164
+63.81.82.165
+63.81.82.167
+63.81.82.168
+63.81.82.169
+63.81.82.17
+63.81.82.170
+63.81.82.171
+63.81.82.172
+63.81.82.173
+63.81.82.174
+63.81.82.175
+63.81.82.176
+63.81.82.177
+63.81.82.178
+63.81.82.179
+63.81.82.18
+63.81.82.180
+63.81.82.181
+63.81.82.19
+63.81.82.21
+63.81.82.22
+63.81.82.23
+63.81.82.24
+63.81.82.25
+63.81.82.26
+63.81.82.27
+63.81.82.34
+63.81.82.35
+63.81.82.38
+63.81.82.4
+63.81.82.40
+63.81.82.41
+63.81.82.42
+63.81.82.43
+63.81.82.44
+63.81.82.45
+63.81.82.46
+63.81.82.48
+63.81.82.49
+63.81.82.5
+63.81.82.50
+63.81.82.51
+63.81.82.52
+63.81.82.53
+63.81.82.54
+63.81.82.55
+63.81.82.56
+63.81.82.57
+63.81.82.58
+63.81.82.59
+63.81.82.6
+63.81.82.67
+63.81.82.77
+63.81.82.78
+63.81.82.79
+63.81.82.80
+63.81.82.81
+63.81.82.82
+63.81.82.83
+63.81.82.84
+63.81.82.85
+63.81.82.86
+63.81.82.87
+63.81.82.88
+63.81.82.89
+63.81.82.90
+63.81.82.92
+63.81.82.93
+63.81.82.94
+63.81.82.95
+63.81.82.96
+63.81.82.97
+63.81.82.98
+63.81.82.99
+63.81.84.13
  630068-dot-n-e-w-me-ss-age-po-rt-al.wl.r.appspot.com
  630124578416503-dot-wah-cgo-lsb.appspot.com
  6306481-0.alojamiento-web.es
@@ -71036,12 +84169,17 @@
  64.1.16.10
  64.110.24.162
  64.111.116.116
+64.111.126.80
  64.111.99.8
  64.113.18.98
  64.113.32.29
  64.118.84.7
+64.119.195.128
+64.119.197.115
+64.119.197.139
  64.120.239.130
  64.120.51.146
+64.124.100.52
  64.128.143.65
  64.128.143.70
  64.13.225.150
@@ -71060,6 +84198,8 @@
  64.137.242.231
  64.137.243.127
  64.137.245.114
+64.137.62.86
+64.137.95.190
  64.139.79.35
  64.140.150.169
  64.140.169.42
@@ -71081,6 +84221,7 @@
  64.15.159.171
  64.15.159.42
  64.150.176.19
+64.150.180.245
  64.156.14.238
  64.16.209.152
  64.16.209.177
@@ -71093,6 +84234,8 @@
  64.182.235.13
  64.183.185.42
  64.183.73.122
+64.184.225.62
+64.184.226.6
  64.185.14.18
  64.187.169.230
  64.187.175.226
@@ -71103,9 +84246,12 @@
  64.188.30.226
  64.188.44.114
  64.189.249.37
+64.190.95.59
+64.196.130.188
  64.20.36.237
  64.20.49.154
  64.20.52.116
+64.20.53.82
  64.201.134.235
  64.202.102.218
  64.202.161.41
@@ -71116,58 +84262,86 @@
  64.202.188.205
  64.202.189.14
  64.202.189.187
+64.203.237.30
  64.207.144.30
  64.207.152.81
  64.207.182.168
  64.207.184.67
  64.207.187.164
+64.213.148.44
  64.213.148.88
  64.22.106.154
  64.22.67.37
  64.225.0.238
+64.225.101.204
+64.225.101.61
  64.225.105.132
+64.225.109.0
  64.225.109.187
+64.225.109.91
+64.225.11.97
  64.225.111.173
  64.225.111.176
  64.225.111.179
  64.225.112.216
-64.225.113.246
  64.225.115.33
  64.225.117.206
  64.225.119.100
+64.225.119.164
  64.225.121.105
+64.225.124.42
+64.225.125.7
+64.225.126.11
+64.225.14.15
  64.225.15.202
  64.225.18.167
  64.225.19.231
+64.225.20.153
  64.225.20.26
+64.225.22.115
  64.225.25.111
+64.225.25.130
  64.225.25.59
-64.225.30.161
+64.225.26.246
+64.225.3.204
  64.225.30.67
+64.225.36.142
+64.225.39.69
+64.225.44.22
  64.225.45.81
  64.225.47.15
+64.225.48.183
  64.225.51.115
  64.225.52.66
+64.225.53.232
  64.225.56.47
  64.225.58.183
  64.225.58.70
  64.225.59.27
  64.225.6.139
  64.225.60.95
+64.225.64.215
+64.225.68.194
+64.225.70.10
  64.225.71.231
  64.225.74.251
  64.225.74.47
+64.225.75.212
  64.225.78.96
  64.225.8.50
  64.225.8.93
  64.227.1.162
  64.227.1.209
  64.227.10.111
+64.227.10.134
  64.227.10.163
  64.227.10.167
  64.227.100.165
  64.227.100.204
+64.227.101.139
+64.227.104.19
  64.227.107.151
+64.227.109.20
  64.227.111.127
  64.227.113.76
  64.227.115.46
@@ -71175,6 +84349,7 @@
  64.227.12.136
  64.227.124.181
  64.227.124.81
+64.227.13.158
  64.227.13.20
  64.227.15.172
  64.227.2.136
@@ -71188,14 +84363,24 @@
  64.227.31.182
  64.227.31.81
  64.227.32.97
+64.227.33.176
  64.227.35.148
+64.227.37.126
+64.227.44.80
  64.227.46.1
  64.227.50.225
  64.227.57.139
+64.227.58.145
+64.227.67.106
  64.227.71.34
+64.227.72.109
  64.227.77.253
  64.227.8.206
+64.227.81.135
+64.227.84.163
+64.227.89.96
  64.227.97.247
+64.227.97.78
  64.231.23.193
  64.232.166.231
  64.233.128.23
@@ -71208,18 +84393,22 @@
  64.233.202.252
  64.233.202.253
  64.234.246.3
+64.234.44.147
  64.235.204.98
  64.235.211.78
  64.235.243.55
+64.235.38.88
  64.237.49.68
  64.239.69.157
  64.244.93.96
  64.25.215.250
  64.250.112.70
+64.252.87.18
  64.27.10.80
  64.29.146.185
  64.31.10.194
  64.32.137.180
+64.32.22.184
  64.33.121.107
  64.33.68.176
  64.34.111.74
@@ -71248,11 +84437,14 @@
  64.44.40.66
  64.46.109.242
  64.46.4.160
+64.46.54.220
  64.46.6.37
  64.50.161.60
  64.52.84.166
+64.52.85.184
  64.52.85.67
  64.53.14.211
+64.59.71.141
  64.59.72.248
  64.59.96.71
  64.59.96.83
@@ -71268,6 +84460,10 @@
  64.62.245.51
  64.62.251.26
  64.62.252.163
+64.64.239.39
+64.68.115.87
+64.68.224.190
+64.68.224.2
  64.69.57.110
  64.69.57.119
  64.69.57.127
@@ -71446,6 +84642,7 @@
  64.91.64.242
  64.91.68.149
  64.92.112.118
+64.92.55.174
  64.94.211.11
  64.95.102.36
  64.95.98.10
@@ -71560,7 +84757,10 @@
  65.131.88.203
  65.131.89.143
  65.131.95.134
+65.151.177.93
+65.151.188.94
  65.151.189.73
+65.156.48.146
  65.17.190.193
  65.171.1.175
  65.172.242.149
@@ -71573,6 +84773,7 @@
  65.18.192.91
  65.181.123.254
  65.181.124.236
+65.181.72.30
  65.181.90.133
  65.182.101.96
  65.182.110.102
@@ -71582,11 +84783,16 @@
  65.189.210.125
  65.19.167.131
  65.19.167.132
+65.190.129.124
  65.191.76.227
  65.196.87.161
  65.207.23.201
  65.21.1.190
+65.21.3.101
+65.21.3.222
  65.21.5.184
+65.21.7.187
+65.21.7.4
  65.210.27.132
  65.222.143.112
  65.23.154.17
@@ -71601,6 +84807,8 @@
  65.27.134.105
  65.27.179.78
  65.30.124.236
+65.31.127.80
+65.32.102.65
  65.32.168.171
  65.34.50.151
  65.35.61.255
@@ -71613,28 +84821,38 @@
  65.41.191.64
  65.41.75.21
  65.43.215.203
+65.49.132.179
  65.49.14.72
+65.49.196.138
+65.49.198.145
  65.49.20.66
  65.49.201.168
+65.49.204.184
  65.49.210.231
  65.49.218.81
  65.49.221.49
  65.49.222.222
  65.49.227.228
  65.49.71.68
+65.50.209.87
  65.52.123.63
+65.52.162.250
  65.52.165.138
  65.52.32.40
  65.52.39.6
  65.52.67.14
  65.60.11.122
  65.60.144.25
+65.60.148.14
  65.60.229.182
+65.60.44.2
  65.60.53.122
  65.61.221.151
  65.64.8.59
+65.68.190.190
  65.75.128.151
  65.78.4.234
+65.78.98.124
  65.79.201.78
  65.79.201.79
  65.79.205.104
@@ -71645,6 +84863,7 @@
  65.96.153.214
  65.96.186.179
  65.96.222.54
+65.97.252.131
  65.99.201.38
  65.99.242.18
  650flwersinsta.000webhostapp.com
@@ -71686,6 +84905,7 @@
  66.11.125.94
  66.11.230.202
  66.11.240.250
+66.11.32.201
  66.110.255.228
  66.111.39.40
  66.111.41.200
@@ -71696,6 +84916,8 @@
  66.112.110.225
  66.112.20.142
  66.112.212.51
+66.112.218.245
+66.113.221.43
  66.114.33.90
  66.115.146.165
  66.115.173.18
@@ -71707,6 +84929,7 @@
  66.118.142.60
  66.118.164.146
  66.128.32.230
+66.128.34.136
  66.132.216.24
  66.135.227.178
  66.135.227.181
@@ -71725,6 +84948,7 @@
  66.151.242.154
  66.154.105.122
  66.154.105.123
+66.154.107.47
  66.154.112.136
  66.154.125.164
  66.160.128.215
@@ -71734,8 +84958,11 @@
  66.165.225.130
  66.165.95.169
  66.168.40.18
+66.168.69.47
+66.172.109.43
  66.172.110.160
  66.172.8.101
+66.172.98.132
  66.173.15.222
  66.175.122.228
  66.175.208.248
@@ -71751,10 +84978,14 @@
  66.18.172.21
  66.18.4.147
  66.18.66.193
+66.181.190.176
  66.181.45.69
  66.181.94.150
  66.183.0.205
+66.183.185.14
+66.183.185.19
  66.186.10.67
+66.189.180.162
  66.189.47.126
  66.191.121.190
  66.192.70.36
@@ -71803,6 +85034,7 @@
  66.220.247.9
  66.222.252.124
  66.225.232.53
+66.226.1.216
  66.226.77.13
  66.227.142.13
  66.228.132.9
@@ -71830,10 +85062,12 @@
  66.234.211.82
  66.235.169.51
  66.235.172.12
+66.235.173.17
  66.235.43.51
  66.238.70.101
  66.240.183.76
  66.240.192.138
+66.240.219.146
  66.240.231.154
  66.240.236.119
  66.240.237.155
@@ -71927,7 +85161,9 @@
  66.36.242.84
  66.36.40.210
  66.37.110.238
+66.38.38.127
  66.40.25.236
+66.41.19.106
  66.41.244.120
  66.42.103.223
  66.42.105.213
@@ -71967,7 +85203,9 @@
  66.57.6.23
  66.61.94.36
  66.63.165.7
+66.68.187.140
  66.68.85.16
+66.69.127.115
  66.69.180.5
  66.69.20.214
  66.69.200.130
@@ -71978,6 +85216,7 @@
  66.7.210.235
  66.7.217.100
  66.70.130.241
+66.70.142.214
  66.70.142.231
  66.70.151.200
  66.70.157.67
@@ -72037,14 +85276,20 @@
  66.90.118.42
  66.90.255.99
  66.91.238.2
+66.91.53.245
  66.96.193.206
  66.96.199.249
  66.96.220.5
  66.96.232.138
+66.96.246.194
  66.98.114.221
+66.98.115.108
  66.98.117.24
+66.98.118.13
  66.98.121.192
  66.98.126.203
+66.98.45.242
+66.98.69.52
  660729052432344-dot-wetransfer-auth-file-343.appspot.com
  6619300803.jclecardinal.com
  662387792398832972.z6.web.core.windows.net
@@ -72113,9 +85358,9 @@
  67.159.3.18
  67.161.14.41
  67.161.93.197
+67.162.140.70
  67.163.129.15
  67.163.135.106
-67.163.37.233
  67.164.15.15
  67.166.219.168
  67.167.104.190
@@ -72126,11 +85371,13 @@
  67.170.250.203
  67.170.72.219
  67.171.183.11
+67.172.145.70
  67.173.5.122
  67.174.205.218
  67.175.223.186
  67.176.235.114
  67.180.251.161
+67.180.97.39
  67.185.19.126
  67.186.197.78
  67.186.247.178
@@ -72156,6 +85403,7 @@
  67.197.155.219
  67.197.156.76
  67.197.157.169
+67.197.185.134
  67.197.205.70
  67.197.239.14
  67.197.29.233
@@ -72191,6 +85439,9 @@
  67.205.133.212
  67.205.134.170
  67.205.137.177
+67.205.138.198
+67.205.138.247
+67.205.138.7
  67.205.139.170
  67.205.140.101
  67.205.140.87
@@ -72209,20 +85460,29 @@
  67.205.157.2
  67.205.158.248
  67.205.160.105
+67.205.161.100
+67.205.161.52
  67.205.161.59
  67.205.161.8
  67.205.162.26
  67.205.164.236
  67.205.165.17
+67.205.165.197
  67.205.169.60
  67.205.170.120
  67.205.170.88
  67.205.171.155
  67.205.171.161
+67.205.172.105
+67.205.174.60
  67.205.176.238
+67.205.176.90
+67.205.178.62
  67.205.178.8
  67.205.179.170
  67.205.181.229
+67.205.181.52
+67.205.182.253
  67.205.183.125
  67.205.184.79
  67.205.186.76
@@ -72233,7 +85493,12 @@
  67.205.190.21
  67.205.190.4
  67.205.191.127
+67.205.31.50
+67.205.38.108
+67.205.39.172
+67.205.40.201
  67.205.57.71
+67.205.58.218
  67.205.85.243
  67.206.200.42
  67.206.220.213
@@ -72241,24 +85506,29 @@
  67.207.157.225
  67.207.207.142
  67.207.82.122
-67.207.84.158
+67.207.82.163
  67.207.84.53
  67.207.85.223
  67.207.86.153
+67.207.86.191
  67.207.87.105
  67.207.88.180
  67.207.88.69
+67.207.89.15
  67.207.89.9
  67.207.90.150
+67.207.91.111
  67.207.91.121
  67.207.91.29
  67.207.92.19
  67.207.92.34
  67.207.93.119
  67.207.93.228
+67.207.94.180
  67.208.195.20
  67.209.176.31
  67.209.185.210
+67.209.185.37
  67.209.189.242
  67.209.190.12
  67.21.145.203
@@ -72268,7 +85538,9 @@
  67.211.141.118
  67.211.155.250
  67.211.155.95
+67.211.208.83
  67.211.218.74
+67.211.219.146
  67.211.221.57
  67.212.186.138
  67.212.186.194
@@ -72276,9 +85548,13 @@
  67.213.201.172
  67.213.212.11
  67.213.212.12
+67.213.74.78
+67.213.75.205
+67.213.82.137
  67.213.87.161
  67.213.87.21
  67.214.167.194
+67.215.218.62
  67.215.224.101
  67.215.248.8
  67.215.4.73
@@ -72288,10 +85564,12 @@
  67.216.192.11
  67.216.200.240
  67.216.204.183
+67.216.209.28
  67.216.216.103
  67.216.218.208
  67.216.220.27
  67.216.221.59
+67.216.223.29
  67.218.131.214
  67.218.133.193
  67.218.133.237
@@ -72316,13 +85594,18 @@
  67.222.109.40
  67.222.131.151
  67.222.16.112
+67.222.96.146
  67.225.130.109
  67.225.139.208
+67.225.142.105
  67.225.147.71
  67.225.178.114
  67.225.179.64
+67.225.188.53
  67.225.196.53
+67.225.241.126
  67.225.244.34
+67.225.31.100
  67.227.134.140
  67.227.167.130
  67.227.193.174
@@ -72381,7 +85664,9 @@
  67.229.48.243
  67.229.48.247
  67.229.97.227
+67.23.112.234
  67.23.244.96
+67.230.173.18
  67.230.190.2
  67.230.191.205
  67.231.16.205
@@ -72531,6 +85816,7 @@
  67.234.179.57
  67.234.18.85
  67.234.180.169
+67.234.181.205
  67.234.182.146
  67.234.183.138
  67.234.183.193
@@ -72542,6 +85828,7 @@
  67.234.184.66
  67.234.185.126
  67.234.185.45
+67.234.186.126
  67.234.186.168
  67.234.186.200
  67.234.186.210
@@ -72625,6 +85912,7 @@
  67.235.200.226
  67.235.201.64
  67.235.204.200
+67.235.206.115
  67.235.206.144
  67.235.209.93
  67.235.213.139
@@ -72780,6 +86068,7 @@
  67.4.104.202
  67.4.11.165
  67.4.11.203
+67.4.12.70
  67.4.13.164
  67.4.16.24
  67.4.169.128
@@ -72810,6 +86099,7 @@
  67.4.50.182
  67.4.50.217
  67.4.50.25
+67.4.50.64
  67.4.51.114
  67.4.51.189
  67.4.51.35
@@ -72817,6 +86107,7 @@
  67.4.53.181
  67.4.54.9
  67.4.55.183
+67.4.56.53
  67.4.57.141
  67.4.58.11
  67.4.58.144
@@ -72882,12 +86173,14 @@
  67.5.40.218
  67.5.5.8
  67.5.6.252
+67.5.7.148
  67.5.9.74
  67.52.127.114
  67.52.228.149
  67.53.72.130
  67.55.101.68
  67.55.115.100
+67.55.38.219
  67.55.90.132
  67.58.209.132
  67.59.151.227
@@ -72925,6 +86218,7 @@
  67.6.73.241
  67.6.75.30
  67.6.76.12
+67.6.83.13
  67.6.87.74
  67.6.89.94
  67.6.90.40
@@ -72937,6 +86231,7 @@
  67.69.76.102
  67.69.76.167
  67.69.76.196
+67.69.76.40
  67.7.1.175
  67.7.10.136
  67.7.102.182
@@ -73006,6 +86301,7 @@
  67.70.146.48
  67.70.18.29
  67.71.223.61
+67.73.243.82
  67.75.2.39
  67.76.104.123
  67.76.105.230
@@ -73014,6 +86310,8 @@
  67.77.0.156
  67.77.221.240
  67.78.143.182
+67.78.156.22
+67.79.105.174
  67.79.44.82
  67.80.164.152
  67.83.49.234
@@ -73067,8 +86365,13 @@
  68.119.215.85
  68.12.98.161
  68.129.153.254
+68.13.6.64
+68.130.210.247
+68.130.210.249
+68.130.211.29
  68.131.72.9
  68.132.136.198
+68.132.245.84
  68.132.64.146
  68.133.75.203
  68.134.140.25
@@ -73080,13 +86383,18 @@
  68.146.113.243
  68.146.99.241
  68.147.228.113
+68.148.133.128
+68.149.107.15
  68.15.151.20
  68.15.4.29
  68.150.197.122
  68.150.221.91
  68.166.0.184
+68.167.179.186
  68.168.115.243
  68.168.142.29
+68.168.142.91
+68.168.176.24
  68.168.209.8
  68.168.213.251
  68.168.213.252
@@ -73144,12 +86452,17 @@
  68.180.230.98
  68.180.231.26
  68.180.231.47
+68.182.39.188
  68.183.102.214
+68.183.108.46
  68.183.109.234
  68.183.110.244
+68.183.110.49
  68.183.112.185
+68.183.115.108
  68.183.117.96
  68.183.119.69
+68.183.12.127
  68.183.12.80
  68.183.120.172
  68.183.120.233
@@ -73161,26 +86474,37 @@
  68.183.131.166
  68.183.132.72
  68.183.133.112
+68.183.134.15
  68.183.134.38
+68.183.135.222
+68.183.137.83
+68.183.139.91
  68.183.140.19
-68.183.142.172
  68.183.143.192
  68.183.144.104
  68.183.145.59
  68.183.146.178
  68.183.147.213
  68.183.148.159
+68.183.148.64
  68.183.153.52
  68.183.156.109
  68.183.158.1
  68.183.159.1
+68.183.169.251
  68.183.170.114
  68.183.176.117
+68.183.177.229
  68.183.177.78
+68.183.178.162
+68.183.178.26
+68.183.179.181
  68.183.179.184
  68.183.179.79
  68.183.18.169
+68.183.18.19
  68.183.18.233
+68.183.181.7
  68.183.182.100
  68.183.184.174
  68.183.186.142
@@ -73189,11 +86513,16 @@
  68.183.186.29
  68.183.186.65
  68.183.188.105
+68.183.188.159
  68.183.188.82
+68.183.189.30
+68.183.19.26
  68.183.190.199
  68.183.190.43
+68.183.191.39
  68.183.192.217
  68.183.192.26
+68.183.199.170
  68.183.203.140
  68.183.203.160
  68.183.207.62
@@ -73209,16 +86538,23 @@
  68.183.219.115
  68.183.219.135
  68.183.22.152
+68.183.22.30
+68.183.22.85
+68.183.221.115
  68.183.221.156
+68.183.224.7
  68.183.227.87
+68.183.229.95
  68.183.23.190
  68.183.231.225
  68.183.232.63
+68.183.234.169
  68.183.234.51
  68.183.235.104
  68.183.235.141
  68.183.235.199
  68.183.235.253
+68.183.236.92
  68.183.237.129
  68.183.237.8
  68.183.240.19
@@ -73226,7 +86562,10 @@
  68.183.28.137
  68.183.29.78
  68.183.30.64
+68.183.31.114
  68.183.35.255
+68.183.36.245
+68.183.38.145
  68.183.48.80
  68.183.50.27
  68.183.52.2
@@ -73237,19 +86576,27 @@
  68.183.57.194
  68.183.58.220
  68.183.65.67
+68.183.66.107
+68.183.66.233
  68.183.67.64
  68.183.68.148
  68.183.69.83
+68.183.70.124
+68.183.71.48
  68.183.72.134
  68.183.75.251
  68.183.75.56
  68.183.77.225
  68.183.78.119
  68.183.79.175
+68.183.82.97
  68.183.86.159
  68.183.86.86
+68.183.88.186
  68.183.89.147
  68.183.90.215
+68.183.92.52
+68.183.94.63
  68.184.192.42
  68.185.36.187
  68.186.33.98
@@ -73259,14 +86606,23 @@
  68.188.63.149
  68.189.184.40
  68.189.220.112
+68.190.120.101
+68.190.212.219
+68.191.108.124
+68.191.31.22
+68.192.74.5
  68.193.247.240
  68.194.85.201
+68.197.33.124
  68.199.157.183
  68.199.159.147
  68.199.40.52
  68.2.104.20
  68.200.165.128
  68.201.129.219
+68.202.138.246
+68.204.78.210
+68.206.123.53
  68.206.25.169
  68.222.218.18
  68.224.249.74
@@ -73274,30 +86630,40 @@
  68.226.217.54
  68.226.233.50
  68.228.184.215
+68.229.125.163
+68.229.210.138
  68.231.37.181
  68.231.7.169
  68.232.120.29
  68.233.22.64
  68.233.33.2
+68.235.229.112
  68.236.156.170
  68.253.255.10
  68.255.156.146
  68.32.243.30
  68.33.13.101
  68.36.139.253
+68.36.56.114
+68.37.91.129
  68.38.190.34
  68.39.235.42
+68.4.2.64
  68.4.215.225
  68.4.6.49
  68.40.11.207
  68.41.134.30
  68.41.31.115
+68.42.204.116
  68.43.185.239
  68.44.137.144
+68.46.125.83
  68.46.38.171
  68.47.41.211
  68.48.131.251
+68.48.240.245
  68.49.83.73
+68.5.173.208
  68.5.37.81
  68.50.46.131
  68.53.195.9
@@ -73405,6 +86771,7 @@
  69.10.62.78
  69.10.63.246
  69.119.193.9
+69.119.85.43
  69.12.28.148
  69.12.66.200
  69.12.66.212
@@ -73417,30 +86784,41 @@
  69.12.75.6
  69.12.80.84
  69.12.84.122
+69.12.85.218
+69.12.85.238
  69.12.88.100
  69.12.88.102
  69.12.88.72
  69.12.90.242
+69.122.208.77
  69.123.129.183
  69.124.231.110
  69.127.214.47
+69.128.154.134
  69.128.36.109
  69.13.196.47
  69.13.39.34
  69.13.39.39
  69.13.39.40
  69.130.201.27
+69.131.26.233
+69.131.5.148
  69.137.140.197
  69.137.195.210
  69.138.189.201
+69.138.220.213
  69.139.69.253
  69.14.145.75
  69.14.157.165
  69.14.208.221
+69.14.29.8
  69.140.70.37
  69.140.80.30
  69.141.15.174
  69.143.214.211
+69.144.99.178
+69.145.177.112
+69.148.169.102
  69.15.68.38
  69.150.120.253
  69.157.161.243
@@ -73453,6 +86831,7 @@
  69.162.111.67
  69.162.69.205
  69.162.79.242
+69.162.94.166
  69.162.99.158
  69.163.160.10
  69.163.160.130
@@ -73539,6 +86918,9 @@
  69.163.169.133
  69.163.178.140
  69.163.179.6
+69.163.186.91
+69.163.234.137
+69.163.239.171
  69.163.248.109
  69.163.33.84
  69.163.35.211
@@ -73550,9 +86932,13 @@
  69.164.201.75
  69.164.202.31
  69.164.205.136
+69.164.207.140
  69.164.212.86
+69.165.166.122
  69.167.13.148
+69.167.136.34
  69.167.151.209
+69.169.5.87
  69.170.216.69
  69.170.74.138
  69.171.117.203
@@ -73564,6 +86950,7 @@
  69.171.17.46
  69.171.209.128
  69.171.209.60
+69.171.232.145
  69.171.66.223
  69.171.71.21
  69.171.72.101
@@ -73572,6 +86959,7 @@
  69.171.78.120
  69.171.78.223
  69.172.165.196
+69.172.87.212
  69.174.245.163
  69.174.70.180
  69.175.109.74
@@ -73581,9 +86969,10 @@
  69.175.44.42
  69.175.49.230
  69.175.83.34
+69.176.44.192
  69.176.89.147
  69.176.89.197
-69.176.90.7
+69.176.89.78
  69.178.49.209
  69.179.0.113
  69.179.1.144
@@ -73605,6 +86994,8 @@
  69.179.96.163
  69.180.214.81
  69.183.32.121
+69.194.15.75
+69.194.8.237
  69.195.129.70
  69.196.158.227
  69.196.165.170
@@ -73627,6 +87018,7 @@
  69.197.189.44
  69.197.189.51
  69.197.32.119
+69.197.76.86
  69.199.44.59
  69.2.244.202
  69.20.164.217
@@ -73638,6 +87030,7 @@
  69.20.94.76
  69.202.156.199
  69.203.64.83
+69.206.138.154
  69.209.23.72
  69.21.245.58
  69.210.185.1
@@ -73650,10 +87043,15 @@
  69.23.123.146
  69.237.82.158
  69.245.212.169
+69.245.45.54
+69.245.71.26
  69.246.26.72
  69.248.146.7
  69.249.137.104
  69.25.236.60
+69.250.156.161
+69.250.225.35
+69.253.71.17
  69.254.146.8
  69.29.152.138
  69.29.153.121
@@ -73711,7 +87109,6 @@
  69.30.218.202
  69.30.221.242
  69.30.221.250
-69.30.225.114
  69.30.233.236
  69.30.234.186
  69.30.234.2
@@ -73745,9 +87142,11 @@
  69.4.94.142
  69.41.0.45
  69.43.168.202
+69.47.161.218
  69.47.172.7
  69.49.88.46
  69.50.181.85
+69.51.16.248
  69.51.24.27
  69.51.24.28
  69.54.29.193
@@ -73755,6 +87154,7 @@
  69.55.234.74
  69.55.35.193
  69.55.54.65
+69.55.55.155
  69.55.55.188
  69.55.62.9
  69.57.164.32
@@ -73785,6 +87185,7 @@
  69.64.51.250
  69.64.51.41
  69.64.57.208
+69.64.62.4
  69.64.67.68
  69.65.3.168
  69.65.65.178
@@ -73793,6 +87194,7 @@
  69.69.179.130
  69.69.185.159
  69.69.213.3
+69.70.75.46
  69.72.169.233
  69.72.194.58
  69.72.202.238
@@ -73800,9 +87202,11 @@
  69.73.133.224
  69.73.144.112
  69.73.28.41
+69.75.133.122
  69.75.227.186
  69.76.240.206
  69.8.175.201
+69.80.255.144
  69.84.240.11
  69.85.223.162
  69.85.70.37
@@ -73818,6 +87222,107 @@
  69.94.114.50
  69.94.12.235
  69.94.125.100
+69.94.144.226
+69.94.147.10
+69.94.147.100
+69.94.147.101
+69.94.147.11
+69.94.147.110
+69.94.147.111
+69.94.147.112
+69.94.147.113
+69.94.147.114
+69.94.147.12
+69.94.147.126
+69.94.147.127
+69.94.147.128
+69.94.147.13
+69.94.147.130
+69.94.147.131
+69.94.147.132
+69.94.147.133
+69.94.147.135
+69.94.147.136
+69.94.147.137
+69.94.147.14
+69.94.147.148
+69.94.147.15
+69.94.147.150
+69.94.147.151
+69.94.147.152
+69.94.147.153
+69.94.147.154
+69.94.147.156
+69.94.147.157
+69.94.147.158
+69.94.147.16
+69.94.147.168
+69.94.147.169
+69.94.147.171
+69.94.147.172
+69.94.147.173
+69.94.147.182
+69.94.147.183
+69.94.147.185
+69.94.147.186
+69.94.147.187
+69.94.147.188
+69.94.147.189
+69.94.147.190
+69.94.147.191
+69.94.147.192
+69.94.147.193
+69.94.147.26
+69.94.147.27
+69.94.147.28
+69.94.147.30
+69.94.147.31
+69.94.147.32
+69.94.147.33
+69.94.147.34
+69.94.147.35
+69.94.147.36
+69.94.147.46
+69.94.147.47
+69.94.147.48
+69.94.147.49
+69.94.147.5
+69.94.147.50
+69.94.147.6
+69.94.147.61
+69.94.147.62
+69.94.147.63
+69.94.147.64
+69.94.147.66
+69.94.147.67
+69.94.147.7
+69.94.147.70
+69.94.147.71
+69.94.147.73
+69.94.147.74
+69.94.147.75
+69.94.147.76
+69.94.147.77
+69.94.147.78
+69.94.147.79
+69.94.147.80
+69.94.147.9
+69.94.147.91
+69.94.147.92
+69.94.147.94
+69.94.147.95
+69.94.147.96
+69.94.147.97
+69.94.147.98
+69.94.147.99
+69.94.152.157
+69.94.152.158
+69.94.152.159
+69.94.152.161
+69.94.152.162
+69.94.152.163
+69.94.152.164
+69.94.152.165
  69.94.27.169
  69348.psdzy.com
  693bst.com
@@ -73908,11 +87413,13 @@
  70.113.86.177
  70.114.59.237
  70.115.61.60
+70.117.63.118
  70.117.70.82
  70.120.24.242
  70.121.135.248
  70.121.172.89
  70.121.219.224
+70.121.79.245
  70.123.116.221
  70.123.125.237
  70.124.137.99
@@ -73922,10 +87429,17 @@
  70.131.38.109
  70.134.63.129
  70.15.194.32
+70.15.242.21
  70.16.157.162
  70.164.0.233
  70.165.64.33
  70.165.65.233
+70.166.167.33
+70.166.167.47
+70.166.167.48
+70.166.167.50
+70.166.167.59
+70.166.167.60
  70.166.204.38
  70.168.249.154
  70.168.249.162
@@ -73942,6 +87456,7 @@
  70.173.56.6
  70.177.74.63
  70.178.134.52
+70.182.149.123
  70.183.15.51
  70.183.211.3
  70.183.53.16
@@ -73952,9 +87467,11 @@
  70.185.56.136
  70.19.77.94
  70.190.171.72
+70.191.128.190
  70.191.39.150
  70.225.137.126
  70.226.119.80
+70.231.71.166
  70.232.179.26
  70.233.173.241
  70.233.181.12
@@ -73981,9 +87498,12 @@
  70.35.98.12
  70.36.100.156
  70.36.101.145
+70.37.107.20
  70.37.50.171
  70.37.66.168
+70.37.75.157
  70.39.150.82
+70.40.118.169
  70.40.210.173
  70.40.213.248
  70.42.131.170
@@ -73992,6 +87512,7 @@
  70.45.30.28
  70.48.238.90
  70.50.151.36
+70.51.18.238
  70.52.3.230
  70.53.175.250
  70.53.185.165
@@ -74033,6 +87554,7 @@
  70.57.99.122
  70.58.196.153
  70.58.196.199
+70.58.199.87
  70.58.200.14
  70.58.203.135
  70.58.204.112
@@ -74051,15 +87573,20 @@
  70.59.5.207
  70.60.132.34
  70.60.238.62
+70.61.141.138
  70.61.166.78
+70.62.168.178
+70.62.82.158
  70.63.170.86
  70.64.48.41
  70.65.175.221
  70.66.139.68
  70.66.176.153
+70.67.15.93
  70.68.135.187
  70.70.194.3
  70.70.50.160
+70.71.226.63
  70.71.236.58
  70.73.151.8
  70.80.14.169
@@ -74082,6 +87609,7 @@
  70.89.104.61
  70.90.21.193
  70.91.125.129
+70.91.139.42
  70.91.244.209
  70.91.247.169
  70.91.56.201
@@ -74159,6 +87687,7 @@
  71.105.116.2
  71.105.155.204
  71.105.44.45
+71.11.197.112
  71.112.212.196
  71.12.234.138
  71.120.6.42
@@ -74170,11 +87699,12 @@
  71.13.92.62
  71.136.142.246
  71.136.240.167
+71.142.245.248
  71.146.114.111
  71.161.90.231
  71.163.243.192
  71.168.214.49
-71.172.200.153
+71.172.202.127
  71.173.141.58
  71.174.105.126
  71.174.144.26
@@ -74186,9 +87716,11 @@
  71.183.251.75
  71.185.203.81
  71.185.31.91
+71.186.165.41
  71.187.229.73
  71.189.180.111
  71.189.24.112
+71.189.47.10
  71.19.144.106
  71.19.144.148
  71.19.144.89
@@ -74199,9 +87731,13 @@
  71.190.219.156
  71.191.207.62
  71.191.75.67
+71.193.164.3
  71.194.108.170
+71.194.70.248
  71.197.211.156
  71.198.208.72
+71.199.148.184
+71.199.27.120
  71.2.120.138
  71.2.121.178
  71.2.127.59
@@ -74219,6 +87755,7 @@
  71.2.83.201
  71.200.70.202
  71.200.89.21
+71.203.23.147
  71.204.154.208
  71.205.226.44
  71.208.0.104
@@ -74427,6 +87964,7 @@
  71.209.28.168
  71.209.28.172
  71.209.30.90
+71.209.33.111
  71.209.36.209
  71.209.39.27
  71.209.4.152
@@ -74639,6 +88177,7 @@
  71.210.37.93
  71.210.38.131
  71.210.41.204
+71.210.41.215
  71.210.42.253
  71.210.43.140
  71.210.43.89
@@ -74651,6 +88190,7 @@
  71.210.46.15
  71.210.49.168
  71.210.49.203
+71.210.50.167
  71.210.50.222
  71.210.50.7
  71.210.51.171
@@ -74658,7 +88198,10 @@
  71.210.54.153
  71.210.56.178
  71.210.57.210
+71.210.57.236
+71.210.59.176
  71.210.62.169
+71.210.63.221
  71.210.63.68
  71.210.67.230
  71.210.67.7
@@ -74868,6 +88411,7 @@
  71.213.225.23
  71.213.225.71
  71.213.226.108
+71.213.226.33
  71.213.228.188
  71.213.228.232
  71.213.228.87
@@ -74940,6 +88484,7 @@
  71.213.68.247
  71.213.70.121
  71.213.72.59
+71.213.74.13
  71.213.75.176
  71.213.76.70
  71.213.77.30
@@ -75140,6 +88685,7 @@
  71.214.71.99
  71.214.75.204
  71.214.76.117
+71.214.76.170
  71.214.77.169
  71.214.78.63
  71.214.8.131
@@ -75147,6 +88693,7 @@
  71.214.81.54
  71.214.81.72
  71.214.82.65
+71.214.84.123
  71.214.84.141
  71.214.85.215
  71.214.85.45
@@ -75191,6 +88738,7 @@
  71.215.144.244
  71.215.145.104
  71.215.145.70
+71.215.146.156
  71.215.146.68
  71.215.147.135
  71.215.147.191
@@ -75326,6 +88874,7 @@
  71.215.71.56
  71.215.72.166
  71.215.74.20
+71.215.76.92
  71.215.77.64
  71.215.78.234
  71.215.78.49
@@ -75374,6 +88923,7 @@
  71.217.118.174
  71.217.118.47
  71.217.119.51
+71.217.12.54
  71.217.121.163
  71.217.121.235
  71.217.122.195
@@ -75609,6 +89159,7 @@
  71.219.140.96
  71.219.142.200
  71.219.142.239
+71.219.142.35
  71.219.142.5
  71.219.144.180
  71.219.149.70
@@ -75654,6 +89205,7 @@
  71.219.182.211
  71.219.182.60
  71.219.182.7
+71.219.183.112
  71.219.183.151
  71.219.184.91
  71.219.186.82
@@ -76031,6 +89583,7 @@
  71.221.174.146
  71.221.174.49
  71.221.175.54
+71.221.176.115
  71.221.177.164
  71.221.178.210
  71.221.179.191
@@ -76040,6 +89593,7 @@
  71.221.180.7
  71.221.181.179
  71.221.184.97
+71.221.185.176
  71.221.186.129
  71.221.186.164
  71.221.186.175
@@ -76343,6 +89897,7 @@
  71.223.94.156
  71.223.98.49
  71.227.242.72
+71.229.145.95
  71.231.145.228
  71.232.26.19
  71.235.124.243
@@ -76433,6 +89988,7 @@
  71.33.152.47
  71.33.210.81
  71.33.232.126
+71.34.114.53
  71.34.114.92
  71.34.115.10
  71.34.116.18
@@ -76667,6 +90223,8 @@
  71.42.187.121
  71.43.112.11
  71.43.118.162
+71.43.53.70
+71.47.8.120
  71.48.32.213
  71.48.33.100
  71.48.39.156
@@ -76722,6 +90280,7 @@
  71.50.221.197
  71.50.221.58
  71.50.221.82
+71.50.23.58
  71.50.24.188
  71.50.25.67
  71.50.26.231
@@ -76862,6 +90421,7 @@
  71.57.241.246
  71.59.28.167
  71.6.135.131
+71.6.146.130
  71.6.146.185
  71.6.146.186
  71.6.158.166
@@ -76869,24 +90429,34 @@
  71.6.167.142
  71.6.167.197
  71.6.199.23
+71.6.232.5
  71.60.192.20
  71.62.129.30
  71.63.10.44
  71.63.116.146
+71.70.83.192
  71.72.140.136
  71.72.196.159
+71.73.5.169
  71.74.184.137
+71.78.103.126
  71.78.158.190
  71.79.11.136
  71.80.74.41
+71.81.178.244
  71.85.183.137
  71.85.218.231
  71.86.81.122
+71.87.161.184
  71.88.207.47
  71.89.209.212
+71.9.225.162
+71.90.165.156
  71.92.202.13
  71.93.148.59
  71.93.27.91
+71.94.198.62
+71.94.222.146
  7108329659.com
  710a6ba4667144d5a4e35f4764a5f51a.svc.dynamics.com
  710exoticcannabis.com
@@ -76901,6 +90471,7 @@
  71zhuan.com
  72.10.32.139
  72.10.75.10
+72.11.135.222
  72.11.140.74
  72.11.145.8
  72.11.148.154
@@ -76909,8 +90480,11 @@
  72.128.6.3
  72.133.177.119
  72.134.81.111
+72.135.209.214
  72.135.224.85
  72.135.232.168
+72.135.35.139
+72.136.98.149
  72.139.68.174
  72.14.164.83
  72.14.179.215
@@ -76919,10 +90493,12 @@
  72.14.186.84
  72.14.190.72
  72.14.191.154
+72.143.15.82
  72.15.247.113
  72.160.1.219
  72.160.105.254
  72.160.106.173
+72.160.107.52
  72.160.110.235
  72.160.111.223
  72.160.111.89
@@ -76946,6 +90522,7 @@
  72.160.165.221
  72.160.165.84
  72.160.167.109
+72.160.167.189
  72.160.167.211
  72.160.17.254
  72.160.17.46
@@ -76992,18 +90569,27 @@
  72.167.161.46
  72.167.164.44
  72.167.164.72
+72.167.190.167
+72.167.190.208
  72.167.190.213
  72.167.190.231
+72.167.190.29
  72.167.190.6
  72.167.222.102
+72.167.224.135
  72.167.232.164
  72.167.35.118
  72.167.96.176
  72.169.65.177
  72.169.66.157
  72.17.22.30
+72.173.49.153
+72.174.128.211
  72.174.254.198
+72.176.162.102
  72.18.130.41
+72.18.200.133
+72.181.50.229
  72.182.43.135
  72.183.63.214
  72.185.0.168
@@ -77014,9 +90600,13 @@
  72.19.37.189
  72.191.113.27
  72.192.162.178
+72.193.250.108
+72.193.56.242
  72.194.159.49
  72.194.243.15
+72.195.114.165
  72.195.114.169
+72.195.114.171
  72.195.114.184
  72.195.34.41
  72.195.34.42
@@ -77031,16 +90621,62 @@
  72.208.58.240
  72.208.58.48
  72.210.252.134
+72.210.252.135
  72.210.252.143
+72.210.252.144
+72.210.252.145
+72.210.252.148
+72.210.252.150
  72.210.252.152
+72.210.252.154
+72.210.252.155
  72.212.63.101
+72.212.63.102
+72.212.63.120
  72.213.167.55
  72.214.69.226
+72.217.158.194
+72.217.158.199
+72.217.158.203
+72.217.158.204
+72.217.158.206
+72.217.158.210
+72.217.158.212
+72.217.158.214
+72.217.158.215
+72.217.158.218
+72.217.158.219
  72.218.206.7
  72.22.247.189
  72.221.164.34
  72.221.164.35
+72.221.164.36
+72.221.164.37
+72.221.164.38
+72.221.164.44
+72.221.164.45
+72.221.164.46
+72.221.164.47
+72.221.164.48
+72.221.164.57
+72.221.164.60
+72.221.172.205
+72.221.196.134
+72.221.196.135
+72.221.196.150
+72.221.196.151
+72.221.196.152
+72.221.232.136
+72.221.232.137
+72.221.232.139
+72.221.232.141
+72.221.232.142
+72.221.232.143
+72.221.232.146
+72.221.232.147
  72.222.130.133
+72.223.168.80
+72.223.168.81
  72.223.35.109
  72.224.193.17
  72.225.198.139
@@ -77055,6 +90691,8 @@
  72.233.127.179
  72.233.36.138
  72.234.182.39
+72.234.189.228
+72.235.210.174
  72.237.117.105
  72.237.117.106
  72.237.117.107
@@ -77069,11 +90707,14 @@
  72.238.18.57
  72.238.229.21
  72.239.229.208
+72.24.107.47
  72.24.196.138
  72.24.91.196
  72.240.123.84
  72.240.125.133
  72.240.126.32
+72.241.169.53
+72.241.94.221
  72.243.138.146
  72.249.108.180
  72.249.108.220
@@ -77090,6 +90731,11 @@
  72.252.4.181
  72.252.4.194
  72.252.4.57
+72.255.201.110
+72.255.36.235
+72.255.5.180
+72.255.61.54
+72.27.128.225
  72.28.240.148
  72.29.55.174
  72.29.64.13
@@ -77107,23 +90753,30 @@
  72.32.69.162
  72.34.235.197
  72.34.43.74
+72.34.44.11
  72.36.18.29
  72.37.199.41
+72.38.244.198
+72.42.162.79
  72.43.207.8
+72.43.215.122
  72.43.232.254
  72.45.49.211
  72.46.135.146
  72.46.157.102
  72.47.248.48
+72.47.30.70
  72.48.32.248
  72.49.49.11
  72.50.240.124
  72.51.34.249
  72.51.6.183
+72.52.131.41
  72.52.150.147
  72.52.150.93
  72.52.169.207
  72.52.184.212
+72.52.216.50
  72.52.231.202
  72.52.251.129
  72.52.255.82
@@ -77133,9 +90786,11 @@
  72.65.246.83
  72.65.246.84
  72.65.62.50
+72.68.122.216
  72.68.165.91
  72.68.29.212
  72.68.47.222
+72.69.217.132
  72.69.68.140
  72.69.99.47
  72.71.251.161
@@ -77144,6 +90799,7 @@
  72.74.34.120
  72.76.221.220
  72.76.243.86
+72.77.31.187
  72.78.189.30
  72.78.238.89
  72.79.54.220
@@ -77194,6 +90850,7 @@
  73.0.216.24
  73.10.75.50
  73.103.18.182
+73.107.29.176
  73.107.36.77
  73.108.241.200
  73.11.153.150
@@ -77202,28 +90859,36 @@
  73.112.123.203
  73.112.84.96
  73.113.120.123
+73.113.8.68
+73.115.74.176
  73.116.193.136
  73.117.1.162
  73.119.190.120
  73.119.255.56
  73.119.50.38
  73.12.38.29
+73.123.70.198
  73.124.60.178
  73.128.186.71
  73.128.250.176
+73.13.104.201
  73.131.166.70
  73.131.78.250
  73.138.75.151
+73.139.233.118
  73.140.142.112
  73.146.64.229
  73.148.23.198
  73.15.70.67
+73.150.145.210
+73.154.18.212
  73.157.231.125
  73.158.127.66
  73.162.121.160
  73.162.222.154
  73.162.253.94
  73.162.55.16
+73.164.13.142
  73.165.187.57
  73.167.2.179
  73.168.170.206
@@ -77231,18 +90896,26 @@
  73.170.66.172
  73.172.24.224
  73.175.16.198
+73.177.64.108
+73.179.71.241
  73.181.212.48
  73.184.146.247
+73.184.220.254
  73.185.1.77
  73.185.17.0
  73.187.102.50
  73.189.163.2
  73.189.164.139
+73.189.21.200
  73.189.248.47
  73.19.95.114
+73.192.213.22
  73.194.109.249
  73.194.127.131
+73.194.215.65
  73.196.205.64
+73.199.65.2
+73.2.193.197
  73.200.123.136
  73.201.111.171
  73.202.118.127
@@ -77260,13 +90933,16 @@
  73.213.160.205
  73.213.26.179
  73.217.79.105
+73.22.212.109
  73.221.249.191
  73.222.94.184
  73.225.8.164
  73.226.220.90
  73.229.153.51
  73.230.167.70
+73.233.235.179
  73.235.226.74
+73.238.205.184
  73.239.107.7
  73.239.11.159
  73.239.197.175
@@ -77274,13 +90950,18 @@
  73.243.176.4
  73.243.243.50
  73.245.35.46
+73.246.103.38
  73.247.135.221
  73.248.234.184
  73.251.84.166
+73.254.197.157
  73.255.236.146
+73.26.138.42
  73.3.250.179
  73.31.210.37
  73.32.108.199
+73.34.222.4
+73.34.63.79
  73.35.60.4
  73.37.123.160
  73.38.213.196
@@ -77303,21 +90984,31 @@
  73.60.227.128
  73.61.161.136
  73.61.6.1
+73.62.252.237
  73.63.14.98
+73.66.228.172
  73.67.133.25
  73.7.135.222
+73.70.45.206
  73.73.137.44
  73.73.230.131
+73.74.53.250
  73.75.107.58
  73.75.199.44
+73.75.219.82
  73.78.105.172
+73.79.253.167
+73.8.149.46
  73.8.77.18
  73.83.103.79
  73.83.150.162
  73.84.152.17
  73.84.156.242
  73.85.21.193
+73.86.202.56
  73.88.233.108
+73.89.158.207
+73.89.52.125
  73.90.205.30
  73.93.252.130
  73.93.56.34
@@ -77346,6 +91037,7 @@
  73buortfa73.bankofamericaslpemr.com
  73f14401f26d7196511c39f2a9a36a0a.accesscam.org
  73idhw.kyu.gh.iaczeg6124.ga
+74.101.108.64
  74.101.225.121
  74.102.39.43
  74.105.127.227
@@ -77358,16 +91050,27 @@
  74.115.50.111
  74.116.59.195
  74.116.59.8
+74.117.157.163
  74.117.183.84
  74.117.61.66
  74.118.137.119
  74.118.138.25
  74.118.156.131
  74.118.192.251
+74.120.14.37
+74.120.14.38
+74.120.14.39
+74.120.14.40
+74.120.14.53
+74.120.14.54
+74.120.14.55
+74.120.170.183
  74.120.172.232
  74.120.173.145
+74.120.174.17
  74.120.175.142
  74.120.55.163
+74.121.149.7
  74.121.149.84
  74.121.151.158
  74.121.151.210
@@ -77377,7 +91080,10 @@
  74.124.198.60
  74.124.214.119
  74.124.219.29
+74.125.212.194
+74.125.212.198
  74.128.121.17
+74.128.93.202
  74.130.83.133
  74.132.146.137
  74.132.148.190
@@ -77386,12 +91092,14 @@
  74.133.89.164
  74.135.120.91
  74.137.220.142
+74.138.144.149
  74.15.64.117
  74.192.32.213
  74.194.28.185
  74.195.162.252
  74.196.137.29
  74.196.219.52
+74.197.178.144
  74.199.111.243
  74.199.84.77
  74.200.208.146
@@ -77431,6 +91139,7 @@
  74.208.229.51
  74.208.45.104
  74.208.66.20
+74.208.67.20
  74.208.73.49
  74.208.75.201
  74.208.80.107
@@ -77470,6 +91179,7 @@
  74.4.248.59
  74.4.255.96
  74.4.51.150
+74.40.1.122
  74.40.205.197
  74.5.133.139
  74.5.134.29
@@ -77510,19 +91220,23 @@
  74.62.215.218
  74.63.199.120
  74.63.199.3
+74.63.209.34
  74.63.220.148
  74.63.221.49
  74.67.240.204
  74.7.84.106
  74.70.21.65
  74.71.15.170
+74.72.4.203
  74.73.158.25
  74.75.117.254
  74.77.90.160
  74.78.144.106
  74.78.203.230
  74.78.31.240
+74.80.13.162
  74.81.68.114
+74.81.88.114
  74.81.88.26
  74.81.88.42
  74.81.88.66
@@ -77571,13 +91285,17 @@
  75.101.224.25
  75.102.27.237
  75.102.39.180
+75.103.66.9
+75.107.188.146
  75.109.111.18
  75.11.8.111
  75.111.125.131
  75.112.160.49
  75.112.74.197
  75.113.193.72
+75.113.213.108
  75.114.235.105
+75.118.149.42
  75.118.158.194
  75.118.181.246
  75.118.243.0
@@ -77675,6 +91393,7 @@
  75.119.207.125
  75.119.207.135
  75.119.207.145
+75.119.215.210
  75.120.1.64
  75.120.12.149
  75.120.122.89
@@ -77747,6 +91466,8 @@
  75.129.64.107
  75.13.245.193
  75.130.218.151
+75.130.225.249
+75.133.43.81
  75.134.55.44
  75.136.121.230
  75.137.46.78
@@ -77761,6 +91482,8 @@
  75.149.226.102
  75.150.192.33
  75.150.62.125
+75.151.156.33
+75.151.156.34
  75.151.213.85
  75.152.7.67
  75.154.127.9
@@ -77770,12 +91493,12 @@
  75.157.90.106
  75.158.39.231
  75.159.162.115
-75.16.168.140
  75.161.138.200
  75.161.154.179
  75.161.193.234
  75.161.201.242
  75.161.224.245
+75.161.252.253
  75.161.69.189
  75.161.76.83
  75.161.89.124
@@ -77843,6 +91566,7 @@
  75.165.128.210
  75.165.128.34
  75.165.129.41
+75.165.130.240
  75.165.131.34
  75.165.132.15
  75.165.135.215
@@ -77993,7 +91717,9 @@
  75.169.110.215
  75.169.13.18
  75.169.137.77
+75.169.158.225
  75.169.167.93
+75.169.173.38
  75.170.100.60
  75.170.101.134
  75.170.102.214
@@ -78013,6 +91739,7 @@
  75.170.119.191
  75.170.12.125
  75.170.12.130
+75.170.120.249
  75.170.121.187
  75.170.125.180
  75.170.125.253
@@ -78263,6 +91990,7 @@
  75.175.125.99
  75.175.126.213
  75.175.126.229
+75.175.126.5
  75.175.126.61
  75.175.127.25
  75.175.128.197
@@ -78322,6 +92050,7 @@
  75.175.213.91
  75.175.214.42
  75.175.214.7
+75.175.215.80
  75.175.216.192
  75.175.216.229
  75.175.217.36
@@ -78355,6 +92084,7 @@
  75.177.178.218
  75.177.207.146
  75.178.122.172
+75.179.186.33
  75.181.139.49
  75.182.136.95
  75.183.15.12
@@ -78365,6 +92095,7 @@
  75.189.232.247
  75.222.32.231
  75.250.130.109
+75.27.150.75
  75.3.206.157
  75.32.236.142
  75.4.189.222
@@ -78379,8 +92110,11 @@
  75.67.100.2
  75.67.221.247
  75.67.227.208
+75.68.178.213
  75.68.45.136
+75.70.14.231
  75.70.181.65
+75.70.89.197
  75.71.161.216
  75.71.41.239
  75.73.90.226
@@ -78501,6 +92235,8 @@
  76.103.215.236
  76.103.7.22
  76.104.80.47
+76.11.31.208
+76.112.42.33
  76.112.56.76
  76.114.45.200
  76.12.191.16
@@ -78536,7 +92272,10 @@
  76.172.36.158
  76.173.137.100
  76.173.238.49
+76.173.243.139
+76.174.123.147
  76.174.129.203
+76.175.140.120
  76.176.17.13
  76.178.135.121
  76.178.199.119
@@ -78544,6 +92283,7 @@
  76.18.1.104
  76.182.177.11
  76.183.211.188
+76.186.131.156
  76.188.24.162
  76.2.178.44
  76.2.180.214
@@ -78562,14 +92302,17 @@
  76.21.92.130
  76.211.74.84
  76.214.9.223
+76.216.16.130
  76.226.169.13
  76.226.243.142
  76.23.147.186
  76.23.24.168
  76.23.58.234
  76.230.156.129
+76.230.77.161
  76.240.162.156
  76.249.155.46
+76.25.97.246
  76.250.150.193
  76.250.234.161
  76.253.0.85
@@ -78681,6 +92424,7 @@
  76.64.171.191
  76.64.248.98
  76.65.215.21
+76.69.176.155
  76.69.29.42
  76.7.101.187
  76.7.107.181
@@ -78731,6 +92475,7 @@
  76.91.24.78
  76.91.74.2
  76.94.204.125
+76.95.50.98
  76.98.136.198
  7611shanthi.ihkaam.com
  7616867.mehregantandis.ir
@@ -78757,24 +92502,37 @@
  76srv.com
  76wzxjp.com
  77.0.220.221
+77.10.219.1
  77.10.27.239
  77.10.7.254
+77.10.98.230
  77.101.132.253
  77.105.87.97
+77.107.185.209
+77.107.28.102
+77.107.50.58
  77.107.60.227
  77.107.87.51
  77.108.219.20
  77.108.78.18
  77.108.78.20
  77.108.90.3
+77.108.97.50
  77.108.98.68
  77.109.139.87
+77.109.173.12
+77.109.177.12
  77.109.191.149
+77.11.249.23
  77.11.76.138
  77.117.250.43
+77.117.254.26
  77.119.128.158
+77.119.128.196
+77.119.129.176
  77.119.229.106
  77.12.69.249
+77.120.103.130
  77.120.113.64
  77.120.113.69
  77.120.116.85
@@ -78800,18 +92558,28 @@
  77.127.114.192
  77.127.56.251
  77.127.75.163
+77.128.70.50
+77.13.28.7
+77.130.135.14
  77.131.79.51
  77.134.172.81
+77.137.126.9
+77.137.2.51
  77.138.170.206
  77.140.201.98
+77.140.225.184
  77.156.242.132
+77.158.71.118
+77.159.149.71
  77.160.194.161
  77.161.42.100
  77.162.104.62
  77.163.105.152
  77.163.123.22
  77.163.136.136
+77.163.43.122
  77.164.241.157
+77.164.248.2
  77.165.178.216
  77.166.83.167
  77.167.245.239
@@ -78822,7 +92590,11 @@
  77.171.227.94
  77.174.237.229
  77.175.30.187
+77.179.37.175
+77.180.58.9
+77.181.97.153
  77.182.51.46
+77.183.191.151
  77.183.219.152
  77.185.252.76
  77.185.64.244
@@ -78831,24 +92603,37 @@
  77.190.158.99
  77.190.181.109
  77.191.164.197
+77.191.218.97
+77.195.143.45
+77.199.87.64
  77.2.120.56
  77.2.5.194
+77.20.146.247
  77.20.171.14
  77.20.246.114
+77.203.110.43
+77.205.183.17
+77.205.239.9
  77.21.95.28
  77.211.170.149
  77.211.170.214
  77.22.153.198
  77.22.22.189
  77.220.185.190
+77.220.64.140
+77.220.64.37
+77.220.64.39
+77.220.64.40
  77.221.130.11
  77.221.130.15
  77.221.130.17
  77.221.130.19
  77.221.130.24
  77.221.130.44
+77.221.145.84
  77.221.151.178
  77.221.220.133
+77.221.39.102
  77.221.52.77
  77.222.113.248
  77.222.115.97
@@ -78863,7 +92648,11 @@
  77.222.40.63
  77.222.60.220
  77.222.61.212
+77.223.98.107
+77.228.192.191
+77.229.201.125
  77.232.134.106
+77.232.163.5
  77.232.167.200
  77.232.186.2
  77.232.51.158
@@ -78874,6 +92663,7 @@
  77.234.41.22
  77.234.89.132
  77.235.161.242
+77.235.8.83
  77.236.189.18
  77.236.192.200
  77.236.196.27
@@ -78886,6 +92676,7 @@
  77.239.15.201
  77.240.230.231
  77.241.20.215
+77.241.7.132
  77.242.107.2
  77.242.16.26
  77.242.219.206
@@ -78903,7 +92694,9 @@
  77.243.191.40
  77.243.191.44
  77.243.191.45
+77.243.218.63
  77.243.51.53
+77.244.180.205
  77.244.211.39
  77.244.26.125
  77.244.42.178
@@ -78922,8 +92715,10 @@
  77.247.181.162
  77.247.181.163
  77.247.181.165
+77.247.186.10
  77.247.250.70
  77.247.251.17
+77.247.94.131
  77.248.178.74
  77.248.247.219
  77.250.107.12
@@ -78932,11 +92727,15 @@
  77.250.60.51
  77.250.67.102
  77.251.235.248
+77.254.212.134
  77.27.123.197
+77.28.105.144
  77.28.255.80
  77.28.96.196
  77.28.96.206
  77.3.194.113
+77.3.56.13
+77.3.9.5
  77.31.161.222
  77.34.164.221
  77.34.186.191
@@ -78944,6 +92743,7 @@
  77.37.138.239
  77.37.152.104
  77.37.156.166
+77.37.162.17
  77.37.164.74
  77.37.174.219
  77.37.206.52
@@ -78955,7 +92755,11 @@
  77.38.42.145
  77.39.11.78
  77.39.117.115
+77.39.8.64
  77.4.22.166
+77.40.103.21
+77.40.103.52
+77.40.123.115
  77.40.160.37
  77.40.160.38
  77.40.160.39
@@ -78971,13 +92775,19 @@
  77.40.160.51
  77.40.160.52
  77.40.178.236
+77.40.2.46
+77.40.3.151
+77.40.3.160
+77.40.61.133
  77.40.62.239
  77.43.1.226
  77.43.65.44
  77.46.138.1
  77.46.138.33
  77.46.138.37
+77.46.248.248
  77.47.90.172
+77.48.13.19
  77.48.137.3
  77.48.137.65
  77.48.187.2
@@ -78985,6 +92795,7 @@
  77.51.128.127
  77.51.189.219
  77.52.178.235
+77.52.211.148
  77.53.228.168
  77.53.246.179
  77.53.53.196
@@ -79001,17 +92812,21 @@
  77.58.58.11
  77.64.162.103
  77.64.234.44
+77.65.37.78
  77.65.65.90
  77.66.1.97
  77.66.214.80
  77.67.55.219
  77.68.114.124
  77.68.115.33
+77.68.30.105
  77.68.62.77
  77.68.82.58
  77.68.86.20
  77.68.9.178
  77.68.9.94
+77.69.170.133
+77.69.208.217
  77.69.23.183
  77.7.54.32
  77.70.16.245
@@ -79029,6 +92844,7 @@
  77.73.70.28
  77.73.91.146
  77.74.78.80
+77.75.125.44
  77.75.161.167
  77.75.76.160
  77.75.76.161
@@ -79090,6 +92906,7 @@
  77.8.100.145
  77.8.202.135
  77.8.214.250
+77.8.3.98
  77.81.100.88
  77.81.139.35
  77.81.139.36
@@ -79102,6 +92919,7 @@
  77.81.139.44
  77.81.139.46
  77.81.142.101
+77.81.191.198
  77.81.247.72
  77.81.7.90
  77.82.173.141
@@ -79116,9 +92934,11 @@
  77.85.203.98
  77.85.204.149
  77.85.238.130
+77.87.14.63
  77.87.196.119
  77.87.246.100
  77.87.75.12
+77.88.192.94
  77.88.47.14
  77.88.47.37
  77.88.47.55
@@ -79128,6 +92948,9 @@
  77.89.246.62
  77.89.248.157
  77.89.251.138
+77.89.252.65
+77.89.253.158
+77.89.254.23
  77.9.124.198
  77.90.136.129
  77.91.201.31
@@ -79135,12 +92958,15 @@
  77.91.82.105
  77.92.132.179
  77.92.144.239
+77.92.52.16
  77.92.53.7
  77.92.83.100
+77.93.126.12
  77.93.208.64
  77.93.223.9
  77.93.235.34
  77.93.248.67
+77.93.251.188
  77.93.254.106
  77.93.255.91
  77.93.42.134
@@ -79189,6 +93015,8 @@
  77options.com
  77rv.net
  77st.net
+78.0.112.231
+78.101.73.255
  78.102.136.61
  78.106.209.103
  78.107.240.57
@@ -79211,18 +93039,21 @@
  78.110.50.121
  78.110.50.127
  78.111.105.171
+78.111.119.123
  78.111.120.110
  78.111.250.174
  78.111.250.49
+78.111.251.20
  78.111.97.179
  78.111.99.178
+78.117.21.233
  78.119.180.62
-78.128.113.162
-78.128.113.222
-78.128.113.42
+78.123.219.248
+78.128.113.0
  78.128.113.66
  78.128.113.67
  78.128.113.68
+78.128.113.69
  78.128.114.111
  78.128.124.9
  78.129.143.154
@@ -79238,6 +93069,7 @@
  78.130.170.66
  78.131.115.73
  78.131.52.120
+78.131.56.112
  78.131.58.83
  78.132.226.165
  78.132.23.118
@@ -79256,13 +93088,17 @@
  78.138.157.26
  78.138.187.231
  78.138.88.236
+78.139.17.130
+78.139.216.117
  78.139.91.76
+78.14.28.76
  78.140.201.254
  78.140.6.68
  78.140.7.239
  78.141.123.99
  78.141.196.180
  78.141.223.107
+78.142.109.84
  78.142.114.69
  78.142.18.20
  78.142.194.29
@@ -79272,7 +93108,9 @@
  78.142.6.117
  78.143.145.1
  78.143.96.35
+78.148.229.251
  78.151.161.24
+78.153.146.222
  78.153.4.122
  78.153.50.88
  78.154.167.68
@@ -79280,6 +93118,8 @@
  78.154.180.12
  78.155.205.102
  78.155.85.67
+78.156.14.60
+78.157.210.51
  78.157.28.15
  78.157.28.26
  78.157.28.35
@@ -79294,16 +93134,22 @@
  78.159.103.53
  78.159.108.204
  78.159.113.194
+78.159.62.90
+78.159.97.29
  78.159.97.56
  78.159.99.85
+78.161.115.242
  78.161.131.121
-78.162.130.110
+78.163.172.59
+78.164.225.8
  78.164.67.9
  78.165.84.158
  78.166.101.188
  78.167.141.123
  78.167.141.4
  78.167.141.52
+78.167.188.9
+78.17.164.171
  78.171.16.229
  78.171.20.4
  78.173.11.230
@@ -79318,7 +93164,9 @@
  78.173.252.226
  78.173.48.221
  78.173.66.18
+78.173.84.115
  78.173.89.211
+78.173.9.172
  78.175.144.33
  78.175.240.146
  78.175.243.49
@@ -79329,26 +93177,31 @@
  78.180.155.1
  78.180.157.169
  78.181.103.113
+78.182.152.239
  78.182.254.231
  78.186.109.7
  78.186.111.109
  78.186.112.235
+78.186.210.48
  78.186.216.101
  78.186.216.216
  78.186.236.10
  78.186.238.58
  78.186.67.212
  78.187.100.171
+78.187.133.26
  78.187.137.194
  78.187.156.31
  78.187.220.150
  78.187.240.125
+78.187.40.35
  78.187.42.96
  78.187.59.175
  78.188.168.64
  78.188.188.141
  78.188.222.90
  78.188.225.105
+78.188.33.152
  78.188.4.124
  78.188.61.165
  78.188.64.92
@@ -79358,26 +93211,40 @@
  78.189.148.42
  78.189.174.117
  78.189.190.196
+78.189.235.4
+78.189.26.51
  78.189.60.109
  78.189.64.42
+78.189.90.149
  78.19.161.8
+78.190.161.112
+78.190.167.251
  78.191.246.237
  78.192.18.48
  78.193.74.165
+78.197.28.46
  78.199.108.157
  78.20.135.129
  78.20.236.28
  78.20.94.222
+78.202.190.240
  78.204.123.164
+78.205.222.137
  78.206.229.130
+78.209.6.45
+78.21.135.248
  78.217.36.106
+78.22.52.122
+78.223.115.69
  78.23.204.168
  78.23.46.93
+78.231.235.92
  78.232.152.36
  78.237.118.103
  78.24.101.86
  78.24.111.198
  78.24.219.147
+78.243.183.184
  78.249.119.122
  78.25.112.42
  78.25.120.105
@@ -79391,19 +93258,24 @@
  78.29.42.10
  78.30.227.222
  78.30.37.249
+78.31.66.62
+78.31.93.49
  78.32.159.52
  78.35.120.245
  78.35.250.110
  78.35.251.85
+78.36.152.186
  78.36.16.214
  78.36.197.146
  78.37.27.139
+78.37.69.21
  78.37.99.51
  78.38.122.1
  78.38.122.249
  78.38.123.110
  78.38.150.103
  78.38.189.249
+78.40.107.64
  78.40.180.217
  78.40.217.86
  78.40.244.243
@@ -79431,6 +93303,7 @@
  78.46.200.216
  78.46.206.77
  78.46.208.107
+78.46.213.158
  78.46.218.20
  78.46.22.102
  78.46.253.40
@@ -79452,6 +93325,7 @@
  78.46.95.150
  78.46.99.198
  78.47.110.223
+78.47.139.43
  78.47.142.206
  78.47.146.79
  78.47.147.223
@@ -79462,11 +93336,14 @@
  78.47.41.177
  78.47.50.83
  78.47.61.83
+78.47.74.206
  78.47.87.196
  78.47.90.84
+78.49.112.191
  78.54.1.56
  78.54.189.255
  78.54.51.24
+78.55.205.76
  78.56.201.4
  78.57.227.227
  78.6.228.32
@@ -79481,6 +93358,7 @@
  78.63.73.155
  78.68.172.124
  78.72.228.239
+78.73.134.37
  78.8.111.87
  78.8.118.115
  78.8.126.198
@@ -79492,6 +93370,7 @@
  78.8.188.250
  78.8.188.97
  78.8.189.1
+78.8.189.103
  78.8.189.115
  78.8.189.147
  78.8.189.156
@@ -79500,6 +93379,7 @@
  78.80.179.178
  78.81.245.153
  78.83.103.4
+78.83.194.186
  78.83.199.235
  78.83.242.229
  78.83.53.171
@@ -79508,6 +93388,7 @@
  78.84.174.53
  78.84.22.156
  78.85.210.13
+78.87.187.69
  78.88.229.104
  78.9.110.94
  78.9.96.142
@@ -79517,9 +93398,13 @@
  78.90.78.210
  78.90.91.220
  78.92.1.28
+78.92.225.232
  78.92.254.169
  78.92.254.9
  78.92.40.9
+78.94.118.210
+78.94.124.10
+78.94.221.189
  78.94.240.180
  78.94.31.171
  78.99.119.64
@@ -79531,7 +93416,6 @@
  782345698752364.site
  7826872563875.online
  783918679436576-dot-hvd-skf-wcf.appspot.com
-7847spaosuuesjq.tk
  7848014fd2ae86ccbdf2c43a84325aa9-dot-dbenitonline.ey.r.appspot.com
  785165189864359-dot-uel-geq-ndk.appspot.com
  7854781-dot-n-e-w-me-ss-age-po-rt-al.wl.r.appspot.com
@@ -79549,7 +93433,11 @@
  78mcp.com
  78ug45egfdy089l095d.top
  79.10.148.140
+79.10.15.101
  79.10.159.73
+79.10.198.229
+79.10.250.204
+79.10.82.174
  79.100.198.122
  79.100.49.51
  79.100.49.79
@@ -79564,6 +93452,7 @@
  79.104.0.82
  79.104.25.218
  79.104.55.134
+79.105.116.207
  79.106.14.13
  79.106.15.98
  79.106.156.181
@@ -79587,6 +93476,7 @@
  79.106.35.62
  79.106.35.82
  79.106.45.125
+79.106.45.206
  79.106.66.25
  79.108.206.93
  79.108.207.194
@@ -79614,11 +93504,16 @@
  79.110.52.243
  79.111.13.155
  79.114.75.198
+79.115.208.217
  79.115.245.227
+79.115.47.249
+79.115.74.146
  79.116.28.250
  79.117.130.214
  79.117.93.38
  79.118.179.194
+79.120.11.154
+79.120.118.82
  79.120.177.106
  79.120.54.174
  79.120.70.47
@@ -79628,11 +93523,13 @@
  79.122.8.208
  79.123.136.96
  79.124.23.9
+79.124.60.179
  79.124.62.10
  79.124.62.250
  79.124.62.26
  79.124.7.253
  79.124.78.143
+79.124.78.233
  79.124.78.43
  79.124.8.24
  79.124.8.8
@@ -79645,8 +93542,11 @@
  79.127.57.43
  79.129.117.118
  79.129.135.116
+79.129.29.237
+79.129.59.118
  79.129.6.235
  79.130.130.240
+79.130.202.26
  79.130.206.78
  79.132.116.124
  79.132.118.133
@@ -79658,16 +93558,19 @@
  79.132.205.34
  79.133.200.146
  79.133.228.55
+79.133.4.71
  79.133.6.236
  79.134.173.69
  79.134.7.134
  79.134.79.252
+79.135.45.158
  79.135.73.141
  79.136.1.41
  79.136.1.46
  79.136.30.33
  79.136.31.253
  79.136.64.176
+79.136.70.159
  79.136.8.214
  79.137.109.83
  79.137.112.61
@@ -79677,14 +93580,17 @@
  79.137.254.51
  79.137.28.159
  79.137.34.248
+79.137.36.108
  79.137.42.124
  79.137.68.161
  79.137.69.162
  79.137.70.55
+79.137.73.76
+79.137.74.57
+79.137.77.131
  79.137.77.213
  79.137.83.50
  79.137.86.157
-79.138.11.247
  79.139.57.55
  79.14.154.4
  79.140.167.238
@@ -79705,6 +93611,7 @@
  79.143.188.7
  79.143.225.152
  79.143.37.84
+79.143.85.228
  79.143.87.166
  79.143.87.218
  79.143.87.227
@@ -79722,8 +93629,10 @@
  79.150.214.31
  79.150.39.20
  79.154.14.4
+79.154.147.222
  79.155.8.95
  79.156.226.121
+79.157.178.210
  79.158.182.231
  79.158.61.202
  79.159.138.37
@@ -79733,17 +93642,24 @@
  79.164.171.32
  79.164.176.68
  79.165.225.234
+79.166.203.224
+79.168.204.180
  79.168.231.184
  79.169.137.95
  79.169.184.113
+79.169.5.17
  79.17.97.167
+79.170.40.166
  79.170.40.168
+79.170.44.116
  79.171.13.166
  79.171.13.182
  79.172.193.32
  79.172.201.60
+79.172.86.139
  79.173.115.196
  79.173.124.177
+79.174.187.54
  79.174.24.137
  79.174.24.172
  79.174.72.78
@@ -79754,6 +93670,7 @@
  79.177.26.177
  79.178.211.152
  79.178.38.54
+79.179.122.203
  79.180.195.205
  79.181.20.138
  79.181.83.16
@@ -79761,19 +93678,23 @@
  79.184.114.136
  79.184.174.202
  79.184.43.149
+79.187.129.5
  79.188.138.170
  79.188.20.242
  79.188.246.2
  79.188.40.187
  79.19.237.79
+79.19.73.54
  79.190.14.42
  79.191.2.19
  79.193.120.50
  79.194.167.232
  79.194.170.86
+79.20.255.163
  79.20.54.60
  79.201.170.110
  79.201.175.119
+79.203.141.76
  79.207.17.39
  79.207.249.149
  79.21.45.9
@@ -79781,19 +93702,28 @@
  79.217.21.51
  79.220.185.61
  79.222.247.96
+79.223.12.189
  79.224.60.158
  79.225.88.178
  79.225.89.232
  79.226.156.91
+79.23.78.196
  79.233.100.114
  79.235.175.228
  79.236.188.146
  79.236.190.3
+79.24.238.169
+79.24.87.203
  79.244.122.142
  79.25.112.10
+79.253.40.185
+79.253.63.18
+79.254.8.171
  79.27.107.176
  79.27.214.141
  79.32.198.220
+79.35.122.7
+79.37.45.108
  79.41.123.117
  79.43.221.23
  79.44.219.31
@@ -79801,14 +93731,18 @@
  79.49.78.176
  79.5.1.73
  79.51.155.106
+79.52.30.6
  79.53.213.67
  79.54.115.243
  79.58.45.55
  79.59.153.241
+79.60.83.251
  79.61.191.231
  79.62.146.233
  79.62.15.239
  79.63.131.98
+79.66.225.169
+79.66.66.18
  79.67.137.168
  79.7.114.1
  79.7.158.208
@@ -79819,8 +93753,10 @@
  79.77.48.143
  79.77.7.225
  79.81.217.156
+79.82.253.50
  79.9.102.153
  79.9.171.88
+79.9.21.146
  79.9.88.185
  79.96.175.83
  79.96.218.84
@@ -79957,12 +93893,15 @@
  8.12.16.78
  8.12.161.82
  8.129.172.40
+8.129.210.222
  8.135.28.152
  8.14.146.83
  8.15.224.120
+8.208.102.227
  8.208.80.253
  8.209.71.217
  8.209.72.208
+8.209.73.223
  8.209.76.181
  8.209.78.101
  8.209.78.146
@@ -79971,6 +93910,7 @@
  8.210.101.132
  8.210.129.196
  8.210.141.183
+8.210.146.161
  8.210.148.132
  8.210.162.171
  8.210.170.138
@@ -79998,12 +93938,16 @@
  8.38.89.146
  8.38.89.152
  8.4.9.137
+8.4.9.152
+8.40.143.51
  8.81.199.35.bc.googleusercontent.com
  8.9.40.245
  8.9.6.229
  8.dojnh.com
  80-87-45.ga
  80.0.141.86
+80.0.157.243
+80.1.223.121
  80.1.31.151
  80.100.128.128
  80.100.161.227
@@ -80012,10 +93956,12 @@
  80.101.146.172
  80.101.82.203
  80.101.91.75
+80.102.214.69
  80.102.22.14
  80.102.50.2
  80.104.143.97
  80.106.228.1
+80.106.241.112
  80.106.247.145
  80.106.59.35
  80.107.117.210
@@ -80025,8 +93971,9 @@
  80.108.210.64
  80.108.82.95
  80.108.95.9
+80.108.97.2
  80.109.153.122
-80.11.253.8
+80.11.131.100
  80.110.188.114
  80.111.130.189
  80.112.127.9
@@ -80038,6 +93985,7 @@
  80.115.166.124
  80.116.185.169
  80.117.116.137
+80.12.91.114
  80.120.212.14
  80.120.248.141
  80.120.248.142
@@ -80045,14 +93993,19 @@
  80.122.229.106
  80.122.92.78
  80.123.143.202
+80.123.162.21
  80.127.116.96
  80.128.156.191
+80.129.62.174
+80.13.105.147
  80.131.64.195
  80.131.67.156
  80.132.122.83
  80.132.123.209
  80.132.189.180
  80.132.231.182
+80.133.35.19
+80.133.37.191
  80.133.46.81
  80.134.203.210
  80.135.119.188
@@ -80063,9 +94016,11 @@
  80.14.31.191
  80.14.40.242
  80.147.82.165
+80.149.158.186
  80.15.100.37
  80.15.14.46
  80.15.195.37
+80.150.254.184
  80.151.40.92
  80.152.186.194
  80.153.76.217
@@ -80075,6 +94030,7 @@
  80.169.225.123
  80.17.127.226
  80.172.255.60
+80.174.199.44
  80.174.70.189
  80.175.219.102
  80.179.149.111
@@ -80082,6 +94038,11 @@
  80.179.42.44
  80.180.30.181
  80.183.80.215
+80.187.108.104
+80.187.116.122
+80.187.121.210
+80.187.80.49
+80.188.168.178
  80.188.204.250
  80.188.239.106
  80.189.118.165
@@ -80097,12 +94058,16 @@
  80.191.169.81
  80.191.174.220
  80.194.62.218
+80.20.133.206
  80.200.58.215
  80.201.24.160
  80.201.85.82
  80.208.230.170
  80.209.229.151
  80.209.231.126
+80.209.242.26
+80.21.190.42
+80.210.32.67
  80.211.102.87
  80.211.11.250
  80.211.128.5
@@ -80141,16 +94106,22 @@
  80.211.89.87
  80.211.99.98
  80.213.212.137
+80.215.207.31
+80.216.100.169
+80.217.191.235
  80.219.173.135
+80.22.165.54
  80.221.41.1
  80.227.134.221
  80.227.174.18
  80.229.116.110
  80.229.139.205
  80.229.147.76
+80.229.157.225
  80.229.249.247
  80.229.28.60
  80.229.46.51
+80.229.46.9
  80.229.88.138
  80.231.93.159
  80.232.248.17
@@ -80188,16 +94159,21 @@
  80.241.222.138
  80.241.222.37
  80.241.243.238
+80.241.46.6
  80.241.60.207
  80.242.123.135
+80.242.194.92
  80.242.39.76
+80.242.70.223
  80.243.8.126
+80.244.179.6
  80.244.224.122
  80.244.237.21
  80.244.237.22
  80.245.106.195
  80.245.115.97
  80.246.130.97
+80.246.2.153
  80.246.31.31
  80.246.31.33
  80.246.31.38
@@ -80225,6 +94201,7 @@
  80.253.29.58
  80.253.92.137
  80.253.94.252
+80.254.102.78
  80.254.48.93
  80.255.192.237
  80.255.3.106
@@ -80251,8 +94228,10 @@
  80.31.238.123
  80.31.241.9
  80.31.49.209
+80.32.117.147
  80.32.195.155
  80.36.22.198
+80.37.181.60
  80.39.128.203
  80.42.48.41
  80.48.183.166
@@ -80275,12 +94254,14 @@
  80.60.135.139
  80.63.106.83
  80.63.106.90
+80.64.165.113
  80.64.172.68
  80.64.77.58
  80.65.23.139
  80.65.28.57
  80.65.75.244
  80.66.146.84
+80.66.150.238
  80.66.77.110
  80.66.83.45
  80.67.111.20
@@ -80342,10 +94323,12 @@
  80.71.112.98
  80.71.113.211
  80.71.117.38
+80.71.13.138
  80.72.121.179
  80.73.13.219
  80.73.84.106
  80.73.87.202
+80.73.88.240
  80.73.9.238
  80.76.236.66
  80.76.55.26
@@ -80363,6 +94346,8 @@
  80.79.116.131
  80.79.116.134
  80.79.116.140
+80.79.148.53
+80.79.158.29
  80.79.23.144
  80.79.23.7
  80.79.66.82
@@ -80375,7 +94360,9 @@
  80.80.167.246
  80.80.167.249
  80.80.171.100
+80.80.172.3
  80.80.234.140
+80.81.232.149
  80.82.147.1
  80.82.147.2
  80.82.147.4
@@ -80392,9 +94379,9 @@
  80.82.64.68
  80.82.64.70
  80.82.65.186
+80.82.65.47
  80.82.65.82
  80.82.66.176
-80.82.68.225
  80.82.69.122
  80.82.69.193
  80.82.69.209
@@ -80407,6 +94394,7 @@
  80.82.70.249
  80.82.70.33
  80.82.77.139
+80.82.77.227
  80.82.77.33
  80.82.77.66
  80.82.78.112
@@ -80422,6 +94410,7 @@
  80.85.86.53
  80.85.87.122
  80.85.87.245
+80.86.31.32
  80.86.91.232
  80.87.184.49
  80.87.185.233
@@ -80439,7 +94428,10 @@
  80.89.137.54
  80.89.150.134
  80.89.156.216
+80.90.130.9
+80.90.131.190
  80.90.228.170
+80.90.82.70
  80.90.83.163
  80.90.84.249
  80.90.86.237
@@ -80457,6 +94449,7 @@
  80.92.29.23
  80.92.84.168
  80.93.124.148
+80.93.130.50
  80.93.184.251
  80.93.213.210
  80.93.213.213
@@ -80466,10 +94459,14 @@
  80.93.41.244
  80.93.48.49
  80.94.118.192
+80.94.93.16
+80.94.93.31
+80.94.93.38
  80.95.109.6
  80.95.248.151
  80.95.82.143
  80.96.150.171
+80.96.24.136
  80.98.185.104
  8004print.com
  800emailsupport.com
@@ -80511,10 +94508,12 @@
  81.107.197.178
  81.109.105.199
  81.109.203.182
+81.109.86.251
  81.110.170.57
  81.110.182.176
  81.111.112.45
  81.111.43.114
+81.111.91.234
  81.12.119.164
  81.12.119.169
  81.12.119.172
@@ -80526,17 +94525,22 @@
  81.12.28.34
  81.12.29.164
  81.130.146.18
+81.130.234.235
  81.130.70.67
+81.131.114.5
+81.133.142.45
  81.134.179.184
  81.137.6.81
  81.138.20.196
  81.141.0.55
  81.141.23.54
  81.144.138.34
+81.145.194.114
  81.15.163.4
  81.151.52.160
  81.152.109.18
  81.154.182.21
+81.156.142.165
  81.156.188.117
  81.16.140.238
  81.16.33.31
@@ -80557,6 +94561,7 @@
  81.162.57.134
  81.163.254.104
  81.163.254.107
+81.163.28.101
  81.163.35.205
  81.163.36.139
  81.163.36.210
@@ -80564,6 +94569,8 @@
  81.163.62.221
  81.163.62.33
  81.163.80.146
+81.164.70.26
+81.165.210.66
  81.167.175.244
  81.167.49.109
  81.168.130.3
@@ -80572,13 +94579,16 @@
  81.169.138.128
  81.169.140.14
  81.169.167.146
+81.169.167.43
  81.169.174.142
  81.169.179.225
+81.169.210.71
  81.169.217.70
  81.169.245.54
  81.169.248.38
  81.17.131.251
  81.17.131.61
+81.17.16.111
  81.17.16.122
  81.17.16.122zeros6x.sh
  81.17.16.146
@@ -80615,6 +94625,7 @@
  81.176.229.202
  81.176.229.7
  81.177.135.25
+81.177.136.51
  81.177.170.90
  81.177.73.10
  81.177.73.17
@@ -80642,6 +94653,7 @@
  81.182.217.13
  81.182.22.241
  81.182.248.193
+81.182.254.124
  81.182.6.245
  81.183.136.218
  81.183.208.244
@@ -80661,6 +94673,7 @@
  81.192.188.112
  81.192.192.254
  81.192.68.126
+81.192.87.130
  81.193.206.140
  81.193.45.123
  81.196.127.37
@@ -80699,9 +94712,13 @@
  81.21.86.97
  81.211.68.14
  81.212.163.230
+81.213.183.164
+81.214.132.220
  81.214.253.80
  81.214.254.203
+81.214.39.192
  81.214.39.214
+81.214.63.228
  81.215.230.173
  81.218.127.187
  81.218.144.128
@@ -80710,6 +94727,7 @@
  81.218.195.216
  81.218.25.210
  81.219.10.62
+81.22.26.26
  81.22.46.196
  81.22.57.92
  81.22.98.49
@@ -80717,6 +94735,7 @@
  81.224.44.164
  81.226.160.5
  81.226.179.58
+81.227.114.224
  81.227.171.215
  81.229.89.161
  81.23.109.186
@@ -80732,23 +94751,32 @@
  81.24.82.69
  81.24.88.32
  81.24.90.174
+81.242.193.55
+81.242.210.95
  81.242.91.23
+81.245.173.127
+81.246.177.106
  81.246.225.203
+81.247.171.241
  81.25.120.224
  81.25.229.123
  81.25.62.84
  81.250.147.230
+81.252.170.75
  81.254.90.197
  81.255.105.165
  81.27.79.18
  81.28.164.55
  81.28.248.132
+81.29.211.35
  81.29.226.100
  81.29.245.164
  81.3.154.235
  81.3.179.83
+81.30.162.28
  81.30.164.221
  81.30.176.30
+81.30.179.11
  81.30.182.215
  81.30.203.202
  81.30.208.30
@@ -80762,217 +94790,437 @@
  81.31.250.193
  81.31.251.148
  81.32.185.185
+81.32.76.190
  81.33.19.126
  81.33.4.214
+81.34.129.27
  81.34.18.81
+81.34.32.255
  81.35.67.42
  81.36.14.52
  81.36.42.178
  81.38.6.34
  81.39.151.46
  81.39.198.220
+81.39.93.189
  81.4.102.200
  81.4.102.69
  81.4.105.175
+81.4.110.153
  81.4.110.236
+81.4.127.228
+81.4.127.34
  81.4.207.62
  81.43.169.242
+81.43.190.249
  81.43.98.133
  81.44.146.77
  81.47.134.66
  81.47.161.135
+81.49.228.39
  81.5.103.14
  81.5.112.19
  81.56.94.102
  81.57.217.41
  81.6.39.241
  81.6.43.167
+81.66.123.25
+81.66.176.120
+81.68.100.138
  81.68.101.116
  81.68.102.235
  81.68.102.238
  81.68.103.135
  81.68.104.156
+81.68.105.55
+81.68.106.155
  81.68.106.157
  81.68.107.74
+81.68.108.77
+81.68.114.6
  81.68.116.127
  81.68.120.181
+81.68.120.99
+81.68.121.82
  81.68.123.185
+81.68.123.186
+81.68.123.65
+81.68.126.101
+81.68.128.180
  81.68.128.31
+81.68.129.2
  81.68.130.11
+81.68.132.197
+81.68.133.128
  81.68.133.16
  81.68.133.181
+81.68.133.86
  81.68.135.238
+81.68.136.135
+81.68.137.90
  81.68.142.128
+81.68.143.165
+81.68.144.156
  81.68.146.126
  81.68.146.199
+81.68.147.53
  81.68.148.214
  81.68.152.105
  81.68.154.150
+81.68.155.143
  81.68.156.111
  81.68.163.114
+81.68.163.129
  81.68.165.205
  81.68.166.245
+81.68.167.79
+81.68.169.2
+81.68.172.21
  81.68.179.112
  81.68.179.203
+81.68.179.38
  81.68.180.253
+81.68.181.52
+81.68.181.60
+81.68.183.164
  81.68.183.98
  81.68.185.40
  81.68.187.195
+81.68.191.188
  81.68.191.219
  81.68.192.169
+81.68.193.31
  81.68.195.113
+81.68.197.106
+81.68.197.197
  81.68.199.77
+81.68.200.73
  81.68.202.212
+81.68.207.135
  81.68.208.67
  81.68.209.131
+81.68.211.117
  81.68.211.26
  81.68.214.53
+81.68.215.10
+81.68.215.181
+81.68.216.53
+81.68.217.130
  81.68.217.15
+81.68.219.65
  81.68.222.241
  81.68.223.45
  81.68.223.63
+81.68.223.9
+81.68.224.186
+81.68.224.236
  81.68.224.42
  81.68.224.51
+81.68.225.56
  81.68.226.158
  81.68.227.187
+81.68.227.46
  81.68.228.53
+81.68.230.252
+81.68.230.55
  81.68.231.34
  81.68.232.133
+81.68.234.113
  81.68.237.243
+81.68.238.7
  81.68.240.218
  81.68.242.191
+81.68.242.64
+81.68.243.13
  81.68.243.185
+81.68.244.19
+81.68.248.77
+81.68.250.31
+81.68.251.200
  81.68.253.104
+81.68.253.14
  81.68.253.19
+81.68.253.95
+81.68.255.153
+81.68.65.90
+81.68.66.41
+81.68.67.193
  81.68.69.68
+81.68.70.18
+81.68.72.231
+81.68.74.16
+81.68.75.34
  81.68.77.146
  81.68.77.156
  81.68.79.246
+81.68.80.98
+81.68.81.31
  81.68.82.251
+81.68.83.2
+81.68.83.82
  81.68.83.83
+81.68.85.135
  81.68.85.250
+81.68.87.47
+81.68.88.208
+81.68.88.51
+81.68.90.243
+81.68.92.188
+81.68.96.99
  81.68.97.72
  81.68.98.8
+81.68.99.93
  81.69.0.110
  81.69.10.179
+81.69.11.51
+81.69.12.243
+81.69.12.67
+81.69.15.129
+81.69.15.140
  81.69.160.121
+81.69.163.230
+81.69.170.127
+81.69.170.217
  81.69.175.143
+81.69.177.174
  81.69.18.110
  81.69.185.250
+81.69.19.167
+81.69.19.79
+81.69.197.21
+81.69.2.35
  81.69.20.76
  81.69.21.163
  81.69.218.137
+81.69.220.225
+81.69.224.195
+81.69.226.44
+81.69.228.153
+81.69.230.208
  81.69.232.120
+81.69.236.93
  81.69.242.112
+81.69.242.16
  81.69.242.220
  81.69.243.46
+81.69.245.83
+81.69.247.142
+81.69.247.221
  81.69.248.123
+81.69.248.159
  81.69.248.82
+81.69.249.10
  81.69.249.56
+81.69.25.239
  81.69.250.222
  81.69.250.247
+81.69.251.177
+81.69.251.46
+81.69.251.89
  81.69.252.108
  81.69.253.29
  81.69.254.251
  81.69.255.211
  81.69.26.23
+81.69.28.23
+81.69.3.109
  81.69.3.227
  81.69.30.95
+81.69.34.109
+81.69.34.152
  81.69.35.41
+81.69.36.223
  81.69.37.18
+81.69.37.85
  81.69.38.149
  81.69.38.97
+81.69.42.199
  81.69.44.148
  81.69.44.222
  81.69.47.35
  81.69.56.253
  81.69.57.115
+81.69.58.254
+81.69.58.34
+81.69.58.73
+81.69.7.105
  81.69.7.163
+81.69.8.18
+81.69.97.151
  81.7.10.238
  81.7.17.202
+81.7.7.69
  81.70.10.77
+81.70.102.35
  81.70.103.204
  81.70.105.82
+81.70.11.106
+81.70.13.198
+81.70.145.250
+81.70.146.26
+81.70.147.144
  81.70.147.94
+81.70.150.244
+81.70.152.154
  81.70.152.213
  81.70.152.225
+81.70.153.152
  81.70.153.173
  81.70.153.243
  81.70.154.62
  81.70.155.151
  81.70.155.157
+81.70.155.219
  81.70.156.134
+81.70.156.146
  81.70.156.161
  81.70.159.11
  81.70.159.196
+81.70.159.2
  81.70.159.249
  81.70.161.183
+81.70.161.216
+81.70.161.94
  81.70.161.95
+81.70.162.235
+81.70.163.83
  81.70.165.48
+81.70.166.61
+81.70.167.241
+81.70.168.63
  81.70.168.69
+81.70.169.178
  81.70.170.184
+81.70.173.185
+81.70.174.192
  81.70.176.12
+81.70.178.224
  81.70.18.171
  81.70.180.77
+81.70.181.27
  81.70.192.180
+81.70.192.31
  81.70.193.157
  81.70.193.18
+81.70.193.181
+81.70.193.192
  81.70.193.24
  81.70.193.90
  81.70.194.187
  81.70.195.174
  81.70.197.147
+81.70.197.160
  81.70.197.188
-81.70.198.206
+81.70.198.8
+81.70.199.169
  81.70.2.223
  81.70.20.28
+81.70.200.121
+81.70.200.133
  81.70.201.21
  81.70.201.53
  81.70.202.237
  81.70.203.183
  81.70.203.235
-81.70.204.105
+81.70.203.246
+81.70.204.31
+81.70.204.41
  81.70.205.107
+81.70.205.137
+81.70.21.113
  81.70.210.160
+81.70.210.219
+81.70.210.74
  81.70.211.212
+81.70.213.240
  81.70.216.217
+81.70.216.28
  81.70.218.157
+81.70.219.145
+81.70.22.137
+81.70.220.67
+81.70.221.178
+81.70.222.20
  81.70.222.231
+81.70.23.139
+81.70.231.240
+81.70.231.73
  81.70.233.94
  81.70.236.203
+81.70.248.131
+81.70.25.150
+81.70.25.19
+81.70.3.190
  81.70.31.196
+81.70.32.28
+81.70.36.8
+81.70.39.239
  81.70.4.52
+81.70.40.161
  81.70.43.103
+81.70.43.144
+81.70.43.97
+81.70.46.31
  81.70.48.45
+81.70.56.215
  81.70.62.181
+81.70.7.32
  81.70.77.89
+81.70.82.150
  81.70.86.135
+81.70.86.218
+81.70.87.214
+81.70.92.101
+81.70.96.13
  81.70.96.222
  81.70.99.146
+81.71.119.159
  81.71.119.160
  81.71.120.65
  81.71.126.121
+81.71.128.128
  81.71.128.134
+81.71.128.135
  81.71.129.100
  81.71.13.210
+81.71.130.72
  81.71.135.159
+81.71.135.16
+81.71.136.41
+81.71.138.119
  81.71.138.133
+81.71.138.241
+81.71.139.210
  81.71.140.116
+81.71.142.20
+81.71.19.202
  81.71.26.161
+81.71.28.205
+81.71.3.99
+81.71.32.176
+81.71.32.248
+81.71.35.59
+81.71.38.138
+81.71.38.43
  81.71.45.162
  81.71.64.10
+81.71.68.119
  81.71.68.54
  81.71.7.144
  81.71.7.201
+81.71.8.200
  81.71.83.218
  81.71.84.128
+81.71.85.116
  81.71.88.53
  81.82.201.5
  81.82.211.25
  81.82.228.134
  81.82.229.114
  81.82.82.45
+81.84.69.122
  81.86.25.161
+81.86.82.68
  81.88.198.162
  81.88.221.190
  81.88.222.222
@@ -81000,7 +95248,9 @@
  81.91.219.98
  81.92.202.202
  81.92.207.106
+81.92.207.78
  81.92.207.82
+81.92.207.98
  81.92.207.99
  81.93.218.200
  81.93.240.199
@@ -81047,12 +95297,16 @@
  81millstreet.nl
  81rc4uw1b4roh99dmn.cf
  82.0.232.117
+82.1.150.122
  82.1.4.99
  82.10.188.54
  82.10.220.141
+82.102.18.110
+82.102.18.235
  82.102.197.110
  82.102.21.185
  82.102.21.214
+82.102.25.147
  82.102.27.10
  82.102.27.118
  82.103.116.126
@@ -81092,6 +95346,7 @@
  82.118.242.25
  82.118.242.76
  82.124.198.234
+82.127.38.115
  82.127.74.162
  82.128.141.82bin.sh
  82.131.144.38
@@ -81120,6 +95375,7 @@
  82.144.207.116
  82.144.83.152
  82.145.210.171
+82.145.221.221
  82.145.31.212
  82.145.43.153
  82.146.38.254
@@ -81146,6 +95402,7 @@
  82.147.67.70
  82.147.80.146
  82.147.93.63
+82.148.19.98
  82.148.25.100
  82.148.25.99
  82.149.123.143
@@ -81157,20 +95414,31 @@
  82.151.120.59
  82.151.192.189
  82.151.220.89
+82.155.199.3
  82.155.28.72
+82.156.164.214
  82.156.67.62
+82.156.71.80
  82.156.72.254
+82.156.76.106
  82.156.78.69
+82.156.86.184
+82.158.34.200
  82.159.109.89
  82.16.128.254
  82.161.200.117
+82.162.104.19
  82.162.120.220
  82.165.100.150
+82.165.114.135
  82.165.117.133
  82.165.124.25
  82.165.135.211
  82.165.137.115
  82.165.140.117
+82.165.152.127
+82.165.159.13
+82.165.159.34
  82.165.18.207
  82.165.184.192
  82.165.186.165
@@ -81179,6 +95447,8 @@
  82.165.197.136
  82.165.198.170
  82.165.23.226
+82.165.249.198
+82.165.253.182
  82.165.48.140
  82.165.48.181
  82.165.73.97
@@ -81189,11 +95459,17 @@
  82.176.164.40
  82.177.176.1
  82.177.176.24
+82.177.80.88
  82.177.87.98
+82.178.0.55
+82.178.1.72
  82.178.107.145
+82.178.20.242
+82.179.122.250
  82.18.174.241
  82.181.218.229
  82.181.91.236
+82.192.42.42
  82.192.80.204
  82.192.81.160
  82.192.88.11
@@ -81216,14 +95492,22 @@
  82.196.0.25
  82.196.1.53
  82.196.11.13
+82.196.11.246
  82.196.11.77
+82.196.113.78
  82.196.12.70
+82.196.14.163
  82.196.14.6
+82.196.15.195
  82.196.15.205
  82.196.15.59
  82.196.2.49
+82.196.3.36
+82.196.5.221
  82.196.5.23
+82.196.5.251
  82.196.6.248
+82.196.9.161
  82.197.195.20
  82.197.204.14
  82.197.214.197
@@ -81233,6 +95517,7 @@
  82.200.205.30
  82.200.226.226
  82.200.55.38
+82.200.65.218
  82.200.81.3
  82.200.88.50
  82.202.162.229
@@ -81259,6 +95544,7 @@
  82.208.146.142
  82.208.149.161
  82.208.173.16
+82.208.72.210
  82.208.92.93
  82.209.118.57
  82.209.206.126
@@ -81295,6 +95581,7 @@
  82.213.78.2
  82.216.110.29
  82.217.127.4
+82.217.169.100
  82.217.194.145
  82.217.217.110
  82.22.96.157
@@ -81342,13 +95629,19 @@
  82.223.14.245
  82.223.198.224
  82.223.69.17
+82.223.77.225
  82.225.49.121
  82.228.6.131
+82.237.252.9
  82.239.200.118
+82.24.112.42
  82.24.215.11
  82.240.207.95
  82.242.45.193
+82.248.146.79
  82.25.143.213
+82.252.151.64
+82.252.156.58
  82.255.203.175
  82.28.153.95
  82.3.220.15
@@ -81360,20 +95653,26 @@
  82.39.38.172
  82.41.236.107
  82.43.201.20
+82.44.64.71
  82.45.166.85
  82.46.89.252
  82.48.39.246
  82.5.67.222
+82.52.171.170
  82.52.44.226
  82.52.45.11
  82.54.91.230
  82.58.61.142
  82.59.139.127
+82.59.69.150
  82.6.33.11
  82.60.7.40
+82.61.223.175
+82.62.153.15
  82.62.53.77
  82.64.104.190
  82.64.132.50
+82.64.150.50
  82.64.153.72
  82.64.165.77
  82.64.170.170
@@ -81382,15 +95681,30 @@
  82.64.206.205
  82.64.212.80
  82.64.220.36
+82.64.234.148
  82.64.247.247
  82.64.25.166
+82.64.25.207
+82.64.30.112
+82.64.32.76
  82.64.45.205
  82.64.49.27
  82.64.51.141
  82.64.57.228
+82.64.69.52
+82.65.108.248
+82.65.115.199
+82.65.117.46
  82.65.134.3
+82.65.166.65
+82.65.173.65
+82.65.190.68
  82.65.207.11
+82.65.210.19
+82.65.217.237
+82.65.217.242
  82.65.27.101
+82.65.27.68
  82.65.3.231
  82.65.42.106
  82.66.234.57
@@ -81404,8 +95718,10 @@
  82.73.194.143
  82.73.53.176
  82.74.87.60
+82.75.107.107
  82.76.111.249
  82.76.135.94
+82.76.153.177
  82.76.183.155
  82.77.136.160
  82.77.136.63
@@ -81419,9 +95735,9 @@
  82.80.139.92
  82.80.191.120
  82.81.102.84
-82.81.18.89
  82.81.19.42
  82.81.4.57
+82.81.46.112
  82.81.98.51
  82.94.216.148
  82.94.228.100
@@ -81468,7 +95784,10 @@
  83.1.213.1
  83.1.215.1
  83.100.193.124
+83.102.134.70
+83.102.180.27
  83.103.147.110
+83.103.150.72
  83.103.195.167
  83.103.195.183
  83.103.206.56
@@ -81481,9 +95800,12 @@
  83.11.92.216
  83.110.223.58
  83.110.225.215
+83.114.140.240
+83.12.171.68
  83.12.244.50
  83.122.73.200
  83.128.49.155
+83.13.19.85
  83.13.191.186
  83.13.235.245
  83.133.121.137
@@ -81499,6 +95821,7 @@
  83.135.197.9
  83.135.198.245
  83.135.202.74
+83.135.202.86
  83.135.203.157
  83.135.203.227
  83.135.204.106
@@ -81516,6 +95839,7 @@
  83.137.41.10
  83.137.54.101
  83.138.48.14
+83.139.112.43
  83.14.55.250
  83.14.56.203
  83.142.197.99
@@ -81533,7 +95857,7 @@
  83.147.153.226
  83.148.241.222
  83.149.126.98
-83.150.16.14
+83.15.108.140
  83.150.54.50
  83.150.63.208
  83.151.229.140
@@ -81602,21 +95926,28 @@
  83.171.99.160
  83.172.144.31
  83.172.144.67
+83.173.138.54
  83.174.218.83
  83.174.233.94
  83.175.111.138
  83.175.166.234
+83.18.149.38
  83.18.190.64
  83.19.92.133
  83.19.99.66
+83.191.163.133
  83.198.144.132
  83.2.189.66
  83.20.207.43
  83.202.231.25
  83.209.121.104
+83.209.240.11
  83.211.162.198
  83.212.102.225
  83.212.111.202
+83.212.92.120
+83.213.167.112
+83.213.244.59
  83.216.160.146
  83.216.190.83
  83.217.154.155
@@ -81626,6 +95957,7 @@
  83.219.1.201
  83.219.139.66
  83.219.149.60
+83.22.1.149
  83.220.144.22
  83.221.163.157
  83.221.175.184
@@ -81637,8 +95969,10 @@
  83.222.178.177
  83.222.5.124
  83.226.184.109
+83.226.76.197
  83.227.81.9
  83.228.102.154
+83.228.36.181
  83.228.47.75
  83.229.84.135
  83.23.172.159
@@ -81655,9 +95989,12 @@
  83.238.39.250
  83.239.138.38
  83.239.171.80
+83.239.38.2
  83.239.90.50
+83.24.104.184
  83.24.175.39
  83.24.27.184
+83.240.242.218
  83.242.96.21
  83.242.96.22
  83.243.191.199
@@ -81666,11 +96003,19 @@
  83.243.59.41
  83.244.54.230
  83.248.66.194
+83.249.239.207
  83.25.14.196
  83.25.206.136
+83.25.74.34
  83.250.140.254
  83.251.241.0
+83.252.70.43
  83.252.9.37
+83.26.98.1
+83.26.98.74
+83.27.42.13
+83.29.175.177
+83.30.8.172
  83.31.140.216
  83.32.17.151
  83.33.235.3
@@ -81679,17 +96024,24 @@
  83.35.117.8
  83.37.10.100
  83.37.158.47
+83.37.215.129
  83.37.216.102
+83.4.53.248
+83.4.8.111
+83.40.35.113
  83.43.153.207
  83.43.53.115
  83.44.130.103
  83.45.243.249
+83.45.31.197
  83.48.101.184
  83.48.97.152
+83.49.178.252
  83.51.3.206
  83.54.61.201
  83.55.0.232
  83.56.121.116
+83.59.103.13
  83.6.146.196
  83.6.159.151
  83.60.154.199
@@ -81709,6 +96061,7 @@
  83.82.161.243
  83.82.82.199
  83.83.155.43
+83.84.211.169
  83.85.139.94
  83.85.29.35
  83.85.9.236
@@ -81722,7 +96075,9 @@
  83.97.111.202
  83.97.20.153
  83.97.20.205
+83.97.20.29
  83.97.20.31
+83.97.20.34
  83.97.20.35
  83.97.20.90
  83.97.20.99
@@ -81735,6 +96090,8 @@
  83.99.245.20
  83.99.83.187
  83.99.83.188
+83.99.83.197
+83.99.92.108
  83010624-96-20190711114544.webstarterz.com
  8304153-89850-dot-bles05.wn.r.appspot.com
  8322344-dot-n-e-w-me-ss-age-po-rt-al.wl.r.appspot.com
@@ -81767,17 +96124,24 @@
  84.107.72.15
  84.110.106.22
  84.112.118.202
+84.112.132.253
  84.112.42.60
  84.112.47.232
  84.112.60.16
  84.113.144.10
  84.113.25.238
+84.115.129.40
  84.115.136.45
  84.115.141.72
  84.118.116.15
  84.118.161.63
+84.118.211.112
  84.118.239.130
+84.119.226.24
+84.121.129.167
  84.121.77.31
+84.122.212.34
+84.124.254.94
  84.126.137.181
  84.126.71.50
  84.127.40.16
@@ -81793,15 +96157,21 @@
  84.15.143.111
  84.15.156.185
  84.15.160.174
+84.15.176.80
+84.15.176.85
  84.15.183.1
  84.15.209.197
+84.16.235.129
  84.16.238.1
  84.16.248.172
  84.16.38.218
  84.16.46.130
+84.160.190.87
  84.160.54.244
  84.160.57.219
+84.164.182.63
  84.164.199.10
+84.164.51.58
  84.166.209.134
  84.166.222.200
  84.168.119.158
@@ -81860,24 +96230,45 @@
  84.17.56.135
  84.17.61.225
  84.171.146.47
+84.174.216.137
  84.174.99.105
+84.180.252.33
  84.181.31.179
  84.182.157.1
+84.185.255.13
  84.185.59.173
+84.189.88.69
  84.19.170.249
  84.19.178.210
  84.19.188.216
  84.190.140.233
  84.190.143.28
+84.192.145.209
+84.193.223.101
  84.194.55.181
+84.195.243.66
  84.197.198.167
+84.198.0.10
  84.198.45.125
  84.199.237.190
  84.2.189.150
+84.2.226.70
+84.2.58.60
  84.200.14.253
  84.200.206.82
  84.200.84.220
+84.201.156.17
+84.201.183.14
+84.201.183.15
+84.201.183.30
+84.201.183.31
+84.201.183.45
+84.201.183.46
+84.201.183.47
+84.201.183.62
+84.201.183.63
  84.201.231.52
+84.201.249.252
  84.202.208.64
  84.202.24.106
  84.202.88.73
@@ -81887,40 +96278,50 @@
  84.204.40.154
  84.205.15.25
  84.205.47.232
+84.208.133.87
  84.208.214.250
  84.209.1.53
  84.209.139.0
+84.209.172.134
  84.209.31.168
  84.209.48.106
  84.209.60.46
  84.21.188.230
  84.21.191.196
  84.21.191.233
+84.21.31.229
  84.210.178.191
  84.212.145.24
  84.212.251.204
  84.213.12.57
  84.213.231.74
  84.214.150.146
+84.214.54.186
  84.216.51.36
  84.217.32.10
+84.217.5.100
  84.217.82.227
  84.22.114.15
  84.22.116.140
  84.22.138.150
  84.22.198.26
+84.22.25.242
  84.22.35.142
  84.22.35.35
+84.22.36.55
  84.22.42.213
  84.22.59.50
  84.22.59.74
  84.22.63.122
+84.221.14.22
  84.224.42.243
  84.224.46.220
+84.226.113.175
  84.226.245.96
  84.226.56.42
  84.228.50.118
  84.232.113.247
+84.232.141.205
  84.232.168.102
  84.232.18.171
  84.232.223.152
@@ -81949,6 +96350,7 @@
  84.242.139.108
  84.242.183.146
  84.242.183.150
+84.242.212.100
  84.243.108.186
  84.244.104.14
  84.244.180.102
@@ -81964,6 +96366,7 @@
  84.247.48.60
  84.247.48.61
  84.247.50.180
+84.247.50.60
  84.247.51.123
  84.248.203.226
  84.25.47.230
@@ -81980,11 +96383,15 @@
  84.26.183.82
  84.26.232.111
  84.28.198.112
+84.3.59.133
  84.30.178.241
  84.33.1.71
+84.33.109.107
+84.33.119.102
  84.33.37.150
  84.33.39.233
  84.38.134.198
+84.38.184.216
  84.38.185.214
  84.38.3.249
  84.38.64.183
@@ -81998,6 +96405,7 @@
  84.42.253.252
  84.42.33.178
  84.42.62.141
+84.42.96.48
  84.43.181.174
  84.43.90.54
  84.45.121.135
@@ -82036,6 +96444,7 @@
  84.54.58.15
  84.54.58.252
  84.54.58.84
+84.54.83.254
  84.55.70.80
  84.57.171.70
  84.61.40.68
@@ -82045,6 +96454,7 @@
  84.67.122.121
  84.69.165.177
  84.7.96.195
+84.70.172.132
  84.71.3.143
  84.72.111.202
  84.73.156.202
@@ -82052,17 +96462,21 @@
  84.74.119.202
  84.75.176.24
  84.75.253.40
+84.75.71.19
  84.77.56.14
  84.80.110.196
  84.80.143.197
+84.81.131.101
  84.84.200.130
  84.85.102.113
  84.85.15.179
+84.85.90.26
  84.91.143.99
  84.92.24.249
  84.92.92.247
  84.93.31.10
  84.94.158.214
+84.94.225.232
  84.97.22.101
  840215.servicesbpd.club
  840e4d67.ngrok.io
@@ -82112,16 +96526,23 @@
  85.102.76.165
  85.104.59.244
  85.105.111.166
+85.105.125.66
  85.105.156.8
+85.105.2.42
  85.105.205.77
+85.105.206.68
  85.105.239.184
  85.105.243.229
+85.105.4.236
  85.105.4.243
+85.105.4.244
  85.105.83.125
  85.105.86.151
+85.105.97.45
  85.106.101.135
  85.106.8.102
  85.108.161.221
+85.108.198.6
  85.109.127.48
  85.109.43.176
  85.109.58.210
@@ -82134,6 +96555,7 @@
  85.113.136.32
  85.113.140.196
  85.113.38.197
+85.113.48.64
  85.113.91.205
  85.114.111.43
  85.114.132.48
@@ -82148,6 +96570,7 @@
  85.115.164.96
  85.116.120.106
  85.116.125.149
+85.117.122.233
  85.117.56.103
  85.117.56.73
  85.117.56.74
@@ -82166,17 +96589,24 @@
  85.125.194.18
  85.125.194.24
  85.125.194.83
+85.128.142.100
  85.128.16.46
  85.128.16.47
  85.13.134.81
+85.13.164.193
  85.13.229.138
  85.13.237.23
  85.130.101.189
+85.132.11.127
  85.132.29.134
  85.132.37.196
  85.132.96.242
  85.133.143.35
+85.135.155.172
  85.135.95.218
+85.136.47.215
+85.138.240.40
+85.139.12.89
  85.14.122.191
  85.14.243.31
  85.14.79.26
@@ -82190,6 +96620,7 @@
  85.144.28.175
  85.146.16.131
  85.146.208.186
+85.146.244.180
  85.148.168.20
  85.15.179.171
  85.15.179.235
@@ -82200,21 +96631,29 @@
  85.152.144.6
  85.152.162.105
  85.152.174.56
+85.152.20.146
+85.154.80.190
  85.158.181.41
  85.159.178.172
+85.159.218.246
  85.159.237.71
  85.159.237.74
  85.159.237.76
  85.159.48.170
  85.159.6.20
+85.160.33.142
  85.163.113.58
  85.163.224.168
+85.163.35.2
  85.163.53.75
  85.164.4.99
  85.165.101.248
  85.165.8.86
  85.166.127.166
+85.166.85.106
  85.167.127.116
+85.168.117.191
+85.168.131.83
  85.17.111.125
  85.17.131.134
  85.17.131.145
@@ -82232,6 +96671,7 @@
  85.17.90.143
  85.170.178.143
  85.170.233.95
+85.171.17.243
  85.171.52.251
  85.172.10.95
  85.172.107.1
@@ -82255,6 +96695,7 @@
  85.175.99.117
  85.175.99.136
  85.18.117.101
+85.18.236.229
  85.184.138.108
  85.184.191.57
  85.185.116.150
@@ -82275,6 +96716,7 @@
  85.192.167.69
  85.192.191.6
  85.193.135.111
+85.193.194.12
  85.194.238.131
  85.195.219.168
  85.195.222.234
@@ -82313,12 +96755,16 @@
  85.204.231.216
  85.204.246.107
  85.204.246.138
+85.204.50.3
  85.206.162.210
  85.206.162.217
  85.206.165.102
+85.206.165.19
  85.206.165.30
  85.206.57.202
  85.207.128.82
+85.207.13.169
+85.207.21.38
  85.208.109.193
  85.208.115.241
  85.208.115.39
@@ -82328,6 +96774,7 @@
  85.208.209.57
  85.208.209.63
  85.208.211.60
+85.208.213.114
  85.208.22.162
  85.208.71.18
  85.208.71.20
@@ -82337,6 +96784,7 @@
  85.208.87.186
  85.208.87.222
  85.208.87.84
+85.209.0.186
  85.209.129.22
  85.209.185.27
  85.209.89.243
@@ -82363,6 +96811,7 @@
  85.214.202.180
  85.214.204.63
  85.214.205.220
+85.214.21.59
  85.214.220.236
  85.214.237.36
  85.214.240.9
@@ -82392,11 +96841,14 @@
  85.215.9.88
  85.215.92.224
  85.216.149.129
+85.216.194.138
+85.216.246.246
  85.216.66.241
  85.217.137.77
  85.217.170.105
  85.217.192.39
  85.217.236.71
+85.220.85.26
  85.222.17.110
  85.222.206.142
  85.222.69.218
@@ -82405,6 +96857,7 @@
  85.223.214.130
  85.225.145.83
  85.226.123.6
+85.226.181.87
  85.227.129.215
  85.227.130.147
  85.228.216.200
@@ -82415,6 +96868,7 @@
  85.23.51.254bin.sh
  85.23.7.190
  85.232.244.35
+85.233.132.6
  85.233.255.46
  85.234.117.151
  85.234.126.107
@@ -82425,6 +96879,7 @@
  85.236.25.18
  85.237.200.113
  85.237.201.58
+85.237.38.22
  85.237.44.125
  85.237.46.168
  85.237.51.73
@@ -82443,20 +96898,27 @@
  85.239.121.168
  85.239.35.124
  85.24.135.103
+85.24.194.41
  85.240.233.220
  85.241.106.203
+85.243.134.107
  85.245.145.254
  85.245.19.44
  85.245.204.149
  85.245.26.67
  85.246.168.252
  85.246.78.192
+85.247.0.210
  85.247.109.182
  85.247.144.202
+85.247.23.199
  85.248.227.163
  85.248.227.164
  85.248.227.165
  85.248.6.41
+85.249.107.197
+85.249.161.67
+85.249.162.240
  85.249.171.252
  85.249.42.77
  85.25.118.22
@@ -82475,21 +96937,29 @@
  85.25.41.233
  85.25.95.141
  85.25.95.51
+85.250.95.247
  85.252.123.110
  85.254.72.26
  85.254.72.27
+85.26.197.210
+85.26.199.81
  85.26.235.221
  85.28.144.228
  85.29.147.222
  85.30.215.48
  85.30.248.210
  85.31.112.191
+85.35.32.245
+85.38.164.51
+85.38.39.122
  85.45.123.232
  85.47.31.179
  85.5.155.94
  85.52.217.114
+85.56.116.122
  85.58.120.201
  85.62.101.113
+85.66.107.100
  85.66.32.181
  85.66.65.139
  85.67.241.46
@@ -82498,12 +96968,15 @@
  85.70.97.59
  85.71.35.47
  85.72.32.44
+85.73.62.160
  85.74.163.232
  85.74.167.209
  85.74.215.180
  85.74.28.151
  85.75.17.172
  85.75.227.67
+85.84.212.12
+85.85.240.246
  85.9.144.123
  85.9.66.15
  85.90.105.201
@@ -82513,6 +96986,7 @@
  85.90.247.9
  85.92.108.211
  85.92.108.246
+85.92.121.213
  85.92.144.88
  85.92.164.179
  85.92.165.225
@@ -82520,7 +96994,20 @@
  85.92.183.97
  85.92.59.59
  85.93.20.70
+85.93.20.82
+85.93.20.83
+85.93.20.84
+85.93.20.85
+85.93.20.86
+85.93.20.87
+85.93.20.88
+85.93.20.89
+85.93.20.90
+85.93.20.91
+85.93.20.92
  85.93.218.204
+85.93.49.34
+85.94.122.26
  85.94.178.144
  85.94.201.138
  85.94.33.242
@@ -82529,6 +97016,7 @@
  85.97.148.176
  85.97.176.191
  85.97.204.234
+85.98.44.116
  85.99.227.200
  8501sanl.com
  850648486-dot-n-e-w-me-ss-age-po-rt-al.wl.r.appspot.com
@@ -82601,6 +97089,7 @@
  86.106.102.166
  86.106.131.150
  86.106.131.207
+86.106.137.150
  86.106.74.248
  86.106.74.249
  86.106.74.253
@@ -82620,23 +97109,31 @@
  86.111.144.10
  86.111.146.250
  86.111.88.138
+86.120.101.159
  86.120.157.254
  86.120.79.84
  86.122.170.50
  86.123.188.209
+86.123.75.137
+86.124.202.79
  86.124.230.115
  86.124.249.9
  86.125.112.230
  86.125.162.105
  86.125.169.47
  86.125.205.28
+86.125.59.56
  86.127.141.84
  86.127.143.176
+86.127.64.46
  86.128.131.204
  86.130.229.7
+86.131.168.226
+86.131.60.43
  86.132.208.148
  86.134.235.140
  86.135.222.202
+86.136.185.225
  86.137.132.80
  86.14.0.69
  86.14.39.167
@@ -82649,6 +97146,8 @@
  86.144.181.215
  86.145.179.255
  86.146.28.244
+86.150.207.88
+86.155.32.158
  86.159.154.192
  86.16.194.177
  86.160.82.214
@@ -82659,11 +97158,14 @@
  86.166.230.54
  86.169.186.53
  86.17.152.159
+86.17.17.216
  86.172.40.22
  86.173.62.115
  86.174.38.254
  86.177.237.106
  86.178.199.96
+86.179.165.151
+86.180.177.27
  86.184.190.186
  86.185.154.182
  86.188.246.2
@@ -82671,33 +97173,46 @@
  86.19.105.25
  86.190.93.136
  86.191.100.254
+86.192.117.239
  86.193.209.93
  86.196.103.38
  86.200.83.221
+86.206.131.154
+86.210.71.45
  86.22.221.170
+86.229.77.118
  86.23.210.63
  86.23.4.8
  86.237.3.61
+86.238.129.40
  86.24.173.237
  86.243.78.95
  86.244.202.145
  86.250.160.150
  86.252.24.102
+86.253.179.186
+86.27.53.150
  86.28.106.203
  86.28.76.189
+86.3.13.115
  86.31.163.247
  86.31.177.60
  86.34.157.3
  86.38.10.57
  86.40.162.231
+86.40.251.56
+86.40.50.195
  86.42.166.147
+86.42.190.155
  86.47.252.137
  86.49.108.37
  86.51.26.11
  86.52.44.102
  86.53.142.50
+86.57.132.71
  86.57.167.132
  86.57.181.122
+86.57.210.110
  86.57.216.191
  86.57.216.23
  86.57.237.53
@@ -82705,8 +97220,10 @@
  86.58.206.100
  86.58.32.180
  86.60.179.136
+86.61.66.59
  86.62.120.68
  86.7.146.132
+86.75.201.236
  86.76.7.132
  86.83.88.212
  86.84.198.19
@@ -82721,6 +97238,8 @@
  86.92.137.53
  86.95.8.249
  86.98.21.56
+86.98.72.177
+86.99.0.142
  86.99.17.120
  860259.com
  861365365.com
@@ -82747,7 +97266,12 @@
  86buortfa86.bankofamericaslpemr.com
  86g8ur.000webhostapp.com
  86mld.com
+87.0.232.93
+87.10.143.142
  87.101.94.67
+87.103.120.250
+87.103.126.98
+87.103.172.19
  87.103.174.109
  87.103.174.147
  87.103.175.22
@@ -82778,16 +97302,25 @@
  87.106.46.107
  87.106.67.146
  87.106.76.218
+87.106.89.36
  87.106.94.225
  87.107.116.255
+87.107.165.191
  87.107.165.206
  87.107.165.64
  87.11.209.236
  87.11.240.80
+87.110.181.30
  87.110.188.59
  87.110.60.124
  87.113.182.83
  87.116.144.36
+87.116.151.237
+87.116.162.67
+87.116.181.141
+87.116.181.95
+87.116.191.105
+87.116.191.240
  87.117.1.169
  87.117.19.29
  87.117.194.22
@@ -82809,6 +97342,7 @@
  87.118.122.51
  87.118.126.150
  87.118.158.223
+87.118.177.207
  87.118.253.155
  87.118.92.43
  87.118.96.154
@@ -82829,9 +97363,11 @@
  87.121.76.86
  87.121.77.130
  87.121.77.67
+87.121.98.61
  87.122.122.30
  87.122.226.239
  87.123.108.47
+87.123.135.221
  87.123.166.163
  87.123.170.178
  87.123.237.229
@@ -82852,7 +97388,6 @@
  87.125.107.232
  87.125.27.169
  87.125.42.222
-87.125.70.101
  87.126.64.193
  87.134.172.12
  87.138.108.161
@@ -82863,6 +97398,7 @@
  87.140.46.98
  87.140.60.37
  87.142.206.185
+87.144.15.40
  87.145.160.9
  87.145.83.245
  87.146.254.112
@@ -82871,11 +97407,17 @@
  87.150.52.39
  87.151.11.111
  87.154.207.55
+87.156.35.225
  87.156.36.52
  87.157.254.120
  87.159.161.188
  87.159.56.53
+87.16.185.127
+87.16.51.10
  87.16.72.110
+87.163.105.250
+87.165.80.143
+87.166.119.98
  87.166.25.251
  87.166.26.89
  87.166.35.73
@@ -82883,26 +97425,41 @@
  87.169.126.200
  87.169.240.79
  87.17.122.3
+87.17.164.169
  87.17.218.205
  87.170.179.202
  87.171.251.175
  87.171.253.166
  87.172.228.92
  87.172.229.207
+87.173.196.55
+87.173.23.180
+87.173.24.166
+87.173.27.50
+87.173.29.225
  87.175.80.209
  87.177.233.5
  87.177.234.13
+87.178.170.216
+87.179.67.68
+87.179.69.40
+87.179.95.4
  87.180.254.178
+87.180.8.82
  87.181.191.66
  87.182.231.191
  87.184.100.184
+87.184.176.147
  87.187.144.72
  87.187.155.63
  87.187.159.136
+87.188.125.211
+87.19.161.94
  87.193.48.235
  87.196.184.69
  87.197.137.223
  87.197.163.118
+87.2.214.182
  87.204.102.195
  87.204.220.68
  87.204.52.10
@@ -82910,16 +97467,25 @@
  87.205.85.162
  87.206.227.194
  87.207.29.236
+87.21.207.221
  87.21.209.109
  87.21.245.127
  87.210.254.220
  87.212.231.68
+87.213.228.114
  87.214.199.95
  87.214.96.147
+87.217.163.17
  87.218.156.4
  87.218.216.239
  87.220.212.62
+87.221.123.93
+87.225.104.117
+87.225.106.195
+87.225.108.2
  87.225.85.107
+87.225.89.93
+87.226.165.143
  87.227.140.10
  87.228.211.216
  87.228.39.19
@@ -82935,6 +97501,7 @@
  87.236.212.22
  87.237.120.219
  87.237.234.187
+87.237.238.185
  87.240.13.77
  87.241.1.186
  87.241.249.59
@@ -82947,20 +97514,27 @@
  87.244.152.124
  87.244.181.136
  87.244.182.241
+87.244.4.93
  87.244.5.174
  87.245.163.250
  87.245.163.252
  87.245.170.253
  87.246.46.132
  87.246.59.44
+87.246.7.0
  87.246.7.210
  87.246.7.226
+87.246.7.242
+87.246.7.43
+87.246.7.48
  87.247.19.126
  87.247.3.234
+87.248.1.12
  87.248.171.235
  87.248.182.115
  87.248.19.119
  87.249.217.57
+87.25.3.149
  87.251.228.114
  87.251.64.125
  87.251.7.114
@@ -82970,9 +97544,11 @@
  87.251.7.85
  87.251.76.122
  87.251.77.206
+87.251.88.115
  87.252.100.28
  87.252.183.184
  87.253.135.238
+87.253.81.220
  87.254.138.170
  87.255.13.217
  87.255.193.50
@@ -82984,8 +97560,11 @@
  87.26.40.62
  87.29.33.163
  87.3.46.64
+87.49.45.61
  87.62.100.86
  87.63.126.70
+87.64.166.201
+87.65.203.65
  87.75.104.165
  87.75.105.186
  87.75.96.241
@@ -82997,6 +97576,7 @@
  87.76.35.22
  87.76.35.250
  87.76.35.59
+87.78.7.183
  87.79.184.155
  87.79.254.225
  87.79.94.221
@@ -83004,6 +97584,7 @@
  87.8.167.188
  87.8.31.186
  87.81.219.92
+87.95.250.140
  87.97.155.156
  87.97.19.91
  87.98.143.87
@@ -83020,6 +97601,7 @@
  87.98.222.207
  87.98.228.144
  87.98.241.34
+87.98.246.193
  87.98.249.90
  87.99.93.100
  870-365.net
@@ -83086,16 +97668,21 @@
  88.12.54.150
  88.120.105.119
  88.121.22.235
+88.122.140.238
+88.125.47.131
  88.129.235.44
  88.129.253.94
  88.129.28.55
  88.13.122.249
+88.13.202.187
  88.13.9.239
+88.130.134.80
  88.130.220.168
  88.130.70.230
  88.132.194.239bin.sh
  88.132.217.184
  88.132.66.26
+88.134.143.96
  88.134.149.7
  88.134.51.48
  88.135.210.179
@@ -83119,6 +97706,7 @@
  88.135.44.175
  88.135.44.189
  88.135.45.99
+88.138.153.178
  88.138.88.184
  88.14.225.24
  88.14.26.46
@@ -83129,6 +97717,7 @@
  88.147.174.128
  88.147.174.19
  88.147.244.250
+88.147.254.66
  88.149.176.75
  88.149.223.65
  88.150.138.114
@@ -83148,8 +97737,10 @@
  88.151.101.31
  88.151.140.190
  88.151.243.106
+88.151.255.107
  88.151.75.42
  88.151.93.83
+88.151.99.87
  88.153.216.102
  88.153.35.32
  88.156.109.134
@@ -83157,7 +97748,9 @@
  88.157.229.58
  88.159.128.67
  88.159.132.102
+88.162.54.93
  88.163.105.128
+88.163.173.196
  88.165.81.34
  88.17.88.100
  88.18.188.158
@@ -83191,6 +97784,7 @@
  88.198.151.153
  88.198.16.108
  88.198.16.153
+88.198.184.53
  88.198.188.142
  88.198.19.164
  88.198.196.79
@@ -83220,6 +97814,7 @@
  88.198.59.60
  88.198.91.74
  88.198.92.47
+88.199.115.25
  88.199.21.75
  88.199.42.178
  88.199.82.114
@@ -83236,12 +97831,15 @@
  88.202.224.162
  88.202.230.221
  88.203.203.150
+88.203.218.39
  88.204.158.106
  88.204.216.142
  88.207.127.83
+88.207.61.193
  88.208.205.79
  88.208.220.105
  88.208.228.139
+88.208.228.45
  88.208.252.204
  88.208.3.195
  88.208.57.212
@@ -83256,6 +97854,7 @@
  88.213.214.254
  88.213.215.15
  88.214.11.71
+88.214.24.92
  88.214.57.95
  88.215.177.224
  88.215.2.29
@@ -83284,6 +97883,7 @@
  88.218.17.222
  88.218.17.223
  88.218.17.232
+88.218.227.162
  88.218.65.124
  88.218.65.143
  88.218.65.162
@@ -83295,18 +97895,28 @@
  88.220.43.198
  88.226.96.242
  88.227.171.93
+88.230.155.181
+88.231.61.203
+88.233.35.229
+88.233.66.184
  88.236.163.250
  88.236.187.82
+88.236.70.190
+88.238.89.33
+88.246.214.212
  88.247.138.7
  88.247.143.224
+88.247.151.51
  88.247.165.215
  88.247.170.207
  88.247.194.52
  88.247.212.56
  88.247.31.189
  88.247.9.171
+88.247.93.137
  88.248.23.216
  88.248.55.136
+88.249.118.13
  88.249.120.205
  88.249.125.146
  88.249.181.198
@@ -83314,12 +97924,14 @@
  88.25.153.3
  88.250.210.8
  88.250.223.190
+88.252.134.66
  88.252.242.152
  88.255.102.114
  88.255.102.119
  88.255.102.19
  88.255.102.22
  88.255.102.33
+88.255.102.45
  88.255.102.6
  88.255.102.60
  88.255.102.99
@@ -83339,13 +97951,18 @@
  88.26.151.85
  88.26.174.12
  88.26.181.16
+88.26.202.180
+88.26.234.59
  88.26.34.89
  88.27.20.192
+88.28.32.116
  88.36.135.138
  88.39.235.66
  88.4.81.198
  88.5.20.125
+88.57.55.218
  88.58.209.2
+88.69.34.83
  88.7.137.57
  88.7.198.4
  88.71.172.62
@@ -83353,6 +97970,7 @@
  88.72.175.175
  88.73.13.238
  88.78.137.199
+88.79.93.114
  88.8.137.122
  88.80.148.234
  88.80.189.129
@@ -83374,9 +97992,11 @@
  88.87.74.87
  88.87.84.17
  88.87.85.103
+88.88.130.173
  88.89.52.144
  88.9.178.174
  88.91.13.191
+88.95.178.241
  88.98.235.134
  88.98.237.182
  88.98.240.31
@@ -83449,8 +98069,10 @@
  89.0.47.253
  89.0.99.104
  89.100.106.42
+89.100.165.138
  89.102.198.78
  89.103.236.146
+89.103.237.72
  89.105.158.245
  89.105.194.236
  89.105.202.39
@@ -83489,23 +98111,30 @@
  89.113.84.51
  89.114.237.38
  89.115.120.43
+89.115.22.34
  89.12.119.168
+89.12.252.109
  89.120.146.186
  89.120.156.28
  89.120.17.179
+89.122.186.71
  89.123.12.95
  89.130.250.155
+89.130.56.159
  89.132.116.240
  89.132.118.246
  89.132.175.246
  89.132.207.82
  89.133.10.60
  89.133.103.216
+89.133.161.153
  89.133.180.150
  89.133.180.22
+89.133.242.58
  89.133.68.65
  89.133.95.177
  89.134.144.41
+89.134.239.7
  89.134.85.129
  89.135.1.16
  89.135.150.137
@@ -83514,6 +98143,8 @@
  89.136.31.222
  89.137.11.41
  89.137.246.181
+89.14.222.246
+89.14.79.102
  89.14.9.231
  89.141.67.231
  89.142.131.74
@@ -83533,13 +98164,17 @@
  89.144.25.95
  89.144.25.96
  89.144.25.97
+89.144.47.249
  89.144.47.28
  89.149.12.188
  89.149.235.45
+89.149.9.69
  89.151.135.90
  89.151.83.58
+89.153.123.100
  89.155.11.229
  89.155.192.121
+89.155.39.33
  89.157.40.103
  89.158.32.44
  89.158.62.170
@@ -83547,6 +98182,8 @@
  89.16.103.241
  89.160.49.80
  89.161.130.94
+89.161.96.188
+89.163.129.92
  89.163.132.40
  89.163.139.209
  89.163.143.8
@@ -83558,6 +98195,7 @@
  89.163.155.202
  89.163.157.3
  89.163.206.19
+89.163.209.26
  89.163.224.112
  89.163.224.143
  89.163.224.187
@@ -83580,22 +98218,30 @@
  89.166.156.23
  89.166.158.93
  89.166.47.198
+89.169.14.19
  89.17.51.234
+89.17.54.18
  89.171.129.58
  89.171.190.107
+89.172.132.117
  89.173.20.134
  89.173.237.42
  89.174.101.42
  89.174.105.118
+89.174.36.41
  89.174.71.111
  89.175.29.126
  89.176.190.207
+89.179.126.155
+89.179.244.69
  89.179.41.211
  89.18.136.217
  89.18.168.135
  89.18.27.192
+89.182.122.246
  89.184.152.198
  89.184.74.45
+89.184.82.86
  89.185.231.103
  89.185.93.190
  89.186.12.24
@@ -83631,6 +98277,7 @@
  89.187.177.97
  89.187.177.98
  89.187.201.70
+89.187.86.97
  89.188.117.71
  89.188.124.145
  89.189.172.88
@@ -83638,18 +98285,22 @@
  89.189.191.51
  89.189.222.150
  89.189.223.236
+89.189.53.103
  89.19.175.117
  89.19.199.152
  89.19.20.202
  89.19.7.152
  89.190.120.116
+89.190.156.38
  89.190.165.4
  89.190.19.162
  89.191.228.105
  89.191.229.35
+89.2.68.144
  89.20.135.204
  89.200.137.67
  89.201.145.59
+89.201.184.35
  89.201.192.104
  89.201.192.62
  89.201.192.64
@@ -83672,19 +98323,28 @@
  89.201.195.91
  89.202.127.4
  89.204.135.175
+89.205.35.133
  89.205.87.153
  89.207.92.107
  89.207.92.110
  89.207.93.238
+89.208.254.11
  89.208.255.98
  89.208.33.211
  89.208.35.79
+89.208.8.50
  89.211.223.6
+89.212.160.214
+89.212.202.200
  89.212.9.96
  89.212.90.179
+89.216.102.123
  89.216.104.9
  89.216.122.92
+89.216.22.136
+89.216.28.53
  89.216.29.79
+89.217.149.148
  89.218.11.2
  89.218.133.170
  89.218.169.122
@@ -83692,7 +98352,9 @@
  89.218.5.108
  89.218.5.110
  89.218.72.51
+89.219.16.149
  89.22.17.62
+89.22.187.111
  89.22.249.241
  89.22.66.2
  89.221.208.77
@@ -83702,6 +98364,9 @@
  89.221.250.23
  89.221.250.9
  89.222.132.31
+89.223.122.166
+89.223.122.215
+89.223.122.236
  89.223.24.86
  89.223.31.237
  89.223.47.219
@@ -83714,9 +98379,11 @@
  89.23.196.60
  89.23.198.165
  89.23.230.189
+89.230.204.161
  89.230.96.42
  89.231.32.193
  89.231.66.155
+89.232.192.40
  89.232.37.103
  89.232.44.249
  89.233.183.64
@@ -83731,6 +98398,8 @@
  89.236.101.52
  89.236.112.100
  89.236.17.108
+89.236.239.25
+89.237.109.148
  89.237.113.144
  89.237.32.129
  89.237.32.161
@@ -83772,6 +98441,7 @@
  89.239.65.140
  89.239.99.102
  89.24.119.126
+89.24.13.101
  89.24.221.82
  89.24.76.185
  89.242.110.185
@@ -83787,6 +98457,7 @@
  89.245.81.230
  89.245.82.119
  89.245.84.117
+89.245.86.160
  89.245.87.119
  89.245.89.144
  89.246.117.21
@@ -83794,31 +98465,37 @@
  89.246.119.203
  89.246.56.104
  89.247.10.75
+89.247.127.135
+89.247.127.203
  89.247.34.21
  89.247.41.6
  89.247.7.228
  89.248.111.164
  89.248.159.202
  89.248.160.132
-89.248.160.178
+89.248.160.135
  89.248.160.192
  89.248.160.215
  89.248.160.217
  89.248.162.170
+89.248.162.217
  89.248.163.3
+89.248.165.109
  89.248.165.44
-89.248.165.53
+89.248.165.45
  89.248.165.59
  89.248.165.70
  89.248.166.183
  89.248.167.131
  89.248.167.133
-89.248.168.157
+89.248.168.140
  89.248.168.171
  89.248.168.188
  89.248.168.204
+89.248.168.240
  89.248.168.29
  89.248.169.103
+89.248.169.12
  89.248.170.232
  89.248.171.137
  89.248.171.139
@@ -83831,6 +98508,7 @@
  89.248.171.38
  89.248.172.10
  89.248.172.139
+89.248.172.16
  89.248.172.169
  89.248.172.175
  89.248.172.196
@@ -83849,9 +98527,12 @@
  89.249.49.118
  89.249.49.120
  89.249.67.57
+89.249.73.162
  89.25.21.170
  89.25.23.210
  89.25.23.212
+89.25.79.164
+89.250.148.154
  89.250.149.114
  89.250.19.173
  89.251.144.37
@@ -83859,7 +98540,9 @@
  89.252.143.70
  89.252.159.99
  89.252.19.66
+89.252.191.187
  89.252.40.18
+89.253.160.222
  89.253.225.14
  89.253.247.144
  89.255.60.4
@@ -83881,10 +98564,12 @@
  89.31.126.216
  89.31.140.14
  89.31.140.28
+89.31.189.206
  89.31.46.208
  89.31.57.5
  89.32.150.160
  89.32.227.230
+89.32.249.21
  89.32.41.79
  89.33.25.104
  89.33.40.70
@@ -83892,6 +98577,7 @@
  89.33.78.174
  89.34.111.122
  89.34.16.212
+89.34.16.7
  89.34.208.216
  89.34.208.223
  89.34.26.129
@@ -83927,6 +98613,7 @@
  89.36.213.13
  89.36.213.45
  89.36.213.79
+89.36.221.124
  89.36.224.10
  89.36.224.11
  89.36.224.2
@@ -83954,6 +98641,7 @@
  89.39.106.94
  89.39.108.202
  89.39.174.13
+89.39.3.12
  89.40.113.141
  89.40.113.161
  89.40.114.11
@@ -83963,15 +98651,18 @@
  89.40.143.228
  89.40.217.40
  89.40.48.186
+89.40.53.35
  89.40.9.189
  89.41.106.8
  89.42.133.58
  89.42.133.67
  89.42.141.28
  89.42.198.30
+89.42.209.67
  89.42.210.116
  89.42.212.219
  89.42.217.11
+89.43.179.12
  89.43.202.10
  89.43.202.168
  89.43.202.44
@@ -84001,10 +98692,25 @@
  89.45.94.188
  89.46.100.105
  89.46.100.144
+89.46.102.116
+89.46.105.144
+89.46.105.166
  89.46.105.182
  89.46.105.196
  89.46.105.197
+89.46.105.229
+89.46.105.235
+89.46.106.231
+89.46.107.138
  89.46.108.165
+89.46.108.248
+89.46.109.194
+89.46.109.212
+89.46.109.223
+89.46.109.238
+89.46.109.246
+89.46.109.247
+89.46.110.212
  89.46.204.81
  89.46.82.5
  89.46.86.183
@@ -84015,9 +98721,12 @@
  89.6.82.164
  89.64.39.142
  89.65.244.169
+89.67.0.87
  89.67.124.35
  89.69.179.180
  89.69.254.27
+89.7.67.223
+89.7.91.132
  89.70.79.108
  89.70.85.189
  89.72.212.205
@@ -84026,6 +98735,8 @@
  89.78.5.56
  89.79.48.213
  89.87.240.160
+89.88.186.164
+89.95.83.154
  89.96.255.77
  89.97.218.142
  89.98.241.10
@@ -84137,14 +98848,21 @@
  9-35.xyz
  90.104.116.167
  90.110.30.206
+90.116.132.248
+90.12.242.180
  90.120.39.186
  90.126.42.245
  90.127.249.192
+90.128.49.247
+90.142.55.243
  90.146.153.21
  90.146.16.34
  90.146.219.186
+90.15.95.81
+90.150.180.66
  90.150.52.45
  90.150.87.79
+90.150.90.231
  90.151.180.215
  90.151.38.251
  90.152.200.81
@@ -84152,21 +98870,27 @@
  90.154.108.68
  90.154.108.70
  90.155.167.227
+90.156.141.32
  90.156.153.161
  90.156.196.18
+90.156.99.180
  90.157.135.205
  90.157.141.214
  90.157.197.48
+90.157.222.183
  90.160.138.175
  90.160.140.35
+90.160.146.165
  90.162.115.79
  90.168.34.174
  90.168.34.229
  90.170.20.2
  90.171.35.83
  90.173.78.53
+90.177.191.78
  90.178.102.136
  90.181.150.210
+90.182.178.18
  90.182.36.30
  90.183.101.238
  90.183.152.178
@@ -84174,6 +98898,7 @@
  90.185.249.111
  90.187.75.113
  90.188.10.59
+90.188.115.210
  90.188.21.217
  90.188.236.43
  90.188.255.142
@@ -84183,6 +98908,9 @@
  90.189.165.213
  90.189.167.93
  90.189.172.54
+90.189.194.83
+90.190.170.200
+90.190.222.229
  90.190.253.254
  90.200.46.79
  90.204.41.78
@@ -84201,19 +98929,35 @@
  90.227.130.6
  90.242.109.39
  90.251.238.108
+90.253.77.156
  90.27.153.190
+90.3.50.161
  90.34.246.35
  90.43.10.44
  90.43.10.95
+90.45.66.58
+90.46.38.235
+90.48.24.168
+90.49.118.54
+90.49.136.166
  90.49.95.3
+90.49.99.61
+90.50.246.32
  90.51.18.170
  90.51.20.22
  90.71.38.63
+90.73.37.62
  90.74.52.246
  90.76.107.69
+90.76.65.9
+90.78.229.103
+90.78.53.137
  90.84.242.139
  90.84.89.54
  90.88.229.233
+90.90.51.29
+90.91.90.103
+90.95.163.208
  900800.com
  900990099009kk.000webhostapp.com
  900emtrtme00.com
@@ -84251,6 +98995,7 @@
  91.102.229.134
  91.102.231.6
  91.103.196.170
+91.103.31.155
  91.103.31.45
  91.105.135.113
  91.105.135.181
@@ -84259,6 +99004,8 @@
  91.105.94.200
  91.106.131.90
  91.106.188.229
+91.106.193.72
+91.106.199.101
  91.107.26.202
  91.108.136.17
  91.108.137.150
@@ -84277,15 +99024,23 @@
  91.109.5.170
  91.11.92.197
  91.11.93.249
+91.117.13.201
+91.117.196.148
  91.117.31.181
  91.120.21.66
  91.120.21.93
+91.120.46.106
+91.120.46.74
  91.120.50.1
  91.120.7.237
+91.121.0.159
  91.121.101.78
+91.121.102.42
+91.121.104.181
  91.121.105.125
  91.121.106.15
  91.121.106.225
+91.121.108.159
  91.121.108.164
  91.121.108.5
  91.121.109.55
@@ -84299,8 +99054,10 @@
  91.121.116.107
  91.121.118.201
  91.121.121.95
+91.121.122.180
  91.121.133.13
  91.121.133.211
+91.121.134.201
  91.121.14.107
  91.121.141.219
  91.121.142.210
@@ -84314,10 +99071,13 @@
  91.121.159.201
  91.121.16.117
  91.121.162.189
+91.121.162.198
  91.121.163.195
  91.121.165.170
  91.121.169.194
+91.121.169.205
  91.121.173.98
+91.121.176.34
  91.121.177.192
  91.121.177.212
  91.121.177.45
@@ -84333,8 +99093,11 @@
  91.121.184.52
  91.121.191.85
  91.121.195.164
+91.121.205.83
+91.121.208.114
  91.121.210.168
  91.121.210.23
+91.121.211.34
  91.121.211.59
  91.121.221.15
  91.121.221.92
@@ -84343,6 +99106,7 @@
  91.121.242.107
  91.121.25.16
  91.121.28.184
+91.121.30.154
  91.121.30.186
  91.121.30.96
  91.121.31.95
@@ -84350,11 +99114,14 @@
  91.121.48.78
  91.121.5.216
  91.121.54.71
+91.121.55.10
  91.121.55.56
+91.121.56.228
  91.121.65.15
  91.121.65.57
  91.121.67.119
  91.121.67.146
+91.121.67.151
  91.121.70.43
  91.121.74.44
  91.121.75.27
@@ -84369,6 +99136,7 @@
  91.121.84.108
  91.121.84.109
  91.121.84.176
+91.121.84.187
  91.121.84.201
  91.121.84.66
  91.121.86.22
@@ -84377,6 +99145,7 @@
  91.121.89.135
  91.121.89.189
  91.121.89.20
+91.121.89.79
  91.121.9.61
  91.121.90.166
  91.121.91.137
@@ -84386,10 +99155,16 @@
  91.122.105.234
  91.122.159.193
  91.122.193.80
+91.122.198.128
+91.122.215.21
  91.122.46.120
+91.122.97.161
  91.123.18.206
  91.123.26.18
+91.124.142.249
+91.124.192.95
  91.126.18.130
+91.126.206.51
  91.126.234.159
  91.127.252.46
  91.13.95.186
@@ -84400,6 +99175,8 @@
  91.132.138.62
  91.132.139.60
  91.132.147.168
+91.134.113.122
+91.134.13.250
  91.134.133.251
  91.134.135.95
  91.134.138.46
@@ -84407,13 +99184,20 @@
  91.134.143.172
  91.134.145.129
  91.134.145.202
+91.134.151.29
+91.134.157.246
  91.134.172.23
  91.134.177.139
+91.134.179.197
  91.134.180.0
+91.134.201.164
+91.134.201.59
  91.134.207.16
  91.134.209.116
  91.134.221.168
  91.134.231.96
+91.134.240.130
+91.134.242.199
  91.134.242.66
  91.134.248.230
  91.134.248.235
@@ -84440,8 +99224,8 @@
  91.144.147.248
  91.144.150.207
  91.144.153.140
+91.144.20.198
  91.144.30.172
-91.145.237.255
  91.147.210.86
  91.147.232.98
  91.147.235.65
@@ -84449,8 +99233,10 @@
  91.148.106.63
  91.148.120.226
  91.148.141.210
+91.149.139.198
  91.149.157.145
  91.149.225.120
+91.149.235.106
  91.15.75.156
  91.15.75.77
  91.15.76.169
@@ -84458,6 +99244,7 @@
  91.15.77.182
  91.15.79.196
  91.150.189.122
+91.150.75.64
  91.150.77.57
  91.150.77.58
  91.152.120.228
@@ -84467,15 +99254,20 @@
  91.155.25.9
  91.159.105.216
  91.159.158.36
+91.160.19.34
  91.163.206.48
  91.168.145.151
  91.169.100.84
  91.17.173.153
  91.17.175.187
  91.173.12.250
+91.173.207.5
  91.174.162.196
+91.176.123.228
+91.178.92.151
  91.18.240.161
  91.181.235.31
+91.183.149.230
  91.183.53.241
  91.184.52.3
  91.185.198.234
@@ -84500,8 +99292,10 @@
  91.189.123.230
  91.189.141.116
  91.189.181.22
+91.189.187.49
  91.189.201.70
  91.191.173.120
+91.191.190.110
  91.191.250.142
  91.192.103.10
  91.192.103.11
@@ -84522,6 +99316,7 @@
  91.192.103.9
  91.192.110.40
  91.192.135.69
+91.192.136.43
  91.192.195.131
  91.192.2.168
  91.192.20.164
@@ -84530,6 +99325,7 @@
  91.192.24.202
  91.192.25.72
  91.192.6.43
+91.193.102.87
  91.193.103.172
  91.193.130.8
  91.193.200.21
@@ -84568,6 +99364,7 @@
  91.200.13.64
  91.200.14.73
  91.201.240.101
+91.202.109.11
  91.202.240.208
  91.203.114.71
  91.203.136.162
@@ -84589,6 +99386,7 @@
  91.204.14.236
  91.204.149.250
  91.204.149.5
+91.204.153.138
  91.204.163.19
  91.204.99.178
  91.205.123.185
@@ -84611,6 +99409,8 @@
  91.205.217.22
  91.205.218.64
  91.205.241.86
+91.205.48.100
+91.205.48.101
  91.205.72.182
  91.206.110.190
  91.206.14.30
@@ -84648,9 +99448,11 @@
  91.210.183.14
  91.210.224.119
  91.210.224.123
+91.210.224.196
  91.210.237.71
  91.210.24.30
  91.210.47.85
+91.210.59.205
  91.211.137.86
  91.211.172.104
  91.211.248.35
@@ -84716,6 +99518,8 @@
  91.219.29.55
  91.219.61.224
  91.219.88.121
+91.22.70.71
+91.22.72.140
  91.221.108.181
  91.221.108.182
  91.221.252.18
@@ -84731,6 +99535,8 @@
  91.223.32.102
  91.224.20.71
  91.224.59.14
+91.224.92.155
+91.224.92.205
  91.224.97.38
  91.224.98.206
  91.225.190.77
@@ -84738,6 +99544,7 @@
  91.225.208.84
  91.225.208.85
  91.225.208.87
+91.225.8.128
  91.226.106.181
  91.226.192.8
  91.226.212.131
@@ -84746,6 +99553,7 @@
  91.226.45.66
  91.226.5.245
  91.227.122.167
+91.227.16.12
  91.227.182.254
  91.227.220.149
  91.227.220.154
@@ -84764,9 +99572,11 @@
  91.230.199.174
  91.230.25.200
  91.231.127.89
+91.231.213.51
  91.231.70.61
  91.232.105.116
  91.232.105.180
+91.232.4.149
  91.233.197.70
  91.233.250.106
  91.233.43.165
@@ -84785,6 +99595,7 @@
  91.234.99.193
  91.234.99.203
  91.234.99.234
+91.235.124.237
  91.235.129.159
  91.235.129.180
  91.235.142.22
@@ -84792,6 +99603,7 @@
  91.235.143.184
  91.235.143.197
  91.235.178.161
+91.235.230.225
  91.235.237.17
  91.235.244.205
  91.235.69.191
@@ -84800,6 +99612,7 @@
  91.236.12.179
  91.236.12.203
  91.236.141.219
+91.236.172.19
  91.236.7.126
  91.236.74.121
  91.237.121.11
@@ -84807,8 +99620,10 @@
  91.237.127.186
  91.237.161.162
  91.237.161.211
+91.237.161.87
  91.237.200.127
  91.237.248.40
+91.237.41.134
  91.237.69.17
  91.237.77.5
  91.238.134.99
@@ -84837,6 +99652,7 @@
  91.243.188.166
  91.243.188.227
  91.243.200.26
+91.243.45.153
  91.243.45.39
  91.243.45.40
  91.243.80.144
@@ -84848,6 +99664,7 @@
  91.244.73.243
  91.245.34.95
  91.245.37.125
+91.246.209.139
  91.246.213.100
  91.246.213.104
  91.246.74.202
@@ -84864,14 +99681,20 @@
  91.37.223.62
  91.39.178.78
  91.44.225.23
+91.46.219.36
  91.46.47.216
  91.5.126.198
+91.53.111.220
+91.58.106.203
  91.58.129.44
  91.61.51.156
+91.62.255.148
  91.64.35.46
+91.64.78.4
  91.64.86.56
  91.65.157.200
  91.65.70.241
+91.66.80.50
  91.67.240.32
  91.72.171.138
  91.72.179.214
@@ -84885,10 +99708,12 @@
  91.77.168.231
  91.78.79.250
  91.78.93.101
+91.78.94.46
  91.82.40.118
  91.82.41.200
  91.82.42.2
  91.82.46.25
+91.82.48.87
  91.83.227.153
  91.83.227.189
  91.83.227.249
@@ -84897,14 +99722,18 @@
  91.83.93.103
  91.83.93.105
  91.83.93.124
+91.86.183.31
  91.87.123.173
  91.87.96.138
  91.90.121.232
  91.90.123.101
  91.90.210.104
  91.90.237.243
+91.90.36.174
+91.90.88.5
  91.92.109.43
  91.92.115.210
+91.92.132.18
  91.92.144.166
  91.92.180.45
  91.92.191.134
@@ -84915,7 +99744,9 @@
  91.92.78.248
  91.92.79.234
  91.92.80.25
+91.93.127.34
  91.93.132.210
+91.93.140.179
  91.93.163.188
  91.93.163.190
  91.93.3.85
@@ -84929,8 +99760,10 @@
  91.98.132.189
  91.98.136.68
  91.98.149.207
+91.98.251.80
  91.98.26.62
  91.98.32.223
+91.98.32.40
  91.98.33.136
  91.98.34.37
  91.98.35.140
@@ -84939,6 +99772,7 @@
  91.98.6.127
  91.98.63.7
  91.98.64.222
+91.98.96.76
  910-365.com
  91131994de4.xyz
  911718.net
@@ -84990,9 +99824,14 @@
  92.115.134.57
  92.116.145.193
  92.116.161.20
+92.116.34.209
  92.117.134.75
  92.117.136.150
+92.117.57.201
  92.118.149.91
+92.118.160.13
+92.118.160.37
+92.118.161.9
  92.118.190.105
  92.118.209.115
  92.118.209.198
@@ -85015,45 +99854,85 @@
  92.119.193.54
  92.124.139.1
  92.124.148.142
+92.124.153.76
+92.124.160.74
  92.126.197.108
+92.126.212.205
+92.126.222.172
  92.130.187.57
+92.137.141.251
  92.15.231.205
  92.151.38.47
  92.151.73.171
+92.154.89.19
  92.154.95.236
  92.157.56.229
  92.170.214.197
+92.170.67.37
  92.184.100.191
  92.184.100.206
+92.184.100.207
+92.184.100.232
+92.184.100.250
  92.184.100.253
+92.184.102.10
  92.184.102.140
  92.184.102.146
+92.184.102.248
  92.184.102.255
+92.184.102.73
+92.184.102.92
+92.184.104.0
+92.184.104.138
+92.184.104.151
+92.184.104.158
  92.184.104.178
+92.184.104.207
  92.184.104.221
+92.184.104.249
  92.184.104.29
+92.184.104.34
  92.184.104.5
  92.184.105.30
+92.184.106.160
+92.184.107.167
  92.184.107.84
  92.184.108.198
  92.184.112.13
  92.184.112.135
  92.184.112.233
+92.184.112.92
  92.184.116.160
+92.184.116.221
  92.184.116.28
+92.184.116.35
+92.184.116.37
  92.184.124.129
  92.184.124.204
+92.184.124.239
  92.184.124.245
+92.184.124.253
+92.184.124.44
  92.184.124.54
  92.184.98.247
+92.185.121.178
  92.185.96.97
  92.187.228.47
  92.19.14.2
  92.19.249.3
+92.190.153.246
+92.190.177.39
+92.191.71.124
+92.192.116.180
+92.192.49.54
+92.193.135.111
+92.193.151.22
  92.193.160.60
  92.193.220.139
  92.194.60.90
  92.194.72.241
+92.195.51.78
+92.196.143.8
  92.196.181.16
  92.198.28.38
  92.2.66.72
@@ -85064,6 +99943,7 @@
  92.20.8.10
  92.20.86.49
  92.200.17.92
+92.201.86.121
  92.204.132.78
  92.204.163.66
  92.204.164.90
@@ -85084,9 +99964,11 @@
  92.208.127.72
  92.208.204.145
  92.208.207.192
+92.210.127.76
  92.219.151.94
  92.22.55.226
  92.22.60.74
+92.220.133.181
  92.220.163.15
  92.221.141.145
  92.221.166.189
@@ -85096,23 +99978,33 @@
  92.222.121.156
  92.222.121.157
  92.222.124.166
+92.222.150.61
  92.222.151.63
  92.222.155.168
  92.222.16.136
  92.222.167.201
  92.222.168.130
+92.222.180.221
  92.222.207.223
  92.222.207.228
  92.222.208.174
+92.222.220.220
  92.222.221.49
+92.222.64.148
  92.222.64.195
+92.222.72.234
+92.222.74.255
+92.222.75.80
+92.222.77.8
  92.222.78.220
  92.222.79.157
  92.222.79.185
  92.222.84.136
  92.222.86.174
  92.222.86.241
+92.222.90.130
  92.222.92.237
+92.222.93.227
  92.222.94.117
  92.223.93.145
  92.225.43.130
@@ -85123,6 +100015,7 @@
  92.237.242.79
  92.238.170.6
  92.238.234.158
+92.239.115.186
  92.24.140.82
  92.24.51.238
  92.240.238.35
@@ -85146,6 +100039,7 @@
  92.242.240.34
  92.242.254.23
  92.242.62.123
+92.242.62.18
  92.243.0.38
  92.243.1.246
  92.243.13.72
@@ -85208,10 +100102,13 @@
  92.249.143.44
  92.249.148.21
  92.249.219.47
+92.249.229.57
+92.252.151.200
  92.252.185.162
  92.252.241.11
  92.252.241.202
  92.253.144.180
+92.253.39.186
  92.255.164.166
  92.255.170.159
  92.255.174.56
@@ -85224,19 +100121,30 @@
  92.255.248.230
  92.255.252.44
  92.255.253.59
+92.255.27.60
  92.27.142.29
+92.27.26.140
  92.31.218.173
+92.32.100.59
+92.33.149.162
  92.33.191.207
  92.33.194.82
  92.34.210.135
  92.35.66.140
+92.35.94.126
+92.38.128.47
  92.38.136.69
  92.38.149.154
  92.38.163.44
+92.38.171.17
+92.38.173.19
+92.38.173.23
+92.38.173.24
  92.38.225.177
  92.38.226.16
  92.38.45.68
  92.39.130.130
+92.39.241.59
  92.39.247.20
  92.39.70.138
  92.42.110.214
@@ -85261,6 +100169,7 @@
  92.45.51.232
  92.45.51.254
  92.46.215.82
+92.47.198.254
  92.47.62.134
  92.48.124.21
  92.49.155.65
@@ -85268,8 +100177,11 @@
  92.50.136.106
  92.50.143.90
  92.50.155.218
+92.50.235.198
+92.50.249.166
  92.51.201.65
  92.51.241.168
+92.51.25.48
  92.51.73.14
  92.51.78.66
  92.51.89.126
@@ -85278,27 +100190,33 @@
  92.53.111.240
  92.53.119.193
  92.53.193.100
+92.53.64.166
  92.53.64.203
  92.54.126.211
  92.54.200.66
  92.54.237.196
  92.54.237.237
+92.55.194.252
+92.55.194.55
  92.59.209.151
  92.60.190.249
  92.60.224.50
  92.61.102.252
  92.61.114.103
+92.62.131.106
  92.62.139.103
+92.62.18.244
  92.62.196.66
  92.62.73.73
  92.63.111.201
  92.63.192.231
  92.63.192.96
-92.63.196.33
+92.63.196.47
  92.63.197.153
  92.63.197.190
  92.63.197.60
  92.63.199.27
+92.63.199.9
  92.63.203.197
  92.63.87.10
  92.63.87.134
@@ -85334,8 +100252,10 @@
  92.94.103.214bin.sh
  92.96.172.185
  92.97.243.144
+92.98.223.12
  92.98.243.43
  92.98.7.153
+92.99.208.52
  9201mobiliref032.com
  920365365.com
  92085.dojnh.com
@@ -85374,6 +100294,7 @@
  93.104.213.162
  93.104.99.54
  93.107.153.162
+93.108.242.140
  93.113.110.87
  93.113.111.100
  93.113.111.193
@@ -85381,7 +100302,10 @@
  93.113.131.129
  93.113.206.62
  93.113.49.1
+93.114.130.20
+93.114.184.56
  93.114.184.8
+93.114.234.242
  93.114.235.168
  93.114.41.133
  93.114.44.253
@@ -85390,6 +100314,7 @@
  93.114.82.21
  93.114.86.226
  93.115.0.62
+93.115.1.195
  93.115.138.250
  93.115.20.130
  93.115.240.26
@@ -85401,6 +100326,7 @@
  93.115.28.92
  93.115.29.28
  93.115.79.137
+93.115.79.97
  93.115.86.246
  93.115.92.169
  93.115.95.202
@@ -85408,10 +100334,25 @@
  93.116.201.15
  93.116.226.60
  93.116.57.4
+93.116.83.126
  93.117.72.27
+93.118.104.23
+93.118.235.9
  93.118.72.92
  93.118.74.237
+93.119.104.36
+93.119.107.22
  93.119.123.233
+93.119.176.102
+93.119.176.143
+93.119.176.157
+93.119.176.198
+93.119.176.219
+93.119.176.231
+93.119.176.238
+93.119.176.64
+93.119.176.66
+93.119.176.90
  93.120.217.221
  93.123.180.164
  93.123.73.123
@@ -85431,21 +100372,32 @@
  93.126.98.242
  93.127.145.162
  93.127.145.40
+93.136.143.126
  93.136.63.221
+93.137.131.175
+93.137.166.9
+93.137.185.232
  93.137.200.47
  93.137.217.170
  93.138.163.107
  93.141.175.161
+93.141.65.211
+93.143.202.210
  93.145.164.6
+93.145.61.6
  93.146.143.191
  93.146.185.139
  93.146.237.163
  93.146.48.84
+93.146.71.211
  93.146.99.125
+93.147.129.222
  93.147.141.5
  93.147.212.206
+93.149.12.2
  93.149.120.214
  93.149.233.109
+93.15.41.61
  93.153.95.186
  93.155.164.41
  93.155.194.69
@@ -85460,11 +100412,14 @@
  93.158.228.230
  93.159.141.165
  93.159.141.166
+93.159.215.244
  93.167.67.69
  93.170.113.159
  93.170.129.150
  93.170.15.177
  93.170.53.188
+93.170.53.25
+93.170.53.59
  93.171.205.34
  93.171.208.194
  93.172.212.252
@@ -85512,7 +100467,9 @@
  93.177.82.226
  93.178.200.122
  93.179.102.31
+93.179.118.218
  93.179.197.152
+93.179.202.87
  93.180.157.61
  93.180.178.213
  93.180.51.51
@@ -85530,9 +100487,11 @@
  93.183.196.115
  93.184.164.231
  93.184.164.233
+93.185.104.26
  93.185.4.90
  93.186.104.20
  93.186.148.33
+93.186.200.154
  93.186.201.250
  93.186.201.37
  93.187.182.176
@@ -85543,6 +100502,7 @@
  93.189.145.169
  93.189.221.253
  93.189.29.75
+93.189.30.194
  93.189.43.3
  93.190.138.136
  93.190.138.3
@@ -85563,21 +100523,30 @@
  93.201.116.81
  93.201.236.52
  93.202.182.99
+93.203.35.140
+93.203.65.46
+93.203.81.93
+93.209.113.118
+93.209.123.126
  93.209.179.250
  93.21.224.154
  93.214.168.59
  93.22.37.164
  93.220.46.182
+93.222.181.39
  93.222.192.185
  93.222.201.124
  93.222.218.113
  93.222.227.150
  93.224.119.12
  93.224.54.2
+93.228.85.201
  93.23.196.55
+93.231.205.209
  93.232.1.155
  93.233.227.21
  93.233.229.126
+93.236.228.86
  93.236.43.148
  93.241.53.201
  93.243.24.237
@@ -85586,32 +100555,53 @@
  93.255.124.134
  93.255.154.62
  93.28.211.232
+93.34.223.186
+93.34.236.88
  93.35.186.155
  93.35.225.23
  93.36.189.210
  93.38.127.179
  93.38.127.199
+93.39.27.225
+93.41.187.209
  93.41.193.212
  93.42.196.218
  93.42.224.202
+93.42.59.225
+93.42.7.100
  93.42.78.173
  93.43.193.42
+93.43.223.61
  93.43.231.1
+93.44.90.143
+93.45.93.47
+93.46.147.47
  93.46.54.4
+93.47.217.190
+93.48.121.117
  93.48.88.51
  93.49.164.197
  93.5.72.88
+93.50.125.249
  93.50.177.66
  93.51.199.110
  93.51.212.122
  93.51.247.104
  93.54.116.118
+93.54.99.234
  93.55.242.131
  93.57.249.8
  93.57.81.162
+93.61.137.226
+93.61.137.46
+93.61.73.166
  93.63.173.228
+93.63.209.28
+93.63.37.231
  93.63.75.62
  93.64.183.162
+93.66.26.223
+93.67.138.66
  93.69.7.20
  93.71.204.169
  93.72.149.200
@@ -85625,10 +100615,12 @@
  93.75.190.194
  93.75.197.17
  93.75.48.211
+93.76.241.39
  93.77.71.235
  93.79.235.177
  93.8.133.221
  93.80.130.220
+93.81.220.42
  93.81.252.222
  93.81.9.28
  93.82.220.150
@@ -85639,6 +100631,7 @@
  93.86.49.105
  93.86.68.186
  93.87.123.245
+93.87.123.53
  93.87.17.1
  93.87.28.158
  93.87.74.202
@@ -85651,6 +100644,7 @@
  93.89.68.36
  93.89.81.97
  93.89.84.93
+93.9.64.233
  93.90.147.104
  93.90.206.167
  93.90.207.43
@@ -85659,13 +100653,16 @@
  93.91.146.30
  93.91.197.147
  93.92.205.180
+93.93.246.97
  93.93.46.180
  93.93.71.228
  93.95.100.163
  93.95.100.171
  93.95.102.81
  93.95.217.45
+93.95.24.10
  93.95.88.13
+93.99.133.247
  93.99.153.113
  93.99.176.84
  93.99.53.201
@@ -85712,6 +100709,7 @@
  94.102.49.169
  94.102.49.175
  94.102.49.190
+94.102.49.193
  94.102.49.210
  94.102.49.211
  94.102.49.26
@@ -85746,15 +100744,22 @@
  94.102.63.74
  94.102.8.112
  94.103.120.173
+94.103.41.203
+94.107.162.136
+94.11.66.237
+94.110.120.66
  94.110.203.27
  94.112.121.49
+94.112.122.212
  94.112.132.191
  94.112.142.134
  94.112.237.231
  94.112.72.244
  94.113.116.212
  94.113.116.24
+94.114.122.116
  94.114.158.146
+94.123.161.86
  94.124.18.3
  94.124.193.242
  94.124.6.181
@@ -85784,11 +100789,13 @@
  94.130.179.24
  94.130.179.91
  94.130.180.55
+94.130.191.202
  94.130.20.181
  94.130.207.177
  94.130.214.218
  94.130.220.87
  94.130.222.174
+94.130.34.225
  94.130.35.227
  94.130.64.182
  94.130.69.46
@@ -85805,6 +100812,8 @@
  94.134.152.105
  94.134.17.74
  94.134.176.80
+94.134.92.115
+94.134.92.196
  94.136.138.142
  94.136.154.49
  94.136.154.53
@@ -85821,6 +100830,7 @@
  94.136.63.119
  94.136.69.199
  94.136.69.228bin.sh
+94.137.136.45
  94.139.150.45
  94.139.161.18
  94.140.114.164
@@ -85851,11 +100861,15 @@
  94.142.245.124
  94.143.43.230
  94.143.83.203
+94.152.206.40
  94.152.214.74
  94.153.157.18
  94.153.169.22
+94.153.212.102
  94.153.224.194
+94.153.224.202
  94.153.227.14
+94.154.107.152
  94.154.159.99
  94.154.18.59
  94.154.22.184
@@ -85863,6 +100877,7 @@
  94.154.23.12
  94.154.23.39
  94.154.23.4
+94.154.36.19
  94.155.115.161
  94.155.33.121
  94.155.33.133
@@ -85908,6 +100923,8 @@
  94.158.165.19
  94.158.245.114
  94.158.245.15
+94.158.245.8
+94.159.31.10
  94.159.6.254
  94.16.104.221
  94.16.105.121
@@ -85941,8 +100958,10 @@
  94.178.127.231
  94.179.133.22
  94.179.135.230
+94.18.228.213
  94.18.231.202
  94.180.246.38
+94.180.247.20
  94.180.249.187
  94.180.253.213
  94.180.57.15
@@ -85956,6 +100975,7 @@
  94.183.40.126
  94.185.83.100
  94.185.85.45
+94.187.0.74
  94.188.28.106
  94.188.39.158
  94.189.132.47
@@ -85970,10 +100990,15 @@
  94.190.177.213
  94.190.76.239
  94.191.107.157
+94.191.122.43
  94.191.125.97
  94.191.18.28
  94.191.2.245
+94.191.66.227
+94.191.71.246
+94.191.75.220
  94.192.225.46
+94.192.252.42
  94.195.113.109
  94.195.15.179
  94.198.1.179
@@ -85993,6 +101018,7 @@
  94.20.233.153
  94.200.114.162
  94.200.126.42
+94.200.17.144
  94.200.178.238
  94.200.195.218
  94.200.38.114
@@ -86013,7 +101039,10 @@
  94.212.219.138
  94.213.107.137
  94.216.194.14
+94.218.218.255
  94.22.47.242
+94.224.187.205
+94.226.118.211
  94.227.238.178
  94.227.40.54
  94.228.10.70
@@ -86033,6 +101062,7 @@
  94.23.150.165
  94.23.154.171
  94.23.16.193
+94.23.160.33
  94.23.179.193
  94.23.179.199
  94.23.19.147
@@ -86042,10 +101072,13 @@
  94.23.201.78
  94.23.205.110
  94.23.205.32
+94.23.206.122
  94.23.21.80
+94.23.211.60
  94.23.214.15
  94.23.216.33
  94.23.220.214
+94.23.222.84
  94.23.229.64
  94.23.236.143
  94.23.237.171
@@ -86060,6 +101093,7 @@
  94.23.4.47
  94.23.40.27
  94.23.44.120
+94.23.45.15
  94.23.45.86
  94.23.51.183
  94.23.69.61
@@ -86079,8 +101113,11 @@
  94.231.80.100
  94.232.11.178
  94.232.126.225
+94.232.136.126
  94.232.200.144
  94.232.41.147
+94.232.46.160
+94.232.46.227
  94.236.182.92
  94.236.23.242
  94.236.252.139
@@ -86088,8 +101125,13 @@
  94.237.64.138
  94.237.80.207
  94.237.93.251
+94.239.252.253
  94.240.30.99
+94.241.165.150
+94.241.165.245
  94.241.236.84
+94.242.144.122
+94.242.151.28
  94.242.206.153
  94.242.206.227
  94.242.206.75
@@ -86114,10 +101156,13 @@
  94.243.24.60
  94.244.28.246
  94.244.97.244
+94.246.160.153
  94.247.134.77
  94.247.241.70
+94.248.134.248
  94.249.160.37
  94.249.171.58
+94.249.18.104
  94.249.224.108
  94.249.224.171
  94.249.224.180
@@ -86127,6 +101172,7 @@
  94.25.148.188
  94.25.228.74
  94.25.94.235
+94.25.95.138
  94.250.17.120
  94.250.248.75
  94.250.254.147
@@ -86138,21 +101184,34 @@
  94.26.49.71
  94.27.233.103
  94.28.31.99
+94.30.4.22
+94.31.100.251
+94.31.100.50
+94.31.99.58
+94.32.243.132
  94.32.66.15
+94.33.52.61
  94.34.224.165
+94.38.254.200
+94.4.144.114
  94.40.127.166
+94.40.75.25
  94.40.87.20
  94.42.144.10
  94.43.101.161
  94.43.101.202
+94.43.132.18
  94.43.139.153
  94.43.139.185
  94.43.139.99
  94.43.191.27
+94.43.85.6
+94.44.110.131
  94.46.15.100
  94.46.186.242
  94.46.186.49
  94.46.3.139
+94.49.241.108
  94.5.135.197
  94.50.27.119
  94.51.211.188
@@ -86163,29 +101222,39 @@
  94.53.0.116
  94.53.120.109
  94.55.126.2
+94.56.137.88
  94.57.252.133
  94.57.252.147
  94.59.162.165
  94.60.136.242
+94.61.159.92
  94.62.137.251
+94.62.172.40
  94.62.201.87
  94.62.37.130
  94.64.254.217
  94.65.56.190
+94.66.221.255
  94.66.80.40
  94.66.99.83
  94.67.207.203
  94.67.252.68
  94.68.139.55
  94.68.141.68
+94.68.160.204
+94.69.226.48
  94.70.170.50
  94.72.143.26
  94.72.158.1
  94.72.158.129
+94.73.19.144
  94.74.124.248
+94.74.142.79
  94.74.148.132
  94.74.148.136
  94.74.150.196
+94.74.168.153
+94.74.181.190
  94.75.133.111
  94.75.207.99
  94.75.228.26
@@ -86197,6 +101266,7 @@
  94.75.98.91
  94.76.247.61
  94.76.92.10
+94.78.68.8
  94.79.4.53
  94.79.54.195
  94.9.58.78
@@ -86247,6 +101317,7 @@
  95.0.66.43
  95.0.66.82
  95.0.66.97
+95.0.93.218
  95.104.114.50
  95.104.54.227
  95.104.7.153
@@ -86268,6 +101339,7 @@
  95.110.194.245
  95.110.200.241
  95.110.224.127
+95.110.224.169
  95.110.224.30
  95.110.226.93
  95.110.234.93
@@ -86275,6 +101347,7 @@
  95.111.234.125
  95.111.235.189
  95.111.236.142
+95.111.239.17
  95.111.242.42
  95.111.244.99
  95.111.245.205
@@ -86286,6 +101359,7 @@
  95.114.38.196
  95.114.6.185
  95.115.104.163
+95.115.13.142
  95.115.86.91
  95.116.1.182
  95.118.17.101
@@ -86324,10 +101398,15 @@
  95.13.95.115
  95.13.95.24
  95.130.13.147
+95.130.168.234
  95.131.70.76
+95.132.255.221
+95.133.163.58
  95.133.163.98
  95.134.130.182
  95.135.142.198
+95.135.142.214
+95.136.111.129
  95.136.47.170
  95.136.9.157
  95.137.156.236
@@ -86593,6 +101672,7 @@
  95.141.17.97
  95.141.17.98
  95.141.17.99
+95.141.232.2
  95.141.36.112
  95.141.41.24
  95.142.121.32
@@ -86625,9 +101705,13 @@
  95.143.22.165
  95.143.22.171
  95.143.22.74
+95.144.230.245
+95.146.159.140
  95.15.140.230
  95.15.162.191
  95.152.55.190
+95.153.112.39
+95.153.126.185
  95.153.167.63
  95.153.31.84
  95.153.31.87
@@ -86657,7 +101741,7 @@
  95.158.217.19
  95.158.63.46
  95.158.63.61
-95.160.190.176
+95.160.23.204
  95.160.38.59
  95.161.12.45
  95.161.188.246
@@ -86670,21 +101754,36 @@
  95.163.192.75
  95.163.196.101
  95.163.207.184
+95.163.255.33
+95.163.255.35
  95.164.65.194
  95.165.104.89
+95.165.108.113
  95.165.132.48
  95.165.133.122
+95.165.150.25
  95.165.160.18
  95.165.160.46
  95.165.163.188
  95.165.164.170
+95.165.167.37
+95.165.172.171
+95.165.174.191
  95.165.252.94
  95.165.27.166
  95.165.28.122
+95.166.153.199
  95.167.123.54
+95.167.139.66
  95.167.159.250
  95.167.178.149
+95.167.20.142
+95.167.9.218
+95.168.120.216
+95.168.120.250
+95.168.121.24
  95.168.164.220
+95.168.167.187
  95.168.170.105
  95.168.96.42
  95.169.1.147
@@ -86692,7 +101791,10 @@
  95.169.181.121
  95.169.213.76
  95.169.22.100
+95.169.5.166
  95.169.6.123
+95.169.6.47
+95.169.9.45
  95.169.92.3
  95.17.44.96
  95.170.115.154
@@ -86712,6 +101814,7 @@
  95.174.123.14
  95.174.124.153
  95.174.15.228
+95.174.182.34
  95.174.65.232
  95.174.66.211
  95.174.8.194
@@ -86738,12 +101841,17 @@
  95.179.210.17
  95.179.212.50
  95.179.214.152
+95.179.225.249
  95.179.250.205
  95.180.167.208
+95.181.131.153
  95.181.131.199
  95.181.148.96
  95.181.151.194
  95.181.151.198
+95.181.155.67
+95.181.157.243
+95.181.172.124
  95.181.214.105
  95.181.230.146
  95.181.236.133
@@ -86753,13 +101861,16 @@
  95.182.123.194
  95.182.126.185
  95.182.126.25
+95.182.213.55
  95.183.51.24
  95.183.52.148
  95.183.55.40
+95.186.130.175
  95.187.50.31
  95.188.71.19
  95.189.218.48
  95.189.78.2
+95.19.126.128
  95.19.50.131
  95.19.50.46
  95.19.50.90
@@ -86768,6 +101879,7 @@
  95.208.253.143
  95.209.155.91
  95.21.243.117
+95.210.227.169
  95.211.10.160
  95.211.103.175
  95.211.118.194
@@ -86815,6 +101927,7 @@
  95.214.235.76
  95.214.53.154
  95.214.54.84
+95.215.1.221
  95.215.19.22
  95.215.206.244
  95.215.44.12
@@ -86827,6 +101940,7 @@
  95.215.62.171
  95.216.0.251
  95.216.10.237
+95.216.107.148
  95.216.11.156
  95.216.11.160
  95.216.11.237
@@ -86848,6 +101962,7 @@
  95.216.187.94
  95.216.19.95
  95.216.192.143
+95.216.194.33
  95.216.197.12
  95.216.198.89
  95.216.2.227
@@ -86855,6 +101970,7 @@
  95.216.207.86
  95.216.209.249
  95.216.21.47
+95.216.219.12
  95.216.226.201
  95.216.226.218
  95.216.227.168
@@ -86943,12 +102059,17 @@
  95.220.131.150
  95.222.190.255
  95.222.97.149
+95.223.73.193
+95.223.73.240
+95.223.73.246
  95.224.117.226
  95.225.157.7
  95.227.198.80
+95.227.234.14
  95.229.138.72
  95.229.138.87
  95.231.87.112
+95.232.26.197
  95.233.68.206
  95.234.98.85
  95.235.60.135
@@ -86956,13 +102077,18 @@
  95.244.104.178
  95.245.172.169
  95.247.233.159
+95.25.12.177
+95.25.45.35
  95.25.5.51
  95.25.69.45
  95.25.99.161
  95.251.21.64
  95.251.9.69
+95.252.44.37
  95.253.100.189
  95.253.238.77
+95.255.173.199
+95.255.69.58
  95.28.1.134
  95.28.248.49
  95.29.42.110
@@ -86986,6 +102112,7 @@
  95.50.22.78
  95.50.85.99
  95.51.180.226
+95.52.199.169
  95.54.196.135
  95.55.95.187
  95.56.104.238
@@ -86998,6 +102125,7 @@
  95.59.7.26
  95.6.64.145
  95.6.70.92
+95.65.1.93
  95.65.124.252
  95.65.30.156
  95.65.81.152
@@ -87034,6 +102162,8 @@
  95.79.35.133
  95.79.41.188
  95.79.45.205
+95.79.50.121
+95.79.56.120
  95.79.57.206
  95.80.10.185
  95.80.252.189
@@ -87043,6 +102173,7 @@
  95.80.85.33
  95.80.85.67
  95.80.89.138
+95.81.105.187
  95.82.146.70
  95.82.176.138
  95.83.73.31
@@ -87066,9 +102197,12 @@
  95.85.23.210
  95.85.25.101
  95.85.26.75
+95.85.28.125
  95.85.28.173
  95.85.30.184
  95.85.31.179
+95.85.33.224
+95.85.34.53
  95.85.37.17
  95.85.38.127
  95.85.38.226
@@ -87076,6 +102210,7 @@
  95.85.39.204
  95.85.39.31
  95.85.4.166
+95.85.43.241
  95.85.47.227
  95.85.48.164
  95.85.49.72
@@ -87086,6 +102221,7 @@
  95.85.61.36
  95.85.8.239
  95.85.9.204
+95.85.9.94
  95.86.32.4
  95.86.37.1
  95.87.14.3
@@ -87098,10 +102234,17 @@
  95.9.150.33
  95.9.180.128
  95.9.194.13
+95.9.3.43
  95.9.5.93
+95.90.182.142
+95.90.198.207
+95.90.232.212
  95.90.32.63
  95.90.6.49
+95.91.224.158
  95.91.45.50
+95.91.76.137
+95.92.54.180
  95.97.209.10
  95.97.27.33
  950-365.com
@@ -87152,6 +102295,8 @@
  96.227.131.249
  96.231.141.105
  96.231.145.254
+96.231.245.19
+96.231.245.20
  96.233.194.4
  96.233.77.159
  96.237.114.206
@@ -87160,6 +102305,8 @@
  96.239.17.242
  96.241.75.151
  96.242.147.73
+96.242.5.87
+96.244.219.200
  96.244.58.127
  96.245.74.37
  96.247.202.109
@@ -87169,6 +102316,7 @@
  96.254.171.10
  96.255.139.230
  96.255.84.96
+96.27.249.5
  96.3.23.178
  96.30.195.215
  96.30.51.176
@@ -87178,7 +102326,13 @@
  96.39.152.89
  96.39.76.211
  96.41.157.101
+96.42.163.199
+96.43.106.210
+96.43.106.227
  96.43.106.239
+96.43.106.246
+96.43.106.247
+96.43.106.251
  96.44.128.250
  96.44.130.190
  96.44.133.34
@@ -87186,7 +102340,9 @@
  96.44.142.250
  96.44.148.86
  96.44.156.210
+96.44.162.82
  96.44.179.242
+96.44.191.156
  96.46.0.208
  96.46.146.254
  96.46.16.216
@@ -87198,19 +102354,23 @@
  96.47.224.42
  96.47.230.215
  96.47.230.238
+96.47.230.253
  96.48.243.148
  96.49.63.16
  96.50.41.57
  96.54.225.175
+96.56.213.182
  96.56.221.138
  96.57.24.186
  96.57.248.252
  96.57.99.138
  96.61.113.203
  96.64.29.46
+96.66.155.147
  96.66.200.209
  96.67.86.201
  96.67.86.202
+96.69.13.140
  96.69.8.235
  96.69.88.83
  96.70.52.227
@@ -87219,6 +102379,7 @@
  96.72.36.136
  96.75.134.85
  96.77.146.148
+96.77.231.29
  96.77.43.233
  96.77.77.53
  96.79.125.33
@@ -87231,13 +102392,17 @@
  96.80.107.217
  96.82.74.129
  96.82.74.134
+96.83.6.121
  96.84.128.196
+96.84.149.98
  96.85.35.233
+96.85.9.73
  96.86.235.11
  96.87.184.101
  96.87.188.193
  96.88.212.146
  96.9.183.85
+96.9.208.177
  96.9.209.210
  96.9.45.2
  96.9.66.112
@@ -87257,10 +102422,12 @@
  96.9.86.70
  96.9.88.139
  96.9.90.58
+96.9.92.236
  96.91.14.37
  96.91.204.122
  96.92.157.164
  96.92.208.34
+96.93.196.89
  96.94.168.154
  96.ip-51-255-193.eu
  960365365.com
@@ -87284,7 +102451,9 @@
  97.100.102.185
  97.102.190.4
  97.102.206.250
+97.103.253.103
  97.104.107.190
+97.107.127.161
  97.107.127.214
  97.107.131.216
  97.107.133.164
@@ -87391,6 +102560,7 @@
  97.112.93.83
  97.112.95.198
  97.112.95.37
+97.112.96.11
  97.112.96.128
  97.112.97.193
  97.112.97.24
@@ -87492,6 +102662,7 @@
  97.119.147.17
  97.119.154.32
  97.119.161.238
+97.119.174.12
  97.119.176.118
  97.119.186.214
  97.119.188.176
@@ -87620,9 +102791,12 @@
  97.127.254.240
  97.127.94.28
  97.127.96.30
+97.64.121.65
+97.64.122.66
  97.64.18.147
  97.64.19.42
  97.64.23.80
+97.64.25.167
  97.64.28.21
  97.64.32.103
  97.64.33.182
@@ -87636,6 +102810,7 @@
  97.69.160.248
  97.69.166.228
  97.70.66.168
+97.71.122.146
  97.73.104.2
  97.74.119.80
  97.74.215.181
@@ -87643,9 +102818,22 @@
  97.74.232.157
  97.74.237.196
  97.74.24.101
+97.74.24.113
+97.74.24.115
+97.74.24.181
+97.74.24.193
  97.74.24.194
  97.74.24.197
+97.74.24.198
+97.74.24.202
+97.74.24.214
+97.74.24.220
+97.74.24.221
+97.74.24.222
  97.74.24.227
+97.74.24.42
+97.74.24.46
+97.74.24.9
  97.74.4.42
  97.74.6.64
  97.76.170.128
@@ -87655,10 +102843,13 @@
  97.81.244.191
  97.82.79.83
  97.83.173.243
+97.84.246.39
  97.85.36.15
  97.88.8.34
+97.88.92.46
  97.90.115.171
  97.90.49.141
+97.91.168.203
  97.93.106.70
  97.93.25.93
  97.93.56.222
@@ -87685,6 +102876,7 @@
  97sm.org
  98.10.200.34
  98.100.202.106
+98.100.92.218
  98.102.222.30
  98.109.133.80
  98.109.159.216
@@ -87760,7 +102952,9 @@
  98.126.215.93
  98.126.215.98
  98.126.23.24
+98.127.248.217
  98.128.152.150
+98.128.212.156
  98.129.77.98
  98.13.75.196
  98.130.2.58
@@ -87768,18 +102962,26 @@
  98.142.101.148
  98.142.129.101
  98.142.130.22
+98.142.139.4
+98.142.141.184
+98.142.143.152
  98.142.221.132
  98.143.104.200
+98.143.148.45
  98.145.214.112
+98.146.133.73
+98.146.212.146
  98.15.140.226
  98.151.250.238
  98.154.3.215
  98.154.87.18
  98.155.152.218
+98.155.92.137
  98.156.108.211
  98.156.162.236
  98.157.100.159
  98.157.226.168
+98.157.53.1
  98.159.110.14
  98.159.110.19
  98.159.110.2
@@ -87808,9 +103010,13 @@
  98.159.99.39
  98.159.99.58
  98.162.215.224
+98.162.223.145
+98.162.25.10
+98.162.25.15
  98.162.25.23
  98.162.25.29
  98.162.25.7
+98.162.96.40
  98.162.96.41
  98.162.96.52
  98.164.165.136
@@ -87823,6 +103029,7 @@
  98.169.195.23
  98.17.20.170
  98.170.208.161
+98.170.57.236
  98.172.191.218
  98.172.31.3
  98.172.69.141
@@ -87831,7 +103038,12 @@
  98.176.99.110
  98.178.240.9
  98.179.182.136
+98.180.217.149
  98.183.37.222
+98.184.33.193
+98.184.33.208
+98.184.33.210
+98.184.33.215
  98.185.94.76
  98.185.94.94
  98.186.166.96
@@ -87844,6 +103056,7 @@
  98.191.71.139
  98.192.74.164
  98.193.226.113
+98.195.176.219
  98.197.167.31
  98.197.37.7
  98.197.62.37
@@ -87851,7 +103064,10 @@
  98.198.66.110
  98.199.196.197
  98.200.189.189
+98.201.121.56
+98.202.232.157
  98.202.232.200
+98.202.242.231
  98.203.158.159
  98.203.162.230
  98.203.244.40
@@ -87875,6 +103091,7 @@
  98.236.166.189
  98.239.128.154
  98.24.30.170
+98.243.51.139
  98.246.66.238
  98.247.106.211
  98.247.52.166
@@ -87892,6 +103109,7 @@
  98.29.195.204
  98.32.83.73
  98.33.38.48
+98.34.81.140
  98.35.16.77
  98.36.161.129
  98.37.180.23
@@ -87942,11 +103160,14 @@
  99.119.110.201
  99.123.224.151
  99.127.234.110
+99.135.183.110
  99.14.51.66
  99.148.197.14
  99.152.32.222
  99.164.139.172
+99.184.69.177
  99.192.218.142
+99.192.31.2
  99.194.106.207
  99.194.108.190
  99.194.11.99
@@ -88014,6 +103235,7 @@
  99.195.41.22
  99.195.43.114
  99.195.43.194
+99.195.44.252
  99.195.81.167
  99.195.81.53
  99.195.82.245
@@ -88021,6 +103243,7 @@
  99.195.83.18
  99.195.85.179
  99.195.86.41
+99.195.87.89
  99.195.88.183
  99.195.88.8
  99.195.90.121
@@ -88048,7 +103271,9 @@
  99.255.184.174
  99.29.112.187
  99.33.195.164
+99.34.232.58
  99.35.17.235
+99.4.181.245
  99.40.165.203
  99.47.110.147
  99.54.134.182
@@ -88481,7 +103706,6 @@ a99d0fd2789c860fd278cd1.icu
  a9adasfafsdg.kplewrao.com
  a9bc.com
  a9cny.svcoding.com
-a9ea1e0ffc31.ngrok.io
  a9f0.addroits.com
  a9qth.addroits.com
  a9xr.mentriqq.com
@@ -88912,7 +104136,6 @@ abledaypay.com
  ablenew.biz
  ablerefrigeration.com
  ablewelders.com
-ablexfieluteetxm-dot-revalidate-icaan-domain.ue.r.appspot.com
  ablojolu.shoesmogul.com
  abloomhc.com
  abmauhhqewhsgxnw-dot-millinium.ey.r.appspot.com
@@ -88948,6 +104171,11 @@ abn-listing-host-39002.site
  abn-mobiel.top
  abn-nb.welcome-guest-julia-29-sept-10-oct.host
  abn-update.link
+abn.app-host-list-48139.icu
+abn.app-list-61282.casa
+abn.app-list-61283.casa
+abn.app-list-91783.casa
+abn.app-list-97192.casa
  abn.co-host-listing-24560.casa
  abn.co-host-listing-24965.casa
  abn.co-host-listing-27401.casa
@@ -89100,7 +104328,6 @@ abservshplesttngpkun.my.id
  abshhuhi-wnafb.com
  absieubhceabjsypdjbzualxftcacqucnyjp-dot-off94032393204.uk.r.appspot.com
  absimpex.com
-absmail.weebly.com
  absogain.ir
  absolutaservicos.com
  absolute-vertex-289818.ey.r.appspot.com
@@ -89146,6 +104373,7 @@ abusalaha.com
  abusaliha.com
  abusalihanow.com
  abuse-js.link
+abuse-paypal267.com
  abuse48paypal.com
  abuseamz-support.com
  abushsnakkaan.com
@@ -89647,6 +104875,7 @@ access-my-payee.uk
  access-onlineclients.com
  access-paypai.servehalflife.com
  access-paypal.web.westandasoneblog.com
+access-paypal285.com
  access-prepayment.serveirc.com
  access-pymentdata.serveirc.com
  access-secure-support-verify.mpsha.com
@@ -89686,6 +104915,7 @@ accesso-app-mobile.com
  accesso-app.com
  accesso-area-clienti-fcc-id3086339004431200.000webhostapp.com
  accesso-bloccato.com
+accesso-conto-web.com
  accesso-conto.eu
  accesso-conto.info
  accesso-info-portale.net
@@ -90530,6 +105760,7 @@ accountverify-twitter.somee.com
  accountverifysupport.live
  accountviewer.stellar.org.connect-wallet.com
  accountviewer.stellar.org.launch-stellar.org
+accountvirus.guru
  accountvk.000webhostapp.com
  accountwelcomedagdog.com
  accounupdateonline.weebly.com
@@ -90734,6 +105965,7 @@ achutamanasa.com
  aci-capital.net
  aci.serabd.com
  acid-fast-march.000webhostapp.com
+acidaburasnshkjs.us
  acidentallyonpurpose.com
  acidicpalemegahertz--five-nine.repl.co
  acidulent-rib.000webhostapp.com
@@ -90922,6 +106154,7 @@ activacionesdeproducto.com
  activacionesgrupomultiredbn2-com.xyz
  activacionespersonas-bnzonasegvra39.xyz
  activacionessegurasclientes.com
+activadigital-1.com
  activadigitalsmszonabn-1.com
  activadordigitalcr.com
  activadorvirtual-cr.com
@@ -91113,6 +106346,7 @@ acupunctureup.in
  acustica.ec
  acusticjjw.pl
  acusyposaq.gq
+acute-excited-termite.glitch.me
  acutelogisticsltd.com
  acuzajt.gikorip.net
  acvdltpcdmmkdtdh-dot-millinium.ey.r.appspot.com
@@ -91240,7 +106474,6 @@ addddsdddfddsa.xyz
  added-newpayee-lloyds.com
  addedpayee-authentication.com
  addedpayeesupport.com
-addedpayeeverify.com
  addergytech.com
  addevin.xyz
  addflux.com
@@ -91265,6 +106498,7 @@ addon-on-apple.basidi.net
  addon-told.web.app
  addonitservices.com
  addpayment-appld843.servebeer.com
+addpraise.buzz
  addresscomplex.com
  addressdigress.com
  addressingtheunaddressedindiafoundation.com
@@ -91537,7 +106771,6 @@ admiralmarketsltd.com
  admirelog.com
  admiring-curran-5ae35f.netlify.app
  admiring-goldstine-f942bc.netlify.app
-admiring-hermann-b48c7c.netlify.app
  admiring-mcclintock-863f18.netlify.com
  admiring-stonebraker-197734.netlify.app
  admission.tuf.edu.pk
@@ -91549,6 +106782,7 @@ admloja10.monster
  admmega.zapto.org
  admofinstagr.000webhostapp.com
  admolex.com
+admonbank.buzz
  admos-gleitlager.de
  admotion.cl
  admotor.hillstationstudio.com
@@ -91619,6 +106853,7 @@ adocmx.com
  adoemprendedor.creatorlink.net
  adolphsrealestate.com
  adon.one
+adonaeqvcrxzrqnxonvrkquszi-dot-gl9393jan.uk.r.appspot.com
  adongbook.com
  adongcomic.com
  adoptawufperuu.000webhostapp.com
@@ -92055,6 +107290,7 @@ aelogica.com
  aeloud.ru
  aelpk.com
  aelpsrsemzwnafja-dot-millinium.ey.r.appspot.com
+aelvpglvkkzevdtlykxtlbmcmz-dot-gl9393jan.uk.r.appspot.com
  aemqcgxbsfthwrth-dot-millinium.ey.r.appspot.com
  aeneolithic-patches.000webhostapp.com
  aenesde.com
@@ -92066,6 +107302,7 @@ aeolius.net
  aeonianmedia.com
  aeonluxe.com.ph
  aeoraliat.com
+aeowmdlqusdbfher.shop
  aepamimxnvoowpko-dot-millinium.ey.r.appspot.com
  aepbexpphdllcqdf-dot-millinium.ey.r.appspot.com
  aeqjjclqbukmcdsd-dot-millinium.ey.r.appspot.com
@@ -92201,6 +107438,7 @@ afeestgk276j-buxod-com.eoldal.hu
  afertille.cloudaccess.host
  afet.ml
  affableguru.com
+affairboom.guru
  affaldsbeholderskraldecontainercom.shaxiaca.top
  affancollections.com
  affectionate-northcutt-f7f341.netlify.com
@@ -92397,6 +107635,7 @@ agarwalrishte.com
  agazetadepiraquara.com.br
  agbanibeautycontest.000webhostapp.com
  agbmjqadhpvqxpwc-dot-millinium.ey.r.appspot.com
+agbnwlvlogmwqogwvfvgjlxlxg-dot-gl9393jan.uk.r.appspot.com
  agbo-chinaonline.com
  agbofx.goruli.com
  agboolafarms.com
@@ -92569,6 +107808,7 @@ agiegoeig.com
  agieshorma.com
  agifxhkbkqkrfxyc-dot-millinium.ey.r.appspot.com
  agighana.org
+agihmilgwlbnjbzazwnnucloha-dot-gl9393jan.uk.r.appspot.com
  agikurier.org
  agile.org.il
  agilebusinessguide.com
@@ -92594,6 +107834,7 @@ agirlsvideos6.xyz
  agirlsvideos7.xyz
  agirlsvideos8.xyz
  agitated-panini-ed4eeb.netlify.app
+agitated-swanson-2400de.netlify.app
  agitiste.com
  agiye.com
  agkewqorzxmcbvznfqiroeid-97550011473jp.com.zxzlhtj.cn
@@ -92747,6 +107988,7 @@ agusbatik.xyz
  agustindivide.buzz
  agutukqxtrixbptwjvvcbatogajuhdkhwckb-dot-gl494903049.wl.r.appspot.com
  agvc.goruli.com
+agvfmekjjmmqynkjugzirwueig-dot-gleow2021ja.ue.r.appspot.com
  agvizhnkzzntnddq-dot-millinium.ey.r.appspot.com
  agvjidssqclenckj-dot-millinium.ey.r.appspot.com
  agvkafygnyqlgpkd-dot-millinium.ey.r.appspot.com
@@ -92799,6 +108041,7 @@ aherngangmes.com
  ahf4ycvea439tt9rq.site
  ahgdogalpazar.com
  ahger4334.duckdns.org
+ahgklexlhlsgngbteccfbfulvw-dot-gl9393jan.uk.r.appspot.com
  ahhcydtaugkgjchcu.com
  ahhkucqqxcyvudnj-dot-millinium.ey.r.appspot.com
  ahhpjj.com
@@ -92899,6 +108142,7 @@ ahzh-pv.com
  ahznatthozgzzxvv-dot-millinium.ey.r.appspot.com
  ahzrydaxfrmmcayj-dot-millinium.ey.r.appspot.com
  ahzxy.com
+ai-match-ranking.club
  ai-spt.jp
  ai.woogo.net
  ai4africa.org
@@ -92920,6 +108164,7 @@ aicaiqwpvjhpqesulkhjlyhgjq-dot-gleowayel400503.uc.r.appspot.com
  aicebit.com
  aicegrz.goruli.com
  aiceita.co.za
+aicfftuocaeihzwqhrtthhsreo-dot-gl9393jan.uk.r.appspot.com
  aicll2020.sastra.uisu.ac.id
  aicovid19.com
  aicv.info
@@ -92950,6 +108195,7 @@ aiddattiaddetallebbi.org
  aideah.com
  aidesociale19.com
  aidesociale2020.com
+aidfeast.guru
  aidosmarketcoins.org
  aidrqrgcoewqjkdflkasjgr-id35667410993.com.zlftzjp.cn
  aidrwodgkeslziewoid-rqi99005577663co.com.evcxruf.cn
@@ -93240,6 +108486,7 @@ ajbxuvlecof.xyz
  ajchuqbpnnhniogs-dot-millinium.ey.r.appspot.com
  ajczfarnbuggoejl-dot-millinium.ey.r.appspot.com
  ajdevelopmentgroup.com
+ajecwgrhdgblvwarnllvuflsie-dot-gl9393jan.uk.r.appspot.com
  ajedrezenmorelos.com
  ajeetbisen.com
  ajexdntaakevcvsc-dot-millinium.ey.r.appspot.com
@@ -93285,6 +108532,7 @@ ajs-c.com
  ajsdwzjuuqqekouongeqchhhcn-dot-gleowayel400503.uc.r.appspot.com
  ajstudiollc.com
  ajtz9.mentriqq.com
+ajtzgjnjoidhznatlgeccfpxeb-dot-gl9393jan.uk.r.appspot.com
  ajustconta.cf
  ajuste-centraliar-meu-cadastro.000webhostapp.com
  ajuwel.com
@@ -93390,11 +108638,13 @@ akioplt.com
  akiorg.batwoqishort.top
  akioyjyzmkzilblg-dot-millinium.ey.r.appspot.com
  akitaugandasafaris.com
+akitggdpyrceeovnhejugfrnwg-dot-gl9393jan.uk.r.appspot.com
  akitus.com
  akiwdzrsxaplelue-dot-millinium.ey.r.appspot.com
  akj-crypto.com
  akjfsdrfnem.com
  akjhgfdspokjhdss.000webhostapp.com
+akjhunhgfmexwjuflcoqpiiisz-dot-gl9393jan.uk.r.appspot.com
  akjskabd.weebly.com
  akjugm.shoesmogul.com
  akkauntmax4.myjino.ru
@@ -93825,6 +109075,7 @@ alert-device-uk.com
  alert-device.cc
  alert-devicepayee.com
  alert-deviceprotection.live
+alert-devices-payeealert.com
  alert-disableupdate.servebeer.com
  alert-fb-security-account.nogueiracontabil.com
  alert-messageunderrequest.xyz
@@ -93833,6 +109084,7 @@ alert-newdevice-attempt.link
  alert-newpayee.com
  alert-newpayeenotice.com
  alert-online-protection.cc
+alert-pay-hali.com
  alert-payee-detected.cc
  alert-payee-device.com
  alert-payeesecurity.com
@@ -94194,7 +109446,6 @@ alignmentconsulting.xyz
  aliibaba.cf
  aliiydr.xyz
  alika.com.br
-alike-hexagonal-character.glitch.me
  alilisaw.com
  alimdhg.com
  alimentacaosaudeebemestar.com.br
@@ -94204,6 +109455,7 @@ aliminksrl.ml
  alimstores.com
  alina.kenshung.com
  alinaltdwkz.ru
+alindew.tk
  alinebandeira.com.br
  alinestudio.co.za
  alinhador3d.com.br
@@ -94230,8 +109482,8 @@ alistarsecurityromania.com
  alistblogging.net
  alitamo.us
  aliva.ca
+alive4me.buzz
  alivecomputerservice.top
-alively.de
  alivesupport.ml
  alivesupportcenter.com
  alivianutricion.com
@@ -94607,6 +109859,7 @@ alopsitta.vard-forum.ru
  aloput.xyz
  aloradovettiprocedereconilprocessodiesereattivo.accesscam.org
  alordharaschool.com
+alosalamfenhadlaghborakhayghberto.blogspot.com
  alosojosdelmundo.com
  alova.in
  alova.life
@@ -94737,6 +109990,7 @@ alt-jabel.de
  alta-brasiil.com
  altafbrothers.com
  altaftailor.com.au
+altaibalancee.buzz
  altaiheater.buzz
  altaikawater.com
  altaiwork.buzz
@@ -94832,6 +110086,7 @@ alvorkitecenter.com
  alwafincompany.com
  alwahanews.com
  alwalaatours.com
+alwasilla.com
  alwatan.com.bd
  alwatania-co.com
  always-easymeeting.com
@@ -94852,6 +110107,7 @@ alysonhoward.com
  alzaemalazawi2000.000webhostapp.com
  alzahrani-online.com
  alzheimersacademy.org
+alzhmpndglriiqeknssnxdjexi-dot-gl9393jan.uk.r.appspot.com
  alzjlmjgdqlhdviw-dot-millinium.ey.r.appspot.com
  alzknggmhnsdpgpd-dot-millinium.ey.r.appspot.com
  am-concepts.ca
@@ -95108,6 +110364,7 @@ amazcn.co.jp-c163358b6b1a5093f8b9e1c7574af32f22708d71.ph
  amazcn.co.jp-d54c37e7c3c55d6a547b0bc7567a9fd585dcd4dd.ph
  amazcn.co.jp-fca0ca029f9f6e6ee4da108babb11847ded43710.ph
  amazcncojp-accountverify.xyz
+amazcnr-oo.jp.infoamazonjp.xyz
  amazconfirmarmo.com
  amazdjfqslrcdubqgeidklqgdv-dot-gleowayel400503.uc.r.appspot.com
  amazeamazon.ddns.net
@@ -95475,7 +110732,6 @@ amazon-p10.app
  amazon-pagesignin2.serveirc.com
  amazon-payment-declineds.theworkpc.com
  amazon-payment.duarmemek.org
-amazon-payw.top
  amazon-prime-apps-service.gjedrdfvs.com
  amazon-prime-jp.co
  amazon-primejp.online
@@ -97335,8 +112591,8 @@ amozon.co.jp-fca0ca029f9f6e6ee4da108babb11847ded43710.ph
  amozon.co.jp.aeabkm9567.icu
  amozon.co.jp.aghcy5455.icu
  amozon.co.jp.signine-amnzocn.in
+amozon.co.jp.sing-amonan.top
  amozon.co.jp.sing-amzonaz.top
-amozon.co.jp.sing-amzonea.top
  amozon.co.jp.sinng-amuano.in
  amozon.co.jp.sinung-aoumeon.cc
  amozon.co.jp.siung-amuzanou.cc
@@ -97351,6 +112607,7 @@ ampersandindia.com
  amphibischeswohnennet.shaxiacommittee.top
  amphibito.xyz
  ampisolabergeggi.it
+ampkgmbvtysiniozlfwpzneaex-dot-gl9393jan.uk.r.appspot.com
  amplifyonline.co.za
  ampogrewit.gq
  ampoidal.com
@@ -97362,6 +112619,7 @@ ampunnengnabillah.servebeer.com
  ampvaqourgjkjcngsofezmklcwvjkxjcnwvx-dot-cedar-code-289917.nn.r.appspot.com
  amqelendez.com
  amqkasiveongxbal-dot-millinium.ey.r.appspot.com
+amqqasocbzttpraiuwwioatkjo-dot-gl9393jan.uk.r.appspot.com
  amrcdukmhypsffbcyq.top
  amrcin-co-jpservice.xyz
  amrdlm.goruli.com
@@ -97391,6 +112649,7 @@ amsaiudhasiodhjnasuiohgdqwiofjiogjwepqfgaszdfcqaswdfqaw.asiofhunjqioaaosidhaio.s
  amsder.com
  amsdsa12dsbdl.yhrmktf.cn
  amsev.com
+amshcamcrtgeetzbxbbzigpbjr-dot-gl9393jan.uk.r.appspot.com
  amsjcwqgspidgvvi-dot-millinium.ey.r.appspot.com
  amsjeggegsd.com
  amsjeggegsdbhfg.com
@@ -97430,6 +112689,7 @@ amvbylrohzowzfrsbqjpmvsivf-dot-gleowayel400503.uc.r.appspot.com
  amvhikbqodpolbwh-dot-millinium.ey.r.appspot.com
  amviciousava.com
  amway-es.com
+amwbefcnfhtifbwvvtbiqioabp-dot-gleow2021ja.ue.r.appspot.com
  amwdxlwwjhqftclf-dot-millinium.ey.r.appspot.com
  amwebprojects.com
  amwezcon-verservii.xyz
@@ -97564,7 +112824,6 @@ anagonzaleztadeo.com
  anagrafica-portale-web.net
  anagraficaupdate.com
  anainteriordesign.com.br
-anaisrioux289.github.io
  anajuliafolheados.com.br
  anak-kecil-dibawa-kehotel-hot.000webhostapp.com
  anak-ngetot-ibunya-sendiri.000webhostapp.com
@@ -97623,6 +112882,7 @@ anapen.ie
  anapharm-ks.com
  anaqiz.ir
  anaracademy.ir
+anarchitecturestudio.com
  anarjo.com
  anarmidone.ru
  anarp.de
@@ -97662,6 +112922,7 @@ anbg.addroits.com
  anblllmpsgtbcsuecodrelolfjwyjwaydmmf-dot-cryptic-now-290917.ey.r.appspot.com
  anbtjmtcuruqqvig-dot-millinium.ey.r.appspot.com
  ancelsa.com
+anchaltest.000webhostapp.com
  anchicand.xyz
  anchordistilling.net
  anchormarineqroup.com
@@ -98208,6 +113469,7 @@ antecedents.org
  antechcontrols.com.au
  antecipecomdesconto.com
  antecipeofertasparavoce.com
+antelopeo.buzz
  antemundane-calcula.000webhostapp.com
  antena-uk.kz
  antena.cabanova.com
@@ -98379,7 +113641,6 @@ anz.ausecure1.com
  anz.com.au.mngt.info
  anz.com.au.recuser.info
  anz.com.au.unusual.report
-anz.com.auth-manager.services
  anz.com.ucenter.direct
  anz.sms-security.live
  anz.svcoding.com
@@ -98408,6 +113669,7 @@ aoemxuehqsdyoeax-dot-millinium.ey.r.appspot.com
  aofcdady.shoesmogul.com
  aofhpe.com
  aofnw3ew6wf11-fw-s4tv2.wtf
+aogdnfgrhbnvzsnjqagghoseqs-dot-gl9393jan.uk.r.appspot.com
  aognlumtpshczrwh-dot-millinium.ey.r.appspot.com
  aohhoopk.top
  aohrhlscmehdyibb-dot-millinium.ey.r.appspot.com
@@ -98905,7 +114167,6 @@ app-desconto.com
  app-digitalparavoce.com
  app-dispositivo.com
  app-dispositivocliente.com
-app-ep-ignt21a-mwfspeakerweb-muapxk-tayvrv-msesc-westus.azurewebsites.net
  app-facebook-confirmation.4xnzpabyka-v1p3zwo8l3ye.p.runcloud.link
  app-fb2.blogspot.com
  app-feitopravc.com
@@ -98919,6 +114180,7 @@ app-gestaocaixaonline.com
  app-gestaodeatualizacao.com
  app-go.website
  app-halifax-mobileapp-verify.com
+app-host-list-28139.icu
  app-id-verification-online-account.haustierberatung.info
  app-idserviceaccountcloudactivator12392312.boldexperiencebyme.info
  app-intesa.com
@@ -98931,8 +114193,10 @@ app-limites.me
  app-list-29301.casa
  app-list-46519.casa
  app-list-65301.casa
+app-list-77199.casa
  app-list-79301.casa
  app-list-86519.casa
+app-list-92152.casa
  app-list-95301.casa
  app-list-97301.casa
  app-localbitcoins.com
@@ -99117,7 +114381,6 @@ app.manage.purchescancel.ronakkordestani.com
  app.managerpage-help.my.id
  app.mirrorlabelsindia.com
  app.mmlgax.com
-app.mobileslide.top
  app.n26.com-login.oi39.net
  app.netflix.com-toupd-privprofileopen.burrgerhub.com
  app.netflix.tv-launcherror-nopayment.esingenc.com
@@ -99297,7 +114560,6 @@ appealing5004.xyz
  appealing6300.xyz
  appealing6301.xyz
  appealing6302.xyz
-appeals-copyrightvialation-contact.cf
  appealsupport.cf
  appear48-paypal.com
  appearancerecall.com
@@ -99327,7 +114589,6 @@ appgerenciamento-tk-com-br.umbler.net
  appgestao-458.000webhostapp.com
  appgestao-991.000webhostapp.com
  apphelpdesk.info
-apphlpbsns.live
  apphys-sucrodhasj242.efeknuy.com
  appiappleidcrs.sytes.net
  appid-information.about.your.purchase.akhirnyagapending2903.com
@@ -101282,6 +116543,7 @@ apronreassure.co.za
  aproveedspaqesdisableds0987.gq
  aproveedspaqesdisableds4567432.gq
  aproveita-e-compra-agora.com
+aproveitandoagora.online
  aproveitaquedatempo.com
  aproveite-dia-dos-pais.online
  aproveite-essa-oferta.com
@@ -101470,12 +116732,10 @@ aramunca1980.blogspot.be
  arandahotel.ru
  arandi.co.ke
  aranducachaca.com.br
-arangessementookie.flywheelsites.com
  aranis.xyz
  aranjgheobqgjtphrlracrfntksylqofueyz-dot-glegen303939423233.ue.r.appspot.com
  arantesadvogadas.com.br
  ararst-74.ml
-aratea.org
  araucaniatv.cl
  araujoesouza.com.br
  araujovillar.es
@@ -101608,6 +116868,7 @@ areablankserver.tk
  areac-agr.com
  areaclienti-ppl.net
  arealrionegro.com.br
+areaofficeonaging-com.ga
  areaparticulares-smartsantandr.com
  areashusht.com
  areasistemasbngobiper.com
@@ -101745,6 +117006,7 @@ argentum72.ru
  arghyabiswas.com
  argirioucom.chifanbob.top
  argirioucom.chifanbudget.top
+arglkacyeiwtovvutgzwpydrht-dot-gl9393jan.uk.r.appspot.com
  argogroupus-com-dot-gl494903049.wl.r.appspot.com
  argolhatitirlatq-dot-millinium.ey.r.appspot.com
  argolidafish.gr
@@ -101946,6 +117208,8 @@ arpersenoa.com
  arpeysappliancerepairs.com
  arpmgfvfyvszgfjd-dot-millinium.ey.r.appspot.com
  arportfolio.rahmanmahbub.com
+arpstulqvxpwacowvojdnupqbt-dot-gl9393jan.uk.r.appspot.com
+arpztwhbussccxjvpjabvjfaew-dot-gl9393jan.uk.r.appspot.com
  arq10x.com.br
  arqdesignconstruct.com
  arquitectonicamente.com
@@ -101987,6 +117251,7 @@ arsczsas.000webhostapp.com
  arsczsps.000webhostapp.com
  arsczsvz.000webhostapp.com
  arsenel-bg.com
+arsenic-outboards.000webhostapp.com
  arsgdcxdfgh.space
  arshallhe.com
  arshermeneutica.org
@@ -102368,6 +117633,7 @@ asd71.com
  asd8uiahsdias.herokuapp.com
  asda-pranenich.ga
  asdadqwdas.tk
+asdalzkeeesxgxnexcsdlbaecl-dot-gl9393jan.uk.r.appspot.com
  asdaplus-jp.com
  asdasd.gasdasd.top
  asdasd.kahulasup.ch
@@ -102665,6 +117931,7 @@ asltechworld.in
  aslywrhxpgneidro-dot-millinium.ey.r.appspot.com
  asmadale.com
  asmae-ppie.org
+asmbfbkejbcasyqimfwxjwsqep-dot-gl9393jan.uk.r.appspot.com
  asme1010.ddns.net
  asmelhoresofertasdomesparavocecliente.club
  asmessagging1.com
@@ -102715,6 +117982,7 @@ aspendigitallife.com
  asperformancefrance.com
  asperm.club
  aspharma-afrique.com
+aspidagames.com
  aspinrare.temp.swtest.ru
  aspire-zone.com
  aspireautosales.com
@@ -102957,6 +118225,7 @@ astrologieforuminfo.shaxiaoh.top
  astrologize.xyz
  astrologysikhen.com
  astrom2.com
+astrometersysr.us
  astronica.org
  astroshankersegurukulam.com
  astroyogi.app
@@ -103047,7 +118316,6 @@ at.fbookcom-26519348.mentmag.com
  at.fbookcom-93177901.mentmag.com
  at1111p000ttrryol.godaddysites.com
  at16.jaysbrand.com
-at183782h737att.weebly.com
  at1snet.weebly.com
  at1t23.weebly.com
  at4p.porkaspk.com
@@ -103088,6 +118356,7 @@ atbuilds.info
  atbxjtockqsuybhe-dot-millinium.ey.r.appspot.com
  atccn3.it
  atcenterla.com
+atcfowihqwiawqugaxdiahtjkx-dot-gl9393jan.uk.r.appspot.com
  atchec.com
  atcq.jaysbrand.com
  atd-636-jf73-jfj6-65e.weebly.com
@@ -103321,6 +118590,7 @@ atozmfactuing.top
  atozsewa.com
  atp5.jaysbrand.com
  atphwsyxecebtpx.serveirc.com
+atplcjkkdrmxhmsesczpgsrcvt-dot-gl9393jan.uk.r.appspot.com
  atprofessional.org
  atpuddrmhtgrhyyp-dot-millinium.ey.r.appspot.com
  atqdhb.goruli.com
@@ -103503,10 +118773,8 @@ attackforyou.xyz
  attactiveclient.weebly.com
  attactiveuser.weebly.com
  attadjustment.weebly.com
-attadmindesksupport.weebly.com
  attadminofficeverificationnwet.weebly.com
  attadminserviceteam.weebly.com
-attadminsupportdesk.weebly.com
  attadminupdating2020.weebly.com
  attadminverification.weebly.com
  attadminverificationmailservices.weebly.com
@@ -103590,8 +118858,8 @@ attdomainsvice.weebly.com
  attdomainupdates.weebly.com
  attdomainupdatesvsz.weebly.com
  attdomainverification.weebly.com
+attdomainwebsiteservice.weebly.com
  attdommaa.weebly.com
-attdoomain.weebly.com
  attdoonnetworksercvive.weebly.com
  attdsgd.yolasite.com
  attdx.000webhostapp.com
@@ -104047,7 +119315,6 @@ attserviceupdate3096.weebly.com
  attserviceupdatenow.weebly.com
  attserviice.weebly.com
  attserviiceteams.weebly.com
-attservisesa.weebly.com
  attserviupdmil.weebly.com
  attsettingaccountcenter.weebly.com
  attseverupgrade.weebly.com
@@ -104082,7 +119349,6 @@ attstayin.weebly.com
  attsts.weebly.com
  attstsv.weebly.com
  attsup.000webhostapp.com
-attsuportuui.weebly.com
  attsupport-mailupgrade.weebly.com
  attsupportbox.weebly.com
  attsupportcustomerloginemail.weebly.com
@@ -104090,7 +119356,6 @@ attsupportemail.yolasite.com
  attsupportservice.weebly.com
  attsupportsystem.net
  attsupportteam.weebly.com
-attsupporttmal.weebly.com
  attsupportupgradenow.weebly.com
  attsurpport.weebly.com
  attsurv.000webhostapp.com
@@ -104136,6 +119401,7 @@ attttnetenet.weebly.com
  atttttnet.weebly.com
  attttttmaiiillliiingbox.weebly.com
  attttttt223.weebly.com
+atttttttmaff.weebly.com
  attttttttttttttttt.weebly.com
  atttttttttttttttttttt.weebly.com
  atttttttttttttttttttttttlikkknlink.weebly.com
@@ -104235,7 +119501,6 @@ attyahoo-web.weebly.com
  attyahoo.yolasite.com
  attyahoo0update.weebly.com
  attyahooactivation-net.weebly.com
-attyahooadminservice.weebly.com
  attyahooconfirmation.weebly.com
  attyahoocurentlydomainsite.weebly.com
  attyahoodomainserverlogin.weebly.com
@@ -104564,6 +119829,7 @@ aupayicloud.com
  aupvfp.com
  auq-c6opa-agora-sim-tudo-de-bom.com
  auqsuiqrfghiabjn-dot-millinium.ey.r.appspot.com
+auquafinera.tk
  auraco.ca
  aurainside.bid
  auraokg.com
@@ -104746,6 +120012,7 @@ auth-twitter.com
  auth-uber.net
  auth-user-id21.com
  auth-user-verify.com
+auth-valid-dev.com
  auth-verif2app.servequake.com
  auth-verify-account.site
  auth-verify.paypal.com-webmatamuscrid26873.com
@@ -104840,6 +120107,7 @@ authenticate-new-payee.com
  authenticate-online.com
  authenticate-onlinepayee.com
  authenticate-onlinepayment.com
+authenticate-payees.com
  authenticate-recovery.com
  authenticate-session.center
  authenticatehelp-remove.com
@@ -105130,7 +120398,6 @@ automatronics.net
  autombstar.com
  automed.ge
  automobile-lambert.com
-automobile-roadtx-bill.com
  automodelismo-rc.com.br
  automotive-group-item9340.com
  automotrizoregon.cl
@@ -105476,7 +120743,9 @@ avviso-cliente.com
  avvxxtjvssdhnwrt-dot-millinium.ey.r.appspot.com
  avwggdhwxehgfumqqefbmoffffomyhgqppdz-dot-cryptic-now-290917.ey.r.appspot.com
  avwggdhwxehgfumqqefbmoffffomyhgqppdz.cryptic-now-290917.ey.r.appspot.com
+avwqitjccccleaomkwiwilmaof-dot-gl9393jan.uk.r.appspot.com
  avwu.handipants.com
+avxxvxz.jpjd.xyz
  avz-pr.com
  avzzsoz.000webhostapp.com
  aw-test.com
@@ -105647,6 +120916,7 @@ awxjsogo.goruli.com
  awxo.000webhostapp.com
  awxpyjtjkoquavwo-dot-millinium.ey.r.appspot.com
  awxxournowehvnrexohwjlodzg-dot-gleowayel400503.uc.r.appspot.com
+awyoojyexlducjpaltcpexrndu-dot-gl9393jan.uk.r.appspot.com
  awzevpuboaaxmqsy-dot-millinium.ey.r.appspot.com
  awzoiiuxiabjrcxl-dot-millinium.ey.r.appspot.com
  ax196.com
@@ -105686,7 +120956,9 @@ axeonerat.zapto.org
  axer82456238.xyz
  axeraan.com
  axerooms.com
+axesxceslljvlhjwhjpxxkndxn-dot-gl9393jan.uk.r.appspot.com
  axg1.awaykart.com
+axgsolutions-a.ml
  axgsolutions-authentication.gq
  axgsolutions-authentication.ml
  axgssolutions.com
@@ -105700,7 +120972,9 @@ axgxskdtpeamcfpk.top
  axhciqibbwpqccaq-dot-millinium.ey.r.appspot.com
  axhsljgoyvbowzwc-dot-millinium.ey.r.appspot.com
  axi.topkorder.su
+axijshetymczlwdxswfylmgzdw-dot-gl9393jan.uk.r.appspot.com
  axikrwgjsmloellx-dot-millinium.ey.r.appspot.com
+axisneglect.guru
  axisymmetryelegised.net
  axitezw.gikorip.net
  axjp.cn
@@ -105731,6 +121005,7 @@ axqjxieudijvqzjf-dot-owaonk399399393.uk.r.appspot.com
  axrlwc.goruli.com
  axse.duckdns.org
  axset.xyz
+axsjqxvjbqkygqyncpwtrgmryc-dot-gl9393jan.uk.r.appspot.com
  axsn.goruli.com
  axstw.xyz
  axsvzdanyelsoebzommwpzlbbq-dot-gleowayel400503.uc.r.appspot.com
@@ -105920,6 +121195,7 @@ aywdjgiyuehcbcuv-dot-millinium.ey.r.appspot.com
  aywvfugqvqjlgfvolqnvufodoz-dot-gleowayel400503.uc.r.appspot.com
  ayxa.nicedayjp.com
  ayxcsfkosrzprige-dot-millinium.ey.r.appspot.com
+ayxsmlmbjjqdxkshuzyfagzari-dot-gl9393jan.uk.r.appspot.com
  ayy-85-com.preview-domain.com
  ayyappantat.com
  ayycxmzvkrulobif-dot-millinium.ey.r.appspot.com
@@ -106120,6 +121396,7 @@ azvszxc.000webhostapp.com
  azvszxzs.000webhostapp.com
  azvzxsz.000webhostapp.com
  azwsza.000webhostapp.com
+azwylplgtgnftcbhrtxqyjwrba-dot-gl9393jan.uk.r.appspot.com
  azxcvb.ml
  azxde.xyz
  azxilwogjnrbzrrr-dot-millinium.ey.r.appspot.com
@@ -106370,7 +121647,6 @@ babunggrupbokepp2020.000webhostapp.com
  baby-case.ru
  baby-lim.com
  baby.ajanskunye.net
-baby.joingroup-neu.tk
  baby.mamdogo.xyz
  baby.py.shangdu.com
  babybag.com.ua
@@ -106598,6 +121874,7 @@ bagnet.ir
  bagolyvill.sxoon.com
  bagp.jaysbrand.com
  bagraphics.net
+bagswallow.guru
  bagtcp.com
  baguiogiftpack.000webhostapp.com
  baguiogiftpacks.000webhostapp.com
@@ -106809,7 +122086,6 @@ ballu-russian.ru
  ballzing.com
  balm.zone
  balmey.nl
-baloguntery.weebly.com
  balohiji.com
  balonmans.net
  baloobafoudanitojahdge.space
@@ -106843,6 +122119,7 @@ bambamli.com
  bambamsed.ml
  bambathamobileloans.co.za
  bambinos.bounceme.net
+bamboo-win.000webhostapp.com
  bamboobypanda.com
  bamboomogleyt.com
  bambudeposu.com
@@ -106884,6 +122161,7 @@ banc0estad0.cl.esmac.com.br
  banca-bpm-italia.com
  banca-electronica-cajamar.com
  banca-en-linea.personas.wtmeys.club
+banca-general01.webcindario.com
  banca-impresa.com.ru
  banca-mobile.com
  banca-mps-info.com
@@ -107225,6 +122503,7 @@ banhoatuoi.com
  bani-maryno.ru
  banigerz.com
  banik-pontacle.ml
+banishclerk.guru
  banister.com.pk
  banistmo-promo.devv.shop
  banistmoapp.com
@@ -107253,6 +122532,7 @@ bank-of-secure.webcindario.com
  bank-online-login3.xyz
  bank-partners.com
  bank-sec.com
+bank-servicee.info
  bank-wells-fargo-alert.com
  bank-wf-account.site
  bank-wil.duckdns.org
@@ -107778,7 +123058,6 @@ basmahane.com
  basnecopnama.com
  basohaitrading.com
  basojuttfvdlknvcaounvrd.club
-basratourism.com
  basricukcukgas.000webhostapp.com
  basriktlgglimbat.000webhostapp.com
  basritolkon123.000webhostapp.com
@@ -107805,6 +123084,7 @@ basvurum-geri-iadesi-bireysel.com
  basvururesmiegirisiyapin-trmerkezi.com
  bat.archi
  bat.stockxk.com
+bat24.buzz
  batagorasyik.id
  batal-pemblokiran2020.tk
  batalblokir-akun-fb9.webnode.com
@@ -107843,6 +123123,7 @@ batonrougeluxuryhomes.com
  bator.duckdns.org
  batriaruum.com
  batshonrealestate.com
+batstation.guru
  batta.co.in
  battered-exceptions.000webhostapp.com
  batteredbalancing.com
@@ -108129,6 +123410,7 @@ bbvavirtual.ga
  bbviners.cf
  bbwstocking.com
  bbxmail.gdoc.sercelinsaat.com
+bbydjkwpdfuwmnypeiifyynkne-dot-gl9393jan.uk.r.appspot.com
  bbypass.pw
  bbzanyfjboywxxkfoyooobujftphfrdesxii-dot-cryptic-now-290917.ey.r.appspot.com
  bbzvxcsasd.firebaseapp.com
@@ -108171,6 +123453,7 @@ bcem.ie
  bcevdncwkpprhpfs-dot-millinium.ey.r.appspot.com
  bceysigorta.com
  bcfe.awaykart.com
+bcggiuprkdidpsfbdxccyybfhi-dot-gl9393jan.uk.r.appspot.com
  bcgk.shoesmogul.com
  bchawda.com
  bchecklist.com
@@ -108701,6 +123984,7 @@ beautyscissor.com
  beautysel.com
  beautyveins.com
  beautywork.in
+beaverdamcondoms.com
  beavohroot.com
  beaware.flbanqofme.com
  beawvlgjpuqioovh-dot-millinium.ey.r.appspot.com
@@ -108731,6 +124015,7 @@ becharakam.ddns.net
  bechemical.net
  bechtelar.buzz
  bechtelarland.buzz
+becjdeymmlcwvjmyqmimiaabsd-dot-gl9393jan.uk.r.appspot.com
  becjmqxowutitycu-dot-millinium.ey.r.appspot.com
  becker-tm.org
  beckerrapid.buzz
@@ -108849,6 +124134,7 @@ begoventa.top
  begumazing.com
  begumbadshah.com
  begurtyut.info
+behavestun.buzz
  behavioralmedicinespecialists.com
  behaylu.000webhostapp.com
  behcosanat.com
@@ -109004,6 +124290,7 @@ bellsouthupdate.weebly.com
  bellspalsy.info
  bellstechfashionshow.000webhostapp.com
  bellstore.000webhostapp.com
+bellsttattnetverify.weebly.com
  bellvada.co.id
  bellwireles.site
  bellychef.com
@@ -109035,6 +124322,7 @@ belyi.ug
  bem.is
  bemaxx.in
  bemeom.com
+bemfchtqrmvjzxluwvyrkxlkrb-dot-gl9393jan.uk.r.appspot.com
  bemindfulmich.com
  bemnessa.com.br
  bemsnet.com
@@ -109306,7 +124594,6 @@ besichange.com
  besichenge.live
  besichenge.site
  besixoni.tripod.com
-bespattered-checkpo.000webhostapp.com
  bespokebysumitgrover.com
  bespokemerchandises.com
  bespoqa.com
@@ -109323,6 +124610,7 @@ best-backup.com
  best-buys.ru
  best-checkers.ddns.net
  best-credit-online.com
+best-good198.net
  best-homes.ir
  best-ideas.pp.ua
  best-lavish-option.glitch.me
@@ -109573,6 +124861,7 @@ betalco.biz
  betaleasinboard.loadingsecure-4.host
  betalen-ing.info
  betaling-melding.info
+betaling-proces.icu
  betaling-sms.info
  betalingenverificaties.zone
  betalings-kenmerken.eu
@@ -109675,7 +124964,6 @@ betebet150.com
  betebetgirisim.blogspot.com
  betebetgirisimiz.blogspot.com
  beteebetgiris.blogspot.com
-beteronderzoek.xyz
  betesxeleke.com
  beteveeke.com
  betfgwbdhjbxdmuudogmcbwttz-dot-gleowayel400503.uc.r.appspot.com
@@ -109698,6 +124986,7 @@ beti64.fr
  betindianasports.com
  betjohn.xyz
  betmais.app
+betmenu.buzz
  betnano101.com
  beto-met.pl
  betobarata.com.br
@@ -109761,6 +125050,7 @@ betypark.serveminecraft.net
  betzq.com
  beu-hr.com
  beuiawaonxussqhc-dot-millinium.ey.r.appspot.com
+beujwkowdsfftclnjqzzcuovco-dot-gl9393jan.uk.r.appspot.com
  beurrtwvbjddvqcmshfinzlxul-dot-gleowayel400503.uc.r.appspot.com
  beutify.com
  beutifydesktop.com
@@ -109781,7 +125071,6 @@ bew-gw24w1bee-e52wbe3.party
  bewareofleaking.newcardamaontoyou.icu
  bewareofleaking.rakutenmall.cyou
  bewareofleaking.rakutenmallcard.xyz
-bewareofleaking.rightamazoncard.xyz
  bewareofleaking.znewrakuten.club
  bewareofleakingto.rakutenmall.cyou
  bewareofleakingto.rakutenmallcard.xyz
@@ -109918,6 +125207,7 @@ bgaccountinggroup.com
  bgasa.com
  bgasnipnxhlvnguu-dot-millinium.ey.r.appspot.com
  bgayra.pw
+bgbiqhkbmvkgovtxmnfxcrjmbm-dot-gl9393jan.uk.r.appspot.com
  bgbzohftpn.duckdns.org
  bgcapatftvroshov-dot-millinium.ey.r.appspot.com
  bgcdhsujcoyqcmvt-dot-millinium.ey.r.appspot.com
@@ -109984,6 +125274,7 @@ bgthele.com
  bgtnw.jaysbrand.com
  bgtritjpyjtkijto-dot-millinium.ey.r.appspot.com
  bgtyw.xyz
+bgupvsqprgifftnligltuevglj-dot-gl9393jan.uk.r.appspot.com
  bgvhfnyhsgvwatt.weebly.com
  bgviscnjd.goruli.com
  bgybahxayicfsfqoruwvnazurrjokjkcvavn-dot-gl494903049.wl.r.appspot.com
@@ -110019,7 +125310,6 @@ bharatfoundation4gtower.in
  bharathvision.in
  bharatinside.com
  bharatisangli.in
-bharatiyakisanunion.com
  bharatpoudel.com.np
  bharatsilks.com
  bharatsteelfiber.voec.in
@@ -110115,7 +125405,6 @@ bialk.de
  bialorus.pl
  bialytradings.us
  biancamodaintima.com.br
-biancapier.xyz
  biancoecolorati.com
  biankhoahoc.com
  biapi-coaching.fr
@@ -110310,7 +125599,6 @@ bikemyday.se
  bikergirls.za.net
  bikerouteshop.com
  bikerzonebd.com
-bikes-marketplace-item.billabonghighrewa.com
  bikesectorcom.nckiengineering.gdn
  bikeshshrestha.com.np
  bikesterilizasyon.com
@@ -110407,6 +125695,7 @@ billing-myeesupport.com
  billing-myinfo.com
  billing-mythree.net
  billing-net1.com
+billing-netflix.me
  billing-netflixsubscription.com
  billing-o2-monthlysupport.com
  billing-o2info-help.com
@@ -110470,7 +125759,6 @@ billinginfo-updatenetflix.com
  billinginfo-verificatiom.com
  billinginfos-netfiix.com
  billingmanageinfo.com
-billingmy3-update.me
  billingo2-alerts.com
  billingpayment-info1.com
  billingportalshaw.atskype.net
@@ -110479,6 +125767,7 @@ billingprobllemem-12689312893ajsfhjasca.com
  billings-h3g.com
  billings-o2.co.uk
  billings-three.co.uk
+billings-verify-myee.com
  billingservice-ee.com
  billingservices-ee.co.uk
  billingservices-ee.com
@@ -110948,6 +126237,7 @@ bjalyvatghtbbnwi-dot-millinium.ey.r.appspot.com
  bjayaslqaiyvbckn-dot-millinium.ey.r.appspot.com
  bjbfbimeogpmmmij-dot-millinium.ey.r.appspot.com
  bjbfriends.com
+bjbhuiolssthkunguexswxpjrz-dot-gl9393jan.uk.r.appspot.com
  bjbs.com.au
  bjbt.hopto.org
  bjbus.net
@@ -111015,11 +126305,13 @@ bjykb-----login.ygber.com
  bjym7.weblium.site
  bjyxsj8.com
  bjzgzjnymmkscwgsdunurgspeska.top
+bjziywguihufkjsitjmsrhitrb-dot-gl9393jan.uk.r.appspot.com
  bjzzmbhhgkczdpjk-dot-millinium.ey.r.appspot.com
  bk-4n.mentriqq.com
  bk-coin.com
  bk-gfi.com
  bk3gold.com
+bkaacwijyfatmfudkymzuusnyz-dot-gl9393jan.uk.r.appspot.com
  bkagrosprayers.com
  bkbodnboxtwugdwv-dot-millinium.ey.r.appspot.com
  bkcf-line.com
@@ -111258,6 +126550,7 @@ blcwp.openmadrasa.com
  bldbs.vipsnapchatsexting.com
  bldvjoazlxxinaey-dot-millinium.ey.r.appspot.com
  blearcloxqkfjpgl-dot-millinium.ey.r.appspot.com
+bleatx.buzz
  bledsoetx.buzz
  bleepbar.com
  bleeppersonal.com
@@ -111340,6 +126633,7 @@ bllqbkjxlfhnnyjb-dot-millinium.ey.r.appspot.com
  blmihrwirdgesperrt.needyourconfirm.net
  blmrbl.space
  bln-product.com
+blnyjvorzoeruvhquukmivyptw-dot-gl9393jan.uk.r.appspot.com
  blobfeed.com
  blobim.club
  blocco.intesa-servizio.info
@@ -111409,7 +126703,6 @@ blog.canmertdogan.com
  blog.cellprofiler.org
  blog.cerpen.cc
  blog.chefbrunaavila.com.br
-blog.cicil.co.id
  blog.colegiosantorini.com.br
  blog.cotiabank.paypal-login.us
  blog.cspconsultoria.com.br
@@ -111483,6 +126776,7 @@ blog.solutionsarchitect.guru
  blog.spkwilcz.pl
  blog.spokanehyundai.net
  blog.steadfast-inc.com
+blog.storrea.com
  blog.supplybunny.com
  blog.synergyglobal.one
  blog.tatilvitrini.com
@@ -111554,6 +126848,7 @@ blogvanphongpham.com
  blokkade-verificatie.xyz
  blominstallatietechniekcom.shaxiaassessment.top
  blominstallatietechniekcom.shaxiapurpose.top
+blomzy.abbyservertime.fun
  blond-signature.000webhostapp.com
  blood-sports.net
  bloodclub.com.bd
@@ -111567,6 +126862,7 @@ bloodremedies.cyou
  bloodsach.buzz
  bloodthirsty-grease.000webhostapp.com
  bloodveinscruffy.com
+bloody-lifeboats.000webhostapp.com
  bloodybits.com
  bloohash.com
  bloomasiaus.com
@@ -111584,7 +126880,6 @@ blorehost.in
  blosil.in
  blossombeyond50.com
  blossomevent.co.uk
-blossomwater.us
  blossomworldinformatix.com
  blotec.in
  bloucoiiglzpdcso-dot-millinium.ey.r.appspot.com
@@ -111676,6 +126971,7 @@ bluemarble.cloud
  bluemontva.xyz
  bluemoonholidaysbd.com
  bluemooselounge.com
+bluemotos.com
  bluemttours.com
  bluemushroom.com.au
  bluenewsletter.ml
@@ -111719,6 +127015,7 @@ bluetickforfree.000webhostapp.com
  bluetickfre.0fees.us
  bluetickfree.0fees.us
  bluetickinstagram.ga
+bluetickserviceinnnstagram4409x.ga
  blueticksform.com
  bluetickverification.ml
  bluewaterappco.com
@@ -111791,6 +127088,7 @@ bmixcomunicacao.com.br
  bmjpinqtun.com
  bmkdnd.com
  bmkopjrnhmpcoppp-dot-millinium.ey.r.appspot.com
+bmldvlbnpukzgrwntfdlussapc-dot-gl9393jan.uk.r.appspot.com
  bmlkochi.com
  bmlstgngbhstlog.my.id.akknggwpstpblmrlog.my.id
  bmmihwemlyswiess-dot-millinium.ey.r.appspot.com
@@ -111800,6 +127098,7 @@ bmmufuhhdkwricds-dot-millinium.ey.r.appspot.com
  bmo.ways-to-bank.buzz
  bmoabogados.com
  bmovieapp.com
+bmpawrjdwbxcjquszdqdfzyyzi-dot-gleow2021ja.ue.r.appspot.com
  bmpsmnlrgdhkgcgl-dot-millinium.ey.r.appspot.com
  bmpssjajjtjxiguc-dot-millinium.ey.r.appspot.com
  bmpzsxdlrupwpdyr-dot-millinium.ey.r.appspot.com
@@ -111814,6 +127113,7 @@ bmskdn.com
  bmssw.org
  bmsystem.ro
  bmti.com.np
+bmtlzcqthrvibhuqwibhboozrd-dot-gl9393jan.uk.r.appspot.com
  bmttcbari.com
  bmub.goruli.com
  bmvdsisqqqhjatojsxqbdzmftd-dot-gloff849483.uk.r.appspot.com
@@ -112095,6 +127395,7 @@ bockamp.com
  boclog.com
  boconceptla.com
  bocongan113vn.com
+bocpvegdwxmamymsbzhwkblgxi-dot-gl9393jan.uk.r.appspot.com
  bocsberry.ru
  bodabom.com
  bodapsutfowdymau-dot-millinium.ey.r.appspot.com
@@ -112134,7 +127435,6 @@ bodyskinclean.com
  boec.ubksg.ru
  boegdfvoaypwoanfoexftojigr-dot-gleowayel400503.uc.r.appspot.com
  boeijendmanagement.nl
-boekfzkrqjbgzjpl-dot-revalidate-icaan-domain.ue.r.appspot.com
  boeschboddenspies.com
  boetadippenaar.com
  boevqvrjjcbuljuumxcz.ru
@@ -112242,7 +127542,6 @@ boite-fixeinfo-tel.web.app
  boite-reception-call.web.app
  boitevocale-orangetelfixe.web.app
  boiverifinfo.com
-boiverify.com
  boiviyeu.com
  bojueyulecheng.tavmo.com
  bok-poczta.pl
@@ -112393,6 +127692,7 @@ bokepspecialcovid19.event-indo.com
  bokepsugionogan.xxxy.biz
  bokepterbaru-whatsappindonesiahot.wa-xxx18.ga
  bokepterbaru1.tk
+bokepterbaru18keatas.000webhostapp.com
  bokepterbaru2020.xvip.my.id
  bokepterbaru2020grubnew.getsviip7.com
  bokepterbruviral2020indonesialih.000webhostapp.com
@@ -112559,6 +127859,7 @@ bonitamagia.cl
  bonjourinternet.000webhostapp.com
  bonlines.000webhostapp.com
  bonmarartleewik.com.au
+bonmayromer.tk
  bonn-arte.co.uk
  bonneausc.buzz
  bonniebinary.co.uk
@@ -112695,6 +127996,7 @@ boozekrewes.com
  boozzdigital.com
  bop.binaryoptionsprofitmachine.com
  bopheloclub.org
+bopnsosdfleztwxzsuazpomrox-dot-gl9393jan.uk.r.appspot.com
  boquan.net
  boqvl.417mcp.com
  bor-demir.com
@@ -112767,7 +128069,6 @@ bosjoxldthopotqywauzbsvnoxadzfwyqqfe-dot-solar-vertex-285913.rj.r.appspot.com
  boslife.com.br
  bosmangouai.xyz
  bosmj.net
-bosnewpaye.com
  bosniakov.com
  bospoint.com
  boss-gear.com
@@ -113071,6 +128372,7 @@ bpqcczizvzfeksqadmossevzas-dot-gleowayel400503.uc.r.appspot.com
  bpqwvvkpxrjauxlu-dot-millinium.ey.r.appspot.com
  bpradiousac.org
  bprbalidananiaga.co.id
+bprigmiuxbyqlvlsxlqffqddyj-dot-gl9393jan.uk.r.appspot.com
  bprkita.com
  bprkoperindojaya.id
  bproperty.ru
@@ -113293,7 +128595,6 @@ bradesco.news
  bradesco.nextdigital.website
  bradesco.realvideosbr.kiev.ua
  bradesco.servicosac24horas.com
-bradescoajuda.cf
  bradescoatualizacao.ddns.net
  bradescodentalcnpj.com.br
  bradesconext.digital
@@ -113590,6 +128891,7 @@ bric-groupe.com
  brick-salty-toast.glitch.me
  brickauditor.com
  brickcityblogs.com
+brickpetty.buzz
  brickwholesaler.com
  bricorate.com
  bricotienda.com
@@ -113882,6 +129184,8 @@ brpak.com
  brpuwuocznmqbywo-dot-millinium.ey.r.appspot.com
  brrlolrb.info
  brroduvnaatlwncbimgzuevjfqntkhnfyxlf-dot-cryptic-now-290917.ey.r.appspot.com
+brrtqgrrlcarphkpuxrnmisglc-dot-gl9393jan.uk.r.appspot.com
+brrvjofjinkyhbzyvixzpslieq-dot-gleow2021ja.ue.r.appspot.com
  brsbrosker.ml
  brsemprepresente.com
  brsydl.cn
@@ -114027,7 +129331,9 @@ bsknz.ga
  bskpwjueqpjqsfre-dot-millinium.ey.r.appspot.com
  bsllock.zzuxx.my.id
  bslmdgevnsuceozd-dot-millinium.ey.r.appspot.com
+bslofxlppmqribqybdsundqbzz-dot-gl9393jan.uk.r.appspot.com
  bsltd059.net
+bslyxqakhqlastsohwlwthihef-dot-gl9393jan.uk.r.appspot.com
  bsm-be.firebaseapp.com
  bsmart-solutions.com
  bsmcqgstedmcegnwaczpyapauxzrduyubisr-dot-glegen303939423233.ue.r.appspot.com
@@ -114131,7 +129437,6 @@ btcomlandlinemanagechange.web.app
  btconfirms.com
  btconnintravels.xyz
  btcovqnxzmjzjxdyumjwvtwqiekvmchoyjua-dot-cedar-code-289917.nn.r.appspot.com
-btcpayment.000webhostapp.com
  btcpm.duckdns.org
  btcsurgico.com
  btctrust.xyz
@@ -114226,6 +129531,7 @@ btwwwfs.icu
  btx.goruli.com
  btxl.goruli.com
  btxmail.uk.r.appspot.com
+btxrsbjwehktchelgmxrbvekbl-dot-gl9393jan.uk.r.appspot.com
  btyiuskahserves.weebly.com
  btynmorilvaujefl-dot-millinium.ey.r.appspot.com
  btyqsbngoliyhueyufmswoifzn-dot-gloff849483.uk.r.appspot.com
@@ -114237,7 +129543,6 @@ bualammetcnwncju-dot-millinium.ey.r.appspot.com
  buarf.com
  buashfe.com
  bubai521.com
-bubasoftware.com
  bubbaoff.press
  bubble2.site
  bubblebanter.icu
@@ -114750,7 +130055,6 @@ butikpatike.com
  butjylfjrnlhbnwaokn.servebeer.com
  butland.cf
  butlercourse.com
-butlershillcrest.co.za
  butonmedya.com
  butter-spiced-judge.glitch.me
  buttercupinc.com
@@ -114767,6 +130071,7 @@ butyconversesklep.com
  butyniketanio.pl
  buulyoponjpiwgcikx.top
  buuwong-watts-project.bftrtdfg.com
+buuybnhifcoextapaniqdxorxv-dot-gl9393jan.uk.r.appspot.com
  buvdclgkccmxhplw-dot-millinium.ey.r.appspot.com
  buwong-puyuh.dungvkci.com
  buxdoxmytmdalfdh-dot-millinium.ey.r.appspot.com
@@ -114857,6 +130162,7 @@ buzzone.duckdns.org
  buzzpr.ca
  buzztinker.com
  buzztrends.club
+buzzx.buzz
  buzzzones.com
  bv.atendimentomobi.online
  bv.topbackupintheworld.com
@@ -114882,14 +130188,15 @@ bvdk.net
  bveasd.com
  bvereartions.net
  bvereartisdercb.com
-bverification-contro-live.com
  bvfinanceira.online
  bvfinanciamento.org
  bvfqfphhk.xyz
  bvfufqjexicpqiwtiifpukfkqacypbuwvhmn-dot-glegen303939423233.ue.r.appspot.com
  bvgvoyehxrrughbw-dot-millinium.ey.r.appspot.com
  bvhcrzwzppeopnadpprrwihhao-dot-gleowayel400503.uc.r.appspot.com
+bvhpxdddxalbgpavogmrlxlzlq-dot-gl9393jan.uk.r.appspot.com
  bvirtuouswear.com
+bvjaxokraphkqxqzgoobyutduw-dot-gl9393jan.uk.r.appspot.com
  bvjdgxvzegpfackydb.top
  bvkfyoejykzowxwn-dot-millinium.ey.r.appspot.com
  bvklsh.000webhostapp.com
@@ -114898,6 +130205,7 @@ bvnupdate.ddns.net
  bvoccspslbwdstrg-dot-millinium.ey.r.appspot.com
  bvoxvojciwxuzhcc-dot-millinium.ey.r.appspot.com
  bvpqspelzwqhjmes-dot-millinium.ey.r.appspot.com
+bvqdyhsumhmdrbcwvvkmrmosri-dot-gl9393jan.uk.r.appspot.com
  bvrenegociacaodecontrato.com
  bvrfontmfn.web.app
  bvrhpjcwjgabwgsckrmjclaflulylbzkqcfs-dot-solar-vertex-285913.rj.r.appspot.com
@@ -114908,6 +130216,7 @@ bvsbi.com
  bvshzdffgixkzmcr-dot-millinium.ey.r.appspot.com
  bvsxuumuexojhils-dot-millinium.ey.r.appspot.com
  bvtai.dhhlch.club
+bvtgcfpknkjahoyezikkjdcutk-dot-gl9393jan.uk.r.appspot.com
  bvuyeiaflygqpytwsxmlgqfupoiaujrdgnxy-dot-glxcel49934343434.rj.r.appspot.com
  bvvosmpgfubihgut-dot-millinium.ey.r.appspot.com
  bvvsnet.com
@@ -114940,6 +130249,7 @@ bwlaphjdpiourqns-dot-millinium.ey.r.appspot.com
  bwlodarczyk.2-0.pl
  bwmc.handipants.com
  bwmednpfeqdmmrnuchuorrqomk-dot-gleowayel400503.uc.r.appspot.com
+bwmxzybjbihyulmestuqrqzbsn-dot-gl9393jan.uk.r.appspot.com
  bwngpyhcrtbkphot.join-grupwhatsapp.ml
  bwnmktxjdskozium-dot-millinium.ey.r.appspot.com
  bwntsfuwfmlbieuxleriheigjrkbovkpnddj-dot-glenxpecial3009493.ey.r.appspot.com
@@ -114988,8 +130298,10 @@ bxlmkyjzu.shoesmogul.com
  bxlrgkwjawypcfes-dot-millinium.ey.r.appspot.com
  bxmajkqjskktymqh-dot-millinium.ey.r.appspot.com
  bxnjggghshwjotky-dot-millinium.ey.r.appspot.com
+bxogfbyxdoyepwollgoyfhhvcu-dot-gl9393jan.uk.r.appspot.com
  bxp0.svcoding.com
  bxpaffc.com
+bxplaoipllmbyrmllivmqdhrbi-dot-gl9393jan.uk.r.appspot.com
  bxpsdamgucjyaqkm-dot-millinium.ey.r.appspot.com
  bxqbactellkbgptudfwtzmneefjbmtvvsjac-dot-cedar-code-289917.nn.r.appspot.com
  bxqnlo.goruli.com
@@ -115083,6 +130395,7 @@ byukattie.top
  byuroperevodovonline.work
  byuyoxryzbszzeyixtcwtwfyqj-dot-gleowayel400503.uc.r.appspot.com
  byvfhjarbrhkqkkmihlgtkbuvtrmbrtxqzda-dot-cryptic-now-290917.ey.r.appspot.com
+byvhrsgksrmzmgwgtjbuuqkrae-dot-gl9393jan.uk.r.appspot.com
  bywgbxaxvdqkrlin-dot-millinium.ey.r.appspot.com
  bywiuwhqjasdf.com
  bywn397.top
@@ -115099,6 +130412,7 @@ bzblfppdpefpmwid-dot-millinium.ey.r.appspot.com
  bzbomvvuexsjulgg-dot-millinium.ey.r.appspot.com
  bzdcbqtylmfcwozk-dot-millinium.ey.r.appspot.com
  bzdh.hamhonar.com
+bzdpismpkobsjiqpqptsfgvemj-dot-gl9393jan.uk.r.appspot.com
  bzenncdhqukbluph-dot-millinium.ey.r.appspot.com
  bzew48iricq0a.000webhostapp.com
  bzfbpaulmaeefrvivpsqtylzqkcarfzbcvye-dot-cedar-code-289917.nn.r.appspot.com
@@ -115110,6 +130424,7 @@ bzgjhpdcdujkjdxx-dot-millinium.ey.r.appspot.com
  bzgmbaryziwrgdzw-dot-millinium.ey.r.appspot.com
  bzhhc.shoesmogul.com
  bzhovb.rogagot.com
+bzhtsmejsurkakdqhfmwbznuok-dot-gl9393jan.uk.r.appspot.com
  bzhw.com.cn
  bzhxhbijzb.ml
  bzhxvacmdsyobscxeybqtqvthltyxvwntnns-dot-cryptic-now-290917.ey.r.appspot.com
@@ -115445,6 +130760,7 @@ cacarrier-int.com
  cacatbalas.com
  cacbiihrtbvdlhpc-dot-millinium.ey.r.appspot.com
  cacerolazocol.com
+cacgkowijrbyybhqoeeoidaqif-dot-gl9393jan.uk.r.appspot.com
  cacgucfipptgilreqsgxlwnnhtdpkgdknqgs-dot-cryptic-now-290917.ey.r.appspot.com
  cache-0147l45bwfg345ml8ydb344pwdf75sd32zifoe83wm356pad.info
  cache-mskmar05.cdn.yandex.net
@@ -115526,6 +130842,7 @@ cafeponton.nl
  caferaclete.pt
  caferestaurantnador.com
  cafeshipefd.com
+cafeslacatedral.com
  cafethailan.com
  cafetiere.ovh
  caffeencup.com
@@ -115683,6 +131000,7 @@ caldenercom.nckirent.gdn
  caldwellcpas.net
  caldwellfbc.com
  caleii.kokoweill.vip
+calendered-acquisit.000webhostapp.com
  calendqr.com
  caleromartinez.ug
  calettadelcanavese.com
@@ -115786,6 +131104,7 @@ cameljobfinal.com
  camelliia.com
  camera-ip.myq-see.com
  cameraforce.tv
+camerafrozen.buzz
  cameragrace.guru
  camerajoint.com
  cameranguyendat.com
@@ -115966,10 +131285,10 @@ cancel-online.com
  cancel-onlinepayee.com
  cancel-orders.serveirc.com
  cancel-outgoingpayee.com
-cancel-paipai.serveirc.com
  cancel-payee-haii.com
  cancel-payee-halifax.info
  cancel-payee-hs.com
+cancel-payee-info.com
  cancel-payee-request.com
  cancel-payee-service.com
  cancel-payee-verify.com
@@ -115979,11 +131298,11 @@ cancel-payeeverification.com
  cancel-paymentprotection.com
  cancel-payments.co
  cancel-payments.info
+cancel-personal-payees.com
  cancel-ppal.xyz
  cancel-removalloginrequest.com
  cancel-requestverify.com
  cancel-suspension.duckdns.org
-cancel-unauthorisedpayment.com
  cancel-unknown-payees.com
  cancel-your-payees.com
  cancel.billing.update-eg.en-us.auth-sec-manageforms.com
@@ -116012,6 +131331,8 @@ cancellation-payments.info
  cancellation-removing.com
  cancellation-support.co.uk
  cancellation-update.cc
+cancellationforpayee.com
+cancellationforpayee.net
  cancellationi-tunesrequestapplstore.com
  cancellations-payments.cc
  cancelling-payee.cc
@@ -116031,7 +131352,6 @@ cancelpaylogin.com
  cancelpayments-haii.online
  cancelppal.xyz
  cancelrecipient.com
-cancelrecipientshelp.com
  cancelrequestedtopay.net
  cancelrequesttopay.net
  cancelstore-viewpay-itemid0084727100.cf
@@ -116086,6 +131406,7 @@ canicattinotizie.net
  canimcalzo.com
  caninegrindz.com
  caninetags.ga
+caninoyfelinospoblado.com
  caniparc.net
  canisdelicaticom.shaxiaprimary.top
  canismajor.co.za
@@ -116164,7 +131485,6 @@ canyon.me
  canyonplastering.com
  canyouhelp140.casa
  canyouhelp140.cyou
-canyouhelp140.icu
  canzy.com.vn
  caoamelieoohildegard.club
  caonimacaonima.fdgfdgsdfhjsdfklsdkjkghdfhgeyuhjkfdgjkfhsdk.top
@@ -116814,11 +132134,13 @@ case-id8391.com
  case-id9103.com
  case-navi.online
  case-navi.ru
+case-paypal792.com
  case-review1002.design
  case-review2244.xyz
  case-review483.xyz
  case-review484.xyz
  case-review5204.xyz
+case-review596.xyz
  case-sw.sourceforge.io
  case.gonukkad.com
  case09-problem-account-48gh4dfhd7.graphicnovelreview.com
@@ -117062,6 +132384,7 @@ catholichub.tv
  catholicismrefreshernotes.co.uk
  catholicmusicfest.com
  catholish.biz
+cathybeesey.com
  cathycabrera.com
  cathykeir.co.uk
  cathyoakes.com
@@ -117125,10 +132448,10 @@ cawqeeqbkywunwsucf.top
  cawzxlqaeylyqqdpptzi-dot-gleowyel040493443434989.wl.r.appspot.com
  caxbnee.com
  caxg.xyz
+caxnkubgqhwrsqmahbjqvuhvwe-dot-gl9393jan.uk.r.appspot.com
  caxrejnstisfedii-dot-millinium.ey.r.appspot.com
  cayahanshaj.com
  caycerichardson.com
-caycos.beispielseite-wmka.de
  cayecasas.com
  caygiongcongnghecao.com
  caygri.com
@@ -117149,12 +132472,12 @@ cb98944.tmweb.ru
  cbacpartnership.org
  cbahiateajuda.com
  cbahvjgvdjacharahcaefa.com
+cbakks.cam
  cbakugzp.dogestocks.com
  cbakvtl.cohiun.xyz
  cbaoffshore.com
  cbasnvvfuzjijzcf-dot-millinium.ey.r.appspot.com
  cbaurangabad.in
-cbay.com-itm.34342235.xyz
  cbbc.bankin.live
  cbbc.banksacc.com
  cbbsxpbhtvyanvjdrs.top
@@ -117192,6 +132515,7 @@ cbi.bpergruop.net
  cbi.com.eg
  cbicbc.com
  cbifinance.ca
+cbiinrdruwyptvellsktlvybvr-dot-gl9393jan.uk.r.appspot.com
  cbiobjmrjuzfjwerouywykpjxgtxiykfakuc-dot-glenxpecial3009493.ey.r.appspot.com
  cbjets.com
  cbjrywuxnniebzcp-dot-millinium.ey.r.appspot.com
@@ -117241,6 +132565,7 @@ cbvinylrecordart.com
  cbvmbzordtyzfzzs-dot-millinium.ey.r.appspot.com
  cbvpiulwnrgmpphl-dot-millinium.ey.r.appspot.com
  cbwimkwgdz.duckdns.org
+cbwlqoopevaoxjjtnxllhviuer-dot-gl9393jan.uk.r.appspot.com
  cbxttdgcmrnlysvd-dot-millinium.ey.r.appspot.com
  cbyiifkyvjvrzwfd-dot-millinium.ey.r.appspot.com
  cbyulecheng.tavmo.com
@@ -117265,6 +132590,7 @@ cc87487.tmweb.ru
  cc8848.xyz
  ccadminn.com
  ccandcbrand.com
+ccaofqsnmjcaactsckmaxcugvg-dot-gl9393jan.uk.r.appspot.com
  ccaqauvu.topkorder.su
  ccarhcgkjelwuokarbxkobtvkl-dot-gleowayel400503.uc.r.appspot.com
  ccash.xyz
@@ -117377,6 +132703,7 @@ ccxbnwwbwqpygyoewrxymhimbmmxzakhdprm-dot-solar-vertex-285913.rj.r.appspot.com
  ccxbnwwbwqpygyoewrxymhimbmmxzakhdprm.solar-vertex-285913.rj.r.appspot.com
  ccxvmxqsyyqtncwjofoberdueaxbocypnvoe-dot-cedar-code-289917.nn.r.appspot.com
  ccycny.com
+ccyfyvgqpzyopweqhftuuruwmc-dot-gl9393jan.uk.r.appspot.com
  cczpzfrfpelmuagv-dot-millinium.ey.r.appspot.com
  cd-08-verify.cf
  cd-shl.com
@@ -117739,6 +133066,7 @@ celebsdetail.com
  celebshine.com
  celebtravelandevents.co.za
  celeclub.org
+celenggus.000webhostapp.com
  celengle.xyz
  celensecurity.com
  celeratured.xyz
@@ -117854,6 +133182,7 @@ centermeinkontode.aba.vg
  centerofbiopolitics.com
  centeroflifechurch.com
  centeroflightyoga.com
+centerofmetro.com
  centerofsupport.gq
  centerpontosmultipresente.center
  centerpontosmultipresente.live
@@ -118039,7 +133368,6 @@ certificawebank.com
  certificazioneanagrafica-web.com
  certifiedmembership.top
  certifiedprolnstabluecheck.000webhostapp.com
-certifiedsalty.com
  certifiquesupagod.com
  certifymyproperty.com
  certinaj.000webhostapp.com
@@ -118179,6 +133507,7 @@ cft6.addroits.com
  cft8.awaykart.com
  cftg8.likesyou.org
  cftqz.com
+cftwkurbtyujscwuxvswlqrvgo-dot-gl9393jan.uk.r.appspot.com
  cfvevcbloqyzoqvdmxrgrdivqxpqalqlekbz-dot-solar-vertex-285913.rj.r.appspot.com
  cfvwwwbmxkwqkqtmhv.top
  cfwc-deanzadistrict.org
@@ -118222,7 +133551,7 @@ cghmedia.com
  cghomrfrynpbjtegytsgrpkgrlimwijxzcqi-dot-cryptic-now-290917.ey.r.appspot.com
  cghxwcnwckjibqnr-dot-millinium.ey.r.appspot.com
  cghygiene.com
-cgi-bin-rbaccess-rbcgi3m01f61f7ib-f21-ibf12-ibrequest.top
+cgi-bin-rbaccess-rbcgi3m10f81f-f21ibrequest.top
  cgi-ebay-de-ws-ebayisapi-dll.a0001.net
  cgi-paypal.com
  cgi-summary.serv764.ajktebaju.com
@@ -118256,6 +133585,7 @@ cgs32.com
  cgshunt.com.cn
  cgsijibemewlczco-dot-millinium.ey.r.appspot.com
  cgubtokn.info
+cgunnkchxeroewuexebxndyys-dot-gl9393jan.uk.r.appspot.com
  cgupt-first.xyz
  cgutvxalhhxbneny-dot-millinium.ey.r.appspot.com
  cguyvkgtkcedjnfpxd.top
@@ -118316,6 +133646,7 @@ ch4s3-s3crt22.com
  ch4s3-secure-dashboard-r3port.eventosideal.com.br
  ch4z3-s3cur7y.com
  ch77067.tmweb.ru
+ch79847.tmweb.ru
  cha.6888ka.com
  cha.jameslanska.biz
  cha.ypytws.tk
@@ -118526,6 +133857,7 @@ charmless-multimete.000webhostapp.com
  charmservice.icu
  charmsmith55.com
  charn.com.au
+charneecollier.com
  charonik.com
  charonver.gq
  charperimagedesign.com
@@ -118996,11 +134328,11 @@ chat-grupwhatsapp1.h6d.shop
  chat-grupwhatsapp8.crott.ga
  chat-grupwhatsapp8.dnvnt.cf
  chat-grupwhatsapp82.jcub.xyz
-chat-grupwhatsapp897.tk
  chat-grupwhatsapp90.jcub.xyz
  chat-grupwhatsapp94.jcub.xyz
  chat-grupwhatsapp94.qpoe.com
  chat-grupwhatsapp95.jcub.xyz
+chat-grupwhtsapbokep.whtsapp-citha.gq
  chat-hali-fax.com
  chat-invite-grup-htydxza.000webhostapp.com
  chat-mariozawa.jkub.com
@@ -119103,6 +134435,7 @@ chat-whatsapp-join-grub-bokep.join-bkeps10.cf
  chat-whatsapp-kp1jlr5pzer0nb4o1jutmc.3-a.net
  chat-whatsapp-kpr0nb4o1jut5.onmypc.org
  chat-whatsapp-kpr1djlrg5pzegfr0nb4o1jutmc.mynumber.org
+chat-whatsapp-notnot-join-grup-mabar.evnt-gratis078.ml
  chat-whatsapp-sexyyhott18.wa-gruops.ml
  chat-whatsapp-tantemuda-v281g28.zzux.com
  chat-whatsapp-viral5.ourhobby.com
@@ -120485,6 +135818,7 @@ cibinong-gunungsindur.desa.id
  cible-energy.com
  cibnationalmonument.com
  cibxen.com
+cicakn.cam
  cicdidsisd.club
  cicek.gen.tr
  cicendoeyehospital.org
@@ -120699,7 +136033,6 @@ citiaccessjbrhjefe.carlylecommunity.icu
  citiaonlineccproces.pierceremodelinggroup.icu
  citibanamex.ahmreg.mx
  citibanco-london.co.ua
-citibank-jfp-token-awboij77.top
  citibank-securityservices.com
  citibank.online.account.italianamericanrelief.org
  citibank.xcigroups.com
@@ -120816,6 +136149,7 @@ civso0qas.appspot.com
  civtkonqetbdzbloxfetzbaequ-dot-gleowayel400503.uc.r.appspot.com
  ciwckltqhlfjncpt-dot-millinium.ey.r.appspot.com
  ciwcvqsxlojumxxx-dot-millinium.ey.r.appspot.com
+ciwfcsewcdwulogxestyblhylo-dot-gl9393jan.uk.r.appspot.com
  cixshtwrmuxonqjl-dot-millinium.ey.r.appspot.com
  cixz.goruli.com
  cixzserxfsmmxesl-dot-millinium.ey.r.appspot.com
@@ -120843,6 +136177,7 @@ cjchoteis.wdcom.host
  cjcmnbzlofrvyjrm-dot-millinium.ey.r.appspot.com
  cjczxewrfdspfeze-dot-millinium.ey.r.appspot.com
  cjdnvdrfknjtmcxw-dot-millinium.ey.r.appspot.com
+cjdobevtzdpicikccyybssybdl-dot-gl9393jan.uk.r.appspot.com
  cjdososks.cf
  cje.cl
  cjepglzvcbishify-dot-millinium.ey.r.appspot.com
@@ -120890,6 +136225,7 @@ cjwbzl.shoesmogul.com
  cjwmebnuwiuavjav-dot-millinium.ey.r.appspot.com
  cjwpropertygroup.com
  cjwtwhucyoobuvawtyvrnoerec-dot-gleowayel400503.uc.r.appspot.com
+cjwzejuuntzxiuxzaewydhmojc-dot-gl9393jan.uk.r.appspot.com
  cjx7r.mentriqq.com
  cjxtjsrueryygihboezncoxpze-dot-gloff849483.uk.r.appspot.com
  cjxzhsad.uygfdzmk.top
@@ -120933,6 +136269,7 @@ ckonuttpvy20.000webhostapp.com
  ckosafqy.tanglescanner.com
  ckpnigflsxnsadni-dot-millinium.ey.r.appspot.com
  ckpoemyqgslntpgw-dot-millinium.ey.r.appspot.com
+ckpuxypyseyvhilsyqqmseistf-dot-gl9393jan.uk.r.appspot.com
  ckqadxgimwqlhppymvqoqxdkryqmanftpeqd-dot-cryptic-now-290917.ey.r.appspot.com
  ckqadxgimwqlhppymvqoqxdkryqmanfxpeqd-dot-cryptic-now-290917.ey.r.appspot.com
  ckqn3.anahkedm.com
@@ -121007,7 +136344,6 @@ claimeventgratisfreefirebgid.000webhostapp.com
  claimeventpubgmobile.com
  claimevents15.net
  claimeventspinff.login-ambil34.ga
-claimeventxnow.com
  claimfree-skinsml.zyns.com
  claimfree00.zyns.com
  claimfree02.2waky.com
@@ -121050,7 +136386,6 @@ claimsekali.000webhostapp.com
  claimsff.my.id
  claimskin-mlnew78.wikaba.com
  claimskin.in
-claimskinfree.com
  claimskinfree.gleeze.com
  claimskinfree24.wikaba.com
  claimskinm4now.com
@@ -121089,6 +136424,7 @@ clarifyadjust.com
  clarifybalance.com
  clarifylawyer.com
  clarifyproduction.com
+clarisilremedie.buzz
  clarislaborbuilder.com
  claritcentre.org
  claritybusinessfunding.com
@@ -121172,6 +136508,7 @@ clck.ru
  clconfirmpayment.us
  cld7m.codesandbox.io
  cldbx.goruli.com
+cldimanrtiwhprhttwxbxiyktn-dot-gl9393jan.uk.r.appspot.com
  cle-secure.net
  clean-cut.co.uk
  clean24k.com
@@ -121208,6 +136545,7 @@ cleanupcongresspac.com
  cleanwelllitconference.cartoomy.repl.co
  cleanwindow.top
  clear-4020accyt.000webhostapp.com
+clear-headed-dimens.000webhostapp.com
  clear-lb.com
  clear-translations.com
  clearakrepall.kozow.com
@@ -121219,6 +136557,7 @@ clearcovid19virus.com
  cleardrishti.com
  cleardristi.com
  clearenergy.pl
+clearpm-docusign.com
  clearpointcenter.com
  clearriskviewcom.nckiaccounting.gdn
  clearskopeacademy.com
@@ -121230,6 +136569,7 @@ clearviewpartners.in
  clearviewretirement.com
  clearwaterriveroutfitting.com
  clearwaterwd.com
+clearwing.guru
  cleatdarg.top
  cleats4soccer.com
  cledental.com
@@ -121436,7 +136776,6 @@ clientsample1.icu
  clientsecure.servehttp.com
  clientsecurehttp.servequake.com
  clientservagrictct.com
-clientservicemessag.xyz
  clientshatefreeman.org
  clientsidefrivolousaddons--five-nine.repl.co
  clientsrecupnetfllix.com
@@ -121601,7 +136940,6 @@ cloud.auslogics.org
  cloud.graph.us
  cloud.manage-feedback220.thehotmesscrew.net
  cloud.onedrive.my-wiley.com
-cloud.owavoicestream.ga
  cloud.owawebcloud.gq
  cloud.paypal.com-informationaccounts.com
  cloud.settings.recoverysecuritycloud-tuh.com
@@ -121746,6 +137084,8 @@ cmasempresa.com
  cmb-bois.best
  cmb-company.xyz
  cmb-secureweb.com
+cmbaohpyvtfitmiwxhxrshseyn-dot-gl9393jan.uk.r.appspot.com
+cmbexmfnnlppowdkwfyphigewe-dot-gl9393jan.uk.r.appspot.com
  cmbifxdhk.rogagot.com
  cmc-me.com
  cmck4vve6e24wdktsc9n8l1izi7eb9.biz
@@ -122081,6 +137421,7 @@ coatsgroup.com
  coausmgos.org
  coba.servebeer.com
  cobaaainmasuk.000webhostapp.com
+cobaajadisiniykyk.000webhostapp.com
  cobaem.edu.mx
  cobajalani.com
  cobaltbd.mnhd.com
@@ -122106,6 +137447,7 @@ cocktailcontent.com
  cocktailpayment.com
  cocky-chandrasekhar-72cffa.netlify.app
  cocky-galileo-fb18bb.netlify.app
+cocky-nightingale-40ccb8.netlify.app
  cocky-solder.000webhostapp.com
  cocky-wescoff-aac502.netlify.app
  cocnguyetsanlincupsg.com
@@ -122233,6 +137575,7 @@ cogitype166.com
  cogiutil53.com
  cogmyboazfvvqaqotcjfoufofshzexhyoaiv-dot-glxcel49934343434.rj.r.appspot.com
  cognerium.com
+cognitional-caves.000webhostapp.com
  cognitiveoutlaw.org
  cogqjefxuumkkbaumzzmexdnwlwrmieeylqm-dot-glxcel49934343434.rj.r.appspot.com
  cogstateconstructions.com.au
@@ -122327,6 +137670,7 @@ coldlandscolts.uk
  coldsggpla.com
  coldstar.pk
  coldstoragebrokers.buzz
+coldwargeneratroriusi.us
  coldweatherenergyfund.com
  coldweatherpayment.com
  coleagriservclient.xyz
@@ -122385,6 +137729,7 @@ collection.wzzwn.com
  collectionofartists.com
  collectionofvideos.000webhostapp.com
  collectionslinkzimbrahome.000webhostapp.com
+collective-techniqu.000webhostapp.com
  collectiveagency.co
  collectivedigitalmarketing.com
  collectiveenterprises.com
@@ -122608,6 +137953,8 @@ com.appco.cc
  com.appleinc.de
  com.au.defence-nab.services
  com.bvn6.ru
+com.cgi-bin-rbaccess-rbcgi3m01f61f-f21ibrequest.info
+com.cgi-bin-rbaccess-rbcgi3m01f61f-f22ibrequest.info
  com.check-iphone.com
  com.cibc.com.ionisedfecconnerly.icu
  com.cm6j.ru
@@ -122842,6 +138189,7 @@ commmcc.weebly.com
  commnuity.stage.powerforrthepeople.stage6ixte.org
  commodex.com
  commomwealthbankgroups.com
+common-oauth2-authorize.glitch.me
  common-problem.live
  commonfewsearchservice--five-nine.repl.co
  commonground-stories.com
@@ -122945,10 +138293,11 @@ compagnons-alzheimer.com
  compagnonvoyage.com
  companhiaitaunense.com.br
  companieshouseonlinedownload.com
+company-11326489780965443.tk
+company-11326489780965444.tk
  company-partenariat-investissement.com
  company.motopays.com
  company01.sutoweb.com
-companydilemma.com
  companydoc-a1c66.web.app
  companynotificcations.tk
  companyriviera.eu
@@ -123030,7 +138379,6 @@ completeboxdocumentfp6wmnh2rmozhd0gp14.azurewebsites.net
  completeboxdocumentfp6wmnh2rmozhd0gp15.azurewebsites.net
  completecertif.com
  completedigitalmedia.co.uk
-completefilee.mybluemix.net
  completeleasing.icu
  completeshs.com
  completetheupdate.anewnoticerakuten.icu
@@ -123042,6 +138390,7 @@ compliance-central.com
  complianceattestation.com
  complianceceo.com
  compliancesolutionsstrategies.com
+compliant-armful.000webhostapp.com
  complored.xyz
  compmold.com
  component.pw
@@ -123104,6 +138453,7 @@ compte-interdit-bancaire.net
  compte-labanquepostale.fr
  compte-pour-tous.fr
  compte.at
+comptecibcap06.000webhostapp.com
  compteclient.cagrico-servicecms.fr
  compteiikg.000webhostapp.com
  comptenetlfix-update.com
@@ -123147,6 +138497,7 @@ comteconerneraphedb.info
  comun1c10nes0y0atenc10n.com
  comunaghergheasa.ro
  comune.gioiadeimarsi.aq.it
+comune.royal-eng.ps
  comunicacaovertical.com.br
  comunicado.novoatendimentocaixa.tk
  comunicadobombeiro.email
@@ -123272,9 +138623,11 @@ confidenceforbid.com
  confidenceswell.com
  confidencetumble.com
  confident-brattain-61219f.netlify.app
+confident-fermat-82200a.netlify.app
  confident-fermi-1e9947.netlify.app
  confident-hoover-947da2.netlify.com
  confident-hoover-e7a38c.netlify.app
+confident-kirch-8ba712.netlify.app
  confidentialite-profils.webnode.cr
  confidentiality.info
  confidesac.com
@@ -123319,7 +138672,6 @@ confirm-account-for-repairing-00781.my.id
  confirm-account-page-service-site.my.id
  confirm-account-page-service.my.id
  confirm-account-repair-info.my.id
-confirm-account.contact
  confirm-accounts-support-reporting.my.id
  confirm-anymention.net.pl
  confirm-apple.sytes.net
@@ -123336,16 +138688,15 @@ confirm-devices-security.com
  confirm-fbservice.xyz
  confirm-hs-payee.com
  confirm-id.xyz
-confirm-inv.web.app
  confirm-lnstagram.com.de
  confirm-migrate-me-yahoo-1.webredirect.org
  confirm-mobile-uk.com
  confirm-my-account-pay-pal.4pu.com
  confirm-my-netflix.com
  confirm-my3.info
-confirm-mynew-payees.com
-confirm-mynew-transactions.com
+confirm-myrecent-transfers.com
  confirm-needed.com
+confirm-new-payee-authorization.com
  confirm-new-payee.cc
  confirm-newpayee.com
  confirm-onlinepayments.com
@@ -123354,6 +138705,8 @@ confirm-payee-ref8920.com
  confirm-payee-reference006.com
  confirm-payee-reference1721.com
  confirm-payee-security.com
+confirm-payeeactivity.com
+confirm-recipientactivity.com
  confirm-secured-department.com
  confirm-transfer-reference00821.com
  confirm-transfer-reference11772.com
@@ -123521,7 +138874,6 @@ congnghexanhtn.vn
  congnghieptiendat.com
  congoley.com
  congphim.org
-congratulationselect.weebly.com
  congratulatory-purg.000webhostapp.com
  congregacioncristiana.org.ar
  congresolenguas.uicui.edu.mx
@@ -123762,7 +139114,7 @@ construtorasempre.com.br
  consubcencheden.xyz
  consuelawilliams.com
  consuetudinary-spec.000webhostapp.com
-consulenteappaccesso.com
+consulentewebaccesso.com
  consulenza-aggiornamento-app.com
  consulenza-web-online.com
  consulmuseum.ca
@@ -123930,7 +139282,6 @@ content-528527410.curetrick.com
  content-54283452.interiorholic.net
  content-547427849.helenquan.ca
  content-556383911.helenquan.ca
-content-56280270428.keegan21.com
  content-566160985.helenquan.ca
  content-57813602.interiorholic.net
  content-578674009.curetrick.com
@@ -124152,10 +139503,8 @@ controllo-it-sms.com
  controllo-urgente-mps.com
  controllo-urgente-we-bank.com
  controlloaccessi-ban.com
-controlloaccesso-web.com
  controlloaggiornamento.com
  controlloautomatico.000webhostapp.com
-controllodisposizione-conto.com
  controlmaxheacom.nckila.gdn
  controlparental.fr
  controlshop.support-futuremarket.com
@@ -124182,6 +139531,7 @@ convertinchtocm.com
  convertt.co.kr
  convesdeim.cabanova.com
  convexsol.com
+convictbill.guru
  convictionfitness.webdmcsolutions.com
  convicttoralselivessoftwarx.com
  convid-19update.com
@@ -124347,8 +139697,6 @@ copyright-report-detect-check.my.id
  copyright-service-live.com
  copyright-serviceform.com
  copyright-servicies.com
-copyright-suportss-notification-irecovry.ga
-copyright-suportss-notification-irecovry.gq
  copyright-support-appeal.com
  copyright-support-forms-insta.com
  copyright-support-help-instagram.ml
@@ -124363,6 +139711,7 @@ copyright2-instagram.gq
  copyrightaccountconfirmation.tk
  copyrightappeal-instagram.com
  copyrightappealsupport.com
+copyrightbusiness.support
  copyrightbusinessteam.com
  copyrightcenter.0fees.us
  copyrightcenters-instagram.ml
@@ -124410,6 +139759,7 @@ copyrights-lnstagram-verification.com
  copyrights-notice.com
  copyrights-objection-instagram.cf
  copyrights-securitys.com
+copyrights-violation-help.com
  copyrightsbusiness.com.instagram-helpteam.tk
  copyrightscenter.net
  copyrightscentersupport.ml
@@ -124490,6 +139840,7 @@ cords-sucks.org
  cordsandkrebs.org
  cordsnkrebs.org
  cordujainjcsvlfh-dot-millinium.ey.r.appspot.com
+cordulahart.de
  core300.org
  corecheck.me
  coredataresearch.co.uk
@@ -124933,7 +140284,7 @@ count.mail.163.com.upgrademailquota.xyz
  count.mail.163.commsk.count.fkc.count.mail.163.com.wedge-ksa.com
  count.office.emailsrvr.spgas.com.au
  count.secured.emailsrvr.villacorfu.com.au
-countdomaailpartdata.ga
+countdomaailpartdatae.ga
  counteractive-digit.000webhostapp.com
  counterbend.xyz
  counterclockwise-fo.000webhostapp.com
@@ -124948,6 +140299,7 @@ countrication.info
  countrycuffs.com
  countryeggplantr.com
  countryhappy.men
+countrymove.guru
  countryrelaxation.info
  countrywoodinteriors.com
  countsingnorpeo1923.blogspot.al
@@ -125209,7 +140561,6 @@ coyprightshelpcenter.com
  coysatx.com
  coysfyuzxnnrisckfnypbpgvdn-dot-gleowayel400503.uc.r.appspot.com
  coz10savd7.gmz.cc
-cozibmk30393jdjdjd93939dkxjxjjxxjjxjxjxjxxsdsssd.s3.us-east-2.amazonaws.com
  cozinessboncrete.net
  cozinha-batedeira-cozinha-batedeira.tk
  cozinha-cozinha-cozinha.tk
@@ -125359,6 +140710,7 @@ cpanelpourcontinuerhqnfghjkackmailercom.000webhostapp.com
  cpawhy.com
  cpaybr.com
  cpazimbabwe.co.zw
+cpbatlxqgjefgkecbbqugxxkvk-dot-gl9393jan.uk.r.appspot.com
  cpbmfidnvkjaqkrk-dot-millinium.ey.r.appspot.com
  cpc.cx
  cpc.mashresearchb.com
@@ -125661,6 +141013,7 @@ cpntmbxeugxnbmxbaz.top
  cpoohcodmfkucglhzjmmkkeyquhrnxjkzglo-dot-solar-vertex-285913.rj.r.appspot.com
  cporiente.cl
  cpphost.com
+cpqjgcmxzxjicyimstndztmhmo-dot-gl9393jan.uk.r.appspot.com
  cprdpqqqqhdzccvhhgfvpljoxx-dot-gleowayel400503.uc.r.appspot.com
  cprodmasx.weebly.com
  cprodx-att-net-common-login-igate-email.weebly.com
@@ -125693,6 +141046,8 @@ cq9.jaysbrand.com
  cq94166.tmweb.ru
  cqae.svcoding.com
  cqaimhxtyljscgql-dot-millinium.ey.r.appspot.com
+cqajzmhwugvclobwvcliaqkdam-dot-gl9393jan.uk.r.appspot.com
+cqasnbnscvihibkuivkdwevsfn-dot-gl9393jan.uk.r.appspot.com
  cqaxz.club
  cqbano.ddns.net
  cqbxjrcnqfrqvixk-dot-millinium.ey.r.appspot.com
@@ -125979,6 +141334,7 @@ craneindo.com
  crankisdg.servepics.com
  cranky-bose-78b530.netlify.app
  cranky-liskov-a0842b.netlify.app
+cranky-mahavira-4f42e4.netlify.app
  cranky-sinoussi-aa196d.netlify.app
  cranleighscoutgroup.org
  craonline-registration.com
@@ -126033,6 +141389,7 @@ crditoshared.appspot.com
  crdt-agrcole-compte-securipass.u670943hb3.ha004.t.michaelgchan.com
  cre-authenticate-official.n4t.co
  creaception.com
+creacersadvsf.us
  creacersuiyiushad.us
  creadesigners.com
  creadictos.com.bo
@@ -126539,6 +141896,7 @@ cs-alertappleid.serveirc.com
  cs-amazonid3153.servebeer.com
  cs-analyzer.tk
  cs-assistamazon.servecounterstrike.com
+cs-bnk.app.link
  cs-dazzler.com
  cs-empire.ga
  cs-free-skins.xyz
@@ -126589,6 +141947,7 @@ cscasedrop.xyz
  csccambodia.com
  cscclabs.com
  cscdlsalnvgzdcdsnixadnvvzi-dot-gleowayel400503.uc.r.appspot.com
+cscentralcard.com.br
  csceyynbceucfndn-dot-millinium.ey.r.appspot.com
  csckwxfiguxaewub-dot-millinium.ey.r.appspot.com
  cscobejxkjbpekux-dot-millinium.ey.r.appspot.com
@@ -127020,6 +142379,7 @@ cu-gong.com
  cu1-org.be
  cu1org.be
  cu26494.tmweb.ru
+cu27228.tmweb.ru
  cuacuonsieure.com
  cuadi.com.mx
  cuadros.pe
@@ -127154,6 +142514,7 @@ cuppacap.com
  cuptiserse.com
  cuqjvszsjxmksntq-dot-millinium.ey.r.appspot.com
  cuqvzi.dermals.org
+cuqwndpjtbhlinqjvffrtmvqjg-dot-gl9393jan.uk.r.appspot.com
  cuqwoeuavscxhneduitnfpzhbp-dot-gleowayel400503.uc.r.appspot.com
  curait.com
  curasnacks.com
@@ -127224,7 +142585,6 @@ currentlyattdomains5.weebly.com
  currentlyattfastmail.weebly.com
  currentlyattfastreplies.weebly.com
  currentlyattfastservice.weebly.com
-currentlyattfromyahoo.weebly.com
  currentlyattlog.weebly.com
  currentlyattm.weebly.com
  currentlyattmai1.weebly.com
@@ -127370,6 +142730,7 @@ cust.capek-aing.com
  cust.chase.gmcparts.net
  cust.privacy-protection-id.com
  custislogistics.com
+custodyset.guru
  custom-bearing-286119.ew.r.appspot.com
  custom-essays-online.co.uk
  custom-kvbo.frb.io
@@ -127534,6 +142895,7 @@ custsomer.com
  custsupport1000.com
  custumetanet-uttbedbr.mzbomboniere.it
  custupdates.com
+cusupgoigwusbooxlexxjyweah-dot-gl9393jan.uk.r.appspot.com
  cusuppmyworldfosupp13.com
  cuszoulouiseje.gq
  cut-out-pails.000webhostapp.com
@@ -127588,7 +142950,6 @@ cv.habjobs.com
  cv00879.tmweb.ru
  cv1.info
  cv8udg720hgr.pembukacsaio.club
-cv94260.tmweb.ru
  cvacca.ca
  cvaonovlqjveaktb-dot-millinium.ey.r.appspot.com
  cvasajhsjkls00pro.co.uk
@@ -127612,6 +142973,7 @@ cvdfeyt.cf
  cvetisbazi.ru
  cvetochniy-buket.ru
  cvetolenta.ru
+cvfqtcftxfrxgxyhzcfczutqms-dot-gl9393jan.uk.r.appspot.com
  cvg.smtbkw.cn
  cvgmamuviguwfuqc-dot-millinium.ey.r.appspot.com
  cvgpoyayqhtvajcl-dot-millinium.ey.r.appspot.com
@@ -127632,6 +142994,7 @@ cvndschwb.ml
  cvnfr.xyz
  cvnjknife.fun
  cvnty.ga
+cvormqvbihcnpueknfmofgxwxb-dot-gl9393jan.uk.r.appspot.com
  cvowlgqeszewrnsm-dot-millinium.ey.r.appspot.com
  cvphyypngclippny-dot-millinium.ey.r.appspot.com
  cvpipaeatzpivzlf-dot-millinium.ey.r.appspot.com
@@ -127737,6 +143100,7 @@ cxezgnncnacmyded-dot-millinium.ey.r.appspot.com
  cxezrofpsfjgoqxpjhmvfxcfzy-dot-gleowayel400503.uc.r.appspot.com
  cxf-art.com
  cxfnlokheiwwsxdnmkyawujkuy-dot-gleowayel400503.uc.r.appspot.com
+cxfxcclgjcyaqurckuemddfyyi-dot-gl9393jan.uk.r.appspot.com
  cxghdsf.yegdnmtd.top
  cxghzatyeizbetbf-dot-millinium.ey.r.appspot.com
  cxgxfdwxepehgizhbdhycwalesrjjpswrtdv-dot-cryptic-now-290917.ey.r.appspot.com
@@ -127749,6 +143113,7 @@ cxlofrtg.com
  cxmazrvvzspcvvwj-dot-millinium.ey.r.appspot.com
  cxmfxjtwdxbrfqnx-dot-millinium.ey.r.appspot.com
  cxmx2020atualizacao.com
+cxmxmninodlyhoyfrizpwvgwqp-dot-gl9393jan.uk.r.appspot.com
  cxnabqecxpawvhmilcqockguoo-dot-gleowayel400503.uc.r.appspot.com
  cxnfdefreqmidjhr-dot-millinium.ey.r.appspot.com
  cxpprfp.mapstore.su
@@ -127759,6 +143124,7 @@ cxrsvwemxeuyirgm-dot-millinium.ey.r.appspot.com
  cxrtaeug7w.com
  cxrtqmbqdqweiyfz-dot-millinium.ey.r.appspot.com
  cxsdofsdo.kyhdmkug.top
+cxsdrijvrcrgxcahaqlbokvcxi-dot-gleow2021ja.ue.r.appspot.com
  cxsmfcppzoznbbpl-dot-millinium.ey.r.appspot.com
  cxtdyguidy-online.com
  cxtjgxdultxyxbnh-dot-millinium.ey.r.appspot.com
@@ -127859,6 +143225,7 @@ cyclopean-margins.000webhostapp.com
  cycy.198424.com
  cydfkyryfnnlesfiltpwickaeidgimwukagt-dot-cryptic-now-290917.ey.r.appspot.com
  cye-fscp.com
+cyeemznvnxntnlqqowugvqemwv-dot-gl9393jan.uk.r.appspot.com
  cyejzdfwuiamcegcsbgwizyakqlaobrqhpmp-dot-cryptic-now-290917.ey.r.appspot.com
  cyeumsmmmyancbdsdfllhieyzf-dot-gloff849483.uk.r.appspot.com
  cygcomputadoras.com
@@ -127899,6 +143266,7 @@ cypressbrook.com
  cyprus.in.ua
  cyqozznahctqocqz-dot-millinium.ey.r.appspot.com
  cyrela-imoveis.blogspot.com
+cyrwdletlumpjraoahuxgggkcz-dot-gl9393jan.uk.r.appspot.com
  cysnu.dermals.org
  cysyonetim.com
  cyszbqcvnjesckmy.top
@@ -127950,6 +143318,7 @@ czmedium.com
  czmlmrpkdyrjewgy-dot-millinium.ey.r.appspot.com
  czmmvogaacdqynte-dot-millinium.ey.r.appspot.com
  cznxk.goruli.com
+czohvwnqbxfyrnzruamkosdull-dot-gl9393jan.uk.r.appspot.com
  czp3j.addroits.com
  czqaxeccsyoixrxa-dot-millinium.ey.r.appspot.com
  czqhfzt.goruli.com
@@ -128154,7 +143523,6 @@ da62.nichesite.org
  da634fdas.appspot.com
  da822325-313f-4f85-b334-d9b00a2d64da.htmlcomponentservice.com
  daa-hu.com
-daa.org.et
  daaduaneiros.com.br
  daaeskannbank.com
  daandf.com
@@ -128319,6 +143687,7 @@ dainfoupf.com.br
  dainiksomoy24.com
  dainpower.com
  daintesuib.com
+daiopssop.cam
  dairyfocus.com.au
  dairyinputcentre.com
  daisy-alive-diascia.glitch.me
@@ -128960,7 +144329,12 @@ davismgt.com
  davisra.com
  davitherbal.com
  davivienda.cualquier-cosa.com
+davivienda.enlinea-wps.cc
+davivienda.enlinea-wps.com
+davivienda.enlinea-wps.net
  davivienda.icu
+davivienda.ingresospersona.online
+davivienda.ingresowps.co
  davivienda.inversionesargos.net
  davivienda.link
  davivienda.portalpersonas.com
@@ -129006,6 +144380,7 @@ dawoodmarafie.com
  daxex.pro
  daxuesen.com
  daxuminc.com
+daxxdjiveynqlaxgqvxxvzjwuz-dot-gl9393jan.uk.r.appspot.com
  day.dimaq.pl
  dayahblang.id
  dayakpoker.club
@@ -129063,10 +144438,10 @@ dba-dk.live
  dba-gmbh.de
  dba.dk.erhverv-annonce-21833657.cloud
  dba.dk.erhverv-annonce-35476815.xyz
-dba.dk.log-ind-pa-dba.art
  dba.dk.log-ind.co
  dba.dk.log-ind.email
  dbbc3db0c32eb6fd59cb18e51be1ada7af017b86.ph
+dbbmvnqzlcszsloocxpyavdpid-dot-gleow2021ja.ue.r.appspot.com
  dbbpohyisnfqylim-dot-millinium.ey.r.appspot.com
  dbcfd.xyz
  dbcomestic.com
@@ -129098,8 +144473,8 @@ dborg.kepoteman.xyz
  dbowfljwciscgljb-dot-millinium.ey.r.appspot.com
  dbperfection.com
  dbqgzi.deklareraspanien.se
+dbqjopmgnqlemaxsykkykfjifk-dot-gl9393jan.uk.r.appspot.com
  dbresorts.si
-dbs-approval.com
  dbs-digitaltoken.com
  dbs-fslchy.com
  dbs-internet.digital
@@ -129279,6 +144654,7 @@ ddhost.ro
  ddhpztpmsspnwjwvxd.top
  ddimobile.deliriumcg.com
  ddjewellers.co.zw
+ddkgapdhkehktzxhwnfyebvscw-dot-gl9393jan.uk.r.appspot.com
  ddkoo.com
  ddl.okgoodmobi.com
  ddl7.data.hu
@@ -129345,7 +144721,6 @@ de-item239161322.be
  de-item67854744.com
  de-item68452133.com
  de-kleinanzeig-en.ulvmichel22.de
-de-meinekonto-aktualisieren-meinekontoid-prufen.email
  de-myaccount-sicherheitscenter-t8gp0onk2v5p89.top
  de-onlineservice-supportsk.life
  de-register-dev.cc
@@ -129355,6 +144730,7 @@ de-register-halifax.com
  de-register-newdevice.co.uk
  de-register-newdevice.online
  de-register-uk.com
+de-register-unauthorised-mobile-auth.live
  de-registerdevice.com
  de-registered-device.link
  de-sparkasse1334.000webhostapp.com
@@ -129520,6 +144896,7 @@ debragunter.com
  debrah5434262.xyz
  debrawright-profile.info
  debraxjones-bazemore.com
+debrn10.000webhostapp.com
  debt-conflict.ru
  debtfreelaunch.com
  debtschedule.buzz
@@ -129532,6 +144909,7 @@ decamerous-displays.000webhostapp.com
  decasos.com
  decaturilbgc.com
  decaty.xyz
+deccadmysdumtbfawvgfopfxey-dot-gl9393jan.uk.r.appspot.com
  deccanmarket.com
  decembergun0.com
  decemberrushing.us
@@ -129638,6 +145016,7 @@ deeasrewomsabsubttop.tk
  deedprogress.co.za
  deeds.yolasite.com
  deeehuhhuv.duckdns.org
+deefntteydrlxvhrbmafyuqsya-dot-gl9393jan.uk.r.appspot.com
  deehyiqirvecxykn-dot-millinium.ey.r.appspot.com
  deekartmobile.com
  deeksis.info
@@ -129738,6 +145117,7 @@ degavu.esy.es
  degea.ga
  degenkolb.com
  degepro.com
+deghjkso.cam
  degisimkalip.com
  degisimkalip.com.tr
  degnanfleck2019.com
@@ -129890,10 +145270,10 @@ deloilte.com
  delongade.nckitickets.gdn
  delopa.org
  delow.co.uk
-delpacificoweb.com
  delphic-consulting.com
  delphinph.com
  delpradoapartment.com
+delrsong.com
  delsector.com
  delservi-four.tk
  delsilencio.de
@@ -130024,6 +145404,7 @@ demoliticism.info
  demolscorp.com
  demoluckyspinv1.jnrpanel.xyz
  demoluckyspinv3.jnrpanel.xyz
+demon12.000webhostapp.com
  demonbets.ru
  demondkapjesman.nl
  demonesia.net
@@ -130057,6 +145438,7 @@ denieepohio.cloudaccess.host
  denifl-consulting.at
  denis-99bg.com
  denise-booth.com
+denise-brooks.xyz
  denisetdavis.com
  denisgroy.com
  denizalticafe.com.tr
@@ -130150,6 +145532,7 @@ depascoalcalhas.com.br
  depatmentmanage.com
  depaulaetitaraadvogados.com
  depaulafestas.com.br
+depbjeuimlfbqpghtytnxfbvtw-dot-gl9393jan.uk.r.appspot.com
  dependentobreality.com
  dependication.com
  depenvnvces-confirm.serveirc.com
@@ -130211,6 +145594,7 @@ deregister-lloyd-unauthorisedaccess.com
  deregister-mobile-secured.com
  deregister-mobilebanking.com
  deregister-mobiledevice-secure.com
+deregister-newdevice-info.com
  deregister-newdevice-secure.com
  deregister-newdevice-secured.com
  deregister-newdevice.co.uk
@@ -130232,6 +145616,8 @@ deregister-payee-protect.com
  deregister-payeeaccount.com
  deregister-secure-online.com
  deregister-secure.com
+deregister-securelloyd-device.com
+deregister-securelloyd-unknown.com
  deregister-signin.com
  deregister-unsecuredevice-security.co.uk
  deregister-unverifieddevice.com
@@ -130251,7 +145637,6 @@ deregistered-devices.live
  deregistered-mobile.com
  deregistered-newdevice.com
  deregisternew-device.com
-deregisternewdevice-access.com
  deregisternewdevice.cc
  deregisterpayee-auth.net
  deregisterpayee.com
@@ -130306,6 +145691,7 @@ dertesta.serveirc.com
  dertierfotografde.chifanbudget.top
  dertuyuwo.cam
  deruiterstaalkabel.nl
+derupidvirygajehewzialfwta-dot-gl9393jan.uk.r.appspot.com
  dervosipniarubainc.com
  derwahnsinn.at
  derxone.ug
@@ -130451,6 +145837,7 @@ desinfectercoronavirus.com
  desing.co
  desintox.site
  desinytravel.com
+desireless-elapse.000webhostapp.com
  desiringhands.com
  desite.gr
  desjardins-2fraudalert.com
@@ -130515,6 +145902,8 @@ destek-turkiye-2020.ml
  destek1498tl.com
  destekekibipandemisorgulama-tr.com
  destekzamani.ml
+destenprojpass11.000webhostapp.com
+destenprojpass5.000webhostapp.com
  desterilization.xyz
  destfrtdsferdfterd.com
  destgrena.at
@@ -130777,6 +146166,7 @@ device-deregistration-info.com
  device-detection.americansse.org
  device-detection.verifyed-accountid.business
  device-enrolment.services
+device-faculty-unpaired.co.uk
  device-gb-deregister.com
  device-gived.xyz
  device-hplc-verify.com
@@ -130850,6 +146240,7 @@ deviceful-errors.000webhostapp.com
  devicegive.us
  deviceid-halifax.com
  deviceinfo-secure.com
+devicemanagementonline.com
  devicemanagerhalifax.com
  devicemoon.com
  deviceprotection-alert.cc
@@ -130958,6 +146349,7 @@ dextermnagessl.bounceme.net
  dexterplatypus.org
  dexterpowertech.com
  dextrotrading.com
+dexwsbvvfwobsgqaxreaflqnvj-dot-gl9393jan.uk.r.appspot.com
  dexxcagbtzouuyxr-dot-millinium.ey.r.appspot.com
  deyang.06rl.com
  deyang.06wi.com
@@ -131012,6 +146404,7 @@ dff.kf6tc.cn
  dffdfdsaffdsfd.000webhostapp.com
  dffesigninatt.weebly.com
  dffg.co.za
+dffmfgprzjipmrzfbxyyrhsudh-dot-gl9393jan.uk.r.appspot.com
  dffssdyt.weebly.com
  dfg.16rn00.cn
  dfg.wankdqr.cn
@@ -131123,6 +146516,7 @@ dfwyzxx.cn
  dfwzuuhoibfnhpeu-dot-millinium.ey.r.appspot.com
  dfxdp-zmjnz-fhpgp.web.app
  dfydemos.com
+dfyujgvfgv.tokyo
  dfzf.net
  dfzfgnf.ddns.net
  dfzlohzejihgwsayjavedrbucpumryjwuyel-dot-offglen.uk.r.appspot.com
@@ -131143,6 +146537,7 @@ dgc5.com
  dgcwnvcxnoukukvhrgvqehjtdjvakrzdwbpr-dot-solar-vertex-285913.rj.r.appspot.com
  dgdaerxing.com
  dgdfasddfs.ru
+dgdggdgdhwwootlowlkk.ibx.lat
  dgds54h1b65rf41ehjn6t8e74j8rt74j8t5er47j8rtj747-56ej4tr4j46t4g7.buzz
  dge.mbtrkb.cn
  dgecolesdepolice.bf
@@ -131172,6 +146567,7 @@ dgirlsvideos2.xyz
  dgirlsvideos4.xyz
  dgirlsvideos5.xyz
  dgiusghusegya363.xyz
+dgiwzfbeetauniwbtaduqfqlkn-dot-gl9393jan.uk.r.appspot.com
  dgkhj.ru
  dgkjdsghjrghjg.weebly.com
  dgkpkvlgivrozncd-dot-millinium.ey.r.appspot.com
@@ -131379,6 +146775,7 @@ dhxparggflvhxeoh-dot-millinium.ey.r.appspot.com
  dhyanmitra.com
  dhyarwhabcihdzuv-dot-millinium.ey.r.appspot.com
  dhybwe-nctwvm-ocuam.netlify.app
+dhyuhvwewmawrcpevrmegnhtms-dot-gl9393jan.uk.r.appspot.com
  dhzwg.awaykart.com
  dhzwoyqbkkokpysuqiiuonzlcdldhuqnuqix-dot-solar-vertex-285913.rj.r.appspot.com
  di-1.icu
@@ -131402,6 +146799,7 @@ diabcontrols.buzz
  diabetcentro.info
  diabetes-insight.info
  diabetesfreedom.net
+diabetesmasteravclauyehs.us
  diabetesprotocolshsj.us
  diabeticgoodbaking.icu
  diabeticsolutionsnetwork.com
@@ -131575,6 +146973,7 @@ dichvuvnpt.com
  dichvuvnpt.com.vn
  dickenshandchimes.com
  dickenspark.buzz
+diclcwucnnnxbozygocqklvoua-dot-gl9393jan.uk.r.appspot.com
  dicoli.in
  dict.ekitistate.gov.ng
  dictatorialness.xyz
@@ -131853,6 +147252,7 @@ digresseyebrow.com
  digrup.gq
  digua.club
  dih.gov.al
+dihfdpihdildrfuwiredyjpwht-dot-gl9393jan.uk.r.appspot.com
  dihnlihuvwnfpjaturambtvcry-dot-triple-upgrade-293822.rj.r.appspot.com
  dihnlihuvwnfpjaturambtvcry.triple-upgrade-293822.rj.r.appspot.com
  dihocthem129.000webhostapp.com
@@ -131864,6 +147264,7 @@ diiw.dermals.org
  diiwkgxnazmlzkxo-dot-millinium.ey.r.appspot.com
  dijaminn-crotttt-enjoyyyy.000webhostapp.com
  dijari.com
+dijbgyqfsptrpbafcgiujfvfqb-dot-gl9393jan.uk.r.appspot.com
  dijital-btk-duyurular-giris.ml
  dijital-esubem-cep.com
  dijitalbaskicenter.com
@@ -131975,6 +147376,7 @@ dipartimento-amministrativo.com
  dipelnet.com.br
  diper.one
  dipets.pt
+dipflower.buzz
  dipi-177.com
  dipleurogenesis.xyz
  diplomadosyespecializaciones.org.pe
@@ -132114,6 +147516,7 @@ disercom.es
  disferonline.com.br
  disfrazplanet.com.mx
  dishdashaex.com
+disheartened-crime.000webhostapp.com
  dishnchips.com
  dishsouq.com
  disinfectantdoctor.com
@@ -132178,6 +147581,7 @@ dispatch-security-651.com
  dispatch-woodcock-case.com
  dispatcher.latam-dff-dev.rokketlabs-apps.com
  dispensariosur.cl
+displayconcert.guru
  disponibilidade.online
  disponiblepost-ch.com
  disponivelparaconsulta.email
@@ -132369,6 +147773,7 @@ djdjcharm.com
  djdjdjdjdjdjdklsl.weebly.com
  djdjrubyapp.com
  djdjsa.bounceme.net
+djdusgqibeestvbxyhcmnlwqfd-dot-gl9393jan.uk.r.appspot.com
  djeane.com.pe
  djeffries.com
  djeshwxzsiz.biz
@@ -132527,10 +147932,12 @@ dktkzpkrrmyyuntz-dot-millinium.ey.r.appspot.com
  dktlnomgvzodbymw-dot-millinium.ey.r.appspot.com
  dktmhxfbohjkrlsc-dot-millinium.ey.r.appspot.com
  dktuku.com
+dkudqqyihtrvllscctfkhhpcde-dot-gl9393jan.uk.r.appspot.com
  dkw-engineering.net
  dkwheels.com.br
  dkxnne-----login.ygber.com
  dkxvqeqbsnrkgqqo-dot-millinium.ey.r.appspot.com
+dkyakposqaseyqtkejfihpsjvp-dot-gl9393jan.uk.r.appspot.com
  dkyogacentre.com
  dkzcugposexizgbp-dot-millinium.ey.r.appspot.com
  dkznyysudomwkwlkjaifinrxotggnuztrpnz-dot-gl494903049.wl.r.appspot.com
@@ -132568,6 +147975,7 @@ dl2.soft-lenta.ru
  dlagplc.com
  dlahidspnvacjuxhgisiakgicihbykipmazr-dot-cedar-code-289917.nn.r.appspot.com
  dlawgist.com
+dlbcdzilrkbtkklajwajuwfkmo-dot-gl9393jan.uk.r.appspot.com
  dlbktkqwzbstcwym-dot-millinium.ey.r.appspot.com
  dlc.berlin
  dld.jxwan.com
@@ -132675,6 +148083,7 @@ dmlqvyutcmxgrnwh-dot-millinium.ey.r.appspot.com
  dmmaakkkordii.com
  dmminox.com
  dmnaslpkple.com
+dmnzlvqifibmelzucihltxcxyb-dot-gl9393jan.uk.r.appspot.com
  dmobgprnwmiancfl-dot-millinium.ey.r.appspot.com
  dmosefen.com
  dmpmarketinggroup.com
@@ -132752,6 +148161,7 @@ dnldn-scfko-pbnzn.brazses.com
  dnliren.com
  dnmartin.net
  dnmazon.com
+dnmkpziujmtcamfgnohvjtwlgi-dot-gl9393jan.uk.r.appspot.com
  dnmny.com
  dnn.alibuf.com
  dnnfsqgbxqvnpegm-dot-millinium.ey.r.appspot.com
@@ -132763,6 +148173,7 @@ dnraviations.com
  dnrfmrklnzsbcbpy-dot-millinium.ey.r.appspot.com
  dnrmabcegyuywufkkwanlcgjei-dot-gleowayel400503.uc.r.appspot.com
  dnrwvmpwotvlgdiq-dot-millinium.ey.r.appspot.com
+dnrykxwtrlvtudvdspxcprjkqo-dot-gl9393jan.uk.r.appspot.com
  dns.alibuf.com
  dns.fanta222.xyz
  dns.proactiveads.be
@@ -133086,6 +148497,7 @@ dohoro.com
  dohowtodo.com
  dohxmsvsqxvxhizmflzwmfizuw-dot-gleowayel400503.uc.r.appspot.com
  doibietchangconchi8899.com
+doifwkjxfeyimgmraparbnirte-dot-gl9393jan.uk.r.appspot.com
  doiisveujkmfcykqltsyjlazbq-dot-gleowayel400503.uc.r.appspot.com
  doiiwgnmiggpqeut-dot-millinium.ey.r.appspot.com
  doil.hopto.org
@@ -133439,6 +148851,7 @@ dontsweattit.com
  donuttacopalaceinaustin.com
  donweeseinc.com
  donwload-file-id.tk
+donwqhpickmyghegsejfgpslka-dot-gl9393jan.uk.r.appspot.com
  donya-almesmar.com
  dooball-live.com
  doodahlabs.com
@@ -133534,6 +148947,7 @@ dosamdkasd.com
  doscity.com
  doscug.live
  doserveradmin.com
+doshohclgndifhemckvuckxmfg-dot-gl9393jan.uk.r.appspot.com
  doshomikfoundation.com
  dosi.unaux.com
  dosiertechnikonlinecom.baerseventhings.top
@@ -133657,6 +149071,7 @@ double-jointed-site.000webhostapp.com
  double-six.com
  doublecllck.com
  doubledog.nl
+doubleflavor.guru
  doublenjoymentech.com
  doubleproud.com
  doubler.link
@@ -133664,6 +149079,7 @@ doublerx2connect.000webhostapp.com
  doubleupted.com
  doubling-injectors.000webhostapp.com
  doubscoton.fr
+doubttaxi.guru
  douce-gusto.com
  douceurs-natures.com
  doucevale.com
@@ -133715,7 +149131,6 @@ down.liangziip.com
  down.maipala.com.cn
  down.pcclear.com
  down.qqfarmer.com.cn
-down.seriesnow.website
  down.shatangmu.cn
  down.slothy.in
  down.tgjkbx.cn
@@ -133807,6 +149222,7 @@ doze.odinstitute.org
  dozerdays.org
  dozfg.goruli.com
  dozhgvcdpqighwjt-dot-millinium.ey.r.appspot.com
+dozoqfdkunbfoyvpecocembjxf-dot-gl9393jan.uk.r.appspot.com
  dp5lga4akzjg.talagaremix.com
  dpacewhw.shoesmogul.com
  dpbh.info
@@ -133834,6 +149250,7 @@ dpg0k.mentriqq.com
  dpgjjs.com
  dphejwbxvtalhmyj-dot-millinium.ey.r.appspot.com
  dpidwfwcbsbzzpjnwjkxslrijo-dot-gleowayel400503.uc.r.appspot.com
+dpieyvasbqtxercmpsycrydqsk-dot-gl9393jan.uk.r.appspot.com
  dpiouqqzmxhpkwweorikldryrm-dot-gloff849483.uk.r.appspot.com
  dpjc.lt
  dpjmercgxrzvfggy-dot-millinium.ey.r.appspot.com
@@ -133853,6 +149270,7 @@ dpnykrmyfrjbgfnfylfajujxov-dot-gleowayel400503.uc.r.appspot.com
  dpo-as-a-service.com
  dpparki.or.id
  dppgwghaqahpiwpiloetcfpllohummvtmshz-dot-cryptic-now-290917.ey.r.appspot.com
+dppoxpyrjokbtkeyttukdullme-dot-gl9393jan.uk.r.appspot.com
  dpqlhwdclpvxddsghcaztkqbtalxnwgrswpp-dot-gl494903049.wl.r.appspot.com
  dprince.org
  dprisuzavkaurlea-dot-millinium.ey.r.appspot.com
@@ -133890,6 +149308,7 @@ dqjulius.com
  dqkyaxrfhrouhpwz-dot-millinium.ey.r.appspot.com
  dqlzzxipmmfhycsw-dot-millinium.ey.r.appspot.com
  dqmiefurtnwbxfyf-dot-millinium.ey.r.appspot.com
+dqmmiouzxbypnfuaqhbwvsyedx-dot-gl9393jan.uk.r.appspot.com
  dqnat-gulf.com
  dqnfgvrefdyfnocf-dot-millinium.ey.r.appspot.com
  dqngmladiwfkgmfwjshshmqwqk-dot-gloff849483.uk.r.appspot.com
@@ -133989,6 +149408,7 @@ dravesauto.com
  dravitech.com
  dravosburgpa.xyz
  drawanz.com.br
+drawerspill.guru
  drawings.ae
  draws13-pubgm.com
  drawspin-luckyspinn.dns04.com
@@ -134042,7 +149462,6 @@ dreamplaystudio.com
  dreamportalz.us
  dreampreneur.com
  dreamprips.xyz
-dreams-al.online
  dreams-innovations.com
  dreamsoftw.com
  dreamspact.com
@@ -134074,7 +149493,6 @@ drerkenscom.batwoqisent.top
  dresanit12.beget.tech
  dresmlqunbiykzuo-dot-millinium.ey.r.appspot.com
  dresortsgocek.com
-dressedflex.club
  dressesfinder.com
  dresslifes.com
  dresslikevs.com
@@ -134102,6 +149520,7 @@ drfxxagjnuihhljy-dot-millinium.ey.r.appspot.com
  drg.tervam.ru
  drgchadgreen.com
  drgh.r7yxz.cn
+drghwblxaulqfvgywxasdkvhgn-dot-gleow2021ja.ue.r.appspot.com
  drh4x.ddns.net
  drhalaelsaid.com
  drheidimist.com
@@ -134193,6 +149612,7 @@ drjbsclinic.com
  drjoshihospital.com
  drjoy.tech
  drkanwaljitsingh.co.in
+drkaqmvhbghqsauxacpwlsrxkl-dot-gl9393jan.uk.r.appspot.com
  drkateroberts.com
  drkerklaan.com
  drkerncom.chifanbackground.top
@@ -134381,6 +149801,7 @@ drydwcmokkrmcwmf-dot-millinium.ey.r.appspot.com
  dryhu.xyz
  drykit.de
  drylinkers.site
+dryphggesmxtrupcickjqfvfqz-dot-gl9393jan.uk.r.appspot.com
  dryproservices.com
  drzamindarseyecentre.com
  drzawgrzas.com
@@ -134396,6 +149817,7 @@ ds45x1.com
  ds7.main.jp
  ds851.addroits.com
  ds8f7g98asfill-informations.com
+dsabefbgtbymwfzqxqljvkyeqo-dot-gl9393jan.uk.r.appspot.com
  dsacsacsadcsadcsdac.sportsontheweb.net
  dsadasq1.xyz
  dsadoors.com
@@ -134527,6 +149949,7 @@ dt49.onderhost.com
  dtauuqxsdigjhpim-dot-millinium.ey.r.appspot.com
  dtechgov.com
  dtechsynergy.com
+dteovyksbvntqwrqpugrkustsb-dot-gl9393jan.uk.r.appspot.com
  dtepdiwivgsmcdmn-dot-millinium.ey.r.appspot.com
  dterhnwpdyszohfr-dot-millinium.ey.r.appspot.com
  dtes9tomain.ga
@@ -134561,6 +149984,8 @@ dtours.si
  dtowjfohj.goruli.com
  dtparnian.ir
  dtpfuxpqslfnqlaj-dot-millinium.ey.r.appspot.com
+dtpodyjcqamxndguryzzyvbfyx-dot-gl9393jan.uk.r.appspot.com
+dtqpafijtnzipbqugemfkhagwh-dot-gleow2021ja.ue.r.appspot.com
  dtrendz.site
  dtsawdh.com
  dtsay.xyz
@@ -134662,10 +150087,10 @@ due-retlnvoice.com
  due7invoice45review.ue.r.appspot.com
  dueightere.com
  duelmark.com
-duemiglia.evoluzioneufficio.net
  duenexacch.com
  duesouthalbany.net
  duetsqofr.shoesmogul.com
+duevote.buzz
  dueya.com
  dufbzuphbgmvfxdx-dot-millinium.ey.r.appspot.com
  duffelbagadventures.com
@@ -134997,6 +150422,7 @@ dvloriihqswuixod-dot-millinium.ey.r.appspot.com
  dvmquy.enexbyte.com
  dvncx.goruli.com
  dvnfmdykftftzeff-dot-millinium.ey.r.appspot.com
+dvngdtzrcymyigvesrczvfhnpg-dot-gl9393jan.uk.r.appspot.com
  dvolwrgtmmeuntdb-dot-millinium.ey.r.appspot.com
  dvonlinenotificationsuwpal.com
  dvpont.com
@@ -135012,6 +150438,7 @@ dvtcgafg.rogagot.com
  dvthut.com
  dvtibfngdegxmtrhzifzmgumxj-dot-gleowayel400503.uc.r.appspot.com
  dvtiqxi.cabanova.com
+dvtlpseexzypjmahtiufqoxrpc-dot-gl9393jan.uk.r.appspot.com
  dvwpmavyefxlaljhzgargqtgom-dot-gleowayel400503.uc.r.appspot.com
  dvyatkitotrsctoa-dot-millinium.ey.r.appspot.com
  dvychhqsqjnodpcw-dot-millinium.ey.r.appspot.com
@@ -135045,6 +150472,7 @@ dwgdtuxnuvskdswv-dot-millinium.ey.r.appspot.com
  dwhkkh.ph
  dwifyubwnwcpbxab-dot-millinium.ey.r.appspot.com
  dwillow100bc.com
+dwisqtghmbzmxakmkshpyrfana-dot-gl9393jan.uk.r.appspot.com
  dwistl.net
  dwjrbbbnwbvrgiuorqxxrkiegymcqhggbwdf-dot-glenxpecial3009493.ey.r.appspot.com
  dwkmchivdkgtgucsnzdptdlsugfvdkfjzsbj-dot-cryptic-now-290917.ey.r.appspot.com
@@ -135264,6 +150692,7 @@ dzinestudio87.co.uk
  dzipluyurinjuvqg-dot-millinium.ey.r.appspot.com
  dzirkstelite.lv
  dziwne-zdjecia.24f.eu
+dzjywbzfflwocfguxsunhbkadb-dot-gl9393jan.uk.r.appspot.com
  dzktfpfsnperwijb-dot-millinium.ey.r.appspot.com
  dzlc7xp7tenv.talagaremix.com
  dzmxfmbsgetnrkfwyhbavjaxnsfnkpluiczf-dot-cedar-code-289917.nn.r.appspot.com
@@ -135808,6 +151237,7 @@ eatspam.co.uk
  eau.4buyuklergazete.com
  eauiefzneyqhswxd-dot-millinium.ey.r.appspot.com
  eaurbeauty.com
+eauxleft.buzz
  eave.com.cn
  eavejdhurtojgkbhrndlwgqnbeqyipygktnl-dot-solar-vertex-285913.rj.r.appspot.com
  eavhxnqtfjxijean-dot-millinium.ey.r.appspot.com
@@ -136065,6 +151495,8 @@ ebay-payment-issues.com
  ebay-power-service.com
  ebay-promotion.free-listings-over-months.live
  ebay-rechnung-jetzt-online.mariagianinawillroth.de
+ebay-seller.negative-feedback-archive.xyz
+ebay-seller.negative-feedback-log.xyz
  ebay-sellers-promotion.free-listings-starting-today-02.live
  ebay-sellers.free-10000-listings-over-months.live
  ebay-sellers.free-10000-listings-promote-todays.live
@@ -136267,6 +151699,7 @@ ebaymotors.de.ekauferschutz-session37106094.de
  ebayupdatebilling.com
  ebbayr.com
  ebbindrum.de
+ebbkcoucuoeddoqjimybdikbjt-dot-gl9393jan.uk.r.appspot.com
  ebblackenterprise.com
  ebbvdkdehqlxxvhy-dot-millinium.ey.r.appspot.com
  ebcijwynwwlbrxrj-dot-millinium.ey.r.appspot.com
@@ -136473,6 +151906,7 @@ eclubsettingsinfo.com
  ecmeinmediterranean.com
  ecmqfxmgcezrafxptrbcgokegrptjrkfecaz-dot-glxcel49934343434.rj.r.appspot.com
  ecmtabu.com
+ecmuhkgghqngsmzrjnzdlijnmr-dot-gl9393jan.uk.r.appspot.com
  ecngx256.inmotionhosting.com
  ecngx270.inmotionhosting.com
  ecngx279.inmotionhosting.com
@@ -136738,7 +152172,6 @@ editoranger.com
  editorasede.com
  editorialsolar.co
  ediugsgnileef.com
-edizioniflavius.com
  edje.com
  edjpa.gulfhirings.com
  edkdesign.com
@@ -136810,6 +152243,7 @@ educationthai.co.th
  educators.plus
  educcactions.com
  educovisa.com
+edudefferrari.com.br
  edudlqrdwfbfvxzodkhzjzhjkm-dot-gleowayel400503.uc.r.appspot.com
  edufoxconsultancy.000webhostapp.com
  eduhac.com
@@ -136898,7 +152332,6 @@ ee-bill-login.com
  ee-bill-myaccount.com
  ee-bill-payment.com
  ee-bill-secure.com
-ee-bill-statement.co.uk
  ee-bill-support.com
  ee-bill-uk.com
  ee-bill-update.com
@@ -137018,6 +152451,7 @@ ee-co.uk-id6t-user.com
  ee-co.uk-id9p-user.com
  ee-co.uk-user-4ip-id.com
  ee-co.uk-user-67p-id.com
+ee-co.uk-user-i1-ee-id.com
  ee-co.uk-user-id-97.com
  ee-co.uk-user-id44p.com
  ee-co.uk-user4i-id.com
@@ -137071,7 +152505,6 @@ ee-login-auth.com
  ee-login-secured.com
  ee-login.live
  ee-loginsecured.com
-ee-manage-billings.com
  ee-manageaccount.com
  ee-managenow.com
  ee-manageonline.com
@@ -137080,7 +152513,6 @@ ee-manageweb.com
  ee-members-help.000webhostapp.com
  ee-mobile-bill.com
  ee-mobileaccount.com
-ee-mobilebill-uk.com
  ee-mobilebill.com
  ee-mobilebillinfo.com
  ee-mobilebilling.com
@@ -137127,6 +152559,7 @@ ee-onlineupdates.com
  ee-overview.uk
  ee-pay-billing.com
  ee-pay-monthly-billing.com
+ee-payment-failure.co.uk
  ee-payment.com
  ee-paymentalert.com
  ee-paymentblock.com
@@ -137286,6 +152719,7 @@ ee.co.uk.billing-updates.limited-3ds.info
  ee.co.uk.billing.june2020.icu
  ee.co.uk.cgi-bin.icu
  ee.co.uk.cgi-bin.link
+ee.co.uk.confirm-statement.com
  ee.co.uk.ref7946.link
  ee.co.uk.ref895.com
  ee.co.uk.secure-auth.ir
@@ -137297,6 +152731,7 @@ ee.failedbill-payment.com
  ee.failedbilling-details.com
  ee.failedbilling-payment.com
  ee.failedpayment-details.com
+ee.failurebill-update.com
  ee.gov-repayment.com
  ee.help-login.net
  ee.help.billing-xz.com
@@ -137492,6 +152927,7 @@ eenjoy.live
  eenotice.com
  eenswrlfppfgwqshretymxrjhy-dot-gleowayel400503.uc.r.appspot.com
  eeodzywkiwpl.ru
+eeohfdyofvdnxwtvpptnwtszid-dot-gl9393jan.uk.r.appspot.com
  eeonline-billsupport.com
  eeonline-customerbill.com
  eeonlineadd.link
@@ -137509,6 +152945,7 @@ eeredirect-update.com
  eeredirect.info
  eerna.com.bd
  eernejd-diskl.com
+eerswuwnglchztmyodqvcjbzxt-dot-gl9393jan.uk.r.appspot.com
  eertfd.com
  eesecure-accountbill.com
  eesecure-accountinfo.com
@@ -137610,6 +153047,7 @@ efis.top
  efkbnnkzfhbfjogy-dot-millinium.ey.r.appspot.com
  eflom.app.link
  efloscdhgfpasqcmibzmpregcuojsqqgjmbf-dot-cryptic-now-290917.ey.r.appspot.com
+eflroqeudnxccrhayaxrkukafv-dot-gl9393jan.uk.r.appspot.com
  eflugvvprdhamaevnuvnncixdzbqmwvddyqx-dot-cryptic-now-290917.ey.r.appspot.com
  efmgecbsotlljvgq-dot-millinium.ey.r.appspot.com
  efmny.org
@@ -137650,6 +153088,7 @@ efvzkvszfkrbtlti-dot-millinium.ey.r.appspot.com
  efwdrzvmvfoelmqe-dot-millinium.ey.r.appspot.com
  efwvrged.weebly.com
  efxdesigners.com
+efxwstgtvgarysqwrkxecojpaj-dot-gl9393jan.uk.r.appspot.com
  efyyf-376r-hfejf-3r3r3-fjh3-3hhfj.weebly.com
  eg-dota.com
  eg4c.mentriqq.com
@@ -137709,6 +153148,7 @@ eglantiers1180.site-officiel.be
  eglb5.egdemo.info
  eglectonk.online
  eglobletrade.com
+eglypppzyhiiqrjblbyxujcrni-dot-gl9393jan.uk.r.appspot.com
  egmgrupo.com
  egmontair.co.nz
  egnbloqt.rogagot.com
@@ -137831,6 +153271,7 @@ ehyqtazdopfmfjmj-dot-millinium.ey.r.appspot.com
  ei-rbcroyalbank.com
  eiadelerhizmetbasvurun.tk
  eiadetalep-turkiyegovtr.com
+eiakffafvdaubcmcprbxjcovmh-dot-gl9393jan.uk.r.appspot.com
  eiba-center.com
  eichmannforest.buzz
  eichnnpvyvgklyag-dot-millinium.ey.r.appspot.com
@@ -137850,6 +153291,7 @@ eiffelmx.com
  eig-kristinjangro.com
  eigher.info
  eightkimomedicura.info
+eigjsutvxagppxmlygbvaljilu-dot-gl9393jan.uk.r.appspot.com
  eigoeb.com
  eiimquc.goruli.com
  eiitadfswxafdkjsxmipuhlnpx-dot-gleowayel400503.uc.r.appspot.com
@@ -137939,6 +153381,7 @@ ejercitodemaquinas.com
  ejewelbox.com
  ejfdnjgsjbppehxrzpafdulsaayvadwujseh-dot-solar-vertex-285913.rj.r.appspot.com
  ejgbzqaplwmyhxkt-dot-millinium.ey.r.appspot.com
+ejikpnydoohgqykvasldvukoqd-dot-gl9393jan.uk.r.appspot.com
  ejjpeuqebtxrsflmekzxohnjvebsrxkcjiko-dot-cedar-code-289917.nn.r.appspot.com
  ejkpkznchsirkfpdetsnozbgtjlekcukqxew-dot-cedar-code-289917.nn.r.appspot.com
  ejmdnsbhfl.com
@@ -137996,7 +153439,6 @@ eko-finance.com
  eko-mak.pl
  ekobert.com
  ekobygghandel.se
-ekoda-recording.tokyo
  ekofuel.org
  ekonaut.org
  ekonkarserai.com
@@ -138014,6 +153456,7 @@ ekramuzzaman.com
  ekrhqcaxeqtrwynu-dot-millinium.ey.r.appspot.com
  ekrkoprojthvdbso-dot-millinium.ey.r.appspot.com
  ekruhwier.mrbasic.com
+ekrvfkarzywcrkmnluejyhvxrj-dot-gl9393jan.uk.r.appspot.com
  ekseyazilim.com
  eksiegowa.online
  eksioglu.tv
@@ -138082,6 +153525,7 @@ elastic-objects.000webhostapp.com
  elastic-poincare-1fdcbc.netlify.app
  elastic-swirles-d4fab0.netlify.app
  elastic.paypal.com-informationaccounts.com
+elasticbeanstalk-us-east-2-95newbeie.s3.us-east-2.amazonaws.com
  elasticbeanstalk-us-west-2-371481629042.s3-us-west-2.amazonaws.com
  elastim.netlify.app
  elasun.com
@@ -138134,6 +153578,7 @@ elecbits.in
  eleccionesicfmexico2020.com
  elecom.com.tr
  elecomfree.com.mx
+electeagle.guru
  electionnewsug.com
  electiontrainingbeta.ml
  electrest.net
@@ -138287,6 +153732,7 @@ eliminatory-materia.000webhostapp.com
  elimupi.com
  elinazium.online
  elinkco-com.ga
+elinorestreet.buzz
  eliobkahwrocypdy-dot-millinium.ey.r.appspot.com
  eliomagico.com
  eliotecae-my.sharepoint.com
@@ -138348,6 +153794,7 @@ eljdjopxseqndepp-dot-millinium.ey.r.appspot.com
  eljokerhacking3215.ddns.net
  eljrrnlcfbepauqv-dot-millinium.ey.r.appspot.com
  eljumvo.goruli.com
+elk24.buzz
  elkablog.ru
  elkanis-agribusinessblog.com.ng
  elkbeetroots.net
@@ -138586,6 +154033,7 @@ emarclofitnessacademy.com
  emardmews.xyz
  emark4sudan.com
  emasresources.com
+emayquosloctywmnshapjmxbnv-dot-gl9393jan.uk.r.appspot.com
  emaze.me
  embalagemdesushi.com.br
  embalagememgeral.com.br
@@ -138605,6 +154053,7 @@ embracinghiscall.com
  embramedica.com.br
  embrava.eu
  embroity.com
+embryo-nests.000webhostapp.com
  embunpajar.com
  embusducet.topkorder.su
  embutec.com.br
@@ -138938,6 +154387,7 @@ en.onpubg.com
  en.paypal.com.preferred-eng.com
  en.polarklima.hu
  en.pubgmobilereward.com
+en.secure03a-login.manage-summary.appsignxz.com
  en.secureaccountlimited-paypal.com
  en.servicecare-manageaccount.webcaresafe-formgateway.com
  en.singin-page.paypall.com-secure-caseid.abaflow.com
@@ -139236,11 +154686,13 @@ enkaypastri.com
  enkelaar.eu
  enkennedy.com
  enkilswvlydrnhdp-dot-millinium.ey.r.appspot.com
+enkpwwtufyhwlvzbemqdwsskwc-dot-gleow2021ja.ue.r.appspot.com
  enkqlcnz.goruli.com
  enkzshcaeskzeoto-dot-millinium.ey.r.appspot.com
  enlacesrp.com.mx
  enlalucha.org
  enlbhg6ogw6cagi.e8273.pro
+enldwigpusehyqghfaslfpzrrv-dot-gl9393jan.uk.r.appspot.com
  enlegeas.com
  enleude.chifanbackground.top
  enlhesa.com
@@ -139267,6 +154719,7 @@ ennqqnonivrtugdtrryvsamaxk-dot-gleowayel400503.uc.r.appspot.com
  ennrc.com
  eno.si
  enodablork.ru
+enoiytrywnyaceidlfawocimud-dot-gleow2021ja.ue.r.appspot.com
  enomicrowler.xyz
  enonanik.ml
  enophksydrees.cf
@@ -139284,6 +154737,7 @@ enquiry-id-918412.net
  enquiry.pascally.com
  enqxqacwknadakun-dot-millinium.ey.r.appspot.com
  enragedsimultaneousfunction--five-nine.repl.co
+enrgygreensjshjh.us
  enricocaproni.it
  enriquesoliz.com
  enrolledz-4u.xyz
@@ -139374,8 +154828,11 @@ enturarts.com
  entzuxtdvs.duckdns.org
  enucpzfiicljjltgsamcknqtiw-dot-gleowayel400503.uc.r.appspot.com
  enulfhqbjughzafpqzzymgxkgieaopzkexwj-dot-off94032393204.uk.r.appspot.com
+enumerable-print.000webhostapp.com
  enunclic.mx
  enunclick.uno
+enunkeoqlhpeiahngsvvtbhemv-dot-gl9393jan.uk.r.appspot.com
+enunomuxfdnelbptsnxxozbqax-dot-gl9393jan.uk.r.appspot.com
  enuonoe.xyz
  enuyguned.ru
  env-3421506.cloud-fr1.unispace.io
@@ -139465,6 +154922,8 @@ eoshj.blob.core.windows.net
  eoslead.com
  eosouthasia.showtimemobileapp.com
  eostechnologies.net
+eoszwpyqsqzgroelhbcnzlainx-dot-gl9393jan.uk.r.appspot.com
+eotsoumgnvimhykdlpkkkapzrv-dot-gl9393jan.uk.r.appspot.com
  eotya-71.ml
  eoueqlaivekqcbsdxilmmeqaggfmbotanvxk-dot-glegen303939423233.ue.r.appspot.com
  eoufpzemogibytupwpdpffoizfdiyzrckexu-dot-cedar-code-289917.nn.r.appspot.com
@@ -139472,6 +154931,7 @@ eouryfvioeurfoevri.xyz
  eovjzzxugcnommeihbayprt.top
  eowkankalnfwupvj-dot-millinium.ey.r.appspot.com
  eowyyyfpmtradhzw-dot-millinium.ey.r.appspot.com
+eoztxxvpcclfqmhidhgptdkmxq-dot-gl9393jan.uk.r.appspot.com
  ep1.marionteams.com
  ep1b.jaysbrand.com
  ep4italiacom.chifanblock.top
@@ -139604,6 +155064,7 @@ epworthlocalboard.co.zw
  epwritescom.wordpress.com
  epxivazrxv.duckdns.org
  epxtfpauyuudavpxqv.top
+epybrqipcqnvskkirdcjqpnmrt-dot-gl9393jan.uk.r.appspot.com
  epyieovsnzxatewy-dot-millinium.ey.r.appspot.com
  epyorke.edu.bz
  epzlaepehptjhzenlzvubxqusz-dot-gleowayel400503.uc.r.appspot.com
@@ -139620,6 +155081,7 @@ eqcozbyftbsqdksuxbhjyrdkfu-dot-gloff849483.uk.r.appspot.com
  eqcytxnslsfjzhgcnszewjyvwk-dot-gleowayel400503.uc.r.appspot.com
  eqd.sovereignty2020.com
  eqdzrxhyyftifqxujbvkguedjaaslduoaixx-dot-off94032393204.uk.r.appspot.com
+eqdzxjxwmynrenlaesolldepce-dot-gl9393jan.uk.r.appspot.com
  eqett13assz.appspot.com
  eqfaqvzbodiotyqk-dot-millinium.ey.r.appspot.com
  eqgoeridgowiedgzcobeid0-0975188970co.com.dskweh.cn
@@ -139708,6 +155170,7 @@ erbbwvljatiojkgm-dot-glexcel1.ue.r.appspot.com
  erbria.xyz
  ercey.com.tr
  erchasbnlkjptzoy-dot-millinium.ey.r.appspot.com
+erciilrlxuxidcqimwlconyyic-dot-gl9393jan.uk.r.appspot.com
  ercops.com
  erdabeaghcomp.tk
  erdch.xyz
@@ -139806,6 +155269,7 @@ erkbil.com
  erkekatlet.site
  erkjgcbbrgdjubcfyv.top
  erkmuhval.ru
+erlaxzlrhtgooeaiectseljodi-dot-gl9393jan.uk.r.appspot.com
  erlzchuwr.wang
  erma-systemsoft.de
  ermatiko.ee
@@ -139971,7 +155435,6 @@ es-facebook.es
  es-idq441es.xyz
  es-la-denuncia-inicio-sesion.000webhostapp.com
  es-la-linicio-sesion.000webhostapp.com
-es-la.facebook.negociosremon.com
  es-locatbltcoins.com
  es-paypal-pia-paypalx.mchillz.com
  es-santander.blogspot.com
@@ -140006,6 +155469,7 @@ escalum.com.mx
  escang.com
  escanor11.ddns.net
  escapegamenc.fr
+escapereduce.buzz
  escaperoomuniverse.com
  escapetrainingclub.com
  escapetravel.be
@@ -140112,9 +155576,11 @@ eslamea1.space
  eslammamd3.xyz
  eslammamd8.xyz
  eslammame13.xyz
+eslfaceb00k.000webhostapp.com
  eslickcreative.com
  eslkatowice.com
  esloekqokef.com
+eslwyaxcaqkzpqoggqmqpwtgmp-dot-gl9393jan.uk.r.appspot.com
  esma-edu.com
  esmce.nrru.ac.th
  esmeralda.buzz
@@ -140126,6 +155592,7 @@ esmocoin.com
  esms12.000webhostapp.com
  esmyojrydnnfoftq-dot-millinium.ey.r.appspot.com
  esnconsultants.com
+esnprns.work
  esnz8udujwe0xlx.e8273.pro
  esnzpocowo.topkorder.su
  eso.dermals.org
@@ -140202,6 +155669,7 @@ esquirefinecleanerscornwall.ca
  esquso.com
  esrahanum.com
  esranagsaddlful.ml
+esrhxbwvwuooczkguuavvvrsyy-dot-gl9393jan.uk.r.appspot.com
  esrmotors.com
  esryd.xyz
  ess1.info
@@ -140662,6 +156130,7 @@ etvreal.com
  etwae.xyz
  etwem.xyz
  etwjnhc.shoesmogul.com
+etwlmrchucvklhscooznqethwb-dot-gleow2021ja.ue.r.appspot.com
  etwowofficiel.fr
  etwqa.xyz
  etwqz.xyz
@@ -140743,6 +156212,7 @@ eujlfomaif.duckdns.org
  eujyoecxsqfmsbdx-dot-millinium.ey.r.appspot.com
  euk.lt
  eukbkxljweewawnydomzkcqmltjfdzpkmgnp-dot-glegen303939423233.ue.r.appspot.com
+eukhdxpuouncxalfwzrmvxefwo-dot-gl9393jan.uk.r.appspot.com
  eukpkujhncvmkyqx-dot-millinium.ey.r.appspot.com
  eulawfirmsp.eu
  eulx.goruli.com
@@ -140901,6 +156371,7 @@ evaproekt.ru
  evaskincomplex.com
  evasqlnuoxalwteq-dot-millinium.ey.r.appspot.com
  evavcexmypssohgmstsuwhbtmlqolumrgtqi-dot-glenxpecial3009493.ey.r.appspot.com
+evbkbfwasiuasbwlygumjsotxi-dot-gl9393jan.uk.r.appspot.com
  evcoches-carfactory.net
  evdekal-turkiyegov-tr.com
  evdekal8gbkazan.com
@@ -141295,6 +156766,7 @@ ewfxgtvrmzobjjbi-dot-millinium.ey.r.appspot.com
  ewges38c.beget.tech
  ewh5t.jaysbrand.com
  ewheydkool.com
+ewhjnayikdplvbnsiwfopqjetu-dot-gl9393jan.uk.r.appspot.com
  ewhyqunanfzzqauk-dot-millinium.ey.r.appspot.com
  ewhzxiqy.goruli.com
  ewillstrin.com
@@ -141345,6 +156817,7 @@ ewtte.xyz
  ewtyreturytuyi13582docfile.rj.r.appspot.com
  ewubo.net
  ewuvpkryxtlzfofc-dot-millinium.ey.r.appspot.com
+ewviazvjmxwynkrbyubgcsfmpq-dot-gl9393jan.uk.r.appspot.com
  ewvrqhjlbysfxilg-dot-millinium.ey.r.appspot.com
  ewwd.82ykza.cn
  ewwsa.xyz
@@ -141766,6 +157239,7 @@ eymzjxriauhvirmcjkuulocvlhuyotaahurd-dot-cryptic-now-290917.ey.r.appspot.com
  eynbr.vipsnapchatsexting.com
  eynet.biz
  eynriseao.tk
+eynzffyunjcgazjxkducucjpta-dot-gl9393jan.uk.r.appspot.com
  eypcazxgnhtybeqf-dot-millinium.ey.r.appspot.com
  eypdrvkssjujgbug-dot-millinium.ey.r.appspot.com
  eyrherrhereh.tcp4.me
@@ -141842,6 +157316,7 @@ ezootampcraez.com
  ezoskficoxjxpnuamjogleqmcg-dot-gleowayel400503.uc.r.appspot.com
  ezottlinggrow.com
  ezpanz.com
+ezpkledivqbmpgrkahpyqegqpp-dot-gl9393jan.uk.r.appspot.com
  ezprofitfx.com
  ezpxfwexfnjtejxloxgetetukcypzusvtrqf-dot-gl494903049.wl.r.appspot.com
  ezratisrael.org.il
@@ -142055,7 +157530,7 @@ f0487671.xsph.ru
  f0490078.xsph.ru
  f0490470.xsph.ru
  f04qvvbwwhmxc09y.com
-f0507146.xsph.ru
+f0509826.xsph.ru
  f0b.casa
  f0bea11ce084c97ca99bce9df2a07eec-dot-dbenitonline.ey.r.appspot.com
  f0f1a0c9fa92044a3d8cd65ff09536c8.buzz
@@ -142253,6 +157728,7 @@ facbook-authenticaon.000webhostapp.com
  facbook-freefiree.000webhostapp.com
  facbook-moderator-community-issue.my.id
  facbookauthantication.000webhostapp.com
+facbookine.000webhostapp.com
  facbooksecuritytips.000webhostapp.com
  facbooksupp0rt.000webhostapp.com
  facbookvoteownbuisnescontest-uk.000webhostapp.com
@@ -143001,6 +158477,7 @@ facebook-user-activity.premiumz.pro
  facebook-user.payeazy.xyz
  facebook-user9863.id20498-managers09482.us
  facebook-verification-account298382.com
+facebook-verification-com.pbid.asia
  facebook-verifier.webhop.me
  facebook-video-apps.weebly.com
  facebook-video-aps.weebly.com
@@ -143455,8 +158932,6 @@ facebookcolor2.pubguc.world
  facebookcolor3.pubguc.world
  facebookcolor4.pubguc.world
  facebookcolor5.pubguc.world
-facebookcolors-changer.tk
-facebookcolorschanger.ml
  facebookcom-02486026.drwax.as
  facebookcom-06892955.drwax.as
  facebookcom-12727563.drwax.as
@@ -143793,6 +159268,7 @@ facepraelasok.xyz
  facepraelasokonline.xyz
  faceprofilephotogroups.000webhostapp.com
  facerbok.aba.vg
+facerequire.online
  facertosz.000webhostapp.com
  facesboookk.000webhostapp.com
  facetaok.000webhostapp.com
@@ -143944,6 +159420,7 @@ fajas89.club
  fajbwzuijhazcksmfemukqwcvfovwiozwrac-dot-gl494903049.wl.r.appspot.com
  fake-wimpern.de
  fakebok.blogcu.com
+fakebook-co.000webhostapp.com
  fakebook.com.mx
  fakebook.my.id
  fakebook.romainlenoir.fr
@@ -143952,6 +159429,7 @@ fakebook4u.byethost7.com
  fakebookanees.000webhostapp.com
  fakebooknew.000webhostapp.com
  fakebuck.masakoteam.repl.co
+fakecontact.top
  fakeebook.0fees.us
  fakeformalityshowoff.com
  fakeframes.xyz
@@ -144064,6 +159542,7 @@ falmer.de
  falmouthin.buzz
  faloolsldodl.xyz
  faloookik.000webhostapp.com
+falshtech.buzz
  faltynekme.baerqiprimary.top
  fam-honing.nl
  famalivingcastellon.com
@@ -144082,7 +159561,6 @@ famigliafranciulli.com.br
  familiachickenargentina.com
  familiachickengrillperu.com
  familiadobarulho.com.br
-familiarsubduedprogrammingmacro.aalijah77.repl.co
  familiatransition.be
  familie-merz.de
  familiebome.com
@@ -144141,8 +159619,10 @@ fanfaronadee.com
  fanfaronquays.com
  fanfold-loops.000webhostapp.com
  fangqianghuaye.com
+fanha.ga
  fanina-tools.pl
  fankaerclothing.com
+fanlinc.com
  fannmedias.com
  fannsasn.com
  fanoutnorthamerica.com
@@ -144430,6 +159910,7 @@ fateffir.com.br
  fateful-sentry.000webhostapp.com
  fateh.com.my
  fateweaver.tech
+fatfdagqnrlujtnscyieikmugc-dot-gl9393jan.uk.r.appspot.com
  fatfoodfetish.com
  fatfreezingmachines.com
  fatg3so.info
@@ -144519,6 +160000,7 @@ favtcgtgdataomeh-dot-millinium.ey.r.appspot.com
  fawasome8hngku54videonhfunhsgtk7scontest.awasomevideocontest.xyz
  fawltorconsroc1976.blogspot.be
  fawltorconsroc1976.blogspot.com
+fawqsnbfajteqxnyspuletigib-dot-gl9393jan.uk.r.appspot.com
  fax-payday-loans.com
  faxitalia.com
  faxmail.live
@@ -144847,7 +160329,6 @@ fb-marketplace.item-75328.com
  fb-marketplace264512545.com
  fb-marketplace34558573.com
  fb-marketplace443436.online
-fb-marketplace9789831.com
  fb-me.xyz
  fb-messenger-heckethorn.xyz
  fb-messenger-profile-id.com
@@ -144931,7 +160412,6 @@ fb-properties3567783.net
  fb-properties874028.net
  fb-re-update-5964757-com.preview-domain.com
  fb-realtols-230067-usa-056h45-buissnes-asd-0000546.com
-fb-realtor-item.com
  fb-realtors-page19831.com
  fb-realtors-page2563478.com
  fb-realtyhome21098.com
@@ -145028,6 +160508,7 @@ fb-sales-marketplace.com
  fb-saless521458.com
  fb-scarlet273-photography.com
  fb-secuerity-protect.000webhostapp.com
+fb-secure-data.000webhostapp.com
  fb-security-department.mobi
  fb-security-review.com
  fb-security-rules.ml
@@ -145337,8 +160818,11 @@ fbauthenticate86.000webhostapp.com
  fbauthorized.000webhostapp.com
  fbaylejrg.co.cc
  fbb-20k21.gq
+fbb-20k21.tk
  fbb-858.com
+fbb-logtrye.cf
  fbb-logtrye.gq
+fbb-logtrye.ml
  fbbejeycmpygcfazwa.top
  fbbookxyzo.000webhostapp.com
  fbbuisnscontestsite-uk.000webhostapp.com
@@ -145666,6 +161150,7 @@ fbook-syte.000webhostapp.com
  fbook-weeb.000webhostapp.com
  fbook-yellowteeth.000webhostapp.com
  fbook.com-06662451.vochtplekken.be
+fbook.com-10403695.vochtplekken.be
  fbook.com-12105200.vochtplekken.be
  fbook.com-12229835.mrubens.mx
  fbook.com-12276767.mrubens.mx
@@ -146458,10 +161943,13 @@ fejs.ga.dnsfordomains.ru
  fejs.ml
  fejs.ml.dnsfordomains.ru
  fekctjhutkasswcgkidhjouipc-dot-gleowayel400503.uc.r.appspot.com
+fekdxpvnubbxwtianefipelnzp-dot-gl9393jan.uk.r.appspot.com
+fekegnrgvfxcbcbqlcuznfvddye-dot-gl9393jan.uk.r.appspot.com
  fekilopol.xyz
  fekilozi.beget.tech
  felaggeislafraedinga.is
  felavcaqyvjxpxtm-dot-millinium.ey.r.appspot.com
+feldspathic-trims.000webhostapp.com
  felemax.com.ar
  feleskehg.com
  felicia0918.digital
@@ -146555,6 +162043,7 @@ fentiaoji.cn
  fentlix.com
  fentq.org
  fenum.io
+fenuoxyrkvxhhetqzijscdecdz-dot-gleow2021ja.ue.r.appspot.com
  fenxx.ddns.net
  fenzy.0fees.us
  feoabook.000webhostapp.com
@@ -146644,7 +162133,6 @@ feshor.top
  feskook.xyz
  fesondeby.com
  fesqoareup.com
-fesstivalgame.com
  fessuseasesee.com
  festajuninadonipo.com.br
  festanodiadasmaes.com
@@ -146829,6 +162317,7 @@ fgdengqufezrtrhx-dot-millinium.ey.r.appspot.com
  fgdftttf.com
  fgdggsfatt2020.weebly.com
  fgdhffsguitreuotd.com
+fgehziilfeifduyzwbbzxfecsh-dot-gl9393jan.uk.r.appspot.com
  fgezwitgfqnojwaa-dot-millinium.ey.r.appspot.com
  fgfgdsdgg3.weebly.com
  fgfgfgdgt.000webhostapp.com
@@ -146876,6 +162365,7 @@ fgliurgibybtxhab-dot-millinium.ey.r.appspot.com
  fgmcm.org
  fgmfshfrmyxavevcqxx.top
  fgmj.onderhost.com
+fgmocircjkntasrvoesiutedlp-dot-gleow2021ja.ue.r.appspot.com
  fgncompensationcommittee.com
  fgncx.svcoding.com
  fgngvp.kk.sopqa.arg.r.uk.a2ip.ru
@@ -146918,6 +162408,7 @@ fh50.svcoding.com
  fh7na.oujevais.com
  fh8s.jaysbrand.com
  fh9.psdzy.com
+fhaguid.buzz
  fhaj455.cn
  fhamxjcjszzrbvyg-dot-millinium.ey.r.appspot.com
  fhawamerica.com
@@ -146995,6 +162486,7 @@ fiaya.webout.life
  fibankoiad-loading.myddns.me
  fibeex.com
  fibercel-latam.com
+fibercheck.xyz
  fibergratifiedv.com
  fiberjalon.com
  fiberspotqatar.com
@@ -147010,6 +162502,7 @@ ficaemcas4nosentregamossgrtiss.com
  ficaemcasa-magalu.com
  ficaib.com
  ficdehypmider.ml
+ficebooak.000webhostapp.com
  ficeboukco.000webhostapp.com
  ficeofice.com
  fiching-irk.ru
@@ -147029,6 +162522,7 @@ fidapeyzaj.com
  fiddlemarches.com
  fidelit.com.br
  fidelity-access-gh.com
+fidelity-veri-0.000webhostapp.com
  fidelityguide.com
  fidelityplans.com
  fidelitysecure.azurewebsites.net
@@ -147081,6 +162575,7 @@ fifthelement.be
  fiftolkf.cf
  fiftyy42.beget.tech
  figexorcit.com
+figfbwcgtprxlbqtmjlwmogmye-dot-gl9393jan.uk.r.appspot.com
  fighttechsports.com
  fightvscorona.com
  fightwithcapitalism.com
@@ -147089,6 +162584,7 @@ figuig.net
  figura.team
  figurkowy.pl
  figzbgtqoicgefhfcqwgdbsgkspcflqsbbfe-dot-gl494903049.wl.r.appspot.com
+fihrfgnzouuqysuvusrjelkhio-dot-gl9393jan.uk.r.appspot.com
  fiirst-ohst.kozow.com
  fiisttechfed.com
  fij-projet3.be
@@ -147625,6 +163121,7 @@ firuvet.com
  firuzblog.ir
  fis-lab.com
  fisberpty.com
+fiscal-altitude.000webhostapp.com
  fiscaldopovo.online
  fiscalia.ga
  fiscalsort.com
@@ -147798,6 +163295,7 @@ fjfpyrqsbfaykkag-dot-millinium.ey.r.appspot.com
  fjfqyc.com
  fjgfoknf.com
  fjggfhf.bl18.cn
+fjgmnwwmdhdxduoooyzgfsqqvf-dot-gl9393jan.uk.r.appspot.com
  fjgypqafv.goruli.com
  fjhmdt.com
  fjhygqstataowmrjqoiqavdnuy-dot-gleowayel400503.uc.r.appspot.com
@@ -147846,6 +163344,7 @@ fkgjkfh.ga
  fkgjkfh.ml
  fkgmrgbwlpfztepm-dot-millinium.ey.r.appspot.com
  fkgxijz.goruli.com
+fkiimygeibgdkforeqmyzmzgcq-dot-gl9393jan.uk.r.appspot.com
  fkip.unrika.ac.id
  fkj8.com
  fkjdfdfjrrhref.com
@@ -148198,9 +163697,11 @@ floatformula.com
  floating.sfo2.digitaloceanspaces.com
  floaty-blindfolds.000webhostapp.com
  flobex.net
+flockshower.guru
  flodgelf.com
  floggingserver.com
  flojem.com
+flokii.us
  flood-protection.org
  floodcleanupbakersfield.com
  flooo-skins.ml
@@ -148556,6 +164057,7 @@ followersgratis.holls12.com
  followersigfree.xgetts.com
  followersitefre.000webhostapp.com
  followgf.myjino.ru
+followinglinktostarttheprocedure0customerfs.000webhostapp.com
  followpage.casa
  followr-forfree.ml
  followthemak.com
@@ -148588,6 +164090,7 @@ fonds-2020-recu-ca.org
  fonemoleu.com
  fonerwa.org
  fonesurgeon.com
+fonhnzlvatkkullucbbvljvxei-dot-gleow2021ja.ue.r.appspot.com
  fonitel.com.br
  font-assets.com
  fontanerianumar.com
@@ -148636,6 +164139,7 @@ foodworks.mu
  foojlskfkeohkftk-dot-millinium.ey.r.appspot.com
  fool-signin-webcsr-online.com
  fooledbeer.xyz
+foolproof-diagnosis.000webhostapp.com
  foolwall.com
  fooodshooters.com
  foooosin.com
@@ -148654,6 +164158,7 @@ footytube.top
  footzyflipflops.com
  foozoop.com
  fopckwboqvndntbe-dot-millinium.ey.r.appspot.com
+foqfsvihnvpqxmacjqhbcgreow-dot-gl9393jan.uk.r.appspot.com
  for-me.design
  for-realestate-page-736171177.com
  for-remont.ru
@@ -148803,6 +164308,7 @@ formacionz.com
  formafitness.com.br
  formal-audio-279012.uc.r.appspot.com
  formalab.info
+formalbanish.guru
  formalincom.nckiamerican.gdn
  formandbackground.com
  formanymens24.co.com
@@ -148924,6 +164430,7 @@ foruminfo2020.gq
  forumods.com.br
  forums-dofus.info
  forums.artistrightsalliance.org
+forumsbb.com
  forumschat.top
  forumstadtcom.shuiacall.top
  forward30days.xyz
@@ -148976,6 +164483,7 @@ fotodanvideonikah.com
  fotodeconcurso.000webhostapp.com
  fotodolomiticampiglio.it
  fotoelektrowpl.ru
+fotofreunde-krofdorf-gleiberg-ev.de
  fotografie-eveniment.ro
  fotografnapiatke.net.pl
  fotografnapiatke.pl
@@ -149005,10 +164513,11 @@ foulturrin.com
  found-witnesses.000webhostapp.com
  found.new-in.us
  found.sing-us.com
-foundation-admin-ck9978421658031451.tk
-foundation-admin-ck9978421658031452.tk
-foundation-admin-ck9978421658031453.tk
-foundation-admin-ck9978421658031455.tk
+founder-admin-ck-18896331864589076.tk
+founder-admin-ck-18896331864589077.tk
+founder-admin-ck-18896331864589078.tk
+founder-admin-ck-18896331864589079.tk
+founder-admin-ck-18896331864589080.tk
  foundlity.com
  fountainofhope.com
  four-by-four.club
@@ -149025,6 +164534,7 @@ foutbolchannnels.com
  fovjqlxzeqdqixur-dot-millinium.ey.r.appspot.com
  fox-video-download.xyz
  fox.awesomemichiganhouses.com
+fox24.buzz
  fox5467.com
  foxben10.ddns.net
  foxbit.com.br.suporte.click
@@ -149129,6 +164639,7 @@ fqnvtmqsywublocpheas.com
  fqnvtmqsywublocpheas.eu
  fqohiqxzjzxnkgui-dot-millinium.ey.r.appspot.com
  fqovrnjzrodjzpqbnppxqrqmwyprifbxovkp-dot-cedar-code-289917.nn.r.appspot.com
+fqpxgcrtcqgyhgastuwfutesfj-dot-gl9393jan.uk.r.appspot.com
  fqqnnrabtqznquqc-dot-millinium.ey.r.appspot.com
  fqr5us00.firebaseapp.com
  fqrlmkhsvuyspgss-dot-millinium.ey.r.appspot.com
@@ -149262,7 +164773,6 @@ franticsupered.com
  franubait.000webhostapp.com
  franz-spedition.de
  franzenplumbing.com
-fraserpropertiescyprus.com
  frasi.online
  fratirloktarlitmalr.blogspot.com
  frattighmygamac.cf
@@ -149278,6 +164788,7 @@ fraudeitadetectada-tk.umbler.net
  fraudevi.info
  fraudprevention-365online.com
  fraudsecurity-protection.com
+fraudworth.buzz
  frauensachencom.shuiacause.top
  frauleinwunderkind.com
  fraxebook.tk
@@ -149362,6 +164873,7 @@ free-skin.giveclaim.shop
  free-spin-event-s13.duckdns.org
  free-stickers-vk.ml
  free-stuffs.work
+free-turkeys.com
  free.bokep96.com
  free.claimbundle.tk
  free.itu-marketplace.uno
@@ -149392,7 +164904,6 @@ freeboomvk.000webhostapp.com
  freebox34.ddns.net
  freeboxbd.000webhostapp.com
  freebreez.com
-freebrowsing.naijaexplosive.com
  freebybtc.com
  freecapes.com
  freecardsgiveaways.000webhostapp.com
@@ -149620,7 +165131,6 @@ freespinevents.com
  freespinpubgmobile.com
  freespins18k.xyz
  freespins198.xyz
-freespinupdate.com
  freespiritmind.com
  freespiritweddings.com
  freestickers-vk.ml
@@ -149840,6 +165350,7 @@ frimaus.shuiaecho.top
  frin.ng
  frindowsberyllium.com
  frindshipp.org
+fringillid-crust.000webhostapp.com
  friofresh.cl
  friscotrailministorage.com
  friseursekretariatcom.nckiaccounting.gdn
@@ -149872,6 +165383,7 @@ frnlvbnprkhqfvfm-dot-millinium.ey.r.appspot.com
  frockyllie.com
  froderand.info
  froebelian-weave.000webhostapp.com
+frog24.buzz
  froggyprints.com
  frogrock.pl
  frogtechologies.com
@@ -149926,11 +165438,13 @@ froshnationng.com.nsgl.xyz
  frospubgm.com
  frostbill.com
  frostmorg.com
+frostmrewerds.com
  frostpubgm.com
  frosty-ardinghelli-2fad11.netlify.app
  frosty-benz-329e5d.netlify.app
  frosty-bore.netlify.com
  frosty-curie-82a6dc.netlify.app
+frosty-fermat-051f1b.netlify.app
  frosty-nobel-ca7f68.netlify.app
  frosty-ramanujan-09342d.netlify.app
  frosty-visvesvaraya-23af8b.netlify.app
@@ -149993,6 +165507,7 @@ fryingpanboson.com
  fryktis.ru
  frzltptmharczkimdewzziibsn-dot-triple-upgrade-293822.rj.r.appspot.com
  fs-11.com
+fs-one.com.br
  fs.nfdngx.club
  fs01n1.sendspace.com
  fs01n2.sendspace.com
@@ -150032,6 +165547,7 @@ fse2020.com
  fsecurity-authenticate.000webhostapp.com
  fseerere.bodybydesignfl.com
  fsefsfeg.xyz
+fsemvdgdrvokmxqdkfjluftpva-dot-gleow2021ja.ue.r.appspot.com
  fsf4t4gd.club
  fsfiyusbxfhuokps-dot-millinium.ey.r.appspot.com
  fsgeg.xyz
@@ -150057,6 +165573,7 @@ fspzdjbgpvjxfipv-dot-millinium.ey.r.appspot.com
  fsqnvuyparkzavastkploqveuq-dot-gleowayel400503.uc.r.appspot.com
  fsr.goruli.com
  fsr2ojyz3asfgu-g7rxvsvvm.vercel.app
+fsseddufwlfjgjkhpgglmlhhpa-dot-gl9393jan.uk.r.appspot.com
  fsslg.com
  fsslptljsxktuzgq-dot-millinium.ey.r.appspot.com
  fssrnvrbboztitdy-dot-millinium.ey.r.appspot.com
@@ -150066,6 +165583,7 @@ fstfafphjdqvqiai-dot-millinium.ey.r.appspot.com
  fstudio.co.nz
  fstuoao.com
  fstzl.com
+fsumvwxqydsdppuswvybnmqiqu-dot-gl9393jan.uk.r.appspot.com
  fsvslxgdglijnottocrlhafrzxppcqhwfgas-dot-solar-vertex-285913.rj.r.appspot.com
  fswgqt.vteexcx.com
  fswisqrtrvszqzpl-dot-millinium.ey.r.appspot.com
@@ -150114,6 +165632,7 @@ ftlyrqcwescvdfgb-dot-millinium.ey.r.appspot.com
  ftlzk.goruli.com
  ftmb.ailacabs.com
  ftmuhcolfcbhyvih-dot-millinium.ey.r.appspot.com
+ftnbvtfuuyxorctravrqjlqfzw-dot-gl9393jan.uk.r.appspot.com
  ftnxnx2.000webhostapp.com
  ftook.000webhostapp.com
  ftop9000.com
@@ -150156,6 +165675,7 @@ ftryu.tk
  ftsrscujutpzsumj-dot-millinium.ey.r.appspot.com
  fttzysqbhfupawhhtkclqbzycistlctuablf-dot-cryptic-now-290917.ey.r.appspot.com
  ftu.goruli.com
+ftvriposfvlzifwzkxwrkfxfzv-dot-gl9393jan.uk.r.appspot.com
  ftvyiihbnhojwbda-dot-millinium.ey.r.appspot.com
  ftwbbb.serviceorder.su
  ftwork.co.uk
@@ -150241,6 +165761,7 @@ fuliestone.com
  fuliginous-approach.000webhostapp.com
  fuling.06fv.com
  full-bodied-relays.000webhostapp.com
+full-mouthed-handfu.000webhostapp.com
  full-out.net
  fullappz.pk
  fullassistance.cl
@@ -150586,6 +166107,7 @@ fxtradecompany.top
  fxtradingtactics.com
  fxuenc4tbqtk6xuzgjhph3am6y-adwhj77lcyoafdy-www-paypal-com.translate.goog
  fxvfwocmozylftil-dot-millinium.ey.r.appspot.com
+fxvgrwlndkxdjnkuvhdvgmhtfn-dot-gl9393jan.uk.r.appspot.com
  fxvipmaster.com
  fxw01.jaysbrand.com
  fxwhjlxhxtmlbnrhlmsfhmnclggulxqutjxf-dot-cryptic-now-290917.ey.r.appspot.com
@@ -150684,6 +166206,7 @@ fzwise.com
  fzwjsbzfvrfsgmcuay.top
  fzwjwzqkruracthc-dot-millinium.ey.r.appspot.com
  fzwxluze.goruli.com
+fzxgfcwphqtwyombdwsqdzxfco-dot-gl9393jan.uk.r.appspot.com
  fzxxpwlghbzsztev-dot-millinium.ey.r.appspot.com
  fzyrnlgoxvbmtfvy-dot-millinium.ey.r.appspot.com
  fzywqfcatjpamwmu-dot-millinium.ey.r.appspot.com
@@ -150736,6 +166259,7 @@ g0mj.jaysbrand.com
  g0n-d.mentriqq.com
  g0ogle.free.fr
  g0rj1om33t.ru
+g0uxvvzzmu0utgixmhhhvmyj.fra1.cdn.digitaloceanspaces.com
  g0vdvlalicensi-g0vsupporttaxpaymentseeuyfw.sue-cape.co.uk
  g0vpaymettaxrefund.ifossw.com
  g0y.95mcp.com
@@ -151322,7 +166846,6 @@ garena-gratisdiamond.ocries.com
  garena-reedem-kode-2020.000webhostapp.com
  garena-topupforfree.mariachisensantiago.cl
  garena16.com
-garenabestsurvival.2021abc.tk
  garenaclaimevent.com
  garenaehi12.000webhostapp.com
  garenaff.website
@@ -151352,6 +166875,7 @@ garins234.000webhostapp.com
  garizzlas.top
  garkueche-allerley.de
  garlicbbqhotpotbuffet.com
+garlicsiege.buzz
  garlobanker.xyz
  garmentkart.com
  garniermens.cf
@@ -151627,6 +167151,7 @@ gcesab.com
  gcfnyxxhailyazjg-dot-millinium.ey.r.appspot.com
  gcftdrds.m3ikp3.cn
  gcg-corp.com
+gcgexyexxqfrfkoilpsngwgtoi-dot-gl9393jan.uk.r.appspot.com
  gch7.com
  gciciqpswepiwhwm-dot-millinium.ey.r.appspot.com
  gcirsa.com
@@ -151643,6 +167168,7 @@ gcoronag.000webhostapp.com
  gcorpsa.com
  gcowntlxasuhadfe-dot-millinium.ey.r.appspot.com
  gcpfs.info
+gcqdexsdodkbnxnkqvdenpooex-dot-gl9393jan.uk.r.appspot.com
  gcqjx.com
  gcqpoyokibsccivh-dot-millinium.ey.r.appspot.com
  gcradiology.com.au
@@ -151713,9 +167239,11 @@ gdmsemea.caas4u.com
  gdmusic.net
  gdnamesg.firebaseapp.com
  gdnbklwvyzosntkp-dot-millinium.ey.r.appspot.com
+gdnccosyimvwxspvpimabkpzns-dot-gl9393jan.uk.r.appspot.com
  gdockierock.us
  gdonedoc.retailcube.eu
  gdorxhookzkpkeef-dot-glexcel1.ue.r.appspot.com
+gdoyantfytnnbjgebasevnvhsu-dot-gl9393jan.uk.r.appspot.com
  gdpr-giffgaff.network
  gdpr-law-giffgaff.support
  gdr01-supports-account-security-card-amazon.org
@@ -151745,6 +167273,7 @@ gdv.stomp.digital
  gdvdjsyd.com
  gdviacrumvcbxodmxpvpsnhxqugvuefsagxy-dot-cedar-code-289917.nn.r.appspot.com
  gdvucfkspaytczqgersbtunjxsar.top
+gdxgktiydrpypcamkrixvydmzu-dot-gl9393jan.uk.r.appspot.com
  gdyaxf.com
  gdyblvjmwrmnmnmj-dot-millinium.ey.r.appspot.com
  gdynia-fakt24.pl
@@ -151968,6 +167497,7 @@ genevieveschorr.com
  genf20pluscoupons.com
  gengrasjeepram.com
  geni.us
+geniallipsicologia.com.br
  geniaturkey.com
  geniavo.com
  genichesk.best
@@ -152046,7 +167576,6 @@ geometrai.com
  geomterystyle.com
  geopinfactory.com
  geoplanum.lt
-geoproblems.eu
  geoption.com
  georg-martin.net
  georg.maehring.at
@@ -152263,7 +167792,6 @@ getgohelp.com
  getgondidawvnbs.info
  getgoodvideo.com
  getgrowextrainches.com
-gethalloweeks.com
  gethardagain.net
  gethealthierhair.icu
  gethelp-update-mythree.co.uk
@@ -152332,7 +167860,6 @@ getsharktank.com
  getskinmobilelegends.ml
  getskinpubgs13.loseyourip.com
  getskinrewardpubg.freeddns.com
-getskinspiss.dvrlists.com
  getsmartifi.com
  getsmartlead.com
  getsnewssfreex.mlbbcollect.com
@@ -152364,6 +167891,7 @@ gettingreadycom.000webhostapp.com
  gettingwebpage.billing-update3248769.xyz
  gettjoingruopswhatpss.xxuz.com
  gettnews11.ocry.com
+getuc17.com
  getuniques.buzz
  getupandcboz.com
  getupandcycle.com
@@ -152397,6 +167925,7 @@ getz5.shop
  geuhw.xyz
  geuka.org
  gevkzojcniieqmlx-dot-millinium.ey.r.appspot.com
+gevxnhlgezuysliuwbjevppeko-dot-gl9393jan.uk.r.appspot.com
  gew63.svcoding.com
  gew9axd89-6xvvf7480.vercel.app
  gewcaaqarelouine.com
@@ -152404,6 +167933,7 @@ gewe.tech
  gewhhewweq.mypi.co
  gewtt.xyz
  gexgyxglylmpvern-dot-millinium.ey.r.appspot.com
+geyxdhhzljkrfmppqptqxaoehq-dot-gl9393jan.uk.r.appspot.com
  gezewgsvrsfknrnk-dot-millinium.ey.r.appspot.com
  gezrerrt-support.net
  gf2b.ailacabs.com
@@ -152471,6 +168001,7 @@ gfsdfd.hfsjkdf.xyz
  gfshyjy.com
  gfsjkqgooblbqktq-dot-millinium.ey.r.appspot.com
  gfsn.com.mx
+gfsrjsrhpbxuxvejoiephpwskp-dot-gl9393jan.uk.r.appspot.com
  gfssecurities.com
  gfstcrates12.otzo.com
  gfstw.xyz
@@ -152490,6 +168021,7 @@ gfvjhoiui.zfyvlcclo.cn
  gfwvseqnydiodujq-dot-millinium.ey.r.appspot.com
  gfxapanbnqd4jhf.pw
  gfxckhxpahhpcabb-dot-millinium.ey.r.appspot.com
+gfxpatogh.com
  gfxvkzpgrxowtsra-dot-millinium.ey.r.appspot.com
  gfxx.creatorlink.net
  gfyaxkqyobsnkqfo-dot-millinium.ey.r.appspot.com
@@ -152565,7 +168097,6 @@ ggoapwkksaomrdlx-dot-millinium.ey.r.appspot.com
  ggoofgg.s3-website.us-east-2.amazonaws.com
  ggopwbyonvvearhfayudcdzzxvagpydapfwx-dot-off94032393204.uk.r.appspot.com
  ggp1c.oujevais.com
-ggpflxxgfbtnqmmn-dot-revalidate-icaan-domain.ue.r.appspot.com
  ggq.kr
  ggq61.oujevais.com
  ggrlbkfcownpvyhx-dot-millinium.ey.r.appspot.com
@@ -152726,6 +168257,7 @@ giaanhvu.com.vn
  giadungg7.com
  giadungtienich.info
  giadw.shoesmogul.com
+giaide.net
  giaim.org
  giaipadpro.com.vn
  giamcannhanhslimfast.com
@@ -152761,6 +168293,7 @@ gibsonhennigan.com
  gibsonhomesva.com
  gicdjnxlppvozamg-dot-millinium.ey.r.appspot.com
  giclima.gr
+gicvpycktpqbmrzupmfmyicjsg-dot-gl9393jan.uk.r.appspot.com
  gidazkepxhvkfbvifulccacihz-dot-gleowayel400503.uc.r.appspot.com
  giddyupmedia.com.au
  gidirmegala.com
@@ -152834,6 +168367,7 @@ giftstickers.tk
  giftsyoupick.icu
  giftttfree.xyz
  giftucpubgm.com
+giftuuxx.xyz
  giftwithus.in
  giftz1.com
  gifvideos.in
@@ -153127,6 +168661,7 @@ gjihlhahjsdnyuxqaqeuvymupn-dot-gleowayel400503.uc.r.appspot.com
  gjjotkzbkqaifvdm-dot-millinium.ey.r.appspot.com
  gjleyrbbgtqzowed-dot-millinium.ey.r.appspot.com
  gjlwkoqyqmdqoaoz-dot-millinium.ey.r.appspot.com
+gjmyetokvkuzzrxloxjzrbcqov-dot-gl9393jan.uk.r.appspot.com
  gjnfgmjghmgh.ddns.net
  gjnnazwyahmjwqtrjf.top
  gjobertshausen.de
@@ -153176,6 +168711,7 @@ gkh-psp.ru
  gkhdwewhwdricuyw-dot-millinium.ey.r.appspot.com
  gkilpatrick.town.ie
  gkjao02kgml12dhfaffgw537hvfs.top
+gkjuvboxlskgcphusacohkvzgd-dot-gleow2021ja.ue.r.appspot.com
  gkjx168.com
  gkkgorzow.pl
  gkldl.godaddysites.com
@@ -153197,6 +168733,7 @@ gkvmcybpckeggwwg-dot-millinium.ey.r.appspot.com
  gkwrkzrhpjoxpocb-dot-millinium.ey.r.appspot.com
  gkx8.addroits.com
  gkxntlgrtwxagehqhrbqknnfia-dot-gleowayel400503.uc.r.appspot.com
+gkyykzqzhxoxilbuyljuajsrtp-dot-gl9393jan.uk.r.appspot.com
  gkz9877oj.gq
  gkzdzzgcvi.duckdns.org
  gkznvxbnhoghmknm-dot-millinium.ey.r.appspot.com
@@ -153255,7 +168792,6 @@ glcc-sbd.co.uk
  glccgeiqdwuykvej-dot-millinium.ey.r.appspot.com
  glcidihanodndibxfliseunwvw-dot-gleowayel400503.uc.r.appspot.com
  glcinter.com
-glcmcrusaders.org
  gldesarrollos.com
  gldveqwqagxzzqyyqtlhxhltsk-dot-gleowayel400503.uc.r.appspot.com
  gldvzhiddydnjzfg-dot-millinium.ey.r.appspot.com
@@ -153288,6 +168824,7 @@ glf.wwthkx.cn
  glfgaxyojzrwsvcs-dot-millinium.ey.r.appspot.com
  glfgepnpsqsnnutspjstqazzlimunvimsykd-dot-glxcel49934343434.rj.r.appspot.com
  glfo.eu
+glfsugvsqyzsadgauvshotpchy-dot-gl9393jan.uk.r.appspot.com
  glgtnuxqfwcoaumu-dot-millinium.ey.r.appspot.com
  glibonlinewebapps.com
  gliclof.org
@@ -153351,7 +168888,6 @@ globalbloodtx-com.gl494903049.wl.r.appspot.com
  globalblouse.com
  globalbpomanagement.com
  globalcashcenter.com
-globalcenterlive.ml
  globalcfd.com
  globalcitibank.com
  globalclasificados.com
@@ -153492,7 +169028,6 @@ glovm.com
  glow-deeply-divan.glitch.me
  glow-wormcombi.com
  glow.co.in
-glowdisk53.xyz
  glowjab53.com
  glowjigs.net
  glowtank.in
@@ -153584,6 +169119,7 @@ gmpategofr.nckiwomen.gdn
  gmpbfsroioaddwuotodvdxxawv-dot-gloff849483.uk.r.appspot.com
  gmpfwoywfguwyxfwgpbogyjzwd-dot-gleowayel400503.uc.r.appspot.com
  gmpwqczfgtdgdjvtnp.top
+gmqqqvjlwicfsrtogzvggxfaix-dot-gl9393jan.uk.r.appspot.com
  gmr.az
  gmrs-roanoke.com
  gms2006.de
@@ -153618,6 +169154,7 @@ gnarlyearth.com
  gnb4.blob.core.windows.net
  gnc.happenizedev.com
  gncahphwsfiobrchoizulkmxguxrebqanczp-dot-gl494903049.wl.r.appspot.com
+gncrgjkjgleionvtgobalcjjex-dot-gl9393jan.uk.r.appspot.com
  gnctoilvarxynfmtdblqhsknto-dot-gleowayel400503.uc.r.appspot.com
  gndfrujrt6t6.ddns.net
  gndi-sp.com.br
@@ -153640,6 +169177,7 @@ gnimelf.net
  gninvest-ag.com
  gnitzerqcgbldfnq-dot-millinium.ey.r.appspot.com
  gnizxvtorwcjsrzopubfvkgcmudzkjrzonle-dot-solar-vertex-285913.rj.r.appspot.com
+gnjaiunhioafklpjudjwxfyunm-dot-gl9393jan.uk.r.appspot.com
  gnlmfgpyoqbvampn-dot-millinium.ey.r.appspot.com
  gnnqbhsjnoxwvjgekbfoaunedavcxccmuafe-dot-cedar-code-289917.nn.r.appspot.com
  gnoddrc.org
@@ -153718,6 +169256,7 @@ goanbazzar.com
  goandshine.org
  goapplesupport.com
  goasjves.org
+goatbitter.buzz
  goatskinflakily.co.kr
  goattlogin.com
  goaudio.cc
@@ -153778,6 +169317,7 @@ godrejproperties-thane.co.in
  godrejs-southestate-okhla.com
  godrivedrop.com
  godryall.com
+gods.bicegyplifeg.fun
  gods.brernbanarolle.com
  godsave.tk
  godsglotyonme.com
@@ -153869,6 +169409,7 @@ gojuryukarate.co.za
  gok.wladyslawow.pl
  gokdenizz.com
  goklerlastikkaplama.com
+goktbnuhadlwxazeqaeuqmhzrf-dot-gl9393jan.uk.r.appspot.com
  gokulnath.me
  gol4apple.com
  golaantsystem.xyz
@@ -153938,6 +169479,7 @@ goldenstarkos.gr
  goldenstatetow.com
  goldentigerphotocircuit.com
  goldentimepattaya.com
+goldentop.info
  goldentouchevents.com
  goldenwestsetupservice.yolasite.com
  goldenwing.co.ke
@@ -154287,6 +169829,7 @@ gorrasnissin.com
  gorseinonprimary.com
  gorumriwjuezresw-dot-millinium.ey.r.appspot.com
  gorundpoweraddusiu.us
+gorundpowergeneratorjs.us
  gosdfkm.gq
  goseka.co
  goshmanconsulting.com
@@ -154342,6 +169885,7 @@ goulivazaruba.com
  goupdate-info.net
  goupwhatsappsange2020.whatsapp-bokep.tk
  gouro-b.com
+goutnutsrtcnsfksmurdvcasvs-dot-gl9393jan.uk.r.appspot.com
  gouttieresboivin.com
  gouv-federalsubsidiescovid-19crisis.com
  gouv-impot.cemerbas.com
@@ -154350,6 +169894,7 @@ gouv1-0billd.com
  gouvcanada-covid19.com
  gouvernementrdc.com
  gouvref456216verifauthentification.com
+gouwtmcvoxcgfrjetpohxxvvde-dot-gl9393jan.uk.r.appspot.com
  gov-24.com
  gov-az.herokuapp.com
  gov-ca-covid19.org
@@ -154735,9 +170280,11 @@ gqsbqxhtsgqbhynr-dot-millinium.ey.r.appspot.com
  gqtwqatpeomadhny-dot-millinium.ey.r.appspot.com
  gqtxnfqsjdppohywtuwsqaibcssehqmeizdb-dot-glenxpecial3009493.ey.r.appspot.com
  gquijiayap.duckdns.org
+gqutbaaymgemoxgshgtjavjzuz-dot-gl9393jan.uk.r.appspot.com
  gquy4.app.link
  gqvngvvbxoyekoyawmmrjrvgqqxhbkvqoavr-dot-cedar-code-289917.nn.r.appspot.com
  gqvvrrvhheboqdmaoafwfxusbf-dot-gleowayel400503.uc.r.appspot.com
+gqwbaymuwxnokpyixkmqbkksep-dot-gl9393jan.uk.r.appspot.com
  gqwhyjh.com
  gqyjixnnffwwvsnz-dot-millinium.ey.r.appspot.com
  gqzdqdgolu.duckdns.org
@@ -154802,6 +170349,7 @@ gracious-benz-c057e6.netlify.app
  gracious-colden-d8c349.netlify.app
  gracious-goldstine-6f9ab9.netlify.app
  gracious-lovelace-3d7ab6.netlify.app
+gracious-torvalds-2d7677.netlify.app
  graciouslyyourssydney.com
  graciouswordsmith.online
  gradamossine.nl
@@ -154859,7 +170407,6 @@ grandholidayvacations.in
  grandhomesgroup.com
  grandhospitall.com
  grandinvestment.com
-grandiose-luxurious-avocado.glitch.me
  grandiosemidnightbluetranslations--five-nine.repl.co
  grandirensemble85.com
  grandmarketltd.co.uk
@@ -154956,6 +170503,7 @@ graymarshwound.com
  graztrty.net
  grb-inter.com
  grbbectsklcgnludvmvbotilir-dot-gleowayel400503.uc.r.appspot.com
+grbqbuqjtfhrkqilmqfondfvva-dot-gl9393jan.uk.r.appspot.com
  grbrahasiaxxtah.000webhostapp.com
  grcollins.co.uk
  grdjynmvcok.top
@@ -155190,6 +170738,7 @@ gretrix.com
  greuueper.com
  greyandco.000webhostapp.com
  greygate.co.zw
+greygorillagroup.com
  greyhuksy.work
  greymatterplus.com
  greypacemedia.com
@@ -155387,7 +170936,6 @@ group.agriparts.kz
  group.bokeps18plus.frezas.my.id
  group.whatsapp-me.gq
  group.whatsapp-me.tk
-group.whatsapp.get-freefire2021-com.ga
  group.whatsapps.19covidd.com
  group.xxx-whatsapp.com
  group18join022.000webhostapp.com
@@ -155660,6 +171208,7 @@ growasiacapital.id
  growena.in
  growfurtherfinancials.com
  growing-marijuana.org
+growlx.buzz
  growmore.in
  growmybusinessfinancing.com
  growncarbon.com
@@ -156115,6 +171664,7 @@ grup-bokep-terhotxnxx.000webhostapp.com
  grup-bokep-tetbaru-rahasia.000webhostapp.com
  grup-bokep-vcs-asia-hd.000webhostapp.com
  grup-bokep-viral.joinwa.me
+grup-bokep-wa-2021-virall.tk
  grup-bokep-wa-terbaru-2k20.000webhostapp.com
  grup-bokep.xxxy.biz
  grup-bokep18.vvipz4.com
@@ -156144,7 +171694,6 @@ grup-free-fire-batelgrounds-com.000webhostapp.com
  grup-happy-18keatas.000webhostapp.com
  grup-hot.mantap2k20.tk
  grup-indonesia-2020.000webhostapp.com
-grup-invt.mrslove.com
  grup-join-whatsapp.vizvaz.com
  grup-join-whattsapp.gq
  grup-juniiv2.ga
@@ -156279,6 +171828,7 @@ grup-whatsappsviral.ftp1.biz
  grup-whatsappx.xnxxx.my.id
  grup-whatshap-free-fire-2020.000webhostapp.com
  grup-whatspp-bokep-indo18.000webhostapp.com
+grup-youtubee.000webhostapp.com
  grup-youtuber.holds20.com
  grup.18pluss.frezas.my.id
  grup.bokep.wa.crotdsx.ygto.com
@@ -156326,6 +171876,7 @@ grupberbagividiodewasa18.000webhostapp.com
  grupberbagividioenakenak.000webhostapp.com
  grupberbagividioenakenak120.000webhostapp.com
  grupberbagividioenakenak130.000webhostapp.com
+grupberbagividiowikhwikh.000webhostapp.com
  grupbf18.whatsap-gr33.tk
  grupbfvirallll.000webhostapp.com
  grupbk3p.000webhostapp.com
@@ -157080,7 +172631,6 @@ grupwhatsapp18terbaru.ezua.com
  grupwhatsapp18terbaru.itsaol.com
  grupwhatsapp2020.25u.com
  grupwhatsapp2020.hol7.com
-grupwhatsapp2021-vipp.tk
  grupwhatsapp31.holl21.tk
  grupwhatsapp5.jkub.com
  grupwhatsapp5.vip4z.com
@@ -157207,6 +172757,7 @@ gsagsa-71.ml
  gsbc.gr
  gsbedcvjshjs.weebly.com
  gsbh.shoesmogul.com
+gschqpcjmzbayewgmphhwagvdv-dot-gl9393jan.uk.r.appspot.com
  gscrow.com
  gscustomeerslocloud0.com
  gsddfsfasa.pw
@@ -157249,6 +172800,7 @@ gskoummczkdahzds-dot-millinium.ey.r.appspot.com
  gslmjlrxnzcjuafu-dot-millinium.ey.r.appspot.com
  gslspiritassociation.org
  gslstion.com
+gsmaduoxzciizjhfaklekrrbim-dot-gl9393jan.uk.r.appspot.com
  gsmadvisors.co.in
  gsmaige.com
  gsmdenfeukfhdmix-dot-millinium.ey.r.appspot.com
@@ -157363,6 +172915,7 @@ gthnhmerrv.web.app
  gtigtex.info
  gtimarkets.com
  gtitco.com
+gtjevekyvnsjwrgnghmljvdzyl-dot-gleow2021ja.ue.r.appspot.com
  gtjjrcmwxcxgemzo-dot-millinium.ey.r.appspot.com
  gtjypro.com
  gtkvrytbyqbrrkta-dot-millinium.ey.r.appspot.com
@@ -157391,6 +172944,7 @@ gttulpodoqdqrgfs-dot-millinium.ey.r.appspot.com
  gtuwhkcdjhstyyhn-dot-millinium.ey.r.appspot.com
  gtvtuning.com
  gtw420.com
+gtwjtvolovswmcscmsbvudbjxn-dot-gl9393jan.uk.r.appspot.com
  gtworldacademy.webhibe.com
  gtxgiveaway.fun
  gtxlpfirefly.000webhostapp.com
@@ -157498,6 +173052,7 @@ guide-84402677.zjlions.org
  guide-86385722.zjlions.org
  guide-coin.com
  guidebattleground.com
+guideflat.guru
  guidegdanskcom.chifanassociate.top
  guidehimalayan.com
  guideinengland.ru
@@ -157507,6 +173062,7 @@ guiderite.org
  guides.prostruction.net
  guidescience.com
  guidesshop.com
+guidex.buzz
  guidex.eu
  guido-mockel.de
  guidobarosio.it
@@ -157596,6 +173152,7 @@ guose.intsungroup.com
  guoseu.com
  guotao.winmail01.cn
  guoxiaorui.cn
+gupivooocdgwamevzhlvosdrck-dot-gl9393jan.uk.r.appspot.com
  gupoty.aninik.me
  gupovipteamsos.com
  guppon.com
@@ -157627,9 +173184,11 @@ gustavocosta.pt
  gustavodcampos.com
  gustochain.com
  gustosoesemplice.com
+gusyozqyjwtlakehznaxovuypn-dot-gl9393jan.uk.r.appspot.com
  gutachter-kanzlei.de
  gutasiergo.com
  gutasiergo1.com
+gutblessyou.com
  gutbrod-kunkler.ch
  gutesvonhierorg.batwoqiseries.top
  guteunterhaltung.de
@@ -157670,6 +173229,7 @@ gveywmvcqo.firebaseapp.com
  gvfoundation.com
  gvghwoedcnyorgao-dot-millinium.ey.r.appspot.com
  gvglfcwwdyitbldopmwugkdedkczyvqlcdyj-dot-glegen303939423233.ue.r.appspot.com
+gvgovzrmfrgpxoayjkzymhtpxx-dot-gl9393jan.uk.r.appspot.com
  gvgvvgvvjjh.weebly.com
  gvgxgzenraldqfmj-dot-millinium.ey.r.appspot.com
  gvhybvyd3.com
@@ -157759,6 +173319,7 @@ gwkaqtfaufyrrncfhdzaenpzld-dot-gleowayel400503.uc.r.appspot.com
  gwlbnin.goruli.com
  gwmpdtveuxwamqfl-dot-millinium.ey.r.appspot.com
  gwnfsdlhjnyjycvbijabilvahdbzqtanwfaj-dot-solar-vertex-285913.rj.r.appspot.com
+gwnqjficunfgzfqnhraigmqqbe-dot-gl9393jan.uk.r.appspot.com
  gwqr.onderhost.com
  gwqxrscggodvvzfb-dot-millinium.ey.r.appspot.com
  gwrd.hq1.best
@@ -157791,6 +173352,7 @@ gxfbkj.com
  gxffny.com
  gxgfnm.com
  gxghsy.com
+gxgizzvroadmfykdhvfkgcumim-dot-gleow2021ja.ue.r.appspot.com
  gxhaoyouhh.com
  gxirvjfiqirmiwtd-dot-millinium.ey.r.appspot.com
  gxkaishan.com
@@ -157854,6 +173416,7 @@ gykiotocukqdjaua-dot-millinium.ey.r.appspot.com
  gylabtwj.shoesmogul.com
  gylcvlizuaecpbmkkboomwrgmggkgababorw-dot-glegen303939423233.ue.r.appspot.com
  gyligsvlzycdnmbthozknzhqtx-dot-gleowayel400503.uc.r.appspot.com
+gylkzfmbrkqphglrapcpvhssnd-dot-gl9393jan.uk.r.appspot.com
  gyltwsbenrcjdzesvswyeybyixtxqoeevztm-dot-cedar-code-289917.nn.r.appspot.com
  gylvqcvfvrnniuwc-dot-millinium.ey.r.appspot.com
  gym.marvin.tech
@@ -157877,6 +173440,7 @@ gyrnta.com
  gyroenmoozflgbtngrza-dot-gleowyel040493443434989.wl.r.appspot.com
  gyrowtdhyeyottjo-dot-glexcel1.ue.r.appspot.com
  gysjwyqfcgocxhijfwauxbowxx-dot-gleowayel400503.uc.r.appspot.com
+gysuiiwoo.cam
  gytm.jaysbrand.com
  gyttgod.com
  gyu88jh.nrtyjyt44ee.al1av.com
@@ -158082,7 +173646,6 @@ haar-spange.com
  haaratelier-cloppenburg.de
  haartfordct.buzz
  haarwelten.com
-haawoomedia.com
  habaapac.com
  habaudeutschlandcom.nckichicago.gdn
  habbo-com-br.albamendes.com.br
@@ -158182,6 +173745,7 @@ hadiyaacoub.com
  hadiyecekilis.xyz
  hadoweggplant.com
  hadre.xyz
+hadteunion.weebly.com
  hadybook.com
  haeacokzchwhipdt-dot-millinium.ey.r.appspot.com
  haeal.ru
@@ -158614,7 +174178,6 @@ halifax-recipient-support.com
  halifax-recipient.com
  halifax-registered-devices.com
  halifax-registered-payee.com
-halifax-remove-payee-page.com
  halifax-remove-payee.com
  halifax-removedevice.co.uk
  halifax-removedevice.com
@@ -159376,7 +174939,6 @@ halimanagepayee.com
  halipayee-auth.com
  halipersonalsec.link
  halisecure-ilogincancel.com
-halisecure-iverify-activity.com
  halisecure-login.com
  halisecure-online-login.com
  halisecure-online.com
@@ -159384,7 +174946,6 @@ halisecure-request.com
  halisecure-verifypayee.com
  halisecure.co.uk
  halisecuredevice.com
-halisecurity-iverify-proceed.com
  halisecurity.com
  haliuk-secure-device.com
  hall-motor-47.myjino.ru
@@ -159607,6 +175168,7 @@ happsoftware.com
  happy-albattani-b18730.netlify.app
  happy-antshop.sitenode.sk
  happy-dealstoday.blogspot.com
+happy-dubinsky-6ee824.netlify.app
  happy-runner.com
  happy-thinking.com
  happy-wright-e1ba1b.netlify.app
@@ -159674,6 +175236,8 @@ hardsofts.ru
  hardwoodcolor.com
  hardwrtion.net
  hardyqeeens.com
+hare24.buzz
+hareeyuui.cam
  harehsdhed.com
  haremnick.com
  hareshawwise.com
@@ -159704,6 +175268,7 @@ harmonious-fuschia-cardigan.glitch.me
  harmonyandlife.top
  harmonyrealestate.ae
  harmonysolutions.co.za
+harmtap.buzz
  haroldhazard1-wixsite-com.filesusr.com
  haroldkjones.com
  harolds.ooguy.com
@@ -159872,6 +175437,7 @@ haveuseen.us
  haviorated.xyz
  havlv.com
  havlv.org
+havnfsgdpuwizkvyviuzhdkohu-dot-gl9393jan.uk.r.appspot.com
  havoezbfiboxsydxwane-dot-gleowyel040493443434989.wl.r.appspot.com
  havygiu4.xyz
  hawa-nafsu.000webhostapp.com
@@ -159944,6 +175510,7 @@ hbd.svcoding.com
  hbejedilyf.sweetwprice.su
  hbes.amzaoe.top
  hbetngdgtvltrfqh-dot-millinium.ey.r.appspot.com
+hbeyizdgmlukzbqejjhwgsvhxl-dot-gl9393jan.uk.r.appspot.com
  hbeywdxtctkinpbmobibmxkgqltlgjcmbcny-dot-glenxpecial3009493.ey.r.appspot.com
  hbfhdaooxlvdthxdogmzvqsqcukkmysntxla-dot-solar-vertex-285913.rj.r.appspot.com
  hbfiauqcfcvehryb-dot-millinium.ey.r.appspot.com
@@ -159995,6 +175562,7 @@ hbweiner.org
  hbwqz.ml
  hbwuu.weebly.com
  hbxcubb9.ml
+hbxwwzqhblinmhjiqhoujzusce-dot-gl9393jan.uk.r.appspot.com
  hbxyqfairjaswqyf-dot-millinium.ey.r.appspot.com
  hbyfyxh.com
  hbyoubu.com
@@ -160107,6 +175675,7 @@ hdkhdjkdhdsd.yolasite.com
  hdlinkslist.site
  hdmediahub.club
  hdmmlrqcdrytjwye-dot-millinium.ey.r.appspot.com
+hdoemoqtnpqzlxlckhoplriiam-dot-gl9393jan.uk.r.appspot.com
  hdoetwzhavnddswhcidchuheyulgfdum.com
  hdokfjrgxcnrxrbeiuuudbkxhp-dot-gloff849483.uk.r.appspot.com
  hdpbsnshlprcvrysrvce01.my.id
@@ -160114,6 +175683,7 @@ hdplayer9.site
  hdplaygirl.club
  hdposter.com
  hdpqzeclgnlcajaa-dot-millinium.ey.r.appspot.com
+hdqctjmogtghfqzvhmlkipybif-dot-gl9393jan.uk.r.appspot.com
  hdqnacguyvufqezx-dot-millinium.ey.r.appspot.com
  hdrgs.xyz
  hdrops.fun
@@ -160189,6 +175759,7 @@ health-security.me
  health.1jl4.com
  health.buvizyon.com
  health263.systems
+health4you.casa
  healthandbeautyblog.5pm.co.uk
  healthandnutritionapps.com
  healthandwellnessgel.com
@@ -160328,6 +175899,7 @@ hedayhascometoanendhome.top
  heddguardian.website
  hedeawnetdc.ru
  hedftfdepgwladbc-dot-millinium.ey.r.appspot.com
+hedgehog24.buzz
  hedgerowfarms.com.au
  hedigital.tech
  hedimesa.com.mx
@@ -160632,7 +176204,6 @@ help-snnbc.monster
  help-snnbcs.xyz
  help-support-copright.ml
  help-support-secure.link
-help-supportlive-community.tk
  help-t-mobile.org
  help-team3.com
  help-teamservicesafemyappstore.club
@@ -160677,7 +176248,6 @@ help3secure.info
  help3uk.com
  help438.000webhostapp.com
  helpabout-center.com
-helpaccountmedia.ml
  helpadmnsed.000webhostapp.com
  helpadya.com
  helpappovralcustombussiness.com
@@ -160799,7 +176369,6 @@ helpmatetell.club
  helpme-payee.com
  helpmediacopyright.cf
  helpmediacopyrights.com
-helpmediaig-supportservice.ml
  helpmemoreatt.weebly.com
  helpmepayless.com
  helpmereset-myaccount.com
@@ -160845,7 +176414,6 @@ helpserver-instagram-form-105614853501338.ml
  helpservice-account.com
  helpservice-ig.com
  helpservice.0fees.us
-helpservicecopyrideforbusinnes.ml
  helpservicesofinstagram.com
  helpsfety-checkpointpage.000webhostapp.com
  helpsfor-ig.com
@@ -161186,6 +176754,7 @@ hg76ytsdas.appspot.com
  hgaldiddn.000webhostapp.com
  hganny.com
  hgapps.com.br
+hgasjsh.tk
  hgazjp.rogagot.com
  hgbirkcvwglagqazhczkpygaoh-dot-gleowayel400503.uc.r.appspot.com
  hgbse.xyz
@@ -161216,6 +176785,7 @@ hggwvrhwzuqrjakrxmyezkfiojgoxjaqhgtu-dot-glxcel49934343434.rj.r.appspot.com
  hghdefined.com
  hghdhsdgsupport.net
  hghdhsdgsupport.org
+hghdrieyuxitspdanfalchwkot-dot-gl9393jan.uk.r.appspot.com
  hghltdpendin-gemail.imfast.io
  hghpskvvboiivacr-dot-millinium.ey.r.appspot.com
  hgj8.svcoding.com
@@ -161233,6 +176803,7 @@ hgniuxcjptgdlslbdcutnnllom-dot-gleowayel400503.uc.r.appspot.com
  hgo.vipsnapchatsexting.com
  hgpe.addroits.com
  hgpnmmfiqmpzmlptrapp-dot-gleowyel040493443434989.wl.r.appspot.com
+hgpsdhlgiashdwqfczyhnwmmpe-dot-gl9393jan.uk.r.appspot.com
  hgsatrwqsaz6a.com
  hgscicjb2epf9xn.e8273.pro
  hgsgukkowgzkcocznitbocinsz-dot-gloff849483.uk.r.appspot.com
@@ -161267,6 +176838,7 @@ hh3368.com
  hh35.anahkedm.com
  hh4aj.svcoding.com
  hh7ujsg.yuhootech.cn
+hhafep.cam
  hhafs.cam
  hhatyui-71.cf
  hhbbiionnnnn.com
@@ -161457,6 +177029,7 @@ higdghxkcwemogxcxgraxldecc-dot-gloff849483.uk.r.appspot.com
  higgsdominocomunity.000webhostapp.com
  high-alert24x7.com
  high-handed-flags.000webhostapp.com
+high-octane-tracker.000webhostapp.com
  high-principled-dig.000webhostapp.com
  high-voltage-surfac.000webhostapp.com
  highaltitudes.net
@@ -161622,6 +177195,7 @@ hinodeshop.net
  hinsorn.ac.th
  hinter-den-schlagzeilen.info
  hinterface.com
+hintgalzrlpxqqelzlkomeppjc-dot-gleow2021ja.ue.r.appspot.com
  hiohgtr.gq
  hiolouinqare.com
  hiontrendy.com
@@ -161770,7 +177344,9 @@ hjg.nkkhmxn.cn
  hjg.pjtdpjl.cn
  hjg.uygwjjq.cn
  hjg.xpdfrlz.cn
+hjg.xqbkqye.cn
  hjg.xtnnllj.cn
+hjg.ylxwznj.cn
  hjgdfbnvghgfn-com.preview-domain.com
  hjgfj56u.tk
  hjgkhgf.weebly.com
@@ -161945,6 +177521,7 @@ hlrlluckclssllmw-dot-millinium.ey.r.appspot.com
  hlse.sovereignty2020.com
  hlsquared.ca
  hlss.jigsy.com
+hlszbsjlkcipwzjslxpbluewss-dot-gl9393jan.uk.r.appspot.com
  hlthyeqdbkyzmuft-dot-millinium.ey.r.appspot.com
  hltps-wwv-bancoestado-cl.clinicadentistar489.com
  hltps-wwv-bancoripley-cl.publicidadtechtre.com
@@ -162016,7 +177593,6 @@ hmcharitableassociation.com
  hmcria.com
  hmcrkhqufz.duckdns.org
  hmcschool.in
-hmcustoms.tax.secure-auth-details1.com
  hmdrnuks.gotdns.ch
  hmebingerville.ci
  hmelgt.work
@@ -162103,6 +177679,7 @@ hmrc-return.com
  hmrc-return.uk
  hmrc-returncalculate.com
  hmrc-returnsuk.me
+hmrc-secure-taxrebate.com
  hmrc-secure.com
  hmrc-securetaxreturn.com
  hmrc-security-authorise-user9403811.net
@@ -162404,6 +177981,7 @@ hmutkwvjvkhkyyie-dot-millinium.ey.r.appspot.com
  hmuv2.blob.core.windows.net
  hmvcri.com
  hmvjofabqfgzgipr-dot-millinium.ey.r.appspot.com
+hmwtxetfpzsbmldlumlsxenvbq-dot-gleow2021ja.ue.r.appspot.com
  hmxwczhmhewisoim-dot-millinium.ey.r.appspot.com
  hmyahymgbwpvsbyo-dot-millinium.ey.r.appspot.com
  hmyj.cc
@@ -162421,6 +177999,7 @@ hnase.duckdns.org
  hnbeu.xyz
  hnbrfglcyhioawfz-dot-millinium.ey.r.appspot.com
  hnbse.com
+hnbslbxqvjbycjvlwqdvsicmgl-dot-gl9393jan.uk.r.appspot.com
  hnc-cm.rodevdesign.com
  hncirm.com
  hndoficialmexico.com.mx
@@ -162444,6 +178023,7 @@ hnjwybwbciffxwkm-dot-millinium.ey.r.appspot.com
  hnkhvb.com
  hnlfaxzfkljeaasz-dot-millinium.ey.r.appspot.com
  hnmdnd.com
+hnnpnqiakmwnexopjsiirgkvub-dot-gl9393jan.uk.r.appspot.com
  hnnrci.com
  hno-bremennord.de
  hnohiaaewe.duckdns.org
@@ -162555,6 +178135,7 @@ hoga-consulting.de
  hogar-dulceh-inc.ga
  hogarymas.es
  hoghooghonline.legal
+hoghplpiphlenbyxcnrstnjodu-dot-gl9393jan.uk.r.appspot.com
  hognalsezpnbzwmieapqfxyvfebsuorbwloy-dot-cedar-code-289917.nn.r.appspot.com
  hogoscarstudio.com
  hogvet.com
@@ -162948,6 +178529,7 @@ honorwave.com
  honpfucvywnkcctx-dot-millinium.ey.r.appspot.com
  hont.ml
  hontam.net
+honushearth.com
  hoo.gl
  hoobpromoticon.gq
  hoochie.ga
@@ -163321,7 +178903,6 @@ hotgifts.online
  hotgrub-whatsapp-join.25u.com
  hotgrupbokepwhatsapp-join.vvipx09.ml
  hotgrupbokepwhatsapp2020join.vidxxv9.xyz
-hothot18.duckdns.org
  hothotelrock.com
  hothothot247.ml
  hotirial.com
@@ -163389,12 +178970,15 @@ hottestklusin.ga
  hottestxxxvideo.com
  hotto.duckdns.org
  hottsevents.ml
+hotupdatev19.com
  hotwa.join-now.net
+hotwagrup-hothot.000webhostapp.com
  hotwagrup-wa.000webhostapp.com
  hotwaindo.000webhostapp.com
  hotwhatasapp.is-slick.com
  hotwhatsap.onviy.com
  hotxxpornstars.club
+hotysuiosp.cam
  hotz-groupz-joins.jetos.com
  hotz-grup-18.jkub.com
  houara.com
@@ -163550,6 +179134,7 @@ hplaptopservicecentermumbai.com
  hplc-remove-device.com
  hplgwlrvsfdakkpm-dot-millinium.ey.r.appspot.com
  hpllf.vipsnapchatsexting.com
+hplxjleaqimehdxtowfjebnoha-dot-gl9393jan.uk.r.appspot.com
  hpmaytinhtaophongcach.com
  hpqgfglpllxovgds-dot-millinium.ey.r.appspot.com
  hpqiijfnynhwoseysmejnugrrhflvymlinqn-dot-cryptic-now-290917.ey.r.appspot.com
@@ -163620,6 +179205,7 @@ hqsistemas.com.ar
  hqtlqgogkbhvfyvcbkyyqbpjsdgjveychixx-dot-solar-vertex-285913.rj.r.appspot.com
  hqtpckjvryqpmsxuvm.top
  hqubzbsv.fbk2020.xyz
+hqulzdqwnvqwbntnkegpftoamj-dot-gl9393jan.uk.r.appspot.com
  hqumbprfqv.duckdns.org
  hqx.shoesmogul.com
  hqxldfiqhxpqyyyr-dot-millinium.ey.r.appspot.com
@@ -163739,7 +179325,6 @@ hs-cancel-auth.net
  hs-cancel-payee.com
  hs-cancel-paym.net
  hs-cancelpayee.net
-hs-delete-new-payee.com
  hs-denotfisecs.com
  hs-failedpayment.com
  hs-fraudpaymentsaccountalert.com
@@ -164104,6 +179689,7 @@ hsianpgehlp01rcvrsrvce01.my.id
  hsihqmwksawmqavq-dot-millinium.ey.r.appspot.com
  hsipl.in
  hsjinowainqivguyfgbzypmdvk-dot-secret-argon-296111.uk.r.appspot.com
+hsjkklliopp.cam
  hsjsrjhfkfzqkaom-dot-millinium.ey.r.appspot.com
  hsjxpk.com
  hskapapsh.000webhostapp.com
@@ -164129,6 +179715,7 @@ hspayee-alert.com
  hspayee.cc
  hspaymentshelp.com
  hspersonal-onlinebanking.com
+hsprzylcybpfdwmpedblrvxsys-dot-gl9393jan.uk.r.appspot.com
  hspwjsehshuqygrz-dot-millinium.ey.r.appspot.com
  hsrfjgkytvzeiddtsonwscnwqs-dot-gleowayel400503.uc.r.appspot.com
  hsrmic.com
@@ -164161,6 +179748,7 @@ hsuk-paymentverify.com
  hsukpayments.com
  hsuse.xyz
  hsuukrtsrgkwhphnabnudpyqjqofortrqvoy-dot-gl494903049.wl.r.appspot.com
+hsvbwopccyhgucqrqbfvqoiqsx-dot-gl9393jan.uk.r.appspot.com
  hswajqsucgggeuclnsustodtia-dot-gloff849483.uk.r.appspot.com
  hswawuo7c8axfxw3.com
  hswgs.xyz
@@ -164246,7 +179834,6 @@ htsxupsxbqabtumi-dot-millinium.ey.r.appspot.com
  htt.munsternissan.com
  http-appie.com
  http-cdek.ru
-http-chat-whatsapp-join.grup-mabar672.ga
  http-gabung-grup-bokep-viral.000webhostapp.com
  http.farodevirh.com
  http.mzapk.pro
@@ -164339,6 +179926,7 @@ huaian.06rl.com
  huaibangchina.com
  huaihua.06rl.com
  hualish01.com
+hualplamxbvddmgdknwfoyundh-dot-gl9393jan.uk.r.appspot.com
  huananzixun.com
  huangao6.com
  huangjiaduchangyulecheng.tavmo.com
@@ -164402,6 +179990,7 @@ huesges-gruppe.de
  huesosinaebanayanahuiblyat.xyz
  huethietke.com
  huevacations.com
+hufemyrbflikppsnplczjzhkht-dot-gl9393jan.uk.r.appspot.com
  huffalmond.com
  huffpuff.com.au
  hufixive.tk
@@ -164409,6 +179998,7 @@ hufz.vipsnapchatsexting.com
  hugecloud.is-a-techie.com
  hugeroll.ru
  hugesumlily.000webhostapp.com
+hugfxnvywroqtbhwmjfcxckpts-dot-gl9393jan.uk.r.appspot.com
  hughesnet.club
  huginyazarkasa.com
  hugomartinez.lopedevega.es
@@ -164419,6 +180009,7 @@ huhucow.com
  huhucow2.com
  huhuhue.net
  huhwg.xyz
+huhxteacthldrpbivbnvrdgxkf-dot-gl9393jan.uk.r.appspot.com
  huiascdoy.cn
  huices.xyz
  huichengshebei.com
@@ -164491,6 +180082,7 @@ humorencatala.cat
  humput23.000webhostapp.com
  humreas.hopto.org
  humsabrajasthani.com
+humx.buzz
  hun-tington02a.serveftp.com
  hunanhaizhao.com
  hunanyuhui.com
@@ -164583,6 +180175,7 @@ hushnsh.ddns.net
  husjklm.com
  huskedeggplantr.com
  huskennemerland.nl
+huskskiio.cam
  huskystorage.net
  huslerz.com
  husolicitors.com.au
@@ -164620,6 +180213,7 @@ huupkhbwk.rogagot.com
  huusiiwee.cam
  huuuaaa.cam
  huvudstadsguiden.eu
+huwouuooww.cam
  huxdsrladybxvazbqvxmcjurgf-dot-gleowayel400503.uc.r.appspot.com
  huxere.xyz
  huxtable.com.au
@@ -164648,6 +180242,7 @@ huzucoxloqlvgixu-dot-millinium.ey.r.appspot.com
  huzurdansi.com
  huzurdugunsalonu.com
  huzurunkalbi.net
+huzyytxnhmxzewejfgklyoenvg-dot-gl9393jan.uk.r.appspot.com
  hvac-retrofits.com
  hvacprosplus.com
  hvacrheritage.ca
@@ -164686,6 +180281,7 @@ hvuwnzispjbatlym-dot-millinium.ey.r.appspot.com
  hvwaxkbgnykzecgh-dot-millinium.ey.r.appspot.com
  hvwenivurremuspweyuetfemhjpufwxckckd-dot-solar-vertex-285913.rj.r.appspot.com
  hvwyrylvhsrdolpy-dot-millinium.ey.r.appspot.com
+hvxpsgkkfqwumfhyudzxiwlprg-dot-gl9393jan.uk.r.appspot.com
  hvzkmehwglojsvjb-dot-millinium.ey.r.appspot.com
  hw3leonardand.000webhostapp.com
  hw591.com
@@ -164746,6 +180342,7 @@ hxensonwenqroxwlufccucaqbvvflofuqznr-dot-gl494903049.wl.r.appspot.com
  hxev888.com
  hxfgg.cn
  hxgdrfhfttgovgus-dot-millinium.ey.r.appspot.com
+hxgxgtflhsmqeqapzlokkujkzu-dot-gl9393jan.uk.r.appspot.com
  hxjqbcnjdiolciet-dot-millinium.ey.r.appspot.com
  hxjspcafjpipttqkmuxdxpbqgizffyvmiyfo-dot-offglen.uk.r.appspot.com
  hxjxvfkkyczqbyvsxkiayjtaxsgmrflqyqjx-dot-cedar-code-289917.nn.r.appspot.com
@@ -164777,6 +180374,7 @@ hxwwiskclfsloxzy-dot-millinium.ey.r.appspot.com
  hxxgrhrcyavrnscmwpzwkuvnwx-dot-gleowayel400503.uc.r.appspot.com
  hxynd.awaykart.com
  hxyssc.com
+hxyueeooo.work
  hxzcbjohpmuxadyw-dot-millinium.ey.r.appspot.com
  hxzitong.com
  hxzqjz.com
@@ -164864,6 +180462,7 @@ hymryzmalqeavlot-dot-millinium.ey.r.appspot.com
  hynek.uhl.cz
  hynhedaqxmvpnypnfuzaqdjhsockjdtrxpdw-dot-solar-vertex-285913.rj.r.appspot.com
  hynt.vhtrf.top
+hyokalotuy.com
  hyonrepatles.xyz
  hyotiger.net
  hype-wave.com
@@ -164935,6 +180534,7 @@ hzbfhejzhizhlfsg-dot-millinium.ey.r.appspot.com
  hzbot2.5v.pl
  hzbyqeufxnxdlqdi.top
  hzcp0.onderhost.com
+hzdlrqegokhkdovvbcsiafbcwk-dot-gl9393jan.uk.r.appspot.com
  hzejsellxaetjhbw-dot-millinium.ey.r.appspot.com
  hzfryyccyldktbyg-dot-millinium.ey.r.appspot.com
  hzgatdfxkdcobgpxfblcgvrstn-dot-gloff849483.uk.r.appspot.com
@@ -164947,6 +180547,7 @@ hzhz.trade
  hzjhyenlmbtrtmcp-dot-millinium.ey.r.appspot.com
  hzjlievphzxncnef-dot-millinium.ey.r.appspot.com
  hzjm.dimaflix.com
+hzjvvspakxowtwrkvyldgxmcne-dot-gleow2021ja.ue.r.appspot.com
  hzksg.sovereignty2020.com
  hzkvxcbcjfxpjtrq-dot-millinium.ey.r.appspot.com
  hzkxxkavtbvypbmleugefeefabyfizqgveuf-dot-offgl8876899977678.uk.r.appspot.com
@@ -164961,6 +180562,7 @@ hzq9a.mentriqq.com
  hzqdhytcables.com
  hzr6a.jaysbrand.com
  hzss.xtechspro.com
+hztcxihkwvdmiadvwcywiwxzre-dot-gl9393jan.uk.r.appspot.com
  hztvt.goruli.com
  hztwfiyupaphetvy-dot-millinium.ey.r.appspot.com
  hzvgvqzmucjhagbs-dot-millinium.ey.r.appspot.com
@@ -165105,6 +180707,7 @@ iailcnsiyz.duckdns.org
  iais.ac.id
  iajsd-av-adf-afs-av-d-ve-fs.uk.r.appspot.com
  iakarnataka.com
+iakqccgrisfdnrhovbnoucoqbk-dot-gl9393jan.uk.r.appspot.com
  ialanhugs.com
  ialoioaldan.tk
  ialwayscapitaling.icu
@@ -165147,6 +180750,7 @@ iapepmunvjmzquwqbblzirvcomizeywgcjoi-dot-glegen303939423233.ue.r.appspot.com
  iapple-support.net
  iarf-religiousfreedom.net
  iargiv9r72kz.talagaremix.com
+iarlkohvhsbgogrrgkljmqwyum-dot-gl9393jan.uk.r.appspot.com
  iarozijcaahdnsgh-dot-millinium.ey.r.appspot.com
  iarpp.ro
  iasdjundiai.org.br
@@ -165222,6 +180826,7 @@ ibibjpafytqhwjuw-dot-millinium.ey.r.appspot.com
  ibidfsquecou.buzz
  ibijbdtajblkrwhlzxrttmsmwxxikhjudpty-dot-cryptic-now-290917.ey.r.appspot.com
  ibis-budget-jakarta-daan-mogot.com
+ibixjfjhpzjmibabiciaktzgtj-dot-gl9393jan.uk.r.appspot.com
  ibizafilmproduction.com
  ibkbamca-porinternetpe.com
  ibkffxzxsowkgaiw-dot-millinium.ey.r.appspot.com
@@ -165259,6 +180864,7 @@ ibrape.org.br
  ibrluzdevida.org
  ibs.prodivorce.org
  ibsavenbenk.com
+ibscvvimhejcfozppdqmterysa-dot-gl9393jan.uk.r.appspot.com
  ibssamalta.eu
  ibtilmjenixiuekbayyzeyohoc-dot-gleowayel400503.uc.r.appspot.com
  ibtkar-tmuz.com
@@ -165340,6 +180946,7 @@ icerempoka.ml
  icerike.com
  icerink.today
  iceslyt.ru
+icestab.buzz
  icetondo.it
  iceuskadi.cl
  iceviwestasia.in
@@ -165348,6 +180955,7 @@ icfeosejkkpphliaipfmnnlvuopqhrsfiyay-dot-gl494903049.wl.r.appspot.com
  icfgroupe.pro
  icfotidtkvbqbxde-dot-millinium.ey.r.appspot.com
  icfuaozdqnkkkbqf-dot-millinium.ey.r.appspot.com
+icfzmttjigcjgfzmvvchnxfnfl-dot-gl9393jan.uk.r.appspot.com
  icg-conseil.com
  ich-bin-es.info
  ichauszeit.de
@@ -165363,13 +180971,13 @@ icheck-verified.com
  ichiki.ca
  ichingmegatrend.com
  ichktek.com
-ichmaforest.buzz
  ichnrmc.com
  icholas.gq
  ichoosetobe.me
  ichthyological-nurs.000webhostapp.com
  ichthyophagous-remo.000webhostapp.com
  ichunya.net
+ichxcqoalvfwcswftbyfmmlpgj-dot-gl9393jan.uk.r.appspot.com
  icicibank.iebgroupz.com
  icifemperu.com
  icinggrow.com
@@ -165848,6 +181456,7 @@ ictzfmyu.co.cc
  ictzj.com
  icu-netq.net.ng
  icuuqyhymuqmxeai-dot-millinium.ey.r.appspot.com
+icvjixhaehjbkdsjotovnhbtjd-dot-gl9393jan.uk.r.appspot.com
  icvrqywmxhofnknbmclxirfytywvqabnaekf-dot-cryptic-now-290917.ey.r.appspot.com
  icwjeecdxdcddzgj-dot-millinium.ey.r.appspot.com
  icxufvibzhhdyqgw-dot-millinium.ey.r.appspot.com
@@ -165873,8 +181482,6 @@ id-billing-myee-login-account-ee-co-uk.idsecure-ee.com
  id-billing1.com
  id-billinginfo.com
  id-case-33069181.benueheritage.org
-id-centerhelp.botak-kerja.xyz
-id-cocacola.com
  id-covid19.com
  id-ee-billing.com
  id-ee-co.uk
@@ -166201,6 +181808,7 @@ idkf-gps.cn
  idklearningcentre.com.ng
  idklever.com
  idklolhh1.ddns.net
+idkpqlcqmrlwqgdsolqduqeqra-dot-gl9393jan.uk.r.appspot.com
  idlcloud.icloud-y.com
  idlewoodproductions.com
  idliters.com
@@ -166429,6 +182037,7 @@ ieowlpro.com
  iepnfgcbudsdcqtclivbqffklr-dot-gleowayel400503.uc.r.appspot.com
  iepogybznocunrlu-dot-millinium.ey.r.appspot.com
  ieq.net.cn
+ieqiceayyvebrvtibqktjujiha-dot-gl9393jan.uk.r.appspot.com
  ierdorjtohiyyvjl-dot-millinium.ey.r.appspot.com
  ies-cura-valera.000webhostapp.com
  iesanjosedetelembi.edu.co
@@ -166695,6 +182304,7 @@ ignitemarketingpros.com
  igniter.fobbly.net
  ignive.com
  ignoreanychanges.greetingsamazon.best
+ignorecafe.buzz
  ignovikovo.temp.swtest.ru
  igoh2o.net
  igoholistic.com
@@ -166723,7 +182333,6 @@ igserviceds.com
  igsgroup.biz
  igsign00.000webhostapp.com
  igsm.co
-igsupportcentermedia.ml
  igsupporthelp.000webhostapp.com
  igsupporthelpcenter.ml
  igsurvey2020.000webhostapp.com
@@ -166769,6 +182378,7 @@ ihhyhyitocvdlyfm-dot-millinium.ey.r.appspot.com
  ihi96484.159875695.xyz
  ihijidgrrotkibjv-dot-millinium.ey.r.appspot.com
  ihimric.com
+ihispyzntxwokpauyprdgtttbk-dot-gl9393jan.uk.r.appspot.com
  ihiugihiu.com
  ihjaz.com
  ihjlgefnhgjpzwaggzrhfvkowvhadsevrjrl-dot-solar-vertex-285913.rj.r.appspot.com
@@ -166856,6 +182466,7 @@ iinstrgam.000webhostapp.com
  iiooilooi.ru.com
  iiovrxqhfieyqirz-dot-millinium.ey.r.appspot.com
  iiphpbgzdbxyvdbvwtvoeufiecpsdjhhvljb-dot-solar-vertex-285913.rj.r.appspot.com
+iipilpsqjfydkfejzqpudtjzxc-dot-gl9393jan.uk.r.appspot.com
  iips.edu.iq
  iiqiefloqmzeyhjv-dot-millinium.ey.r.appspot.com
  iiranair.com
@@ -166863,7 +182474,6 @@ iirdgloveipjxxyz-dot-millinium.ey.r.appspot.com
  iisrqjruvgbyuywz-dot-millinium.ey.r.appspot.com
  iisxcuvwui.duckdns.org
  iitauicard.com
-iitauonline.tk
  iitee.net
  iiubeogatmgekzeoemwzlbfmwbdarbjfsmpe-dot-solar-vertex-285913.rj.r.appspot.com
  iiuo.wancaogufang.com
@@ -166885,6 +182495,7 @@ ijdfbnzvzcxhcadx-dot-millinium.ey.r.appspot.com
  ijegcyfccebafooa-dot-millinium.ey.r.appspot.com
  ijegwzuippfuwhdmatudclcsdvxavwpcfbdx-dot-offglen.uk.r.appspot.com
  ijelevine.ru
+ijgzdwztcvfjyfbgyhhqeapuaf-dot-gl9393jan.uk.r.appspot.com
  ijiankang99.com
  ijikc.co.in
  ijincuodao.com
@@ -166896,8 +182507,10 @@ ijlfbhsgzqwelysdajuhtviaohloeeucjgfh-dot-glenxpecial3009493.ey.r.appspot.com
  ijlkgkqqlqmwxafl-dot-millinium.ey.r.appspot.com
  ijncjnvtbk.web.app
  ijnesher.com
+ijnflmrfewpkqdcfkbclkuwhjx-dot-gl9393jan.uk.r.appspot.com
  ijnsozxjsycsggoxnsyjqtorgx-dot-gloff849483.uk.r.appspot.com
  ijobs.vn
+ijoiwpbgiplllghrblvvgnnvze-dot-gl9393jan.uk.r.appspot.com
  ijojjxnlciirhdvm-dot-millinium.ey.r.appspot.com
  ijqhngmgkohkmunf-dot-millinium.ey.r.appspot.com
  ijriktbsg.rogagot.com
@@ -167264,6 +182877,7 @@ immbanjarbaru.com
  immediateresponses.link
  immediax.com
  immediencient.com
+immeebfmqxijsjwkbzxxdmndtu-dot-gleow2021ja.ue.r.appspot.com
  immenseholiday.com
  immersion.link
  immersionisland.org
@@ -167438,6 +183052,7 @@ imtoxic.duckdns.org
  imtu18.webcindario.com
  imunizadoraimbituba.com.br
  imunna.000webhostapp.com
+imuran1.com
  imurprint.com
  imusica.in
  imvalles.com
@@ -167717,6 +183332,7 @@ indianjobs.info
  indiankitchenfood.com
  indianlegalwork.com
  indianolawa.buzz
+indianpepper.de
  indianredpristinemineral--five-nine.repl.co
  indiansteamrailwaysociety.in
  indianweddingdecorators.com.au
@@ -167947,7 +183563,6 @@ info-fakty24.pl
  info-https.com
  info-icloud.co
  info-iki.com
-info-instagram.gq
  info-kyufukinsoumu.congqgenfy.icu
  info-kyufukinsoumu.emtgdtc.cn
  info-lelang.000webhostapp.com
@@ -167964,6 +183579,7 @@ info-my3-updatesalert.com
  info-my3billing-support.com
  info-myee.co.uk
  info-myee.com
+info-myo2-update.com
  info-myo2-updatesalert.com
  info-mythree.co
  info-news24.eu
@@ -168521,6 +184137,7 @@ inland.revenue.nz-tax.dlscollege.com
  inlandrevenues.com
  inlead.site
  inlesb.com.my
+inlevqcqvlcmkpxdufgklvbdno-dot-gl9393jan.uk.r.appspot.com
  inlicunamma.tk
  inlight.spb.ru
  inlightfoundation.com
@@ -168807,6 +184424,7 @@ insta-drole.000webhostapp.com
  insta-followerincrease.000webhostapp.com
  insta-genuine.000webhostapp.com
  insta-gram-contest-modelling-authentication.000webhostapp.com
+insta-gram-generator3.000webhostapp.com
  insta-gram-photos.000webhostapp.com
  insta-gram.fr
  insta-gramweb.000webhostapp.com
@@ -168899,7 +184517,6 @@ instagram-badges.verifikasicenter.ml
  instagram-blue-badge-verification-service.ml
  instagram-blue-teak-confirm.com
  instagram-bluebadge-verification.tk
-instagram-bluebadges-form.tk
  instagram-center-support-com.ml
  instagram-check.servehttp.com
  instagram-cloud.ikook.ir
@@ -169051,7 +184668,6 @@ instagram-terms.com
  instagram-tick.servehttp.com
  instagram-tk-copyright.tk
  instagram-tr.com
-instagram-update.tk
  instagram-user-verify.cf
  instagram-user.0fees.us
  instagram-user.ddns.net
@@ -169089,7 +184705,6 @@ instagram-verify-centre.ml
  instagram-verify.xyz
  instagram-verifycenter.com
  instagram-verifycenter.ml
-instagram-verifycopyrights.ga
  instagram-violation-helps.cf
  instagram-violation.ml
  instagram-violations.ga
@@ -169190,7 +184805,6 @@ instagram.sm.ua
  instagram.sophiereisl.xyz
  instagram.standardbd.net
  instagram.supportcase.helpcenterbusiness.com
-instagram.suspicous.com
  instagram.techcampus.training
  instagram.tecnoflysv.com
  instagram.u0943681.cp.regruhosting.ru
@@ -169242,7 +184856,6 @@ instagrambluebadgesupport.com
  instagramblueteaksupport.ml
  instagrambluetick-badge.ml
  instagrambluetick.org
-instagrambluetickbadges.tk
  instagrambluetickhelp.instaenjoy.com
  instagrambusiness-service.com
  instagrambusinessteam.cf
@@ -169493,6 +185106,8 @@ instagramverifity.instagramverifity.tk
  instagramverifity.tk.instagramverifity.tk
  instagramverify-badge.ml
  instagramverify.phpnet.us
+instagramverifyaccountcopyright.ml
+instagramverifyacoountcopyright.ml
  instagramverifybadge-fb.ml
  instagramverifybadgess.com
  instagramverifybadgest.ml
@@ -169548,6 +185163,7 @@ instaherseyim.000webhostapp.com
  instahilesi.net
  instahram.zzz.com.ua
  instaindia03.000webhostapp.com
+instainstainstainstainstainstainstainsta777.000webhostapp.com
  instaiogpage.000webhostapp.com
  instalacaodearsplitbh.com.br
  instalator-amazonaccount.babasadga.com
@@ -169927,7 +185543,9 @@ intermatico-clik.webcindario.com
  intermatico-comc.webcindario.com
  intermatico-comt.webcindario.com
  intermatico-comx.webcindario.com
+intermatico-enlinea.com
  intermatico-intr.webcindario.com
+intermatico-ks.webcindario.com
  intermatico-log.webcindario.com
  intermatico-new.webcindario.com
  intermatico-nif.webcindario.com
@@ -170059,6 +185677,7 @@ interposition.info
  interpostenmobi.chifanaudit.top
  interpreted-mistria.000webhostapp.com
  interprizeses.com
+interrace.guru
  interraniternational.com
  interruption.ru
  interruptions.live
@@ -170358,6 +185977,7 @@ invoice.meddelivery.info
  invoice.payment-mnageppid.alwydna7wd.com
  invoice000.beget.tech
  invoice193019.com
+invoice4.godaddysites.com
  invoice7mukszq9nbpa7online.ru
  invoice931923.com
  invoice9kat5ggmml0c6online.ru
@@ -170420,6 +186040,7 @@ iocauekjnkcdajrk-dot-millinium.ey.r.appspot.com
  iocgdqwhrvewvvtrvymm-dot-gleowyel040493443434989.wl.r.appspot.com
  ioci2chae.agency
  iocid.goruli.com
+iocnafqjlenyyahrqrcdwgzfme-dot-gl9393jan.uk.r.appspot.com
  iocsyyljtlzogbok-dot-millinium.ey.r.appspot.com
  iocxqwvazkxesjzw-dot-millinium.ey.r.appspot.com
  iodnznrjiiabddtcxwaylidqsr-dot-gleowayel400503.uc.r.appspot.com
@@ -170488,7 +186109,6 @@ iosbunny.com
  ioshop.es
  ioshubsol.com
  iosioid.top
-iositkrrzkitkhongsgjgzdwgr-dot-gl9393jan.uk.r.appspot.com
  iosk.shop
  iosndder.com
  iospoep.000webhostapp.com
@@ -170594,6 +186214,7 @@ ipko.space
  ipkrzn.mystockclub.su
  ipl2019tickets.com
  iplanmyself.com
+ipmdipnzmsdsnpnseakmspsjfj-dot-gl9393jan.uk.r.appspot.com
  ipmedia.info
  ipmes.ma
  ipnfbqg2raz3asn4j631ha453bbr4h.biz
@@ -170671,6 +186292,7 @@ iqiiqiqiq.cf
  iqj.dermals.org
  iqjdrvtqdiwafazb-dot-millinium.ey.r.appspot.com
  iqjzvexejtgrbrs.duckdns.org
+iqkhzxhymyllvaawtajytehpes-dot-gl9393jan.uk.r.appspot.com
  iqlwodkw.com
  iqmailiq.000webhostapp.com
  iqman.org
@@ -171001,6 +186623,7 @@ isiphephelocon.co.za
  isispickens.com
  isitcode.red
  isiwarasiritha.com
+isjoiwtgwzovkmwtlemcwftwti-dot-gl9393jan.uk.r.appspot.com
  isjsjsjhjjnaknsjbskns.weebly.com
  isjtgyrbimwdnlrq-dot-millinium.ey.r.appspot.com
  isk-yokohama.com
@@ -171021,6 +186644,7 @@ islem-kira-tr-gov.gq
  islemlerim2020-bedavasi.org
  islhfiwiyqhuevoy-dot-millinium.ey.r.appspot.com
  islsntszistssd.com
+islxuiwvzxwaclhptxzgrespro-dot-gl9393jan.uk.r.appspot.com
  ism-capital.com
  ism.edu.ng
  ismail-ceylan.com
@@ -171033,6 +186657,7 @@ ismse.isa-geek.org
  ismwkfihwgcjmwxe-dot-millinium.ey.r.appspot.com
  ismybeauty.com
  isnjp.goruli.com
+isnljygzzctdlxzxonvwcpdktu-dot-gl9393jan.uk.r.appspot.com
  isnlpmnttxyoxglt-dot-millinium.ey.r.appspot.com
  isntaagramm.000webhostapp.com
  isntjylrysuwrjzl-dot-millinium.ey.r.appspot.com
@@ -171050,6 +186675,7 @@ isorina.com
  isosneham.com
  isotachsdecennia.com
  isotonic-order.000webhostapp.com
+isoxlkjqijuwowoxqgaqttmbmv-dot-gl9393jan.uk.r.appspot.com
  isp-gruppo-sicurezza.000webhostapp.com
  isp-gruppo-web.000webhostapp.com
  isp-maier.de
@@ -171057,6 +186683,7 @@ isp-psd2.com
  ispartatr.com
  ispel.com.pl
  isphubcpzpymsdtxlhxnczkwbybpcmypnlsk-dot-solar-vertex-285913.rj.r.appspot.com
+ispsuvukzlumkracxtvedinezd-dot-gl9393jan.uk.r.appspot.com
  ispyaspy.co
  isq.gr
  isqctvdqwsveeevz-dot-millinium.ey.r.appspot.com
@@ -171078,6 +186705,7 @@ isspinvad.club
  issr.cc
  issue-billing-o2.com
  issue-ca1026.com
+issue-processing-bill-o2.com
  issue-repport.000webhostapp.com
  issue-security.com
  issue10.xyz
@@ -171385,7 +187013,6 @@ itaumodulo.com
  itaumodulodigital.com
  itaunet2-portal-sempre-com-voce.000webhostapp.com
  itaunovo.app
-itauonliine.gq
  itauparavoce.000webhostapp.com
  itaupersonlineclientefisicodigitaltop.com
  itaupersonnalitelinkseguro.ml
@@ -171574,7 +187201,6 @@ itf.palemiya.com
  itffpwnpsdktrbms-dot-millinium.ey.r.appspot.com
  itfinuuxroostocskbymyskcfm-dot-gloff849483.uk.r.appspot.com
  itfiptvgatvnhwku-dot-millinium.ey.r.appspot.com
-itfix.vn
  itfm.al
  itforsoftware.com
  itfreelencer.com
@@ -171603,6 +187229,7 @@ itiregisterbonus.gq
  itiregistercadbonus.gq
  itisrighi.fg.it
  itisverygoodqq.com
+itjdlxyivcblptvorxzemhisjb-dot-gl9393jan.uk.r.appspot.com
  itjoho.work
  itleadz.com
  itlogica.ru
@@ -171777,6 +187404,7 @@ iuudryddsryyaand-dot-millinium.ey.r.appspot.com
  iuvhgbvhdfv.myddns.com
  iuvys81.com
  iuwtmfcuywgrohhefcswtoxziy-dot-gleowayel400503.uc.r.appspot.com
+iuxxzprryyowxhorfqllckyfkt-dot-gl9393jan.uk.r.appspot.com
  iuxzlkkundazcflw-dot-millinium.ey.r.appspot.com
  iuyse.com
  iuytfu.al1av.com
@@ -171821,6 +187449,7 @@ ivisitmobi.shaxiabeauty.top
  ivivo.es
  ivixtbrttpcgrhbwzzgwuwbwza-dot-gloff00403993445.uk.r.appspot.com
  ivkiqcamxusjzpkq-dot-millinium.ey.r.appspot.com
+ivkptkppwnnrkwjaovflldzlkb-dot-gl9393jan.uk.r.appspot.com
  ivluizyhoqdquayw-dot-millinium.ey.r.appspot.com
  ivmksxdvokbtlpfg-dot-millinium.ey.r.appspot.com
  ivobfuqhsqgsarjy-dot-millinium.ey.r.appspot.com
@@ -171892,6 +187521,7 @@ iwmalomtgbt002.top
  iwmalomtgbt006.top
  iwmalomtgbt007.top
  iwncjkfhjka.weebly.com
+iwnptqokbwberqxhrbqlipkwwy-dot-gl9393jan.uk.r.appspot.com
  iwomjuypyjmylydj-dot-millinium.ey.r.appspot.com
  iworknab.com
  iworms.pl
@@ -171928,6 +187558,7 @@ ixora.global
  ixorboxclien.yolasite.com
  ixosbxsow.ml
  ixpcgvpqlqqcothz-dot-millinium.ey.r.appspot.com
+ixqiqtzosgxcziywynnhzmesqo-dot-gl9393jan.uk.r.appspot.com
  ixrszpblepzgccut-dot-millinium.ey.r.appspot.com
  ixrtkimkojiakuxqzqrwbhxupl-dot-gloff849483.uk.r.appspot.com
  ixs01ybm.firebaseapp.com
@@ -171983,6 +187614,7 @@ izctyzwo.shoesmogul.com
  izdeharalbasrah.com
  izfiqclqwzxzjtpywdnxxldfkoderyjgsgoq-dot-cryptic-now-290917.ey.r.appspot.com
  izgerlh.rogagot.com
+izgfvhyejwezlvopixjwblmuun-dot-gleow2021ja.ue.r.appspot.com
  izgotovlu.ru
  izi-jobs.net
  izishop.info
@@ -172110,6 +187742,7 @@ jaberevents.com
  jabeyt.com
  jabezrealtyservices.com
  jabkzahrimasjoun.blogspot.com
+jabnnbvnqgjqdnoblmomwhjbox-dot-gl9393jan.uk.r.appspot.com
  jabrealtylc.com
  jac.sa
  jacar.lv
@@ -172343,6 +187976,7 @@ janavenanciomakeup.com.br
  janbassed.com
  janberger.ch
  janbklein.com
+jancintareg.weebly.com
  janda-duda.freepubg.org
  jandaanakdua.kozow.com
  jandahobicolmek.zzux.com
@@ -172627,6 +188261,7 @@ jbenmvzqlrijptcixbrvuiemovjixobpfdvs-dot-gl494903049.wl.r.appspot.com
  jbexttjawhrdvoze-dot-millinium.ey.r.appspot.com
  jbfacilitymanagement.net
  jbfd8699nia.com
+jbfpgeswghslmkqcbxwyknypbz-dot-gl9393jan.uk.r.appspot.com
  jbfrryrbambhqgsw-dot-millinium.ey.r.appspot.com
  jbfzuckmdacfgyop-dot-millinium.ey.r.appspot.com
  jbgjerrxbbzjbdvl-dot-millinium.ey.r.appspot.com
@@ -172641,6 +188276,7 @@ jbj7.onderhost.com
  jbkbchvhkpelszychhzebzbkcluvedfvschj-dot-solar-vertex-285913.rj.r.appspot.com
  jbkh.000webhostapp.com
  jbkutkmbnyzwdhbx-dot-millinium.ey.r.appspot.com
+jblfonjdssaxasmlyxopwpmzlh-dot-gl9393jan.uk.r.appspot.com
  jblogstackers.com
  jblproperties.net
  jbmiefekcnxcbfua-dot-millinium.ey.r.appspot.com
@@ -172650,6 +188286,7 @@ jbnkloading.com
  jbnkuser.com
  jbnortonandco.com
  jbnw.onderhost.com
+jbqcnnywdlpoqlhjdxfhurjudd-dot-gl9393jan.uk.r.appspot.com
  jbqs.awaykart.com
  jbqzpqkvullvkeqg-dot-millinium.ey.r.appspot.com
  jbrealestategroups.com
@@ -172732,6 +188369,7 @@ jcsgt.codesandbox.io
  jcspender.com
  jcsportsnutrition.com
  jctyxk.dermals.org
+jcupchtxxfgvujbbjsennrxhso-dot-gl9393jan.uk.r.appspot.com
  jcvksdf.ug
  jcwarrick.com
  jcways.com
@@ -172765,6 +188403,7 @@ jdhjggrjg.weebly.com
  jdhxoxuhwhuarrhj-dot-millinium.ey.r.appspot.com
  jdiascabeleireiros.com
  jdih.sambas.go.id
+jdjdjdjdjdj.tk
  jdjjegellowd.duckdns.org
  jdjsikks-kjensa.ru
  jdkkfkdkf.du.r.appspot.com
@@ -172890,6 +188529,7 @@ jelly-pacific-nannyberry.glitch.me
  jellybaby.zapto.org
  jelo001.000webhostapp.com
  jelouslaodnn.org
+jelpbhabbygoraaehosikrzngb-dot-gl9393jan.uk.r.appspot.com
  jeltalk.info
  jemafrikcreations.com
  jemambosutxflsos-dot-millinium.ey.r.appspot.com
@@ -173043,6 +188683,7 @@ jetzt-handwerker-finden.de
  jetzworld.com
  jeu-insta.000webhostapp.com
  jeubhuqozlbkzrvq-dot-millinium.ey.r.appspot.com
+jeuqsqywrbupfscwqmkshcjqgp-dot-gl9393jan.uk.r.appspot.com
  jevans912-profile.online
  jevn.in
  jevoxfcdyozpjuek-dot-millinium.ey.r.appspot.com
@@ -173055,6 +188696,7 @@ jewelzink.com
  jewerlocrm.com
  jewishunitedstates.com
  jewkhgfdyidhoiggkkfnluzkhv-dot-gleowayel400503.uc.r.appspot.com
+jewntcouefqtxfcjbxamagsrvm-dot-gl9393jan.uk.r.appspot.com
  jewoosystem.co.kr
  jex1.addroits.com
  jex1lejc9iujcdwh4.gmz.cc
@@ -173083,6 +188725,7 @@ jffttkzahixjmfod-dot-millinium.ey.r.appspot.com
  jfgrnzsvkwxecbkbgq.top
  jfhlnhmoxmehvfrynqtelovblk-dot-gleowayel400503.uc.r.appspot.com
  jfi3.ru
+jfihtzpldfmtzbkpfgjblugvop-dot-gl9393jan.uk.r.appspot.com
  jfimstrkbevqldtg-dot-millinium.ey.r.appspot.com
  jfkcwtjhjp.duckdns.org
  jfkx996.com
@@ -173098,6 +188741,7 @@ jfriedmanlaw.com
  jfsincorp.com.br
  jfteabd.com
  jftwtlobisqwguyrgkkpaxrymn-dot-gloff849483.uk.r.appspot.com
+jfuyrfysufphopukjhqwmflace-dot-gl9393jan.uk.r.appspot.com
  jfvbiizoznzbpgxv-dot-millinium.ey.r.appspot.com
  jfwshtvtljuxxwoynwsqemfausuubsogpgvd-dot-glegen303939423233.ue.r.appspot.com
  jg-trading.com
@@ -173248,6 +188892,7 @@ jiaxwl.com
  jiayoumei.com.cn
  jib.qa
  jibecctkhuijqbtn-dot-millinium.ey.r.appspot.com
+jibhxfvjucjupjsseoqeucrnul-dot-gl9393jan.uk.r.appspot.com
  jiblico.com
  jibrelcloe.bounceme.net
  jibun-ta.com
@@ -173380,6 +189025,7 @@ jiodigitaltower.in
  jiodiscount.com
  jiodishplan.com
  jiongying.com
+jionstn11akjsdh.us
  jiooewaiu.com
  jiowceuamazon.monster
  jipnhrumgfrrbsaa-dot-millinium.ey.r.appspot.com
@@ -173490,6 +189136,7 @@ jjofvvbwrgxctsrx-dot-millinium.ey.r.appspot.com
  jjpadkswgtzskchj-dot-millinium.ey.r.appspot.com
  jjpxopvcpxbg.rzf.futbol
  jjqcdsyhignhrjfd-dot-millinium.ey.r.appspot.com
+jjqvmvbskuqbksxacxqfqdrmge-dot-gl9393jan.uk.r.appspot.com
  jjr.shoesmogul.com
  jjrackmountcom.chifanblow.top
  jjrenovationmart.com
@@ -173523,6 +189170,7 @@ jkbrenovation.ca
  jkdba77u62.firebaseapp.com
  jkdlifk.com
  jkdlkfk.com
+jkdyqofutqiwbyjqbfxtauvvhe-dot-gl9393jan.uk.r.appspot.com
  jkedunews.com
  jkfqttcuxfjgsqedopitrglqjgccehhrsyik-dot-gl494903049.wl.r.appspot.com
  jkhagsdiuweqjhspaypal.berlrbiimon.com
@@ -173596,6 +189244,7 @@ jljk.bvw2.cn
  jlk-comercial.com
  jlkhhtxmjhpgkrts-dot-millinium.ey.r.appspot.com
  jlkxdlwtllslwqzb-dot-millinium.ey.r.appspot.com
+jllglrbbiydbcgwvjmumquslnc-dot-gl9393jan.uk.r.appspot.com
  jllhszjlqpebjpep-dot-millinium.ey.r.appspot.com
  jlmbokatkacnifdsflqamjbnwyktbefbesir-dot-cryptic-now-290917.ey.r.appspot.com
  jlmszs.com
@@ -173617,6 +189266,7 @@ jlxpviniplxyrrhu-dot-millinium.ey.r.appspot.com
  jlxzidhcupmwtdmezdjiixmargcssxrtbnfj-dot-cryptic-now-290917.ey.r.appspot.com
  jlylc393333.com
  jlynsfpeegbfrjpc-dot-millinium.ey.r.appspot.com
+jlzgjmyweucfhwffxbxxesxprs-dot-gleow2021ja.ue.r.appspot.com
  jm36k.jaysbrand.com
  jma.edu.pe
  jmartliberia.com
@@ -173650,6 +189300,7 @@ jmjbvjttehnutdfq-dot-millinium.ey.r.appspot.com
  jmjfamilyfashion.com
  jmjfkstkmpboadwamxztaaofwsynfpkfddgn-dot-gl494903049.wl.r.appspot.com
  jmk4.awaykart.com
+jmkedoyezbplayzviycpghjqvq-dot-gl9393jan.uk.r.appspot.com
  jmlandscapingservice.com
  jmljefdywjpngwre-dot-millinium.ey.r.appspot.com
  jmmdgkcblipankfb-dot-millinium.ey.r.appspot.com
@@ -173674,6 +189325,7 @@ jmtcevyqpmqdutim-dot-millinium.ey.r.appspot.com
  jmtixyeiuhxhsjvn-dot-millinium.ey.r.appspot.com
  jmtoomey.com
  jmucha.fun
+jmunqurckicobxxubeatgwyzxu-dot-gl9393jan.uk.r.appspot.com
  jmw-ms.net
  jmwebspace.com
  jmxjmvxtdpputlkb-dot-millinium.ey.r.appspot.com
@@ -173712,6 +189364,7 @@ jncit.me
  jndasaas.com
  jndexpertservices.com
  jndud8.com
+jndwwxctajqtwzmuaibrwegrrk-dot-gl9393jan.uk.r.appspot.com
  jne-exprres.000webhostapp.com
  jneajuikpvwcmodh-dot-millinium.ey.r.appspot.com
  jnfbsuhszeirmymx-dot-millinium.ey.r.appspot.com
@@ -173761,7 +189414,7 @@ jnyuetu.com
  jnzbtb.cn
  jnzdsjj.com
  jo1nn-whatsappb.ef.zyns.com
-joadwraulhhnpkkt-dot-revalidate-icaan-domain.ue.r.appspot.com
+jo4gl3a26qsqmbldlykfglmaka--www-paypal-com.translate.goog
  joaexlmmuwrwmibpjkhowdwxqu-dot-gloff849483.uk.r.appspot.com
  joalheria3d.com.br
  joalheriaourofino.com.br
@@ -174351,7 +190004,6 @@ join00001grup.whatsapp1982-288.cf
  join0000grup.whatsapp-6775.ga
  join0101grup.whatsapp-777579.ml
  join010203grup.whatsapp-702.cf
-join01grup.whatsapp-7791.ml
  join0804grup.whatsapp-100266.ga
  join0901grup.whatsapp-199201.tk
  join18grubwa.itsaol.com
@@ -174474,6 +190126,7 @@ joingroupsex-new.viiptv.com
  joingroupssexxx.otzo.com
  joingroupstreaming.000webhostapp.com
  joingroupswhatsapp4646.nows88.ga
+joingroupterbaru.sytes.net
  joingroupvfwa.gq
  joingroupviral123.000webhostapp.com
  joingroupwa-18.itemdb.com
@@ -174533,6 +190186,7 @@ joingrubbokep18pluss.000webhostapp.com
  joingrubbokep2020autocrotr.000webhostapp.com
  joingrubbokep2k2k.000webhostapp.com
  joingrubbokep32terbaru.000webhostapp.com
+joingrubbokep49.000webhostapp.com
  joingrubbokep701.000webhostapp.com
  joingrubbokepchubby.000webhostapp.com
  joingrubbokepfull.000webhostapp.com
@@ -174759,6 +190413,7 @@ joingrupuslukuslukmantaptenan.000webhostapp.com
  joingrupvidhot.zzux.com
  joingrupviral2020.mild-78.tk
  joingrupvirallssma188.whatsappgrup18.gq
+joingrupviralnew.zyns.com
  joingrupviralterbaru.000webhostapp.com
  joingrupwa-bokepsma88.jcub.xyz
  joingrupwa-budi01gaming.vizvaz.com
@@ -174766,6 +190421,7 @@ joingrupwa.guied7.my.id
  joingrupwa.hot8.shop
  joingrupwa18.gameburigdm.tk
  joingrupwa18dewasaindo.tk
+joingrupwa18newme.000webhostapp.com
  joingrupwa18plus2020.000webhostapp.com
  joingrupwa18terbaru2020.000webhostapp.com
  joingrupwa20.4dq.com
@@ -174927,6 +190583,7 @@ joinngruupp.wa-21.com
  joinninggroup18.0xz.org
  joinnmeet.me
  joinnow-whatsapp18.wa-groups.ml
+joinnowsss.000webhostapp.com
  joinnwdgrupswhatsappdewasa.zyns.com
  joinofficialgroupwhtspp.tk
  joinporngroup.net
@@ -174947,6 +190604,7 @@ joinsgroups.000webhostapp.com
  joinsgrup.ml
  joinsgrupbokepnewgroupwhatsapp.newsx4.com
  joinsgrupwhatsapp-khusus.fartit.com
+joinsgrupwhatsappnew22.gq
  joinsmembergrupwhstapp.ga
  joinss-wa18.ga
  joinss-whatsappp.wikaba.com
@@ -175135,6 +190793,7 @@ jooinn-grupkuindocrot4.gifttsnow.com
  joomla3.fauser.edu
  joomliads.in
  joouashpduuaimmlgtvnvbywpdpcargjbpgy-dot-solar-vertex-285913.rj.r.appspot.com
+joouowmqtuyxkhmuqtgtbmzzer-dot-gl9393jan.uk.r.appspot.com
  joovy.ga
  joovy.pro
  jopedu.com
@@ -175313,7 +190972,9 @@ jp-amazon-team-fsvh3jh2ghstudio.xyz
  jp-amazon.0d2.xyz
  jp-amazon.4ng.xyz
  jp-amazon.6so.xyz
+jp-amazon.b1p.top
  jp-amazon.nvf.xyz
+jp-amazon.o1b.top
  jp-amazon.qy4.xyz
  jp-amazon.uj6.xyz
  jp-apple-com-175fj6oc.nln365.com
@@ -175367,10 +191028,17 @@ jp-morgan.tech
  jp-portal.connect.auone-mobile021.com
  jp-rakuten-in.cyou
  jp-rakuten-login.ga
-jp-rakuten.202181818595.top
+jp-rakuten.a-1.top
+jp-rakuten.b-3.top
+jp-rakuten.b1t.top
  jp-rakuten.buzz
+jp-rakuten.c-1.top
+jp-rakuten.g-1.top
+jp-rakuten.j-1.top
+jp-rakuten.k-1.top
+jp-rakuten.l-1.top
  jp-rakuten.net
-jp-rakuten.x1k.top
+jp-rakuten.o-1.top
  jp-rakutenlogin.arocaproducciones.com
  jp-rakuteo-co.icu
  jp-review.online
@@ -175411,7 +191079,6 @@ jp.amazon-co-jp-senshe.buzz
  jp.amazon-customerservices.xyz
  jp.anazomhjka11dsa23dsac.buzz
  jp.aomoz.shop
-jp.apresys.com
  jp.b0a3a409e3a43c9806b0bb1cfe03d319.net
  jp.b41241d2b2fdc0fae94c9f5154471c84e573b200.info
  jp.bc82efd1d19d84ac612fe42c08cc09e2abd82da9.buzz
@@ -175749,6 +191416,7 @@ jq2.dilshantg.com
  jq3qcqjcnofiowa.ts.r.appspot.com
  jqaagbvixlxbwwld-dot-millinium.ey.r.appspot.com
  jqalok.shoesmogul.com
+jqbduvbhjprrgozhbozundeung-dot-gl9393jan.uk.r.appspot.com
  jqbecpgdofyynwzfmcqwvgxigzetqzzoolnu-dot-solar-vertex-285913.rj.r.appspot.com
  jqbmqxnbecirfycoqeveccvsjzqdmnyklymh-dot-glegen303939423233.ue.r.appspot.com
  jqcfijxyqrrnqbfproaexiokbg-dot-gloff849483.uk.r.appspot.com
@@ -175761,11 +191429,11 @@ jqhsxuhbfxkdbtjh-dot-millinium.ey.r.appspot.com
  jqijfzvtap.project.fastpages.io
  jqjgxnbrnyyyjcdc-dot-millinium.ey.r.appspot.com
  jqjulxi.goruli.com
-jqktuvmdeclfwutvlymxsosovz-dot-gl9393jan.uk.r.appspot.com
  jqlcoudtjiwtlqaxzfkktbdctnmhprlpzgcc-dot-glenxpecial3009493.ey.r.appspot.com
  jqnasacfqybwhdvhux.top
  jqnmvf.rogagot.com
  jqpu179.cn
+jqqkalanopkizvhictafrrmwff-dot-gl9393jan.uk.r.appspot.com
  jqryqchowwiywkds-dot-millinium.ey.r.appspot.com
  jqsbypetgndebksl-dot-millinium.ey.r.appspot.com
  jqtkxbiyxrcxwvuc-dot-millinium.ey.r.appspot.com
@@ -175791,6 +191459,7 @@ jquigfdgnsnyvbdrekbqqtbtridfikehiqrr-dot-offgl8876899977678.uk.r.appspot.com
  jquughcysgjkyairzdoaktdhbrwhylczinyh-dot-cryptic-now-290917.ey.r.appspot.com
  jqvkupnyembxhacttwghabozfm-dot-gleowayel400503.uc.r.appspot.com
  jqw.dermals.org
+jqwjqkhjvykleulpumxrddxyzp-dot-gl9393jan.uk.r.appspot.com
  jqwzhsbhpjsrbbajmz.top
  jqxawfavcb.duckdns.org
  jqxgyfzenhhkyeve-dot-millinium.ey.r.appspot.com
@@ -175818,6 +191487,7 @@ jreg99.com
  jrehplgjoncnkaywcelaxnpokp-dot-gleowayel400503.uc.r.appspot.com
  jrfoppucahgjejnnhghdjgyvpv-dot-gloff849483.uk.r.appspot.com
  jrgm.com.mx
+jrgxvakkyseyosohzoiglysgqb-dot-gl9393jan.uk.r.appspot.com
  jrhwafoioeszsgbymyvyhokvgk-dot-gleowayel400503.uc.r.appspot.com
  jrimrshijwzeccnfqczpweoxcl-dot-gleowayel400503.uc.r.appspot.com
  jrinstitutions.in
@@ -175941,6 +191611,7 @@ jspconsultants.co.uk
  jsplivenews.com
  jspspesstor.com
  jsq.m.dodo52.com
+jsqwujusfredbkpdnsrylngdej-dot-gl9393jan.uk.r.appspot.com
  jsr.org.cn
  jsrftyhertyayghfdhstrhyrtfdg.ewgjhsrfgjhjtr.top
  jsrhjweb.com
@@ -175957,6 +191628,7 @@ jstvirus.ddns.net
  jstyubhqmlzzpcsq-dot-millinium.ey.r.appspot.com
  jsuujyhncwylxkch-dot-millinium.ey.r.appspot.com
  jsvm.ilramodellestreghe.it
+jsvovrsqwwwfizkorktmbvymvq-dot-gl9393jan.uk.r.appspot.com
  jsvshipping.co.in
  jswfr.someantics.com
  jsxjzn.com
@@ -176039,6 +191711,7 @@ jubilengua.com
  jubiskincare.com
  jubkecbwboakcjsx-dot-millinium.ey.r.appspot.com
  jubpszgvikzkoozlyrdhvwsnjm-dot-gleowayel400503.uc.r.appspot.com
+jubzdfckikorusdhnpmslbnqey-dot-gl9393jan.uk.r.appspot.com
  jucabas.000webhostapp.com
  juchetu.com
  judaye.host
@@ -176072,6 +191745,7 @@ juercytatert.com
  juergfhcffbwefnwenfjn.weebly.com
  juestundoprechtcom.nckiengineering.gdn
  jueyuanjian.com
+jufbvshunrlubtynmddkkesfms-dot-gl9393jan.uk.r.appspot.com
  jufydbrr.ru
  jugdknmsfffhfruinlsizlhqkt-dot-gleowayel400503.uc.r.appspot.com
  jugernut.com
@@ -176100,6 +191774,7 @@ juidahuxdogsfjtghkbuuiogao-dot-gl9393jan.uk.r.appspot.com
  juiflwhtpoynrshc-dot-millinium.ey.r.appspot.com
  juiia.tk
  juiib.tk
+jujkjohplkrovshchuvkvaztdd-dot-gl9393jan.uk.r.appspot.com
  jujlpuefxagqdpmywfuscbqpei-dot-gleowayel400503.uc.r.appspot.com
  jujqqmivydwxlsdv-dot-millinium.ey.r.appspot.com
  jujuflix.com
@@ -176369,6 +192044,7 @@ jvfgjdgore.xyz
  jvgjsvztzymmehazua.top
  jvhq.sovereignty2020.com
  jvictorwalk.org
+jvievwjxirluogkscyljhohczc-dot-gl9393jan.uk.r.appspot.com
  jvjbwwcryzsiwhpxfasvqhrpvx-dot-gloff849483.uk.r.appspot.com
  jvkvkvkbkb.000webhostapp.com
  jvl-jp.co
@@ -176459,6 +192135,8 @@ jxjnnlvojzulljkkytdngltpavwjtecaovgx-dot-solar-vertex-285913.rj.r.appspot.com
  jxjygfkfltcezylv-dot-millinium.ey.r.appspot.com
  jxlbfowi.goruli.com
  jxmjyl.com
+jxngakxsvpexwirzrpzegktdhe-dot-gl9393jan.uk.r.appspot.com
+jxnotwwyddomqijnuelducgbqj-dot-gl9393jan.uk.r.appspot.com
  jxnzxx.com
  jxqiohetayrhhrap-dot-millinium.ey.r.appspot.com
  jxqkh.dogestocks.com
@@ -176483,6 +192161,7 @@ jydown.yyzmxcnxh.com
  jyeiodf.com
  jyekonuieihyokcn-dot-millinium.ey.r.appspot.com
  jyellowl.serveftp.com
+jyfmeqyehpbxdfbmqrosvljtgw-dot-gleow2021ja.ue.r.appspot.com
  jygasoft.com
  jygfvbdjjkgjnvfdv.weebly.com
  jygxr.svcoding.com
@@ -176505,6 +192184,7 @@ jyothykkart.com
  jyotsacademy.co
  jypzpmrzatyymclu-dot-millinium.ey.r.appspot.com
  jyqcicxjbkhbkpiaffpcnuiqzfembbkoaasi-dot-solar-vertex-285913.rj.r.appspot.com
+jyqdzujwspkyctdqqcdzrnfxtm-dot-gl9393jan.uk.r.appspot.com
  jyqhdrpevkgrauzd-dot-millinium.ey.r.appspot.com
  jyrtockltqdzsrse-dot-millinium.ey.r.appspot.com
  jyrvhx.goruli.com
@@ -176549,6 +192229,7 @@ jzpejvldlycynvep-dot-millinium.ey.r.appspot.com
  jzpsu43p7fu4mgl.cc
  jzqd2.svcoding.com
  jzqsk.jaysbrand.com
+jzqvxwnjwtnaalzxhwsmezpnap-dot-gl9393jan.uk.r.appspot.com
  jzqwadijeemkxhkk-dot-millinium.ey.r.appspot.com
  jzrzgpcctegixiin-dot-millinium.ey.r.appspot.com
  jzsefyfaeherequu-dot-millinium.ey.r.appspot.com
@@ -176718,6 +192399,7 @@ kadamfootcare.com
  kadbnkroyal.com
  kadecuritiba.com.br
  kadencewest.com
+kadeoo.25u.com
  kadesignandbuild.co.uk
  kadidadi.publicvm.com
  kadigital.co.uk
@@ -176788,6 +192470,7 @@ kaisermodecom.nckitechnology.gdn
  kaisiyulecheng.tavmo.com
  kaisorensen.com
  kaiteelao.com
+kaitemashita.jp
  kaitlynandco.com
  kaitlynrodriguez.info
  kaiwachis.ug
@@ -176816,6 +192499,7 @@ kakorioo.cam
  kakoro.mcdir.ru
  kakprosto.media
  kakprostoyes.ru
+kaktjzmekpxsuaxvxqfnwrgmmd-dot-gl9393jan.uk.r.appspot.com
  kaktosh.com
  kakucsiwlp.com
  kakudobno.ru
@@ -176984,6 +192668,7 @@ kanyewest-shoes.com
  kanzlei-hermes.com
  kao.at
  kao3131.info
+kaodkvhtguhwvejtwvvqpghogb-dot-gl9393jan.uk.r.appspot.com
  kaoliao.ac.th
  kaorishiina.it
  kaoshila.cc
@@ -177242,7 +192927,6 @@ kattawrorghkmuaz-dot-millinium.ey.r.appspot.com
  katthus.site
  kattransportationllc.com
  katuturafashionweek.com
-katyisd-d.cf
  katypiaphotography.com
  katyremodelingpros.com
  katzenaugecom.shuiabid.top
@@ -177311,6 +192995,7 @@ kazanin20gbturkiye.com
  kazasafaris.com
  kazdaglariorganik.com
  kazeevkablues.star-go.ru
+kazimacosmetics.com
  kazimoto.sytes.net
  kaziriad.com
  kazlcomposite.com
@@ -177345,6 +193030,7 @@ kbfvzoboss.bid
  kbgc.com.hk
  kbgdvslzbppytyln-dot-millinium.ey.r.appspot.com
  kbgh.com.tr
+kbgmvhgwqyaptovyecihhbotan-dot-gl9393jan.uk.r.appspot.com
  kbhgyqtsfafvklsf-dot-millinium.ey.r.appspot.com
  kbhmat.dk
  kbimperial.com
@@ -177407,6 +193093,7 @@ kcgwtjgiayvszxtk-dot-millinium.ey.r.appspot.com
  kcjhrqpsycqmhvkv-dot-millinium.ey.r.appspot.com
  kcjjbbkfpddovkya-dot-millinium.ey.r.appspot.com
  kck9f.awaykart.com
+kckgfhxaasdtavnlwymmpykiln-dot-gl9393jan.uk.r.appspot.com
  kcksecurity.000webhostapp.com
  kcllqsmkzrgeygxu-dot-millinium.ey.r.appspot.com
  kcmaggwofddhkktobbghhwkuqf-dot-gleowayel400503.uc.r.appspot.com
@@ -177414,6 +193101,7 @@ kcnibyusbjermsxrplgzqmxiuw-dot-gleowayel400503.uc.r.appspot.com
  kcntv.org
  kcobngqsmjspcuyrgrmfybhyeskidqfofrlr-dot-cryptic-now-290917.ey.r.appspot.com
  kcomaegjqfkmnuct-dot-millinium.ey.r.appspot.com
+kcopdrcqkmwdsrwnrvttsscjpg-dot-gl9393jan.uk.r.appspot.com
  kcosmetics-bd.com
  kcpl.info
  kcpzgvttsgldfkuyxxsfgggcxu-dot-gleowayel400503.uc.r.appspot.com
@@ -177423,6 +193111,7 @@ kcsbrssnkwpebsnm-dot-millinium.ey.r.appspot.com
  kcsoftstats.com
  kcsonanr.org.ru
  kcspesaxlpbtlpfh-dot-millinium.ey.r.appspot.com
+kcujxtowjkukmofodvokccsorw-dot-gl9393jan.uk.r.appspot.com
  kcviajtjtwpltizw-dot-millinium.ey.r.appspot.com
  kcwkjtrqzpybslhbzsjpgsjnzk-dot-glowablu03049033.du.r.appspot.com
  kcxe.net
@@ -177453,6 +193142,7 @@ kdi.org.ng
  kdipoqta.shoesmogul.com
  kdjf.guzaosf.com
  kdjredw.com
+kdjubivicswnohqweuuqckencn-dot-gl9393jan.uk.r.appspot.com
  kdkaamixjklkuvrq-dot-millinium.ey.r.appspot.com
  kdkpztzefdxqdyas-dot-millinium.ey.r.appspot.com
  kdmfacilityservices.com
@@ -177524,6 +193214,7 @@ kedkekk.co.cc
  keeblerplain.buzz
  keel.work
  keen-brahmagupta-cec944.netlify.app
+keen-lewin-867ae6.netlify.app
  keen-mclean-b4780a.netlify.app
  keen-pare-000b9f.netlify.app
  keen-ride-52e1b9.netlify.app
@@ -177562,6 +193253,7 @@ kefelharis.com
  kefflee.net
  kefqthngihwpmtlz-dot-millinium.ey.r.appspot.com
  kefybcxaduolgdxq-dot-millinium.ey.r.appspot.com
+kegcvcvqmhuofbrfptsdbqmuza-dot-gl9393jan.uk.r.appspot.com
  kehagia.gr
  kehjkbklbgtvrdoq-dot-millinium.ey.r.appspot.com
  kehutanan.umuslim.ac.id
@@ -177786,6 +193478,7 @@ ketab-88.cf
  ketalycoffee.com
  ketanggungan.desabrebes.id
  ketapang.bawaslu.go.id
+ketarfjsjovqclajwfqbbvnrlg-dot-gl9393jan.uk.r.appspot.com
  ketchupsnool.com
  kethellysquevedo.com
  ketinca.temp.swtest.ru
@@ -177961,6 +193654,7 @@ kgtgxlmrobbpvciemvcilgmdjcaxtgaulbjf-dot-offgl8876899977678.uk.r.appspot.com
  kgu.goruli.com
  kgusfufdcfbdycvvjomkqiidknyattbowgfv-dot-glegen303939423233.ue.r.appspot.com
  kgutjgdjdmlthice-dot-millinium.ey.r.appspot.com
+kgwfvehdhbuvhhecwkwqbqwohp-dot-gl9393jan.uk.r.appspot.com
  kgwhzpespzcmmbkvplswgyiypd-dot-gloff849483.uk.r.appspot.com
  kgwoool.com
  kgwr.tianyilin.cn
@@ -178063,7 +193757,6 @@ khaomauythai.com
  khar-71.gq
  kharazmischl.com
  kharhirhayhaidhuladkha7.tukpluiy.com
-kharid-adams.ir
  khaskhaskhabrein.com
  khassyyui.cam
  khatragovernmentiti.com
@@ -178081,6 +193774,7 @@ khdmatqatar.com
  khdsaz.com
  khdubeuwpixsrmve-dot-millinium.ey.r.appspot.com
  khdyhgkyskxddmmc-dot-millinium.ey.r.appspot.com
+khebbrkjsqjxrfxmpdhzvllatd-dot-gl9393jan.uk.r.appspot.com
  khebstveekriedle-dot-millinium.ey.r.appspot.com
  khefws.vipsnapchatsexting.com
  kheiriehsalehin.com
@@ -178166,6 +193860,7 @@ khyaoyacv.info
  khyoie.life
  khyujxtnvqjsloxe-dot-millinium.ey.r.appspot.com
  khywdlvwfxfldori-dot-millinium.ey.r.appspot.com
+khyxzpyrusfceyfvtbqqrinbmc-dot-gl9393jan.uk.r.appspot.com
  khzsjbvtn.goruli.com
  ki-lowroermond.nl
  ki3.info
@@ -178176,6 +193871,7 @@ kia-sorento-problem.com
  kiabongo.ru
  kiabuhcsfpqpodyq-dot-millinium.ey.r.appspot.com
  kiacops.com
+kiaks.tk
  kialovuigene.com
  kiamobaim.theworkpc.com
  kiana-leather.com
@@ -178352,6 +194048,7 @@ kind-davinci-b4f5be.netlify.app
  kind-jones-5c3725.netlify.app
  kind-mclean-2e4c71.netlify.app
  kind-meitner-91e0a2.netlify.com
+kind-pike-cd6bdd.netlify.app
  kind-spence-b0840b.netlify.app
  kindapal.com
  kinder-camp.com.ua
@@ -178476,6 +194173,7 @@ kipliani.com
  kippies.org
  kippo.eu
  kipqrgogpcsbplxfhexkbgjhha-dot-gloff849483.uk.r.appspot.com
+kiqjdaegopdkonbillksdxtwxe-dot-gl9393jan.uk.r.appspot.com
  kiqwlqwkggyriegc-dot-millinium.ey.r.appspot.com
  kiraamora.000webhostapp.com
  kiradz3.ddns.net
@@ -178607,6 +194305,7 @@ kj3t.svcoding.com
  kj6n.jaysbrand.com
  kjahjsahj.tk
  kjajkcmnklla.weebly.com
+kjarhhvabvxmpeodfdhzzsxiff-dot-gl9393jan.uk.r.appspot.com
  kjarjpaoudeoepzkhfbzuykqen-dot-gleowayel400503.uc.r.appspot.com
  kjasblka.weebly.com
  kjavikcraven.xyz
@@ -178654,6 +194353,7 @@ kjtp0.svcoding.com
  kjtshswajbjvivxk-dot-millinium.ey.r.appspot.com
  kjwdkyglqwsduznl-dot-millinium.ey.r.appspot.com
  kjwgjdkj.weebly.com
+kjxijgbbckcvlsthytoqpmizhz-dot-gl9393jan.uk.r.appspot.com
  kk-0t.jaysbrand.com
  kk1793.com
  kk68.lishuny3.cn
@@ -179050,6 +194750,7 @@ knwosay-71.ga
  knxhpbrixgjswsmcsubeahpofw-dot-gleowayel400503.uc.r.appspot.com
  knypbxnvakayrbej-dot-millinium.ey.r.appspot.com
  knzdzkrqrf.duckdns.org
+knzphagzmoljafoehdywcoglsj-dot-gl9393jan.uk.r.appspot.com
  ko-racingshop.com
  ko4k12baou6avli.e8273.pro
  ko52.com
@@ -179115,6 +194816,7 @@ koght.co
  kogjaigj.ml
  kognitus.com.br
  kogohohkkh.buzz
+kogpxmdvexrfqjpiessgfzpvav-dot-gl9393jan.uk.r.appspot.com
  kohfaih.com
  kohinoorpearl.com
  kohnaninews.ir
@@ -179352,6 +195054,7 @@ konzeptprint.com
  koodaktv.ir
  koof.com.au
  koohsportsfoundation.com
+kookie-movement.000webhostapp.com
  koolahivqruibesk-dot-millinium.ey.r.appspot.com
  koolergazishop.ir
  koolpiquillov.com
@@ -179534,6 +195237,7 @@ kpqk5lt6u5op4kf.web.app
  kprealtors.com
  kprfkro.ru
  kpsbwjdjxqwovvhwgqtpdphccjeefsytfjxs-dot-solar-vertex-285913.rj.r.appspot.com
+kpsjvfhacghonmgegqtcjmzefa-dot-gl9393jan.uk.r.appspot.com
  kpsynfsmquawolgwrlhedpkxjjurmgbizeum-dot-cryptic-now-290917.ey.r.appspot.com
  kpt1m6i.gmz.cc
  kptnkgdipugtvmumrqkcgttaqw-dot-gloff849483.uk.r.appspot.com
@@ -179567,6 +195271,8 @@ kqnnuplnwbqvbjgm-dot-millinium.ey.r.appspot.com
  kqpxndrqdm.duckdns.org
  kqqgegowbnnabooqzldjahtyxb-dot-gleowayel400503.uc.r.appspot.com
  kqrjxgqqkrcwxvbb-dot-millinium.ey.r.appspot.com
+kqtmhgwprdjevxtfccscllkorp-dot-gl9393jan.uk.r.appspot.com
+kqtnwhlacmtlmmzpfhkwxeawds-dot-gl9393jan.uk.r.appspot.com
  kqtzlfgemajpugohgiwussvfcbnwwxktqqgm-dot-solar-vertex-285913.rj.r.appspot.com
  kqupyryhvjqnyagitgmfimluvm-dot-gleowayel400503.uc.r.appspot.com
  kqvrmvfgmlxzmjsh-dot-millinium.ey.r.appspot.com
@@ -179590,7 +195296,6 @@ kraeuterschneckenet.chifanbudget.top
  kraftsandkreations.com
  kraftwerkatdorfcom.nckihouse.gdn
  kraftwerkatdorfnet.nckiaccounting.gdn
-kraftymax.net
  krafway.ru
  kraglepure.com
  kragueraizjprmik-dot-millinium.ey.r.appspot.com
@@ -179626,6 +195331,7 @@ krayker.com
  krazyfoxx9.xyz
  krbanpagehlpsrvce01.my.id
  krbkcavojfvcxjvv-dot-millinium.ey.r.appspot.com
+krbwqifxyoiwwsifssgtecciar-dot-gleow2021ja.ue.r.appspot.com
  krcove-zily.eu
  kre-8.co.za
  kre8ives.com
@@ -179703,6 +195409,7 @@ kritikalinc.com
  krivistechnologies.com
  krizasrednjihgodina.in.rs
  krjpl.com
+krjtzgrqrxmpnqrfnkshalwdzq-dot-gl9393jan.uk.r.appspot.com
  krkgdcaddanki.ac.in
  krkrteam.ddns.net
  krky8.svcoding.com
@@ -179819,6 +195526,7 @@ ksojjsoj.000webhostapp.com
  ksokdofoskf.ml
  ksoncrossfit.com
  ksongoieng.aokwolferv.com
+kspahhnpqvqwytszdyxqpjbqeu-dot-gl9393jan.uk.r.appspot.com
  kspipes.com
  ksppdaehkekuwtlcfgvpvzidqnrlrsdgpkme-dot-glegen303939423233.ue.r.appspot.com
  kspvdrhalyaqfldq-dot-millinium.ey.r.appspot.com
@@ -179847,9 +195555,11 @@ ktgsfxnpzxpntpbecj.top
  kthhqmiwxcrvsuqm-dot-millinium.ey.r.appspot.com
  ktignvlgdjwgnmhowxnznoiwybwnaadwdsmn-dot-cryptic-now-290917.ey.r.appspot.com
  ktipanama.com
+ktjijhoolahumxsymwlfsgbpkt-dot-gl9393jan.uk.r.appspot.com
  ktkjnpbjokfggdik-dot-millinium.ey.r.appspot.com
  ktktst.com
  ktlxn.dermals.org
+ktmdartdapnofydasqnutvsplx-dot-gl9393jan.uk.r.appspot.com
  ktml.org
  ktnsbavfig.duckdns.org
  kto-kruche.fun
@@ -179944,6 +195654,7 @@ kultfitness.com
  kultour-mv.com
  kulturens.org
  kumaontalc.in
+kumar1298.000webhostapp.com
  kumaralok.in
  kumarprodesign.com
  kumfqoiigafjcbirqreytdmwtxurfgwngiej-dot-solar-vertex-285913.rj.r.appspot.com
@@ -179973,6 +195684,7 @@ kumqdyhuuwzybcrz-dot-millinium.ey.r.appspot.com
  kumudlily.com
  kumutjdwreihmwrbpwkuusljifevyaguftgw-dot-glxcel49934343434.rj.r.appspot.com
  kumykoz.com
+kunbwdgalqttbqcrhgsqvntztv-dot-gl9393jan.uk.r.appspot.com
  kunci-sistem-id.webnode.com
  kuncidomino.com
  kunden-ebay.de
@@ -180122,6 +195834,7 @@ kvark1905.siteme.org
  kvartura.vn.ua
  kvav.in
  kvbswivyinwhagly-dot-millinium.ey.r.appspot.com
+kvbthfovbwrdfbycfjxvgyonik-dot-gl9393jan.uk.r.appspot.com
  kvctmwximalxuere-dot-millinium.ey.r.appspot.com
  kvene1z.info
  kvfmxmjsgd.duckdns.org
@@ -180152,6 +195865,7 @@ kvmappsciod272861.fjrmmk.com
  kvmappsciod643662.fjrmmk.com
  kvmappsciod911562.bgromenicheak.com
  kvmappsciod99053.bgromenicheak.com
+kvmcekwlfcyyuxxdwphtfjxfqj-dot-gl9393jan.uk.r.appspot.com
  kvmhostedcloud-id202948.losdolaknjut.com
  kvmmawxlrlefifar-dot-millinium.ey.r.appspot.com
  kvmmrkrkksaugwzkjbdlwfqqtijppnyftquv-dot-glegen303939423233.ue.r.appspot.com
@@ -180223,6 +195937,7 @@ kwprxsijamcjiignfzofyiovvlhwizmlmote-dot-solar-vertex-285913.rj.r.appspot.com
  kwqufatxcybvzpgy-dot-millinium.ey.r.appspot.com
  kwrdzbitihghsfmm-dot-millinium.ey.r.appspot.com
  kwrealty2015.mobi
+kwrorvxgkpfizuucvnadeocigq-dot-gl9393jan.uk.r.appspot.com
  kwsg.awaykart.com
  kwtkkevkybaavjcj-dot-millinium.ey.r.appspot.com
  kwtr.svcoding.com
@@ -180236,6 +195951,7 @@ kx6gn.baydiboo.com
  kxah1.addroits.com
  kxahyifiiklitfqh-dot-millinium.ey.r.appspot.com
  kxbcnkykcqcmcdlzjtmainudqecflergicpf-dot-cedar-code-289917.nn.r.appspot.com
+kxbmlxmcaqihhjujomewffzcae-dot-gl9393jan.uk.r.appspot.com
  kxbmxljhfx.duckdns.org
  kxczhgjdb.goruli.com
  kxdvln.shoesmogul.com
@@ -180290,6 +196006,7 @@ kykegvqjoovmkedp-dot-millinium.ey.r.appspot.com
  kykeon-eleusis.com
  kykofcdmkbhmudqf-dot-millinium.ey.r.appspot.com
  kykywka.xyz
+kylaskyway.buzz
  kylebeard.com
  kylepetersenmusic.com
  kyleriffic.com
@@ -180373,6 +196090,7 @@ l.www.dyamm.com
  l0.lonlydra.ru
  l000888457covid.online
  l00c25cf32.temp.swtest.ru
+l010.cf
  l09162020-fixmailhelpdesk.web.app
  l09d56a7.justinstalledpanel.com
  l0g1nn-rec0v3rdata.com
@@ -180405,6 +196123,7 @@ l6fd96ca.justinstalledpanel.com
  l7n2.com
  l83cwgpr.firebaseapp.com
  l84c6a7c.justinstalledpanel.com
+l850.gq
  l8b6a671.justinstalledpanel.com
  l94d6f63.justinstalledpanel.com
  l968905q.beget.tech
@@ -180719,6 +196438,7 @@ lamourautempsducorona.cc
  lamp.ernsintl.com
  lampaca.fr
  lampalazszelidito.hu
+lampgas.buzz
  lampz.de
  lamsaomadiedc.cf
  lamtinchina.com
@@ -180798,7 +196518,6 @@ lanhodiepuytin.com
  laniermusic.com
  laninesolution.com
  lanitidevmiaiz-kind-topi-kd.mybluemix.net
-lanjar.seriesnow.website
  lanjunhome.com
  lankaexplorer.net
  lankanewsroom.com
@@ -180921,6 +196640,7 @@ laredcoaching.com
  lareggiadelladanza.it
  largadosmotoclube.com
  largelabiaingsproject.icu
+largeroyalbluedos.sdsdsdsd77dsdsd.repl.co
  largyiypqlfjtisg-dot-millinium.ey.r.appspot.com
  lariconsults.com
  larikemana.my.id
@@ -181021,7 +196741,6 @@ laszurabsaxiopolinga.ml
  latam-pontos.com
  latamresgate.com
  latamtest.cingodesarrollos.com.ar
-latamtravelco.com
  latchfordincorporates.com
  latek-ms.brucebil.repl.co
  latekms.brucebil.repl.co
@@ -181057,6 +196776,7 @@ latinotrade.ru
  latinotravel.cz
  latiprantz.com
  latisiotheohm.xyz
+latitudinal-launche.000webhostapp.com
  latmasoud.persiangig.com
  latouche-eco.fr
  latovfbjscuekfkpuspjsjlnlp-dot-gloff00403993445.uk.r.appspot.com
@@ -181113,6 +196833,7 @@ laurentbernardaquarelles.com
  laurentchipaux.com
  laury.co
  laus538wov.firebaseapp.com
+lausd-ignn.ga
  lausebpro.com
  lausellv.com
  lausinexamenes.com
@@ -181157,9 +196878,11 @@ lavitaworld.com
  lavoixdesmots.free.fr
  lavorosubordinatosmartw.org
  lavrin.pl
+law-abiding-seesaws.000webhostapp.com
  lawang88view01.my.id
  lawerencesfranklin.com
  lawetasandomierz.pl
+laweuqkomqsuboybevyblymbmo-dot-gl9393jan.uk.r.appspot.com
  lawfirm-int.online
  lawful-pokes.000webhostapp.com
  lawinternship.000webhostapp.com
@@ -181196,6 +196919,7 @@ layagroup.net
  laydomain.cf
  layemfoods.com
  layerdry.cyou
+layered-dears.000webhostapp.com
  layerstiont.xyz
  laylachotty.com
  laylalanemusic.com
@@ -181204,6 +196928,7 @@ laymosupmistpercvi.tk
  laynasusedtiresandautorepair.com
  layrshift.eu
  laytonavenuechurch.org
+laywest.buzz
  lazarus.co.zw
  lazisnukolomayan.com
  lazonasegurabetaviabcp.com
@@ -181285,6 +197010,7 @@ lbr.gov.lr
  lbrfirycjopqhtru-dot-millinium.ey.r.appspot.com
  lbrimzyrvarmmyshjahi-dot-level-elevator-279110.nw.r.appspot.com
  lbsinfo.shaxiabuy.top
+lbskyaurdcjdyxhstpobisfzyg-dot-gl9393jan.uk.r.appspot.com
  lbtlgpxlouhbgvqi-dot-millinium.ey.r.appspot.com
  lbubzqasipnyjejw-dot-millinium.ey.r.appspot.com
  lbugfrfwsdrljzid-dot-millinium.ey.r.appspot.com
@@ -181310,8 +197036,10 @@ lcd365de.shaxiaadd.top
  lcdecor.ru
  lce.goruli.com
  lcen66xr.firebaseapp.com
+lcenwhjekchpajhevxqmijonuf-dot-gl9393jan.uk.r.appspot.com
  lcevgmyimquqhoabvskwmzxyhpnjxdubefwd-dot-glegen303939423233.ue.r.appspot.com
  lcfbcerbxkhbhpov-dot-millinium.ey.r.appspot.com
+lcfpqfodwuumdqhnzysjwluegt-dot-gl9393jan.uk.r.appspot.com
  lcga.net.cn
  lcgcintemag.ru
  lcgdsorg.shaxiabed.top
@@ -181323,6 +197051,7 @@ lcivfvexozrxhamweqyeefgwrxjgqdsfyltu-dot-gl494903049.wl.r.appspot.com
  lcjwquyamvfqdosh-dot-millinium.ey.r.appspot.com
  lckyspinpubg.com
  lcl-fr-access-compte-particulier-verification.acd-getraenke.de
+lcl-pro-espace-fr.web.app
  lcloud-id-apps.live
  lcloud-id.support
  lcloud-server.us-south.cf.appdomain.cloud
@@ -181397,6 +197126,7 @@ ldfsgc.com
  ldgcorp.com
  ldgfip-appcontact.link
  ldgqwovkrnfbkbulurrwcikredhtovbjnnrm-dot-cryptic-now-290917.ey.r.appspot.com
+ldhqcoaexkttidetbvduaojesw-dot-gl9393jan.uk.r.appspot.com
  ldibxfvwtrybedrfaqisqjbbae-dot-gleowayel400503.uc.r.appspot.com
  ldireproprintingllc.for-more.biz
  ldjbsgcqmaqnfoyg-dot-millinium.ey.r.appspot.com
@@ -181426,6 +197156,7 @@ ldrmercury.casa
  ldrpeset.casa
  ldrtango.casa
  ldrtoyota.casa
+ldryoxgbrclvbkzuwtynvevmoi-dot-gleow2021ja.ue.r.appspot.com
  ldsplanettt.yolasite.com
  ldtaempresanostra.com.br
  ldtvkkzmdvknrsrn-dot-millinium.ey.r.appspot.com
@@ -181476,6 +197207,7 @@ leadtribeca.com
  leadxweb.com
  leafless-employees.000webhostapp.com
  leafstone.in
+leafyoldlaceapplication.sdsdsdsd77dsdsd.repl.co
  league0flegends-worlds2020-orb-euw.000webhostapp.com
  league0flegends-worlds2020-orb.000webhostapp.com
  league0flegends01y4er.000webhostapp.com
@@ -181569,6 +197301,8 @@ leaveletter.in
  leavell-photography.com
  leavensbagsfqz6nh.com
  leaverally.xyz
+leaveyear.buzz
+leawills.de
  lebagoodboxc.com
  lebangkokclinic.com
  lebanonga.buzz
@@ -181615,7 +197349,6 @@ leddanceflooromaha.com
  ledelampa.com
  ledenergythai.com
  ledexpress.fr
-ledgdr.com
  ledger-event.com
  ledger-web.network
  ledger.com.downloads.update-server16.com
@@ -181740,6 +197473,7 @@ legzjsjt.shoesmogul.com
  lehavregenealogie2017.fr
  lehraagrotech.com
  lehsa.com
+lehsjwjxcvsiayiooiaggjxkvh-dot-gl9393jan.uk.r.appspot.com
  lehuopai.com
  lehygdhiyusjidjusbhfiaod.live
  lehzig.com
@@ -181762,6 +197496,7 @@ leipzigagency.baerseventake.top
  leipziger-schrippe.de
  leitersadvogados.com.br
  leixiayiran.com
+lejasvukdtrmnklzfwapyasxta-dot-gl9393jan.uk.r.appspot.com
  lejintian.cn
  lejkjnfpepqviujb-dot-millinium.ey.r.appspot.com
  lejkmrcclkwvsmac-dot-millinium.ey.r.appspot.com
@@ -181778,7 +197513,6 @@ lelangg.online
  lelecars.it
  leleians.com
  leleshwa.com
-lelger.com
  lelitonsl.com
  lelkizona.hu
  lella.top
@@ -182031,6 +197765,7 @@ levelupyourledger.com
  levelwater.org.uk
  leveragingyourself.icu
  leveretiridium.com
+leverlwie.cam
  levestito.com.br
  levidom.ru
  levieuxsinge.com
@@ -182097,7 +197832,6 @@ lfdoeprfldmmlerfpodlmef.com
  lffkvvm.rogagot.com
  lffldyf.tk
  lfgesi.servebeer.com
-lfh0l1l.yolasite.com
  lfitvmntbsrtpryd-dot-millinium.ey.r.appspot.com
  lfix10102020l-mailsolution.web.app
  lfixcom.shaxiaprofessional.top
@@ -182106,6 +197840,7 @@ lfkdkfdfdflfkfk.com
  lfkdkfdkfdjkfd.com
  lfknmqovagmzeqdb-dot-millinium.ey.r.appspot.com
  lfkycsdatnyflqvb-dot-millinium.ey.r.appspot.com
+lflwkcqugcvpatlqxgqjucdodd-dot-gl9393jan.uk.r.appspot.com
  lfmdmlfmdfder.com
  lfmultiformas.com
  lforgot-en.us
@@ -182134,6 +197869,7 @@ lgc-wine.com
  lgcopyrightform.com
  lgcopyrighthelpsupport.tk
  lgdayxbaggzbyqwk-dot-millinium.ey.r.appspot.com
+lgdfjqtgzcnpdunrmcbiynosoa-dot-gl9393jan.uk.r.appspot.com
  lgdrzbmfzihytcdi-dot-millinium.ey.r.appspot.com
  lgdtrngkhegwwkcyzouqqouubjxeqpfzuqwk-dot-solar-vertex-285913.rj.r.appspot.com
  lgexnwtkiufmpfuuscinnzokjw-dot-gleowayel400503.uc.r.appspot.com
@@ -182148,6 +197884,7 @@ lginaccntntflixss.com
  lgintflixsc.com
  lgioginpage45662123.000webhostapp.com
  lgjmcaz.cn
+lgkmzmoblxtczagkwmxpngjwir-dot-gl9393jan.uk.r.appspot.com
  lgkpwqxasagsyptq-dot-millinium.ey.r.appspot.com
  lglaoiteohybkhrgpleofaivmy-dot-gleowayel400503.uc.r.appspot.com
  lglistjnb.com
@@ -182184,6 +197921,7 @@ lgunxlajidubjxzx-dot-millinium.ey.r.appspot.com
  lguwvacjoktparygwfioudfhcs-dot-gleowayel400503.uc.r.appspot.com
  lguzxapqdaogxkcf-dot-millinium.ey.r.appspot.com
  lgvhfbqwmfpdpugz-dot-millinium.ey.r.appspot.com
+lgvmkxrpjgmbwljvpodgqkglxn-dot-gleow2021ja.ue.r.appspot.com
  lgxnmhfaspejuumsmnavryiwsapkewhnonzn-dot-glxcel49934343434.rj.r.appspot.com
  lgxx8.cn
  lh-broker.com
@@ -182204,6 +197942,7 @@ lhelp.pl
  lhf0e.cn
  lhfkgyriaepntxme-dot-millinium.ey.r.appspot.com
  lhfpavcznedqludr-dot-millinium.ey.r.appspot.com
+lhfxavfflcrnpuuyutjzqnvlse-dot-gl9393jan.uk.r.appspot.com
  lhhetvkc.goruli.com
  lhicddbjcsdhrbniwhurjjvjgzmlrbimoxni-dot-glxcel49934343434.rj.r.appspot.com
  lhiscpztunheqeaw-dot-millinium.ey.r.appspot.com
@@ -182404,6 +198143,7 @@ lifecycleeng.com
  lifedive.gr
  lifeful-numeral.000webhostapp.com
  lifegiveaway.com
+lifeguardglobal.com
  lifeinsurancenew.com
  lifeisbetternow.ml
  lifeiswhatyoumakeofit.com
@@ -182463,6 +198203,8 @@ ligfebacktolife.us
  lighjetagend.tk
  light-architecture.fr
  light-boy.top
+light-handed-animal.000webhostapp.com
+light-headed-indica.000webhostapp.com
  light-headed-minimu.000webhostapp.com
  light.brwrqweo.uk
  light.fakesemoca16.com
@@ -183035,6 +198777,7 @@ lipertekstil.com
  lipiciucamaciuca.life
  lipnik.com.pl
  lipobatteries.net
+lipoeiew.cam
  liposuctionsurgery.co.in
  lippielust.com
  lipripperz.com
@@ -183401,6 +199144,7 @@ lj65.com
  lja93bqw.firebaseapp.com
  ljalwpnjckhgeijkikxvbpqpihwyzewlhxci-dot-cedar-code-289917.nn.r.appspot.com
  ljaocdezkibhmkta-dot-millinium.ey.r.appspot.com
+ljaowtiwrttwujnnqsfwfznlsc-dot-gl9393jan.uk.r.appspot.com
  ljbbx.de
  ljbfmkudgzmpiwefofclsvxdjbkflpqgpkkc-dot-cedar-code-289917.nn.r.appspot.com
  ljbfmkudgzmpiwefofclsvxdjbkflpqgpkkc.cedar-code-289917.nn.r.appspot.com
@@ -183419,12 +199163,16 @@ ljjqmrwvzqcxedziofzvnzdrcquzvzsotdtt-dot-solar-vertex-285913.rj.r.appspot.com
  ljjsizlcmfwxrmig-dot-millinium.ey.r.appspot.com
  ljkhjkkjg.org.ru
  ljkuqzlemiwrkyfespfjducall-dot-gleowayel400503.uc.r.appspot.com
+ljltixmdwcakjodvszlpaxsysg-dot-gl9393jan.uk.r.appspot.com
+ljmwjsnvyulhwiocvqvdrkuzrg-dot-gl9393jan.uk.r.appspot.com
  ljogcaiwbxmvbyfvzpgptajxfnsvrxqbwcej-dot-glegen303939423233.ue.r.appspot.com
  ljoihohb.gb.net
  ljp9neothtzc.com
  ljrabeuftqmymvml-dot-millinium.ey.r.appspot.com
+ljtdsikefomdovnwxmqcnyokcn-dot-gl9393jan.uk.r.appspot.com
  ljtlkyzanfftftkfjautiuubxi-dot-gleowayel400503.uc.r.appspot.com
  ljusbxyunjgbhsqczibrpoivfp-dot-gleowayel400503.uc.r.appspot.com
+ljxgpmqqwvbapzrgjbgkqkfltt-dot-gl9393jan.uk.r.appspot.com
  ljyvszkjuscqwdizcjxsjcvercnzvgjnqbpq-dot-cedar-code-289917.nn.r.appspot.com
  ljyxx.com
  lk.seva-online.com
@@ -183545,7 +199293,6 @@ lloyd-online.login-online-support.com
  lloyd-payee-cancel.net
  lloyd-personal.onlinebankinguk.net
  lloyd-securebank.com
-lloyd-securityattention.com
  lloyd-verify.com
  lloyd.groupplc-supportgb.com
  lloyd.new-secure.co.uk
@@ -183553,13 +199300,14 @@ lloyd.unauthpayee.com
  lloydalert.com
  lloydbank-cancel.com
  lloydbank-login.com
+lloydbank-payeereview.com
+lloydbank-securemanagepayee.com
  lloydbank.com.compliance-user.services
  lloydbank.new-secure.co.uk
-lloydbanking-devicesecure.com
  lloydbanking-managepayees.com
-lloydbanking-payeereview.com
  lloydcancelpayee.com
  lloydconstruction.com
+lloydgb-newdevice-online.com
  lloydolb.com
  lloydonline-eservices.com
  lloydonlinesecure.loginpayeesecure.com
@@ -183612,9 +199360,7 @@ lloyds-new-device.com
  lloyds-new-payment.com
  lloyds-newpayee-authorisation142.com
  lloyds-newrecipient.com
-lloyds-online-alerts.com
  lloyds-online-banking-help.com
-lloyds-online-device.com
  lloyds-online-login.payeesadded.com
  lloyds-online-secure.com
  lloyds-online-securedetails.com
@@ -183748,6 +199494,7 @@ lloydsbank.com.login-review-4453.info
  lloydsbank.com.login-review-976.info
  lloydsbank.com.submit-application.services
  lloydsbank.contacts-help.co.uk
+lloydsbank.deregister-secure-payee.com
  lloydsbank.deregister-unknown-payee.com
  lloydsbank.device-auth-new-verify.com
  lloydsbank.device-login-verify-auth.com
@@ -183780,7 +199527,6 @@ lloydsbank.new-secure.co.uk
  lloydsbank.newly-login-attempted-access-gained.com
  lloydsbank.online-auth-device-verify.com
  lloydsbank.online-auth-secure-verify.com
-lloydsbank.online-auth-verify-security.com
  lloydsbank.online-login-auth-device.com
  lloydsbank.online-login-auth-verify-device.com
  lloydsbank.online-login-authenticate-info.com
@@ -183790,6 +199536,7 @@ lloydsbank.online-personal-login-info.com
  lloydsbank.online-personal-login-verify.com
  lloydsbank.online-personal-logon-uk.com
  lloydsbank.online-personal-validate.com
+lloydsbank.online-security-auth-verify.com
  lloydsbank.online-validate-device.com
  lloydsbank.online-validate-login-info.com
  lloydsbank.online-verify-auth.com
@@ -183797,15 +199544,16 @@ lloydsbank.online-verify-device-info.com
  lloydsbank.online-verify-personal.com
  lloydsbank.online-verify-registration.com
  lloydsbank.online-verify-security.com
-lloydsbank.online-visit-secure-auth.com
  lloydsbank.payee-portal.co.uk
  lloydsbank.personal-login-mobile-verify.com
  lloydsbank.personal-login-online-auth.com
+lloydsbank.personal-login-secure-payee.com
  lloydsbank.personal-private-user.com
  lloydsbank.personal-profile-login.com
  lloydsbank.personal-secure-payee-request.com
  lloydsbank.personal-security-payee-request.com
  lloydsbank.personal-user-device.com
+lloydsbank.personal-user-shield.com
  lloydsbank.personal-user-verify.com
  lloydsbank.prevention-auth-device-login.com
  lloydsbank.register-mobilebanking.com
@@ -183854,6 +199602,7 @@ lloydsbanksecure.net
  lloydsbnk-authenticate.com
  lloydsdataprotect.net
  lloydsderegisterdevice.net
+lloydsdevice.com
  lloydsdevicedata.co.uk
  lloydsdevicemanagement.com
  lloydsdevicemanagment.co.uk
@@ -183881,7 +199630,6 @@ lloydsreviewpayeeuk.com
  lloydsreviewuk.com
  lloydsrevisionuk.com
  lloydssecure.com
-lloydssecure2user.com
  lloydssecuredevice.com
  lloydssecuregroup.com
  lloydstsb.auth-device-new-verify.com
@@ -183955,6 +199703,7 @@ lmpulsefashion.net
  lmpvjicjvvfuyhefmggs.com
  lmqauyjfzywkwkkubfiduusrlj-dot-gloff00403993445.uk.r.appspot.com
  lmqgijbrdkzvlhru-dot-millinium.ey.r.appspot.com
+lmqhnckidswqwbgjywlbnbhaip-dot-gl9393jan.uk.r.appspot.com
  lmrcaorgukdy.cf
  lmrpcxbgrnerkdsq-dot-millinium.ey.r.appspot.com
  lms.latrobe.aroe.me
@@ -183987,6 +199736,7 @@ lncherr-facebook.com.villa-evelyn.com
  lnchzhqcnvfumhzwuoyleighjccfflczmzxk-dot-solar-vertex-285913.rj.r.appspot.com
  lnefsrpozm.duckdns.org
  lneqqkvxxogomu.eu
+lnfbbdhkilrgvukfyiqveiazce-dot-gl9393jan.uk.r.appspot.com
  lnfo-appmobile.com
  lnfo-instgram-center.ml
  lnfo.web-chat.eu
@@ -184014,6 +199764,7 @@ lnhhpxnotgsticvc-dot-millinium.ey.r.appspot.com
  lnhoa6bz4vxs.talagaremix.com
  lniciosucursal.site
  lniclkhalaxpkoiqfbdzlwbaen-dot-gloff849483.uk.r.appspot.com
+lnjmdujnolrqpgvncfigpmodai-dot-gl9393jan.uk.r.appspot.com
  lnk.jecool.net
  lnk.pmlti-etai-2.ovh
  lnkaqvwowakoflei-dot-millinium.ey.r.appspot.com
@@ -184043,6 +199794,7 @@ lnstaglams.com
  lnstagram--verify.ml
  lnstagram-about.com
  lnstagram-approves.com
+lnstagram-auth-users.000webhostapp.com
  lnstagram-badge-confirm.com
  lnstagram-badge-team.tk
  lnstagram-blue-badge-form.tk
@@ -184081,6 +199833,7 @@ lnstagram-copyrighthelpcenter.com
  lnstagram-copyrighthelpig.ml
  lnstagram-copyrightrules.com
  lnstagram-copyrights-center.com
+lnstagram-copyrights-central.cf
  lnstagram-copyrights-supports.ga
  lnstagram-copyrightvioalation.com
  lnstagram-copyrightvioalation.tk
@@ -184232,7 +199985,6 @@ lnstagramcopyrighteamm.ml
  lnstagramcopyrightedform.com
  lnstagramcopyrightforbusines.000webhostapp.com
  lnstagramcopyrighthelpcenters.com
-lnstagramcopyrighthelper.gq
  lnstagramcopyrighthelpforms.com
  lnstagramcopyrighthelpgroup.com
  lnstagramcopyrighthelpsupports.com
@@ -184251,6 +200003,7 @@ lnstagramcopyrightsystem.com
  lnstagramcopyrightveryfy.cf
  lnstagramcopyrightviolationcenter.com
  lnstagramcopyrightviolationhelps.com
+lnstagramcopyrightviolationreports.ml
  lnstagramcopyrighty.ml
  lnstagramcopyrright.ml
  lnstagramcourtappeals.com
@@ -184339,7 +200092,6 @@ lnstagramsecurityhub.com
  lnstagramsecurtycenter.com
  lnstagramservice.ml
  lnstagramservicehelpers.com
-lnstagramserviceshelp.gq
  lnstagramservicesupport.com
  lnstagramsforsupportings.com
  lnstagramsforums.com
@@ -184404,7 +200156,6 @@ lnstaqrambluetick.cf
  lnstasupport.com
  lnstaverifyaccounts.org
  lnstaverifyhelpsbadge.cf
-lnstgram-bussines-helpcenter-account-contact-82847828377389.ml
  lnstgram-help-service.com
  lnstgram.co
  lnstgramcopyrigtsupport.ml
@@ -184438,6 +200189,7 @@ lnv0lce06855.com
  lnvaetpne.dermals.org
  lnvkbagsprwcagpb-dot-millinium.ey.r.appspot.com
  lnvoice82673.com
+lnvydjhoutuzmguwcscalhyikd-dot-gl9393jan.uk.r.appspot.com
  lnwoevmfraeuywrntsggvhqfvz-dot-gleowayel400503.uc.r.appspot.com
  lo-bank.com
  lo-localbltcoins.com
@@ -184895,7 +200647,6 @@ login-mypayees.com
  login-mypaypal.com
  login-myvirginmedia.com
  login-myvirginmobile.com
-login-natwest-alert.com
  login-new-o2.com
  login-newpayee-security.com
  login-newpayee.com
@@ -185149,7 +200900,6 @@ login.facebook.com.account.pplrfs.icu
  login.facebook.com.loopindo.com
  login.facebook.com.security.yasoess.com
  login.facebook.v7.tollz55.net
-login.facebookgarena.gq
  login.fcbuk.xyz
  login.free-officialll.getmltoday.com
  login.gmail.com18975215.cf
@@ -185445,7 +201195,6 @@ logincurrentlyattnetwork.weebly.com
  logincurrentlyattoffice.weebly.com
  logincurrentlyattwebsite.weebly.com
  logincustomerpageamazonauthenticationbilling.kozow.com
-logindailyrewards.com
  logindatafacebook2.tloos.ml
  logindevice-unknown.cc
  logindisek.tk
@@ -185709,6 +201458,7 @@ lojasinvernobahia.com
  lojasmagazinelu.com
  lojasmc.net
  lojaspromo-com.umbler.net
+lojaspromoverao-com.umbler.net
  lojaxgrowup.com
  lojin-inst.000webhostapp.com
  lojkqy.vipsnapchatsexting.com
@@ -185864,6 +201614,7 @@ lonnie534645.xyz
  lonosoneteams.blogspot.com
  lonrsurf.com
  lont.co.in
+lonxvcufxjxbeulkvqjgyzfrch-dot-gl9393jan.uk.r.appspot.com
  look-com.cabanova.com
  look-downloads.ga
  look.in
@@ -185977,12 +201728,12 @@ loskiauieo.com
  loslegon.wixsite.com
  losmecabra.gq
  losmejoresexitosdericardoarjona.blogspot.com
-losmvuhjcfybjadc-dot-revalidate-icaan-domain.ue.r.appspot.com
  losnachos.de
  losoftemer.temp.swtest.ru
  losososdesign.com
  lospequenines.com
  losras25s.weebly.com
+losrecuerdosperduransiempre.000webhostapp.com
  lost-icloud.live
  lost-log.icloud-y.com
  lostacntwuexcmhxklwliuchwbwdhbopwpdt-dot-solar-vertex-285913.rj.r.appspot.com
@@ -186004,6 +201755,7 @@ lotlee.com
  loto041219.blogspot.com
  loton.com.pl
  lotpgyvievygejmmujcimfjlxqczspsxpjma-dot-cryptic-now-290917.ey.r.appspot.com
+lotrhwrmvnlmavknczeylwdgab-dot-gl9393jan.uk.r.appspot.com
  lotrqkwihhoyjicq-dot-millinium.ey.r.appspot.com
  lotsarecipes.com
  lotsforsalellc.com
@@ -186166,6 +201918,7 @@ lowthercastle-views.com
  lowvoltage.ro
  loxien2.com
  loxliver.com
+loxqnaykpbdqflobujgqxlmnwb-dot-gleow2021ja.ue.r.appspot.com
  loyalbinary.com
  loyaldeliriousautoresponder--five-nine.repl.co
  loyaler.ga
@@ -186196,6 +201949,7 @@ lp0766.ddns.net
  lp2m.umsu.ac.id
  lp4jzf1e.web.app
  lpacwsbjpyjkoktd-dot-millinium.ey.r.appspot.com
+lpalcdhixfpuycdyxynjrlbljo-dot-gl9393jan.uk.r.appspot.com
  lpaozvnngzobn.icu
  lpatrick.com
  lpbhtrulmhxctemb-dot-millinium.ey.r.appspot.com
@@ -186245,10 +201999,13 @@ lqadmuszkgyaqamw-dot-millinium.ey.r.appspot.com
  lqayjfngjocnyvwv-dot-millinium.ey.r.appspot.com
  lqbfyeljoasfbnnu-dot-millinium.ey.r.appspot.com
  lqclrvrglqjrtazucezpepgxxzkxkiroqkhn-dot-gl494903049.wl.r.appspot.com
+lqcumeoeimgxswochqxpfovwtc-dot-gl9393jan.uk.r.appspot.com
  lqczvrkilhidgjwk-dot-millinium.ey.r.appspot.com
+lqdmxhajrhmbyrhddiprjjcfaq-dot-gl9393jan.uk.r.appspot.com
  lqg8u8.webwave.dev
  lqhuxvgkoozwxfxt-dot-millinium.ey.r.appspot.com
  lqixqpuwwqlhndqo-dot-millinium.ey.r.appspot.com
+lqkmdgwngqnnhthkekjzwmbwre-dot-gl9393jan.uk.r.appspot.com
  lqlpobqzukbpsccxvfyxboruun-dot-gloff849483.uk.r.appspot.com
  lqlxgsqklxlelaltekomuyfrtbtrwynunfug-dot-cryptic-now-290917.ey.r.appspot.com
  lqmnnfacsgshgowfowhoubqnntaoqjhfjorf-dot-solar-vertex-285913.rj.r.appspot.com
@@ -186282,15 +202039,18 @@ lrgxxsboznlwvtlk-dot-millinium.ey.r.appspot.com
  lrhalowsrnbgorka-dot-millinium.ey.r.appspot.com
  lrilnbsvcdngmfrsbrclvcdsrj-dot-gleowayel400503.uc.r.appspot.com
  lrn.goruli.com
+lromcjzjlfatqegijzeizruopk-dot-gl9393jan.uk.r.appspot.com
  lronman4x4.com
  lrowetu.ga
  lrrgxycofhguqbvc-dot-millinium.ey.r.appspot.com
  lrservice.com.ua
  lrslwsthrzmtbnsgompamejpphcuvyumqixk-dot-solar-vertex-285913.rj.r.appspot.com
  lrtcqcfksnzmewycmyisapzryfsdjncipayx-dot-cryptic-now-290917.ey.r.appspot.com
+lrterwxeklzzhkbflupuwqatpr-dot-gl9393jan.uk.r.appspot.com
  lrtt.re
  lruzpian.com
  lrwngnkjrhlfsppnoiaoifntigxvqhpbitvn-dot-solar-vertex-285913.rj.r.appspot.com
+lrwqjzsaiozwkpjomnhewcfdhp-dot-gl9393jan.uk.r.appspot.com
  lrzqcqiiuqsvumdg-dot-millinium.ey.r.appspot.com
  ls.airseal.com
  ls.gucac.com
@@ -186319,6 +202079,7 @@ lskclick.com
  lslxzqqeeplhcpmofcbpsqypke-dot-gleowayel400503.uc.r.appspot.com
  lsmic.com
  lsmtbaqvnqazawfr-dot-millinium.ey.r.appspot.com
+lsnjybqpzckcsgeibybypoliin-dot-gl9393jan.uk.r.appspot.com
  lsnr630.cn
  lsomdcy.shoesmogul.com
  lsp-aggiornami.000webhostapp.com
@@ -186405,6 +202166,7 @@ lth.goruli.com
  lthost.club
  lti.com.ng
  lticep.gikorip.net
+ltitrk.com
  ltiy.cn
  ltkgnabefqrjjtmi-dot-millinium.ey.r.appspot.com
  ltkocurzitn.com
@@ -186432,6 +202194,7 @@ lttrjayxytyvdjxdjqexpshddpsyhdtntrca-dot-gl494903049.wl.r.appspot.com
  ltujagcepzoxtdqnmqawbymjlghueozglmqi-dot-cedar-code-289917.nn.r.appspot.com
  ltuvvosxpwdopsxlxthquecptv-dot-gleowayel400503.uc.r.appspot.com
  ltwvdb.webwave.dev
+ltxurmlhhvyftxrhltimnwrnkx-dot-gleow2021ja.ue.r.appspot.com
  ltyqpqyyqzfyynqn-dot-millinium.ey.r.appspot.com
  ltyuye.com
  ltzmfkeryczbvlzg-dot-millinium.ey.r.appspot.com
@@ -186475,6 +202238,7 @@ lucianodelarco.com.br
  lucianoweb.com.br
  luciatle-71.tk
  lucid-brahmagupta-91bfd6.netlify.app
+lucid-sinoussi-f1726c.netlify.app
  lucid.kiev.ua
  lucidfestival.com
  lucidinvestbank.com
@@ -186651,6 +202415,7 @@ lulla.duckdns.org
  lulu.breful.us
  lulufabllc.com
  luluvipco.com
+luluzwsfqsttkeeiskhqcqqetr-dot-gl9393jan.uk.r.appspot.com
  lum4.com
  lumanaridecorative.com
  lumao.org
@@ -186752,6 +202517,7 @@ luxedollz.com
  luxedrive.fr
  luxeinvesting.com
  luxembourg-capital-finance.com
+luxgormwapuiguuccnhyrvdehh-dot-gl9393jan.uk.r.appspot.com
  luxgsyjrfqdczmhg-dot-millinium.ey.r.appspot.com
  luxi.06wi.com
  luxiyouyue.club
@@ -186853,7 +202619,9 @@ lwizbzaenytfnxjcvhkmshiknl-dot-gleowayel400503.uc.r.appspot.com
  lwkufjerqsgxrock-dot-millinium.ey.r.appspot.com
  lwmvysjhptvckwchqriolklxuzbsqgwmvibt-dot-cryptic-now-290917.ey.r.appspot.com
  lwohwvpnofdcrjbv-dot-millinium.ey.r.appspot.com
+lwpwrmdphkuvugfdcqmyeoxjqh-dot-gl9393jan.uk.r.appspot.com
  lwqfypiyk.goruli.com
+lwrvjybjysntslzwnlqaarhenc-dot-gl9393jan.uk.r.appspot.com
  lwrxtuixfugewegj-dot-millinium.ey.r.appspot.com
  lwsovetnyk.ru
  lwsrxubjvlruyrgq-dot-millinium.ey.r.appspot.com
@@ -186861,6 +202629,7 @@ lwsuspgkddrtuaoy-dot-millinium.ey.r.appspot.com
  lwszyrvvp.goruli.com
  lwubsjmxflzfttswumelcsrbvf-dot-gleowayel400503.uc.r.appspot.com
  lwwmffokktidwbkr-dot-millinium.ey.r.appspot.com
+lwyappnismbhgjakbkuflyakiy-dot-gl9393jan.uk.r.appspot.com
  lwyrojbpwurvokkj-dot-millinium.ey.r.appspot.com
  lwzauaqpiwslctfl-dot-millinium.ey.r.appspot.com
  lwzlwzgame.com
@@ -186872,7 +202641,9 @@ lxdrwbolkxunxfrcyarambaopu-dot-gleowayel400503.uc.r.appspot.com
  lxduexapwhszclxz-dot-millinium.ey.r.appspot.com
  lxersjbxzraamyvdldpeavzecc-dot-gleowayel400503.uc.r.appspot.com
  lxeyneyxulfhnswr-dot-millinium.ey.r.appspot.com
+lxgxhrotmdjxrbalfdfypcowvr-dot-gleow2021ja.ue.r.appspot.com
  lxhrjxulobjtbsvq-dot-millinium.ey.r.appspot.com
+lxkyuhagonwevtctmfbklltnxn-dot-gl9393jan.uk.r.appspot.com
  lxldjupikdxvxfar-dot-millinium.ey.r.appspot.com
  lxnpjuhrosiokwdv-dot-millinium.ey.r.appspot.com
  lxoaix.sytes.net
@@ -186982,6 +202753,7 @@ lzlszvlmgolwwgso-dot-millinium.ey.r.appspot.com
  lzmmubzsrxcwgxak-dot-millinium.ey.r.appspot.com
  lznceuul.dogestocks.com
  lzniemisdnkvdscj-dot-millinium.ey.r.appspot.com
+lznmbsyktjpsybupmguehkqmin-dot-gl9393jan.uk.r.appspot.com
  lzom.000webhostapp.com
  lzopwahqjr.web.app
  lzpmnqxzlchfaqtc-dot-millinium.ey.r.appspot.com
@@ -186993,6 +202765,7 @@ lzurfwdtruotpunq-dot-millinium.ey.r.appspot.com
  lzvqsazzmrgdfhev-dot-millinium.ey.r.appspot.com
  lzvzs.codesandbox.io
  lzwqhxptbziano.serveirc.com
+lzwqwtjwuloqwwlnilpfvkkvaz-dot-gl9393jan.uk.r.appspot.com
  lzxkvwzjatfvzfom-dot-millinium.ey.r.appspot.com
  lzxlmy.com
  lzxsw100.com
@@ -187264,7 +203037,6 @@ m.facebook-profile.aslambari.com
  m.facebook-profile.gammaheightsengineering.com
  m.facebook-verify-page383568378.jmtobacco.com
  m.facebook.apps.hormigasgo.com
-m.facebook.autenticationtokenid.coalcoman.net
  m.facebook.business.pers3467.com
  m.facebook.business.policy25364.com
  m.facebook.check.com.chkk2981.com
@@ -187502,6 +203274,7 @@ m.geniushomes.in
  m.genovesevanderhoof.com
  m.ginosofportwashington.com
  m.gmailmx.com.qdmai.xyz
+m.gpt55.com
  m.gucac.com
  m.ham9222.com
  m.haojiedq.com
@@ -187569,6 +203342,7 @@ m.kgb0zfd.icu
  m.kgesq.com
  m.kvl3963.com
  m.kvm9723.com
+m.lkm8995.com
  m.lkp2333.com
  m.lks2983.com
  m.lmax-china.xyz
@@ -187663,6 +203437,7 @@ m0h.net
  m0hf.mentriqq.com
  m0nanza843.xyz
  m0pedx9.ru
+m0qx0.app.link
  m0rn2g9j.firebaseapp.com
  m0rx1.nicedayjp.com
  m0s3b.mentriqq.com
@@ -188348,6 +204123,7 @@ magsafe-apple.com
  magseal.com
  magungappsstore.manximanzsu.com
  magusenergia.com.br
+magwstfxbltxjtrttkdhopajba-dot-gl9393jan.uk.r.appspot.com
  magzsummary.ga
  mah0ney.com
  maha.co.il
@@ -188496,6 +204272,7 @@ mail.accountprotection.co.uk
  mail.accountsnew.trafalgarprojects.com
  mail.accountupdateinfo.com
  mail.accountverification.online
+mail.acctn.com
  mail.aceccap.com
  mail.acvh.us
  mail.adamsarch.com
@@ -188548,6 +204325,7 @@ mail.ayojoin.whatsapp-100266.tk
  mail.bangkokbankltd.net
  mail.bank-info-verify.com
  mail.bankingloginersystem.com
+mail.bankprotectionuk.com
  mail.bapakkau-kali555.asli20.com
  mail.barmaestros.com
  mail.bbglowfrance.fr
@@ -188623,7 +204401,6 @@ mail.cnbhzd.com
  mail.codashop-uygoblok.join-grupnew.my.id
  mail.com-whattsap.v7z.shop
  mail.cometak2.com
-mail.confirm-mynew-tranfers.com
  mail.connectibtinterauth.com
  mail.coolstufffromken.com
  mail.coronafundme.com
@@ -188804,7 +204581,6 @@ mail.ing-klant-alerts.xyz
  mail.inicio-appbanrural-plataforma.com
  mail.instagram-endorse.verifiedcenter.tk
  mail.instagramcopyright.ir
-mail.instagramcustomsupport.ml
  mail.instagramendorse.verifcenterig.tk
  mail.instargm.com
  mail.integratedsg.com.au
@@ -188910,7 +204686,10 @@ mail.mrdizi.com.au
  mail.msnllc.com
  mail.mxonline23.com
  mail.my-appleid.in
+mail.mydevice-authorisation.com
  mail.myee-billing-verify.com
+mail.myee-updateinfo-billing.com
+mail.myo2-billing-error28.com
  mail.myo2-billing-error83.com
  mail.mypayee-cancel.com
  mail.mypayee-login.com
@@ -188922,6 +204701,7 @@ mail.neve-indoor.nl
  mail.new-payee-error.info
  mail.new-threebill.com
  mail.new-unusual-activity.com
+mail.newdevicederegistration-online.com
  mail.newgrub.xxx-wa.com
  mail.newhavenrestoration.org
  mail.newpayee-notification.cc
@@ -188956,7 +204736,6 @@ mail.payee-check-online.cc
  mail.payee-online-security.org
  mail.payeehelp-guide.com
  mail.payeeremoval-emergency.cc
-mail.paymentauth-payeer.com
  mail.payments-viewpayees.com
  mail.paypal-limitedaccess.com
  mail.paypal-recovery-support.gleeze.com
@@ -189360,6 +205139,7 @@ mailfast.co.uk
  mailgoi001.applestore-id-apple.com
  mailgrupobancolombia.online
  mailguard.ie
+mailgw.royal-eng.ps
  mailhost.royal-eng.ps
  mailiaatt.weebly.com
  mailiattt.weebly.com
@@ -189383,9 +205163,11 @@ mailliiatt.weebly.com
  mailliveoutlook.netlify.com
  mailllaatt.weebly.com
  mailloginmicrosoft.wixsite.com
+maillssuio.cam
  mailmarketingworlddoc.live
  mailmarketingworldmax.info
  mailmatt.weebly.com
+mailmboya.eu-gb.cf.appdomain.cloud
  mailmejoresvendedores.com.ar
  mailms.yolasite.com
  mailmustang.com
@@ -189674,6 +205456,7 @@ makkiya.ca
  makkupaiyan.com
  maklryanb.com
  makmurusa.com
+makopse-y-denisa.ru
  makosoft.hu
  makoto-osaka.com
  makpar.net
@@ -189697,6 +205480,7 @@ mal-42574997.itugolhelp.com
  mal-62116981.itugolhelp.com
  mala-riba.com
  malachite-rural-gander.glitch.me
+malachyobodo.000webhostapp.com
  malagaminibus.com
  malaisewheelchairfitness.com
  malajsie.webzdarma.cz
@@ -189720,6 +205504,7 @@ maleexcellhealth.com
  maleficentslovely.000webhostapp.com
  malejaduff.com
  malencacom.baerseventake.top
+malepause.buzz
  malepenet.xyz
  maleposer.com
  malerbetriebbandcom.shaxiaact.top
@@ -190254,6 +206039,8 @@ maneger-amazonsecureteam999847234434.gleeze.com
  manegers-amazonsecurecodeplay88897544521.gleeze.com
  manejfsztgsmatio-dot-millinium.ey.r.appspot.com
  manerck.com
+maneuverable-freeze.000webhostapp.com
+manextrapro.buzz
  manferesquadrias.com.br
  manfith.com
  manga-gaysex.com
@@ -190270,6 +206057,7 @@ mangasaurgames.com
  mangateon.com
  mange-gode-blogs.dk
  mange.google.com.brunocpa.com
+mangeractivityalerthomeconnectmailsuppertygugugu.000webhostapp.com
  mangero.xyz
  mangiamoresto.com
  mangiest-son.000webhostapp.com
@@ -190420,15 +206208,19 @@ manuscript.ge
  manutencaodigital-app.com
  manutencaoitauchecks.com
  manutenzione-anagrafica.com
+manutenzione-web-conto.com
  manutouchmassage.com
  manuyala.com
  manxen.com
+manxtwo.buzz
  manxz.duckdns.org
+many.abbyservertime.fun
  manychatonline.ga
  manygoats.fun
  manymanycrotahiahi.000webhostapp.com
  manzana-gray-smith-burlon.vercel.app
  maoazmn.cc
+maoism-torque.000webhostapp.com
  maokaicom.batwoqisellers.top
  maolixin.com
  maoljovlbghjdftx-dot-millinium.ey.r.appspot.com
@@ -191011,6 +206803,7 @@ marketplace-item-458659.com
  marketplace-item-47362462.com
  marketplace-item-4754762.com
  marketplace-item-485738.com
+marketplace-item-523121.cndigisol.com
  marketplace-item-5473621.com
  marketplace-item-5676523.com
  marketplace-item-5745874.com
@@ -191736,7 +207529,6 @@ massanuttenbikerental.com
  masscorporation.in
  massdepiedra.com
  massdisp.com
-massengernic-support.tk
  masserviciosgron.webcindario.com
  massessnd.com
  massgames.net
@@ -191752,6 +207544,7 @@ massivelights.net
  massivenoise.icu
  massivewebtech.com
  massivholzdielenfussbodenheizungcom.shaxiaput.top
+massngger.github.io
  massomsadarpuri.com
  massplugs.com
  masswisscolor.com
@@ -191920,6 +207713,7 @@ matongjia.com
  matorolamagalu.myvnc.com
  matphilip.com
  matque.com
+matrialupweapon.com
  matrin.com.au
  matriskurs.com
  matrix-partners.theworkpc.com
@@ -191968,7 +207762,6 @@ maturingmold.net
  matute.com.br
  matutina.mg.gov.br
  matutinal-deserters.000webhostapp.com
-mau-pumd.my.id
  mauiairportcabco.com
  mauimassages.top
  mauinibkp.toh.info
@@ -192227,6 +208020,7 @@ mbmaquila.com.py
  mbmarquitectos.com.pe
  mbmfirepyn.top
  mbmicc.org
+mbmywaaukbwswcqofhsoicycxb-dot-gl9393jan.uk.r.appspot.com
  mbnbowwjnjfqssso-dot-millinium.ey.r.appspot.com
  mbnd.svcoding.com
  mbniorhdmsnqsxsilvydcywvbp-dot-gleowayel400503.uc.r.appspot.com
@@ -192234,6 +208028,7 @@ mbnq.svcoding.com
  mboavision.rodevdesign.com
  mbos.in
  mbpgmqwmkzyqejuodkevzqnihv-dot-gleowayel400503.uc.r.appspot.com
+mbpkiycbxjchksefknzwwflqdk-dot-gl9393jan.uk.r.appspot.com
  mbpp4z53awlpj8.easy.co
  mbq43.mentriqq.com
  mbqyqeoawwqjifdevuvzctexpv-dot-gloff849483.uk.r.appspot.com
@@ -192389,6 +208184,7 @@ mddesqifmbhiffbm-dot-millinium.ey.r.appspot.com
  mdeaankrdtpxeiuzmjmwidisnu-dot-gleowayel400503.uc.r.appspot.com
  mdeletro.com.br
  mdevents.in
+mdfltlpayoakatqpsvxubdggba-dot-gl9393jan.uk.r.appspot.com
  mdgopbpyqwqrlnmaoxknhsotwj-dot-gleowayel400503.uc.r.appspot.com
  mdgphotos.com
  mdgretailer.com
@@ -192419,6 +208215,7 @@ mdp.mg
  mdp11.000webhostapp.com
  mdprobuilders.com
  mdqassessing.co.za
+mdqsrcpfcmpzcnvctyydnzmvso-dot-gl9393jan.uk.r.appspot.com
  mdqylnxapiqlawdwrcwozvjcmtpxxhpzdfmx-dot-cryptic-now-290917.ey.r.appspot.com
  mdrcqa.shoesmogul.com
  mdrealtor.in
@@ -192464,6 +208261,7 @@ meanbusinwith.com
  meanbuyer.guru
  meaningfulfutures.org
  meankinddatabases.angueluisreyama.repl.co
+meanstruth.buzz
  mearchaer.xyz
  mearile.live
  meartitalo.com
@@ -192704,6 +208502,7 @@ meet-realtor.ca
  meetabansal.in
  meetabella.com
  meetbg.com
+meetentry.buzz
  meeting-23900123090123.bitbucket.io
  meeting-bonus.web.app
  meeting.azurefd.net
@@ -192842,6 +208641,7 @@ meilleuremployeuraumaroc.com
  meilleurscrus.com
  meilleurskills.in
  mein-dkb2020-online.preview-domain.com
+mein-eu-blog.de
  mein-konto-einloggen.com.de
  mein.gmx.de.bbm.co.nz
  mein1fs3v4.firebaseapp.com
@@ -192995,6 +208795,7 @@ membranced.xyz
  membrunescape-bonds.com
  memdrops.com
  memeklaudha.takonjebol.com
+memeklia.000webhostapp.com
  memekmerah.000webhostapp.com
  memeksienakskalicok.linkthroughapple.com
  memeofalbanians.000webhostapp.com
@@ -193338,7 +209139,6 @@ messebauleipzigorg.shaxiacd.top
  messelive.tv
  messenger-chat.com
  messenger-m.to
-messenger-updates.ga
  messenger.appliveplays.xyz
  messenger.mobile-loginpage.com
  messenger.zango.com
@@ -193447,7 +209247,7 @@ metropolitanogoiania.com.br
  metropolitanpropinc.serveirc.com
  metropubgm.com
  metropubgm16.dnset.com
-metropubgx.com
+metroroyaleexodus.com
  metroroyalepubgm.com
  metroroyalprize.jetos.com
  metrospesial.com
@@ -193475,6 +209275,7 @@ meu-itaunet4-sempre-com-voce-nesse-momento.000webhostapp.com
  meu-porta-net1-itauweb3-portal-a-p-p-net.000webhostapp.com
  meu2-portal-facil-itaunet-web3.000webhostapp.com
  meuacesso-app.com
+meuacessodigital-app.com
  meuandnv.goruli.com
  meuauxilio.com
  meubbfacesage.ga
@@ -193523,6 +209324,7 @@ mewduei.com
  mewijtaku.brandstorez.su
  mewolters.nl
  mewpservices.ie
+mewx.buzz
  mexalzzy.000webhostapp.com
  mexcorp.net
  mexicocomix.com
@@ -193602,11 +209404,13 @@ mffox.vipsnapchatsexting.com
  mffyjcdn.btgame.com
  mfgehfkq.vipsnapchatsexting.com
  mfgirt5oldertexer4te45rnvchjdrtfhysxdrfgsetgdsfgvg.2waky.com
+mfiizcpxpwtbeokgzrihtbywsd-dot-gl9393jan.uk.r.appspot.com
  mfinance.in
  mfingers.com
  mfj222.co.za
  mfjfhfjfkghgfgfhf.weebly.com
  mfkj02.top
+mfkjkrezutqhmycwjngjilqpne-dot-gl9393jan.uk.r.appspot.com
  mflogistics-my.com
  mflswbfbidjdsjby-dot-millinium.ey.r.appspot.com
  mfm-ca.com
@@ -193694,6 +209498,7 @@ mgv-unterschoenmattenwag.eu
  mgvpbqhyesfdeuzwbtrwuuixrf-dot-gleowayel400503.uc.r.appspot.com
  mgvrqweeaatisdu.top
  mgxoqtgncbdphpqn-dot-millinium.ey.r.appspot.com
+mgxxwkevsknbmafzgvrnpyrldd-dot-gl9393jan.uk.r.appspot.com
  mgy.yiq.me
  mgyuefgzoxeqwawb-dot-millinium.ey.r.appspot.com
  mgzfdkeiovwyeoqd-dot-millinium.ey.r.appspot.com
@@ -193734,6 +209539,7 @@ mhmwypnighdwotsj-dot-millinium.ey.r.appspot.com
  mhncms.com
  mhni.xyz
  mhnrw.com
+mhobeyrcgvmlkfwhsmpmuhntnn-dot-gl9393jan.uk.r.appspot.com
  mhodols-dhoangksh13.3utilities.com
  mhomemklocosseer.com
  mhoptions.com
@@ -193999,12 +209805,12 @@ microsoft.officedocuments.me
  microsoft.sendsmtp.com
  microsoft.systeminfo.tk
  microsoft1.serving-secure.com
-microsoft1245.s3.us-east.cloud-object-storage.appdomain.cloud
  microsoft23-uslive4.online
  microsoft365faxxx.weebly.com
  microsoft365voicemails.weebly.com
  microsoft47.yolasite.com
  microsoftaccountsecurityportal.wl.r.appspot.com
+microsoftadminhelpdesk.000webhostapp.com
  microsoftbillingsys.com
  microsoftcenter.co
  microsoftcloud.yolasite.com
@@ -194075,7 +209881,6 @@ midak-photography.com
  midas-buys15.jetos.com
  midasbuy-official.ga
  midasbuy9.com
-midasbuyeventsnow.com
  midasbuygift.com
  midasbuyo.com
  midasbuypubg15.zyns.com
@@ -194519,6 +210324,7 @@ minerkg.myjino.ru
  minerro23x.ga
  minervaadvisors.com
  minerways.xyz
+mines.abbyservertime.fun
  mineservice.top
  minesports.biz
  minet.nl
@@ -194776,9 +210582,11 @@ missourisolarenergycontractors.info
  missp.net
  misspetitebuenavista78.000webhostapp.com
  missstarletinternational.com
+misstayuui.cam
  missunderstood1.com
  missyhydrick.com
  mistakement.com
+mistbundle.guru
  mistcinemas.com
  mistercertified.net
  misterix.duckdns.org
@@ -194985,6 +210793,7 @@ mkenlee250.000webhostapp.com
  mkfaoieplu.topkorder.su
  mkfiuozihphfigjt-dot-millinium.ey.r.appspot.com
  mkfpaxpfku.duckdns.org
+mkfxcnngkvnnjuwwwsewyujaqo-dot-gl9393jan.uk.r.appspot.com
  mkgbcsnacazextsohyjfjqyaugzgfwxxtztv-dot-solar-vertex-285913.rj.r.appspot.com
  mkgsqmplyh.duckdns.org
  mkhi.stxbamt.cn
@@ -195036,7 +210845,6 @@ mktting.com
  mkudjgeq.goruli.com
  mkupd6564.com
  mkvfkertyqeegswmqlbjcubbfd-dot-gloff849483.uk.r.appspot.com
-mkvkvvcthljbprbu-dot-revalidate-icaan-domain.ue.r.appspot.com
  mkwwvijviv.duckdns.org
  mkyntxnmegeqgtjl-dot-millinium.ey.r.appspot.com
  mkyw.addroits.com
@@ -195124,6 +210932,7 @@ mlpcollection.com
  mlpporn.com
  mlribeiro.pt
  mlrodasepneus.com.br
+mls.ad.jp
  mlskin-free.my.id
  mlskitchensmanchester.com
  mltdolnglexkrnknkcndcvwfepuxwetirghk-dot-offglen.uk.r.appspot.com
@@ -195159,7 +210968,6 @@ mmaju.top
  mmakaronagre.xyz
  mmambala.org
  mmanueud.tk
-mmaonlinegear.info
  mmarau.ac.ke
  mmasenger.buzz
  mmasenger.xyz
@@ -195225,6 +211033,7 @@ mmnaggtstg.duckdns.org
  mmnresort.com
  mmnrsmrdyuycdxko-dot-millinium.ey.r.appspot.com
  mmnskehnbbbs.in
+mmnwbcnvzqrudelexvqgmfggho-dot-gl9393jan.uk.r.appspot.com
  mmo.martinpollock.co.uk
  mmobillbahis233.com
  mmobilleitaucardonline.com
@@ -195511,7 +211320,6 @@ mobile-halifaxveirfy.com
  mobile-identification-vocal00.webnode.sk
  mobile-info-wells-fargo.com
  mobile-instagramaid.com
-mobile-internet-fixe.weebly.com
  mobile-kleinanzeigen.de.m-elnioggen.de
  mobile-legend-bangbanghero.ezua.com
  mobile-legends-bagi2-hadiah.my.id
@@ -195577,6 +211385,7 @@ mobile.ifacebock.com
  mobile.lnstagram.com.toufikk.com
  mobile.mfrga3inlakmok.com
  mobile.sccom.cn
+mobile.virgin-bill.com
  mobile.virginmedia-ecare.com
  mobile.virginmedia.auth-v.com
  mobile.wellsfargo.com-account.verif.singinwfs.xyz
@@ -195647,6 +211456,7 @@ mobileapp-security.com
  mobileapp.help
  mobileapplicationdevelopment.co.uk
  mobileappupdatehalifaonlinesecure.app
+mobileat-fb-item279809010.com
  mobileatualizacao.com
  mobileauth.co
  mobileauto-services.co.uk
@@ -195874,6 +211684,7 @@ modernofficedecor.com
  modernrattan.com
  modernsfoodproducts.com
  modeschmuckankaufcom.chifanassume.top
+modest-colden-5017d6.netlify.app
  modest-murdock-a959b2.netlify.app
  modest-yonath-531225.netlify.app
  modestclouds.eu
@@ -195974,6 +211785,7 @@ moheedeb.com
  mohgo.org
  mohidigi.com
  mohinhgohandmadedtoys.com
+mohiteddd.cam
  mohitranpura.com
  mohrcircle.icu
  mohrislands.buzz
@@ -196046,6 +211858,7 @@ moldgbc.org
  moldkey.com
  moldremovalsquad.top
  moldxusa.com
+mole24.buzz
  moleculelabs.co.in
  molen-desire.nl
  moleomar.com
@@ -196388,6 +212201,7 @@ moqsocial.com
  moquite.ga
  moradikermani.oilyplus.ir
  moragphotography.co.uk
+moral-crown.000webhostapp.com
  moraniz.co.il
  morasergiox.ac.ug
  moratdss.spiekermann-porzellan2.de
@@ -196632,6 +212446,7 @@ mouood.ir
  mouredon-couverture.com
  mourndeclination.com
  mourningwood.org
+mouseact.guru
  mousedot.de
  mousepad-direkt.de
  moustirko.theworkpc.com
@@ -196768,13 +212583,16 @@ mpmlco.com
  mpmyejy3.firebaseapp.com
  mpn.org.in
  mpnamnbbxeymlkzc-dot-millinium.ey.r.appspot.com
+mpnnsjoigqexfgyhusvlbzvdmk-dot-gl9393jan.uk.r.appspot.com
  mpnutaxcsdbbnaavzt.top
+mpomxsgmycvkdlzhtettpqefvq-dot-gl9393jan.uk.r.appspot.com
  mpoodsine.com
  mpounta-donuts.gr
  mppaccche.com
  mpparagon.com
  mppowerservices.com
  mpress.com.br
+mprhnkmqgwkijlfhwwjgbrmdgm-dot-gl9393jan.uk.r.appspot.com
  mps-attiva-sicurezza.000webhostapp.com
  mps-gruppo.com
  mps-italy-cartetitolari.ssl443.org
@@ -196917,7 +212735,6 @@ mrshare.info
  mrsjenkinsclass.com
  mrsnor.org
  mrsplans.net
-mrsquarmas.com
  mrssgroup.com
  mrssmartlys.com
  mrstuzzichini.com.au
@@ -196970,7 +212787,6 @@ msblatne.sk
  msbtbqsonqhxtlkl-dot-millinium.ey.r.appspot.com
  msbuyl.com
  mscbsgob-es.social
-msceoconnections.com
  mscni.org
  msconsultants.co
  msctombola.com
@@ -197115,7 +212931,6 @@ msssszvvfifgqpusjjmrrjacfbmrifsvzxio-dot-cryptic-now-290917.ey.r.appspot.com
  msstrustsgroupe.family
  mssvuthmsvsv.azurewebsites.net
  mssystems.com.pk
-mstaff.klikbsi.id
  mstxepxtkdekbdnh-dot-millinium.ey.r.appspot.com
  mstxqvytnnprlbvhdrowtiewcl-dot-gloff00403993445.uk.r.appspot.com
  msuclanac.onmicrosoft.com.inboxreadl.icu
@@ -197375,6 +213190,7 @@ multimarine.com.br
  multimediamouth.com
  multimix.hu
  multinet.in.ua
+multiplans.buzz
  multiplataformadigital.com
  multiplestreamsmastery.com
  multipontos-multiexpirando.center
@@ -197448,6 +213264,7 @@ muntanic.com
  munteanuion.com
  munyfvhbeymziwle-dot-millinium.ey.r.appspot.com
  muondietiepquadi.cf
+muoostyaa.cam
  mup.goruli.com
  mupeci.net
  muplizonasegvrabnmuy01.xyz
@@ -197502,6 +213319,7 @@ musesmilos.gr
  museumszambia.org
  museumtheoriginal.com
  mushafiqsultan.com
+mushaiioo.cam
  music-appstore.i7cgiv01.info
  music-for-events.com
  music-hnmgfy5ei2-7fjq4c5vz.vercel.app
@@ -197694,6 +213512,7 @@ mwrc.ca
  mwreyejbbjsqetsgcj.top
  mwvauhexxqvevbxuat.top
  mwvbxtrlhfabonto-dot-millinium.ey.r.appspot.com
+mwvsbhvfniyxjrpilmbbvifrxh-dot-gl9393jan.uk.r.appspot.com
  mwww.ecure.runescape.com-xu.top
  mwxbuptyzasqfpowklhlkvriotpjewxxszzj-dot-glxcel49934343434.rj.r.appspot.com
  mwyxoeenttpailsd-dot-millinium.ey.r.appspot.com
@@ -197872,7 +213691,6 @@ my-newtransactions.org
  my-o2-account.com
  my-o2-billing.com
  my-o2-profile.com
-my-o2billing-info.com
  my-online-ee.org
  my-onlineverify.webredirect.org
  my-p4nel.net
@@ -197970,8 +213788,6 @@ my.ee-billingfailed.com
  my.eebill.club
  my.hmrc-taxclaim.com
  my.instagram.com.login.page.jmz.ir
-my.jcb.co.domianshosting.buzz
-my.jcb.co.dtcbxf.com
  my.jcb.co.jp.365huyu.com
  my.jcb.co.jp.aogo.vip
  my.jcb.co.jp.celija.com
@@ -197996,7 +213812,7 @@ my.jcb.co.jp.wbin.top
  my.jcb.co.jp.xsltjt.com
  my.jcb.co.jp.yulion.vip
  my.jcb.co.jp.yxjcd.com
-my.jcb.co.sjztxj.com
+my.jcb.countdomaailpartdate.ml
  my.mzhrbs.work
  my.nativeforms.com
  my.navyfederal.databig1.xyz
@@ -198059,6 +213875,7 @@ my3-billing-check.com
  my3-billing-id226.net
  my3-billing-issue.com
  my3-billing-issue.online
+my3-billing.uk
  my3-billing238.com
  my3-billingerroruk.xyz
  my3-billinghelp.com
@@ -198113,7 +213930,6 @@ my3-restriction.co.uk
  my3-secure-login-details.com
  my3-securedsite.com
  my3-securelogin.com
-my3-securepayment.com
  my3-security.com
  my3-support-team.com
  my3-support-uk.com
@@ -198127,7 +213943,6 @@ my3-update-bill.com
  my3-update-information.com
  my3-updatebill.com
  my3-updatebilling.link
-my3-updatebilling.org
  my3-updatelogin.com
  my3-updatepay.com
  my3-updates-billing.com
@@ -198209,7 +214024,6 @@ my3billingupdates.com
  my3bills.co.uk
  my3billupdate.net
  my3ddreams.com
-my3drenderings.com
  my3log-in-secure.com
  my3log.co.uk
  my3management.com
@@ -198385,6 +214199,7 @@ myattmailcenter.weebly.com
  myattmailupdate-newmaillookinterface.weebly.com
  myattmyhomepaehddh.weebly.com
  myattnlf.com
+myattnow.weebly.com
  myattonlineservices.weebly.com
  myattonlineverification.weebly.com
  myattonlinverificationcenter.weebly.com
@@ -198597,7 +214412,6 @@ myee-support.uk
  myee-supports.000webhostapp.com
  myee-uk-billing-error.com
  myee-uk-billing.com
-myee-uk.com
  myee-uk.user-id0120.com
  myee-uksupport.com
  myee-verifybill.com
@@ -198646,6 +214460,7 @@ myeebillingupdate.com
  myeebills.billingsuk-ee.net
  myeebillupdate.com
  myeehelp.000webhostapp.com
+myeeonline-account.com
  myeeonline.cc
  myeeonlinelogin.com
  myeeprotect.com
@@ -198821,7 +214636,6 @@ myjcb.update.co.jp.myjcb-service.top
  myjcbs-members.fsaiche.com
  myjcbs.com
  myjcbs.zhandiguo.com
-myjdrhupusamfxux-dot-revalidate-icaan-domain.ue.r.appspot.com
  myjedesigns.com
  myjghqyzuiflcuiw-dot-millinium.ey.r.appspot.com
  myjuhe.com
@@ -199110,6 +214924,7 @@ myserviceproduc.com
  myservices-eehub.com
  myservices-mobile.com
  myservices.live
+myshedoaplanjs.us
  myshop-bgj604.myinsales.ru
  myshop.yo.fr
  myshsedpladuys.us
@@ -199491,7 +215306,6 @@ n5fp.addroits.com
  n5hk.jaysbrand.com
  n5k71.mentriqq.com
  n5rmvwzz6sdw.talagaremix.com
-n5tuf.app.link
  n5yh4tev.gb.net
  n5zgk.awaykart.com
  n5zx3.awaykart.com
@@ -199646,6 +215460,7 @@ nabitita1870.blogspot.no
  nabitita1870.blogspot.se
  nabjsouthflorida.com
  nabprotect.info
+nabrsfyhrclgjwdvcagebeyxie-dot-gl9393jan.uk.r.appspot.com
  nabs.live
  nabsecure.info
  nabsecuredonline.au-ib.cf
@@ -199786,6 +215601,7 @@ nakedlove.co.uk
  nakhonsawangames.com
  nakitrade.com
  nakrutkavk.live
+nakrytkains1.000webhostapp.com
  nakshadekho.com
  nakupenda.ml
  nakupnikartarka.cz
@@ -199960,6 +215776,8 @@ nasabonebolango.com
  nascar-info.net
  nascentayur.com
  nasekaxtjrldmyxerhrrjblaytcefhwqybxi-dot-glegen303939423233.ue.r.appspot.com
+nashauiuii.cam
+nashc.net
  nashikehayuomu.xyz
  nashikproperty.tk
  nashobmenfiles.com
@@ -200049,6 +215867,7 @@ nationalfinancedaily.icu
  nationalflaggenorg.shaxiaadd.top
  nationalhhca.com
  nationallife.casa
+nationalnose.guru
  nationalnutritionnetwork.com
  nationalpensionersfederation.ca
  nationalpeo.com
@@ -200486,6 +216305,7 @@ ncid.bc.ca
  nciwc.us
  ncj.shoesmogul.com
  ncjaqbmpjzbdxtuj-dot-millinium.ey.r.appspot.com
+ncjrdqtnqyglawcjcbqwktfxzx-dot-gl9393jan.uk.r.appspot.com
  ncjxmgemhraxvpdt-dot-millinium.ey.r.appspot.com
  nckeajgpwzbfpjvxfpcsqmcqawcv.top
  nckfle0095275raydl0394832020.nn.r.appspot.com
@@ -200508,6 +216328,7 @@ ncqewupitbavqorhkieqcjpncf.triple-upgrade-293822.rj.r.appspot.com
  ncr.shoesmogul.com
  ncrdress.com
  ncrhycgrjgrjfcfgtrvr.weebly.com
+ncridrqnsngmycjirboapuldbq-dot-gl9393jan.uk.r.appspot.com
  ncronline.in
  ncs-graphic-studio.com
  ncsabecwvpanrxbc-dot-millinium.ey.r.appspot.com
@@ -200519,6 +216340,7 @@ ncshmesh.com
  ncsn.cf
  ncstechnoled.ru
  ncsu.org.ng
+nctemrctyokoieljymmpstmbbo-dot-gl9393jan.uk.r.appspot.com
  ncthufaskruclsbbhhdyyzdhtw-dot-gloff849483.uk.r.appspot.com
  nctrqj.com
  ncuccr.org
@@ -200581,6 +216403,7 @@ ndronhqhiwalmbth-dot-millinium.ey.r.appspot.com
  ndrs.cloud
  ndsaert768.cloudaccess.host
  ndsfeo.com
+ndsmodecmjnwdahqnliwlgnhiu-dot-gl9393jan.uk.r.appspot.com
  ndt-college.kz
  ndtgt.in
  ndtpwbjayljgwxnbrbezfmgukvfpgiixraqg-dot-offgl8876899977678.uk.r.appspot.com
@@ -200630,6 +216453,7 @@ neciwear.com
  neckedexpress.com
  neckezwtqfbmpkwn-dot-millinium.ey.r.appspot.com
  necklacesusa.000webhostapp.com
+necklock.casa
  necla.co.ke
  necmettinozlu.com
  necmtbswuaeujblk-dot-millinium.ey.r.appspot.com
@@ -200644,6 +216468,7 @@ nedaelwatan.com
  nedbank.com-web.xyz
  nederland.verhuur.facebook.marketplace.com.50481.space
  nedirien.uno
+nedirien.website
  nedisnive.ml
  nedorim.top
  nedoru2.gq
@@ -200973,7 +216798,6 @@ netfelixx.com
  netfiilx.net
  netfiix-com.com
  netfiix-memb-ca.com
-netfiix.portal-o.com
  netfilx-billingupdate.com
  netfilx-com.org
  netfilx-membersubsription.com
@@ -201020,6 +216844,7 @@ netflix-billing-renew.com
  netflix-billing-resolve.info
  netflix-billing-verify.com
  netflix-billing-vrf.com
+netflix-billing.link
  netflix-billing.org
  netflix-billing.uk
  netflix-billingerroruk.com
@@ -201042,7 +216867,6 @@ netflix-chance.com
  netflix-chile.com.sitiocrvzkr.com
  netflix-cl.com.pagogruhrs.com
  netflix-client-payment.movietvplans.online
-netflix-com.com
  netflix-comm.serveirc.com
  netflix-compte-gratuit.streamto.cc
  netflix-contact.info
@@ -201153,6 +216977,7 @@ netflix-securepage.com
  netflix-securesubscription.com
  netflix-secureverify.com
  netflix-security-help.com
+netflix-security.fr.web78bf8aeee87a.my-phsite.com
  netflix-securlty.com
  netflix-service-uk.com
  netflix-service.club
@@ -201203,7 +217028,6 @@ netflix.accouns.cc
  netflix.account-security-information-preventing-blocked.center
  netflix.account-summary-resolutioncenter.com
  netflix.account.storeiphone.net
-netflix.alexfilipealves.com
  netflix.allfree.live
  netflix.billing-changes.com
  netflix.billing-error.co.uk
@@ -201570,6 +217394,7 @@ neuor-71.tk
  neupane.com.np
  neuplastlcs.com
  neuralmapper.com
+neuroaclamekjaprios.us
  neurocir.cl
  neuroen.de
  neurolat.id
@@ -201584,6 +217409,7 @@ neurotransmitter.xyz
  neurotropic-dips.000webhostapp.com
  neuschelectrical.co.za
  neusoftware.com
+neuswrjfpegancqrbodykxgqyt-dot-gl9393jan.uk.r.appspot.com
  neutralsources.com
  neutrondad.com
  neutrum.pl
@@ -201607,7 +217433,6 @@ nevsunca.com
  nevyuty.co.uk
  new-0fficewk-8732masu3.pagedemo.co
  new-3-billing.com
-new-3-login.com
  new-3updated.com
  new-55.com
  new-account-verification.mypi.co
@@ -201618,6 +217443,7 @@ new-attempted-login.link
  new-center-fargo.work
  new-coronavirusmask.com
  new-credit.space
+new-dataregistration-hali.co.uk
  new-deregistered-device.com
  new-device-activity.link
  new-device-added.live
@@ -201627,7 +217453,6 @@ new-device-authorisation.com
  new-device-cancel.com
  new-device-login.com
  new-device-login.link
-new-device-payee-confirmation.com
  new-device-secure.com
  new-device-unsecure.com
  new-device-unusual.link
@@ -201922,6 +217747,7 @@ newgrupwhatsapp2.ml
  newhacker.kro.kr
  newhercoaching.com
  newhitak.com
+newhost.zapto.org
  newid-update.com
  newimprovement.nl
  newindraprasthagroup.com
@@ -202038,7 +217864,6 @@ newpayee-secured.com
  newpayee-securityvalidation.com
  newpayee-verifyalert.com
  newpayeeadd-secure.com
-newpayeealert.live
  newpayeecancel.net
  newpayeehalifax.com
  newpayeehelp-halifax.com
@@ -202070,6 +217895,7 @@ newproplaunch.com
  newpubgm16x.wikaba.com
  newpulsa.000webhostapp.com
  newratehub.com
+newrecipienthelp.com
  newreleasesbussniis.com
  newreleasesneakers.com
  newrem.duckdns.org
@@ -202254,6 +218080,7 @@ newupdate-alldomain.web.app
  newupdateappleid-apple.loseyourip.com
  newupdatelinksmoreyes.calcivicenginee.net
  newupdatemy3info.com
+newupdiatethroo1.000webhostapp.com
  newuploadswift.pw
  newupvaledateng.000webhostapp.com
  newuvolume2.com
@@ -202393,6 +218220,7 @@ nfsi.biogenicherb.com
  nfsports.biz
  nftlixsupps-019.myvnc.com
  nfvohxudnjzndenomxwkqqwzdk-dot-gleowayel400503.uc.r.appspot.com
+nfvqgeemzjwaymqhjzacruixyp-dot-gl9393jan.uk.r.appspot.com
  nfvztcrrkjejagup-dot-millinium.ey.r.appspot.com
  nfx-mgmteam.com
  nfx1-acc647.info
@@ -202444,6 +218272,7 @@ ngeweenak.sorehtrss.com
  ngeweyuk.join-wa.net
  ngezen.com
  ngfczzapsgntvrppdv.top
+ngflqmzcfvolbxtgybxxewrthc-dot-gl9393jan.uk.r.appspot.com
  ngfomwrnlewurgfw-dot-millinium.ey.r.appspot.com
  nggkfdxtfpdejzilwivrzrqsprnxawoavkdi-dot-solar-vertex-285913.rj.r.appspot.com
  nggt6c22.firebaseapp.com
@@ -202578,6 +218407,7 @@ nhlan.com
  nhlbqkbsrkzihlzv-dot-millinium.ey.r.appspot.com
  nhlnk.com
  nhms.solutions
+nhnlucpwtfhehxmcwcsxmsjbda-dot-gl9393jan.uk.r.appspot.com
  nhoanjrfjymrengp-dot-millinium.ey.r.appspot.com
  nhomkinhlongxuyen.com
  nhomtoan.net
@@ -202745,6 +218575,7 @@ nieuwe-betaalpas.nl162.ir
  nieuwe-ing-pas.online
  nieuweberichten.info
  nieuwste-info.nl
+nieuwtjeswebonline.eu
  nieversefa.com
  niewiarygodnie-zdarzenia.xyz
  niezezlepouldn.com
@@ -202875,6 +218706,7 @@ nin-sapo.or.jp
  nina-queen.com
  ninacucciopeck.com
  ninaflowersprofile.online
+ninageil.de
  ninasukash.com
  ninatrentmann.com
  nincinko.com
@@ -202989,6 +218821,7 @@ nivhvtfnvu.duckdns.org
  nivis.gr
  nivnpwpgrrwzavrxrwgfulndin-dot-gloff849483.uk.r.appspot.com
  niwa.oconavi.com
+niwrekrsdqqkbbowtrrjonsffk-dot-gl9393jan.uk.r.appspot.com
  nix4e.com
  nixamorealestateagent.com
  nixkbeyaxfvnlkwh-dot-millinium.ey.r.appspot.com
@@ -203075,6 +218908,7 @@ nkap.global
  nkausyrsbnmxaqfb-dot-millinium.ey.r.appspot.com
  nkax.svcoding.com
  nkbanks.com
+nkbkfjkelhsczkmxphlfyhajtq-dot-gl9393jan.uk.r.appspot.com
  nkcceuin2udd.talagaremix.com
  nkcoupon.com
  nkdctrust.in
@@ -203215,6 +219049,7 @@ nmdservices.com
  nmediiehwhzvxcqrkvgupjtqjhzonapeaeoq-dot-glxcel49934343434.rj.r.appspot.com
  nmetqrubkuxhgucpowcwcuwwpd-dot-gleowayel400503.uc.r.appspot.com
  nmfggt.com
+nmgfhqpisuethlpdqntowtqkyy-dot-gl9393jan.uk.r.appspot.com
  nmhsu.xyz
  nmiec.com
  nmjvcvtgptltppul-dot-millinium.ey.r.appspot.com
@@ -203235,6 +219070,7 @@ nmplluc.cn
  nmpp.com.ua
  nmqvzsx.cn
  nmqxs.goruli.com
+nmrgadhenozgufibxvacmcbwne-dot-gl9393jan.uk.r.appspot.com
  nmsin292o4k3ju2yvkap7p.creativetutors.com
  nmsoia.duckdns.org
  nmsuh.xyz
@@ -203396,6 +219232,7 @@ nocontent-algwofjz.velocityhub.com
  nocontent-bbpcytxb.velocityhub.com
  nocontent-ctiezzsv.velocityhub.com
  nocontent-dwpmcmyu.velocityhub.com
+nocontent-fnhqeato.velocityhub.com
  nocontent-giffgiso.velocityhub.com
  nocontent-gqmwtfmh.velocityhub.com
  nocontent-gyuenowf.velocityhub.com
@@ -203431,7 +219268,6 @@ nocontent-syrxvomx.velocityhub.com
  nocontent-tnxsqiil.velocityhub.com
  nocontent-uibuwpss.velocityhub.com
  nocontent-upjhiolu.velocityhub.com
-nocontent-uropvkux.velocityhub.com
  nocontent-uvkquxnm.velocityhub.com
  nocontent-uvonrmnz.velocityhub.com
  nocontent-uxvxklgg.velocityhub.com
@@ -203472,6 +219308,7 @@ nodep-games.com
  nodetectshere.top
  nodets-huaoptcioo.cikaperformance.ma
  nodets-ykqtmtqjkd.cikaperformance.ma
+nodipt.com
  nodraumafion.ga
  nodreamco.com
  noe-fbv2.ddnslive.com
@@ -203667,6 +219504,7 @@ noonasimo.cloudaccess.host
  noonbir.com
  noonle.xyz
  nooo11.ddns.net
+noops-stil.web.app
  noor.me.ke
  nooragifts.com
  noorrik.com
@@ -203756,6 +219594,7 @@ norcaltc-my.sharepoint.com
  nord.novalex.co
  nordebk.com
  nordeclairwbe.ru
+nordenlifescience.com
  nordenlifesciences.com
  nordesteirrigacao.com
  nordestmedical.ro
@@ -203792,6 +219631,7 @@ noreplypaypalus.serveirc.com
  noreplysecure-account.info
  noreplysignin.weebly.com
  noreplysigninatt1092.weebly.com
+noreplysupportattservice.weebly.com
  noreplyttehhdg.weebly.com
  noreportsapp.stallbrand.com
  norges-online.com
@@ -203807,7 +219647,6 @@ normativa-sicurezza-dati-info.org
  normativa-sicurezza-info.org
  normativa-sicurezza-web-info-dati.com
  normativaaggiornamento.000webhostapp.com
-normativaeuropea-aggiornata.com
  normativaeuropeapd2.info
  normativeappintesa.com
  normativevigenti.com
@@ -203887,7 +219726,9 @@ nossaslojas.tintasmc.com.br
  nossocentrogamek.com
  nossocombatecontraocorona.com
  nossocomecodesemanafeliz.com
+nostalgic-leavitt-6cfeb9.netlify.app
  nostalgic-lichterman-1412e9.netlify.com
+nostalgic-liskov-b4d36c.netlify.app
  nostalgic-sinoussi-6bc12b.netlify.app
  nostalgic-tin-heart.glitch.me
  nosub-3447084040.maylexdecor.com
@@ -204169,7 +220010,6 @@ noveamining.com
  novelcoronavirus.cc
  novelcoronavirusnews.xyz
  noveldocs.com
-novelelderlylocation.sdsdsdsd77dsdsd.repl.co
  novelideas.com
  novelindo.xyz
  novellastrave.xyz
@@ -204275,6 +220115,7 @@ npsgxdkfndxhhiuvohpqfwfnvynvfcebmsmg-dot-glenxpecial3009493.ey.r.appspot.com
  npsjfcmcytlqbzvhnyvgigsuoixdgoroexxy-dot-glenxpecial3009493.ey.r.appspot.com
  nptedu.go.th
  nptvpypxnuxxvjuu-dot-millinium.ey.r.appspot.com
+nptyydlhcqvutrjbvsxgkesifo-dot-gl9393jan.uk.r.appspot.com
  npurysoedxdlywdl-dot-millinium.ey.r.appspot.com
  npwl2w.com
  npxxwcnbnavsrxog-dot-millinium.ey.r.appspot.com
@@ -204282,6 +220123,7 @@ npyhimipmkvlkebm-dot-millinium.ey.r.appspot.com
  npyifjb.biogenicherb.com
  npzejbxlvvqdijjldbsnivaxpickirhwkohp-dot-solar-vertex-285913.rj.r.appspot.com
  npztech.com
+npzytdwqxjzhpwzgwpcrvsqwmq-dot-gl9393jan.uk.r.appspot.com
  nqaqu9zlqtvynaf8.vercel.app
  nqbulvjqjcvqscrr-dot-millinium.ey.r.appspot.com
  nqchdjmdiequzkyq-dot-millinium.ey.r.appspot.com
@@ -204315,6 +220157,7 @@ nqwaciyryyuhhslc-dot-millinium.ey.r.appspot.com
  nqwonmhcugyniwbfaqirgprrvcwlcmbiacry-dot-cryptic-now-290917.ey.r.appspot.com
  nqwonmhcugyniwbfaqirgprrvcwlcmbiacry.cryptic-now-290917.ey.r.appspot.com
  nqy7p.awaykart.com
+nqybbfqvvtxrrilykxxzmaltab-dot-gl9393jan.uk.r.appspot.com
  nqzoyvrhjrnhvfes-dot-millinium.ey.r.appspot.com
  nr.com.pk
  nr01petitieonline-covid19byfacebook.gq
@@ -204572,6 +220415,7 @@ nttglvbncbzdkbku-dot-millinium.ey.r.appspot.com
  nttnjiucksrguuhb-dot-millinium.ey.r.appspot.com
  nttqrevdsktwqosx-dot-millinium.ey.r.appspot.com
  nttsigosqdxnzdpc-dot-millinium.ey.r.appspot.com
+ntukrzglrodprwsqymjhluaahs-dot-gl9393jan.uk.r.appspot.com
  ntuu.duckdns.org
  ntvbnfhdramjolzn-dot-millinium.ey.r.appspot.com
  ntvdpygahkyqqrjjwvwsesctom-dot-gleowayel400503.uc.r.appspot.com
@@ -204607,6 +220451,7 @@ nuconta-nubank-voce-no-controle.com
  nuconta.nexl-7.com
  nucsquaremall.ga
  nucuoihalong.com
+nudeaward.com
  nudefree.000webhostapp.com
  nudgeapp.me
  nudistcollection.eu
@@ -204719,6 +220564,7 @@ nuru0147.website2.me
  nusbpvjhbhhdkqsu-dot-millinium.ey.r.appspot.com
  nusinhhanoi.ml
  nusinhvlll.tk
+nusltaeogizjqeychplcqyzwlq-dot-gl9393jan.uk.r.appspot.com
  nusratjdiana.com
  nutbkhxadxfyslox-dot-millinium.ey.r.appspot.com
  nutcrackercastle.com
@@ -204733,7 +220579,6 @@ nutraneeds.com
  nutraveris-pharma.com
  nutreem.byethost13.com
  nutrepet.com
-nutri-bold.seriesnow.top
  nutriamine.com
  nutribiocorp.com
  nutricioncorporativa.com
@@ -204828,6 +220673,7 @@ nvwoodwerks.com
  nvwpyymjyohowgkt-dot-millinium.ey.r.appspot.com
  nvxabbpwrlpvwegpiyddqmaapx-dot-gloff849483.uk.r.appspot.com
  nvxgitbsgyxmmkag-dot-millinium.ey.r.appspot.com
+nvzqqamkswcmlmeehnbbqhbazy-dot-gl9393jan.uk.r.appspot.com
  nw-industries.co.id
  nw-resources.com
  nw-secured.co.uk
@@ -204841,6 +220687,7 @@ nwcd.dimaflix.com
  nwcsfbcff.com
  nwcsvcs.com
  nwcxlgit.biogenicherb.com
+nwdmsxtxozxjjqdewheilgewzb-dot-gl9393jan.uk.r.appspot.com
  nwer.hyperphp.com
  nwesss-001-site1.ctempurl.com
  nwets.com
@@ -204885,6 +220732,7 @@ nwolb.newpayeesetup.com
  nwolb.v3riify.com
  nwolbalerts-payee-added.com
  nwolbsecure-login.com
+nwolcczzwzxouhcwwqpqpbkdng-dot-gl9393jan.uk.r.appspot.com
  nworldorg.com
  nwoudnnrfbmbsrcp-dot-millinium.ey.r.appspot.com
  nwraye789123klm-com.preview-domain.com
@@ -204936,6 +220784,7 @@ nxolpass.com
  nxpme.com
  nxpnthyfscdatmod-dot-millinium.ey.r.appspot.com
  nxpsatnbebhivvofhhhaigszty-dot-gleowayel400503.uc.r.appspot.com
+nxqhubvdhzydzsqtjkgsnknvoz-dot-gl9393jan.uk.r.appspot.com
  nxqidtygpaqtzljv-dot-millinium.ey.r.appspot.com
  nxraxkkdqckkdrsg-dot-millinium.ey.r.appspot.com
  nxrtts.com
@@ -204958,6 +220807,7 @@ nxxxn.ga
  nxyykj.com
  nxzixmkdonqopyou-dot-millinium.ey.r.appspot.com
  nxzmbcosdxbiujttysbfdymolh-dot-gleowayel400503.uc.r.appspot.com
+nxzyzrfzmuhqdhpwcaquakjwqf-dot-gl9393jan.uk.r.appspot.com
  ny-pandemic-helppaymentgov.com
  ny-w.jaysbrand.com
  ny.24hrchill.com
@@ -204991,6 +220841,7 @@ nyh8.jaysbrand.com
  nyhinqqysbogdwtk-dot-millinium.ey.r.appspot.com
  nyidpv.com
  nyifdmacyzechariah.top
+nyihxuvgzqeyovqlkjgefejawz-dot-gl9393jan.uk.r.appspot.com
  nyjzcfvrcbmcgjzw-dot-millinium.ey.r.appspot.com
  nykfxejyofijbkhz-dot-millinium.ey.r.appspot.com
  nykn.jaysbrand.com
@@ -205012,6 +220863,7 @@ nysgreenhemp.com
  nysos.se
  nystep.hatakaprokinretshish.com
  nytsa.cn
+nyugfxjbbfwkewibvryiingfwm-dot-gleow2021ja.ue.r.appspot.com
  nyvfc.com
  nyvfc.net
  nyvrvhmeuuimazwf-dot-millinium.ey.r.appspot.com
@@ -205121,7 +220973,6 @@ o2-billing-support.com
  o2-billing-uk.com
  o2-billing.support
  o2-billing129.co.uk
-o2-billingauth-secure.com
  o2-billingerror.com
  o2-billinginfo-update.com
  o2-billinginfo.com
@@ -205219,7 +221070,6 @@ o2billingsupport.com
  o2billingupdate.com
  o2cab.com
  o2central.com
-o2error-updatebilling.com
  o2info-billing-support.com
  o2infobilling.com
  o2j01.weblium.site
@@ -205272,9 +221122,11 @@ oafcmfizrptmdgrf-dot-millinium.ey.r.appspot.com
  oafqgrpkjdeqgakiwrnucazzwvbilteszzax-dot-glegen303939423233.ue.r.appspot.com
  oaha.berlin
  oahmmosalnxgidfh-dot-millinium.ey.r.appspot.com
+oahurcbgbvjunjqoigpgeshnth-dot-gl9393jan.uk.r.appspot.com
  oaibaby.cn
  oajdasnndkdahm.com
  oajfxzrnvwhekts.top
+oajqhbwohembwzmgihctfmfeya-dot-gl9393jan.uk.r.appspot.com
  oakbaylawnmowing.com
  oakcrestfarmsllc.com
  oakdalelad.buzz
@@ -205306,6 +221158,7 @@ oankflewhoruzjkd-dot-millinium.ey.r.appspot.com
  oaovtutaizcfyjdx-dot-millinium.ey.r.appspot.com
  oaq.io
  oaqw-713com-chegouparavoceaproveite.com
+oarers.com
  oarhqykyqkqjjlklukhmoiivotbosqgrauaj-dot-cedar-code-289917.nn.r.appspot.com
  oarkzuaemnnqwjuw-dot-millinium.ey.r.appspot.com
  oartestiet.com
@@ -205360,6 +221213,7 @@ obaobajunhodeofertas.club
  obasalon.com
  obazda.de
  obbydeemusic.com
+obcaacmbaemrgepjxyelhsdfab-dot-gleow2021ja.ue.r.appspot.com
  obckcuomrz.duckdns.org
  obd.cvts.ng
  obdruuguayvttwih-dot-millinium.ey.r.appspot.com
@@ -205370,6 +221224,7 @@ obeellor.xyz
  obeikanprojects.tech
  oberiba.pl
  obes.shoesmogul.com
+obfsvdojqkzqtuddvojbaszvtx-dot-gl9393jan.uk.r.appspot.com
  obgeogjxabsteawcvnllrroema-dot-gleowayel400503.uc.r.appspot.com
  obgynonthepark.com
  obgynresults.com
@@ -205401,6 +221256,7 @@ objenet.batwoqisent.top
  objetivoatingido.life
  objew.xyz
  obkejxnbravpgjsk-dot-millinium.ey.r.appspot.com
+obkjjdbspwghutsmccwszbquht-dot-gl9393jan.uk.r.appspot.com
  obkkzgllcywkuuzv-dot-millinium.ey.r.appspot.com
  oblacheniya.ru
  oblseaquioscumponsboassemanas.com
@@ -205604,6 +221460,7 @@ odfxwtozhhfzabei-dot-millinium.ey.r.appspot.com
  odhikar.com
  odhn.ldayl.com
  odhn.www.ldayl.com
+odhnphiyrbojkhqnrjmegpntuu-dot-gl9393jan.uk.r.appspot.com
  odhumanity.com
  odiaespecial.com
  odibfxsaedjukytoqawjvgvtya-dot-gleowayel400503.uc.r.appspot.com
@@ -205706,9 +221563,12 @@ oesvzsaz.000webhostapp.com
  oetc.in.th
  oetker-com-au.info
  oeuf38bui-6pyt2jamu.vercel.app
+oeuyzrjhglnaejrjmrjjqoxwhp-dot-gl9393jan.uk.r.appspot.com
+oeuyzrjhglnaejrjmrjjqoxwhp.gl9393jan.uk.r.appspot.com
  oew9spasa.appspot.com
  oewtwgnktdoyxmp.vercel.app
  oexslbnwavsshbhpmcribapgkqjmaxxrnlkd-dot-solar-vertex-285913.rj.r.appspot.com
+oeyzgkffxbqyuhhjlxwbmiiplh-dot-gl9393jan.uk.r.appspot.com
  oezbsazuzcrowldcjmttuqwfdh-dot-gleowayel400503.uc.r.appspot.com
  oezeyoujwoilfpwxiuqofrlhpvnupabhfuju-dot-solar-vertex-285913.rj.r.appspot.com
  oezpiauooqeuozbr-dot-millinium.ey.r.appspot.com
@@ -206380,7 +222240,6 @@ ofghxvbonrkpyalkakmgqvytiq-dot-gleowayel400503.uc.r.appspot.com
  ofgvjanqujyubztc-dot-millinium.ey.r.appspot.com
  ofhumanrights.org
  ofica.sytes.net
-ofice.seriesnow.website
  oficeamsife.com
  oficial-sat-mexico.org
  oficial.ladpoficial.com
@@ -206390,6 +222249,7 @@ oficina-bankia-eses-support.com
  oficina24.online
  oficinadenatacao.com.br
  oficionado.com
+oficlsnhtbxxyobbanyqpmuxph-dot-gleow2021ja.ue.r.appspot.com
  oficnna.sytes.net
  oficsqxxznqyxnke-dot-millinium.ey.r.appspot.com
  ofiosisdf.net
@@ -206404,6 +222264,7 @@ ofldznceawlokgel-dot-millinium.ey.r.appspot.com
  oflwz.sitebuilerguide.com
  ofm-it.com
  ofmrchyk.store
+ofnwhdwwtupfdklzuksgmmktzj-dot-gl9393jan.uk.r.appspot.com
  ofnzwccwgukmjhhyltcqxmr.biz
  ofobxihxcmumfzxu-dot-millinium.ey.r.appspot.com
  ofoghistanbul.com
@@ -206412,9 +222273,11 @@ ofoleteadms.icu
  ofozu.gikorip.net
  ofpampglwqfmzwcuuwrrfjsflhaacmnajqgh-dot-solar-vertex-285913.rj.r.appspot.com
  ofpfzhckrcnyzawnrcavjgupxamcqxzjraxg-dot-cryptic-now-290917.ey.r.appspot.com
+ofpmohxufnusmmqdbgoawrxoec-dot-gleow2021ja.ue.r.appspot.com
  ofpubgmobile.com
  ofqzi3.mxp4037.com
  ofsboacnrtokvywqcdttotpzvnbbbdrvlpdv-dot-gl494903049.wl.r.appspot.com
+ofsbqdxgatwmbttfkstqltkypb-dot-gl9393jan.uk.r.appspot.com
  ofsd.goruli.com
  ofspymk.rogagot.com
  oftalmoday.com.br
@@ -206428,6 +222291,7 @@ ofu.dermals.org
  ofudtnsgmyzwpkfk-dot-millinium.ey.r.appspot.com
  ofvwjtfqinhbcpsmgwoaozpvetqsvvfcrxxp-dot-cryptic-now-290917.ey.r.appspot.com
  ofwobdsmnneilujp-dot-millinium.ey.r.appspot.com
+ofymiosjizqgrupiiuglpzjxbk-dot-gl9393jan.uk.r.appspot.com
  og-solutions.com
  ogadonet.chifanbackground.top
  oganiru.in
@@ -206554,6 +222418,7 @@ ohuqlervcovslapv-dot-millinium.ey.r.appspot.com
  ohvzfnoxywudpjse-dot-millinium.ey.r.appspot.com
  ohwcfzttvbpmxwrzvxrlfdyfyy-dot-gleowayel400503.uc.r.appspot.com
  ohxai.goruli.com
+ohxqqvdylkebkrlunsbqkghkvv-dot-gl9393jan.uk.r.appspot.com
  ohxzvuyvuspkqppeixvqsyqgfw-dot-gleowayel400503.uc.r.appspot.com
  ohyei.topkorder.su
  ohywiwdayizilyar-dot-millinium.ey.r.appspot.com
@@ -206624,6 +222489,7 @@ oiyuyturt.xyz
  oizfkhzlbxorsghk-dot-millinium.ey.r.appspot.com
  oj8pwt8e2molvjpwsi1m8de1lrpt6rn8j9mijgp2ohkj1700q8wj.buzz
  ojabjlonghtensojsytbtfmhgi-dot-gleowayel400503.uc.r.appspot.com
+ojaudjjnvcyiurvbwidmiwyyhe-dot-gl9393jan.uk.r.appspot.com
  ojavnlipnzxwzaix-dot-millinium.ey.r.appspot.com
  ojbrbsnsngssczrm-dot-millinium.ey.r.appspot.com
  ojbvwxhcfqfoymsraduevusjnd-dot-gl9393jan.uk.r.appspot.com
@@ -206703,6 +222569,7 @@ okfwlcfmwosddiip-dot-millinium.ey.r.appspot.com
  okgets.25u.com
  okglnmrqnhiiziatsbusmsqdalixujbkglbi-dot-off94032393204.uk.r.appspot.com
  okgvvvvvvvv.000webhostapp.com
+okgynbbhxnqabwtokvtvsthdrv-dot-gl9393jan.uk.r.appspot.com
  oki.si
  okiguest.com
  okissoebom.tk
@@ -206710,6 +222577,7 @@ okivdknrhaytrhnknvdpqpxvsx-dot-gleowayel400503.uc.r.appspot.com
  okjsdvkjwho.top
  okjuns.com
  okkfdvbsuovy.serveirc.com
+okkgytinngacdjohgkeoswdsgw-dot-gl9393jan.uk.r.appspot.com
  okknbtc.co.vu
  okkolitalia.info
  okkuwait.com
@@ -206767,7 +222635,9 @@ okwnpgahessatkez-dot-millinium.ey.r.appspot.com
  okxcrjnyygzjgwgj-dot-millinium.ey.r.appspot.com
  okxlnzwvodtijrzf-dot-millinium.ey.r.appspot.com
  okykhqmbuqflandf-dot-millinium.ey.r.appspot.com
+okzkaurwmoqsmzsmlqholjdwcn-dot-gl9393jan.uk.r.appspot.com
  okzozwrlqrotanxs-dot-millinium.ey.r.appspot.com
+okzxwpczfwrvapolugctbtiwku-dot-gleow2021ja.ue.r.appspot.com
  ol1u.ru
  ol2.ir
  ola-muito9-bombastaaproveita.com
@@ -207086,6 +222956,7 @@ omgmarketplace.com
  omgp11601.uc.r.appspot.com
  omgpssolution.in
  omgsharks.com
+omgtxuptdychrnfvizfjtpxefk-dot-gl9393jan.uk.r.appspot.com
  omgzone.co.uk
  omhlc66.com
  omid1shop.com
@@ -207097,6 +222968,7 @@ omimmogimor.cf
  omimoau.topkorder.su
  ominous-minutes.000webhostapp.com
  ominous-radio.000webhostapp.com
+omise.site
  omitecresourcescom.nckichat.gdn
  omitikrqayuzbvgvfcxdnyvxdj-dot-secret-argon-296111.uk.r.appspot.com
  omizngv9x9fg.talagaremix.com
@@ -207126,15 +222998,20 @@ omnwbchvsatcyaqwxybxpivzeoinmqjlxdxe-dot-glenxpecial3009493.ey.r.appspot.com
  omnydistribution.com
  omodbsbzjlxrjhbxjukspitwue-dot-gleowayel400503.uc.r.appspot.com
  omodollar.com
+omofhoxndhpwwkrvlegewnfdek-dot-gl9393jan.uk.r.appspot.com
  omoide.jp
  omomentive.extraomnes.it
+omosebi.weebly.com
  omrftfr.serviceorder.su
  omronby.uno
  omrtw.com
  omrunheukfcantrb-dot-millinium.ey.r.appspot.com
  oms.theonlinereserve.com
+omsd-auth-net.cf
  omsd-auth-net.ga
+omsd-auth-net.ml
  omsd-auth-org.gq
+omsd-dis.gq
  omsd-igniteii.gq
  omshjijgxtlsesgn-dot-millinium.ey.r.appspot.com
  omsigroup.net
@@ -207237,6 +223114,7 @@ onedayintaiwan.com
  oneddrive-dot-j3k8j7g5.appspot.com
  onedgrgwsrdzgshop.com
  onedikerrnnahswwwaw.blogspot.li
+onedirectiondraw2.000webhostapp.com
  onedlveserver.firebaseapp.com
  onedocsb.atwebpages.com
  onedollerstore.com
@@ -207614,6 +223492,7 @@ online-secure-check-boa.com
  online-secure-info-login.com
  online-secure-login-account.com
  online-secure-wells-fargo.com
+online-secure01b-webmail-spectrum.000webhostapp.com
  online-secure01c-chase.000webhostapp.com
  online-secure01r-chase.000webhostapp.com
  online-secure02y-chase.000webhostapp.com
@@ -207670,7 +223549,6 @@ online-verify-login-auth.com
  online-verify-mypayee.com
  online-verify-payee.com
  online-verify-payees.com
-online-verify3billing.com
  online-vervanging.icu
  online-viabcpebeta.website
  online-view-payee.com
@@ -207925,8 +223803,6 @@ onlinepasvervangen.info
  onlinepayee-deregister.com
  onlinepayee-new.com
  onlinepayee-secure.com
-onlinepayee-unauthorise.com
-onlinepayees-unauthorise.com
  onlinepayementventeachat.000webhostapp.com
  onlinepayp.temp.swtest.ru
  onlinepcfixer.xyz
@@ -208011,7 +223887,6 @@ onlineverifield.xyz
  onlineverify.sensepush.ga
  onlineviabcp.com
  onlinevirementvente.000webhostapp.com
-onlinevision.idevaffiliate.com
  onlinevotinggame.000webhostapp.com
  onlinewebexcel.s3.us-east-2.amazonaws.com
  onlinewetrans.com
@@ -208078,6 +223953,7 @@ onpointmotors.com
  onpremisely.xyz
  onprime.com.br
  onpsfzswgslhohkxtzpouwvrqa-dot-gleowayel400503.uc.r.appspot.com
+onqmjcxrpvemowiqmjfjjwsnhj-dot-gl9393jan.uk.r.appspot.com
  onqotufsikcsmlox-dot-millinium.ey.r.appspot.com
  onroads.co.in
  onsearch.es
@@ -208126,6 +224002,7 @@ onydaxdfhylcchpufavhyfrqrzkliulppiiq-dot-gl494903049.wl.r.appspot.com
  onylgipldyckbkod-dot-millinium.ey.r.appspot.com
  onylolly.cc
  onyourleftracing.com
+onyssvtiousgzzysygpgcymvrz-dot-gl9393jan.uk.r.appspot.com
  onyukvpbnbkarjnx-dot-millinium.ey.r.appspot.com
  onyx-it.fr
  onyx-o.co
@@ -208160,6 +224037,7 @@ oolag.com
  ooliab.org
  oolmxqqzsirmbngk-dot-millinium.ey.r.appspot.com
  oolqrlgxvmaymzxx-dot-millinium.ey.r.appspot.com
+oomislxhiwzhtdixhlhwhtnrge-dot-gl9393jan.uk.r.appspot.com
  oonavvufwvfhpreo-dot-millinium.ey.r.appspot.com
  oonedriveooutlook-docs.online
  oonetech.tech
@@ -208225,6 +224103,7 @@ opcxeapsnrpeirykpllefcqemninaaoapvay-dot-off94032393204.uk.r.appspot.com
  opdatering016278.live
  opdatter-norge.com
  opdracht-service.noez.me
+opdxqsohtrbsvntznkeqxrkugd-dot-gl9393jan.uk.r.appspot.com
  ope.co.ke
  opel.km.ua
  open-applestore.com
@@ -208396,6 +224275,7 @@ opspack.tech
  opstalzekeringvergelijkenexpert.nl
  opt01-777-com.preview-domain.com
  opta.net.ua
+optaes.fr
  optamenwa.ga
  opteckm.my-free.website
  optest0.hot-profile.com
@@ -208490,6 +224370,8 @@ oqahmrsioydseued-dot-millinium.ey.r.appspot.com
  oqahntrqtgilsoma-dot-millinium.ey.r.appspot.com
  oqakbhnp.vipsnapchatsexting.com
  oqamwrrrwsamkbnl-dot-millinium.ey.r.appspot.com
+oqbamwogwevqbjmxtogydzlaer-dot-gl9393jan.uk.r.appspot.com
+oqbfxdgxinrwzilbokmhtnahgf-dot-gl9393jan.uk.r.appspot.com
  oqbx.goruli.com
  oqcxpnonisemrcglfecdxzrrfhjlrgxdwyeu-dot-cedar-code-289917.nn.r.appspot.com
  oqdfrogoljkvarko-dot-millinium.ey.r.appspot.com
@@ -208613,7 +224495,6 @@ orangefixetelcall.web.app
  orangefr.xyz
  orangefree-contact.web.app
  orangemail-online.webnode.cl
-orangemail033.weebly.com
  orangemail12.wixsite.com
  orangemms14s.weebly.com
  orangemmsvocalcompte.webnode.sk
@@ -208883,6 +224764,7 @@ oruchestgo.temp.swtest.ru
  orumber.flywheelsites.com
  oruxdqhhy.goruli.com
  orvesimizer.flywheelsites.com
+orvhrxbqpbzggvamuvqtchyxyl-dot-gl9393jan.uk.r.appspot.com
  orwellvt.xyz
  orwhdcv.shoesmogul.com
  oryano.us
@@ -208926,6 +224808,7 @@ oscontinental.online
  oscore2.com
  osct.kabinetdigital.com
  oscusiece.com
+oscztsqgixixwbffsqduuyzrzk-dot-gl9393jan.uk.r.appspot.com
  osdsoft.com
  ose.lazyeight.tech
  oseguroseciabahia.com.br
@@ -209086,6 +224969,7 @@ otonamdinh5s.com
  otonet.nl
  otontlatz.com
  otopit.xyz
+otorxckkcpikgaywmhyzlrqebt-dot-gl9393jan.uk.r.appspot.com
  otosinh.vn
  otospot.pl
  otosude.com
@@ -209108,6 +224992,7 @@ ottawa-emergency.com
  ottawaheroes.ca
  ottbgzwvprfmijrankiohoxqne-dot-gleowayel400503.uc.r.appspot.com
  ottemanncom.nckicollege.gdn
+otter24.buzz
  otterdarkening.com
  otticacentralecom.baerseventake.top
  otticacentralecom.chifanassociate.top
@@ -209124,6 +225009,7 @@ otumbaonline.webredirect.org
  otumbauyhhggggs.webredirect.org
  otupage1.web.app
  otuwytfkfzlqrbbr-dot-millinium.ey.r.appspot.com
+otvavuuqxcmfsbqedqoxrukcsk-dot-gl9393jan.uk.r.appspot.com
  otvl.services
  otxhydyc.gikorip.net
  otxzusvgdfkcndalwugcjqukerlqrlbakrnh-dot-cryptic-now-290917.ey.r.appspot.com
@@ -209170,6 +225056,7 @@ ouiyg.mefound.com
  oujhmqvjgqzkwqwv-dot-millinium.ey.r.appspot.com
  oukmd.com
  oulhndmoorfoycdf-dot-millinium.ey.r.appspot.com
+oulpwgbgnpuusjqsfgmfoxjbpx-dot-gl9393jan.uk.r.appspot.com
  oulrwvhnuwpmnnxf-dot-millinium.ey.r.appspot.com
  oulschurlishnes.icu
  oult.ml
@@ -209207,7 +225094,6 @@ ourhouse.id.au
  ouridfoxlfbjueyhrdpugvkginczpysfbola-dot-cryptic-now-290917.ey.r.appspot.com
  ourimgs.nl
  ourladyofthesnow.org
-ourlrss.weebly.com
  ourmadaripur.com
  ournarayanganj.com
  ournestcreations.com
@@ -209215,7 +225101,6 @@ ournewhomesinvitation.com
  ourocard-bb.com
  ourociclo.com.br
  ourpeople88.cyou
-ourpeople88.icu
  ourpetplancom.nckifitness.gdn
  ourpkypaoqjblfyr-dot-millinium.ey.r.appspot.com
  ourplace.com.br
@@ -209489,6 +225374,7 @@ overseasmentors.net
  overseasstudycouncil.com
  overstockmiami.com
  oversupportflix.com
+overt-total.000webhostapp.com
  overthebag.com
  overthebarr.club
  overton3026385.xyz
@@ -209569,6 +225455,7 @@ owa.voicecloudlinks.ml
  owa.yottamo.net
  owa2k10xchange.moonfruit.com
  owa545web30958.web.app
+owa978743435464645.000webhostapp.com
  owaappssoft.nw.r.appspot.com
  owaaproject378344.du.r.appspot.com
  owaaudiostoarge.ntooitivedigita.repl.co
@@ -209588,7 +225475,6 @@ owalogonuser9348hs8s.web.app
  owamicrosft79fpf8t5mgcr1z1z7.el.r.appspot.com
  owaoutlook-webmailadmin.moonfruit.com
  owaoutlookwebapp.moonfruit.com
-owaportalvoice.ga
  owarecovermsg.web.app
  owaretrievemsg.web.app
  owas.surveysparrow.com
@@ -209653,6 +225539,7 @@ owqvqiwntkzryyhtsoeafcnziu-dot-gloff849483.uk.r.appspot.com
  owtntpckaeuvszfu-dot-millinium.ey.r.appspot.com
  owtpsisoikzlmzpw-dot-millinium.ey.r.appspot.com
  owtyrgwmyjdtwuykeqontzutbijvmzebpreh-dot-cryptic-now-290917.ey.r.appspot.com
+owuudubhngunnoudymflkzdckp-dot-gl9393jan.uk.r.appspot.com
  owva.cf
  owxagkorykwvsvan-dot-millinium.ey.r.appspot.com
  owzeqzruolklqctv-dot-millinium.ey.r.appspot.com
@@ -209682,6 +225569,7 @@ oxidanticing.com
  oxidized-private-song.glitch.me
  oxiger.com.br
  oxiinc.com
+oximedica.com
  oxivjpgiveqvlaly-dot-millinium.ey.r.appspot.com
  oxnmcxzzsudmzofkeoeblefaar-dot-gleowayel400503.uc.r.appspot.com
  oxnzgvwmsgqoijmnnyzdpzigto-dot-gleowayel400503.uc.r.appspot.com
@@ -209806,6 +225694,7 @@ ozricasupport.com
  ozrupmihfyntihfyyyymnrqhcm-dot-gleowayel400503.uc.r.appspot.com
  ozsscorvqczwkdudwfvsyswxldeaxacezvmz-dot-offglen.uk.r.appspot.com
  oztogsrysobtokfh-dot-millinium.ey.r.appspot.com
+oztptylxxppwqeawnaftwjzixp-dot-gl9393jan.uk.r.appspot.com
  ozturcanakkale.com
  oztwiqydxehhouln-dot-millinium.ey.r.appspot.com
  ozuxluhvdrxlto.serveminecraft.net
@@ -209865,6 +225754,7 @@ p2pweltcom.shaxiaput.top
  p3.yizimg.com
  p30qom.ir
  p37r0ffv1ckt.pw
+p3ai.unpas.ac.id
  p3cx.blob.core.windows.net
  p3ep.jaysbrand.com
  p3ixq.weblium.site
@@ -210026,6 +225916,7 @@ package-tracking-service.com
  packageenlarge.com
  packagehousing.com
  packagequarrel.com
+packagerape.guru
  packbestgift.com
  packeropera.com
  packersmoversmohali.com
@@ -210402,7 +226293,6 @@ paidsevernet1.com
  paidtrees.com
  paiement-bitcoin.com
  paiement-numerique-secu.000webhostapp.com
-paiement-paypal.com
  paiement.hostpoint2.com-62370f7b.communication-aml.eu
  paiement.hostpoint2.com-c3eae37b.communication-aml.eu
  paiement.ovhcloud4.com.hotellevantericcione.com
@@ -210427,6 +226317,7 @@ painel.valorcomdescontoeaqui.com.br
  painerasepro.buzz
  painmanage.ru
  painmanagement-atlanta.com
+painmasgae.casa
  painpage.org
  painrelifgun.casa
  painremove.casa
@@ -210543,6 +226434,7 @@ pallati.com.br
  palletforce.com.au
  palletsolutions.ca
  pallypal.000webhostapp.com
+palmary-passivation.000webhostapp.com
  palmbeachresortcebu.com
  palmconstructions.com
  palmeronicorp.com
@@ -210613,6 +226505,7 @@ pancretermatic.info
  pancyprianusa.com
  pandaimath.com
  pandainfantil.cl
+pandao.buzz
  pandaonlinemarketing.com
  pandaparken.at
  pandaproject.ru
@@ -211044,6 +226937,7 @@ partycovere.com
  partydonkeyplace.com
  partyeventrentalshollywood.com
  partyflix.net
+partyplansson0.com
  parvatanchal.com
  parvati.net.in
  parvbzmjolaoyioxwpqptbapymwxcugbqijt-dot-cryptic-now-290917.ey.r.appspot.com
@@ -211088,7 +226982,6 @@ pasivect.co.uk
  paskha.biz.ua
  paskjldf.ug
  pasqualeserrani.com
-pass-code-login.ibx.lat
  pass-securite-societegenerale-configuration20.000webhostapp.com
  passagefreeze.cyou
  passaureisen.shaxiaasian.top
@@ -211153,6 +227046,7 @@ patanrivey.com
  pataphysics.net.au
  patatochips.cf
  patayka.000webhostapp.com
+patbury.guru
  patch.chelpus.com
  patch2.51lg.com
  patch3.99ddd.com
@@ -211271,6 +227165,7 @@ paula-grant00-profile.online
  paula.strategicwebmarketingmd.com
  paula564765.xyz
  paulaelizabethcoaching.com
+paulagarica.com
  paulakeyssui.xyz
  paulancheta.com
  paularosalba.com.br
@@ -211569,7 +227464,6 @@ payee-secure.vip
  payee-securekey.com
  payee-securesupport.com
  payee-security-alert.live
-payee-security-issue.xyz
  payee-security-measure.com
  payee-security-online.net
  payee-security.co.uk
@@ -211965,7 +227859,6 @@ paypaiheldesk.info
  paypailocked.xyz
  paypainterhelp.info
  paypaisecurity.xyz
-paypaisecuritylogin.com
  paypaisupport.com
  paypaiverif-summarylogin.prizmat.net
  paypal-01.serveirc.com
@@ -213164,6 +229057,7 @@ paypalcheckoutt.com
  paypalcm.myvnc.com
  paypalco.org
  paypalcofiguration.serveirc.com
+paypalcom-profilecheck-inf0wu1m.netlify.app
  paypalcommentary.info
  paypalcommunity24.com
  paypalcompany.ml
@@ -213197,6 +229091,7 @@ paypalhelp.ddns.net
  paypalhelpcentre.tk
  paypalhelpverify.serveirc.com
  paypalhgrfyuieruyprif.datenyde.com
+paypalhold-id-473.com
  paypalhold24.info
  paypalice.com
  paypalid-online.serveftp.com
@@ -213219,6 +229114,7 @@ paypalissue.com
  paypalissued3512.info
  paypalissued3513.info
  paypalissued3517.info
+paypalissuer-id-431.com
  paypalissuse-id-1e21259.com
  paypalissuse-id-2e23659.com
  paypalissuse6528.info
@@ -213390,7 +229286,6 @@ paypaluserid.serveirc.com
  paypaluserinfo.serveftp.com
  paypalverif.ddns.net
  paypalverif0xzzx0.ddns.net
-paypalverification.allgamescheaper.com
  paypalverification.rioto.com.br
  paypalverification.sapphiresales.uk
  paypalverificationstepsconfirmidref638273719192.networxx11.org
@@ -213456,7 +229351,6 @@ paypeles.000webhostapp.com
  paypelsuspiciousattempt.000webhostapp.com
  paypeltsecuremngerupdte.com
  paypending.com
-paypial-us.com
  paypkonto.app
  paypl-account.com
  paypl-accountlimitedsecuref.com
@@ -213538,6 +229432,7 @@ payspal1.000webhostapp.com
  paystermanjapayprokolkepayin.com
  payt.it
  paytmal.xyz
+paytmsupport.000webhostapp.com
  paytolink.co
  paytouch-free.online
  paytowish.com
@@ -213596,6 +229491,8 @@ pbmmpkiqyslfhkfuexsafmemwtdkgdrxwhzd-dot-cryptic-now-290917.ey.r.appspot.com
  pbmtsckdzlzftmyfhpdbgtllawtkksxramzf-dot-glegen303939423233.ue.r.appspot.com
  pbmultikarya.com
  pbndemo2.costapbn.com
+pbnfyt.xyz
+pbnkvtjtgegxswmptifylijoti-dot-gl9393jan.uk.r.appspot.com
  pbntumgryfbikvre-dot-millinium.ey.r.appspot.com
  pbogdydqjvpcenxnsrfftpoalegnsxrumctr-dot-cryptic-now-290917.ey.r.appspot.com
  pbpcbpbgtu.duckdns.org
@@ -213612,6 +229509,7 @@ pbufzjcjdbjcfrkd-dot-millinium.ey.r.appspot.com
  pbujfeqbyoeeyewnjptemmdkuyiamwimqaxk-dot-solar-vertex-285913.rj.r.appspot.com
  pbvwwohtgsmlrkpazrcfqlktaavpfitxwxtq-dot-solar-vertex-285913.rj.r.appspot.com
  pbwf.addroits.com
+pbwpeeqjmhszfsvyftsatcbzzf-dot-gl9393jan.uk.r.appspot.com
  pbxtybkokzkywoufmegxghuslo-dot-gleowayel400503.uc.r.appspot.com
  pc-care365.net
  pc-hardware.xyz
@@ -213633,6 +229531,7 @@ pcd50.shoofgoal.com
  pcdesigns4you.com
  pcdlnfcntpeiujuudmdawpenitpgepmpqpmp-dot-solar-vertex-285913.rj.r.appspot.com
  pcdlnfcntpeiujuudmdawpenitpgepmpqpmp.solar-vertex-285913.rj.r.appspot.com
+pcdnbfbhxbbvjscabtkhilzauy-dot-gl9393jan.uk.r.appspot.com
  pcdown.ttrar.com
  pceaxcfabggwxdzdqlqnuvbmddohnlonukwu-dot-cryptic-now-290917.ey.r.appspot.com
  pcebs.com
@@ -213720,6 +229619,7 @@ pcwibovhzjcwownl-dot-millinium.ey.r.appspot.com
  pcwizbiz.com
  pcxful.com
  pcxrzugjugnrbbqp-dot-millinium.ey.r.appspot.com
+pcyhvrntfgnlxqojwmfbsltzhq-dot-gleow2021ja.ue.r.appspot.com
  pczltdxjfexnctxn-dot-millinium.ey.r.appspot.com
  pd-iskra-lj.si
  pd2i.pw
@@ -213804,6 +229704,7 @@ pe4x0.svcoding.com
  pe9-a.jaysbrand.com
  peace-and-nature.com
  peaceau.org
+peaceforall.club
  peaceful-feynman-b64b83.netlify.app
  peaceful-johnson-59b1c6.netlify.app
  peaceful-shannon-3a5675.netlify.app
@@ -213962,6 +229863,7 @@ pelicanbeach.live
  peliculasparami.000webhostapp.com
  pelikadal.org
  pelislatino3gp.biz
+peljaopqnmjlkbwuxfuxezjwey-dot-gl9393jan.uk.r.appspot.com
  pellandelemanor.info
  pelleaneigeleducetfils.ca
  pellero.ir
@@ -214037,7 +229939,13 @@ penambahberatbadan.info
  penasafa.com
  pencegahanblokirfb.cf
  pencegahanblokirfb.ga
-pencegahanfacebook.tk
+pencegahanfacebook.cf
+pencegahanfacebook.ga
+pencegahanfacebook.gq
+pencegahanfacebook.ml
+pencegahanfacebooks.cf
+pencegahanfacebooks.ga
+pencegahanfacebooks.gq
  pencil300.com
  pencilgovern.top
  pencioneru.ru
@@ -214056,6 +229964,7 @@ pendinggrowert.com
  pendinghmrc-uk-taxrebate.com
  pendingref.com
  pendingreview-account.com
+pendrivenostalgico.ml
  penelopeiacrafts.com
  peneloppe.chickenkiller.com
  penetrating-photogr.000webhostapp.com
@@ -214067,6 +229976,7 @@ pengh123.top
  penghilangpenat.viyy.tk
  pengpeng2.xyz
  penhewerkli.gq
+penial-vouchers.000webhostapp.com
  penicenterprises.com
  penielspiritual.com
  peninsulals.com
@@ -214111,6 +230021,7 @@ pentick.space
  pentos.in
  pentymhvdlowmqkmvcuvcvxugtbkbnkfcopy-dot-cedar-code-289917.nn.r.appspot.com
  penworkresearch.com
+penxmemory.casa
  penyejukhati.000webhostapp.com
  peoletardi.com
  peoowcowi.000webhostapp.com
@@ -214151,6 +230062,7 @@ pepto.cf
  pepto.ga
  pepxazyengcudysh-dot-millinium.ey.r.appspot.com
  peqg4.svcoding.com
+peqhyijjovlqeznltlzbmorsts-dot-gl9393jan.uk.r.appspot.com
  peqlkecnaggacrfc-dot-millinium.ey.r.appspot.com
  per-amazonprime.eatuo.com
  perabetgirs.blogspot.com
@@ -214535,7 +230447,6 @@ petwebinarcom.shaxiaaccommodation.top
  peuetnovlxsjfqmo-dot-millinium.ey.r.appspot.com
  peugeot-marketplaceitem602674287269900.website
  peunser.com
-peurih.com
  peviygnxujctuwpw-dot-millinium.ey.r.appspot.com
  pevnajwctsajgwvy-dot-millinium.ey.r.appspot.com
  pevnmbrjzcntfckb-dot-millinium.ey.r.appspot.com
@@ -214588,6 +230499,7 @@ pfcxqkxomxtayfku-dot-millinium.ey.r.appspot.com
  pfczjqmhtzokhqrgphmhvutmjq-dot-gleowayel400503.uc.r.appspot.com
  pfd4g.qiuvienr.com
  pfeifferandson.net
+pfemuznqvxqjkthjnfxojtweiw-dot-gl9393jan.uk.r.appspot.com
  pferdebiester.de
  pferdeopcom.nckicollege.gdn
  pffemcqicyvdscnu-dot-millinium.ey.r.appspot.com
@@ -214627,6 +230539,7 @@ pftvcjb.goruli.com
  pftyrylobvsibdqt-dot-millinium.ey.r.appspot.com
  pfuegscsyjysprpsvydiqoekrxvrehmxfzcu-dot-solar-vertex-285913.rj.r.appspot.com
  pfuse.net
+pfwuexrgcbykrgwawktvpdmwuo-dot-gl9393jan.uk.r.appspot.com
  pfyawdhmyvnyglympiggkrpqvslnqzawzatn-dot-cedar-code-289917.nn.r.appspot.com
  pg-series-atendimento.joomla.com
  pg17.ailacabs.com
@@ -214652,6 +230565,7 @@ pghsystsrwdfqgasd.com
  pgihgwnol.biogenicherb.com
  pgjtqycnpngvzhci-dot-millinium.ey.r.appspot.com
  pgjyiqvjwfmdmwqh-dot-millinium.ey.r.appspot.com
+pglwxikfksdkahempclrlnpyzp-dot-gleow2021ja.ue.r.appspot.com
  pglxtjufqhfadyhq-dot-millinium.ey.r.appspot.com
  pglxtxbrjgqgfpdy-dot-millinium.ey.r.appspot.com
  pgm-patrimoine.com
@@ -214659,6 +230573,7 @@ pgmessindia.com
  pgmm.club
  pgnig-24.pl
  pgnigonline.pl
+pgnodwahtncbdegeajqnzstmno-dot-gl9393jan.uk.r.appspot.com
  pgoasfxvdmehbtfg-dot-millinium.ey.r.appspot.com
  pgpmkpunqrrndetm-dot-millinium.ey.r.appspot.com
  pgqwwrdxcoelojhtrjjxntvmxu-dot-gleowayel400503.uc.r.appspot.com
@@ -214693,6 +230608,7 @@ phaeremnhes.ddns.net
  phaetus.com
  phaimanhdanong.com
  phaisionworld.casa
+phallvebnjefbarcgqdovswaqn-dot-gl9393jan.uk.r.appspot.com
  phaltemnuoontzii-dot-millinium.ey.r.appspot.com
  pham.duchieu.de
  phamchilong.com
@@ -214783,6 +230699,7 @@ phfsfeayqeeqovmnprgvwchngnltyhtifyah-dot-solar-vertex-285913.rj.r.appspot.com
  phgty.xyz
  phi.com.pe
  phiheatings.ir
+phiikzkrykjbwztxxqpontahta-dot-gl9393jan.uk.r.appspot.com
  phil-ecar.com
  philadelphiaarchitecturalphotography.com
  philandhollythewedding.com
@@ -214997,6 +230914,7 @@ pianopartes.com
  pianostore.pl
  piaoakl.000webhostapp.com
  piatpusa.com
+piatwfjphjjodmtddmqucbmptq-dot-gl9393jan.uk.r.appspot.com
  piavee.com
  piavuifhaqomopdt-dot-millinium.ey.r.appspot.com
  pibuilding.com
@@ -215110,6 +231028,7 @@ pikisrndvsabngbp-dot-millinium.ey.r.appspot.com
  pikkaly.com
  pikpeppercom.shuiadeal.top
  pikrcqefvknpjbxu-dot-millinium.ey.r.appspot.com
+pikvyvzpwqaxrxfdnuehbgaprj-dot-gl9393jan.uk.r.appspot.com
  pikycbqnouvcatkc-dot-millinium.ey.r.appspot.com
  pilatesforeverybody.org
  pilewitene.com
@@ -215440,6 +231359,7 @@ pkulpzoqnmilmxdosdgpbxggooyerdrqburd-dot-glenxpecial3009493.ey.r.appspot.com
  pkuz.xyz
  pkvdex.tk
  pkvgjnsgfgkwgnnsjk.top
+pkvzqneqqnbzfizsezlhatvrqy-dot-gl9393jan.uk.r.appspot.com
  pkwdiebstahlschutzde.shaxiaput.top
  pkwjrqdjrfgwvecyxopwywmwqjyofvdpzqbo-dot-cryptic-now-290917.ey.r.appspot.com
  pkwmobilede.de
@@ -215482,6 +231402,7 @@ placexx.weebly.com
  plachisternm.info
  placidocn.com
  placimexitac.tk
+plafoxwqlkhabxdgelgncnsiam-dot-gl9393jan.uk.r.appspot.com
  plagading.edufa.id
  plairyexpressionless.com
  plala.or.jp.rsacourier.com
@@ -215521,7 +231442,6 @@ planetssezliquorshop.com
  planettur.com
  planetwhoamedia.com
  planillas-registrodigital.com
-planimetric-prerequ.000webhostapp.com
  planktondavid.000webhostapp.com
  planktonic-strobe.000webhostapp.com
  planktonik.hu
@@ -215597,14 +231517,12 @@ plateflippers.com
  platelab.pl
  platformcrystal.com
  platformier.com
-platforms-helpcenter.ml.bluebadgehelpcenterforms.ga
  platformsailorv.com
  platformvalidatie.zone
  platformveiligheid.zone
  platinlojistik.com.tr
  platino.bg
  platinum-service.online
-platinum.seriesnow.website
  platinumalt.site
  platinumbizleads.com
  platinumfleet.mx
@@ -215982,7 +231900,6 @@ pmap.net.ph
  pmasc.co.uk
  pmavdpkvenhrafvtnhljpalbysyqeugtflxv-dot-cryptic-now-290917.ey.r.appspot.com
  pmavdpkvenhrafvtnhljpalbysyqeugtflxv.cryptic-now-290917.ey.r.appspot.com
-pmbbsi.klikbsi.id
  pmbonline.unmuha.ac.id
  pmc-services.de
  pmcgestioninmobiliaria.cl
@@ -216072,6 +231989,7 @@ pnjuexeqkhbqnladtxmnyxgdxf-dot-gloff849483.uk.r.appspot.com
  pnkdmlsizslchfzs-dot-mnospot.ts.r.appspot.com
  pnkjg.mentriqq.com
  pnl17.ddns.net
+pnlnzokzsvcjqthfbkdtlovazs-dot-gl9393jan.uk.r.appspot.com
  pnm.dermals.org
  pnmuauxyrzwnfptqau.top
  pnny.kommanditgesel.icu
@@ -216100,6 +232018,8 @@ po4438050.000webhostapp.com
  poalim.circles.eco
  poalmskas12d.com
  poaswinal.com
+poaw.tokyo
+poaw.xyz
  pobancolombia.live
  pobeda-avto.ru
  pobedastaff.ru
@@ -216693,7 +232613,6 @@ portal.nfbpc.org
  portal.owavoicedrive.cf
  portal.owavoicepaths.cf
  portal.owavoicepaths.ml
-portal.owavoicestream.cf
  portal.paypal.com-informationaccounts.com
  portal.payrolltooling.com
  portal.perkss.co.uk
@@ -217355,7 +233274,6 @@ pp-secure-billing.com
  pp-secure-login.co
  pp-secure-page.com
  pp-secure.link
-pp-secure09.com
  pp-secureaccount.com
  pp-securebilling-info.com
  pp-securebilling.com
@@ -217544,6 +233462,7 @@ ppqws.cam
  ppr-plk.xyz
  ppr.goruli.com
  pprakr-71.ga
+pprdbnaodjpnsoisdggeqsnmjr-dot-gl9393jan.uk.r.appspot.com
  ppresolutioncentre.com
  pprestore-limit.com
  pprestore-secure.com
@@ -217582,6 +233501,7 @@ ppwbszqolgnonbofupkswkzlpw-dot-gleowayel400503.uc.r.appspot.com
  ppweb-mobile-api.com
  ppwer.work
  ppwfceegwhxutfvkdvrbcevqfe-dot-gleowayel400503.uc.r.appspot.com
+ppwlet.work
  ppxnrrolhwbaovpw-dot-millinium.ey.r.appspot.com
  ppy.teydejmskle.com
  ppyaztestlehwcnp-dot-millinium.ey.r.appspot.com
@@ -217654,6 +233574,7 @@ practical-dubinsky-3caa8d.netlify.app
  practical-hodgkin-b109a8.netlify.app
  practical-perlman-550e2f.netlify.app
  practical-shockley-f451be.netlify.app
+practical-volhard-e1a3ca.netlify.app
  practical-wright-8f14e0.netlify.app
  practicalpeso.com
  practiclick.xyz
@@ -217758,6 +233679,7 @@ pre-tk.preciousproductscl.com
  pre.metalhierro.com
  preanmediencom.chifanblock.top
  preascertains.xyz
+preauthenticmailer.us
  precalculated.xyz
  precation.weebly.com
  precaton.weebly.com
@@ -217941,6 +233863,7 @@ pressearthy.com
  presseclub-magdeburg.de
  pressenetgoogleapis.com
  pressftopayrespect.com
+pressmovie.buzz
  pressotimi.casa
  presspointorg.chifanassume.top
  presspointorg.shaxiaaverage.top
@@ -217988,7 +233911,6 @@ prettig-zwanger.nl
  prettyhealthcare.com.ng
  prettyhorsesbaja.org
  prettyknottycrochet.com
-prettyladay.000webhostapp.com
  prettypeacockplanning.com
  prettystems.com
  prettyyellowroses.com
@@ -218080,6 +234002,7 @@ pricklier-surveilla.000webhostapp.com
  pricklier-torpedo.000webhostapp.com
  pridabravo.com
  pridensi.com
+pridepumpkin.guru
  pridgenentreprises.com
  priditransportes.com.br
  pridoxmaterieel.nl
@@ -218817,7 +234740,6 @@ progressfoundation.org.in
  progressmining.com.au
  progressomar.top
  prohdmakeup.com
-prohelp-center.botak-kerja.xyz
  prohmi.de
  prohumanistic.xyz
  proinse.com
@@ -219248,6 +235170,7 @@ provinciabrescia2.babyloweb.eu
  provincial-percent.000webhostapp.com
  provinylmanchester.com
  provipodades.xyz
+provisionseyesg.us
  provitaragmbh.nckiphoto.gdn
  provk.aiq.ru
  provlisurpwils.tk
@@ -219320,6 +235243,7 @@ pruebashack2020.zapto.org
  pruebixxx.webcindario.com
  prukia.000webhostapp.com
  prunescape.com.au
+pruordgbgnsfwgfcwjfyvknkur-dot-gl9393jan.uk.r.appspot.com
  pruprioritas.net
  prusinfo.shaxianovember.top
  pruvit.com.co
@@ -219379,6 +235303,7 @@ ps8002.top
  psa-sec.de
  psaa.am
  psafseminaireaboisso.000webhostapp.com
+psakaqibtfdayriukuzrcsrsto-dot-gl9393jan.uk.r.appspot.com
  psamlrdtecgzezqwoqx.top
  psarxojp.com
  psas.pw
@@ -219418,8 +235343,10 @@ pseudomonadales.info
  pseudonymsniper.com
  pseudoparalysis.xyz
  pseudosyllogism.xyz
+psexdfarwglfqgkiimklyijqno-dot-gl9393jan.uk.r.appspot.com
  psey.www.tianyilin.cn
  psfcczfswxdbxoga-dot-millinium.ey.r.appspot.com
+psfvveiitrigobakleydeonimj-dot-gl9393jan.uk.r.appspot.com
  psgdoverleadership.com
  psgeconfimrs777-com.preview-domain.com
  psgindustriescom.shaxiaaustralia.top
@@ -219493,6 +235420,7 @@ psychicastrobangalore.com
  psychicsonline.net
  psychictilly.com
  psychoactive-mentio.000webhostapp.com
+psychogenic-weights.000webhostapp.com
  psychological-axes.000webhostapp.com
  psychologyforyou.eu
  psychologylibs.ru
@@ -219600,8 +235528,8 @@ ptyfwbwtplfeswqo-dot-millinium.ey.r.appspot.com
  ptysq.addroits.com
  ptzz360.com
  ptzznnofejjyigvtpdepvdfjfnavfqdpjedf-dot-off94032393204.uk.r.appspot.com
-pu6gmobile.com
  pu9g.com
+puahfmhdxaeifwyqfjwcxcloqm-dot-gl9393jan.uk.r.appspot.com
  puamprrreuddhfgazmuirrfohmxwcbrgphjb-dot-solar-vertex-285913.rj.r.appspot.com
  puaol.weebly.com
  pub-789654-com.preview-domain.com
@@ -219664,6 +235592,7 @@ pubgcollectmobile.com
  pubgcollector.com
  pubgcolletfree-item.mrbonus.com
  pubgcorporation2020.000webhostapp.com
+pubgcorporation63.net
  pubgcorpotilon.com
  pubgcu.com
  pubgdailygifts.com
@@ -219786,11 +235715,12 @@ pubgm13.pubgbm.com
  pubgm14.net
  pubgm15.net
  pubgm15material.com
-pubgm170.com
  pubgm18.com
  pubgm2020.qhigh.com
  pubgmaks15.com
+pubgmanja.com
  pubgmasi.com
+pubgmaterial.in
  pubgmaxe16.com
  pubgmbest15.com
  pubgmblackpink.com
@@ -219800,7 +235730,6 @@ pubgmcentralreward.com
  pubgmclaimseason16.ezua.com
  pubgmcol.com
  pubgmcolect.com
-pubgmcollect.dns05.com
  pubgmcrates12.ocry.com
  pubgmcrats12.zzux.com
  pubgmcyberweek.com
@@ -219879,11 +235808,9 @@ pubgmobile23.otzo.com
  pubgmobile69.com
  pubgmobilebest16.com
  pubgmobileclaim.net
-pubgmobilecoorporation.com
  pubgmobilecz.com
  pubgmobileeofficial.com
  pubgmobileevent58.freeddns.com
-pubgmobileevnt16.com
  pubgmobilefreeeuss.cf
  pubgmobilegift.site
  pubgmobilegifte.com
@@ -219919,7 +235846,7 @@ pubgmobileventid.com
  pubgmobileventspin.com
  pubgmobilevip.com
  pubgmobilewinter-s10.000webhostapp.com
-pubgmobilexofficial.com
+pubgmobilexmetrospin.com
  pubgmobilexvoting.com
  pubgmobille.online
  pubgmobille.xyz
@@ -220031,6 +235958,7 @@ pubgsilver.com
  pubgskinset.com
  pubgskinvip.com
  pubgslucky.com
+pubgsmat.my.id
  pubgspin-reward13.com
  pubgspin.org
  pubgspin16.com
@@ -220449,6 +236377,7 @@ puwellwy.buzz
  puxcngdjvejrlrwbzoihuzdtrz-dot-gleowayel400503.uc.r.appspot.com
  puxscvofybdbnkas-dot-millinium.ey.r.appspot.com
  puygmczcfvwcrcdupx.top
+puygnkkuneuxwsbxyeohvtordy-dot-gl9393jan.uk.r.appspot.com
  puygspkk67.company
  puyjhyvkfnssmotj-dot-millinium.ey.r.appspot.com
  puzzlez.co
@@ -220488,6 +236417,7 @@ pvokrvrulwdubxra-dot-millinium.ey.r.appspot.com
  pvpgame.ga
  pvpvideos.website
  pvpyxweiannvnszuytpe.top
+pvqzpyhtrpzjuqkacxpyaqlpio-dot-gl9393jan.uk.r.appspot.com
  pvrdesignstudio.in
  pvrpmaflqrsrtvzr-dot-millinium.ey.r.appspot.com
  pvsddjaayz.duckdns.org
@@ -220527,6 +236457,7 @@ pwgyommjgamsakiamllaawvebdhyurhrfryi-dot-glenxpecial3009493.ey.r.appspot.com
  pwhaemonetics.com.awanlalu.com
  pwieurc.godaddysites.com
  pwitknltjhzxrkxi-dot-millinium.ey.r.appspot.com
+pwiwgmzlgvjhwjfbfybvihjjik-dot-gl9393jan.uk.r.appspot.com
  pwizxjbsbsymwjeo-dot-millinium.ey.r.appspot.com
  pwj-g.svcoding.com
  pwjpcwdafxfvthlr-dot-millinium.ey.r.appspot.com
@@ -220569,6 +236500,7 @@ pxcr.www.dyamm.com
  pxczsmmd.goruli.com
  pxdk11.com
  pxdmdqjiihnpizcm-dot-millinium.ey.r.appspot.com
+pxdnjxdyddygdbnffrwxbodrbk-dot-gl9393jan.uk.r.appspot.com
  pxdspeiosolljcjf-dot-millinium.ey.r.appspot.com
  pxfl.de
  pxhfqwifdqoanrhd-dot-millinium.ey.r.appspot.com
@@ -220594,6 +236526,7 @@ pxi.scorpdynamics.com
  pxi.scottalexanderbaker.com
  pxi.unpaperu.today
  pxid360.com
+pxjcchujjqvgspiyqlerzperqc-dot-gl9393jan.uk.r.appspot.com
  pxkteinzgkahgbwp-dot-millinium.ey.r.appspot.com
  pxllvdissdzjqawz-dot-millinium.ey.r.appspot.com
  pxm.svcoding.com
@@ -220630,6 +236563,7 @@ pyas.rogagot.com
  pyasdf.com
  pybekee2.xyz
  pybiwbjzlssmftyt-dot-millinium.ey.r.appspot.com
+pycodex.xyz
  pyconworldcom.shuiaecho.top
  pycssltsdywinnersinternationalevangelix.duckdns.org
  pycuyxlfar.duckdns.org
@@ -220702,8 +236636,10 @@ pzaid0944-001-site1.atempurl.com
  pzbhhc.dermals.org
  pzbxwcoqeixyxodd-dot-millinium.ey.r.appspot.com
  pzcejkgkrwzwrpetwwapolxwrq-dot-gleowayel400503.uc.r.appspot.com
+pzdbkgrixdadimzbikrdzxvhhc-dot-gl9393jan.uk.r.appspot.com
  pzdlwjcbmyteirosedndjmsatiofoqpsemhe-dot-offgl8876899977678.uk.r.appspot.com
  pzdlwjcbmyteirosedndjmsatiofoqpsemhe.offgl8876899977678.uk.r.appspot.com
+pzezpekmhryjxkjemqhibunzwy-dot-gl9393jan.uk.r.appspot.com
  pzfkdlcjxfjrnxvk-dot-millinium.ey.r.appspot.com
  pzfpwfykqsjxnqiicsbdbfncmssdzvxfrzhj-dot-solar-vertex-285913.rj.r.appspot.com
  pzhv.goruli.com
@@ -220932,6 +236868,8 @@ qcnwhwikm.dermals.org
  qcoexxltglpblnwixgfaqvfvee-dot-gleowayel400503.uc.r.appspot.com
  qcqwaabjvggxphdi-dot-millinium.ey.r.appspot.com
  qctyu.tk
+qcuziqnkzebgrofmeunwnqvymp-dot-gl9393jan.uk.r.appspot.com
+qcvzotohytgpiygylygqjarwyq-dot-gl9393jan.uk.r.appspot.com
  qcwvbysucewkidmi-dot-millinium.ey.r.appspot.com
  qcytzahena.topkorder.su
  qczwgvmnduzkuzsjvs.top
@@ -221041,6 +236979,7 @@ qf82.jaysbrand.com
  qfasfzhjcfivlynu-dot-millinium.ey.r.appspot.com
  qfav.goruli.com
  qfddhesuenvkgxzm-dot-millinium.ey.r.appspot.com
+qfdieiwlouagbquoxbdrbtkdnf-dot-gl9393jan.uk.r.appspot.com
  qfdoucpmqgecylcy-dot-millinium.ey.r.appspot.com
  qfgiaolhloirrxvz-dot-millinium.ey.r.appspot.com
  qfgvbhguyvnjtrrer.weebly.com
@@ -221050,6 +236989,7 @@ qfiw.goruli.com
  qfjqelsbvhburdss-dot-millinium.ey.r.appspot.com
  qfjtflamzpitfatp-dot-millinium.ey.r.appspot.com
  qfjys.com.img.800cdn.com
+qflijnnplteeuxkmyqtmxfhori-dot-gl9393jan.uk.r.appspot.com
  qfnhfwmdammpngnm-dot-millinium.ey.r.appspot.com
  qfpcwfkfpsxsrkayyddktkfdph-dot-gloff00403993445.uk.r.appspot.com
  qfpiabyolofivlmw-dot-millinium.ey.r.appspot.com
@@ -221123,12 +237063,15 @@ qhsiqcoppkxzkraw-dot-millinium.ey.r.appspot.com
  qhst.yunlanit.com
  qhuqgphigivjrnhojpgfvfezosozguuvhixj-dot-solar-vertex-285913.rj.r.appspot.com
  qhuuvsxlagzs.saihjucardatos.com
+qhvdltiavizbvhapvtnluqabjo-dot-gl9393jan.uk.r.appspot.com
  qhvm.goruli.com
  qhwhqlxaewhmhxhh-dot-millinium.ey.r.appspot.com
  qhxcdmdmfriswpmj-dot-millinium.ey.r.appspot.com
  qhxjjjlukyfvbgim-dot-millinium.ey.r.appspot.com
  qhxtnsbfpyqzzhrt-dot-millinium.ey.r.appspot.com
  qhyrhflokrrqkdih-dot-millinium.ey.r.appspot.com
+qhyryhvvadxtkttpswwdgzelji-dot-gl9393jan.uk.r.appspot.com
+qhzkeaneugmvocwkbwerpbvgwn-dot-gl9393jan.uk.r.appspot.com
  qi.jjconcreteseattle.com
  qi1xap6nsguh.talagaremix.com
  qi8ymuiiito-otimo-e-top.com
@@ -221145,6 +237088,7 @@ qiemoqie.com
  qieyhflkjdl.gq
  qif.ac.ke
  qifhhrlloqmxvbik-dot-millinium.ey.r.appspot.com
+qifocuyryxxdilezqdwpbdmqgg-dot-gl9393jan.uk.r.appspot.com
  qifp35o.kempongkenyot.info
  qigong-gironde.fr
  qigupzplmlhezeuxvxrwavaeysfqeqqyikke-dot-cedar-code-289917.nn.r.appspot.com
@@ -221192,11 +237136,11 @@ qj08.awaykart.com
  qj0k.addroits.com
  qj4ec.svcoding.com
  qjasenuqmjqkyjye-dot-millinium.ey.r.appspot.com
-qjbutterflyevents.co.za
  qjd39.mentriqq.com
  qjdax.mentriqq.com
  qjdhnusmgcazrmknshccgqrlol-dot-gleowayel400503.uc.r.appspot.com
  qjdpjy.goruli.com
+qjgcbxcdqiqoioydqffpodsjrx-dot-gleow2021ja.ue.r.appspot.com
  qjgvohyphohcgqrg-dot-millinium.ey.r.appspot.com
  qjgwfnmjnedmecks-dot-millinium.ey.r.appspot.com
  qjgwtrkdqawbqglr-dot-millinium.ey.r.appspot.com
@@ -221241,6 +237185,7 @@ qkslvstelcvyoqot-dot-millinium.ey.r.appspot.com
  qkvnekeeqhtqtrymxdkjsutwyf-dot-gleowayel400503.uc.r.appspot.com
  qkx3yieuufh5.talagaremix.com
  qkycz.onderhost.com
+qkzsbeswcgzxhjtofsfvubtrrm-dot-gl9393jan.uk.r.appspot.com
  qla.shoesmogul.com
  qlaston.net
  qlczvuwnkesltavi-dot-millinium.ey.r.appspot.com
@@ -221346,11 +237291,13 @@ qocfzavvjsgqgnfcmtckmbtyrv-dot-gleowayel400503.uc.r.appspot.com
  qochdghwqg.duckdns.org
  qocsbkewpfmzncjz-dot-millinium.ey.r.appspot.com
  qoejbqafoilbsqss-dot-millinium.ey.r.appspot.com
+qoeuboayiiegxfnkvaoajlzdka-dot-gleow2021ja.ue.r.appspot.com
  qofjvkwvgylrhupu-dot-millinium.ey.r.appspot.com
  qofrmxzjkjwydcdmdjrzmdyvafzfzwtqkssr-dot-solar-vertex-285913.rj.r.appspot.com
  qofrmxzjkjwydcdmdjrzmdyvafzfzwtqkssr.solar-vertex-285913.rj.r.appspot.com
  qogoyxphhjmjxswouaxyvfhvpy-dot-gleowayel400503.uc.r.appspot.com
  qohevmqbjrjlhhtvntsrowtgqe-dot-gleowayel400503.uc.r.appspot.com
+qohroiktwxjamdsmddvoecqvam-dot-gl9393jan.uk.r.appspot.com
  qojkkfqotdihvcyi-dot-millinium.ey.r.appspot.com
  qoljhmpdfnwtsnvvumxthjtmmb-dot-gleowayel400503.uc.r.appspot.com
  qombrvplxglhlbpp-dot-millinium.ey.r.appspot.com
@@ -221361,7 +237308,6 @@ qoohooq.000webhostapp.com
  qooqle-accounts.com
  qooqsbfpcuqwwfdk-dot-millinium.ey.r.appspot.com
  qop7tom.com
-qopduavwkgwddqpu-dot-revalidate-icaan-domain.ue.r.appspot.com
  qoqip.com
  qoracup.xyz
  qorotv.com
@@ -221427,6 +237373,7 @@ qpycbie.goruli.com
  qpzdpbaxmwozgeokdeksbxzsuj-dot-gleowayel400503.uc.r.appspot.com
  qpzfxkzwuvydwvce-dot-millinium.ey.r.appspot.com
  qpzgviukwjutjtae-dot-millinium.ey.r.appspot.com
+qpzvsvnhhfnvgodvxjjacrmulj-dot-gl9393jan.uk.r.appspot.com
  qq274314920.top
  qq461677041.f3322.org
  qq522455.mfzj.1377.xyz
@@ -221500,6 +237447,7 @@ qrihojlykgfjgxvo-dot-millinium.ey.r.appspot.com
  qrjpsicjnetkoowp-dot-millinium.ey.r.appspot.com
  qrkkfhykkzwvielw-dot-millinium.ey.r.appspot.com
  qrlifjagfigscqos-dot-millinium.ey.r.appspot.com
+qrlrowknngnqyshrtohkhorhyf-dot-gl9393jan.uk.r.appspot.com
  qrmgyycyuwaomebn-dot-millinium.ey.r.appspot.com
  qrmn.awaykart.com
  qrmx0.ailacabs.com
@@ -221688,7 +237636,6 @@ quarrington.icu
  quarryrhyming.com
  quarterhausbrewing.com
  quarterly-objective.000webhostapp.com
-quarterlyflusteredkeygen.sfsfffff.repl.co
  quartile-levers.000webhostapp.com
  quartosalacozinhaparavoce.com
  quartosalacozinhavoce.com
@@ -221757,6 +237704,7 @@ quelandro.temp.swtest.ru
  quemargrasa.net
  quemonezneza.000webhostapp.com
  quemviuissoegay.ddns.net
+quenched-sweeps.000webhostapp.com
  quenshud.nahbwsyh.top
  quentinberra.fr
  queoro.net
@@ -221860,6 +237808,7 @@ quirky-clarke-d15627.netlify.app
  quirky-johnson-c4a60c.netlify.app
  quirky-noether-cd4453.netlify.app
  quiropraxia.grupokeithmar.com
+quirurgicamente.com
  quistsolutions.eu
  quitaragora.godaddysites.com
  quiteaqui.xyz
@@ -221868,6 +237817,7 @@ quitenice.co.uk
  quiterenegocieja.com.br
  quiwan8.com
  quixotic-sol-291317.ts.r.appspot.com
+quixoticcooperativeaudacity.sdsdsdsd77dsdsd.repl.co
  quixzlytmgdscnjvkwvgjggcouytbuvaummk-dot-solar-vertex-285913.rj.r.appspot.com
  quiz.facebook.com.getbackonyourfeet.sg
  quiz.takingfive.com
@@ -221882,6 +237832,7 @@ quizzical-blackwell-df290c.netlify.app
  quizzical-lamport-2bde27.netlify.app
  quizzical-leakey-647bbb.netlify.app
  quizzical-ptolemy-1e6d7f.netlify.app
+quizzical-wing-b03752.netlify.app
  quizzigquiz.000webhostapp.com
  quizzingbee.com
  qujedvbiikqvwuljmenftyyiiebfuaurdmwx-dot-cedar-code-289917.nn.r.appspot.com
@@ -221949,6 +237900,7 @@ qvbnafzuigxwjapl-dot-millinium.ey.r.appspot.com
  qvdbdgd.duckdns.org
  qvdpkytcaantuviddvhwnqlzohinsmiv-1rf71aktc.vercel.app
  qvercdzkunralxkp-dot-millinium.ey.r.appspot.com
+qveyippaufhlspcjsfkwwhrean-dot-gl9393jan.uk.r.appspot.com
  qvfftmornmxerrgy-dot-millinium.ey.r.appspot.com
  qvfoxcfdqunx.in
  qvggngrizsovkvglkyfrnaeowk-dot-gleowayel400503.uc.r.appspot.com
@@ -221970,6 +237922,7 @@ qvu2z.app.link
  qvucjdwpdgutxinihesxyxehuaxigqjybwuh-dot-glegen303939423233.ue.r.appspot.com
  qvvdusjfaaxzqgrb-dot-millinium.ey.r.appspot.com
  qvvkhpyscqvrqchfetinbvqyvoktciuatjrp-dot-cedar-code-289917.nn.r.appspot.com
+qvyaqzqnhzzoflhbkeyirjuarv-dot-gl9393jan.uk.r.appspot.com
  qvzshjwxefpzceig-dot-millinium.ey.r.appspot.com
  qw-1.eurmonitor.co
  qw-2-2-2.glitch.me
@@ -222124,6 +238077,7 @@ qz-2.jaysbrand.com
  qz1c.pritiritobo.ru
  qzag.ailacabs.com
  qzbiclaelxudgtcn-dot-millinium.ey.r.appspot.com
+qzcahlrmzcnoxggqhsvlntjhuc-dot-gl9393jan.uk.r.appspot.com
  qzdfjbsmsazfipzm-dot-millinium.ey.r.appspot.com
  qzdvereyqynsovuxqrtbtaeggflidvyszqvj-dot-glxcel49934343434.rj.r.appspot.com
  qzfsvessgpmnsnvo-dot-millinium.ey.r.appspot.com
@@ -222173,7 +238127,6 @@ r.smore.com
  r0-d.lawapass.com
  r00tb0x.org
  r01.addroits.com
-r0d00dd0df0rddn00r0rd000.ams3.cdn.digitaloceanspaces.com
  r0d9s.addroits.com
  r0g3rs02cl1ent92.com
  r0gerscustomers.com
@@ -222292,10 +238245,12 @@ raamagrofoods.com
  raankntue-cco-j.top
  raankntue-coo-j.top
  raasset.com
+raassllopp.cam
  raasvin.com
  raatphailihai.com
  raaukuent-coo.top
  rabaneda.adv.br
+rabbit24.buzz
  rabbitstewlady.com
  rabblepreseli.com
  rabbleserlokclogin.com
@@ -222482,6 +238437,7 @@ radiodouradacd.com.br
  radioebwu.com
  radioecos.com
  radioeska24.com.pl
+radiolac.ch
  radiolibri.it
  radiologyhanoi.com
  radiomisterio.cl
@@ -222898,6 +238854,7 @@ rakuten-jp.buzz
  rakuten-jp.monster
  rakuten-lll.buzz
  rakuten-lll.cyou
+rakuten-lll.icu
  rakuten-login.top
  rakuten-lotte-jp.top
  rakuten-ma.com
@@ -223109,6 +239066,7 @@ rakuten.co.jp.c2rk38.cn
  rakuten.co.jp.cardemaill.xyz
  rakuten.co.jp.cardinfo.cf
  rakuten.co.jp.cardloan.top
+rakuten.co.jp.cardmail.buzz
  rakuten.co.jp.cardmaill.xyz
  rakuten.co.jp.cfsuppportnorplya.xyz
  rakuten.co.jp.cfsuppportnorplyc.xyz
@@ -223346,7 +239304,6 @@ rakuten.co.jp.oeio32iejwhbisd93jkbsdjfgkwjq12.ga
  rakuten.co.jp.ohgdcafagbsggfda.top
  rakuten.co.jp.oiber9dvmb3isdf.xyz
  rakuten.co.jp.osroom.cn
-rakuten.co.jp.paysafeid.xyz
  rakuten.co.jp.pccksq.asia
  rakuten.co.jp.pcgssl.asia
  rakuten.co.jp.pcmbsk.asia
@@ -223799,6 +239756,7 @@ rakuten2.rakuten-jp.link
  rakuten2.song12.monster
  rakuten20.xyz
  rakuten2019.net.cn
+rakuten3.buzz
  rakuten3.laoliu2.xyz
  rakuten3.raku6.xyz
  rakuten3.raku7.xyz
@@ -224123,13 +240081,13 @@ random.eurometalsas.it
  random.it.randalfrance.fr
  random.strabox.it
  random.waterandcoffee.it
-randomboxes1.xyz
  randomhere.ned.online-wb2.xyz
  randomllil.com
  randomsage.work
  randomstranger.com
  randomstring.fiesta.it
  randomstring.yujtrewtrey.from-ms.com
+randomstuff-dot-gl9393jan.uk.r.appspot.com
  randomtuto101.ddns.net
  randopaysdumontblanc.com
  randpassconsulting.co.za
@@ -224512,6 +240470,7 @@ rbjhvjkjbkj.top
  rbji.com
  rbjlifqhrebzlototmuctytiarcwtjxiwswz-dot-gl494903049.wl.r.appspot.com
  rbjoeaefpiwvntrf-dot-millinium.ey.r.appspot.com
+rbjowknyuhnpqgfubltkszjsxt-dot-gl9393jan.uk.r.appspot.com
  rbk-de.net
  rbk-ie.net
  rbkfzvwbibzbfmgavxshjwkxnl-dot-gleowayel400503.uc.r.appspot.com
@@ -224553,6 +240512,7 @@ rbsonline.cc
  rbstyle.club
  rbsutnkchgbqaxghnkxwdzdmtujqdwjvnktr-dot-gl494903049.wl.r.appspot.com
  rbtha.net
+rbtjynggawsgueolyzyjknjvlz-dot-gl9393jan.uk.r.appspot.com
  rbtrtziynbzokegiowtrhoelyn-dot-gleowayel400503.uc.r.appspot.com
  rbtsu.com
  rbuat.net
@@ -224643,12 +240603,14 @@ rcone.kvhkosher.org
  rconfig.pqrhosting.nl
  rcpt-orderinappstoreacc.ohifig.com
  rcptqqehkyldjpwd-dot-millinium.ey.r.appspot.com
+rcqejmcyulpzvsiawfvkuxnoga-dot-gl9393jan.uk.r.appspot.com
  rcqhumhyorddqlxugbncglpvfnidqgmvbxmx-dot-gl494903049.wl.r.appspot.com
  rcqyzpyxtguosboz-dot-millinium.ey.r.appspot.com
  rcrqyqgsdzpwgwixkoetkuxfhx-dot-gleowayel400503.uc.r.appspot.com
  rcscaaa.com
  rcscewjjafjpupsq-dot-millinium.ey.r.appspot.com
  rcsdeliveryservice.com
+rcsfypckybcrktzidvbyfuctma-dot-gl9393jan.uk.r.appspot.com
  rcsharmacollege.com
  rcsic.technocloudtech.com
  rct0aaslr2m8rsl9mpylqtrs.infoaxewa.repl.co
@@ -224784,7 +240746,9 @@ reactivacionlbcpenlinea.verit-is.com
  reactivacionoutlaaklo.000webhostapp.com
  reactivacionperubcp.cilonss.com
  reactivalbcponline.on-pops.com
+reactivaonlinebcpzonasegura.000webhostapp.com
  reactivaperuconbcponline.rec-tosw.com
+reactivaperuzonasegurabcponline.000webhostapp.com
  reactivarperubcpenlinea.rec-tivsps.com
  reactivasperuconbcp.cardio-rd.com
  reactivassnt-online.preview-domain.com
@@ -225019,7 +240983,6 @@ reakettem.reakktee.top
  reaknteuc-coo-j.top
  real-corp.info
  real-deal.net
-real-estate-41012.cakejiny.com
  real-estate-6417409-page.me
  real-estate-ads876567u84839yr63ry8f743yt4t54y.com
  real-estate-experts.com
@@ -225089,6 +241052,7 @@ realestate-page-id156295.com
  realestate-page-id1565125.com
  realestate-page-id15729380.com
  realestate-page.us.alapinta.com
+realestate-page1265623.com
  realestate-page5174612.live
  realestate.estatedeeds.com
  realestate.page-2000075874.credmillions.com.br
@@ -225218,6 +241182,7 @@ realtygrouppage-temproperties-pfb201145471385.org
  realtymarket.in
  realtyproperty-page8553839.com
  realvidiobokepviral.ooguy.com
+realvoicecode.buzz
  realwdwere24.com
  realwomaisndb.com
  realworld.co.in
@@ -225368,6 +241333,7 @@ recipeacademycom.nckibasketball.gdn
  recipetoday.xyz
  recipharm.xyz
  recipient-delete.com
+recipienthelp.com
  recivdissued.com
  recklessdarkreddefragment--five-nine.repl.co
  reclaimforms.com
@@ -225575,6 +241541,7 @@ rede-de-novidades.com
  redecaminhodosaber.com.br
  redeem-magic-cube-gratis-fre-fire.000webhostapp.com
  redeem-taxrepayment.com
+redeemee-coodeee.000webhostapp.com
  redeemerssports.com
  redeemlace.cyou
  redeempubgms15.zyns.com
@@ -225584,7 +241551,6 @@ redeemtencent.com
  redeftp.ddns.net
  redelementhealth.com
  redeleteslashinghun.quickwebchecker.com
-redelivery.rmalerts.co.uk
  redemhadiah.eventfreeclaims8.my.id
  redenoticiasmarajo.com
  redensd.com.br
@@ -225708,6 +241674,7 @@ redsonitjobs.com
  redsrev.com
  redsswou.ml
  redstoneklazomaniac.com
+redsxqjjozogfcfptefwzzqzly-dot-gl9393jan.uk.r.appspot.com
  redtv.top
  reducedeputize.com
  reductioniststudios.com
@@ -225890,6 +241857,7 @@ regdev-new.com
  rege.opriessnig.at
  regeimaging.in
  regency-pacific-a.gq
+regency-pacific-auth.cf
  regencymyanmar.com
  regencyship.info
  regenerationcongo.com
@@ -225924,6 +241892,7 @@ registandesertsafari.com
  registasports.com
  register-accountpesfree300coins.dubya.net
  register-alert.cc
+register-auth-handheld.co.uk
  register-banking-halifax.com
  register-device-halifax.com
  register-device.co.uk
@@ -225940,7 +241909,6 @@ register-secure.co.uk
  register-setting-online.webnode.com
  register-singup.com
  register-vanillascard-zipcode.com
-register-your-vehicle.com
  register-yourdevice.com
  register.amazon.update-co-jp.top
  register.amz.account.update-co-jp.top
@@ -225971,6 +241939,7 @@ registreer.mijn-verificatie.noez.me
  registro-falabe.info
  registro-seguro-c.com
  registrobdserver.com
+registrobn1-multired.xyz
  registrobn1clients.com
  registrobnservicios.com
  registrobnservicios1.com
@@ -226063,6 +242032,7 @@ reikirelax.xyz
  reimbursement.cra-arc.cc
  reimbursment.nesconpk.com
  reimer-gartenbau.de
+reindeer24.buzz
  reindeermachinery.com
  reinfosec.000webhostapp.com
  reingerinlet.xyz
@@ -226198,11 +242168,11 @@ relianceonl.com
  reliancepublications.co.in
  reliancetradeandcommerce.com
  reliantland.vn
-relica-71.gq
  relicatessen.com
  reliclow.xyz
  relief-co.com
  reliefbenefitnews.com
+reliefextinct.guru
  relieffund.freeinternetz.com
  reliefnygov-resource.net
  reliefofcosatu.fun
@@ -226214,6 +242184,7 @@ relikutenda.top
  relishburger.ca
  relitechinfosys.com
  reliwirkprlnuumt-dot-millinium.ey.r.appspot.com
+rellingforward.shop
  reload.com0c.casa
  reload.com0q.casa
  reload.com0y.casa
@@ -226403,7 +242374,6 @@ remove-newpayee.co.uk
  remove-payee-online.co.uk
  remove-payee.co.uk
  remove-payee.live
-remove-payeeadded.com
  remove-payees.co.uk
  remove-payees.uk
  remove-payeesecure.com
@@ -226486,7 +242456,6 @@ renatamalls.tk
  renatocoto.com
  renatoparente.com
  renatoraquetes.com.br
-renatostropafotografia.com.br
  renaulta-app.web.app
  renauths.com
  rencontre-feminin.com
@@ -226524,7 +242493,6 @@ renew365boionline.com
  renewable-tanks.000webhostapp.com
  renewablre.work
  renewal-amazonprimembership.com
-renewal-bill-info-secured.com
  renewal-billing.updateukee.com
  renewal-primemember.serveirc.com
  renewal0srv-prime.serveirc.com
@@ -226612,6 +242580,7 @@ rentlala.com
  rentmall.in
  rentmotorhomesmuenchencom.chifanassume.top
  rentmybooth.fun
+rentnew.buzz
  rentonspineclinic.com
  rentonwa.top
  rentry-co-info-login-facebookapp01.webnode.com
@@ -226890,6 +242859,7 @@ resgatandomeuspontos.jumpingcrab.com
  resgatapontoslivelobb.com
  resgatar-alianca.com
  resgatar-premio-tv.com
+resgatardescontos.online
  resgate-70milmilhas.ml
  resgate-hoje-conosco-seguro.online
  resgate-pontos-seguro-hoje-conosco.site
@@ -226947,6 +242917,7 @@ resolutioncenters.paypal.com.mxlimted.com
  resolutioncommunityservices.com.au
  resolutionelectric.com
  resolutionhomesales.com
+resolve-bill-error-09.com
  resolve-fraud-help.com
  resolve-issues-with-account.com
  resolve-limit-issues.com
@@ -227007,7 +242978,6 @@ response-online.co.uk
  response3-gb.com
  responseinfoinc.com
  responsive-sun-284810.nw.r.appspot.com
-responwhatsapp.gq
  respublicae.com.br
  resq-today.com
  resraginmriwatfa-dot-millinium.ey.r.appspot.com
@@ -227107,7 +243077,6 @@ restremt.com
  restrepohenao.com.co
  restrict-anew-onlinepayee.com
  restrict-newpayee-alert.com
-restricted-account.tk
  restricted-pp.com
  restricted3account.com
  restrictedclump.com
@@ -227203,6 +243172,7 @@ resumabitas.com
  resume4dummies.com
  resun-secureidapp.serveirc.com
  resurfaceenigmatic.com
+resurgetop1.buzz
  reswase.com
  resxsqreup.com
  reszpao.000webhostapp.com
@@ -227261,6 +243231,9 @@ retourxvente.info
  retransform.xyz
  retratoitinerante.com.br
  retreatparadox.com
+retribution-admin-1991153264987087.tk
+retribution-admin-1991153264987088.tk
+retribution-admin-1991153264987089.tk
  retrievals.000webhostapp.com
  retrieve-update.gq
  retrievepaypal.com
@@ -227351,6 +243324,7 @@ revenuecra-auth02.gleeze.com
  revenueemployementinterac.com
  revenueqc-interac.ca
  reverenddiameters2284.000webhostapp.com
+reverent-darwin-9eedc5.netlify.app
  reverent-goldwasser-b61599.netlify.app
  reverent-mclean-37a573.netlify.app
  reverent-mestorf-e3b099.netlify.app
@@ -227395,11 +243369,11 @@ review-pages-authorized-2020.my.id
  review-pages-identify-fb2020.my.id
  review-pages-manager-fb03322020.my.id
  review-payee-9347.info
-review-payeeactivity.com
  review-payeeonline.link
  review-paymenthsbc.com
  review-payments.net
  review-paypal.theworkpc.com
+review-paypal581.com
  review-secure.com
  review-terms-conditions-ticket-id.cbdoilsmed.com
  review-user-information.com
@@ -227423,7 +243397,6 @@ reviewactivity.de
  reviewactivity.limited
  reviewbig.com
  reviewblock.org
-reviewdevices.online
  reviewfb-policy.com
  reviewfbinfo.com
  reviewfiles.aircon.org.in
@@ -227549,6 +243522,7 @@ rewardxuc.com
  rewebmail-login.web.app
  rewindpiquillok.com
  rewitek.nl
+rewnal.monster
  rewqas.xyz
  rewqqwer1.000webhostapp.com
  rewrer.ddns.net
@@ -227603,8 +243577,10 @@ rf4w4.com
  rfanews.sslport.work
  rfaqdejtmewfwcjymgtbclhwxr-dot-gleowayel400503.uc.r.appspot.com
  rfarm.net
+rfbutkzhkuqyjflnglwivsztjk-dot-gleow2021ja.ue.r.appspot.com
  rfd-royalight.com
  rfeybtjrlcdturzj-dot-millinium.ey.r.appspot.com
+rffaclsgjnkmbmznjkgabipmka-dot-gl9393jan.uk.r.appspot.com
  rffrvdgkckjwuizd-dot-millinium.ey.r.appspot.com
  rffsa.jiahaitao.cn
  rfg.dez3.cn
@@ -227619,6 +243595,7 @@ rfheoiopfoipeodwojdhjkwdkl.weebly.com
  rfhgs.1r7dkb.cn
  rfhsg.xyz
  rfidhr.tk
+rfihtqqfaclxgbjkywnybfcxxp-dot-gl9393jan.uk.r.appspot.com
  rfilqtypyscbdyfy-dot-millinium.ey.r.appspot.com
  rfjtumostvds.cf
  rfjzk.mentriqq.com
@@ -227674,6 +243651,7 @@ rgggsg.xtwprc.cn
  rghyjkos.com
  rgiatlsdafguqonx-dot-millinium.ey.r.appspot.com
  rgilabfgmycammsckmxefwrlmw-dot-gleowayel400503.uc.r.appspot.com
+rgilqsqdinuksiuysbfqcnrlbe-dot-gl9393jan.uk.r.appspot.com
  rgjqmtj2wqif.talagaremix.com
  rgkpgftg.pcchvud.cn
  rglrilwlgvjxgeaf-dot-millinium.ey.r.appspot.com
@@ -227703,10 +243681,12 @@ rguvsxhdvhgoxsqq-dot-millinium.ey.r.appspot.com
  rgvgnk391hiu.talagaremix.com
  rgviixkxvqczmdpr-dot-millinium.ey.r.appspot.com
  rgwwcuoyxtyjqtnk-dot-millinium.ey.r.appspot.com
+rgxhvniedeyshghtlcjuuzaxce-dot-gleow2021ja.ue.r.appspot.com
  rgyg.rl2078.cn
  rgyolo.2fa637.cn
  rgys.muhuangshi.cn
  rgz6y.addroits.com
+rgzhhnqmimyjrzxnihvrlcapma-dot-gl9393jan.uk.r.appspot.com
  rh0tpostadikka.xyz
  rh2j6r3dcs2njy96fgsb.party
  rh6s.addroits.com
@@ -227782,6 +243762,7 @@ rhqnrkms.rogagot.com
  rhqtgrwrznwhbwgwzu.top
  rhshowkhin.com
  rhsp.svcoding.com
+rhujonbdfinhimtfdlznxeinse-dot-gl9393jan.uk.r.appspot.com
  rhurkukexgognnswwkcmdnhnue-dot-gleowayel400503.uc.r.appspot.com
  rhvodjdjjipsfgkt-dot-millinium.ey.r.appspot.com
  rhvqpyscsmxmhvyb-dot-millinium.ey.r.appspot.com
@@ -228171,6 +244152,7 @@ rj6bq.addroits.com
  rjanneman.nl
  rjaytech.com
  rjbsplzk.rogagot.com
+rjcuacokiyersxhcadguoqqpwu-dot-gl9393jan.uk.r.appspot.com
  rjenmzux.goruli.com
  rjgflsqsl.gulfhirings.com
  rjglbsla.tanglescanner.com
@@ -228194,6 +244176,7 @@ rjstdkhhpamixxtndomladbfnxxqyjvysmwb-dot-cryptic-now-290917.ey.r.appspot.com
  rjujebgmgwsqmsbk-dot-millinium.ey.r.appspot.com
  rjvbtxpdhfxtcztvth.top
  rjwd.jaysbrand.com
+rjwstnnwpmydncavruwysnkzmk-dot-gl9393jan.uk.r.appspot.com
  rjxaodkjezdbpufihwcxahhrfw-dot-gleowayel400503.uc.r.appspot.com
  rjxz7.gds.name
  rjyw.awaykart.com
@@ -228290,12 +244273,14 @@ rlnashracing.com
  rlphcwirefqwgmhnpiphftvbcblxfhleqrvl-dot-solar-vertex-285913.rj.r.appspot.com
  rlsgitovlwopdvka-dot-millinium.ey.r.appspot.com
  rlteaid.com
+rlthulembmxfieyhnphvlfmeuj-dot-gl9393jan.uk.r.appspot.com
  rlvoknihzxeoqsnu-dot-millinium.ey.r.appspot.com
  rlwhvtqu.top
  rlwqrxcplhnbwhfkmhaeknqibmiekfifrhyq-dot-solar-vertex-285913.rj.r.appspot.com
  rlwxfcjqzhcqgjet-dot-millinium.ey.r.appspot.com
  rlwyfokqtszipgngcgeohcwlrlbixaqvckqe-dot-glegen303939423233.ue.r.appspot.com
  rlxdcourixzlipbvwnxpmgrkut-dot-gleowayel400503.uc.r.appspot.com
+rlzczzkauxxxcmjqjiaqvvhkyy-dot-gl9393jan.uk.r.appspot.com
  rlzvpndubgmdahkcliyfyxokumiddykjpmqi-dot-cryptic-now-290917.ey.r.appspot.com
  rm.facebookus-07423148.cleansol.lk
  rm4w.lawapass.com
@@ -228354,6 +244339,7 @@ rmtigszxmtmvmgks-dot-millinium.ey.r.appspot.com
  rmtottawa.ca
  rmtz-amazonservis9k.servebeer.com
  rmutcon2018.rmutsv.ac.th
+rmuwxaiumrbndzuflfzivctldn-dot-gl9393jan.uk.r.appspot.com
  rmv-01760142.detalhesmusical.com.br
  rmv-03520176.detalhesmusical.com.br
  rmv-08773627.detalhesmusical.com.br
@@ -228483,10 +244469,12 @@ rns-coaching.fr
  rnsewa.com.np
  rnsmazon.com
  rnt99.com
+rnteeed.000webhostapp.com
  rntlnz.cam
  rntlr.goruli.com
  rnuffrnhdwgyqdvanz.top
  rnuganbank.com
+rnugnziusflvcpdixufvpxzpbm-dot-gl9393jan.uk.r.appspot.com
  rnumfscsdsbhncpb-dot-millinium.ey.r.appspot.com
  rnviftfpqcgznrhk-dot-millinium.ey.r.appspot.com
  rnvrxw68.firebaseapp.com
@@ -228508,6 +244496,7 @@ roadtripkiddos.icu
  roadubettlapi.tk
  roadwarrior.app
  roajic.goruli.com
+roalmsteghkpcoctioygcmorcm-dot-gleow2021ja.ue.r.appspot.com
  roan-slash-pomelo.glitch.me
  roannestanislausolimpia.casa
  roar-cbd.com
@@ -228597,6 +244586,7 @@ robustmiggs.com
  roby557.000webhostapp.com
  robyn-plombier-chauffagiste.fr
  robyn.imcupropertyrentalsgroup.com
+robynjania.ru
  rocaprevera.cat
  rocareindia.co.in
  rocbattle.com
@@ -228626,6 +244616,7 @@ rockettt.xyz
  rocketviral.com
  rocketzaym.ru
  rockfilenteess.ml
+rockharaagaiansg.us
  rockhardboost.cyou
  rockinprices.net
  rockinrhinestonesandvinyls.com
@@ -228935,6 +244926,7 @@ roomycars.com
  rooney.access.ly
  rooneyelectric.com
  rooony.000webhostapp.com
+roooolejhrpnoiwwvkjnzesvlb-dot-gl9393jan.uk.r.appspot.com
  roopakbabu.com
  roorthie.com
  roosteralan.000webhostapp.com
@@ -228956,6 +244948,7 @@ rootvewr.com
  rootvhcfjrxnjbqp-dot-millinium.ey.r.appspot.com
  rootwqra.com
  rooyan.in
+roozhmandecor.com
  ropaemporio.com
  ropergulf.net.au
  ropexon.com
@@ -229106,6 +245099,7 @@ routrackerlinefx.ml
  rouxlive.tk
  rovaconstruction.com
  rovegania.ro
+rover-bts.000webhostapp.com
  rover-chm.000webhostapp.com
  rover-mxn.000webhostapp.com
  rover-ps30.000webhostapp.com
@@ -229148,6 +245142,7 @@ royalalpaca.com
  royalbaks.com
  royalbank-reset--7839384993.com
  royalbank.com.0sf-50tg05-f54t.com
+royalbank.com.cgi-bin-rbaccess-rbcgi3m01f51f-f23ibrequest.info
  royalbank.com.wkoj4vg72vt.doggoneracing.com
  royalbank.com.xa-mxv.com
  royalbank.com.xtudocapela.com.br
@@ -229181,6 +245176,7 @@ royalhometouchhotels.com
  royalini.com
  royaljokar.000webhostapp.com
  royalland.com.tr
+royalmail.support
  royalmaill.top
  royalmedicpharma.com
  royalmeds.in
@@ -229320,6 +245316,7 @@ rqhqhyqylgsjbcbs-dot-millinium.ey.r.appspot.com
  rqhtrylhtyzjtyde-dot-millinium.ey.r.appspot.com
  rqicnclmxavccnqqvvegmujokz-dot-owaonk399399393.uk.r.appspot.com
  rqijaglnfnchpefr-dot-millinium.ey.r.appspot.com
+rqinartbyeawzbiycjvwdnxnkq-dot-gl9393jan.uk.r.appspot.com
  rqitgedsmpjurpunrqcolmkhulzieyupkjeu-dot-cryptic-now-290917.ey.r.appspot.com
  rqkbntwjfavhhunu-dot-millinium.ey.r.appspot.com
  rqkowhlfai.duckdns.org
@@ -229327,6 +245324,7 @@ rqkyuiwgsbgfkvih-dot-millinium.ey.r.appspot.com
  rqllgeauzylkqnfw-dot-millinium.ey.r.appspot.com
  rqmgsbszfhsoplbn-dot-millinium.ey.r.appspot.com
  rqmiampkvledtwfj-dot-millinium.ey.r.appspot.com
+rqnpxvvcotgivdccogmksjjdmg-dot-gl9393jan.uk.r.appspot.com
  rqnzycof.tanglescanner.com
  rqoestorecpaqe.000webhostapp.com
  rqoykqkfwcjwxaky-dot-millinium.ey.r.appspot.com
@@ -229452,6 +245450,7 @@ rsglwsjwlfiuyfot-dot-millinium.ey.r.appspot.com
  rsgqmtposdmiqpaknnnicehcdhpiqezixcyr-dot-cedar-code-289917.nn.r.appspot.com
  rshack.ddns.net
  rshalbrlobafiarjmajxjrklpjdnzhdoljhq-dot-glenxpecial3009493.ey.r.appspot.com
+rshtiuobyyjtcwpogzsrqkvkuy-dot-gl9393jan.uk.r.appspot.com
  rsibxky.goruli.com
  rsimadinah.com
  rsiuhs7vyfvz9ntbw.gmz.cc
@@ -229777,6 +245776,7 @@ rumbaskincare.com
  rumemyztrupjqspr-dot-millinium.ey.r.appspot.com
  rumewle.xyz
  rumhellersafrican.digital
+rumorkeep.guru
  rumpunbudiman.com
  rumsse.com
  rumz.net
@@ -229788,7 +245788,6 @@ runawaysecliptic.top
  runda-wygranych.eu
  runderfulthailand.com
  rundll.co.in
-runelegendsloginrewards.com
  runescape-benefits.club
  runescape-benefits.com
  runescape-bonds.com
@@ -229888,6 +245887,7 @@ runtimebroker.pw
  ruohvnqwiopioftn-dot-millinium.ey.r.appspot.com
  ruon1on.ru
  ruoungoai.online
+ruououailwryxyhrjfoldshidv-dot-gl9393jan.uk.r.appspot.com
  rupaq.com
  rupayangroup.com
  rupcgyfotpcqsxrb-dot-millinium.ey.r.appspot.com
@@ -229966,12 +245966,12 @@ ruugus.buahx.cn
  ruvstkipwsqoabqq-dot-millinium.ey.r.appspot.com
  ruw7q.weblium.site
  ruwiin.gdn
+ruwzlnyplaxzsdycoosugqnuhq-dot-gl9393jan.uk.r.appspot.com
  ruxkqmmeovfefabz-dot-millinium.ey.r.appspot.com
  ruyfucgeuuksgkkqzcxuuhlcrj-dot-gleowayel400503.uc.r.appspot.com
  ruylmlxlxleydeyq-dot-millinium.ey.r.appspot.com
  ruymatz.com.br
  ruyonkgtqzqwpust-dot-millinium.ey.r.appspot.com
-rv.seriesnow.website
  rva-ltd.co.uk
  rvalzieikar.cloudaccess.host
  rvasyeedvrjrdnjqfq.top
@@ -230078,10 +246078,12 @@ rwkqtvbbmf.top
  rwkuten.xyz
  rwlqjimpzwlcaktr-dot-millinium.ey.r.appspot.com
  rwlwlngpvevqxgak-dot-millinium.ey.r.appspot.com
+rwlysfwbiylbyabehviwhvwiey-dot-gl9393jan.uk.r.appspot.com
  rwmaz1ewk6lk18.com.de
  rwnqjiadsbbwzybmwuvxhokxybdhktxvogvt-dot-glegen303939423233.ue.r.appspot.com
  rwokm.app.link
  rwozjbdegrnlrlal-dot-millinium.ey.r.appspot.com
+rwpegdudiyolhozelflrbqknve-dot-gl9393jan.uk.r.appspot.com
  rwpyrwlpmhrgvxyj-dot-millinium.ey.r.appspot.com
  rwrrvwnvxmgbnlwi-dot-millinium.ey.r.appspot.com
  rwrwnmphvyxdlsmpqiibqkvocf-dot-gloff849483.uk.r.appspot.com
@@ -230106,6 +246108,7 @@ rxgnvdlfornuuajn-dot-millinium.ey.r.appspot.com
  rxifihxfosugwkxtoemawshqjx-dot-gleowayel400503.uc.r.appspot.com
  rxizkulnyptuqlthatrmgcluov-dot-gleowayel400503.uc.r.appspot.com
  rxknap.newhotstore.su
+rxlaegcltsbjlrgshignzfobgf-dot-gl9393jan.uk.r.appspot.com
  rxlensbuhiomhkdg-dot-millinium.ey.r.appspot.com
  rxmedstores.com
  rxnmcldtxnpydfhjfbtnuubqkm-dot-gleowayel400503.uc.r.appspot.com
@@ -230120,6 +246123,7 @@ rxwnxpvspslzyxkcdwdbuxxwqz-dot-gleowayel400503.uc.r.appspot.com
  rxwpukdcfywnvxdhdp.top
  rxwsterzuzpekqzaqa.top
  rxxroll.fun
+rxyuorcmoljtdemjithjcyqzyo-dot-gl9393jan.uk.r.appspot.com
  rxzbrcdatadwuwnp-dot-millinium.ey.r.appspot.com
  rxzkiwag.goruli.com
  ry.valerana44.ru
@@ -230146,6 +246150,7 @@ rybinskbarhat.ru
  rybkamoya.club
  rybkewirbqplklnuyiqgrwqinb-dot-gleowayel400503.uc.r.appspot.com
  rybnoemesto.net.ua
+rybruniueltsarvksuznjzdwks-dot-gleow2021ja.ue.r.appspot.com
  rybzp.goruli.com
  rycbradgvedzlxiqhhzrpvukptwvuzhrvvmt-dot-offglen.uk.r.appspot.com
  ryccaslvs.parahcenah.com
@@ -230204,6 +246209,7 @@ rytys.xyz
  ryug.uk
  ryugakusite.biz
  ryuoy.weebly.com
+ryurlqdxjcagrmgcwfyyohjzdn-dot-gl9393jan.uk.r.appspot.com
  ryvan000.xyz
  ryvcqelxqmlubloo-dot-millinium.ey.r.appspot.com
  ryvrs.com
@@ -230249,6 +246255,7 @@ rznmarket.ru
  rznp4.oujevais.com
  rzp1y.awaykart.com
  rzpgqpdlcqggdgol-dot-millinium.ey.r.appspot.com
+rzphddinjcmipyyafljzbifzta-dot-gl9393jan.uk.r.appspot.com
  rzqnxgqehevumqaz-dot-millinium.ey.r.appspot.com
  rzrcd.svcoding.com
  rzroll.xyz
@@ -230743,6 +246750,7 @@ safepayee-support.com
  safepayeeguard-help.com
  safepayeehelp-support.com
  safepaymentpayee-help.com
+safeproed.casa
  safer.com.gt
  saferakuten.top
  saferways.com
@@ -231436,7 +247444,6 @@ santaliny.net
  santaliny.org
  santaluisa.top
  santamama.ac.ug
-santan-device-authentication.com
  santan-es-banco-20.tk
  santan-payeealert.com
  santan-totta.org
@@ -231501,8 +247508,7 @@ santanderway.servehttp.com
  santanderwaycliente.ooguy.com
  santandewayonline.com
  santandor.mx-reti.com
-santanhelp-service.com
-santansupport-device.com
+santanservices-mydevice.com
  santaremplay.com.br
  santaskey2recovery.com
  sante.ge
@@ -231653,7 +247659,6 @@ sarkarisuccess.com
  sarkoklamhlpsrvce01.xyz
  sarl-diouane.com
  sarlessrtaer.com
-sarma-e503b.web.app
  sarmvdvkhdvyosfm-dot-millinium.ey.r.appspot.com
  sarobiglobal.com
  sarohardting.tk
@@ -231731,7 +247736,6 @@ satiricon.be
  satkaniaiit.com
  satkom.id
  satmythuatdongduong.vn
-satne.eu3.biz
  satnt-fra.netlify.app
  satnt-fra.netlify.com
  satola.at
@@ -232067,6 +248071,7 @@ scheduledpaym-alert.com
  scheduletext.com
  scheff.com
  schelliing.com
+schemeanxiety.com
  schemecoffin.guru
  schiedelriteventcom.nckiconsulting.gdn
  schiguidemobi.shaxiaarea.top
@@ -232292,6 +248297,7 @@ scotiiabank.live
  scotiiabank.xyz
  scotilbakcolpatrea.online
  scotiranrks.xyz
+scotlabans.com
  scotlabanxmx.net
  scotncolpn.com
  scotriabank.online
@@ -232327,6 +248333,7 @@ scrapy999.com
  scratchcustomdesserts.info
  scratchiestcamel.htmlpasta.com
  scratchless-college.000webhostapp.com
+scratchraw.guru
  scratchygrowlingarchitects.vadasd.repl.co
  scrawk.tusarranjan.com
  scrawlier-sediments.000webhostapp.com
@@ -232335,6 +248342,7 @@ scrcconnexionportailmssgeriemms.udo.photo
  screamcup.xyz
  screamhard50.24x7s.com
  scredit-agricolesl-credit-agricole-voscomptes-slsmns.com
+screechx.buzz
  screen-fantom.com
  screenfirst.de
  screenlinenet.shaxiaabove.top
@@ -232382,7 +248390,6 @@ scscxx.weebly.com
  scservice.at
  scshiur.org
  sct-pst.ml
-sct-pst.tk
  sctec.xyz
  sctehonm.xyz
  sctiabanx.net
@@ -232423,6 +248430,7 @@ scxugosports.com
  scxza.top
  scylex.com
  scyzm.net
+sczdhmxlazovjlpvpllfowgwcy-dot-gl9393jan.uk.r.appspot.com
  sd-2-d.glitch.me
  sd-asd-s.glitch.me
  sd-products.info
@@ -232442,6 +248450,7 @@ sdaheaf.com
  sdallzfqvlkrkhupnagjrdedzjlbcfmdnrua-dot-cryptic-now-290917.ey.r.appspot.com
  sdaqt.xyz
  sdast.xyz
+sdawadxzc2322x48s4dd.xyz
  sdawqe.myddns.rocks
  sdayhaneql.tastypriceo.su
  sdboatstore.com
@@ -232630,6 +248639,7 @@ seafarerconsulting.com
  seafees.surge.sh
  seafoflexpenn.xyz
  seafood.sa.gp
+seaforgame.000webhostapp.com
  seagalology.xyz
  seagamebbss.000webhostapp.com
  seagatesthreecharters.com
@@ -232884,8 +248894,8 @@ secure-account44565.servepics.com
  secure-accountaccess-amazon.de.vcxpq.com
  secure-accountalertid843-services.loseyourip.com
  secure-accountappieidhasbenlockded.com
-secure-accountlogins-devive.com
  secure-accountonline.com
+secure-accounts0-jp1.tk
  secure-accovid.com
  secure-action-21744.000webhostapp.com
  secure-agence.com
@@ -233084,6 +249094,7 @@ secure-document-viewer-login.du.r.appspot.com
  secure-docusign.net
  secure-dynamic.serveirc.com
  secure-ee.digital
+secure-eeuk-updateinfo.com
  secure-etransfer.serveirc.com
  secure-excel-file.glitch.me
  secure-faceb00k.ad64987-photo948hd3654.com
@@ -233248,7 +249259,6 @@ secure-my-payee.live
  secure-my3billing.com
  secure-myaccount.com
  secure-myaccountdetails.com
-secure-mybillingthree.com
  secure-myee-startuk.com
  secure-myeelogin.com
  secure-myhalifax.com
@@ -233270,9 +249280,9 @@ secure-network-web.com
  secure-new-device.link
  secure-new-login.link
  secure-new-online.com
+secure-new-payee-deactivation.com
  secure-newdevice-cancellation.com
  secure-newdevice-deregister.com
-secure-newlogin-devices.com
  secure-newonline-payee.com
  secure-newpayee.cc
  secure-notice-account-sign.valhallainfull.com
@@ -233294,7 +249304,6 @@ secure-online-halifax.com
  secure-online-halifaxmobileapp-systemupgradeapp.otticagrande.com
  secure-online-info.duckdns.org
  secure-online-payee-login.com
-secure-online-payeemagement.com
  secure-onlinebanking-review-dashboards.ddnsfree.com
  secure-onlinehali.com
  secure-onlinehalifax.co.uk
@@ -233323,7 +249332,6 @@ secure-payee.org
  secure-payeeattempts.live
  secure-payeecheck.com
  secure-payeelink.com
-secure-payeeremoval.com
  secure-payeesecurity.live
  secure-payeeslist.com
  secure-payeeupdate.com
@@ -233332,6 +249340,7 @@ secure-payment.servehalflife.com
  secure-payment221.serveirc.com
  secure-payment222.axagufniman.com
  secure-payment234.gomanxis.com
+secure-payne-pp-marchand.000webhostapp.com
  secure-paypailine.serveirc.com
  secure-paypal-service-review-dashboard2.casacam.net
  secure-paypal-verification-review-dashboard.ddnsfree.com
@@ -233425,7 +249434,6 @@ secure-threerefund.com
  secure-tls-auth4.com
  secure-transparency-page-account.000webhostapp.com
  secure-tsb.safety-account.com
-secure-tsbpayee.link
  secure-uk-halifax.com
  secure-unrestricted-online.com
  secure-up-login.com
@@ -233596,6 +249604,7 @@ secure.financeweb.cyou
  secure.financework.live
  secure.financework.monster
  secure.gov-refunduktax.org
+secure.hali-confirm.com
  secure.halifax-cancel.co.uk
  secure.halifax-deregister.co.uk
  secure.halifax-mobile.co.uk
@@ -234518,7 +250527,6 @@ secured-deregister-mobile.com
  secured-deregisterdevice.com
  secured-deregistration-newmobile.com
  secured-device-alert.com
-secured-device-login.com
  secured-device-protection.com
  secured-device-support.com
  secured-device.com
@@ -234665,7 +250673,6 @@ securedrecovery.misecure.com
  secureds-orderses.serveirc.com
  securedscalogin.eu
  securedsupport-check.com
-securedtsb-device-login.com
  secureduser.du.r.appspot.com
  securedverifychase.serveirc.com
  securedwebapp.chase.webapp.bottazzineumaticos.com.ar
@@ -234687,6 +250694,7 @@ securefixes.com
  securefox.guru
  securegate04a-chase.theworkpc.com
  securegate05b-banking.dns05.com
+securegroupdevice.co.uk
  securehalifax-login.com
  securehalifax-portal.com
  securehalifax.com
@@ -234737,6 +250745,7 @@ securekey-activity-safegaurd.com
  securekey-app-protection.com
  securekey-device-removal.com
  securekey-remove-payee.com
+securekey-sitelogin.com
  securekey-unknown-device.com
  securekoliume.000webhostapp.com
  secureld.validation-form.required.japanbikeclub.com
@@ -234747,8 +250756,6 @@ securelin-activaton.cba.pl
  secureline-activity.dynamic-dns.net
  secureline-helpdesk.com
  securelloyd-data.com
-securelloyd-device-unknown.com
-securelloyd-device-unregister.com
  securelloyd-device.com
  securelloyds-auth.com
  securelloyds.com
@@ -235069,7 +251076,6 @@ securewfffaccc-serveraccess.com
  securewindred.weebly.com
  securex.login.accounts.click.gift-arg0s-c0-uk.icu
  secureyouraccount12.000webhostapp.com
-secureyourpayees.com
  securezza.at
  securfb20.my.id
  securie01a.chase.id-login-server.com
@@ -235146,6 +251152,7 @@ security-id-login.com
  security-indeed.com
  security-information-paypl-supportes.smith-petersonmediagroup.com
  security-jpmorganchase.serveuser.com
+security-keylogin.com
  security-limitedsaccnt.drheaas.com
  security-limitedsdevice.vabhvxac.com
  security-limitedsdevice.xvaaxca.com
@@ -235176,7 +251183,6 @@ security-newpayee-alert.link
  security-olb.co.uk
  security-online-halifax.com
  security-online-login.com
-security-online-stop.com
  security-operation-center.de
  security-page-busines.000webhostapp.com
  security-page-help.000webhostapp.com
@@ -235507,6 +251513,7 @@ seemasartworkhalt.com
  seemlue.com
  seencompany.com
  seenext.com.pk
+seenurbo.us
  seepisiolt.com
  seeresults.000webhostapp.com
  seesamstrasse.extended-applications.de
@@ -235647,7 +251654,7 @@ selaronpedacosdomundo.com.br
  selberschoen.net
  selbstinszenierungnet.shaxiaadd.top
  seldefence.work
-selebtiktok.25u.com
+seleb.whatsapp-grub.tk
  selebtop.xyz
  seleccionsodimac.ru
  select-wines.org
@@ -235688,6 +251695,7 @@ selfish-cheese.aerobaticapp.com
  selfnationz.com
  selfoutlet.com
  selfovereat.xyz
+selfporter.guru
  selfrudhall.com
  selfsecureupgrade.servehttp.com
  selfservice-verify.misecure.com
@@ -235739,6 +251747,7 @@ sellstant.com
  selltnow.com
  sellularbd.com
  sellusedgym.com
+selma.thagard.net
  selopet.co.uk
  selrverette.tk
  seltecasiacom.nckila.gdn
@@ -235858,6 +251867,7 @@ sendmail.aldo007.com
  sendmail003.apps-apple-id.com
  sendmenw.beget.tech
  sendmonneyaccptwebhose.000webhostapp.com
+sendoffice365docx.ddns.net
  sendoutcards.jamesmontgomerylaw.com
  sendtlgrf-com.preview-domain.com
  sendunsolicitedemails.com
@@ -235884,6 +251894,8 @@ seniorcarecentersltc-auth.ml
  seniorcarecentersltc-view.net
  seniorcarehome.co
  seniorinterim.net
+seniors-com.fr
+seniors-map.fr
  seniorshare.net
  seniorshomesadvisor.com
  senirolifestyle.com
@@ -235988,6 +252000,7 @@ serben.mywire.org
  serce.info.pl
  sercodemanagesocial.bounceme.net
  sercommunity.com
+serconosgawuhnnesrvwofzlfc-dot-gl9393jan.uk.r.appspot.com
  sercovid.fun
  sercs-banrillines.servehalflife.com
  sercure-accounthelpmail.com
@@ -236374,7 +252387,6 @@ service-dkabinfo.eu
  service-dkabinfo.it
  service-espacevocale.web.app
  service-fees-updaete.com
-service-globalmedia.ml
  service-hel.com
  service-hellper.com
  service-helpinstagram.cf
@@ -236684,7 +252696,6 @@ services-helpers.com
  services-inc.net
  services-informati.serveirc.com
  services-mail-exchange-cox.netlify.app
-services-media-copyright.cf
  services-microsoft6726.000webhostapp.com
  services-my3.com
  services-myee.com
@@ -237288,6 +253299,7 @@ sezionemobile.com
  sezk.svcoding.com
  sezop.com
  sezoxrcvmmmnksv.serveirc.com
+sezuiwabtezawahiqkbfphmghf-dot-gl9393jan.uk.r.appspot.com
  sezujqjmucqjwufrsb.top
  sf-2007.official-org.com
  sf-express-delivery.herokuapp.com
@@ -237298,6 +253310,7 @@ sf6p9.onderhost.com
  sf976.addroits.com
  sfabfgurfxbysbtemfj.top
  sfahmedco.org
+sfanjimwlqmccnfsbsmzshlzvi-dot-gl9393jan.uk.r.appspot.com
  sfarthkadeway.com
  sfasfjklj.yhmefnsz.top
  sfawjqratxqlbdsjcybsqxbgccwtdyqhpcaz-dot-spyexc3093493.ey.r.appspot.com
@@ -237433,6 +253446,7 @@ sglre.ga
  sglzyrddxkixvrlcidcfmvsijmwmfxhguxmh-dot-gl494903049.wl.r.appspot.com
  sgm0c.alnawwar.com
  sgmoneycollections.com
+sgmptukbibdkjfzwuytovehccq-dot-gl9393jan.uk.r.appspot.com
  sgmslw3ac.verify-accountdkas.informationskdws2s.gastipiss1.com
  sgmueaepir.duckdns.org
  sgnaturn.com
@@ -237473,6 +253487,7 @@ sgxst.xyz
  sgxza.xyz
  sgyvolashfddjkbgmjcllpplbeychbfhyyws-dot-cedar-code-289917.nn.r.appspot.com
  sgywap.servegame.org
+sgzunlkfvqsqacqikcgqhqcmhi-dot-gl9393jan.uk.r.appspot.com
  sh-sunq.com
  sh-sunvvard.com
  sh-womensstore.com
@@ -237912,7 +253927,6 @@ sheinropasexycatalogo25.000webhostapp.com
  sheisbatala.com
  sheldonschweidt.com
  shell-indir.com
-shell-sumptuous-wisteria.glitch.me
  shell.blackunix.com
  shell7498pzb.allsalelist.com
  shelljs.com
@@ -237970,6 +253984,7 @@ shewanted.com
  shfgyg.fkumq1.cn
  shfkcjoniwjeupxnlgiihvaxmqedhqvhbndw-dot-gl494903049.wl.r.appspot.com
  shflow.com
+shfontlpnqnuqwdglzndargxtz-dot-gl9393jan.uk.r.appspot.com
  shg3nf.xyz
  shgbyuuttupsponbrvcerds.work
  shgdofikrnlueicxanbeuasahh-dot-gleowayel400503.uc.r.appspot.com
@@ -238030,7 +254045,6 @@ shilohchurchslough.com
  shilpkarmedia.com
  shimaarutechies.com
  shimahosting.co.za
-shimmering-torch-munchkin.glitch.me
  shina-h.ru
  shinaceptlimited.com
  shinai.jp
@@ -238058,6 +254072,7 @@ shinseico.chifanbob.top
  shinshu-u-phn.net
  shinsotsublog.icu
  shiny-tulip-william.glitch.me
+shiny-vent.000webhostapp.com
  shinycoins.pro
  shinynickel.000webhostapp.com
  shinywiy.com
@@ -238115,6 +254130,7 @@ shivshaktiyog7777.com
  shivshyaminfocom.xyz
  shivsons.info
  shiwanba.cc
+shiwqaofuwrfhqsgscynmnbvuk-dot-gl9393jan.uk.r.appspot.com
  shiyan.yfqzdfd.com
  shizizmt.com
  shjgxroqdpycakbhodnwlwcnya-dot-gleowayel400503.uc.r.appspot.com
@@ -238347,7 +254363,6 @@ shortcodes.teleshoppe.com.sg
  shortcut-links.com
  shortkun.bounceme.net
  shortlagibos.loseyourip.com
-shortlink-61e56k.web.app
  shortlink.co
  shortmails.net
  shortnr.xyz
@@ -238449,6 +254464,7 @@ shridurgadevelopers.com
  shriganeshchemical.com
  shrihariindia.in
  shrilldamagedrange--five-nine.repl.co
+shrillhilariouspayware.sdsdsdsd77dsdsd.repl.co
  shrinavkarsevasansthan.com
  shrinkcom.com
  shriramenterprisesonline.com
@@ -239436,7 +255452,6 @@ siiigroup.com
  siili.net
  siinna.com
  siircharrhaha.com
-siitav.net
  siizhealth.com
  siketiskvali.ge
  siketma.upr.ac.id
@@ -239458,6 +255473,7 @@ sileam.com
  silence-dot-case-file22.df.r.appspot.com
  silencerrook.date
  silencilcure.buzz
+silencilsoisjhs.us
  silentexploitbase.com
  silentfool.club
  silentfusion.net
@@ -239727,6 +255743,7 @@ singlets.co
  singohotel.com
  singpost-e.top
  singrechalfstec.tk
+singshirt.buzz
  singsingmusic.net
  singtel.visionanalytics.co
  singular-backup-291311.ts.r.appspot.com
@@ -239838,6 +255855,7 @@ sissz.site
  sistaqui.com
  sistasinsuccess.info
  sistelligent.com
+sistelti.com
  sistem-apps.com
  sistem-in-kunci.webnode.com
  sistem-kuncii-indo.webnode.com
@@ -239875,6 +255893,7 @@ sistemicaconsulting.com
  sisteminformasipantaijepara.000webhostapp.com
  sistemmine52acccountdemagesupportappstore.janganhiraukansaja.com
  sistersinministrybirmingham.org
+sisteshotel.com
  sistmostgraval.xyz
  sisubur.xyz
  sit4all.com
@@ -240033,7 +256052,6 @@ sjcjc.cn
  sjdcf.awaykart.com
  sjddv.ru
  sjdgxhshduuehr.000webhostapp.com
-sjdhomes.co.uk
  sjdwtpuuzrvhmmtcgihwsedwchvcnpckoigz-dot-gl494903049.wl.r.appspot.com
  sjegb.svcoding.com
  sjeiyvfvyxvwzhcawnbecdbnue-dot-gleowayel400503.uc.r.appspot.com
@@ -240042,6 +256060,7 @@ sjhsk.app.link
  sjhy123.com
  sjkd.duckdns.org
  sjmp.co.in
+sjnlurdqtkkcbnczaghjxscyqh-dot-gl9393jan.uk.r.appspot.com
  sjnykoghcx.duckdns.org
  sjomfpyj.goruli.com
  sjpharmacycollege.org
@@ -240173,7 +256192,6 @@ skingfts12.my03.com
  skingfts12.xxuz.com
  skingfts13pubg.25u.com
  skingiftnew60.ml
-skingiftnewsml3.cf
  skingo.ru.com
  skingohome.xyz
  skinharman.fun
@@ -240182,7 +256200,6 @@ skinlegendbebaspilih2021.000webhostapp.com
  skinluckyspin.my03.com
  skinmane.ru.com
  skinmarketgo.com
-skinmetroroyale.com
  skinmlbbactivity1.ml
  skinmlbbactivity1.tk
  skinmonkey.club
@@ -240421,6 +256438,7 @@ slashdb.com
  slashed-lid.000webhostapp.com
  slashingdelegator.win
  slasquareup.com
+slateblueoutgoingmathematics.elmuto00otrogit.repl.co
  slatenctionnit.xyz
  slaterarts.com
  slausonswapmeet.net
@@ -240451,6 +256469,8 @@ sleepy-noether-eea1cb.netlify.app
  sleepy-ramanujan-e4f52c.netlify.app
  sleepybearcreations.com
  sleepyshop.ru
+sleet-far.glitch.me
+sleevekneel.buzz
  sleighttaff.com
  slenderishere.ddns.net
  slepdd.com
@@ -240577,6 +256597,7 @@ slsmiamihydecom.shaxiaact.top
  sltgx.goruli.com
  sltorg.ru
  sltru.org.uk
+sltvatozfltsrjofdawrjqupcf-dot-gl9393jan.uk.r.appspot.com
  slucky.giize.com
  slugger.de
  slumberingamerica.com
@@ -240629,7 +256650,6 @@ smallonlinebestflashlite.icu
  smallopinions.com
  smallponder.net
  smallreformtypeflashselect.icu
-smallspark.space
  smallsparksoftware.dev
  smalltowncarrental.com
  smalltownideamill.wordpress.com
@@ -240666,6 +256686,7 @@ smartbusinesses.in
  smartbusinessoperations.com.au
  smartbuy.co.za
  smartbuzz-afrika.com
+smartcable53.icu
  smartcard.iisc.ac.in
  smartcloudfiles-2020.nw.r.appspot.com
  smartconstruction.kz
@@ -240831,6 +256852,7 @@ smbc-card.best
  smbc-card.billguard.cn
  smbc-card.btchm.com
  smbc-card.cc
+smbc-card.cf
  smbc-card.chcgc.com
  smbc-card.co.jp.ac2696q.top
  smbc-card.co.jp.asdnnene.xyz
@@ -241008,6 +257030,7 @@ smbc-crd.best
  smbc-help.co
  smbc-jdauw.com
  smbc-jdauw.me
+smbc-jp.cc
  smbc-jp.club
  smbc-pa.com
  smbc-qasd.myalloy.org
@@ -241096,6 +257119,8 @@ smbcard.com.fundnqh.cn
  smbcbank.top
  smbcc-card.com.jndlv.top
  smbcc-card.top
+smbcc.kutternytg.xyz
+smbcc.lonewoaini.shop
  smbcc.top
  smbcc.xyz
  smbccao.xyz
@@ -241244,7 +257269,7 @@ smcsistemas.com.br
  smcvbardi.monster
  smcz.buzz
  smdaudio.in
-smdc-cacd.com
+smdc-cacd.vip
  smdc-ccdd.gtamclass.com
  smdc-ccrd.yuguiwl.com
  smdc-ccrr.fsdfgweb.xyz
@@ -241461,7 +257486,6 @@ smtasia.co.th
  smtgo.ga
  smtp-softbank.com
  smtp.callsouth.net.nz
-smtp.comune.royal-eng.ps
  smtp.securewebemail.co
  smtp.securityupdatenotice.com
  smtp.sslport.work
@@ -241509,6 +257533,7 @@ snackology.me
  snaer.cn
  snagabitcoin.com
  snahcat.000webhostapp.com
+snakesword.buzz
  snaky-fence.000webhostapp.com
  snap-ontech.com
  snapbit53.com
@@ -241535,6 +257560,7 @@ snapechate1234secure.000webhostapp.com
  snaplensfilter.club
  snapposecolorld.xyz
  snappyframes.com
+snappygracefulinfinity.sdsdsdsd77dsdsd.repl.co
  snappylink.000webhostapp.com
  snapsupport15.000webhostapp.com
  snapsupportforum.000webhostapp.com
@@ -241583,9 +257609,11 @@ snet101.weebly.com
  snet2020supportserviceupgrade.weebly.com
  snetonlineservice.weebly.com
  snewells.bounceme.net
+snewjihlyiyjharhmplghvuaor-dot-gl9393jan.uk.r.appspot.com
  snficokd.dermals.org
  snginntflsxzs.com
  snhc.org
+snhygkdgncpttdtujwvjvdrkxh-dot-gl9393jan.uk.r.appspot.com
  sniodoliss.com
  snip.li
  sniperdz.com
@@ -241632,6 +257660,7 @@ snnbcwebs.bcxnaksdsal.xyz
  snnbcwebs.oerujdmasmcvnsd6fdgfd1a.xyz
  snnbcwebs.xyz
  snnmnkxdhflwgthqismb.com
+snnwwunduhkkgvocstacvbjfeo-dot-gl9393jan.uk.r.appspot.com
  snoginei.com
  snome.tk
  snomoln.se
@@ -241641,6 +257670,7 @@ snoorkersnow.top
  snoozical.com
  snopsd.duckdns.org
  snorhmy.cam
+snorhrm.cam
  snortcnc.duckdns.org
  snovvflake.com
  snowagainfearfreezesagainagainitfeelslikeiceisinmyhands.space
@@ -241953,6 +257983,7 @@ softprintt.ga
  softrino.com
  softsale.ie
  softsproductkey.com
+softtouch.life
  softtricksmedia.com
  softtube.cn
  softupdate1.me
@@ -242319,6 +258350,7 @@ sophrologie-untempspourmoi.fr
  sopiamanart.com
  sopiamanrock.com
  sopisconews.online
+sopitbullderacafilmes.com
  sopito.website
  sopk.kz
  sopociakcom.shaxiaapril.top
@@ -242380,6 +258412,7 @@ sorteiodasemana.org
  sorteo-bcpzonasegura.club
  sorteo-viabcpzonasegura.com
  sorteointranet.ml
+sorteozapatillascl.000webhostapp.com
  sortini.bharatbioscience.in
  sortoshvac.com.41114-webdesign.info
  soruoka-daftar.000webhostapp.com
@@ -242410,6 +258443,7 @@ sosyalhile.com
  sosyalizoprofilgorme.com
  sosyalsat.com
  sot-deutschlandde.google-safety.de
+sotaivqcklhtwfgdzxkfbrinlo-dot-gl9393jan.uk.r.appspot.com
  sotasqaese.com
  sotasveesavseese.com
  sotaysongkhoe.site
@@ -242488,6 +258522,7 @@ sourcesseven.com
  sourcetechnologyassociates.com
  sourcetoearn.info
  sourcingandlogistic.com
+sourebn.cam
  soursingsegura23bn-tag.xyz
  sousakupartners.com
  soused-meridians.000webhostapp.com
@@ -242557,6 +258592,7 @@ sowkinah.com
  sowlef.com
  sowr-paypalservis5g.servebeer.com
  sowseglass.com
+sowtaqqmqbofgjtzkdoodgmfym-dot-gleow2021ja.ue.r.appspot.com
  soxlablengdiumenet.xyz
  soxmi.vipsnapchatsexting.com
  soxzc.000webhostapp.com
@@ -242625,6 +258661,7 @@ spacermedia.com
  spacesarchitects-ka.com
  spacesolutions.com.cy
  spaceteampo.net
+spacetotal.guru
  spaceweba.com
  spaceweba.net
  spaceworkstudios.com
@@ -242639,7 +258676,6 @@ spaday-men.ru
  spadesdesign.ca
  spafuzion.com
  spaggdesign.com.br
-spaiclast.com
  spaine.000webhostapp.com
  spainhelp.000webhostapp.com
  spajor.com
@@ -242999,6 +259035,7 @@ spiraller.com
  spireacademyhk.org
  spireid.com
  spiritassembly.000webhostapp.com
+spiritedelementaryalgorithms.lizcambage.repl.co
  spiritedfrigidvertex.angueluisreyama.repl.co
  spiritnsong.fr
  spiritofmambo.fr
@@ -243036,6 +259073,7 @@ split.to
  splitbiin.co
  splitperspiranthun.quickwebchecker.com
  splitrailtickets.com
+splitthing.buzz
  spll.co.in
  splogistic.in
  splonk.ie
@@ -243046,6 +259084,7 @@ spm-tnr.co.id
  spmkomputer.com
  spnewsthailand.net
  spnisxoljjqqylchqzlfvnioqw-dot-gleowayel400503.uc.r.appspot.com
+spoeiur.monster
  spoglain.com
  spoilersrr.000webhostapp.com
  spojrzeniefarmaceuty.pl
@@ -243147,6 +259186,7 @@ spotted-katowice-1021.pl
  spotted-wroclaw-471.pl
  spottedapple.com
  spotty-honeysuckle-mammal.glitch.me
+spotwood.buzz
  spovahealth.com
  sppedgoo7.gq
  sppenterprises.in
@@ -243154,6 +259194,7 @@ sppiscina.com
  spplue2.duckdns.org
  spprtlgnntflixs.com
  sppuort.rr.gg.rolulentaraten.com
+spqfodxessejuixhqtodoasslf-dot-gl9393jan.uk.r.appspot.com
  spqlobal.info
  spr6m.mentriqq.com
  sprachwerk.at
@@ -243210,6 +259251,7 @@ spsshomeworkhelp.com
  sptconstruction.co.za
  spunkyhealthylife.com
  spunkyvids.com
+spuqbdawylqiolzquqjramnrlw-dot-gl9393jan.uk.r.appspot.com
  spurious.io
  spurknetliknztv.com
  spurting-thermocoup.000webhostapp.com
@@ -243253,6 +259295,7 @@ sqgsfkxjwj.duckdns.org
  sqiakser.com
  sqiuaresmail.com
  sqjakreps.com
+sqjcrldotgmbjymsmnewycerli-dot-gl9393jan.uk.r.appspot.com
  sqjyvxfntylvnhbnesnwvskucn-dot-gleowayel400503.uc.r.appspot.com
  sqkijwuvolqexzvkydbdokqlzpdpkdcouirj-dot-gl494903049.wl.r.appspot.com
  sqkumzuhunpqfbqbsbixupoajakjozobnezc-dot-offgl8876899977678.uk.r.appspot.com
@@ -243263,7 +259306,6 @@ sqmaiyp.com
  sqmasterinc.com
  sqmasterinc.net
  sqmb.tanglescanner.com
-sqmessaaggings.com
  sqmmcs.com
  sqnauwsj.wze.io
  sqnewhouse.ac.ug
@@ -243891,10 +259933,12 @@ ssupportervicespartners.ml
  ssuse.com
  ssuyturwelve.cn
  ssvinterior.com
+sswfbrhbsdztdcyyuthxpociam-dot-gl9393jan.uk.r.appspot.com
  sswxa.xyz
  sswxq.top
  sswz78.com
  ssx6152.su
+ssybmiqbfottjjvrmziozezuyk-dot-gl9393jan.uk.r.appspot.com
  st-92.svcoding.com
  st-amu-cz.my-free.website
  st-andrews.ac.uk.mailchkmessageb.icu
@@ -244138,6 +260182,7 @@ startgift.work
  startincorp.com
  startingnice.com
  startkeymaya.top
+startman.guru
  startmarkets.com
  starto-de.integratedpattern.com
  startoptions.com
@@ -244223,6 +260268,7 @@ staticfeistykeyboardmacro--five-nine.repl.co
  staticmxrec221.z13.web.core.windows.net
  staticschase.business
  staticwebanalysisv1.utybs.com
+staticwhoppingtitles.sdsdsdsd77dsdsd.repl.co
  statieheli.com
  station120.com
  stationaryhome.com
@@ -244946,7 +260992,6 @@ stock.comuf.com
  stock.mtrocchedeimanzonia.com
  stock.romazilada.com
  stock5188.com
-stockhome.webc5.vn
  stocklab.id
  stockocontactsg.nckibasketball.gdn
  stockpallets.com
@@ -245034,6 +261079,7 @@ stopweedtoday.com
  storage.googleapis.com.statics.alliantccreditunion.org
  storage.googleapis.com.statics.ibcaserv.xyz
  storage.nett00n.org
+storagedatagobig.000webhostapp.com
  storageshared.000webhostapp.com
  storagesharedcdsxo.dnsabr.com
  storageteacher.com
@@ -245133,6 +261179,7 @@ stowmatchst.com
  stpatricks.com
  stpetersburglimocompany.com
  stpresuppport.com
+stqqgnmoshgafefncwkveviaxb-dot-gl9393jan.uk.r.appspot.com
  str.shoppclick.com
  stradious.com
  straffreeks.xyz
@@ -245190,6 +261237,7 @@ straw.awakening999.com
  strawbald.ga
  strawbald.ml
  strawfrenky.com
+strawmy.guru
  strdashport.com
  strdashport.me
  strdashport.net
@@ -245888,7 +261936,6 @@ sudmedexpert.ru
  sudmotoservices.fr
  sudqeffpv.goruli.com
  suds.whitefurs.com
-sudsolutions.mx
  sudsupp0rtt0kenunusualded1c4t3ds3pp4l.duckdns.org
  sudyolu.com
  sue7153ylivuk.000webhostapp.com
@@ -245913,6 +261960,7 @@ sufindiatours.com
  sugandhachejara.com
  sugano.trictalmk.com
  sugar22.com
+sugarabalcneks.us
  sugarcoatedspider.co.uk
  sugarcoatitdev.online
  sugarplan.buzz
@@ -245949,6 +261997,7 @@ suimmitobobank-cardissure.xyz
  suinfotech.net
  suining.06rl.com
  suisjkf.ga
+suisseark.000webhostapp.com
  suit-able.com
  suitablefoodsja.com
  suitcasecollect.cyou
@@ -245958,6 +262007,7 @@ suitsforseniors.com
  suivi-post-ch.info
  suivi-secure-pcs.fr
  suivis-packets-ag-diepost-ch.com
+suizjdcjbpjapbelmpfrjaaejc-dot-gleow2021ja.ue.r.appspot.com
  sujalappliances.co.in
  sujet-du-bac.com
  sukababysite.000webhostapp.com
@@ -246094,6 +262144,7 @@ summittaxandpayroll.com
  summmarychecks23456.ga
  summmarychecks777666.ga
  summofgifts.ga
+summonable-electron.000webhostapp.com
  sumptuous-sky-geranium.glitch.me
  sumpybadland.com
  sumswell.guru
@@ -246125,6 +262176,7 @@ suncorp-reactivate-au.com
  suncorp-reactivate.com
  suncorp-reactivation-au.com
  suncorp-secure-au.com
+suncorp.access.au.mitchellbourne.com
  suncorp.au.susp.info
  suncorp.com.au.useractivity.info
  suncorp.routine-check.com
@@ -246247,6 +262299,7 @@ suparmany.com
  supastitioness.com
  supaypal.com
  supcenterspubgv.serveftp.com
+supdorting.flywheelsites.com
  supen-fcl.com
  supengocr.com
  super-arraia-de-ofertas.com
@@ -246331,6 +262384,7 @@ superma.co
  supermainers.online
  supermanne.com
  supernaturalmedicine.org
+supernetforme.com
  superoferta-espcial-pra-voce.com
  superofertadomesparavoces.online
  superofertaespecial.com
@@ -246368,6 +262422,7 @@ supervermelhasantiaderentes.com
  superviajes.do
  superviseer.iptoestel-blokkade.xyz
  supervisordemanage.ddnsking.com
+superwebbysearch.com
  superwhite.com.au
  superzxx.com
  supinstructortraining.com
@@ -246437,7 +262492,6 @@ suports-a.net
  suportsaccount.0fees.us
  suportscenter-acontsecur88.gq
  suportseguro.com
-suportss-notifiication-identity-copyright.my.id
  suportstone.000webhostapp.com
  suportsxr-serv902.asfnuha.com
  suporttbbcovirtu.atwebpages.com
@@ -246545,9 +262599,7 @@ support-center3.com
  support-center5.com
  support-centre-uk.info
  support-chase03.serveirc.com
-support-confirm-newpayee.com
-support-confirmmypayee.com
-support-confirmnewpayee.com
+support-confirmmynewpayee.com
  support-connexion.com
  support-contact010022.com
  support-customer-amazonlogin.securessl.honzy.net
@@ -246585,6 +262637,7 @@ support-infosecure.com
  support-instagram-team.com
  support-instagram-verification.com
  support-ionos.tk
+support-jxe1xvya-league-of-legends.000webhostapp.com
  support-liquidx.com
  support-lng.pro
  support-log-in-check-up.000webhostapp.com
@@ -246599,7 +262652,6 @@ support-my3billing.com
  support-myee.com
  support-myjcb.t24te.uk.com
  support-mymembership.com
-support-mynewtransfer.com
  support-nab.enrouteasiaholidays.com
  support-ncvbvcjaka.nreagb.com
  support-netflix.ca
@@ -246617,6 +262669,7 @@ support-payeeremove.com
  support-paypai.xyz
  support-paypal.com-cgi-bin.info
  support-paypal.serigo.com
+support-paypal163.com
  support-paypalverificationaccountisrequired-idosf501.tk
  support-paypalverificationaccountisrequired-idosf502.tk
  support-paypalverificationaccountisrequired-idosf503.tk
@@ -246646,7 +262699,6 @@ support-three-co.uk
  support-transcards.com
  support-transfer.uk
  support-uk-eu.com
-support-unauthorisedlogin.com
  support-update-app-store.biardupal.com
  support-upgrade-verification2020.weebly.com
  support-upgrade-verificationlogin.weebly.com
@@ -246667,6 +262719,7 @@ support-wells-fargo-notice.work
  support-wells-fargo-verify.com
  support-wells-online01.mobi
  support-wysf1t3ooo6pytkibkpszisthur8b1zx.65ujhf76.uk.com
+support-yegz8-league-of-legends.000webhostapp.com
  support-you.in.net
  support.account-id.golaughtussermanage.com
  support.account-updates.servicescompanycenters.casa
@@ -246822,7 +262875,6 @@ supportcenter00.000webhostapp.com
  supportcenter2918.com
  supportcenterlnstagram.com
  supportcenterlnstagram.ml
-supportcentermedia.ml
  supportcenters0.com
  supportcenterwebappssecure.com
  supportcenterwells003.mobi
@@ -246880,7 +262932,6 @@ supportlinebank.com
  supportlivecentre.com
  supportlogs.co.vu
  supportmail.webservis.ru
-supportmediaservices.ga
  supportmethoer00.com
  supportmevoteme.000webhostapp.com
  supportmy-3billing.com
@@ -246916,6 +262967,7 @@ supportpaypal8.serveirc.com
  supportpgepp-manage.forumz.info
  supportproblempaymentfanfaonfjenfmdf.com
  supportprotect.pw
+supports-att.com
  supports-boi.com
  supports-confrimesu22.cf
  supports-confrimesu4.ml
@@ -247317,6 +263369,7 @@ svsorgaccesinter.weebly.com
  svtgyubaznyalctmtlfnpgmcbskfgvnubejq-dot-glxcel49934343434.rj.r.appspot.com
  svuotastock.com
  svveden.com
+svvmiftqbvqllnmyjdlahyvmwr-dot-gl9393jan.uk.r.appspot.com
  svwqc.org
  svxewrjrwdrrztdcyaundwvantpxmjpewbxn-dot-glenxpecial3009493.ey.r.appspot.com
  svxfbthbrbsfvf.duckdns.org
@@ -247475,6 +263528,7 @@ swingcommerce.com
  swingersdance.com
  swingmastersgolf.com
  swingproof.com
+swingy-screw.000webhostapp.com
  swionesw.com
  swipefools.com
  swipenearn.com
@@ -247522,6 +263576,7 @@ switzerladencom.shuiacarry.top
  switzerland-capital.com
  switzerlandrental.top
  swka59kdf.com
+swlbhzhkxbjtngnzqyvwnxjuzo-dot-gl9393jan.uk.r.appspot.com
  swlfrpqb.firebaseapp.com
  swltc-inv-auth.com
  swltc-inv-auth.org
@@ -247576,6 +263631,7 @@ sxianfen.com
  sxjlf.goruli.com
  sxjmxy.com
  sxjtys.com.cn
+sxjupkjhrdmjumfobdyxyigupy-dot-gleow2021ja.ue.r.appspot.com
  sxkyh.addroits.com
  sxlbzgmbmnp8i.edal.cc
  sxmcigars.com
@@ -247597,6 +263653,7 @@ sxyxflix.com
  sxzca.000webhostapp.com
  sy.gxvis.cn
  syacs.syp.ac.in
+sybdflyhiuyexuwkduwctgnalu-dot-gl9393jan.uk.r.appspot.com
  syberenterprise.com
  sybn9otct42ni7.gmz.cc
  sycamoresc.xyz
@@ -247618,6 +263675,7 @@ sygges.kazkgi.cn
  sygnalizujemy.pl
  sygnifai.com
  syh25pnphdcq-i8q6wbnx4.vercel.app
+syhbypnkhzxbkrcopnwbwcavzw-dot-gl9393jan.uk.r.appspot.com
  syhrjofoth.duckdns.org
  syindex.com
  syjhz.jaysbrand.com
@@ -247782,12 +263840,13 @@ sytraders.co
  sytstech.com
  syttuttziabgqbrstegxwslmyqkddzhwqbdh-dot-solar-vertex-285913.rj.r.appspot.com
  syuhmehjcsnoldxevtzmfohlmn-dot-gloff00403993445.uk.r.appspot.com
-syukur.seriesnow.top
  syurtsyurt.com
+syuuidopw.cam
  syvroses.com
  sywhpcxmxhurildirjok.com
  syworkroom.com
  sywsuwiqioqysbanasd.com
+syxamak.com
  syxyd.com
  syyyzsyx.xyz
  syzphlap.cf
@@ -248070,6 +264129,7 @@ tableau.live.nettbuss.tsolutions.co
  tablentif.com
  tablerocklandservices.com
  tablerx.com
+tableslime.guru
  taboclub.com
  tabs7-waridtel-com-7778-tpf.000webhostapp.com
  tabsf.mentriqq.com
@@ -248249,6 +264309,7 @@ takeprofits.in
  takeshykurosavabest.com
  takeskins13.com
  taketheredone.top
+takeuabmqnuvxijcxacayyttcf-dot-gl9393jan.uk.r.appspot.com
  takewingsllc.com
  takeyour-prize6.com
  takeyourprize.ucgift13.com
@@ -248834,6 +264895,7 @@ tbtc.com.my
  tbttmyt.yolasite.com
  tbuild.2tstelecom.com
  tbwysx.cn
+tbyrmunpzmbojhhivftimlgenc-dot-gl9393jan.uk.r.appspot.com
  tbz.onderhost.com
  tbzgmpfqtysiqddafmfuvzwrauqsgfqcqaxu-dot-offglen.uk.r.appspot.com
  tc-eknomi-bakanligi-kayit-basvuru-form.tk
@@ -248933,6 +264995,7 @@ td634805.000webhostapp.com
  tdameritrade.xvmiznat.com
  tdameritradepromocode.moneyandthoughts.com
  tdauth-support05.com
+tdcanadatrust-scr.com
  tdcind.com
  tdclient-auth05.com
  tddrwstgxtkhzaktrg.top
@@ -248966,6 +265029,7 @@ tdsua.com
  tdupdtcn.com
  tdvcxwaqwfcoigfnkgbecreqxw.club
  tdvpprint.com
+tdvtjtefzikbjmrfjqpddgxijq-dot-gl9393jan.uk.r.appspot.com
  tdwcocooiedpbiyudknttzjqhbvdjpbdfgru-dot-cedar-code-289917.nn.r.appspot.com
  tdxl.rogagot.com
  tdzy.lawapass.com
@@ -249058,6 +265122,7 @@ tearcommerce.com
  teardown.com.co
  teardrop-productions.ro
  tearleclayfitness.com
+tearratio.buzz
  teat09.com
  teathasbrew.emtaservices.com
  teatr-akvarel.tomsk.ru
@@ -249239,6 +265304,7 @@ techyss.tech
  teciconut.com
  teciourf.com
  tecklinks.com.pk
+tecladosdemembrana.com.ar
  tecmachine.com.br
  tecmaze.com
  tecmicromg.com.br
@@ -249299,6 +265365,7 @@ tedzey.info
  teeapitary.com
  teee-shop.com
  teeeggplantr.com
+teeejaass.cam
  teeerrrt.ucoz.org
  teeetcuetaie.com
  teejdhytvemxnrawlebm.com
@@ -249469,6 +265536,7 @@ telmobilitydata.com
  telomedic.com
  telorjambans.com
  telotenemos.cl
+telpesbxlvgnthkdnupwzvtbxa-dot-gl9393jan.uk.r.appspot.com
  telros.ru
  telsandalyesi.com
  telse01.000webhostapp.com
@@ -249622,6 +265690,7 @@ tennispot.gr
  tenntechs.com
  tenpor12snkj12k.antihoax.net
  tenrougroup.com
+tensest-haste.000webhostapp.com
  tentandoserfitness.000webhostapp.com
  tentationliye.com
  tentcots.co.uk
@@ -250179,6 +266248,7 @@ tgsweksrgy.duckdns.org
  tgteamcom.shuiabudget.top
  tgtlgrfzmk.duckdns.org
  tgu-kouenkai.org
+tgukjyhdbnwvqmyerklepzcexu-dot-gl9393jan.uk.r.appspot.com
  tgvbvgnmuytrvytyf.weebly.com
  tgvglieyrppqfivflzwqvhbdae-dot-gleowayel400503.uc.r.appspot.com
  tgvuahcnargmeysbaaznefqtygmydnmqwgeo-dot-off94032393204.uk.r.appspot.com
@@ -250282,6 +266352,7 @@ thc420world.com
  thccamera.com
  thcscapes.com
  thcsminhduc.edu.vn
+thcxmebndwbsyayblghevnqiig-dot-gl9393jan.uk.r.appspot.com
  thdatt.weebly.com
  thdnxvhdptjwexcwqgwwvoxmeu-dot-gleowayel400503.uc.r.appspot.com
  thdyprivatecloudshareandfileprotectgent.duckdns.org
@@ -250531,7 +266602,6 @@ theduominuin.com
  thee.network
  theeastsoluttrel.com
  theebeautyspot.co.uk
-theeberharts.com
  theecellgim.in
  theedenmagazine.com
  theefaxcentral.com
@@ -250661,6 +266731,7 @@ thehypnotherapygroup.com.au
  theidiotshow.com
  theifengingmen1986.blogspot.be
  theifengingmen1986.blogspot.com
+theigaffiliate.com
  theiment.xyz
  theimporex.com
  theincontinence.tk
@@ -250739,6 +266810,7 @@ thelittlesoapandcandleshop.com.au
  thelittleufothatcould.com
  thelivefreeproject.org
  thelivingoodcenter.com
+thelmaross.com
  theloanlight.com
  thelocalbitcoins.com
  thelocalsundry.com
@@ -250848,6 +266920,7 @@ thenobleagent.com
  thenomadicguy.com
  thenonosythfkli.com
  thenutnofastflix2.com
+thenxsu.com
  theo.digital
  theoaks-al-e.cf
  theoceanhouse.com
@@ -251094,6 +267167,7 @@ theuniversityoftomorrow.org
  theuniversitystore.in
  theunknowman.ddns.net
  theurbantaco.com
+theuwyr.cam
  thevalleysdentist.com
  thevapordistro.com
  thevaporshub.co.uk
@@ -251175,6 +267249,7 @@ thietbisontinhdien.vn
  thietbivandat.com
  thietkenoithatthongminh.org
  thiganoz.com
+thighcolor.buzz
  thighfinance.cyou
  thighracial.ch
  thiguhghttj.com
@@ -251193,6 +267268,7 @@ thinkbank.hirecentric.com
  thinkbigsecrets.com
  thinkbrief.cn
  thinkcube.design
+thinkdebt.buzz
  thinkfishmedia.nl
  thinkfreedomrei.styleandtrendclothing.com
  thinkingpilates.com
@@ -251558,7 +267634,6 @@ threenetworkverify.com
  threenotice.com
  threenoticeuk.com
  threeonline-billing.com
-threeonline-updateaccount.com
  threepay-account.com
  threepayment.club
  threepayments-update.com
@@ -251658,6 +267733,7 @@ thuysinhvoiviet.com
  thuytienacademy.com
  thvevmtmhpztdpkapluntjizvt-dot-gleowayel400503.uc.r.appspot.com
  thwembteze.duckdns.org
+thwjtwdcbwqhnbmdtqjaimorhr-dot-gl9393jan.uk.r.appspot.com
  thwqqmhaumvuzmmqxqtpkblghb-dot-triple-upgrade-293822.rj.r.appspot.com
  thwsf.awaykart.com
  thxhb.com
@@ -251822,6 +267898,7 @@ tiktokersolmak.xyz
  tiktokpopuleracounts.ml
  tiktoktakipci.xyz
  tikview.xyz
+tikxsdkjvmdmfypeaoruzjsxtu-dot-gl9393jan.uk.r.appspot.com
  tilamaito.info
  tilapustar.info
  tilbudssko.dk
@@ -251989,6 +268066,7 @@ tinac.wedding
  tinaecotton.com
  tinbaomoi24h.net
  tincafrica.com
+tinccgmrjwewvzgtyivuxxunlf-dot-gl9393jan.uk.r.appspot.com
  tinckorm.beget.tech
  tinderaccountpictures.000webhostapp.com
  tinderphotocom.shaxiabeauty.top
@@ -252018,6 +268096,7 @@ tinmoi.vieclamthemde.com
  tinna9876profile.online
  tinnha.vn
  tinniedelulla.com
+tinnitusstrminatoru.us
  tinnitusytyusftrime.us
  tinnong24hcmm.tk
  tinny65.000webhostapp.com
@@ -252127,6 +268206,7 @@ tivaly.com
  tiviz.net
  tivoli.nu
  tiwe.xyz
+tixhmqiekrnrarvongkntbrisy-dot-gl9393jan.uk.r.appspot.com
  tixon.mooo.com
  tixon.website
  tiyait.com
@@ -252145,6 +268225,7 @@ tj25.svcoding.com
  tj2u1smd13.firebaseapp.com
  tj7si.weblium.site
  tjdagngdsshyiglvldcjemeyiumtmdezeccb-dot-glegen303939423233.ue.r.appspot.com
+tjejgoqslxwftitygjxntnvdkw-dot-gleow2021ja.ue.r.appspot.com
  tjenterprises.com.pk
  tjfr.tk
  tjfyskj.com
@@ -252182,6 +268263,7 @@ tkcvgjszqafissjgqifguicgqzwclahheyfv-dot-cryptic-now-290917.ey.r.appspot.com
  tkdkornik.pl
  tkdtosanacademy.ir
  tkexhibits.com
+tkfshflmsuvihgclmfzzlantsi-dot-gl9393jan.uk.r.appspot.com
  tkfsvqatnjyzchpzdjlbtktvugtqvdfttedw-dot-glenxpecial3009493.ey.r.appspot.com
  tkhsqaefpkypwxrddbxslnlhazvslwneqbvg-dot-cedar-code-289917.nn.r.appspot.com
  tking.com.tn
@@ -252211,6 +268293,7 @@ tkwsomujmarcldcwwffvxmlugxrkevbowoqj.cryptic-now-290917.ey.r.appspot.com
  tkx29.codesandbox.io
  tkxmr.cc
  tkynyd710wiw.com
+tkzfdmqhsgrmxqsbhjuvgnslmb-dot-gl9393jan.uk.r.appspot.com
  tlanddissipate.at
  tlbohr.com
  tlbplanning.org
@@ -252226,6 +268309,7 @@ tlftdaduzy.duckdns.org
  tlg.40eb.com
  tlgramsenfb-com.preview-domain.com
  tlhblogs.com
+tlhguitdfkmpvluoqvppocjtmp-dot-gl9393jan.uk.r.appspot.com
  tlidigital.net
  tljytfffdycgymhoqnegqlnuas-dot-gleowayel400503.uc.r.appspot.com
  tlkshow.com
@@ -252268,11 +268352,13 @@ tmcaa526j4.firebaseapp.com
  tmcarthur.com
  tmcdataservices.com
  tmcintyre.com
+tmcqvqbxtjtuepwoqnhpnxwqac-dot-gleow2021ja.ue.r.appspot.com
  tmd827264.000webhostapp.com
  tmdemo.in
  tmdggjzhachlwpbpnhlggruzhecsaxfxbunx-dot-glenxpecial3009493.ey.r.appspot.com
  tmdkckaymkbxdarbxp.top
  tmdl.pro
+tmdwmxxxfnxdbxgrbnjbddehhx-dot-gl9393jan.uk.r.appspot.com
  tme7dmhjnzhmjeswyvpe.us-south.cf.appdomain.cloud
  tmeu.ir
  tmf.gk-yug23.ru
@@ -252447,6 +268533,7 @@ togkhd.com
  togmoupamcemhpcaxrnbctezyp-dot-gleowayel400503.uc.r.appspot.com
  togras.si
  togroow.com
+togymhpzayiwrsflhgxcwcafmg-dot-gl9393jan.uk.r.appspot.com
  toh.handipants.com
  toholdplan.temp.swtest.ru
  tohomeroom.com
@@ -252464,7 +268551,7 @@ token-desbloqueio.com
  token-mobile30hs.ddns.net
  tokendigital-bn1multired.com
  tokendigital.registrosmvltired.xyz
-tokendigital.serviciosenlinea1bn-corn-pe.xyz
+tokendigital.segurazonaclientes1bn-corn-pe.xyz
  tokendigital.zonasegvraperu1bn.com
  tokendigitalbnsegura.com
  tokengamblers.icu
@@ -252623,6 +268710,7 @@ toolers-france.com
  toolfiles1.000webhostapp.com
  tooligmeta.000webhostapp.com
  toolingguru.com
+toolmurder.buzz
  toolmuseum.net
  toolplus-cn.com
  tools-for-brokers.com
@@ -252757,6 +268845,7 @@ topmilk.com.vn
  topmodelbiz.batwoqishop.top
  topmodelbiz.shaxiacash.top
  topmothers.com.mx
+topndfhgeapbxtexpkchnpyseq-dot-gl9393jan.uk.r.appspot.com
  topodesia.com.pe
  topografi-minilidar.com
  topologic-giant.000webhostapp.com
@@ -252792,6 +268881,7 @@ topsecrets.com.pl
  topsecuritysys.com
  topselectedtours.com
  topserge.com
+topshelfglasspoolfence.com.au
  topshelfmarijuanadispensary.com
  topshopbrand.com
  topskin.xyz
@@ -252843,6 +268933,7 @@ tora3.co.jp
  torabmedia.com
  toras2-s.000webhostapp.com
  toravalon.com
+torchclay.guru
  torchedkaty.com
  torchskin.pro
  torcup.xyz
@@ -253067,6 +269158,7 @@ tpzhmcfdqnmyqdbqbvx.top
  tpzutlugxvmaxnxaahmumbdbvgfoyruvtcja-dot-glegen303939423233.ue.r.appspot.com
  tq8w.jaysbrand.com
  tq8z.jaysbrand.com
+tqavsyaoollanouopzxymadlpi-dot-gl9393jan.uk.r.appspot.com
  tqb.dermals.org
  tqbadr.com
  tqcgrcnqmwkceujpak.top
@@ -253239,6 +269331,7 @@ tradeskin.ga
  tradeskins.gq
  tradesnsw.live
  tradespawn.com
+tradespeoplemarkiting.com
  tradespersonnel.biz
  tradetengo.com
  tradetoolsbazaar.com
@@ -253295,6 +269388,7 @@ trailblazer-metallurgy.com
  trailershopper.com
  train6.netwisedev6.co.za
  traindevie.it
+trainedappropriateterabyte.sdsdsdsd77dsdsd.repl.co
  traingrad.com.mx
  training-equipment.net
  training.cloudtechtiq.com
@@ -253318,6 +269412,7 @@ trainwithconviction.webdmcsolutions.com
  trainyourdogs.myvnc.com
  traitementtransactioneurope.000webhostapp.com
  traiteur-tablematiere.be
+traitorous-leg.000webhostapp.com
  trajectt.com
  trajooolp.cam
  trak-molc.applysap.com
@@ -253460,6 +269555,7 @@ trapiantofue.it
  trapone.xyz
  trappie.nl
  trapthought.cyou
+traptown.buzz
  trascendenza.pe
  trashmblematicy.com
  trashycrafter.top
@@ -254105,13 +270201,15 @@ tsad.goruli.com
  tsatest-812.tk
  tsatwg2bdst4.000webhostapp.com
  tsavo.ke
+tsb-demo.tuga.tools
  tsb-online.auth5s.com
  tsb-online.payee-add-online.com
+tsb-secure-online.com
  tsb-security-issue.com
+tsb.derestrictedpayee-auth.com
  tsb.new-loginattempt.com
  tsb.page
  tsb.uk-secure-deregisterdevice.com
-tsbdeclinepayee.com
  tsbfraud.com
  tsbmanagepayee.com
  tsbqgpsuez.duckdns.org
@@ -254179,6 +270277,7 @@ tsrv3.ru
  tsrv4.ws
  tss.4buyuklergazete.com
  tsshshop.xyz
+tssqxvxykglnmzceszzcodkabm-dot-gleow2021ja.ue.r.appspot.com
  tst.tynda.ru
  tstaffing.nl
  tstg.000webhostapp.com
@@ -254222,9 +270321,11 @@ ttechttech.000webhostapp.com
  ttenet.xyz
  tternikscsgo.work
  tterra.pt
+tteyuxfydjcckukvkxpaflaxxu-dot-gl9393jan.uk.r.appspot.com
  ttf.tidt47.cn
  ttfg.8js1c.cn
  ttgsjushaj.weebly.com
+ttgwngctawbzecgiuckyrjzbvy-dot-gl9393jan.uk.r.appspot.com
  tthedayhascometoanend.xyz
  tthszjwysfcanxquyhsyrucsjb-dot-gleowayel400503.uc.r.appspot.com
  ttiiu-71.gq
@@ -254285,6 +270386,7 @@ tubepchiunuoc.com
  tubestore.com.br
  tubjymafjjzdmntxfhk.top
  tuchnitaro.gq
+tuckrghflrketzldobrtpcgpsz-dot-gl9393jan.uk.r.appspot.com
  tuco-salamanca.dynamic-dns.net
  tucondominioenlinea.com.ve
  tucontaweb.com
@@ -254293,6 +270395,7 @@ tucsonballroomdanceacademy.com
  tucsoncrimelawyers.com
  tucsonpilawyer.com
  tudavi-viendacom.com
+tudddnusehtbjvuqbdyrmgbyss-dot-gl9393jan.uk.r.appspot.com
  tudialactate.ro
  tudo-para-vce-agora.net
  tudo-que-voce-mais-esperou-esta-aqui.com
@@ -254394,6 +270497,7 @@ tunisiamall.xyz
  tunisianabalone.com
  tunlanpa.privateimport.jp
  tunlearn.com
+tunmfqyfssexxkdiixlbfkvaiy-dot-gleow2021ja.ue.r.appspot.com
  tunnabelly.ug
  tunnel.kelikerica.com
  tunnelwell.com
@@ -254590,12 +270694,14 @@ tvbildirim.com
  tvbtgj.yolasite.com
  tvcc-pdf.com
  tvchda.healthygenez.club
+tvdjenertopnwqwuriepltsckq-dot-gl9393jan.uk.r.appspot.com
  tveebsorg.su
  tvffans.org
  tvh.31117n.cn
  tvhkkbfidfzidmpkdvehhhhlxx-dot-gleowayel400503.uc.r.appspot.com
  tviewer.ga
  tvinfo-24.online
+tvkcydvkelmrkwgnlizmspovnw-dot-gl9393jan.uk.r.appspot.com
  tvktjldkayrwtlzlnfdxrqywvgmjxtvyagvz-dot-cryptic-now-290917.ey.r.appspot.com
  tvl.billing-xz.com
  tvlicence-renew.com
@@ -254715,6 +270821,7 @@ twjdz.com
  twksupply.com
  twlove.ru
  twltch.fun
+twmmmujrxegthufyvikjwwyfeq-dot-gl9393jan.uk.r.appspot.com
  twnjzsaykcvpwzlfxcvqfxafeguifsidmmsp-dot-gl494903049.wl.r.appspot.com
  two-a-penny-hats.000webhostapp.com
  two-hitchhikers.ru
@@ -254762,6 +270869,7 @@ twtw.toh.info
  twuw.gikorip.net
  twv3w46verhz6awkyux6c.buzz
  twwse.xyz
+twwwwpmhtyuoonolwwbyrijfrc-dot-gl9393jan.uk.r.appspot.com
  twzhcxtn.biogenicherb.com
  tx-markets.com
  tx-returns.org
@@ -254796,6 +270904,7 @@ txjvpimiqotzxkjzhlqmtnyrjm-dot-gleowayel400503.uc.r.appspot.com
  txklhcycacqskbhnjrombhtecy-dot-gleowayel400503.uc.r.appspot.com
  txlmnqnunppnpuq.ru
  txmvakzdvmzujgbs.top
+txocoljfuowqgnnqnkgaondsle-dot-gl9393jan.uk.r.appspot.com
  txoecaolgjcvocnwhkrougfhad-dot-gloff849483.uk.r.appspot.com
  txpjvxfnps.duckdns.org
  txrebate-gov.com
@@ -254826,7 +270935,6 @@ tybkhljwvseijovnascoqklncyzcfuvhvpgs-dot-cryptic-now-290917.ey.r.appspot.com
  tyc1j.awaykart.com
  tycfsb.com
  tych.pe
-tycooncuriosity.com
  tycoweb.com
  tycp133.com
  tyczquarere.tk
@@ -254843,6 +270951,7 @@ tyh.shoesmogul.com
  tyhhjsyy.com
  tyhjgrftrt.xyz
  tyhjsod.tk
+tyhonauvbmouygeltnlvxympyi-dot-gl9393jan.uk.r.appspot.com
  tyhotel.vishou.net
  tyieoqxsoeucwosinzbaulcspapwjqmddxyy-dot-glegen303939423233.ue.r.appspot.com
  tyiesek.com
@@ -254861,6 +270970,7 @@ tyllietruite.com
  tyloumangonfairs.com
  tyowfh.com
  typal-hate.000webhostapp.com
+typdaygpkvcwsurinqhrssaaeo-dot-gleow2021ja.ue.r.appspot.com
  type-dcument-request.mypi.co
  type.officeseries.xyz
  type.setamazon.cyou
@@ -254896,6 +271006,7 @@ tytybinoe343.000webhostapp.com
  tyu87hfxz.appspot.com
  tyuebff.com
  tyuijghfd.com
+tyujfvzcwaatgdlwsnevnzbqqu-dot-gl9393jan.uk.r.appspot.com
  tyukr-----login.ygber.com
  tyvdr.herokuapp.com
  tyvgshop.com
@@ -254961,7 +271072,6 @@ u0999907.cp.regruhosting.ru
  u0lmailserver.ddns.net
  u1.xainjo.com
  u100586.test-handyhost.ru
-u100642.test-handyhost.ru
  u100694.test-handyhost.ru
  u1016927.cp.regruhosting.ru
  u1018739.cp.regruhosting.ru
@@ -255087,10 +271197,13 @@ uaeluxuryhotels.icu
  uaeneeds.com
  uaerhqjthiropcteuzfxhlpklseuqwimdnnc-dot-solar-vertex-285913.rj.r.appspot.com
  uafinty3f552sda.serveirc.com
+uaftjkzthqaoxemqbpauvxodus-dot-gl9393jan.uk.r.appspot.com
  uagdztech.org
  uagritech.com
+uaikpxdkvpfjoygooyxkgehdfn-dot-gl9393jan.uk.r.appspot.com
  uaisoftware.com.br
  uaixsuam.web.app
+uakrkcgpqqmqfgajxtolhtawzk-dot-gl9393jan.uk.r.appspot.com
  ualocal787.org
  ualocal853.org
  ualsi.test3d0.it
@@ -255120,6 +271233,7 @@ ubagroupci.in.net
  ubahlfjlqkoexkdw-dot-dbenitonline.ey.r.appspot.com
  ubayrldc.vipsnapchatsexting.com
  ubber.ga
+ubbhbobwruwvoujdqnidlhatvj-dot-gl9393jan.uk.r.appspot.com
  ubect.org
  ubee.co.kr
  ubekzmjonw.com
@@ -255173,7 +271287,6 @@ uberpromoco.com
  uberpromocoesgratisbaratas.000webhostapp.com
  uberpromocovid19.000webhostapp.com
  uberpromosortejm300.com
-uberprufung-vodafone.online
  ubersdescontos.000webhostapp.com
  uberteste.irtechsolucoes.com
  ubertransfer.uk
@@ -255209,7 +271322,6 @@ ubr.solutionseasyproblemsnow.com
  ubredaio.cloudns.asia
  ubrrrtaxi.com
  ubsall.com
-ubsbank-online.com
  ubsbanks.com
  ubsbd.com.bd
  ubtforex.com
@@ -255287,6 +271399,7 @@ ucup.com.tw
  ucuzdonanim.com
  ucuzrehber.com
  ucuzyemektarifi.com
+ucvjyhvrzoirvuqrtiqzwazzgu-dot-gl9393jan.uk.r.appspot.com
  ucx12.com
  ucxdim.com
  ucxdis.com
@@ -255346,6 +271459,7 @@ uedayuichicom.shaxiapurpose.top
  uefdtswwcbyfdfevye.top
  uegenesaret.000webhostapp.com
  uehdyte.duckdns.org
+ueljxnjbpcuuiobdacqciuerzv-dot-gl9393jan.uk.r.appspot.com
  uemasul.edu.br
  uemaweb.com
  uemoa.africasys.com
@@ -255358,6 +271472,7 @@ ueoevhuhhkbdcvkvggbxqwmyps-dot-gleowayel400503.uc.r.appspot.com
  uepl.com.pk
  ueprnynmjzuychqzyf.top
  ueqtmovbtumwipiylbphgamyjm-dot-gloff849483.uk.r.appspot.com
+ueqxdliqvrcpecevbzhmfozafl-dot-gl9393jan.uk.r.appspot.com
  uer.reiykiq.ir
  uetac.goruli.com
  uetech.com.my
@@ -255410,6 +271525,7 @@ ugan.ga
  ugcnet-coaching.com
  ugdgfvciokdmnvhha2vxfsbv9hgfn0jdhv3bxc7hvb1vz.000webhostapp.com
  ugenauto.bt
+ugetvekbkoaiottxxgpqlffatx-dot-gl9393jan.uk.r.appspot.com
  uggaustraliawebsite.com
  uggbootsoutlet.cn
  uggjsghuvevwgvbkgpzzlanmyblqrwrowffi-dot-cedar-code-289917.nn.r.appspot.com
@@ -255479,6 +271595,7 @@ uiebqbus.cbudnfni.cnuid.fbuqhiosnkklfnm.top
  uieines.com
  uiensewes.com
  uierhtureit.000webhostapp.com
+uifakfghmnphlbyxlgxidjmozw-dot-gl9393jan.uk.r.appspot.com
  uigsg.rogagot.com
  uiguvgaywyxkbdazxrywywzokhfjpqxrrxwg-dot-cryptic-now-290917.ey.r.appspot.com
  uihgjsyegkzwgywglqacghckga-dot-gleowayel400503.uc.r.appspot.com
@@ -255508,6 +271625,7 @@ uivhdilfynkaxklydarwbsxqczcaudxeokcf-dot-solar-vertex-285913.rj.r.appspot.com
  uivskbdn8klp.talagaremix.com
  uivwntfsbjmtswxdmlvnodekng-dot-gleowayel400503.uc.r.appspot.com
  uiwet.goruli.com
+uixfcholdfefehkxagfdsmeglz-dot-gl9393jan.uk.r.appspot.com
  uizjyrwikriggszzchpsdlbkkwdrlbghjtrw-dot-gl494903049.wl.r.appspot.com
  uizneuyackucrobywaeekjkxryyqjjhxxayb-dot-glegen303939423233.ue.r.appspot.com
  uj.jjconcreteseattle.com
@@ -255523,6 +271641,7 @@ ujkhggsgs.kwaidian.com.cn
  ujkhhss.com
  ujocqmadeczp.talagaremix.com
  ujqbofpegocysthbzlcbzkppnmyxnulynnfl-dot-cryptic-now-290917.ey.r.appspot.com
+ujqcqdhnfldgxgcnzmjomtuzus-dot-gl9393jan.uk.r.appspot.com
  ujrvjdbeivxutwkafjxeqskoda-dot-gleowayel400503.uc.r.appspot.com
  ujrvjezrkbfzqvebsb.top
  ujs612.activehosted.com
@@ -255554,6 +271673,7 @@ uk-grantpartner.zapto.org
  uk-grants.com
  uk-halifax-account.com
  uk-halifax-secure.com
+uk-help-centre.co
  uk-hmrc-tax-refund.com
  uk-hmrclog.info
  uk-hmtaxrefund.com
@@ -255671,6 +271791,7 @@ ukhiamkhdigxtbp-dot-charming-sky-2700.appspot.com
  ukhmer.com
  ukhmrebates.com
  ukhmrefunds.com
+ukhsbcplc.helphsverify.com
  ukhscbc-service.com
  ukhscbc-services.com
  ukhtinada.com
@@ -255684,6 +271805,7 @@ ukks.net
  uklidovka.eu
  uklimitationspaypal.com
  uklimitspp.com
+ukmdculijsrdgkfpyzfxpvidit-dot-gl9393jan.uk.r.appspot.com
  ukmedm.com
  ukmgnvdscor.top
  ukmkarate.unsil.ac.id
@@ -255778,6 +271900,7 @@ ulmaceous-bushing.000webhostapp.com
  ulmbespedfdfmx.serveirc.com
  uln976af.firebaseapp.com
  uloab.com
+ulobbvzkzmoxkdumbqjwpudxhg-dot-gl9393jan.uk.r.appspot.com
  ulodrzxivz.duckdns.org
  ulq.goruli.com
  ulrich-bredlow.de
@@ -255831,6 +271954,8 @@ ulusoylogistics.com
  uluyyrwzywdvqoxxfeobsjvorootmullfqoc-dot-cryptic-now-290917.ey.r.appspot.com
  ulvis.net
  ulvlibvsjcxuhvkfvrzaiowyef-dot-gleowayel400503.uc.r.appspot.com
+ulvrhwkykrpfreznfvhtzzsxfh-dot-gleow2021ja.ue.r.appspot.com
+ulwtdmybzuwjgzrghiwsjcxlva-dot-gl9393jan.uk.r.appspot.com
  ulxsa.shoesmogul.com
  ulyssemarketing.com
  ulyt.vipsnapchatsexting.com
@@ -255855,6 +271980,7 @@ umcg.world
  umconnectumt-my.sharepoint.com
  umctech.duckdns.org
  umdbamlab.com
+umebaebqtsrymauplxkjrelrcw-dot-gl9393jan.uk.r.appspot.com
  umeed.app
  umeedupvanfoundation.com
  umekq.rogagot.com
@@ -255897,6 +272023,8 @@ umuri.weebly.com
  umuugbmalw.duckdns.org
  umwelt-kirchhof.de
  umweltreportcom.shaxiaprimary.top
+umwlifkboygteuotnyfhknagui-dot-gl9393jan.uk.r.appspot.com
+umzzkrgtnahsivpvhxtrukqyoi-dot-gl9393jan.uk.r.appspot.com
  un-538059170.letsfitworld.com
  un-702152396.letsfitworld.com
  un-905474697.letsfitworld.com
@@ -255905,6 +272033,7 @@ un5pcj8j0pkyemnr3jaj8.avlto.host
  una-studios.com
  unaccpetable.publicvm.com
  unadd-newpayee.com
+unadmonished-highwa.000webhostapp.com
  unagi-eu.amazon.aws-sec-ure.loseyourip.com
  unallied-stand.000webhostapp.com
  unamak.com
@@ -255931,7 +272060,6 @@ unauthorise-onlinepayment.com
  unauthorise-paymentonline.com
  unauthorised-attemptedpayment.com
  unauthorised-cancelpayment.com
-unauthorised-onlinepayee.com
  unauthorised-payment.com
  unauthorised-paymentcancel.com
  unauthorised-transaction.net
@@ -255939,7 +272067,6 @@ unauthorisedpayee-gb.com
  unauthorisedpayeehelp.com
  unauthorized-deivce.cc
  unauthorized.activity.detected.on.your-account.digitalfm107.com
-unauthorsed-lloydsplc.com
  unauthourised-cancelpayment.com
  unauthroized-device.cc
  unauthrorisepayment.com
@@ -255957,6 +272084,7 @@ unblockfacebook2020.ml
  unboastful-confusio.000webhostapp.com
  unboringads.com
  unboxingtoycon.mx
+unbpczfuhrnqhmzugmhdnykcac-dot-gl9393jan.uk.r.appspot.com
  uncars.ru
  uncensoringamerica.com
  uncertainty-about-identity.000webhostapp.com
@@ -256447,7 +272575,6 @@ unreadmail.weebly.com
  unready-details.000webhostapp.com
  unreclaimable-ribbo.000webhostapp.com
  unrecognised-devicedetection.com
-unrecognised-devices.live
  unrecognisedpayee-removal.com
  unrecognisedtransaction.support
  unreconstructed-mon.000webhostapp.com
@@ -256675,10 +272802,12 @@ uomioin.com
  uooleunfljlaguriuhbswnsvhx-dot-gleowayel400503.uc.r.appspot.com
  uopredsaubga.gq
  uosnesa.sbxqpezcarnn.top
+uoswxxbybokhrirlqlnirrauln-dot-gl9393jan.uk.r.appspot.com
  uou293que-otima-e-top-semana.com
  uowedu.moonfruit.com
  uowioseave.ga
  uownleave.tk
+uozajgbxwrukvygokdzfeytcmy-dot-gl9393jan.uk.r.appspot.com
  up-liner.ru
  up-login-after-pay.com
  up-pro.apps-repository.net
@@ -257031,7 +273160,6 @@ updatemyeeinfo.com
  updatemyinfo-ee.com
  updatemypaymens.servebeer.com
  updatemyservice.kozow.com
-updatemythree-billing.com
  updatemythree-online.com
  updatemythree.co
  updatenewsbillinginfomation.com
@@ -257088,7 +273216,6 @@ updates.cn.com
  updates.eeinfo.net
  updates.gtaprovince.ru
  updatescheck.com
-updateseason17.com
  updatesecurity.ooguy.com
  updatesecurityamazn.com
  updatesecurityapp.servebeer.com
@@ -257104,6 +273231,7 @@ updatesrv2.bounceme.net
  updatesuport.com
  updatesystem.linkpc.net
  updatesysteml.ddns.net
+updatetaxrefunddetails.com
  updatetaxtermquickaccesssite09874321.fortunaseriquezas.com.br
  updateteam210.weebly.com
  updatetemp.temp.swtest.ru
@@ -257119,6 +273247,7 @@ updateuser.info
  updateverfic.org
  updateverificationsaccount.hangchunhui.com
  updateverificationsaccounts.hb9898.net
+updatevisit.buzz
  updatewe.xyz
  updatewebmail-servicewind.ml
  updatewellsfargo.servebeer.com
@@ -257200,7 +273329,6 @@ upgradenote.checkupdateslive.net
  upgradeprogram.000webhostapp.com
  upgraderyouryahoomail.weebly.com
  upgrades2017.yolasite.com
-upgradesvr-1at.weebly.com
  upgradetosigninyouraccount.weebly.com
  upgradetosigninyourmaillllllllllllllll.weebly.com
  upgradetosignupyourcom.weebly.com
@@ -257226,6 +273354,7 @@ upgradinglevel.weebly.com
  upgradnocst.tk
  upgradskill.com
  upgrdmailw.com
+upgrdmemberwellsship10.000webhostapp.com
  upheldharpy.com
  uphokety.com
  uphxuxcuqchlqqqtzsvkqdpiyc-dot-gleowayel400503.uc.r.appspot.com
@@ -257321,6 +273450,7 @@ upzpage.000webhostapp.com
  upzuy.417mcp.com
  upzvaladating.000webhostapp.com
  uqcafzerqguyypgket.top
+uqcsihipkbquvcewtqfmpjyeen-dot-gl9393jan.uk.r.appspot.com
  uqeuwdnsuhaajfoabgygrnhlylnpuztatmxe-dot-cedar-code-289917.nn.r.appspot.com
  uqgjbqprvwbxlhwdvtilznrihgigtqchyykk-dot-cryptic-now-290917.ey.r.appspot.com
  uqhaeuohi.weebly.com
@@ -257457,12 +273587,14 @@ urogyn-workshops.com
  urokzqwdljjctiagnbbzyzegknrvzowpkazz-dot-glegen303939423233.ue.r.appspot.com
  urologysocietypune.com
  urquilam.com.ar
+urrkpfzmopdawirohxmfojhoqi-dot-gl9393jan.uk.r.appspot.com
  ursreklam.com
  ursulamalls.cf
  urteste.com
  urtnzxmanfpqywbzmg.top
  urtoothfairy.com
  urtut.ru
+urtvutsiynztziszmacqtwonpl-dot-gl9393jan.uk.r.appspot.com
  urtx.ilramodellestreghe.it
  urubnk.com
  urutbersalinmama.com
@@ -257687,7 +273819,6 @@ user-center-account-security-setting-support-appleid-apple.com
  user-customercare.webredirect.org
  user-data-security-settings-support-account-amazon.com
  user-data-security-settings-support-account-rakuten.com
-user-facebook.b2u.top
  user-facebook0052352365.profile-photos328-id-2887263545.link
  user-giffgaff.link
  user-id025.com
@@ -257949,6 +274080,7 @@ uslbair.com
  uslmgfbcyjpadgmejqltzswododltseqiahr-dot-cryptic-now-290917.ey.r.appspot.com
  usload.info
  uslogisticexpress.com
+usloot.buzz
  uslugatel.net
  uslugielektrycznesiedlce.pl
  uslugigazowe-margaz.pl
@@ -257963,6 +274095,7 @@ usmilitaryleaveboard.co
  usnamzone.lzhhsbsjy.top
  usnetflixbills.com
  usnflx-deijhwavay.millennialj.com
+usnkbkejkeiopcpzatbxdyxdzy-dot-gl9393jan.uk.r.appspot.com
  usnqllrrcsisybetsjpzetzzsz-dot-gleowayel400503.uc.r.appspot.com
  usolutionz.com
  usomilhas.com
@@ -257973,6 +274106,7 @@ uspeshnybusiness.ru
  uspsdelvery-001-site1.atempurl.com
  uspsworldwide.com
  usqazt.cn
+usquikqrrqqqrvkqyv00vkqvyqx3vauthport.fra1.cdn.digitaloceanspaces.com
  usr-d892441e6392cbd3aaf41015.000webhostapp.com
  usr-sanpetru.ro
  usr.org.ua
@@ -258097,6 +274231,7 @@ utransilvania.ro
  uttarakhandghoomo.com
  uttarakhandvarta.com
  utting.org
+uttqvitttjnsnuyzprdlgyajyt-dot-gl9393jan.uk.r.appspot.com
  utvjhkpvbuaivuthtadpwaoxiy-dot-gleowayel400503.uc.r.appspot.com
  utyr.gearhostpreview.com
  utzjdwntawovgzbtazjnmlhazeplpzrgjbvr-dot-offgl8876899977678.uk.r.appspot.com
@@ -258114,6 +274249,7 @@ uuldoktxzffetlihiidsebtdyl-dot-gloff849483.uk.r.appspot.com
  uumove.com
  uundreeme02020-life.tk
  uuq.biogenicherb.com
+uuqpvdnjbryuuqcydzvdltyhkc-dot-gl9393jan.uk.r.appspot.com
  uurfgbbvjbfkhmoprxbsletehx-dot-gleowayel400503.uc.r.appspot.com
  uuspold.ee
  uusprun5.azurewebsites.net
@@ -258146,6 +274282,7 @@ uvnvrxhswoihkubdiyjxztpneyyfqlxkflim-dot-solar-vertex-285913.rj.r.appspot.com
  uvoq.gikorip.net
  uvsgodtbzlgfogunrsistvhhcw-dot-gleowayel400503.uc.r.appspot.com
  uvsrvfssjhjmuafbpb.top
+uvualybdvcafnhjvtetxszhrec-dot-gl9393jan.uk.r.appspot.com
  uvurinestl.com
  uvwxi.cn
  uvykhfdxekfxueznnhz.top
@@ -258218,6 +274355,8 @@ uxjwr.club
  uxlsfxdevcstmpuomiiidxlbtw-dot-gleowayel400503.uc.r.appspot.com
  uxlylzesvw.duckdns.org
  uxmks.com
+uxmmuifcvdeiprfwnydgujjfmw-dot-gl9393jan.uk.r.appspot.com
+uxngumkhxwlfacemwcqnwrcxgk-dot-gl9393jan.uk.r.appspot.com
  uxomevsrhoiofvylgpqemlgiagalhcbujngo-dot-cryptic-now-290917.ey.r.appspot.com
  uxqfzkniae.rfzzkmmtoa.top
  uxqqkord.vipsnapchatsexting.com
@@ -258242,6 +274381,7 @@ uyhqtddgfzxhdyxprpydxuwqkinqgwefwsiw-dot-solar-vertex-285913.rj.r.appspot.com
  uyhtlobrvtvcowzazqcbbuqbipflhehrwiau-dot-cryptic-now-290917.ey.r.appspot.com
  uyikjtn.eu
  uyl9so2ddlulwtrg4.com
+uynytmtmybvgamjmrzoupahnef-dot-gl9393jan.uk.r.appspot.com
  uyrsghb.goruli.com
  uyrt.hushenzhen.cn
  uyrtcgrfgbchnrjer.weebly.com
@@ -258462,6 +274602,7 @@ valennecklace.xyz
  valentinamalls.ml
  valentindiehl.de
  valentinegift.xyz
+valentinegifts.xyz
  valeosalesrep.com
  valeriabertolini.com.br
  valerian342.com
@@ -258546,7 +274687,6 @@ validlogin.top
  validservices.co
  valkindead.ru
  vallalkozo.hu
-vallarihotels.com
  vallejointernational.com
  vallenatoregio.com
  valleyal.buzz
@@ -258569,6 +274709,7 @@ valtergrass.com
  valterviana.com.br
  valuablesbells.top
  valuecheep53.com
+valueesgdkzkipypgajzcqbutq-dot-gleow2021ja.ue.r.appspot.com
  valueeurocoins.altervista.org
  valuescaucus.org
  valuesys166.com
@@ -258840,6 +274981,7 @@ vbiicnelmibqlsjxujyjiildbt-dot-gleowayel400503.uc.r.appspot.com
  vbivngfkoioeryyrbtwniabmgd-dot-gleowayel400503.uc.r.appspot.com
  vbizaudyiaud.com
  vbizemail.com
+vbjeuougqpngnmpytlqrcaljiy-dot-gl9393jan.uk.r.appspot.com
  vbkrdrpqmzefesfpesghaudvdpwpdltlkezn-dot-solar-vertex-285913.rj.r.appspot.com
  vbkw.vipsnapchatsexting.com
  vblpeor.com
@@ -258851,6 +274993,7 @@ vbntpwcu.goruli.com
  vbntrolopokowi.tk
  vboglcom.nckiregister.gdn
  vbpgodpvybhvfpusikokwpgvgw-dot-gloff849483.uk.r.appspot.com
+vbpnnmugpttjtrawpmnaffjfyw-dot-gleow2021ja.ue.r.appspot.com
  vbqxrdmzywejnef.top
  vbr4-5886958.xyz
  vbrxhftyhgptsnloutpvwqudhafwfcpexsav-dot-glenxpecial3009493.ey.r.appspot.com
@@ -258865,6 +275008,7 @@ vbtwwztzpadwlfwcgwdgnhwzkj-dot-gloff849483.uk.r.appspot.com
  vbuhaisd.com
  vbujyxybqnqgujeang.top
  vbwfbaezngwncamknotlwkpyvagpkskklocm-dot-cryptic-now-290917.ey.r.appspot.com
+vbwrncjjeuzggzxmsrwjawbsbh-dot-gleow2021ja.ue.r.appspot.com
  vbxdrs.com
  vbxfdgrt.cf
  vbyaudyiaud.com
@@ -258891,6 +275035,8 @@ vcf45df.com
  vcfh4wsdxxc.appspot.com
  vcfyf.kpzsom.cn
  vchosting.ddns.net
+vcjjjqnoutohhmfikymeqbofab-dot-gl9393jan.uk.r.appspot.com
+vcjxrbadjphiotxbbpgulxnlfh-dot-gl9393jan.uk.r.appspot.com
  vclmemos.surge.sh
  vclmmsorg.yolasite.com
  vclnegckukxgpfiiebeafcvixd-dot-gl9393jan.uk.r.appspot.com
@@ -258908,7 +275054,9 @@ vcpxzbnmoplrtfs.host
  vcqwxaeuyrpplnvrdcxaqswif.club
  vcroyal.com
  vcrvdff.com
+vcs-bokep-gratis-full-movie-tante-basah-hd-06.000webhostapp.com
  vcs-bokep-gratis-memek-basah-full-hd-movie-61.000webhostapp.com
+vcs-gratis-dan-vidio-bokep-indo-japan.000webhostapp.com
  vcs-janda-memek-basah-bokep-gratis-movie-hd-0.000webhostapp.com
  vcs-janda-memek-basah-bokep-gratis-movie-hd-8.000webhostapp.com
  vcs-janda-memek-basah-bokep-movie-hot-anal-97.000webhostapp.com
@@ -258917,6 +275065,7 @@ vcs-video-bokep-gratis-khusus-indo.000webhostapp.com
  vcsfs.com
  vcsgratisdangruopvidiobokepindoterbaruhdd.000webhostapp.com
  vcsgrupwhatsapp.kuotaku-gratis.gq
+vcxcbemczvgowgyeibqbuaazaw-dot-gl9393jan.uk.r.appspot.com
  vcxcdrt54dfs.000webhostapp.com
  vcxg1e45e21ewgym.monster
  vcxlcyqielvrmjumimsagnwqzemxfmzbjusi-dot-solar-vertex-285913.rj.r.appspot.com
@@ -259033,7 +275182,6 @@ vegetablesmacaw.com
  vegetownshing.xyz
  vegistore.com
  vehicle-paymentreport.com
-vehicle-registration-update.com
  vehicle-sales-ebay.parkertom.com
  vehicle-tax.ref1x77i.com
  vehicle-taxdetection.com
@@ -259335,6 +275483,7 @@ verif-ppl.serveftp.com
  verif-probox11.yolasite.com
  verif-probox3.yolasite.com
  verif-your-account.applevalide.com
+verif.copyright-instagramid.ml
  verif.pp-recouvrement-paiement.com
  verif.services
  verif1-ac0nt.com
@@ -259406,7 +275555,6 @@ verificaijjiijjijljljljlogin.com
  verificaisp.online
  verificaituoidati.com
  verificalbcpmovil.spy-movs.com
-verificaloginisp.com
  verificaltbcpenlinea.diruns.com
  verificamasqueenlogin.com
  verificando-identidad-xyz.preview-domain.com
@@ -259426,6 +275574,7 @@ verificartbcponline.lalipos.com
  verificartbcpsmovil.cola-ge.com
  verificartbcpsonline.cub-rocv.com
  verificarvialbcpenlinea.est-bcps.com
+verificasicurezza-lnformazione.com
  verificasosislogino.com
  verificasteya.zz.com.ve
  verificasucuenta.moonfruit.ml
@@ -259811,7 +275960,6 @@ verify-details.ltd
  verify-device-check.cc
  verify-device-online.com
  verify-device-reference962.com
-verify-device-secruity.com
  verify-device-security.com
  verify-device-support-0912.com
  verify-device.help
@@ -259822,6 +275970,7 @@ verify-deviceauthorisation.com
  verify-devices.cc
  verify-ee.update-eebilling.mobi
  verify-fb-account.com
+verify-fbinfo.com
  verify-gov.com
  verify-hali.com
  verify-halifax-devices.com
@@ -260003,7 +276152,6 @@ verify.paypalschallenge.com
  verify.paypalwebs.com
  verify.payprestore.site
  verify.ppaccess.com
-verify.qay.login12336775588292545485500.opurudyb.qloiuhfbdhytrre05cd4852.u-clubbing.v-info.info
  verify.security-notifications.com
  verify.update.customer.paypal.com.cvd8542ti.email
  verify.update.email.paypal.com.2452102group.com
@@ -260220,6 +276368,10 @@ veritificartbcpmovil-peru.cola-ge.com
  veritress.info
  veritynova.com
  veritype166.com
+verivikasi-pemblokiran-fb07.ga
+verivikasi-pemblokiran-fb07.gq
+verivikasi-pemblokiran-fb07.ml
+verivikasi-pemblokiran-fb07.tk
  verivikasi.fego-xfb.cf
  verixon.co.uk
  verizon-3support.com
@@ -260325,6 +276477,7 @@ vertitype166.com
  vertoxpayme.000webhostapp.com
  vertoxtm.000webhostapp.com
  vertulounge.com
+verturgonline.us
  vertyswing.com
  vertysystem.work
  verumgroup.droppages.com
@@ -260343,7 +276496,7 @@ very-actapt.000webhostapp.com
  very-app.com
  very.ruvmp.ru
  veryclocksiet.ddnsfree.com
-veryfikasimyaccount.cf
+veryfi-neww.cf
  verynickfbcom.000webhostapp.com
  veryplushhair.com
  veryspec.co.uk
@@ -260362,6 +276515,7 @@ veseco.pt
  vesidailucachau.com
  vesinhcongnghiepqd.com
  vesinhnha.com.vn
+veslksulqvcpuhfydlotqwlnfe-dot-gl9393jan.uk.r.appspot.com
  veslydecor.com
  vespucci.hu
  vesrzkapomljjsbisexalmhjncnuywvxyhmd-dot-glegen303939423233.ue.r.appspot.com
@@ -260381,6 +276535,7 @@ vet-growth.com
  vetapharma.fr
  vetder.org
  veteran-volley.com.ua
+veterancreate.guru
  veteransdisabilityinsuranceattorney.com
  veteransid.com
  veteransrussian.ru
@@ -260441,9 +276596,11 @@ vfhdebjwk5.com
  vfhsnzwmuqclhfswwxgtsdnwqp-dot-gleowayel400503.uc.r.appspot.com
  vfixarqwxdwtbgrmppthervrab-dot-gleowayel400503.uc.r.appspot.com
  vfk.000webhostapp.com
+vfldojxovhavmbdjjrzypdtflz-dot-gl9393jan.uk.r.appspot.com
  vflhvavyllbswjeugroyqutjjh-dot-gleowayel400503.uc.r.appspot.com
  vfocus.net
  vfootcare.com
+vfphptssycvwjrkomwlitgzvtw-dot-gl9393jan.uk.r.appspot.com
  vfsds.com
  vftgrf.kozow.com
  vftrrytdtf.net
@@ -260759,6 +276916,7 @@ videogaixinh.tk
  videogamesgorilla.com
  videogize.com
  videograciosodefortnite.000webhostapp.com
+videogroup-whatappsy.duckdns.org
  videohot6969.info
  videohotanaksma.freefireeventt.tk
  videohotlagiviralkhususdewasa.000webhostapp.com
@@ -260851,6 +277009,7 @@ vidio-bokep-dwasa-www.000webhostapp.com
  vidio-bokep-indo-www.000webhostapp.com
  vidio-bokepviral-2020.000webhostapp.com
  vidio-dewasa-jepang-www.000webhostapp.com
+vidio-hot-sexs.000webhostapp.com
  vidio-sex-18plus.000webhostapp.com
  vidio-sexy-bokep-indo-www.000webhostapp.com
  vidio-viral19.wikaba.com
@@ -260882,6 +277041,8 @@ vidoogle.co
  vidorencontrer.tk
  vidramaq.com.br
  vidrioyaluminiosayj.com
+vidtaoon2asdhs.us
+vidtoon.buzz
  vidusceqtldrdhllvdnpdpfgqjbkvrnynicc-dot-cedar-code-289917.nn.r.appspot.com
  vidx.4pu.com
  vidxnxxpro.cf
@@ -260924,6 +277085,7 @@ view-fbmsg.review-messenger.ga
  view-halifx.me
  view-instgram-iogin.000webhostapp.com
  view-item.shop
+view-my3-co-uk.000webhostapp.com
  view-mypayees-login.com
  view-mypayees.co.uk
  view-mypayees.com
@@ -261201,6 +277363,7 @@ viona589.ddns.net
  vioprotection.com.co
  vioreystalydias.gr
  vioropeily.com
+viotarster.flywheelsites.com
  vip-exness.com
  vip-free57.cf
  vip-gratiso.000webhostapp.com
@@ -261238,6 +277401,7 @@ viphostindustries.info
  vipi.co.ke
  vipitalycom.batwoqisellers.top
  vipitalycom.nckicruise.gdn
+vipixcreative.com
  vipkeycb.ae
  vipkon.com.tr
  viplight.ae
@@ -261248,7 +277412,6 @@ vipmein.com
  vipmerchantclub.com
  vipmom.000webhostapp.com
  vipnetworkonline.com
-vipnewlinkgrupwhatsapp.wikaba.com
  vipno.cf
  vipoutdoorsportsjapmarket.club
  vipplusavlu.com
@@ -261420,6 +277583,7 @@ virtualsynopsis.com
  virtualwebdata.com
  virtualworldprojectcom.batwoqiseller.top
  virtudepaisefilhos.com.br
+virtueless-grass.000webhostapp.com
  virtueless-multipli.000webhostapp.com
  virtulavpilotuds.us
  virtuosoagency.com
@@ -261460,6 +277624,7 @@ viseny.com
  viservice0.from-fl.com
  vishald24.000webhostapp.com
  vishalkalptaru.in
+vishalpaper.com
  vishwakarmaacademy.com
  vishwasanket.com
  visiativ-industry.fr
@@ -261480,6 +277645,7 @@ visionbotix.com
  visionchb.com
  visiondev.online
  visionexims.com
+visionfight.buzz
  visionherbal.com
  visioninternational.info
  visionmoneymantra.com
@@ -261582,6 +277748,7 @@ vito.sspu.sumy.ua
  vitoriamodaintima.com.br
  vitorydasdhrig.com
  vitproupdatess.com
+vitqogtlstbautqelccmhkpfmy-dot-gleow2021ja.ue.r.appspot.com
  vitranphotography.com
  vitrescible-attract.000webhostapp.com
  vitrinejb.com.br
@@ -261643,6 +277810,7 @@ vixim.com.mx
  vixpwenfq.goruli.com
  vizagsource.com
  vizertv.xyz
+vizgemgbyvpeeaoggfxhcuryov-dot-gl9393jan.uk.r.appspot.com
  vizor.cloud
  vizpoets.com
  vizzamedia.com
@@ -261874,6 +278042,7 @@ vladisfoxlink.ru
  vladneta.lt
  vladtrans.ro
  vladzavadsky.com
+vlahkyuphrecovtjlsznfypepu-dot-gl9393jan.uk.r.appspot.com
  vlalnternet.online
  vlanitcom.shaxiaactive.top
  vlanitcom.shaxiaasian.top
@@ -261970,6 +278139,7 @@ vmphotograph.com
  vmpzdsbnztmycvmztp.top
  vmracing507.com
  vmrbuildcon.com
+vmrwbyczbqkqaqoqaaiufbeanz-dot-gl9393jan.uk.r.appspot.com
  vmsconstructions.in
  vmsecityurevz.pw
  vmsecuritysolutions.com
@@ -262153,6 +278323,7 @@ voiced-exhausts.000webhostapp.com
  voiceduration1.website
  voicedxtel.azurewebsites.net
  voicefax98877645678.club
+voiceful-broadcast.000webhostapp.com
  voicehello.z22.web.core.windows.net
  voicelsp.com
  voicemail.sytes.net
@@ -262208,6 +278379,7 @@ volarevic.com
  volatilizes543xz.pw
  volby.000webhostapp.com
  volcanict.com
+volcanodate.guru
  volcemailauthentlcation.netlify.app
  voldter-bers.web.app
  volg-postnl.us
@@ -262255,6 +278427,7 @@ vonunger-representaciones.cl
  voobzfreight.co.za
  vood8zp5kg8e.talagaremix.com
  voodoo4tactical.com
+voomzytqpumqqvksqlxriwdkeh-dot-gl9393jan.uk.r.appspot.com
  voorzorgmaatregel.info
  vootseries.gq
  vootseries.tk
@@ -262371,6 +278544,7 @@ vpass.club
  vpass.site
  vpassecojp.com
  vpayrupay.com
+vpbynhtvgujuseyxbtrmvrssua-dot-gl9393jan.uk.r.appspot.com
  vpcbnxlflipkryqxcwahjnxvwgguvkmnqokr-dot-solar-vertex-285913.rj.r.appspot.com
  vpdhfq.shoesmogul.com
  vpe01rvry01srvcepge01.my.id
@@ -262466,6 +278640,7 @@ vra-srl.com
  vra4.com
  vraag-nu-aan-online.eu
  vraagaan.space
+vrachinformy.ru
  vrachogan.cloudaccess.host
  vrajexports.com
  vrankendiamant.co.kr
@@ -262517,6 +278692,7 @@ vrtxx64uo.com
  vru1zyf6.firebaseapp.com
  vruiolbpaeajrdwmthrxqpaegq-dot-gleowayel400503.uc.r.appspot.com
  vrukshstore.com
+vrwacrjyahqxcrotvmfpjbcagr-dot-gl9393jan.uk.r.appspot.com
  vrxcmvzlcmngjfokydinnbuakczpmeiahqgk-dot-cedar-code-289917.nn.r.appspot.com
  vryxtctpuehkqxsngzyjhpobsqqejygetpuz-dot-cedar-code-289917.nn.r.appspot.com
  vrz-recycle.info
@@ -262595,11 +278771,13 @@ vtk-group.xyz
  vtlduwqgudiqwsqbyhipstaadmkgwevaqqwb-dot-solar-vertex-285913.rj.r.appspot.com
  vtm.olastech.com
  vtnbapizsymnjfcqjivfmxicjh-dot-gleowayel400503.uc.r.appspot.com
+vtnfsqdyfuxgqctzxcjoqpuoge-dot-gl9393jan.uk.r.appspot.com
  vto-netflix.com
  vtoroe-mnenie.ru
  vtorrancekx59.com
  vtoxarlaeldlixowkkmjktcmbl-dot-gleowayel400503.uc.r.appspot.com
  vtpgroup.co.in
+vtrcsetcntxmghixzlhhprjdii-dot-gl9393jan.uk.r.appspot.com
  vtrtuer.com
  vtscomputers.com
  vtsjythatuhxotqmmkbkvmisiz-dot-gleowayel400503.uc.r.appspot.com
@@ -262608,6 +278786,8 @@ vtxmail2018.myfreesites.net
  vtxwtpuixfjzqyjixfmrcvvfbv-dot-gleowayel400503.uc.r.appspot.com
  vtyllllyxl.duckdns.org
  vtzgr13l.firebaseapp.com
+vtzqsykanwqfgrbqsrkmemynhe-dot-gl9393jan.uk.r.appspot.com
+vtzswzpwkhydskwqnbrjzpvjjp-dot-gl9393jan.uk.r.appspot.com
  vuaekfyw.goruli.com
  vuatritue.com
  vuavu.elhyel.xyz
@@ -262641,6 +278821,7 @@ vuotolauta.tk
  vuqebnzsipjkqtdecdcskfjolp-dot-gleowayel400503.uc.r.appspot.com
  vuqshvswcvpktagkorazhjmdpbpseuuhwslf-dot-cedar-code-289917.nn.r.appspot.com
  vuqxlbgjphxuvfmnfvel-dot-gleowyel040493443434989.wl.r.appspot.com
+vurihdzmbltcyprzdmmcwgqrcl-dot-gl9393jan.uk.r.appspot.com
  vurl.bz
  vuuhhuihhh.duckdns.org
  vuurwerkhallen.nl
@@ -262724,7 +278905,9 @@ vvww-cdek.ru
  vvww1royallbank.com
  vvwwbcpzonasegurabeta.com
  vvwwrolox.com
+vvybxeefvueluyrptxycusoljp-dot-gl9393jan.uk.r.appspot.com
  vvyucgyyeqwjzynkyevd.top
+vvzsipvqqelkgbvxhzcxsvzglk-dot-gl9393jan.uk.r.appspot.com
  vw.perlqw.net
  vwapxkqgtgwjmefq.top
  vware.duckdns.org
@@ -262735,11 +278918,14 @@ vwets.ooguy.com
  vwfmpoemc.goruli.com
  vwgbmftwovlgbfxzxxbybnfwyb-dot-gleowayel400503.uc.r.appspot.com
  vwgwvsyjmtxqulkedvmqsbpyicvqpjpxttug-dot-glxcel49934343434.rj.r.appspot.com
+vwhigkjspbesupjvkcemgzfpro-dot-gl9393jan.uk.r.appspot.com
+vwjttckusqowmcksfkivohwbvq-dot-gl9393jan.uk.r.appspot.com
  vwkslhuujclbtxahxvvbpbdqzp-dot-gleowayel400503.uc.r.appspot.com
  vwmaster.hu
  vwmdqvjrdechabwxze.top
  vwnekb.goruli.com
  vwopeyiwqtkvdjrhzcdvdlckzq-dot-gloff849483.uk.r.appspot.com
+vwqufehzbyblswzjczaifcsfiy-dot-gl9393jan.uk.r.appspot.com
  vwrtbkcvkdcblgxyezytinngzy-dot-gleowayel400503.uc.r.appspot.com
  vwsplmail.com
  vwtmvqkerogeubcwlzbbpzewrgjycweppopf-dot-cryptic-now-290917.ey.r.appspot.com
@@ -262766,6 +278952,7 @@ vwzkqxufdiyymmaerntttwfner-dot-gleowayel400503.uc.r.appspot.com
  vxabybupvu.duckdns.org
  vxbnet.xyz
  vxcznbvbzcxn.servecounterstrike.com
+vxcztta.cam
  vxgdft.shoesmogul.com
  vxgqejudtcxyhwxz.top
  vxhwrwqswtsitdhcmdarktuhux-dot-gl9393jan.uk.r.appspot.com
@@ -262775,6 +278962,7 @@ vxojeldzonjlqzrfeolxpatjiilduxvphnyz-dot-solar-vertex-285913.rj.r.appspot.com
  vxptecwkptoevzzv-dot-millinium.ey.r.appspot.com
  vxqghurwhvineepy.oragondesignstudio.com
  vxqkhzourygtzxanxalrjnsjjxelxzxgzcme-dot-solar-vertex-285913.rj.r.appspot.com
+vxqmydlockcygminkoyokmvbyz-dot-gl9393jan.uk.r.appspot.com
  vxser.com
  vxssarhqelaonaedtbnpwlduqrxkywgswjta-dot-glegen303939423233.ue.r.appspot.com
  vxswqefit.com
@@ -262802,6 +278990,7 @@ vyojkgvwxephfjevkevcqjnslyjwfbveakfj-dot-offglen.uk.r.appspot.com
  vyrlksauqzrsvnlflbrhteudgjxjeqvfashn-dot-glenxpecial3009493.ey.r.appspot.com
  vyroba-plotov-bran.sk
  vyrtfcadclhbjfeqwnpcptpwzwkyxtyhxdfh-dot-cedar-code-289917.nn.r.appspot.com
+vysibmdlctbtcloigbscimfzax-dot-gl9393jan.uk.r.appspot.com
  vysimopoulos.com
  vysix.nl
  vysokepole.eu
@@ -262849,6 +279038,7 @@ vztwqkxoadjfjoximiixdzyutoqmrvbewqed-dot-cryptic-now-290917.ey.r.appspot.com
  vzw-covidnopay.com
  vzwcovid19g-001-site1.1tempurl.com
  vzwcovid19i-001-site1.1tempurl.com
+vzwfvotxftroiqsoqxbdeogzcw-dot-gl9393jan.uk.r.appspot.com
  vzwnmksfhju.top
  vzwwijs.be
  vzxivxz.serviceorder.su
@@ -263042,6 +279232,7 @@ wachten-moment.com
  wachtopverbinding.com
  wachtsgroups.frezze.ml
  wacingid.000webhostapp.com
+wacjpcrpmnvjbuyuesvanujkwf-dot-gl9393jan.uk.r.appspot.com
  waco365.org
  wacochamber.com
  wacstderypasgzlrlosjmxpgeslxigbvshkh-dot-solar-vertex-285913.rj.r.appspot.com
@@ -263432,6 +279623,7 @@ wastebilliest.com
  wasteraq.com
  wasteraq.net
  wastewatertreatmentplantscom.chifanblood.top
+wasting-rod.000webhostapp.com
  wastrumermity.xyz
  wasxe.xyz
  wasze-info3.x9.eu
@@ -263568,6 +279760,7 @@ waynela.com
  waynemarketingenterprisesinc.com
  waynencjscjsdcjlkbasm.yolasite.com
  waynes.com.br
+wayone12.000webhostapp.com
  wayrestylephotoblog.com
  waysbanking.com
  waystoneentertainment.com
@@ -263616,6 +279809,7 @@ wbservicingforelsh73d.xyz
  wbsfty6in.com
  wbstormer.com
  wbstudiodesigns.com
+wbtikyutwytqceybrbvmyipcsu-dot-gl9393jan.uk.r.appspot.com
  wbtseerverjs.weebly.com
  wbusinessquare.com
  wbw.acelebrationoflove.net
@@ -263639,6 +279833,7 @@ wcgaec.com
  wcgrant.live
  wcgs.jaysbrand.com
  wchmrvc.com
+wchxjpuppmhnskaotaweltaekh-dot-gl9393jan.uk.r.appspot.com
  wcia.org.in
  wciagniki.eu
  wcjq.mentriqq.com
@@ -263657,6 +279852,7 @@ wcurrentlyattyahoo.weebly.com
  wcustormsigns.com
  wcutmywajrtgxbaydhipyyajcijmpnjqtnab-dot-gl494903049.wl.r.appspot.com
  wcvxbvf.ug
+wcwsdsseiqtigfynlrafrltipz-dot-gl9393jan.uk.r.appspot.com
  wcx666.com
  wcxfaf.rogagot.com
  wcxxppnmriysclhjoumgdwyzojxrqmvzqhfh-dot-solar-vertex-285913.rj.r.appspot.com
@@ -263766,6 +279962,7 @@ wdjhb.mentriqq.com
  wdjkk73.tw
  wdjrq.awaykart.com
  wdkdwq.is-a-financialadvisor.com
+wdlvfjmhgprftibqreoctyjnei-dot-gl9393jan.uk.r.appspot.com
  wdmcs.avantgardeservices.in
  wdnmd.lovemiku.me
  wdovfstiklxxvrrnzpysecwzqonptizknkwt-dot-cedar-code-289917.nn.r.appspot.com
@@ -264004,7 +280201,6 @@ web99841040km-com.preview-domain.com
  web99841050km-com.preview-domain.com
  webabout.gr
  webaccess.co.id
-webacctupdt96976.weebly.com
  webaddssdssd.000webhostapp.com
  webadminz.000webhostapp.com
  webagosducato.info
@@ -264678,6 +280874,7 @@ weeksin-projectmailserver.web.app
  weekskypp.hopto.org
  weenal.info
  weeniecat.com
+weeny-buckle.000webhostapp.com
  weesh.xyz
  weessence.com
  weetmoglen.com
@@ -264752,6 +280949,7 @@ welcome776.000webhostapp.com
  welcomehomerealtyhsv.com
  welcomehouse.ca
  welcomemainoyahoo.weebly.com
+welcomemay.000webhostapp.com
  welcomemidia.com.br
  welcomepage01.hu
  welcometosouthernmd.com
@@ -264895,7 +281093,6 @@ wellsapps-support.mobi
  wellsbank.california.wf-california.online
  wellsbank.ref-id457.work
  wellsbankdae.duckdns.org
-wellscargo.ml
  wellsconfirm-account.com
  wellsd2.com
  wellsd3.info
@@ -265024,6 +281221,7 @@ wenti.000webhostapp.com
  wentuomachinery.com
  wenusemeee.com
  wenzhou.06wi.com
+weoillsfargonewssth.000webhostapp.com
  weorder-xrs.000webhostapp.com
  weowx.com
  weplayaem.com
@@ -265139,6 +281337,7 @@ westchesterpestcontrolpros.com
  westcoast437.club
  westcoastcharities.com
  westcoastsustainable.com
+westcode.tk
  westconsumernews.com
  westcopy.weebly.com
  westcountygold.com
@@ -265275,7 +281474,6 @@ wetransfer5g.000webhostapp.com
  wetransfer69404.000webhostapp.com
  wetransferauto.000webhostapp.com
  wetransferbe.000webhostapp.com
-wetransferdoczz.000webhostapp.com
  wetransferfiles.web.app
  wetransferpo-rfq-pdf.000webhostapp.com
  wetransfersecureshare.mybluemix.net
@@ -265343,12 +281541,14 @@ wfdazhutou.ltd
  wfdons.ru
  wfendo.com
  wferreira.adv.br
+wffsirpajpoalbuuodexswrcrm-dot-gl9393jan.uk.r.appspot.com
  wfg3.blissgood.ru
  wfgk.awaykart.com
  wfiufsyxgitg.top
  wfjmbf.vip
  wflecdmsnydxkrekjjaxrnhvmp-dot-gleowayel400503.uc.r.appspot.com
  wfljzg.cn
+wfmswhrntrigyxugauynlrjpal-dot-gl9393jan.uk.r.appspot.com
  wfmw.onderhost.com
  wfnjwrqufkfrqpdphudezengrcobiuduknyz-dot-glxcel49934343434.rj.r.appspot.com
  wfnoioteinnfweswsbbuxbyqhg-dot-gleowayel400503.uc.r.appspot.com
@@ -265396,6 +281596,7 @@ wgrtfqyogpaymjwrhfqytlinaz-dot-gloff849483.uk.r.appspot.com
  wgsistema.com.br
  wgsqhpz.goruli.com
  wgte.awaykart.com
+wgtqyywvqrbjgfkurxjalbtyoz-dot-gl9393jan.uk.r.appspot.com
  wgwk88.cn
  wgwnvykhkkyhtmtmisezdxgozn-dot-gloff849483.uk.r.appspot.com
  wgyftf.nxewxc.cn
@@ -265543,7 +281744,6 @@ whatsap-youtuber.ff-new1.cf
  whatsap.burik-event1.my.id
  whatsap.hol21.design
  whatsap.ionexusa.com
-whatsap.site
  whatsap01.lflink.com
  whatsap03.lflink.com
  whatsap1.ff-indo.com
@@ -265872,7 +282072,6 @@ whatsapp2020-berbagibokep.mrbonus.com
  whatsapp2020-berbagibokep.wikaba.com
  whatsapp2020.dynamic-dns.net
  whatsapp2020.us.to
-whatsapp2021.selebtiktok99.cf
  whatsapp20grup.getsviip7.com
  whatsapp23.gq
  whatsapp24.lflink.com
@@ -266003,7 +282202,6 @@ whatsappgrup-invite.otzo.com
  whatsappgrup-join.mrbasic.com
  whatsappgrup-joinbkp.gets-x.com
  whatsappgrup.glh12.gq
-whatsappgrup.ink
  whatsappgrup.mrbasic.com
  whatsappgrup6.tk
  whatsappgrup9.gq
@@ -266016,7 +282214,6 @@ whatsappgrupbudi.com
  whatsappgrupbudi01gaming.serveusers.com
  whatsappgruphot2020.dynamic-dns.net
  whatsappgrupinvitation.otzo.com
-whatsappgrupinvite.joingrup-wagrupq.ml
  whatsappgrupinvite20.ml
  whatsappgrupjoin18plus.sexidude.com
  whatsappgrupnew.xyz
@@ -266274,6 +282471,7 @@ wheelhousesocial.com
  wheeliebinorg.chifanavoid.top
  wheelwrightky.xyz
  wheezy-drills.000webhostapp.com
+wheljwacstaohkyxcatrzxouyd-dot-gl9393jan.uk.r.appspot.com
  wheltoninsurancecom-dot-phpapp-shshh.df.r.appspot.com
  whenandwheretravel.com
  whenigoalup.net
@@ -266314,6 +282512,7 @@ whinyn.xyz
  whiogrebs.com
  whiparyund.xyz
  whipixemarketing.com
+whippassage.guru
  whippingssleu.at
  whipplehillestates.com
  whirling-pints.000webhostapp.com
@@ -266381,6 +282580,7 @@ whm.proremontapple.ru
  whm.rc-forms.com
  whmgywlw.com
  whmi.lilliaboutique.com
+who-covid19.org
  who-diff.com
  who-health-covid-19.ru
  who9hih0take.xyz
@@ -266389,6 +282589,7 @@ whoer-vpn.net
  whoisdomain.zapto.org
  whoisnooey.com
  whole30foods.com
+wholefox.buzz
  wholemartonline.com
  wholemezlematic.com
  wholesale-football.com
@@ -266418,7 +282619,6 @@ whsyearbook.com
  whtasapp-join-hhtfy.000webhostapp.com
  whtsaapchatt.cf
  whtsaapjoiin18.my03.com
-whtsapgruopxxx72755.wikaba.com
  whtsapp-group.serveirc.com
  whtsappjoingruplogin.cf
  whtsappjoingruplogin.gq
@@ -266430,6 +282630,7 @@ whtsppgrupsharemom.tk
  whtssapp.ga
  whtssapp.gq
  whtssapp.ml
+whttsaptgrup.ezua.com
  whxjunpwidjysarnbrlsgdwmucaybkgquyfx-dot-solar-vertex-285913.rj.r.appspot.com
  whxoualxllnmvqexmnyogfnwdy-dot-gleowayel400503.uc.r.appspot.com
  why-h.xyz
@@ -266512,6 +282713,8 @@ wielkilukwarty.pl
  wien-mitte.co.at
  wiendle.com
  wiesengrundbayern.shaxiaapril.top
+wieunjtepyxvhzjesvbvaggqub-dot-gl9393jan.uk.r.appspot.com
+wieurqlusdgxhcvrxbncyhvntu-dot-gl9393jan.uk.r.appspot.com
  wiewjdmkfjn.com
  wifeimpact.com
  wifemimi.com
@@ -266524,6 +282727,7 @@ wig-out.org
  wigan-builder.co.uk
  wigfhuipjs.duckdns.org
  wigglez-productions.com
+wigsbmdtvdendxdadbhjxclarw-dot-gl9393jan.uk.r.appspot.com
  wihanstudio.com
  wihnldjgfduflsxfmiqfzuptjrtfwhtfhjzo-dot-cedar-code-289917.nn.r.appspot.com
  wihumanld.com
@@ -266761,6 +282965,7 @@ wilthywatong.ml
  wilyam30.ddns.net
  wimbert.nl
  wimiliorg.chifanbob.top
+wimlfztwhorcjxnxbrxqqeiina-dot-gl9393jan.uk.r.appspot.com
  wimp-oreoo-43.com
  wimverhuur.be
  win-d-9e817.web.app
@@ -267073,7 +283278,6 @@ wizardinfurius.000webhostapp.com
  wizardly-aryabhata-487d22.netlify.app
  wizardly-cori-ec1471.netlify.app
  wizardly-dubinsky-4f26a2.netlify.app
-wizardly-hermann-c50688.netlify.app
  wizardly-johnson-2fdf24.netlify.app
  wizardly-panini-15d935.netlify.app
  wizardly-ptolemy-36e0d8.netlify.app
@@ -267083,6 +283287,7 @@ wizbiz.online
  wizbiz.today
  wizcountinvests.com
  wizcraftagencies.com
+wizened-type.000webhostapp.com
  wizenedteifi.com
  wizlynxgroup.cn
  wizmozinteractive.com
@@ -267095,8 +283300,11 @@ wj4k.onderhost.com
  wj9xr.addroits.com
  wjamtecadwbgsgpztp.top
  wjanrokttshhwusdoozgfohuhhhzjfesicpg-dot-cryptic-now-290917.ey.r.appspot.com
+wjbgvgxdgmzpjacmgyeznvpill-dot-gl9393jan.uk.r.appspot.com
  wjbnvpsaayhquxfned.top
  wjcctf.com
+wjebhnovsckspjwsxdrzjjtmkc-dot-gl9393jan.uk.r.appspot.com
+wjgfaavnvmrihpgamqikhnlnnh-dot-gl9393jan.uk.r.appspot.com
  wjglvuezaaclvnrcjophktnununjqjiwweiq-dot-glenxpecial3009493.ey.r.appspot.com
  wjjjvzdwfmrygldq-dot-glexcel1.ue.r.appspot.com
  wjjprlmbqubxvngkkdtajewppg-dot-gleowayel400503.uc.r.appspot.com
@@ -267104,6 +283312,7 @@ wjknifeq.fun
  wjknifer.fun
  wjkq2.awaykart.com
  wjkukirzndeucqdkcnoflfdgnsaebroaoodf-dot-cryptic-now-290917.ey.r.appspot.com
+wjkvlbcpapgdxxoaxdiiykefrb-dot-gl9393jan.uk.r.appspot.com
  wjlenezubfhlmztcruyfytaqexvhamgvklyl-dot-glegen303939423233.ue.r.appspot.com
  wjmkswezxkwkpdumqrr.top
  wjoll.goruli.com
@@ -267134,6 +283343,7 @@ wkoenferofilctxwhpxqdzfzwe-dot-gloff849483.uk.r.appspot.com
  wkoreaw.com
  wkp9.svcoding.com
  wkprojekt.lwtrakszhona.com
+wkqpdzbqmqbgxvxapwhourinti-dot-gl9393jan.uk.r.appspot.com
  wkralbvzhkxikgniqvsqndodys-dot-gloff849483.uk.r.appspot.com
  wkreation.com
  wkrprime.com.br
@@ -267375,6 +283585,7 @@ womans-blog.000webhostapp.com
  womansonly.de
  wombat-jab.com
  womboperating.co.za
+womdrdjvtpaxnjlvqwcqvmgyxo-dot-gl9393jan.uk.r.appspot.com
  womenatwebug.online
  womenempowermentpakistan.com
  womenfilmnet.icu
@@ -267426,6 +283637,9 @@ woobwoo.ga
  woocommercewebshop.hu
  wood-expert.net
  woodbridgegroup.us
+woodcountydd-a-auth.ml
+woodcountydd-auth-org.ml
+woodcountydd-auth.ga
  woodcraftinteriorz.com
  woodenflooringcontractors.co.za
  woodensupport.sytes.net
@@ -267496,6 +283710,7 @@ wordpresssetstraight.com
  wordpressthemeplugin.com
  wordpubg.com
  wordsgrowere.com
+wordsworthian-deser.000webhostapp.com
  wordsyouwant.com
  work.digitalvichar.com
  work.jonwillchambers.co.uk
@@ -267589,6 +283804,7 @@ worldfreestuff.icu
  worldgenealogy.net
  worldgenerator.su
  worldglassday.xyz
+worldhealth.digital
  worldhealthbasicinfo.com
  worldindiaexpress.com
  worldjaquar.com
@@ -267721,7 +283937,6 @@ wpcccricket.co.za
  wpconnect.org
  wpcorporate.sfdevserver.com
  wpcpsychology.com
-wpd.uztzu.com
  wpdemo.cn
  wpdemo7.xtoreapp.com
  wpdev.ztickerz.io
@@ -267767,6 +283982,7 @@ wptest.demo-whiterabbit.it
  wptm.instamate.com
  wptp.lianjiewuxian.com
  wpwala.net
+wpwavyyyzrfnmikdkhkwfkofgq-dot-gl9393jan.uk.r.appspot.com
  wpyk.jaysbrand.com
  wpyqh.app.link
  wpywgikfekfbriangfgouakygfdzxpudoykg-dot-offgl8876899977678.uk.r.appspot.com
@@ -267845,6 +284061,7 @@ wrk44.ddns.net
  wrkngspam.ooguy.com
  wrkngspamcasacam.net.eventml.my.id
  wrkngspm01.ooguy.com
+wrkshnomcpnauknlnwgdgqtonv-dot-gl9393jan.uk.r.appspot.com
  wrmlavdojebkkeobebmmwmuakhaczdlchxdj-dot-offglen.uk.r.appspot.com
  wroft-fd.club
  wromedia.co.uk
@@ -267870,6 +284087,7 @@ wrwerer-71.cf
  wrwlyxahvinv5j7.e8273.pro
  wryinfo.info
  wryoilcsrdjetebpdihmgokhlxxctxomjkdn-dot-cryptic-now-290917.ey.r.appspot.com
+wrzjnxprhfdbxakrtmlamwaquw-dot-gl9393jan.uk.r.appspot.com
  wrztnchpouldn.com
  ws-ebavisapia01-dll.ir
  ws.stivenfernando.com
@@ -267913,6 +284131,7 @@ wsquareaccount.com
  wsquareaccountw.com
  wsqy.vipsnapchatsexting.com
  wsrjobrzcgocayyonyaatdpojzbbrwpkcdif-dot-cedar-code-289917.nn.r.appspot.com
+wsrufrjlksjmcpoytnziavowgs-dot-gl9393jan.uk.r.appspot.com
  wss.autotradingservices.com
  wssa-ceeflivves.bounceme.net
  wsspaq.com
@@ -267924,6 +284143,7 @@ wstria.jp
  wstrzymana-paczka-paczkomat.xyz
  wstrzymana-paczka.in.net
  wstx.onderhost.com
+wsulddvmuxpujsghatwjacdkog-dot-gleow2021ja.ue.r.appspot.com
  wsus.ga
  wsxhost.net
  wsxqlmpmytpydicshhuvjkkzur-dot-gloff849483.uk.r.appspot.com
@@ -267976,6 +284196,7 @@ wtherss.club
  wthpeokihvtlbtudldofmhrdoo-dot-gleowayel400503.uc.r.appspot.com
  wthwkdeegk.duckdns.org
  wtitrzdcurzitn.com
+wtkebnwdxagchciiximwrwlavz-dot-gl9393jan.uk.r.appspot.com
  wtmrktdbg.goruli.com
  wtn6738hwrt38mnxy.mattsenior1.repl.co
  wtonjdrlaiiksffekxcqnaalmy-dot-gleowayel400503.uc.r.appspot.com
@@ -268070,6 +284291,7 @@ wvobvyitai.topkorder.su
  wvougdkzwdxfhhghbjrggxmktuufastsupwx-dot-cryptic-now-290917.ey.r.appspot.com
  wvrmq5xtoygs.talagaremix.com
  wvuo-okes-gwtj-opvx.benwalek.com
+wvuyequimfaxiuykgiphxaufeb-dot-gl9393jan.uk.r.appspot.com
  wvv-rakuten-co-jp-billingupdatekey69.ngascjxq.com
  wvvvv.rakuten-cder.top
  wvvvv.telecreditoweb.me
@@ -268153,6 +284375,7 @@ ww.manageauts-conf1rm.com
  ww.manageconf1rm-app1erecovery.com
  ww.managesautheapp1e.com
  ww.manageupdate-app1e1nc.com
+ww.mywxjsk.com
  ww.paczkbdpd.com
  ww.paczkcdpd.com
  ww.paczkddpd.com
@@ -268222,6 +284445,7 @@ wwbenjfmbmdrrlgawgtgbulusngtmikqbxyy-dot-solar-vertex-285913.rj.r.appspot.com
  wwbenjfmbmdrrlgawgtgbulusngtmikqbxyy.solar-vertex-285913.rj.r.appspot.com
  wwcvfbbnbcvzfxbjdbtsctmokx-dot-gleowayel400503.uc.r.appspot.com
  wwd.com.pk
+wwe-shop.com
  wwe.guqitaihe.cn
  wwe.o2.service-unpaid-bill.com
  wwealthllc.com
@@ -268262,11 +284486,13 @@ wwsvvayixy.bestserviceo.su
  wwswa.xyz
  wwt90huau2.theliberates.tech
  wwttmm.com
+wwusplwmxiihcdrftedkupbnjq-dot-gl9393jan.uk.r.appspot.com
  wwv-facebook.com
  wwv.amazon.co.jp-manageaccount.3julishiyutreshipolisht.com
  wwv.chase-online.verify-secured-server.com.infoart.com.br
  wwv.comindexmangerinfoverfiyupdte.com
  wwv.scotiabank.online03scotia.com
+wwvbjklzifcojrarnxyhrubekp-dot-gl9393jan.uk.r.appspot.com
  wwvv-paypal.serveirc.com
  wwvv.bancoestado.cl.alertamovilcl.com
  www---cdek.ru
@@ -268698,6 +284924,7 @@ wx.hu-wo.com
  wx84.svcoding.com
  wx8g.hyperphp.com
  wxapp.vishou.net
+wxbxlxwwgriebniachjsbkiwjs-dot-gl9393jan.uk.r.appspot.com
  wxc5w.svcoding.com
  wxcvddaozc6y4n.com
  wxdgut.cn
@@ -268942,7 +285169,6 @@ xalonndoth.xyz
  xamaxzon-sukatoro.servebeer.com
  xamcmoqwvwjvgzqmvbxfwlarevchyfkbkrsd-dot-glegen303939423233.ue.r.appspot.com
  xamle123.ddns.net
-xamqvwvxganzlgohsosjowmvyi-dot-gl9393jan.uk.r.appspot.com
  xanadudigital.com
  xanauto.pt
  xantheshopping.gq
@@ -268959,6 +285185,7 @@ xarconentertainment.com
  xascacacasac.vercel.app
  xasggolbmdonojgkgwbbqmixfogbxqyrbbtb-dot-gl494903049.wl.r.appspot.com
  xashmining-ltc.com
+xaskkks.work
  xaslgqygjixgiqvhlcmqnpvtnbceysjrnowy-dot-cedar-code-289917.nn.r.appspot.com
  xatauthentverificationauth-incoming-paypal-payment-xgbmd30bm.cf
  xatauthentverificationauth-incoming-paypal-payment-xgbmd32bm.cf
@@ -268991,6 +285218,7 @@ xbcnndm.ga
  xbdh66.com
  xbdh6688.com
  xbdqzj.com
+xbedhrhegxqcpjuprpcivsoaea-dot-gl9393jan.uk.r.appspot.com
  xbf.dojnh.com
  xbfrr.xyz
  xbgnwersajqnmlzswkwhrjthpzaxjabvateo-dot-glegen303939423233.ue.r.appspot.com
@@ -269114,6 +285342,7 @@ xe-logistics.com
  xe7nikkij.email
  xebc7.jaysbrand.com
  xebh.goruli.com
+xeceohprgdoyrtckjsnzgsmztc-dot-gl9393jan.uk.r.appspot.com
  xecgrlrcokrknahxzbcnqfgxgnmfszfnpuft-dot-solar-vertex-285913.rj.r.appspot.com
  xecliallandin.xyz
  xecogioisg.com
@@ -269174,6 +285403,8 @@ xescuto.com
  xetaimt.com
  xetgnrjusyxyrlmjacfnjyogjc-dot-gleowayel400503.uc.r.appspot.com
  xetrytv.gb.net
+xeuablwzmmhmcfofayxctsareg-dot-gl9393jan.uk.r.appspot.com
+xeufmsridccqizoaixxmygubgv-dot-gleow2021ja.ue.r.appspot.com
  xexex.duckdns.org
  xexsigukmdiholxuqhvnubwlvdzcqynsvnhg-dot-glegen303939423233.ue.r.appspot.com
  xeynhzaoqu.brandstorey.su
@@ -269210,11 +285441,13 @@ xfinunipextrade.webcindario.com
  xfkeduxutt-4mj6kgk31.vercel.app
  xfmhbpbrvulmazxrsznybdskua-dot-gleowayel400503.uc.r.appspot.com
  xfnzcnedersqiwytvopkagm.top
+xfqrxyipmohbvbipiykgqnbgpo-dot-gl9393jan.uk.r.appspot.com
  xfr-financial.com
  xfreeluckyspin.myvnc.com
  xfroptions.com
  xfspzgxkgtaaphua-dot-millinium.ey.r.appspot.com
  xfthcctcahnfspnydr.top
+xfvhrpmlyccncyknnkdfpsnfva-dot-gl9393jan.uk.r.appspot.com
  xfxcxcvxcvxdfscvcvxfdssfsdfses4w.000webhostapp.com
  xfxiu.vipsnapchatsexting.com
  xfydy.top
@@ -269224,8 +285457,10 @@ xg7wvp3d50qj9tx.gmz.cc
  xgadgetshub.com
  xgbdimdhrjavydbtqvynjkvsaa-dot-gleowayel400503.uc.r.appspot.com
  xgcgonngl.com
+xgebwhztzqfswyaqypnaehukxd-dot-gl9393jan.uk.r.appspot.com
  xgfi.handipants.com
  xgflepvdibpnubdwgwurzhtxupozcsrlpgjv-dot-cedar-code-289917.nn.r.appspot.com
+xgfzwafgvccgyjryjgdvqxiwax-dot-gl9393jan.uk.r.appspot.com
  xggcasex.fun
  xghuacbh.com
  xghyywvutcoq.com
@@ -269241,10 +285476,12 @@ xgolb.com
  xgov.online
  xgqzcmhtzs.duckdns.org
  xgreesti.club
+xgrmxqeznmtkcndhnygpbzjiuk-dot-gl9393jan.uk.r.appspot.com
  xgroup-whatsapp69.zzux.com
  xgsnvqayt.vipsnapchatsexting.com
  xgv.goruli.com
  xgzgktviymgjgomyalrpjdtjrs-dot-gleowayel400503.uc.r.appspot.com
+xgzzkbvamrljbrvjhypualnuzi-dot-gl9393jan.uk.r.appspot.com
  xh1643879264863098023.el.r.appspot.com
  xh167894743.el.r.appspot.com
  xh1oiuej.oa.r.appspot.com
@@ -269266,6 +285503,8 @@ xhmrdaueaguvvtariecjhjtrnxqcyuogmzuh-dot-glxcel49934343434.rj.r.appspot.com
  xholls2.ml
  xhost-secure07c-chase.com
  xhot.eventfreex.com
+xhptdckenqtowidpqpjgvqvtxi-dot-gl9393jan.uk.r.appspot.com
+xhpymnpkkskspiophfoduceufx-dot-gl9393jan.uk.r.appspot.com
  xhqaurnoaalyrwhuxkcggwuwqsejnelcdemj-dot-glegen303939423233.ue.r.appspot.com
  xhqsysp.com
  xhsdxm.com
@@ -269421,6 +285660,7 @@ xk1hz.svcoding.com
  xk2ck.accpt-informtionsjw2r.optus-account.com
  xk7.jmafs.com
  xkaubaashhqxqwqcocrmqyackngxouqwtvsj-dot-solar-vertex-285913.rj.r.appspot.com
+xkbarwzrduejfpulgpmppmwocg-dot-gl9393jan.uk.r.appspot.com
  xkbniorlxhcbzfofweefjyorpi-dot-triple-upgrade-293822.rj.r.appspot.com
  xkedx.jaysbrand.com
  xkesbwgtghzjpgftsgiqigljso-dot-gleowayel400503.uc.r.appspot.com
@@ -269440,9 +285680,12 @@ xkvdlim.dermals.org
  xkyi.shoesmogul.com
  xlarge.at
  xlcsus0815dk1gpzp.xyz
+xldixselhjejafxxevjhaevxin-dot-gl9393jan.uk.r.appspot.com
+xleiqtxpapyxcegynetkrqrvvu-dot-gl9393jan.uk.r.appspot.com
  xlightcx.ddns.net
  xlightcx.myftp.biz
  xlightsfaces.com
+xliseqiqpfuesoxjhuowsdtcqa-dot-gl9393jan.uk.r.appspot.com
  xlix.site
  xljkpsrhv.gulfhirings.com
  xljzexeavrhkcdobtqgvxboprugdqdfihbam-dot-cedar-code-289917.nn.r.appspot.com
@@ -269452,6 +285695,7 @@ xlpxmvjoqgrvlsnqatkikrylhfdllachelec-dot-cedar-code-289917.nn.r.appspot.com
  xlsinvoices.sytes.net
  xltc-dta.be
  xltdwn4788hfj87298eyh.mattsenior1.repl.co
+xltjrvoepnunqtbaaadczhhxnc-dot-gl9393jan.uk.r.appspot.com
  xltyu.com
  xluck.giize.com
  xlucky.giize.com
@@ -269619,8 +285863,11 @@ xn--90aa1biaw7byb.xn--p1ai
  xn--90ac2ce2baj9a.xn--p1ai
  xn--90achbqoo0ahef9czcb.xn--p1ai
  xn--90aear0b9aj9c.xn--p1ai
+xn--90aecd4aao9fvd.xn--p1ai
  xn--90afdnal1aqq.xn--p1ai
  xn--90afxflt8ch.xn--p1ai
+xn--90ahf5cf1bac8c.xn--p1ai
+xn--90ahghnh2c5b.xn--p1ai
  xn--90akv9aa8azb.xn--p1ai
  xn--90ar7ads.xn--p1ai
  xn--90ark7ae9a.xn--p1ai
@@ -269660,13 +285907,16 @@ xn--bnkofmerc-qcbee85c.vg
  xn--bnkofmeric-j9c424eea.ph
  xn--bobleslring-g9a.dk
  xn--borsaliman-6ub.com
+xn--boxbrry-uya.com
  xn--bstchange-03a.net
  xn--bstchange-v4a.net
  xn--bstchange-vf7d.com
  xn--btchang-t8ag78w.net
  xn--btchange-4db49d.net
  xn--c1a0avga.xn--p1ai
+xn--c1ablfk9h.xn--p1ai
  xn--c1ac3a4cba.xn--p1ai
+xn--c1ad6aaries.xn--p1ai
  xn--c1aeffni0cs2c.xn--p1ai
  xn--c1aenimagdf8h.xn--p1ai
  xn--c1ahi1bpcj.xn--p1ai
@@ -269704,6 +285954,7 @@ xn--elctrum-u8a.com
  xn--entrmpelung-kerpen-p6b.de
  xn--evdekalan20gbkapyor-v5c.com
  xn--exods-nva.io
+xn--f1acceiy8c.xn--p1ai
  xn--f1af2bghz1a.xn--p1ai
  xn--facebok-dati-shb.com
  xn--faktygwat-xub.com.pl
@@ -269728,9 +285979,11 @@ xn--google-analytcs-xpb.com
  xn--grupbnclmbi-o7ag7veb.com
  xn--gstatc-7va.com
  xn--gwatpolska24-fcc.eu
+xn--h1ad3ae0a.xn--p1ai
  xn--h1adbkfg.xn--p1ai
  xn--h1adcfjmfy1g.xn--p1ai
  xn--h1adekuf0eb.xn--p1ai
+xn--h1ahmdu5e.xn--p1ai
  xn--h1atooc.xn--p1ai
  xn--hlfx-login-h4ac8m.com
  xn--hravfall-9za.com
@@ -269741,6 +285994,8 @@ xn--iconiqcaptal-0fb.com
  xn--id-zb4axila5esc1e1f9bvhzd4a6fe.sehvcnx.com
  xn--insagram-tj0d.com
  xn--instagrm-g0a.com
+xn--instgram-support-imb.com
+xn--j1agpz3a.xn--p1ai
  xn--js0bt1bly1ak6e.com
  xn--keynavigator-ky-7mb.com
  xn--keynavigators-ky-7pb.com
@@ -269923,6 +286178,7 @@ xnrnalegkngijrgdvsedmwfwcyassdwlcdsw-dot-cedar-code-289917.nn.r.appspot.com
  xnsh1bq0l35aw02avvqcom.batwoqisellers.top
  xnsteuerberatungknstler7lccom.chifanassume.top
  xntrekkingrderocbnet.shaxiaact.top
+xntuktvvjgvnthoprmbmoyjdts-dot-gleow2021ja.ue.r.appspot.com
  xnu8jwgoena6c8cc5d1b9h6hnet.shaxiaprimary.top
  xnufvbqbirlgnuhurmtzfcmjda-dot-gleowayel400503.uc.r.appspot.com
  xnveneza0vacom.batwoqiseller.top
@@ -269980,6 +286236,7 @@ xnxxtanpavpnfree.zyns.com
  xnxxterbarudaripemerintahgratis.dnset.com
  xnxxxfreedwn.tftpd.net
  xnxxxxx.wikaba.com
+xnznkriceiqsiffovjwkkhobsn-dot-gl9393jan.uk.r.appspot.com
  xnzrn3x32.urest.org
  xo57.com
  xo611.com
@@ -270006,6 +286263,7 @@ xoomera.us
  xoomla.xyz
  xoomserver.com
  xoomz.hk
+xoonifsxrmntlshkzilqpiswoa-dot-gl9393jan.uk.r.appspot.com
  xoot.host
  xopq.top
  xopvfcqe.shoesmogul.com
@@ -270036,7 +286294,6 @@ xpertwebinfotech.com
  xpgch.svcoding.com
  xphwidgfpbrhptcovtbl.live
  xphxks.ph
-xphyxglhcbnuojefhmvoppnokl-dot-gleow2021ja.ue.r.appspot.com
  xpiperae94xw.com
  xpkf.svcoding.com
  xpkucthj.goruli.com
@@ -270070,6 +286327,7 @@ xprti.xyz
  xprtii.xyz
  xpslwfeau.goruli.com
  xpssa.000webhostapp.com
+xptmllkwzybtyzwoafntqaecfp-dot-gl9393jan.uk.r.appspot.com
  xpto.ga
  xptvbawkqpgtybsdaj.top
  xpubgluckyspin.myvnc.com
@@ -270098,6 +286356,7 @@ xratfrd.duckdns.org
  xrbcsbzpeiewszakholmmyamjomkqnsmlklr-dot-cryptic-now-290917.ey.r.appspot.com
  xrbcsbzpeiewszakholmmyamjomkqnsmlklr.cryptic-now-290917.ey.r.appspot.com
  xrbmyixwavtarwsrzsmozrooilgcnwcgvqns-dot-solar-vertex-285913.rj.r.appspot.com
+xrfchmjcnyculyrffqnuaekuew-dot-gl9393jan.uk.r.appspot.com
  xrfzblpkdrroduacswbtlqixyvwpeowyljpp-dot-cryptic-now-290917.ey.r.appspot.com
  xrgwxmb.goruli.com
  xrhgstukqmnnaea.top
@@ -270154,15 +286413,18 @@ xspin16.com
  xspins.tencenters.com
  xsqd.awaykart.com
  xsr.hamhonar.com
+xsrwbggnjhfksuatcqwsvadecl-dot-gl9393jan.uk.r.appspot.com
  xsryx.xyz
  xsso.anbtr.com
  xssyuqosqlspqt.org
-xstbxmmffwhrakma-dot-revalidate-icaan-domain.ue.r.appspot.com
  xstmqwhcfgqixdpvtjhapxshme-dot-gleowayel400503.uc.r.appspot.com
  xstradepro.com
  xsvc.000webhostapp.com
  xsvdexbnu.goruli.com
+xsvlbemrmrpkzsjhsqvuntfzzv-dot-gleow2021ja.ue.r.appspot.com
+xsvlheqqefmgmvlwiktvyzpkte-dot-gleow2021ja.ue.r.appspot.com
  xsvnywtvlqjpxzhlvivflmabskpwfnrgwliu-dot-cedar-code-289917.nn.r.appspot.com
+xswdewpyvzwmfkfxkflrxdaict-dot-gl9393jan.uk.r.appspot.com
  xswkcojaomudjyvnmb.top
  xswse.com
  xswxbhdkystwkkikkoemjerodbjvivysozcf-dot-solar-vertex-285913.rj.r.appspot.com
@@ -270172,8 +286434,10 @@ xsykrbnunndjoosuhknkekfultiiyghnwjax-dot-glegen303939423233.ue.r.appspot.com
  xsykrygakonbt.com
  xt.boxerleads.dog
  xtbesqwkbpfonahxjfbtfsnwvphghdcxnhzu-dot-cedar-code-289917.nn.r.appspot.com
+xtbnbsbwmohknncxeandhbvtet-dot-gl9393jan.uk.r.appspot.com
  xtchawd.goruli.com
  xtcovdswgnfjgeknwkoohkuyzd-dot-gleowayel400503.uc.r.appspot.com
+xtdblvmancngfwawqywmqjyvfb-dot-gl9393jan.uk.r.appspot.com
  xtdskggjsrzingnkglmjkesnjw-dot-gloff00403993445.uk.r.appspot.com
  xtecheletronicos.com.br
  xtecsoft.com
@@ -270190,6 +286454,7 @@ xtkbp.awaykart.com
  xtmks.com
  xtmvizmnpdamgwaxzoyalciwlnmxnofutakf-dot-glegen303939423233.ue.r.appspot.com
  xtovin.cn
+xtpfddzrfxyafiyrknswffxlcn-dot-gl9393jan.uk.r.appspot.com
  xtptrack.com
  xtqgs.com
  xtqizu.com
@@ -270205,6 +286470,7 @@ xtronbikewear.co.uk
  xtrtyeyvpzhradhsfhjslcafmxlfdmmcnkcr-dot-cryptic-now-290917.ey.r.appspot.com
  xtsecityurppw.pw
  xtsecityurszh.pw
+xtttlnfvcgystgphequznrmxne-dot-gl9393jan.uk.r.appspot.com
  xtur.pl
  xtxgsx.com
  xtyejcvyxmkijqmxaxmzbhcviulhgqhzsjty-dot-offgl8876899977678.uk.r.appspot.com
@@ -270393,6 +286659,7 @@ xy3js.jaysbrand.com
  xy9t1.jaysbrand.com
  xybghc.com
  xybzq.goruli.com
+xycczvvctenkdadtyexciiflpj-dot-gl9393jan.uk.r.appspot.com
  xyekavpdvmoawexzcqsfbyjcck-dot-gleowayel400503.uc.r.appspot.com
  xyem.shoesmogul.com
  xyguilin.com
@@ -270404,6 +286671,7 @@ xyloid-foot.000webhostapp.com
  xylontoken.com
  xymlhxg.com
  xyqdilpsjemfhzztrrvplssqsymxkhpctnoc-dot-solar-vertex-285913.rj.r.appspot.com
+xyqsecxztjezfqvxkahiyscbdy-dot-gl9393jan.uk.r.appspot.com
  xyrmbb.jaysbrand.com
  xyshbk.com
  xyskyewhitedevilexploitgreat.duckdns.org
@@ -270414,6 +286682,7 @@ xytongda.com
  xyuj.goruli.com
  xyvnacwkzucdvrcpewskouvzexbmeqotwkan-dot-solar-vertex-285913.rj.r.appspot.com
  xyvnacwkzucdvrcpewskouvzexbmeqotwkan.solar-vertex-285913.rj.r.appspot.com
+xyvvysgvusiiwriuukjoymwezz-dot-gleow2021ja.ue.r.appspot.com
  xyxb.jaysbrand.com
  xyxyxt.net
  xyxyxyxyxyxyxywkworkforworldwifewide.duckdns.org
@@ -270472,6 +286741,7 @@ xzvw.xyz
  xzw8.jaysbrand.com
  xzwcjegna.goruli.com
  xzwq.000webhostapp.com
+xzwqgkjhmjeiokyxpsmpshvwaj-dot-gl9393jan.uk.r.appspot.com
  xzxgay-71.ga
  xzxycmfwhkbiyzikiylcrbruxqaejdymviht-dot-solar-vertex-285913.rj.r.appspot.com
  xzxzrqbgzwmuolteiibczcwhox-dot-gloff849483.uk.r.appspot.com
@@ -270687,8 +286957,6 @@ yahoomailcenter11.weebly.com
  yahoomailcommunication202.weebly.com
  yahoomailcommunicationupdate22.weebly.com
  yahoomailcustomercare.weebly.com
-yahoomaildesk43.weebly.com
-yahoomaildesk76.weebly.com
  yahoomaildomainservice.weebly.com
  yahoomailermai.weebly.com
  yahoomailguidiance.weebly.com
@@ -270883,6 +287151,7 @@ yanuotianxia.org
  yanvqcxwgkunrghzvlyagmmczuycosuikakk-dot-spyexc3093493.ey.r.appspot.com
  yaod1.com
  yaoii.org
+yaoixxqbydxnppdmhmuodtdkcw-dot-gl9393jan.uk.r.appspot.com
  yaojiyulecheng.tavmo.com
  yapea.me
  yapi-kredi-76-cekilisim.com
@@ -270894,6 +287163,7 @@ yapikredi-world-ozel.com
  yapikredi-world-xc90-ozel.com
  yapikrediinternetsubeniz.ml
  yapikrediozel-bmwm3.com
+yapmewycsobojoheuqlojlbqpk-dot-gl9393jan.uk.r.appspot.com
  yaralviscrap.com
  yarawp.com
  yardgirlz.com
@@ -270909,6 +287179,7 @@ yasaeimajedigroup.com
  yasarkemalplatformu.org
  yasarlarinsaat.com.tr
  yasarsu.com.tr
+yasbatsqbuogmgfvzwoyunlvob-dot-gl9393jan.uk.r.appspot.com
  yasgold.com
  yasiionasdnberece.net
  yasistore.com
@@ -270940,6 +287211,7 @@ yawaquiriporimaluiosnma.ml
  yawatrends.com
  yawningtrustyconfig--five-nine.repl.co
  yawpthhvrkauazbmhqtptdxdqrpjpvfhpnww-dot-cedar-code-289917.nn.r.appspot.com
+yaws-yin.000webhostapp.com
  yaxinyf.com
  yayasanrumahkita.com
  yayasansekora.org
@@ -270986,12 +287258,15 @@ yc.jbl22.com
  ycbn.info
  yccmbd.com
  ycdswpwvzyjzzrhcur.top
+ycetitvjdpmlolqbifqodxvmbp-dot-gl9393jan.uk.r.appspot.com
  yceybff.1ekefsrlznyc.troublevirgin.com
  ycfuse.com
  ycglnjkbifyopvhaxudquqpptydlxbgafqzf-dot-cryptic-now-290917.ey.r.appspot.com
  ychat.somee.com
+yciotegecowobtnmtizilvvunr-dot-gl9393jan.uk.r.appspot.com
  ycipl.com
  ycis.co
+ycjhnsqqpbxoyirzwgzirjnkjj-dot-gl9393jan.uk.r.appspot.com
  ycjlqlkbrgcfjpvcpdevmeubvmgvloejjozw-dot-gl494903049.wl.r.appspot.com
  yckswwhrqjhrssqchsz.top
  yclasdy.cf
@@ -271045,6 +287320,7 @@ yditrust.org
  ydjzkcapuqhfcytcxkausvwyasxyqrcrtlza-dot-glxcel49934343434.rj.r.appspot.com
  ydn.1kzz.cn
  ydone.site
+ydonqdpeuhwhviunvwqqlveset-dot-gl9393jan.uk.r.appspot.com
  ydreefffkx.duckdns.org
  ydrool.me
  ydsdhsf.2vs5hg.cn
@@ -271080,6 +287356,7 @@ year2006.ru
  yearansport.xyz
  yearinesents.xyz
  yearly-horoscope.org
+yearskin.guru
  yearylvestecoat.info
  yeawindows.com
  yeaysxapeaaq.org
@@ -271181,6 +287458,7 @@ yeutr.live
  yeutrz.live
  yevtuswkpncpoikldcjqrpwrahbellnhpytw-dot-glenxpecial3009493.ey.r.appspot.com
  yewj.awaykart.com
+yeypcknrjojdwukvbfjpfylnop-dot-gl9393jan.uk.r.appspot.com
  yeyu.gq
  yf.jjconcreteseattle.com
  yfca-ye.org
@@ -271206,6 +287484,7 @@ yfnzrluoakwjpyqsurcynqnpetrhayrpaqmq-dot-cryptic-now-290917.ey.r.appspot.com
  yfpmwerdaqhwayotxraiujztbk-dot-gleowayel400503.uc.r.appspot.com
  yfq87.svcoding.com
  yfrcckigfcd.hopto.org
+yfrjwlmjguofvubqmvpiqgmbbf-dot-gl9393jan.uk.r.appspot.com
  yfrscsddkkdl.in
  yfsmg.svcoding.com
  yftqmaweuwdmjvryjdixfazhuu-dot-gleowayel400503.uc.r.appspot.com
@@ -271253,7 +287532,9 @@ yh04er.xyz
  yh7zp5zg.firebaseapp.com
  yhaoonjhhg.weebly.com
  yhbgtrfavagad.top
+yhcbavufnomgpzqctoaozmkzkv-dot-gl9393jan.uk.r.appspot.com
  yhdebljqgx.top
+yheaekshhuvyrfflvybfxlsnmw-dot-gl9393jan.uk.r.appspot.com
  yhedg.xyz
  yhffgvccklmjhnhn.weebly.com
  yhfuhmhvgbnwmvzuswgvyqqnyz-dot-gleowayel400503.uc.r.appspot.com
@@ -271291,6 +287572,7 @@ yi2vtt9iuyf.ua1dw0qk.ga
  yi7qlaice.cf
  yi8qco8z.firebaseapp.com
  yi9pzxosadz.appspot.com
+yiazglxoxvovfwyesmvtcmvhxc-dot-gl9393jan.uk.r.appspot.com
  yibpshop.com
  yicai66.net
  yichang.06rl.com
@@ -271303,6 +287585,7 @@ yieldingsailors.com
  yieldmblematicy.com
  yifennart.com
  yifewgklnaaupdlthfgnbuzsgx-dot-gleowayel400503.uc.r.appspot.com
+yigleyjdynvkqjgkjjwzxkdqqk-dot-gl9393jan.uk.r.appspot.com
  yihaotui.com
  yihe.fcglobal.com.cn
  yihus.cq-zhihui.com
@@ -271354,6 +287637,7 @@ yiwu.06wi.com
  yiwudeals.com
  yixing.06rl.com
  yixuecourse.com
+yixybirmdzowkrusagaiwjseyz-dot-gl9393jan.uk.r.appspot.com
  yiyamu.com
  yiyang.yfqzdfd.com
  yiyou180.com
@@ -271372,6 +287656,7 @@ yjs.rappbdh.cn
  yjs.tnknqf.com.cn
  yjvaazzlls.duckdns.org
  yjvwdomx.goruli.com
+yjwzjxnsdvawximvayrzeuenvo-dot-gleow2021ja.ue.r.appspot.com
  yjxmcrrqmddiax2.e8273.pro
  yjyvpnovkkzqtjzx-dot-millinium.ey.r.appspot.com
  yjzygz.com
@@ -271379,6 +287664,7 @@ yk-2.jammyads.com
  ykbastonmartin2020.com
  ykd.goruli.com
  ykdqbrsxgk.top
+ykhpqxkclovtppdrnigeuttxyp-dot-gleow2021ja.ue.r.appspot.com
  ykjzmhthjblmrdakyzolfkputryvivfvwwak-dot-glenxpecial3009493.ey.r.appspot.com
  ykkgkgyugykkygkg.xyz
  ykpl.shoesmogul.com
@@ -271427,11 +287713,13 @@ ymb6it1mrtqjlvekqu19.oidjwoidj84.com
  ymca-cw.org.uk
  ymcaminya.org
  ymcgroup.eduardohypolito.com
+ymddiijrwlfydfflzgeumjqwws-dot-gl9393jan.uk.r.appspot.com
  ymddna.com
  ymdnbrktxd.top
  ymehgo.com
  ymep.svcoding.com
  ymevobec.gikorip.net
+ymgawimhjnizyhjyifrpsyfuuj-dot-gleow2021ja.ue.r.appspot.com
  ymgsaaqlxoncugioleuyyuyujf-dot-gleowayel400503.uc.r.appspot.com
  ymhdexakiby.gikorip.net
  ymhsptcffopjulmyarrlvwupih-dot-gleowayel400503.uc.r.appspot.com
@@ -271471,6 +287759,7 @@ ynowiowjovnjhqllfaucatirsr-dot-gleowayel400503.uc.r.appspot.com
  ynpfp.csb.app
  ynpzskzffaxqkdihdeqkidnbfy-dot-gloff849483.uk.r.appspot.com
  ynrenai.net
+ynuiskrufaujgcywraewtqslpw-dot-gl9393jan.uk.r.appspot.com
  ynvnwvvbgxushtgbzrjmgwwedb-dot-gleowayel400503.uc.r.appspot.com
  ynwl.uk.com
  ynxl9-id0applepay.com
@@ -271478,6 +287767,7 @@ ynylyw.com
  ynzlrxuxjfhzomworeawvhesfjnocyahutji-dot-solar-vertex-285913.rj.r.appspot.com
  yo.soylegal.es
  yobrit.com
+yobysvcuxzwpenrvdiesxaerxk-dot-gl9393jan.uk.r.appspot.com
  yocrea.fr
  yod.vteexcx.com
  yoder.vkcsites.org
@@ -271616,6 +287906,7 @@ yougeniusads.com
  yougetwhatyouplayedfor.com
  youghe-dod.web.app
  youhavebeennjratted.ddnsking.com
+youitonira.com
  youkahama.com.au
  youkezl.com
  youknownow.ru
@@ -271833,6 +288124,7 @@ ypggdpzhyqfkwssqyhxohfqdss-dot-gleowayel400503.uc.r.appspot.com
  yphzfcozswbmnusmrlopxowmtsreqthduaen-dot-solar-vertex-285913.rj.r.appspot.com
  ypirangaagricola.com.br
  ypjuzdxoktnnnfbrzkmiixfmmq-dot-gleowayel400503.uc.r.appspot.com
+ypjyisrgbbmvdcvympwjptwuac-dot-gl9393jan.uk.r.appspot.com
  ypjzbinvuwanaivzufsasoeubyglpsustzwr-dot-gl494903049.wl.r.appspot.com
  ypko-55.gq
  ypl0207.theworkpc.com
@@ -271842,9 +288134,11 @@ yppaydvxnvcfxbshnmadtsscuv-dot-gleowayel400503.uc.r.appspot.com
  yprwndilzavjoqdg-dot-millinium.ey.r.appspot.com
  ypschool.cn
  ypsmko.com
+ypugacaagijznfxhqdkzkrziug-dot-gl9393jan.uk.r.appspot.com
  ypuyrhztjjqwayvg.top
  ypvcbuvewrvtkjrysceanmhvud-dot-gleowayel400503.uc.r.appspot.com
  ypw1.dilshantg.com
+ypzmnewljwqkywkbagvtpdbnza-dot-gl9393jan.uk.r.appspot.com
  yq32.jaysbrand.com
  yq964.addroits.com
  yqdfbqchxv.top
@@ -271873,6 +288167,7 @@ yrfezuansizyeplwdshmuwtwarqjneusunnu-dot-cryptic-now-290917.ey.r.appspot.com
  yrfhjkgsdfeiyfamazon.hiinmo.com
  yrfiew.info
  yrfvideos.ml
+yrgndlfkdsgoeucanvcycmdmyr-dot-gl9393jan.uk.r.appspot.com
  yrhealth.life
  yrimeamazon.icu
  yrimeamazon.monster
@@ -271883,9 +288178,11 @@ yrmksfgaskqcygta.top
  yroloalllalaa.weebly.com
  yromszady.cf
  yrsmartshoppy.com
+yrtdmmq.cam
  yrtgefvcasedcf.weebly.com
  yrtq.goruli.com
  yrtuhf.frewdsjcvykiyiktjl.ml
+yrufjjaiibevmythtwgumvmtry-dot-gl9393jan.uk.r.appspot.com
  yrupymezlematic.com
  yruttandpaw.live
  yrwrgdbvxaewamwysmgvnofdafrpwgkpfxzz-dot-glegen303939423233.ue.r.appspot.com
@@ -271912,6 +288209,7 @@ yspihdy.cf
  yspublish.co.kr
  yspyropoulos.gr
  ysrqibuwxpxx.in
+yssuqpbrzuvjtgajbjpfavjhlr-dot-gl9393jan.uk.r.appspot.com
  ystconstructor.cl
  ysti.eu
  ysu3hs.xyz
@@ -271934,6 +288232,7 @@ ytarerstioner.com
  ytarerstionet.net
  ytbufidckjo1.com
  ytcdtndpncnupzck.top
+ytceufafcbxqbzvalnjucomaar-dot-gl9393jan.uk.r.appspot.com
  ytco.in
  ytcqmqavpjuhloyabvbadutoct-dot-gleowayel400503.uc.r.appspot.com
  ytcvhrdbmmtmykwstezxmfyjdp-dot-gleowayel400503.uc.r.appspot.com
@@ -272046,6 +288345,7 @@ yulp.cn
  yulswwulbecqzakideuqbosacs-dot-gleowayel400503.uc.r.appspot.com
  yuluobo.com
  yumatfirstbite.com
+yumccwuhrnfepfprbmxb.com
  yuminhong.blog.neworiental.org
  yummieyummers.com
  yummy-shine-decade.glitch.me
@@ -272126,6 +288426,7 @@ yvhgxumeicnewwnqqksxqwquyb-dot-gleowayel400503.uc.r.appspot.com
  yvicuzwcbnmuadtvqmdkpxbivp-dot-gl9393jan.uk.r.appspot.com
  yvjjxkkkxx.duckdns.org
  yvotoliverbooks.dynamic-dns.net
+yvpbhdxlionkhkkbvpujzgazej-dot-gl9393jan.uk.r.appspot.com
  yvpvlh.com
  yvqkumwvertedvaqnohjciuuupgeqyahdkjk-dot-cryptic-now-290917.ey.r.appspot.com
  yvtpueuxcdyczcnbcmajspshlf-dot-gloff849483.uk.r.appspot.com
@@ -272166,11 +288467,13 @@ yx.m.dodo52.com
  yx0y.awaykart.com
  yx1.duckdns.org
  yxbtpwnynb.duckdns.org
+yxbyptghjgpslkxykqhcjdiuhs-dot-gl9393jan.uk.r.appspot.com
  yxchczdy.cf
  yxelgqpgcbpsyydl-dot-millinium.ey.r.appspot.com
  yxfigvzcedarizwyymjdrmyinj-dot-triple-upgrade-293822.rj.r.appspot.com
  yxfq0.ailacabs.com
  yxg999.vip
+yxgtdimampcopkoyjewcawarym-dot-gl9393jan.uk.r.appspot.com
  yxh.goruli.com
  yxhktrcvgkflwtpqwdtwwctrpzyogozxslko-dot-cedar-code-289917.nn.r.appspot.com
  yxirlwizz.tastypriceo.su
@@ -272180,6 +288483,7 @@ yxmrnlnprultjqdrrxavkelcbaphirzhfdpd-dot-offgl8876899977678.uk.r.appspot.com
  yxmsb.shoesmogul.com
  yxnhsbuhvboopmvykoxlyhhnpbrsnqkivhng-dot-cryptic-now-290917.ey.r.appspot.com
  yxokmgwqznocixbwmzcxfmtfuxjmotmyahag-dot-gl494903049.wl.r.appspot.com
+yxpcuavxqkhtzvdiquhvtzyadw-dot-gl9393jan.uk.r.appspot.com
  yxpcwvmsxkmmsyvzrwht.top
  yxpjz.top
  yxqt9.saytanet.com
@@ -272208,6 +288512,7 @@ yyevw.gulfhirings.com
  yyfyyyutyjuemndaad.top
  yygavcvmpvpznofvfgvitznnvv-dot-gloff849483.uk.r.appspot.com
  yygelbbkauxnbcqliovy-dot-level-elevator-279110.nw.r.appspot.com
+yygerchsgpfavjxnudkhqvblfi-dot-gl9393jan.uk.r.appspot.com
  yygvdaewuhjbhrbfbujipuqtzqbidqqbjzad-dot-off94032393204.uk.r.appspot.com
  yyhbnhg.com
  yyhbnhg2.com
@@ -272279,6 +288584,7 @@ z-lab-company.com
  z-ncg.jaysbrand.com
  z-runescape.com.ua
  z-sc.svcoding.com
+z-showers.000webhostapp.com
  z-w6p.jaysbrand.com
  z-x4.alnawwar.com
  z.89fk.top
@@ -272350,6 +288656,7 @@ z9w1d.jaysbrand.com
  z9wc.mentriqq.com
  za549.onderhost.com
  zaaher.com
+zaanmooaonjp.buzz
  zaawgzoeogtwhfkpcrkcjbyvfimrxddxscok-dot-solar-vertex-285913.rj.r.appspot.com
  zaba2heldar.com
  zabava163.ru
@@ -272619,6 +288926,7 @@ zayzoy88888.000webhostapp.com
  zaza100.ddns.net
  zazabajouk.com
  zazbrain.com
+zazzleart.pw
  zb.china-wl.com
  zb06b.com
  zb81.svcoding.com
@@ -272669,7 +288977,9 @@ zcomunicacion.com
  zcpjtvgoalxrfnqhnfwvfyitroufxbrrztwc-dot-cryptic-now-290917.ey.r.appspot.com
  zcq-s.svcoding.com
  zcq.goruli.com
+zcqsgirbtcbnryjanmnmwynzqr-dot-gl9393jan.uk.r.appspot.com
  zcqwyyjywubheksewulzrqdvpc-dot-gleowayel400503.uc.r.appspot.com
+zcrmimeqjegeprygoikaroicmi-dot-gl9393jan.uk.r.appspot.com
  zcs.sk
  zcsbucvunbhmuocpwjfczjrgqy-dot-gleowayel400503.uc.r.appspot.com
  zctnw.rogagot.com
@@ -272715,6 +289025,7 @@ zdrowie-blog.pl
  zdrp.jaysbrand.com
  zduufouuanwcmishvtfhslhsxn-dot-gleowayel400503.uc.r.appspot.com
  zdwallcoveing.com
+zdwzxtbeazxuslqexcdiojacmf-dot-gl9393jan.uk.r.appspot.com
  zdxj3.jaysbrand.com
  zdy6.hyperphp.com
  ze-irs.website
@@ -272737,6 +289048,7 @@ zebragrowere.com
  zebrainvest.com
  zebraking.ddnsking.com
  zebranew.com
+zebrao.buzz
  zebweb.xyz
  zecc.xyz
  zecowyleofiduvbytvonjilafawwugepxbif-dot-cedar-code-289917.nn.r.appspot.com
@@ -272767,6 +289079,7 @@ zeing-kor.com
  zeitkunstbodenseecom.baerseventeam.top
  zeitungsverlagecom.shaxiacalendar.top
  zeizimbrduixisstmymupdyx9i23.jdevcloud.com
+zejyldolyttvrkzqsodbfycemr-dot-gl9393jan.uk.r.appspot.com
  zek.se
  zekahomestyle.nl
  zekamwebsite.000webhostapp.com
@@ -272800,6 +289113,8 @@ zems-skins.ml
  zen-clarke-60eae9.netlify.app
  zen-indonesia.com
  zen-kalam-c40101.netlify.app
+zen-kirch-688697.netlify.app
+zen-rosalind-ccfd2a.netlify.app
  zen-wilson-5f6257.netlify.app
  zenaddevis.com
  zenben.site
@@ -272914,6 +289229,7 @@ zeyadigital.com
  zeytinyagisabun.com
  zeyxhcsnmbxkjepcskxsbufyrbxlcrdypvcs-dot-glegen303939423233.ue.r.appspot.com
  zezewifi.000webhostapp.com
+zezkwdczxvgzsakohggglwneea-dot-gl9393jan.uk.r.appspot.com
  zeztuk.ga
  zf-ka.svcoding.com
  zf-zl.snprobbx.pbz.r.de.a2ip.ru
@@ -272951,6 +289267,7 @@ zgc.com.cn
  zgdiyydgmmkcsuzlyfehzhajvjhsldwhyjpr-dot-solar-vertex-285913.rj.r.appspot.com
  zgeuurpkqztwuusjpt.top
  zghshmw.com
+zghzsbscjrlhmaoejupsaqgtry-dot-gl9393jan.uk.r.appspot.com
  zgipsucwlpdyhxiwrbwopkprrizlgmhwpozs-dot-cryptic-now-290917.ey.r.appspot.com
  zgitjmdwsusnfvvkbszimllvys-dot-gleowayel400503.uc.r.appspot.com
  zgjyzqctoatax.serveirc.com
@@ -273243,6 +289560,7 @@ zjbiting.com
  zjegssdrjbzxuzymmj.top
  zjez.mentriqq.com
  zjfmywqfhzeeiitystulseweuovpvnnduaiq-dot-cryptic-now-290917.ey.r.appspot.com
+zjgrlcloatbzdvwmuocxoarrfy-dot-gl9393jan.uk.r.appspot.com
  zjgsyds.cn
  zjhnyz.com
  zjhuashi.net
@@ -273280,6 +289598,7 @@ zkdevelopers.com
  zke.usacomment.com
  zked.addroits.com
  zkj-z.svcoding.com
+zkoassxblxgzvsddfdvhhvwjlr-dot-gl9393jan.uk.r.appspot.com
  zkqpnjxjwkqvqonvxwqowegsul-dot-gleowayel400503.uc.r.appspot.com
  zkrbox.com
  zkrxplzuy.vipsnapchatsexting.com
@@ -273293,6 +289612,7 @@ zlayla20.com
  zlduejbjcmcfsjmjfjymigfsvcsmuhtzutut-dot-solar-vertex-285913.rj.r.appspot.com
  zleycgkicnygbmizlpzycvifibwwscsszmgj-dot-cryptic-now-290917.ey.r.appspot.com
  zlgic.goruli.com
+zlhoayyjeqmronxlidzmuiexjw-dot-gl9393jan.uk.r.appspot.com
  zlhq8.com
  zliuxhdu.goruli.com
  zlkjqizjxrxzuarpbnshgcaiwsorjbkbnlds-dot-glenxpecial3009493.ey.r.appspot.com
@@ -273315,6 +289635,7 @@ zmdvjrwvyzszcjgdyb.top
  zmelrvdyujucgfreyryhozbbex-dot-gleowayel400503.uc.r.appspot.com
  zmesaurzeumpnlxskzpzqcohzw-dot-gleowayel400503.uc.r.appspot.com
  zmfff20204q6az8.xyz
+zmgbiqznztdbklfyvftraanwlt-dot-gl9393jan.uk.r.appspot.com
  zmgmedia.com
  zmgmnqyfbftzdtcyma.top
  zmgpuwhcggxqqiznyrsgvagchqykxmmniezf-dot-gl494903049.wl.r.appspot.com
@@ -273367,6 +289688,7 @@ znexrgvatcyngsbez.tbbtyr.pbz.r.nl.a2ip.ru
  znexrgvatcyngsbez.tbbtyr.pbz.r.us.a2ip.ru
  znfvzmobi.shoesmogul.com
  zni1.com
+znitvnbxqydiuzxlblsuyulwcw-dot-gl9393jan.uk.r.appspot.com
  znmkan81.lcrintegratedsystems.com
  znmricqctretybachamiqmetna-dot-gleowayel400503.uc.r.appspot.com
  znmyoj.dermals.org
@@ -273384,6 +289706,7 @@ znymall.cn
  znyqerei.rogagot.com
  znz.psdzy.com
  zoahotel.com
+zoaiqesocbcuqadcgpsnnqsebn-dot-gl9393jan.uk.r.appspot.com
  zoam.shop
  zob-orion.com
  zodbzsdyqogwbubzvgufydgack-dot-gleowayel400503.uc.r.appspot.com
@@ -273645,6 +289968,7 @@ zonasegvra-bn1-pe.com.groupebethanie.com
  zonasegvra-bn1-pe.com.homeworkacademy.info
  zonasegvra-bncompe1.com
  zonasegvra-bnmultiweb.club
+zonasegvra-bnonline1info.com
  zonasegvra-registro.xyz
  zonasegvra-serviciobnred10.com
  zonasegvra-serviciobnred2.com
@@ -273712,7 +290036,6 @@ zontaclubofalabang.org
  zoo-invitetoday.s3-ap-northeast-1.amazonaws.com
  zoographic-son.000webhostapp.com
  zoohanpro.com
-zoolinutricaoanimal.com.br
  zoom-appointment.myftp.org
  zoom-corp.gkmaskim.ru
  zoom-emergency.myftp.org
@@ -273755,6 +290078,7 @@ zotech.com.tw
  zourlamac9.000webhostapp.com
  zousbreach.ddnsking.com
  zouttileck.com
+zouyfargjlouthirsodffifjlv-dot-gl9393jan.uk.r.appspot.com
  zouz105.000webhostapp.com
  zowersaude.com
  zoxomouoi.com
@@ -273774,6 +290098,7 @@ zpeagqw.shoesmogul.com
  zpenvjqu.goruli.com
  zpeny.svcoding.com
  zpeo.vipsnapchatsexting.com
+zperehcmayearkreitbsroizld-dot-gl9393jan.uk.r.appspot.com
  zpg.com.br
  zpgajipsgopsyejuxwzizmwmun-dot-triple-upgrade-293822.rj.r.appspot.com
  zpgajipsgopsyejuxwzizmwmun.triple-upgrade-293822.rj.r.appspot.com
@@ -273782,12 +290107,15 @@ zpidsiewtsoeyypopihljwdbhc-dot-gloff849483.uk.r.appspot.com
  zpindyshop.com
  zpitqybgymhrcyws.top
  zpjugrad.shoesmogul.com
+zpkaygzmttwkafinurkcnurnhh-dot-gleow2021ja.ue.r.appspot.com
  zplcaccounting.icu
  zpmagura.com
  zpmcudocdfd37a9x.mxp4037.com
  zpnrywfxnaqbprfugq.top
+zpolflqxaqztqstvdhmfpupwck-dot-gl9393jan.uk.r.appspot.com
  zppasfdntcraujehrolcpzheqgqlpxwlyffy-dot-glegen303939423233.ue.r.appspot.com
  zpr.io
+zpsehtdvhxlmvrfqrmigmsulyf-dot-gl9393jan.uk.r.appspot.com
  zpsghl.xyz
  zptr.awaykart.com
  zpunldzixlwhpenoskdmzfjkswnctqurxnsd-dot-cedar-code-289917.nn.r.appspot.com
@@ -273817,6 +290145,7 @@ zqfrstlggonuomefchsxiudweqnysaowmwjk-dot-cedar-code-289917.nn.r.appspot.com
  zqgbv.app.link
  zqgqwzpwimdqbwtscvtzzamqub-dot-gleowayel400503.uc.r.appspot.com
  zqhe.mentriqq.com
+zqijuctzsaeohcydaddnknrvbh-dot-gl9393jan.uk.r.appspot.com
  zqjh.mentriqq.com
  zqk7x.alnawwar.com
  zqkjn.svcoding.com
@@ -273826,6 +290155,8 @@ zqmdm.com
  zqmjsfds.goruli.com
  zqmltfqisiiwcoeqkeendxurrffzcfdjacfl-dot-gl494903049.wl.r.appspot.com
  zqmojrmvajkewwphsuggmtahfchxlayqwqzs-dot-spyexc3093493.ey.r.appspot.com
+zqohluttbhkjznyfkgmfivcpne-dot-gl9393jan.uk.r.appspot.com
+zqpmzwjbfwybwhptjgwtfxhvbz-dot-gl9393jan.uk.r.appspot.com
  zqptmrujxlruiatyqylexbfdmnwtvsuallik-dot-solar-vertex-285913.rj.r.appspot.com
  zqsafnww.goruli.com
  zquareup.net
@@ -273846,6 +290177,7 @@ zre.dermals.org
  zrgupdwnb.goruli.com
  zrhkviknid.duckdns.org
  zrhqewxgaysnmndkcuoaziv.top
+zricrmrulzoiosbtdknxfvxycy-dot-gl9393jan.uk.r.appspot.com
  zrjn2.weblium.site
  zrlutttapk.duckdns.org
  zrno.co.rs
@@ -273853,6 +290185,7 @@ zrnonzun.zkwqvkr.cn
  zromedia.com
  zrq2y.weblium.site
  zrqgtpjojvbomfkhokdipdhjhm-dot-gleowayel400503.uc.r.appspot.com
+zrqwxvuvpxwfdwexieogmqheze-dot-gl9393jan.uk.r.appspot.com
  zrusebery.com
  zrutaedu.com
  zrxmfcugfmsmbvglwanmyetmlv-dot-gleowayel400503.uc.r.appspot.com
@@ -273884,6 +290217,7 @@ zspedgshjmxfdrfwwd.top
  zspilica.webd.pro
  zspinpubg13.com
  zsplubaszcq2.nazwa.pl
+zsqvvqzgwuhryamokxvijothxh-dot-gl9393jan.uk.r.appspot.com
  zsqwwxcgtyu.cf
  zsqwwxcgtyu.ml
  zsqwwxcgtyu.tk
@@ -273929,6 +290263,8 @@ zucks.comprihensiveprove.xyz
  zucraft.com
  zuevmnpgswrplavarkawommxrk-dot-gloff00403993445.uk.r.appspot.com
  zuhbjbhtcafjgrbytbbtvdhvmbjpikdvojng-dot-solar-vertex-285913.rj.r.appspot.com
+zuhhqlsdmibyusxjzratzwkils-dot-gl9393jan.uk.r.appspot.com
+zuhpyiwmacagtkxsvbuzokgudu-dot-gl9393jan.uk.r.appspot.com
  zuisarch.top
  zujgyjoplcstrjtdgrmevsnemu-dot-gleowayel400503.uc.r.appspot.com
  zukmobile.cc
@@ -273982,6 +290318,7 @@ zvwlgr.shoesmogul.com
  zvxay09.com
  zvxrtcw.com
  zw578376khsds.com.ng
+zwaabvyezgidwsbetpudbypecz-dot-gl9393jan.uk.r.appspot.com
  zwajok.com
  zwanziger-heizungsreinigung.de
  zwaveguide.com
@@ -274005,6 +290342,7 @@ zwfcnxcgcacgfujcuy.top
  zwfxiieabnecjkgkbmebcnsykfeqdennpaaw-dot-glegen303939423233.ue.r.appspot.com
  zwgweb.000webhostapp.com
  zwinglian-goggles.000webhostapp.com
+zwrmgylzwmkxrutqwpyyreilth-dot-gl9393jan.uk.r.appspot.com
  zwset.xyz
  zwuomfeanram.sytes.net
  zwvkmkzmpkfyqkbdteyi-dot-gleowyel040493443434989.wl.r.appspot.com
@@ -274033,6 +290371,7 @@ zxdubljsdpwtjzrsxivczvdhgfvllzyfuucf-dot-cedar-code-289917.nn.r.appspot.com
  zxe32szefr3.000webhostapp.com
  zxe9tmtff3.com
  zxes.goruli.com
+zxfolyhoquexmtnbowwvemakty-dot-gl9393jan.uk.r.appspot.com
  zxha01.com
  zxhbxozdvrps.talagaremix.com
  zxhsqsnu.healthygenez.club
@@ -274045,6 +290384,7 @@ zxmewvguuwrdhswwxmslwykyygncgowzkjps-dot-gl494903049.wl.r.appspot.com
  zxmme.cam
  zxmvagysjo.topkorder.su
  zxmyaibxxnccyfrbzxhpsgbxsp-dot-gleowayel400503.uc.r.appspot.com
+zxofdufsjlexgnyuryzhcnsmzg-dot-gl9393jan.uk.r.appspot.com
  zxozpdtonwavortgtryolgzaht-dot-gleowayel400503.uc.r.appspot.com
  zxq4.onderhost.com
  zxqyrzwapp.cqhc.net
@@ -274059,6 +290399,7 @@ zxsse.xyz
  zxtiandao.com
  zxulu.shoesmogul.com
  zxuoqneouhjlkbcgwseeiwawmg-dot-gleowayel400503.uc.r.appspot.com
+zxuqslatrrutlsaqbgmhagedxt-dot-gl9393jan.uk.r.appspot.com
  zxvcm.ug
  zxvhidsnr.goruli.com
  zxwhatasspgrub.pbz-cc.ga
@@ -274066,6 +290407,7 @@ zxwva.rogagot.com
  zxxohwbeyfkfvswddvqnxvjlnimercukvdsg-dot-glegen303939423233.ue.r.appspot.com
  zxxuxyzbgnsosgiowiinolufjg-dot-gleowayel400503.uc.r.appspot.com
  zxyongheng.com
+zxytcyzfvmyfyuuhfbmdsaxywy-dot-gl9393jan.uk.r.appspot.com
  zxzascvbvfdcdcfcmnhn.000webhostapp.com
  zy-an.addroits.com
  zy0p.dimaflix.com
@@ -274126,6 +290468,7 @@ zzha.net
  zzhaitian.cn
  zzhalm.goruli.com
  zzhare12345.hopto.org
+zzhbcfxbytmmlcyeiekweeotxj-dot-gleow2021ja.ue.r.appspot.com
  zzhhc.cn
  zzi.bellevilledc.com
  zzjph.com
diff --git a/blacklists/malware/urls b/blacklists/malware/urls

index d012eefa9d562aa6260c236146287949d51f4389..c13317a16d115fe0d560a744c3d0e3b75a1316d6 100644 (file)
--- a/blacklists/malware/urls
+++ b/blacklists/malware/urls
@@ -1,37 +1,142 @@
  0i.is/7Tr9
  0i.is/CpAq
  0i.is/IqWc
+103.141.138.118/bin_jzbvYfwP234.bin
+103.143.73.155/signin/
  10ksurf.com/chs/bb6ee33553cbd975d08aee923a85ed25/envoi-carpostal.html
  116.106.39.10/.i
+122.116.17.187/.i
  123formbuilder.com/form-5559915/microsoft-team
  123formbuilder.com/form-5580797
-142.93.55.63/CronicalTheUntouchable.sh
-142.93.55.63/jaws-arm4
-142.93.55.63/jaws-arm5
-142.93.55.63/ppc12
-142.93.55.63/ppc13
-142.93.55.63/roots-x32
-142.93.55.63/roots-x86
-142.93.55.63/sh4
+138.68.20.95/a-r.m-4.GHOUL
+138.68.20.95/a-r.m-5.GHOUL
+138.68.20.95/a-r.m-6.GHOUL
+138.68.20.95/a-r.m-7.GHOUL
+138.68.20.95/i-5.8-6.GHOUL
+138.68.20.95/m-6.8-k.GHOUL
+138.68.20.95/m-i.p-s.GHOUL
+138.68.20.95/m-p.s-l.GHOUL
+138.68.20.95/p-p.c-.GHOUL
+138.68.20.95/s-h.4-.GHOUL
+138.68.20.95/x-3.2-.GHOUL
+138.68.20.95/x-8.6-.GHOUL
+143.95.100.74/.drp
+143.95.100.74/.drp/login.php
+147.135.210.70/fffffs/wifi.exe
+148.66.24.187/ap/signin
+162.241.115.133/oauth/2.0/yahoo
+162.241.115.133/oauth/2.0/yahoo/login.php
  162.241.121.32/xdd/
  162.241.121.32/xdd/confirmation-infos.php
  162.241.121.32/xdd/mot-de-passe.php
+162.241.70.248/interac/interac/lnterac/directing/bmo
+162.241.70.248/interac/interac/lnterac/directing/bmo/secquestions.php
+162.241.70.248/interac/interac/lnterac/directing/royalbank
+162.241.70.248/interac/interac/lnterac/directing/royalbank/index.html
+162.241.70.248/interac/interac/lnterac/directing/simplii
+162.241.70.248/interac/interac/lnterac/directing/simplii/index.html
+177.103.247.17/.i
+18.218.243.55/WellsFargo/session
+18.218.243.55/WellsFargo/session/reset_account.php
+192.227.209.21/bins/akuma.arm
+192.227.209.21/bins/akuma.arm5
+192.227.209.21/bins/akuma.arm6
+192.227.209.21/bins/akuma.arm7
+192.227.209.21/bins/akuma.m68k
+192.227.209.21/bins/akuma.mips
+192.227.209.21/bins/akuma.mpsl
+192.227.209.21/bins/akuma.ppc
+192.227.209.21/bins/akuma.sh4
+192.227.209.21/bins/akuma.spc
+192.227.209.21/bins/akuma.x86
+194.15.36.204/a-r.m-4.Sakura
+194.15.36.204/a-r.m-7.Sakura
+194.15.36.204/i-5.8-6.Sakura
+194.15.36.204/p-p.c-.Sakura
  1drv.ms/xs/s
+2vn.ru/APAPA/dhl_cpanel/
+3.124.3.141/working/KYC%20DOCS.exe
+3.124.3.141/working/regasm.exe
+3.124.3.141/working/svch.exe
+37.120.222.68/bxdlmi
+37.120.222.68/eoxmkb
+37.120.222.68/ghpmuy
+37.120.222.68/lqlakm
+37.120.222.68/nxftvi
+37.120.222.68/qokcon
+37.120.222.68/rlrtqe
+37.120.222.68/rysypg
+37.120.222.68/uybnji
+37.120.222.68/vvahia
+37.120.222.68/wkomqp
+37.120.222.68/yeansn
+37.120.222.68/yuwenb
+39.89.145.144/+-O+/tmp/netgear;sh+netgear&curpath=/&currentsetting.htm=1
+47.157.97.71/.i
+5.101.204.22/CookieAuth.dll
+51.89.246.80/arm4Komodo
+51.89.246.80/arm5Komodo
+51.89.246.80/arm7Komodo
+51.89.246.80/armv6lKomodo
+51.89.246.80/i586Komodo
+51.89.246.80/m68kKomodo
+51.89.246.80/mipsKomodo
+51.89.246.80/mipselKomodo
+51.89.246.80/pp-cKomodo
+51.89.246.80/ppcKomodo
+51.89.246.80/sh4Komodo
+51.89.246.80/x32Komodo
+51.89.246.80/x86Komodo
+69.176.89.151/ap/signin
+69.176.89.211/ap/signin
+77.83.117.225/snype.arm4
+77.83.117.225/snype.arm5
+77.83.117.225/snype.arm6
+77.83.117.225/snype.mips
+77.83.117.225/snype.mpsl
+77.83.117.225/snype.ppc
+77.83.117.225/snype.sparc
+77.83.117.225/snype.x86
  85.96.178.233/.i
+8y5kt9pgkjm6.wixsite.com/my-site/
+91.208.245.201/ReportServser.exe
+91.208.245.201/SQLAGENTIHC.exe
+91.208.245.201/SQLSerase.exe
+91.208.245.201/fdlaunchera.exe
  91.211.245.185/Welcome
+95.216.5.242/a-r.m-4.Logicnet
+95.216.5.242/a-r.m-5.Logicnet
+95.216.5.242/a-r.m-6.Logicnet
+95.216.5.242/a-r.m-7.Logicnet
+95.216.5.242/i-5.8-6.Logicnet
+95.216.5.242/m-6.8-k.Logicnet
+95.216.5.242/m-i.p-s.Logicnet
+95.216.5.242/m-p.s-l.Logicnet
+95.216.5.242/p-p.c-.Logicnet
+95.216.5.242/s-h.4-.Logicnet
+95.216.5.242/x-3.2-.Logicnet
+95.216.5.242/x-8.6-.Logicnet
+aaccount-netflixse.servehttp.com/en
+aaccount-netflixse.servehttp.com/en/Sign.php
+aafpr.org//C-Agricole/ac1646a9edf165f
+aafpr.org//C-Agricole/ac1646a9edf165f/region.php
  abre.ai/as0p
  abre.ai/bLoA
  abre.ai/caixacx
  abre.ai/seguranca-app
  ad.cezmika.com/css/newLin/LinkedinAUT/
+adminssit.ga/secure/wgbground
  adyug.com/database/factories/review7809/8d032
  adyug.com/database/factories/review7809/8d032/signin.php
  airlite.ch/.well-known/F004f19441
  airlite.ch/.well-known/F004f19441/11644210b.php
  aksfleet.com/mailbox/cpsess0757610916/
+alliance4consumersusa.org/enroll/
+alliance4consumersusa.org/enroll/ver.pdf.html
  allowcopy.com/open
  allowcopy.com/open/
  alturl.com/tdhf4
+amancarrental.com/joy/rowan/
  amaznn.co.jp.coj8albq.cc/pc
  americanas-tododia.redirectme.net/tv/samsung/simple-basket.php
  ams3.digitaloceanspaces.com/ams1
@@ -40,13 +145,25 @@ ams3.digitaloceanspaces.com/newvm
  ams3.digitaloceanspaces.com/newvm/index.html
  angelfire.com/games/gamez3
  angelfire.com/games/gamez3/facebook.htm
-anniversary-gifts-shop.com/ewzqndcq.rar
+annlee2642.dothome.co.kr/assets/global/plugins/jquery-file-upload/server/contact/fr/root/id
+annlee2642.dothome.co.kr/assets/global/plugins/jquery-file-upload/server/contact/fr/root/id/login/phpredir.php
  anon.to/H2jGQ0
  anon.to/uRnAyx
  antifraud-securepayees.com/hsbc/
  appbsnshlpscr.live/m.recover.htm
+arnazon.oo.ip.qmjidym.cn/pc/
+aspuzna20.iesmariamolinerinformatica.com/haproxy-https-4povf/64fzoeSNbAkVM0NWqR0m2Vuht
+ausmigrate.net.au/image/yh-phishing/66ccff64e8b90d3b284ea06789421347
+ausmigrate.net.au/image/yh-phishing/66ccff64e8b90d3b284ea06789421347/
+ausmigrate.net.au/image/yh-phishing/66ccff64e8b90d3b284ea06789421347/enter_password.php
  authenticatemy-new-payee.com/lloyds
  authenticatemy-new-payee.com/lloyds/Login.php
+bancaporinternetinterbanpe.com/doc
+bancaporinternetinterbanpe.com/doc/login.php
+bancolombiaveri.webcindario.com/vorife/
+barbohoricounselling.com/prop/int/banks/sco/
+billetterie.angers-sco.dspsport.com/Dsp/web/site/packages/Payment
+billetterie.angers-sco.dspsport.com/Dsp/web/site/packages/Payment/info3Dsecure.htm
  biolinky.co/legendarycontract
  biolinky.co/luckyxspin
  biolinky.co/tencentmetro
@@ -127,7 +244,6 @@ bit.do/fKRpG
  bit.do/fKZdP
  bit.do/fKuC3
  bit.do/fLg8m
-bit.do/fM46f
  bit.do/fdrfg
  bit.do/fnNcm
  bit.do/fndxn
@@ -344,32 +460,66 @@ bitly.com/3kXAhXj
  bitly.com/3oFHKMQ
  bitly.com/3p4HWWh
  bitly.com/PAYPAL-LOGIN-IL
+blancobusquets.com/laravel/vendor/phpunit/sys/wells/
+bluefridam.com/produtos/Utilidades/Jogo-de-Panelas-Tramontina-Antiaderente-de-Alum%C3%ADnio-Vermelho-10-Pe%C3%A7as-Turim/
+bridgemessage.com/bin/Priv8/Priv8
+bridgemessage.com/bin/Priv8/Priv8/index.html
+bss.edu.ge/transhome
+bss.edu.ge/transhome/index.php
  bss.edu.ge/wetransfer
  bss.edu.ge/wetransfer/index.php
+buildartinnovations.com/nk/
  bwavec.com/jh19x7dnrtlvz2a/v1tngimebsxtje/gf17c6pldufkzpb/hu1lv7u6iw4742x/eeq216dl5yg3j3j2j/fd17f6pclr6130m/gs34bngka7k9dz
  cabondhome.com/Drive/Drive
+cabralissa.com/bbbbb/wgbground
  cakeurl.com/sw3zY
  camada.ca/ping/absa
  camada.ca/ping/absa/AbsaOnline.htm
+cancellationfornewpayee.net/hsbc/reg
+cancellationfornewpayee.net/hsbc/reg/info
+cancellationfornewpayee.net/hsbc/reg/spec
+cancellationfornewpayee.net/hsbc/spe
+cancelpayee-attempt.com/Lloyds
+cancelpayee-attempt.com/Lloyds/
+cancelpayee-attempt.com/Lloyds/Login.php
  capesandbox.com/file/sample/2582/8729e52104ec08ca7002b217c42c3ec12262badbb3f11faaab1829eba505c3cb
  capital0ne.36o-bk.com/en/signin/
  cateroo.id/assets/fonts/nn/1und1/
+causalitybrew.com/OMMOM/OM9u8
  cbdhealthreviews.org/ad/1
  cbdhealthreviews.org/ad/1/code.html
+ccbangla.org/admin/
  cdbntrgff5566.onelink.me/sLeQ/810f6c15
  cdn.discordapp.com/attachments/680977014139650072/681241009618681896/n.exe
+cdn.discordapp.com/attachments/788792529372839956/791041217654947910/fatnigger.x86
+ceofloral.com/sessions/files-logs/logs/update-your-account-information/security-measure/log-in/
  changaosports.com/cfg
  changaosports.com/cfg/index.php
  ciscondecor.com/product/m
  ciscondecor.com/product/m/index.html
  claimrewardmetro.org/PUBG/
  cloudplanettech.com/bbbbb/wgbground
+cmtactical.com/js/extjs/Westpac
+cmtactical.com/js/extjs/Westpac/index.htm
+colegare.com/blog/sucursalpersonas.transaccionesbancolombia.com/
+colegare.com/blog/sucursalpersonas.transaccionesbancolombia.com/mua/USER
+completeaccount-supportmember.sign.gedelnakdek.com/15bb63b28926cd083b15e3b97567bbea
+completeaccount-supportmember.sign.gedelnakdek.com/15bb63b28926cd083b15e3b97567bbea/knhmWSOc40J4X3DJCeXJ3v1oVrLP.php
  conexionpos.com/dkb/
+confirmmydetails.com/lloyds
+confirmmydetails.com/lloyds/Login.php
+coopnordouest.ca/Mailbox/Mailbox_2
+coopnordouest.ca/Mailbox/Mailbox_2/i.php
  cort.as/-FgvH
  cpbild.co/c6d466d
  creatv.fr/images/social/netflix
+cuenta.bankia.es.twocountieshogroast.co.uk/bankia-usuario/
+cues-booklet.com/knab/
  customer-mobility-service.com/rbc/onlinebanking/cgi-bin/rbaccess
  customer-mobility-service.com/rbc/onlinebanking/cgi-bin/rbaccess/rbcgi3m013fc9.html
+customer-portal.sytes.net/user/homebankofamerica
+customer-portal.sytes.net/user/homebankofamerica/
+cutt.ly/EkwOp0J/
  cutt.ly/QiCMqtb
  cutt.ly/SsyhHnk
  cutt.ly/SyhM3BP
@@ -378,7 +528,9 @@ cutt.ly/WdEjmec
  cutt.ly/WgAU6fN
  cutt.ly/_BCP
  cutt.ly/actualizarbcp
+cutt.ly/ikqnhlC/
  cutt.ly/ldTGuAB
+cutt.ly/skrODGy/
  cutt.ly/tsqb6ai
  cutt.ly/vsqbVMI
  cutt.us/9WNKq
@@ -387,14 +539,48 @@ cutt.us/rHqRx
  cyw.pe.kr/images/baba/Alibaba.com/Alibaba.com/Alibaba.co.uk/35c2f42de3a745af1c74bd8fc03250ad
  dadafa88.com/03/bet
  dadafa88.com/03/bet/bet.html
+dailyfreshbatter.com/hb/upload
+dailyfreshbatter.com/hb/upload/index.php
+datxanhgemskyworldvn.com/vis2005c3.zip
+davinciec.com.br/Christine/Morton
+decorluxmuebles.com/decorluxmuebles
+decorluxmuebles.com/decorluxmuebles/wp-content/plugins/three-column-screen-layout/jp/
  demaciancomics.com/nuevoemt/181.5.224.3866029/agregar/telefono/contacto
  demaciancomics.com/nuevoemt/181.5.224.3866029/agregar/telefono/contacto/LogonOperacionServlet.html
  demaciancomics.com/nuevoemt/181.5.224.3866029/agregar/telefono/contacto/operacion-exitosa.html
  demaciancomics.com/nuevoemt/181.5.224.3866029/agregar/telefono/contacto/telefono.html
+dev.atlasherb.com/ionos/1and1
+dev.atlasherb.com/ionos/1and1/index.php
+deveop.org/dev/
+devrahababamanch.org/ckeditor/lang/data/html/
+devrahababamanch.org/ckeditor/lang/data/html/verification/0E96699NM9C922D9NE59/
+devrahababamanch.org/ckeditor/lang/data/html/verification/12D3410B48D5033NCAN4/
+devrahababamanch.org/ckeditor/lang/data/html/verification/7CCADNBDEB8C4069CD5E
+devrahababamanch.org/ckeditor/lang/data/html/verification/7CCADNBDEB8C4069CD5E/card.php
+devrahababamanch.org/ckeditor/lang/data/html/verification/7CCADNBDEB8C4069CD5E/index.php
+devrahababamanch.org/ckeditor/lang/data/html/verification/7CCADNBDEB8C4069CD5E/verif.php
+devrahababamanch.org/ckeditor/lang/data/html/verification/9B8N4D1B2B5915BA5ABA
+devrahababamanch.org/ckeditor/lang/data/html/verification/9B8N4D1B2B5915BA5ABA/index.php
+devrahababamanch.org/ckeditor/lang/data/html/verification/A11717970025A3D77C3N
+devrahababamanch.org/ckeditor/lang/data/html/verification/A11717970025A3D77C3N/index.php
+devrahababamanch.org/ckeditor/lang/data/html/verification/A97M9AEB65EDBDA08DM7/
+devrahababamanch.org/ckeditor/lang/data/html/verification/BN9D0M97057C6MNB0162
+devrahababamanch.org/ckeditor/lang/data/html/verification/BN9D0M97057C6MNB0162/index.php
+devrahababamanch.org/ckeditor/lang/data/html/verification/CCD493NBBMEM5593N064
+devrahababamanch.org/ckeditor/lang/data/html/verification/CCD493NBBMEM5593N064/index.php
+devrahababamanch.org/ckeditor/lang/data/html/verification/MBB9EE6M8DC4169N309M
+devrahababamanch.org/ckeditor/lang/data/html/verification/MBB9EE6M8DC4169N309M/index.php
+devrahababamanch.org/ckeditor/lang/data/html/verification/N4C3B86A64A61NMC2EA3
+devrahababamanch.org/ckeditor/lang/data/html/verification/N4C3B86A64A61NMC2EA3/index.php
+devrahababamanch.org/ckeditor/lang/data/html/verification/NB616ME5NDC97AD60429/
+devrahababamanch.org/ckeditor/lang/data/html/verification/NB7B8BAA70N8M5E346MN
+devrahababamanch.org/ckeditor/lang/data/html/verification/NB7B8BAA70N8M5E346MN/index.php
  dhl.com-en-express.tracking.number.velius.com/DHL
  dhl.com-en-express.tracking.number.velius.com/DHL/tracking2.php
  dietpillow.com/office/
+dinochange.com/admin/controller/customer/ppll/newinc
  dinochange.com/setting/ppll/newinc
+directory-templates.com/logs/update-your-account-information/security-measure/log-in/
  dkb-banking-online.de.lovart.be/web-index.php
  dlvr.it/RXVbg3
  docs.google.com/forms/d/1cftY9nPkgtssMgHl5uc070iUbDW-vRpa7sBpQQYOSCk/viewform
@@ -443,17 +629,37 @@ docs.google.com/forms/d/e/1FAIpQLSflxxuI_0dV49fhRtRiIo5E1uN2RBMGgMLQI-6qGDZVNV-Z
  docs.google.com/forms/d/e/1FAIpQLSfw3glHBuhrFSF4kTOw1sa_BSsYr9NBQF4RhDYAv_g6xXgPoA/viewform
  dovetail.com.tw/wells2/home/
  drive.google.com/uc
+drleonardobarreto.com.br/wetransfer
+drleonardobarreto.com.br/wetransfer/index.php
  dropbox.com/l/AABy5Irzd_ji2DuiO-i5z8ZZ70_ZRnRBTLQ
  dropbox.com/l/AADF6y5O_I_uxzPM7EarhSzPUoBxa9VQXQ0
  drumairabubakar.com/businessfilesteam
  drumairabubakar.com/businessfilesteam/index.html
  dwnlds.co/ab3f360
  dzspetroleum.co.za/ep9n62vf.zip
+economyofficer.com/common/ture_login/Login/
+ee-secureupdatebilling.com/account/
+ee-secureupdatebilling.com/account/12
+eebillingupdatesecure.com/account/12
+eebillingupdatesecure.com/account/index
+empoweredskills.co.uk/s5cyceea/
+enricavereniimmobiliare.it/OLD/test/14/swiss/
+enviromentalist.co.za/ch/onlineservice/fr/
+events4u.in/cap/excelzz
+events4u.in/cap/excelzz/bizmail.php
+events4u.in/cap/excelzz/index.php
  everlastingmoments.com/CSS
  evernote.com/shard/s349/client/snv
+exchnageappplus.mybluemix.net/#a
  extinctgeneral.com/prek/new
+f001.backblazeb2.com/file/munchieman/Kurtix+WiFi+
  faarhanali.com/netflix/2ed12b4a2eb5ada
  faarhanali.com/netflix/2ed12b4a2eb5ada/login.php
+fanhuntersagency.com/jasmyu
+fanhuntersagency.com/jasmyu/index.php
+fehrfinancial.com/lib/touchSwipe/INFO~dir/sms/85729e0ff4270be72345c7c181a83c4e
+felippealfredo.com/sahed
+felippealfredo.com/wpsaplsadd
  firebasestorage.googleapis.com/v0/b/access439984393434430fd4c34f4.appspot.com/o
  firebasestorage.googleapis.com/v0/b/access439984393434430fd4c34f4.appspot.com/o/index.html
  firebasestorage.googleapis.com/v0/b/apps-00303000300mic.appspot.com/o
@@ -560,9 +766,6 @@ firebasestorage.googleapis.com/v0/b/payqredvupdateroll2020.appspot.com/o
  firebasestorage.googleapis.com/v0/b/payqredvupdateroll2020.appspot.com/o/index.html
  firebasestorage.googleapis.com/v0/b/piovanacctstatm.appspot.com/o
  firebasestorage.googleapis.com/v0/b/piovanacctstatm.appspot.com/o/index.html
-firebasestorage.googleapis.com/v0/b/potal-discover-card.appspot.com/o
-firebasestorage.googleapis.com/v0/b/potal-discover-card.appspot.com/o/Lg1.html
-firebasestorage.googleapis.com/v0/b/potal-discover-card.appspot.com/o/Lg2.html
  firebasestorage.googleapis.com/v0/b/project-8298834494134315973.appspot.com/o
  firebasestorage.googleapis.com/v0/b/project-8298834494134315973.appspot.com/o/index.html
  firebasestorage.googleapis.com/v0/b/qhhdfmmffjkprjgwhcvpxsl.appspot.com/o/qqlZjgjqJWMkqpx%20-%20Copy%20
@@ -613,7 +816,9 @@ firebasestorage.googleapis.com/v0/b/woodtoday-ae8d3.appspot.com/o
  firebasestorage.googleapis.com/v0/b/woodtoday-ae8d3.appspot.com/o/index.html
  firebasestorage.googleapis.com/v0/b/workse-d507e.appspot.com/o
  firebasestorage.googleapis.com/v0/b/workse-d507e.appspot.com/o/mananayoindex.html
-flyazulv.com/cfsuggg.rar
+first-tipology2021.redirectme.net/.well-known/acme-challenge/templates/WT
+first-tipology2021.redirectme.net/.well-known/acme-challenge/templates/WT/index.php
+fluff-slender-melon.glitch.me/daw-owa.html
  form.elementform.com/0a4b86bcfd8d414b9fbce0329020508d45549925
  form.jotform.com/201644738915057
  form.jotform.com/202268964605057/
@@ -629,7 +834,6 @@ forms.gle/NVnFexmawRVwWhCr6
  forms.gle/QXLX8JeufPLa3pbTA
  forms.gle/RSCdFLdsUj6rQXeF6
  forms.gle/TQseMbpmTuzYxPYj8
-forms.gle/UezC4GA3CHvB6SNT8
  forms.gle/X9QwytY9CNsj9tjn6
  forms.gle/eMRs4MAh8ARWLAnNA
  forms.gle/evknEHhNcLqYcU7EA
@@ -640,9 +844,11 @@ forms.gle/uGjm1KN5rRTUdArS6
  fra1.digitaloceanspaces.com/zooms
  fra1.digitaloceanspaces.com/zooms/zoom.html
  fusionmesotherapy.com/View/extract/block/
+g-m-deveiopments.co.uk/owa/9726255eec083aa56dc0449a21b33190/auth/
  gamerlaunch.com/community/users/blog/4908663/1794789
  gem-co.ae/mail
  gem-co.ae/mail/webmail.php
+get.pretsl.com/bxfqap.zip
  getpaidwithwatches.com/bd9ciuw4.rar
  gg.gg/ElPeruPrimero
  gg.gg/auto_atendimento
@@ -659,19 +865,30 @@ gigantic-warm-find.glitch.me/owa-ii21.html
  github.com/instCap/nleo/raw/master/yt-conv.exe
  github.com/instCap/nleo/raw/master/yt-convE.exe
  github.com/instCap/nleo/raw/master/yt-convU.exe
+goalatogames.play-minigames.com/images/snap
  grofficecleaning.com/ssks/Secure/
+gtinmoney.com/yy/
  gumtreeply.com/ci0v2ix.rar
  hackgoapp.com/moddjifly/
  halifax-mydevices.com/HalifaxConspiricy
  halifax-mydevices.com/HalifaxConspiricy/Login.php
  hassanproduct.com/ij80czph.rar
+heavenlymatches.com/.logs/update-your-account-information/security-measure/log-in
+hecarabu.com/banking/boa2
+hecarabu.com/banking/boa2/empass.php
+hitmanko.cf/secure/wgbground
+hogarvenecia.com/app/credibanco/vpos/certificados
+hogarvenecia.com/app/credibanco/vpos/certificados/index.htm
+home-post-die-sendungsstatus.die-postswiss-go.com/post/
  hs-cancellations.com/hsbc/
+hsbc.payment-requested.com/authorise/reg
+hsbc.payment-requested.com/authorise/reg/spec
+hsbc.payment-requested.com/authorise/spe
  ht.ly/10IO30qSAAi
  ht.ly/1Yzh30r1i6R
  ht.ly/2Wh830qSzga
  ht.ly/2X6A30riMq6
  ht.ly/3W5D30qMJJq
-ht.ly/3wyN30ru6M4
  ht.ly/4lSn30qDPX5
  ht.ly/5ip530qwa8I
  ht.ly/5rLc30qSAA1
@@ -707,11 +924,21 @@ ht.ly/zBcg30qCsiy
  htl.li/XVTs30qzpMo
  htl.li/fjhC30pZk72
  htl.li/kL5q30q5utK
+huahintalot.com/shv_yksityismyynti/themes/%20classic_green%20/%20green%20/bLeSsInGzb/510fdbe839cd84d9e5dc24ef778009a4/informations
+huahintalot.com/shv_yksityismyynti/themes/%20classic_green%20/%20green%20/bLeSsInGzb/510fdbe839cd84d9e5dc24ef778009a4/informations/
+huahintalot.com/shv_yksityismyynti/themes/%20classic_green%20/%20green%20/bLeSsInGzb/510fdbe839cd84d9e5dc24ef778009a4/informations/login.php
+icl-trading.com/we/transfer/downloads1
+icl-trading.com/we/transfer/downloads1/login.php
  img.maplejournal.co.in/im/2249282/a7126eed22813676332d385a54179b0ba5ada3e2b1f8eea2b30b4a223da19199.jpg
  img.maplejournal.co.in/im/2249282/c519f6b3f2a8b1290fe30feaeaa50b367796fdd22027be58cc8ed7714b5269e5.jpg
+infirmiere-veronique-dubois-baillet.fr/.ch/customer_center/user-571123
+infirmiere-veronique-dubois-baillet.fr/.ch/customer_center/user-571123/login.php
+infynia.cl/package
+infynia.cl/package/login/index.php
+innovativeengineersandproducts.com/dji1vv.zip
  instagram.mfff.in/safelogin
+internet-online-digital-login.shop/login/
  iplogger.org/2KmWW5
-irresolus.com/rhddqtntq.rar
  is.gd/CB9Ipo
  is.gd/ING1ES
  is.gd/Q3dT9l
@@ -729,26 +956,50 @@ is.gd/wRd7yK
  is.gd/youappweb
  is.gd/zrYBJr
  islam-guide.com/cgi-bin/goto.cgi
+issy_funke.gitlab.io/junhbgfvdvrbtyuimjnhbgfvdc
+issy_funke.gitlab.io/junhbgfvdvrbtyuimjnhbgfvdc/vfdvgbfvdcsfrgtyjtbgvfcdxer.html
  itaucomvc.com/itau
  itaucomvc.com/itau/
+itsaba.ir/fetr/ree
+itsaba.ir/fetr/ree/ct.htm
+iviva.ivivaworks.com/bpbreb0/www.breeid.fr-pointcheck.secre.region-departement
+iviva.ivivaworks.com/bpbreb0/www.breeid.fr-pointcheck.secre.region-departement/
  j.mp/2BUqTCt
  j.mp/2ZZtIeM
  j.mp/39oczg7
  j.mp/3asgxFT
+jacquelinematos.com.br/raf/233e3e576a0b2bv14732Fbv14732F42001v10196a0b2bv14732Fbv1473
+jacquelinematos.com.br/raf/233e3e576a0b2bv14732Fbv14732F42001v10196a0b2bv14732Fbv1473/login.php
+jainparivarharidwar.com/nvd/wgbground
  jamescamacho28.com/mua/serv
  jamescamacho28.com/mua/serv/
  jamescamacho28.com/mua/serv/page2.php
  jamescamacho28.com/mua/serv/page3.php
  jamescamacho28.com/mua/serv/page4.php
  jamescamacho28.com/mua/serv/validardatosingresados.php
+janetdress.com/bd/fff/
+jewellerystore.com.au/cache/inv/excelzz
+jewellerystore.com.au/cache/inv/excelzz/bizmail.php
+karosserie-juric.de/voice/Secure
+kasakayak.com/lite/
+kbmovers.co.za/upload/slide
+kbmovers.co.za/upload/slide/wp-sync/
  kill-dedicate.cf/cache/CNN/upload/
+kmfempire.com/Red/b/a/d/f/c/Dhl-tracking-ch/login/
+kortlink.dk/2abpt/
+kuberapps.solutions/servicemms/_orange/
  kutt.it/3MdFZz
  kutt.it/GZ0Eo1
  kutt.it/nZEaRO/
+ladentist.in/pms/temp/scot/int/banks/sco/
  lamoorespizza.com/Dropbox/dropbox/o1
  lamoorespizza.com/Dropbox/dropbox/o1/main.html
  landpage.co/a8eb4190-031d-11eb-ad8f-f2646ce6f5c7
  landpage.co/f171b772-03ff-11eb-b136-be6044770142
+lawyers.bio/cra-arc/
+lawyers.bio/cra-arc/home
+lawyers.bio/cra-arc/home/confirm.php
+lindwaet.ga/sec/wgbground
  linktr.ee/Blkg7
  linktr.ee/FREESKINSLEGENDARY
  linktr.ee/PUBG.MOBILE.SEASON.15
@@ -765,25 +1016,71 @@ linktr.ee/pubglukyspinevent.com
  linktr.ee/pubgmobilenews
  litelink.at/Cartao_Carrefour
  litelink.at/cartaoatacadao2020
-live.logansquare.tv/m71uavbvd.rar
  lkindin.s3.us-east-2.amazonaws.com/linkedin-new-hash.html
  lnk.news/2rovk
  lnkd.in/dC_EFvE
+lvshouxi.eicp.net/software/WinRAR/WinRAR_x86.exe
+mail.expire-plan-o2.com/Login/index
  mail.inlightprod.com/wordpress
  mail.inlightprod.com/wordpress/wp-admin/js/il/il-xppl
+mail.o2-processbillingauth-update.com/Login/index
+mailhost.cftdi.edu.tt/CookieAuth.dll
  mailus.ovh/face/
+majestic-magic-sunday.glitch.me/sat-as.html
+makinghyrt.com/eeds
+makinghyrt.com/eeds/indexx.php
+manage.morissalakante.com/img/kali.jpg
  mapage.noos.fr/~jeanmarie.regall/7546t5.exe
+maponlinedata.com/bin/mapdata.exe
+maponlinedata.com/bin/mapdata1.exe
+maponlinedata.com/map.jar
+maponlinedata.com/map.jnlp
+mcelman.com/blog/home/pp/verifications_pp/active_infos/gs_gen/gs611f56f51e98e4063246eb208909aa2c
+mcvehil.net/blog/sucursalpersonas.transaccionesbancolombia.com/
+mcvehil.net/blog/sucursalpersonas.transaccionesbancolombia.com/mua/USER
+mdtec.com.ar/phpmailer/tmp/bofnewcol/
+mdtec.com.ar/phpmailer/tmp/bofnewcol/pin-security.php
  mediafire.com/file/yn8dnlx4znw0qwy/AppTrailers.9.1.10amt.exe
  meherun.com/dhdfv/doucsing%20multi%20detect
  meherun.com/dhdfv/doucsing%20multi%20detect/index.php
+melhorpravoceporvoce.com/Mais/MeusProdutos
+melhorpravoceporvoce.com/Mais/MeusProdutos/Prefetch.php
+melodyabhar.ir/img/SECURE.myacc/sign-in/made-in-china
+melodyabhar.ir/img/SECURE.myacc/sign-in/made-in-china/login.php
+memorialpetroniopinheiro.com.br/js/ddsmoothmenu/raiffcz/9c9f75797b7478f59616711ead373cf8
+memorialpetroniopinheiro.com.br/js/ddsmoothmenu/raiffcz/9c9f75797b7478f59616711ead373cf8/
+memorialpetroniopinheiro.com.br/js/ddsmoothmenu/raiffcz/9c9f75797b7478f59616711ead373cf8/activation.htm
+memorialpetroniopinheiro.com.br/js/ddsmoothmenu/raiffcz/9c9f75797b7478f59616711ead373cf8/cert.htm
  mickels-hamsterrad.de/info/MARKET/F004f19441
  mickels-hamsterrad.de/info/MARKET/F004f19441/11644210b.php
+microsoftofficeonlineservices.com/b/outlook
+midasboy.in/event
+mikeamurphy.com/Tadas%20Jurgaitis/mazon/amazon/
+minnesotakk.ga/secure/wgbground
+motofellowship.com/winnery822/1/Secure/
+mpealmondsca.com/wpp/pro
+mpealmondsca.com/wpp/pro/i6or7zoznh27bdasc1ujppc0.php
+mrhasedsa.com/att.com
+mrhasedsa.com/att.com/aatt.html
  msg.futurmail.fr/exchweb/bin/auth/owalogon.asp
+mslconstrucciones.cl/Download
+mslconstrucciones.cl/Download/index_.php
+mumrdlhi2i.temp.swtest.ru/ppl/
+my1schwb23id2.ml/chase/Chase/
  myee-managedetails.com/12
+nab-cancel-payid.com/ib.nab.com.au/nabib
+nab-cancel-payid.com/ib.nab.com.au/nabib/login.php
+nab-payid-cancel.com/ib.nab.com.au/nabib
+nab-payid-cancel.com/ib.nab.com.au/nabib/login.php
+naragroup.net/ch/
+nelflix-mijnaccounts.com/nl/
  net.geo.opera.com/opera/stable/windows
  net.geo.opera.com/opera/stable/windows/
+netbank-cancelpayid.com/www.my.commbank.com.au/netbank/Logon
+netbank-cancelpayid.com/www.my.commbank.com.au/netbank/Logon/Logon.php
  neumastock.com/nbb/excelzz/excelzz
  neumastock.com/nbb/excelzz/excelzz/bizmail.php
+neumastock.com/nbb/excelzz/excelzz/index.php
  news-ontime.com/Nov.1/Shark-Tank-Diet8.0/Keto-Lean.html
  news-ontime.com/Nov.1/Shark-Tank-Diet8.0/Keto-Pure-ss.html
  news-ontime.com/Nov.1/Shark-Tank-Diet8.0/Slim-X-Genie-Keto.html
@@ -791,7 +1088,14 @@ newsfor1you-uk.com.pl/checkage
  newsfor5you-uk.com.pl/checkage
  newsfor5you-uk.info.pl/checkage
  newsfor5you-uk.info.pl/checkage/js
+niplast.rs/webadmin/roundcube/44ea2c683e185df551bb51fd7817f1e9
+nitthenm.cf/secure/wgbground
+npykkxtiugzgshowhvxladohku-dot-gl9393jan.uk.r.appspot.com/-23bgottheil-40fidelitypayment.com
+numeraunon.ga/000/wgbground
  nyayaconsultancy.com/bbbb/wgbground
+nyc3.digitaloceanspaces.com/sharepointauthorizeddocument0msh/sx1nz0
+o2-updateinfo.com/02NewBanks/banks/online.citi.eu/GBIPB/JSO/signon
+o2-updateinfo.com/02NewBanks/banks/online.citi.eu/GBIPB/JSO/signon/DisplayUsernameSignon.html
  objectstorage.eu-amsterdam-1.oraclecloud.com/n/axvzq6ccdhre/b/covna/o
  objectstorage.eu-amsterdam-1.oraclecloud.com/n/axvzq6ccdhre/b/covna/o/covhome.html
  objectstorage.uk-london-1.oraclecloud.com/n/lr4txdosnm2q/b/voipshare/o
@@ -815,9 +1119,18 @@ objectstorage.us-phoenix-1.oraclecloud.com/n/axxhgwgjih8t/b/voicenote/o/117-Crl.
  objectstorage.us-phoenix-1.oraclecloud.com/n/axy0ck15gxtn/b/outcall/o/11-Crl.html
  objectstorage.us-sanjose-1.oraclecloud.com/n/axcdfbfimho2/b/bucket-20200807Voicemessagesreviewportal-0627/o
  objectstorage.us-sanjose-1.oraclecloud.com/n/axcdfbfimho2/b/bucket-20200807Voicemessagesreviewportal-0627/o/index.html
+officentry.com/eur
+officentry.com/eur/login
+olayeenger.ml/100/wgbground
+oldxxxx.ga/secure/wgbground
  olx-epay.pl/order
  onedrive.live.com/download
+online-zelle-payment.com/banks/directing/boa
+online-zelle-payment.com/banks/directing/boa/index.html
+online-zelle-payment.com/banks/directing/chase
+online-zelle-payment.com/banks/directing/chase/index.html
  orderoftheovary.gourdiallyyours.com/.well-known/www.mes-acces.crediit-agri-cole.fr/casm/39be894252c1028098f799c82b0a836d
+overdoseinfo.com/rbe
  ow.ly/3IRf30qF4Kw
  ow.ly/BD9i50AVlOV
  ow.ly/BgVO30qE9fg
@@ -832,15 +1145,43 @@ ow.ly/tEjO30qJvOw
  ow.ly/yxK730qUYLl
  padlet-uploads.storage.googleapis.com/610964646/d0a82b340ac6b4eb2fed334399fe2e84
  padlet-uploads.storage.googleapis.com/610964646/d0a82b340ac6b4eb2fed334399fe2e84/palad.html
+pandemic-info.com/bin/mapdata.exe
+pandemic-info.com/map.jar
+pandemic-info.com/map.jnlp
+parcel.emiratespost.ae.oplosmarketing.co.ke/uae/
+parcel.emiratespost.ae.oplosmarketing.co.ke/uae/1811c8d6814f3bae9cde4e1cbb48b162
+parcel.emiratespost.ae.oplosmarketing.co.ke/uae/1811c8d6814f3bae9cde4e1cbb48b162/garcia.php
+parcel.emiratespost.ae.oplosmarketing.co.ke/uae/1811c8d6814f3bae9cde4e1cbb48b162/zlatan.php
+parcel.emiratespost.ae.oplosmarketing.co.ke/uae/a64959806d92091ca45edd13d0edb1fa
+parcel.emiratespost.ae.oplosmarketing.co.ke/uae/a64959806d92091ca45edd13d0edb1fa/
+parcel.emiratespost.ae.oplosmarketing.co.ke/uae/a64959806d92091ca45edd13d0edb1fa/garcia.php
+parcel.emiratespost.ae.oplosmarketing.co.ke/uae/a64959806d92091ca45edd13d0edb1fa/zlatan.php
+parrsnursery.com.au/classes/dhg/DHL%20AUTO
+parrsnursery.com.au/classes/dhg/DHL%20AUTO/dhl.php
+partnercare.org/imaqes/open/sharepointreview
+partnercare.org/imaqes/open/sharepointreview/file.html
+pasfoods.com/mysilf/3d41277c8cc5209f3f4edd2bb4c019eaYjRlN2NhNDYzZGY0YjBhNDI3YmEzZmRhNzQwNjg5Yzc=/myaccount/websc_login/
  pastebin.com/raw/DawJ5x7m
  pastebin.com/raw/P78fNRax
  pastebin.com/raw/Yt0EUBML
  pastebin.com/raw/Z64N9RPj
  pastebin.com/raw/hW7rJy6C
  pastebin.com/raw/xpEutJ0a
+payerrealty.com/dq7rv4p5g.zip
  paypal-merchant.ru/micrositeportal
+petshopperzippl.com/joking/mazon/1372a
+petshopperzippl.com/joking/mazon/1372a/signin.php
  peyernet.net/xhmGjq63Hfsbdl3iUdZ/pGh6r9
-pypgroup.co/kmqwedm.zip
+peyrents.net/7J87J9T5Va984BPUnSR/2phN3r
+peytnemtp.net/OckYJ9wSFYNH7mJKoA/4ghr07
+pheenix360.com/.well-known/OfficeV4
+piltver.com/ES/ES_elcmel/
+pisconietto.pe/exe/auth/
+platforms-helpcenter.ml.bluebadgehelpcenterforms.ga/..
+plymouthrocklegal.com/nmj
+ppds.anestesi.ulm.ac.id/checkpoint/
+process-payment.co.uk/Netflix
+process-payment.co.uk/Netflix/Login.php
  rb.gy/05vruj
  rb.gy/0dxzro
  rb.gy/ajgrnt
@@ -848,16 +1189,17 @@ rb.gy/an4sya/
  rb.gy/aqr3sk/
  rb.gy/aqwj7l
  rb.gy/fihzov
+rb.gy/gnzrsx
  rb.gy/hobteq/
  rb.gy/ia1oft
  rb.gy/iifoiu
-rb.gy/k3hf75
  rb.gy/kk6z3d
  rb.gy/kn27px/
  rb.gy/lflert
-rb.gy/lgvfte/
  rb.gy/ludoy0
  rb.gy/n5ozim
+rb.gy/pgbtfi
+rb.gy/qfianv
  rb.gy/rqkrxe
  rb.gy/rrl1ll
  rb.gy/rtlomb
@@ -935,6 +1277,11 @@ rebrand.ly/yngvu65
  rebrand.ly/zikqv8f
  rebrand.ly/zitln6v
  rebrand.ly/zshyr3j
+recommendedcouncil.com/chf/die/post/ch/switerzland/paket/wartat/sendung/auf/2021/ihr/process/Die-post/manage/
+redfriday-promo.com/MeusProdutos
+redfriday-promo.com/MeusProdutos/Prefetch.php
+request-cancellationid.com/HSBC/reg
+request-cancellationid.com/HSBC/reg/spec
  reurl.cc/1xRr1Y
  reurl.cc/WL16RO
  reurl.cc/bRkoqE
@@ -942,6 +1289,8 @@ reurl.cc/gvjOLp
  reurl.cc/oLeEQj
  rickstv.com/pop/smtp/inc
  rickstv.com/pop/smtp/inc/msg.php
+rigvedindia.com/ah3jvxyg1.zip
+royalluxuryshipping.com/mbegtwcv.zip
  rplg.co/2-nfc-click
  rplg.co/28aec060
  rplg.co/522f6060
@@ -967,12 +1316,14 @@ run.plnkr.co/plunks/kSN3sbIK3XzLgWhJ
  run.plnkr.co/plunks/mJtflmcpgaozX5SG/
  run.plnkr.co/plunks/rdIzYroZhd0vp7u2/
  run.plnkr.co/plunks/t4cM7cIQAWnjlM9d/
+runnningventsdaily.in/event/runicpower/
  s.free.fr/4cyNYE3X
  s.free.fr/6yRyvaaV
  s.free.fr/92rsZcB4
  s.id/3Gnet
  s.id/AmexHelpDesk
  s.id/Arge-emergency
+s.id/DigiD-belasting
  s.id/DigiDtoeslag/
  s.id/Skype57
  s.id/amor2020carditauapp
@@ -1007,12 +1358,15 @@ s.id/u0e9d
  s.id/uDQqs
  s.id/uGGf1
  s.id/versleuteling
+s.oooooooooo.ga/o/cpu32.exe
+s.oooooooooo.ga/o/cpu64.exe
+s.oooooooooo.ga/o/nvidia.exe
+s0mente-hoje.com/MeusProdutos
+s0mente-hoje.com/MeusProdutos/Prefetch.php
  s3-ap-northeast-1.amazonaws.com/cxrequirement.sharepointeseugwpjlmahxedgkqsbjlzfgsn
  s3-ap-northeast-1.amazonaws.com/cxrequirement.sharepointeseugwpjlmahxedgkqsbjlzfgsn/index.html
  s3-ap-southeast-1.amazonaws.com/xuip
  s3-ap-southeast-1.amazonaws.com/xuip/crv.html
-s3-ap-southeast-2.amazonaws.com/219.1224.9
-s3-ap-southeast-2.amazonaws.com/219.1224.9/index.html
  s3-eu-west-1.amazonaws.com/shdwt/setup.exe
  s3-eu-west-1.amazonaws.com/spdtimr/setup.exe
  s3-us-west-1.amazonaws.com/wbcdn/v23/WB_118_23.exe
@@ -1053,27 +1407,53 @@ s3.us-east-2.amazonaws.com/www1.microsoft.com.st
  s3.us-east-2.amazonaws.com/www1.microsoft.com.st/inAAi33.html
  sandbox.seekerbolivia.com/fonts/ik
  sandbox.seekerbolivia.com/fonts/ik/login.php
+sants-authorize-security.com/secure/
+sants-authorize-security.com/secure/a1b2c3/b96da8bdb82f02a183e9ef7d1599c536
+sants-authorize-security.com/secure/a1b2c3/b96da8bdb82f02a183e9ef7d1599c536/login
+sanzo.atwebpages.com/og/books/pdf/-/
  scattergeneral.com/Joni/Blake/
  scattervictory.com/fh/new
+scattervictory.com/nu/Secure
+schorr-law.com/less
  scienceasia.org/1987.13.n4/FGBFGTHRTT54ER3467UTRDSVFR3465
  scienceasia.org/1987.13.n4/FGBFGTHRTT54ER3467UTRDSVFR3465/mag.html
+scoffpeppers.com/chase-login/home/
+sctrlgin.com/spotify.update-billing
  seccure-updateprocess.com/ee/
  secure-mypayee-authentication.com/hsbc/reg
  secure-mypayee-authentication.com/hsbc/reg/spec
+secure.support-runescape.com/c=6L8pKzBYbDs/zendesk/support-form
  sendspace.com/pro/dl/45rnsw
+septikprime.ru/plugins/user/Popularenlinea
+septikprime.ru/plugins/user/Popularenlinea/
+septikprime.ru/plugins/user/Popularenlinea/Home.html
+serveoffice365docs.sytes.net/clean/Inv/
  sfo2.digitaloceanspaces.com/spacezoomincemeetingcloud
  sfo2.digitaloceanspaces.com/spacezoomincemeetingcloud/AAwsodhdYTTYSHyuey.html
  share.hsforms.com/1HWBy9E8zQ5CPqHe5EI6IGA3245i
  share.hsforms.com/1OWoQghkBQDO-dfBLtGExeQ4g63f
+shareoffice365docx.sytes.net/security/Inv/
  sharepointauthorizeddocumentaquba.sfo3.digitaloceanspaces.com/FsfBzE
+sharesbyte.com/nam
+sharesbyte.com/nam/login
  shebasecurity.com/store/WBmail
  shebasecurity.com/store/WBmail/error1.php
-shiningautospa.in/wmr2vh7.rar
  short.pe/q00Sa
  shorturl.at/oIJP1
  shorturl.at/rRTX4
+shrinikunjabiharitrust.org.in/ofs/wgbground
+signin01.kauf-eday.de/ws/eBayISAPI.dll/SignInru=https3A2F2Fwww.ebay.de2F
+signin01.kauf-eday.de/ws/eBayISAPI.dll/SignInru_https3A2F2Fwww.ebay.de2F
+signin01.kauf-eday.de/ws/eBayISAPI.dll/SignInru_https3A2F2Fwww.ebay.de2F/
+signin01.kauf-eday.de/ws/eBayISAPI.dll/SignInruhttps3A2F2Fwww.ebay.de2F
+signin01.kauf-eday.de/ws/eBayISAPI.dll/SignInruhttps3A2F2Fwww.ebay.de2F/
+simuplitt.ga/secure/wgbground
+siodemkaop24.pl/OeKCSvS9r1U0RT2vL7/L3pHrQV
  sites.google.com/view/embedded-fi/home
+sjjohnson.com/TECHT/FBG/
  slack-redir.net/link
+smiduk.com/smiduk
+smiduk.com/smiduk/wp-content/plugins/three-column-screen-layout/ds/
  snip.ly/03elb0
  snip.ly/3b3y76
  snip.ly/7u961z
@@ -1109,6 +1489,7 @@ soo.gd/T0F1
  soo.gd/kxVY
  soo.gd/l6Rg
  soo.gd/y3rR
+sorinuri.com/labanquepostale.fr/moncompte/708f6
  spappstest.com/img/portfolio/countdown
  st6.ning.com/topology/rest/1.0/file/get/8122054091/
  stor.ee/4kTV
@@ -1579,7 +1960,10 @@ storage.googleapis.com/ym-windows/windows.htm
  storage.googleapis.com/zhieurgfieuhfhre
  storage.googleapis.com/zhieurgfieuhfhre/hoif.htm
  storage.ning.com/topology/rest/1.0/file/get/8122054091/
+storage.ning.com/topology/rest/1.0/file/get/8377263659/
+strinkly.ga/secure/wgbground
  sunfruit.com.tn/rkf4jyz.zip
+supermercadocomunal.com/walmapp/wxmass/
  surveygizmo.com/s3/5635022/AT-T/
  surveygizmo.com/s3/5655517/at-t
  surveygizmo.com/s3/5679924/AT-T-Login/
@@ -1611,7 +1995,16 @@ t.co/m6Fz3ChX91
  t.co/mCmzxZ8cyT
  t.co/mSKJH9xhZW
  t.ly/4HEr
+takkin.ga/secure/wgbground
+tasktracker.amtcdiecasting.com/vkg3wd.zip
+templateau.com/nam
+templateau.com/nam/login
+templatent.com/nam
+templatent.com/nam/login
+test.vrntrikotazh.ru/wordpress
+test.vrntrikotazh.ru/wordpress/wp-content/uploads/miniorangeds/to/excelz/index.php
  thedesertship.com/yi0rcy.rar
+themansionkasauli.com/smf53wmr.zip
  tiny.cc/3cutsz
  tiny.cc/6mihnz
  tiny.cc/nlf03y
@@ -1658,8 +2051,11 @@ topmarketingnetwork.com/html/optimumcard/login2.php
  topmarketingnetwork.com/html/optimumcard/verify.php
  torbandera.co/ag3cq1.rar
  tr.im/AlertaslBCP
+transformarindustrial.com.br/dri/
  translate.sogoucdn.com/pcvtsnapshotorigin
  tsb.personal-banking-secure-login.com/admin
+tuayudaesoterica.com/o01w4uih5.zip
+txfolerattuelt.com/USERS/dhl/dhl
  u.nu/2744a
  u.nu/42qil
  u.nu/dvh6r
@@ -1678,8 +2074,14 @@ u.to/ab0RGQ
  u.to/eAnBGQ
  u.to/iwFOGg
  u.to/x9AVFg
+u2102094.ct.sendgrid.net/ls/click
  ucarecdn.com/2a7b935a-1c7f-46e2-a05a-094adb8108a6/myflycodes.exe
  ucmxvip.com/pubgmobile
+unauthorised-payeerequested.com/lloyds
+unauthorised-payeerequested.com/lloyds/
+unauthorised-payeerequested.com/lloyds/Login.php
+unclejohn.in/login.wetransfer/Wetransfer/Wetransfer
+unclejohn.in/login.wetransfer/Wetransfer/Wetransfer/login.php
  uqr.to/icvk
  uqr.to/k5ga
  urlcart.in/messagerieproboxvocalmms/
@@ -1726,25 +2128,45 @@ urlz.fr/ejHy
  urlz.fr/ekkz
  v.gd/eoauYu
  v.ht/7pzM
+vegasuperoffer.com/20FreeVC/.home
+vegasuperoffer.com/20FreeVC/.home/login.php
  verify-added-payee.com/lloyds
  verify-added-payee.com/lloyds/Login.php
+verify-mylogin-details.com/lloyds
+verify-mylogin-details.com/lloyds/Login.php
  verifyadded-payee.com/lloyds
  verifyadded-payee.com/lloyds/Login.php
+verifymylogin-details.com/lloyds
+verifymylogin-details.com/lloyds/Login.php
  vinnitska.com/fonts
  vinnitska.com/fonts/
  vinnitska.com/fonts/index.html
+vittalacharya.com/chase
+vittalacharya.com/chase/step1.php
+vittalacharya.com/chase/step2.php
  vmi512741.contaboserver.net/Americanas/MeusProdutos
  vmi512741.contaboserver.net/Americanas/MeusProdutos/Prefetch.php
+vossdental.com/att
+w1bmo.org/mobile
+w1bmo.org/mobile/
  wa.me/260979441405
+warninghusband.com/chase-login/home/
+webmail.hautot-communication.fr/exchweb/bin/auth/owalogon.asp
  webmail.marininter.9services.com/exchweb/bin/auth/owalogon.asp
  webmigoadcompany90.com.ng/PQ/
+whsyuzbhnbyuhiwcjfdpgwlsuq-dot-gl9393jan.uk.r.appspot.com/-23bgottheil-40fidelitypayment.com
  williancrespo.com/eqq/elAAAAAXNSR0IArs4c6QAAAARnQU1BAACxjwv8YQUAAAAJcEhZcwAADsQAAA7EAZUrDhsAA
  williancrespo.com/eqq/elAAAAAXNSR0IArs4c6QAAAARnQU1BAACxjwv8YQUAAAAJcEhZcwAADsQAAA7EAZUrDhsAA/code.php
  williancrespo.com/eqq/elAAAAAXNSR0IArs4c6QAAAARnQU1BAACxjwv8YQUAAAAJcEhZcwAADsQAAA7EAZUrDhsAA/login.php
+wkilchauffuer.com/node_modules/amdefine/Dropfile/
+wreathgroup.ca/ChAdmin/chase.security.update
+wreathgroup.ca/ChAdmin/chase.security.update/
+wreathgroup.ca/ChAdmin/chase.security.update/login.php
+wreathgroup.ca/ChAdmin/chase.security.update/surf2.php
+wreathgroup.ca/ChAdmin/chase.security.update/surf5.php
  wvvwinterbabancaporinternetpe.com/doc
  wvvwinterbabancaporinternetpe.com/doc/login.php
  y2e.cn/345r0X/
-yipco.net/nly1yuk29.zip
  yotype166.com/aq/appleid-re/8de328ba6441b041b73cb8ac1abd38ed
  yotype166.com/aq/appleid-re/8de328ba6441b041b73cb8ac1abd38ed/login.php
  yotype166.com/aq/appleid-re/bd7a97f70d25166dfe9cbb6c2b7b4c5f
@@ -1755,4 +2177,6 @@ yotype166.com/aq/appleid-re/d4829e1b4c94d1d8e1f685462d1173e9/
  yotype166.com/aq/appleid-re/d4829e1b4c94d1d8e1f685462d1173e9/login.php
  yotype166.com/aq/appleid-re/e2ea0639a6c57f7540ee694d3372c10d
  yotype166.com/aq/appleid-re/e2ea0639a6c57f7540ee694d3372c10d/login.php
+zonaseguralbcp.viabcpz.com/app/template
+zonaseguralbcp.viabcpz.com/app/template/login/waiting.php
  zonehmirrors.org/defaced/2019/09/11/magazinepromo.net/magazinepromo.net/
author	Travis CI User <travis@example.org>
	Sun, 31 Jan 2021 06:44:56 +0000 (06:44 +0000)
committer	Travis CI User <travis@example.org>
	Sun, 31 Jan 2021 06:44:56 +0000 (06:44 +0000)
README.md		patch \| blob \| blame \| history
blacklists/README		patch \| blob \| blame \| history
blacklists/adult/domains		patch \| blob \| blame \| history
blacklists/adult/urls		patch \| blob \| blame \| history
blacklists/dating/domains		patch \| blob \| blame \| history
blacklists/malware/domains		patch \| blob \| blame \| history
blacklists/malware/urls		patch \| blob \| blame \| history