Automatic blacklist update

author Travis CI User <travis@example.org>

Thu, 17 Dec 2020 04:52:49 +0000 (04:52 +0000)

committer Travis CI User <travis@example.org>

Thu, 17 Dec 2020 04:52:49 +0000 (04:52 +0000)
author Travis CI User <travis@example.org>
Thu, 17 Dec 2020 04:52:49 +0000 (04:52 +0000)
committer Travis CI User <travis@example.org>
Thu, 17 Dec 2020 04:52:49 +0000 (04:52 +0000)
diff --git a/README.md b/README.md

index e9c5b36cef55a013cfd1b28cb6e4abb77a868c29..4caef64f22d88b31c5b6909dfb68d4e13faf2884 100644 (file)
--- a/README.md
+++ b/README.md
@@ -6,7 +6,7 @@ __Note__: this repository is only intended to mirror lists, to modify/update the
  ## Lists
  | Name | Size | Description |
  |:-----|:-----|:------------|
-| [adult](blacklists/adult) | 2533934 | Some adult site from erotic to hard pornography |
+| [adult](blacklists/adult) | 2533942 | Some adult site from erotic to hard pornography |
  | [agressif](blacklists/agressif) | 384 | Some aggressive sites |
  | [arjel](blacklists/arjel) | 69 | ARJEL which is a french certification authority for gambling sites |
  | [associations_religieuses](blacklists/associations_religieuses) | 1 | religious_association |
@@ -38,7 +38,7 @@ __Note__: this repository is only intended to mirror lists, to modify/update the
  | [jobsearch](blacklists/jobsearch) | 386 | Site to looking for job |
  | [lingerie](blacklists/lingerie) | 83 | Sites for lingerie |
  | [liste_bu](blacklists/liste_bu) | 2881 | A french list for educational sites. VERY locally oriented. may help libraries |
-| [malware](blacklists/malware) | 305147 | Any website which deliver malware |
+| [malware](blacklists/malware) | 286494 | Any website which deliver malware |
  | [manga](blacklists/manga) | 755 | Any website related to manga, and cartoons |
  | [marketingware](blacklists/marketingware) | 28 | Very special marketing sites |
  | [mixed_adult](blacklists/mixed_adult) | 152 | Websites which contains adult sections unstructured |
diff --git a/blacklists/README b/blacklists/README

index 91c7cec2d3bfe65284f6b052cb31d1e154bb2ff3..9f8efe934c08d7277f17c1a8855100f1b9edf16b 100644 (file)
--- a/blacklists/README
+++ b/blacklists/README
@@ -41,7 +41,7 @@ adult.tar.gz          is a list of adult sites. They are based on
                                          Symon Aked
                                          Todd Sieland-Peterson
  
-Last version Tuesday 15 December 2020 with 2466179 domains and 67796 urls : 11024 Kb.
+Last version Wednesday 16 December 2020 with 2466162 domains and 67794 urls : 11024 Kb.
                         
  
  OTHER :
diff --git a/blacklists/adult/domains b/blacklists/adult/domains

index 1e08ce1bd1033b21f91cf1fe557c6216291df861..54cdf1ef70e46390a62e8473a4da5f733c64963b 100644 (file)
--- a/blacklists/adult/domains
+++ b/blacklists/adult/domains
@@ -1246254,6 +1246254,7 @@ intiemcontact.com
  intieme-massage.nl
  intiemedate.nl
  intiemesexdate.nl
+intifilms.be
  intightjeans.com
  intights.net
  intill.blogspot.ae
@@ -1878986,6 +1878987,7 @@ rosenheimladies.de
  rosenudelegs.tumblr.com
  rosenvii.tumblr.com
  rosepoetry.tumblr.com
+rosepourlesgarcons.blogspot.com
  roseprincessblossoms.tumblr.com
  rosepulp.tumblr.com
  rosered-ruby.tumblr.com
@@ -2466139,3 +2466141,7 @@ xxx
  porn
  sex
  adult
+xxx
+porn
+sex
+adult
diff --git a/blacklists/adult/urls b/blacklists/adult/urls

index 0da4ad063c3724b7a1187126719c97404d110eae..afd680bc04bf30067beb0c9ffb9cdd123337119e 100644 (file)
--- a/blacklists/adult/urls
+++ b/blacklists/adult/urls
@@ -28150,6 +28150,7 @@ goriya.com/adult
  gospelbody.blogspot.com/2019
  gospelbody.blogspot.com/2020/01
  gospelbody.blogspot.com/2020/02
+gospelbody.blogspot.com/2020/03
  gospelbody.blogspot.com/2020/05
  gossamer-threads.com/lists/python/python/94229
  gossamer-threads.com/scripts/resources/DBMan/Sites_In_Action/XXX_Adult
@@ -65846,6 +65847,7 @@ whrt.it/13ErDzc
  whtemassathings.tumblr.com/post/72382813025/get-on-your-fucking-knees-nigger-boy-and-crawl
  whuuwit.tumblr.com/post/106253677575/blkowner-robertjjj-dammmmmm-baby-sexy
  whuuwit.tumblr.com/post/133556126750/covery44-sexy
+whymeu23384.blogspot.com/2007
  whysothick.tumblr.com/post/20556912120/sucked-and-fucked
  whyuhaten.tumblr.com/post/85566816466/do-you-know-any-good-beastiality-porn-sites
  wiabt.com/black_teens_lesbian/
diff --git a/blacklists/malware/domains b/blacklists/malware/domains

index 610f6f2e99504336feff71b5cfec304a47d22521..71fff1e7694454d9fed2abee55a3c2107d5cb2cf 100644 (file)
--- a/blacklists/malware/domains
+++ b/blacklists/malware/domains
@@ -11,7 +11,6 @@
  0.7.0.1
  0.8.2.2
  0.8.88.88
-0.9.2.1
  0.9.99.99
  0.laomaotaowinpe.com
  0.m13a.serveirc.com
@@ -207,7 +206,6 @@
  03qyrhn02secure.000webhostapp.com
  03return-ref.com
  03ssrd3334phd00p4sh0s33drcorequemenxxkjw3450w1jklsha.s3-ap-southeast-1.amazonaws.com
-03t.top
  04040-dot-bles05.wn.r.appspot.com
  0408604b-eef9-4c49-94c6-9f8bfdd5f7bf.htmlcomponentservice.com
  0416299399401.z13.web.core.windows.net
@@ -477,27 +475,23 @@
  1.0.133.100
  1.0.133.84
  1.0.133.89
-1.0.134.100
  1.0.134.105
-1.0.134.111
-1.0.134.113
-1.0.134.155
  1.0.134.30
  1.0.135.140
  1.0.144.106
  1.0.146.150
+1.0.148.159
+1.0.152.69
  1.0.155.227
  1.0.155.254
  1.0.157.67
-1.0.161.216
  1.0.162.118
  1.0.162.185
  1.0.162.236
  1.0.163.237
  1.0.163.9
-1.0.180.235
+1.0.177.78
  1.0.181.34
-1.0.182.119
  1.0.183.106
  1.0.186.26
  1.0.189.254
@@ -506,38 +500,35 @@
  1.0.209.152
  1.0.213.40
  1.0.214.159
-1.0.219.197
  1.0.219.37
-1.0.220.73
  1.0.228.190
  1.0.230.50
  1.0.232.36
+1.0.238.81
  1.0.247.22
+1.0.247.90
  1.0.251.26
  1.1.128.161
-1.1.139.28
-1.1.153.180
+1.1.162.154
  1.1.164.63
+1.1.186.106
  1.1.187.218
  1.1.194.253
+1.1.195.117
  1.1.201.185
  1.1.202.132
  1.1.206.192
-1.1.223.88
  1.1.224.64
  1.1.227.251
  1.1.228.221
-1.1.228.36
-1.1.233.205
-1.1.247.120
  1.1.251.221
  1.10.140.43
  1.10.146.148
  1.10.146.31
+1.10.147.64
  1.10.152.185
  1.10.163.190
  1.10.163.208
-1.10.184.139
  1.10.185.135
  1.10.186.114
  1.10.186.167
@@ -550,56 +541,48 @@
  1.10.188.202
  1.10.188.93
  1.10.189.107
-1.10.189.126
  1.10.189.156
  1.10.189.84
  1.10.231.179
+1.10.233.27
  1.10.237.120
+1.10.242.9
  1.10.246.179
  1.11.201.18
-1.11.234.99
  1.119.129.17
  1.119.131.102
-1.119.132.249
  1.119.153.110
-1.119.182.26
-1.119.44.11
+1.119.5.162
  1.122.234.70
  1.122.64.110
+1.129.29.101
+1.129.29.165
  1.129.29.168
  1.129.29.170
  1.129.29.194
  1.129.29.217
+1.129.29.231
+1.129.29.234
  1.129.29.84
+1.129.29.91
  1.129.29.99
-1.157.103.85
-1.160.22.15
-1.160.72.5
+1.144.111.6
+1.144.17.144
+1.144.20.112
+1.161.167.5
  1.161.201.248
-1.161.240.188
  1.161.242.137
  1.162.192.117
-1.162.226.109
-1.163.46.155
  1.164.48.201
+1.164.53.231
  1.164.97.194
-1.165.129.170
-1.165.14.193
-1.165.145.203
-1.165.170.7
  1.165.181.69
  1.165.182.50
-1.165.65.198
-1.168.238.13
-1.168.45.230
  1.170.183.146
-1.170.76.6
-1.171.146.129
+1.171.144.2
  1.171.150.221
-1.171.154.153
  1.171.195.111
  1.171.29.99
-1.171.60.39
  1.17110.com
  1.172.105.154
  1.172.106.77
@@ -607,33 +590,23 @@
  1.172.172.206
  1.173.102.155
  1.173.104.79
-1.173.163.184
+1.173.122.59
  1.173.68.80
  1.173.98.50
  1.174.11.223
  1.174.137.81
  1.174.198.18
-1.174.5.36
-1.174.7.182
  1.175.139.9
-1.175.155.152
-1.175.163.102
  1.175.45.212
  1.175.78.213
  1.175.87.3
  1.175.93.143
-1.177.162.2
-1.179.128.124
  1.179.137.10
  1.179.144.181
  1.179.147.5
  1.179.148.9
-1.179.153.18
-1.179.169.218
-1.179.172.153
  1.179.172.45
  1.179.173.114
-1.179.173.2
  1.179.176.37
  1.179.180.98
  1.179.181.149
@@ -645,10 +618,7 @@
  1.179.198.226
  1.179.201.153
  1.179.246.244
-1.179.247.182
-1.180.51.36
-1.180.89.186
-1.181.46.238
+1.186.151.219
  1.186.242.12
  1.186.248.136
  1.186.248.30
@@ -659,44 +629,30 @@
  1.186.57.150
  1.186.63.133
  1.188.148.244
-1.188.251.201
-1.189.63.88
-1.189.88.66
-1.189.88.67
-1.189.88.68
-1.189.88.69
-1.189.88.70
-1.190.217.200
-1.192.131.153
-1.192.145.246
+1.190.22.204
  1.192.147.48
  1.192.216.217
-1.192.218.179
-1.192.90.228
  1.192.94.61
  1.193.160.164
-1.193.59.239
  1.194.238.187
  1.194.238.226
  1.196.152.217
+1.197.113.130
  1.197.162.194
  1.197.204.182
  1.197.32.10
-1.197.79.3
  1.198.72.233
-1.199.139.24
+1.2.158.141
  1.2.169.101
  1.2.169.49
  1.2.169.8
  1.2.169.81
+1.2.170.139
  1.2.182.121
  1.2.182.138
  1.2.182.229
  1.2.182.68
-1.2.186.75
-1.2.188.182
  1.2.194.171
-1.2.194.36
  1.2.195.116
  1.2.195.76
  1.2.196.247
@@ -708,43 +664,32 @@
  1.2.207.131
  1.2.207.148
  1.2.215.142
-1.2.215.248
  1.2.216.105
  1.2.220.49
-1.2.228.56
-1.2.230.96
-1.2.254.145
+1.2.223.12
  1.20.100.111
  1.20.100.133
  1.20.100.227
  1.20.100.45
+1.20.101.149
  1.20.101.221
  1.20.101.62
-1.20.102.102
  1.20.102.228
  1.20.102.68
  1.20.103.196
  1.20.103.248
-1.20.137.191
  1.20.137.82
  1.20.143.156
-1.20.160.82
-1.20.161.108
-1.20.161.206
-1.20.169.27
+1.20.169.186
  1.20.169.56
  1.20.175.196
-1.20.178.145
-1.20.179.190
  1.20.180.4
  1.20.181.112
-1.20.181.127
+1.20.191.13
  1.20.202.13
  1.20.203.118
  1.20.203.132
-1.20.203.175
-1.20.203.246
-1.20.206.81
+1.20.207.16
  1.20.207.198
  1.20.207.3
  1.20.207.98
@@ -753,9 +698,9 @@
  1.20.217.78
  1.20.218.162
  1.20.220.79
-1.20.221.123
  1.20.221.128
  1.20.221.17
+1.20.221.25
  1.20.227.220
  1.20.227.66
  1.20.229.133
@@ -775,24 +720,20 @@
  1.20.99.122
  1.20.99.218
  1.20.99.44
-1.201.151.54
+1.200.109.246
  1.202.117.35
  1.202.76.226
  1.202.77.210
-1.203.102.100
  1.203.115.141
-1.203.80.2
-1.203.93.254
  1.204.175.20
  1.204.207.42
  1.204.60.210
  1.204.69.38
  1.207.248.244
-1.207.63.62
+1.207.248.245
  1.209.110.88
  1.209.171.34
  1.209.229.179
-1.209.4.219
  1.212.157.115
  1.212.181.131
  1.214.156.164
@@ -801,14 +742,13 @@
  1.214.245.27
  1.214.47.130
  1.214.48.211
+1.214.81.183
  1.214.89.69
  1.215.122.108
  1.215.162.195
  1.215.199.250
  1.217.24.139
  1.22.124.94
-1.22.197.123
-1.22.54.211
  1.220.145.45
  1.220.185.149
  1.220.89.178
@@ -817,30 +757,21 @@
  1.221.192.149
  1.221.254.82
  1.222.105.27
-1.222.141.38
-1.222.142.219
+1.222.139.128
  1.222.170.43
  1.222.176.232
  1.222.176.86
  1.222.178.27
  1.222.180.19
  1.222.187.175
-1.222.192.83
-1.222.194.71
-1.223.121.10
  1.223.248.99
-1.224.161.58
  1.224.249.138
+1.225.101.152
  1.226.12.132
-1.226.168.172
  1.226.84.243
-1.227.18.132
-1.227.37.35
-1.228.210.164
+1.226.84.78
  1.228.231.73
-1.229.0.42
  1.229.165.34
-1.229.83.194
  1.23.183.197
  1.232.247.3
  1.233.163.193
@@ -851,18 +782,11 @@
  1.234.58.157
  1.234.58.236
  1.234.65.61
-1.234.80.82
-1.235.102.223
  1.235.192.218
  1.235.202.83
-1.235.72.111
  1.237.212.184
-1.239.190.222
-1.24.210.102
  1.242.83.112
-1.245.218.80
  1.245.61.144
-1.246.220.166
  1.246.222.105
  1.246.222.107
  1.246.222.109
@@ -941,149 +865,63 @@
  1.246.223.82
  1.246.223.83
  1.246.223.94
-1.246.42.251
-1.246.42.252
-1.248.75.9
  1.249.251.115
-1.252.1.43
  1.252.197.183
  1.254.152.220
  1.254.250.52
-1.254.47.75
  1.255.226.37
-1.26.250.197
  1.28.204.122
-1.29.176.189
  1.30.215.144
-1.30.218.116
  1.30.218.89
-1.30.49.190
-1.31.4.50
-1.32.42.156
  1.32.59.217
-1.34.10.75
-1.34.10.87
-1.34.111.70
-1.34.117.194
-1.34.122.44
-1.34.127.176
-1.34.129.124
-1.34.13.221
-1.34.132.118
-1.34.135.3
-1.34.135.85
  1.34.136.15
-1.34.142.63
-1.34.143.48
-1.34.157.194
-1.34.159.44
-1.34.16.210
-1.34.164.22
-1.34.169.6
-1.34.172.147
-1.34.172.175
-1.34.176.23
-1.34.182.152
-1.34.186.241
-1.34.190.133
-1.34.193.11
-1.34.196.211
-1.34.197.93
-1.34.198.218
-1.34.21.161
-1.34.217.249
-1.34.218.185
-1.34.222.144
-1.34.223.70
-1.34.229.11
-1.34.254.207
-1.34.254.24
-1.34.29.30
-1.34.31.19
-1.34.34.38
-1.34.39.181
-1.34.39.82
-1.34.4.77
-1.34.54.246
-1.34.65.80
-1.34.85.14
-1.34.88.36
-1.34.98.198
-1.34.99.228
-1.36.189.20
-1.36.207.222
+1.34.192.85
  1.36.210.62
  1.36.88.200
+1.38.59.153
  1.38.60.51
+1.39.218.224
+1.39.218.77
  1.4.135.54
-1.4.141.229
-1.4.141.241
  1.4.157.34
  1.4.157.35
  1.4.160.164
-1.4.169.73
-1.4.217.105
-1.4.247.124
+1.4.198.10
  1.4.248.103
  1.4.249.72
  1.4.250.108
  1.4.250.36
-1.42.137.110
+1.4.254.174
  1.42.201.180
-1.48.225.199
+1.49.7.79
  1.4buyuklergazete.com
-1.52.158.59
-1.52.160.220
+1.52.104.80
+1.52.201.58
  1.52.206.137
-1.52.212.255
-1.52.5.235
-1.52.66.79
-1.53.127.200
  1.53.137.12
  1.53.137.164
  1.53.137.220
  1.53.137.84
  1.53.137.92
  1.53.53.234
-1.54.8.196
  1.55.215.30
  1.55.223.95
  1.55.241.4
  1.56.207.130
-1.56.84.130
-1.58.123.84
-1.58.41.114
+1.58.171.238
  1.58.47.108
-1.59.123.31
-1.59.181.177
-1.59.200.69
+1.58.62.108
  1.6.182.218
-1.6.187.33
  1.6.233.253
-1.6.37.181
-1.60.17.28
  1.60.78.144
-1.61.204.235
  1.62.105.107
-1.62.105.22
-1.62.183.135
-1.63.208.4
  1.63.226.147
-1.64.0.200
  1.64.124.62
-1.64.133.223
  1.64.162.72
  1.64.173.182
  1.64.98.50
-1.65.160.83
-1.65.182.112
-1.65.183.56
-1.65.188.221
  1.69.243.225bin.sh
-1.69.78.71
-1.7.142.58
  1.71.140.222
-1.71.191.178
  1.80.148.90
  1.80.151.1
  1.80.153.149
@@ -1099,20 +937,17 @@
  1.80.186.155
  1.83.102.35
  1.83.129.115
-1.83.158.81
-1.83.54.196
+1.83.54.100
  1.83.55.130
  1.83.55.142
  1.83.94.46
  1.85.0.98
  1.85.10.156
-1.85.12.230
  1.85.13.236
  1.85.16.226
  1.85.17.20
  1.85.36.252
  1.85.7.164
-1.86.240.107
  1.9.111.145
  1.9.164.242
  1.9.167.35
@@ -1137,15 +972,16 @@
  100-365.net
  100-diamond.000webhostapp.com
  100.1.12.92
-100.1.218.108
  100.1.9.36
  100.11.101.157
  100.11.173.166
  100.11.242.235
  100.111.231.2.static.cdnserver.in
  100.12.184.63
+100.14.81.22
  100.14.9.2
  100.16.255.31
+100.19.74.43
  100.2.0.58
  100.2.103.5
  100.2.131.143
@@ -1154,22 +990,18 @@
  100.2.202.125
  100.2.243.233
  100.25.110.164
-100.25.117.140
  100.25.185.145
  100.25.217.29
  100.25.36.197
-100.25.37.64
  100.25.60.57
-100.26.11.11
  100.26.143.89
  100.26.180.70
-100.26.221.133
  100.26.228.5
-100.26.53.73
+100.27.42.241
+100.27.42.242
+100.27.42.243
  100.3.129.148
-100.3.129.59
  100.32.29.134
-100.33.112.5
  100.33.3.222
  100.33.71.189
  100.34.113.39
@@ -1177,13 +1009,11 @@
  100.35.103.31
  100.35.47.77
  100.35.90.115
-100.37.240.194
  100.37.240.62
  100.37.254.90
  100.37.41.185
  100.38.234.159
  100.4.220.245
-100.40.58.187
  100.42.229.74
  100.42.30.34
  100.42.48.198
@@ -1201,7 +1031,7 @@
  100.6.23.40
  100.7.3.44
  100.7.3.45
-100.8.189.178
+100.8.111.23
  100.8.21.205
  1000-diamonds.000webhostapp.com
  1000000att.weebly.com
@@ -1233,24 +1063,21 @@
  101.0.81.153
  101.100.139.83
  101.100.174.138
-101.100.182.12
-101.100.201.67
+101.100.177.165
  101.101.217.165
  101.108.114.55
  101.108.119.123
  101.108.128.20
  101.108.130.149
  101.108.130.44
+101.108.130.57
  101.108.132.194
-101.108.136.74
-101.108.142.111
  101.108.143.220
  101.108.145.106
-101.108.16.214
+101.108.154.51
  101.108.161.158
  101.108.164.176
  101.108.177.85
-101.108.178.99
  101.108.179.114
  101.108.179.175
  101.108.179.190
@@ -1259,6 +1086,7 @@
  101.108.180.146
  101.108.180.250
  101.108.180.75
+101.108.181.122
  101.108.181.223
  101.108.181.226
  101.108.181.78
@@ -1269,6 +1097,7 @@
  101.108.184.33
  101.108.184.70
  101.108.184.86
+101.108.186.109
  101.108.186.2
  101.108.186.208
  101.108.187.197
@@ -1284,19 +1113,16 @@
  101.108.194.172
  101.108.194.239
  101.108.195.13
-101.108.195.179
  101.108.195.222
  101.108.195.232
  101.108.196.23
-101.108.196.91
-101.108.197.86
  101.108.198.167
  101.108.198.207
  101.108.198.24
-101.108.198.91
  101.108.199.127
  101.108.199.165
  101.108.199.37
+101.108.199.88
  101.108.20.130
  101.108.20.224
  101.108.216.101
@@ -1307,9 +1133,10 @@
  101.108.31.173
  101.108.32.208
  101.108.52.221
-101.108.93.201
+101.108.93.184
  101.108.93.222
  101.109.104.19
+101.109.123.5
  101.109.130.217
  101.109.143.71
  101.109.167.150
@@ -1319,8 +1146,6 @@
  101.109.184.193
  101.109.245.158
  101.109.245.200
-101.109.246.126
-101.109.246.8
  101.109.247.160
  101.109.251.42
  101.109.253.16
@@ -1332,62 +1157,40 @@
  101.109.39.120
  101.109.43.176
  101.109.46.111
-101.109.57.99
+101.109.46.155
  101.109.64.167
  101.109.94.244
  101.112.169.46
-101.116.207.237
-101.116.30.178
-101.127.155.33
-101.127.160.41
-101.127.168.49
-101.127.185.104
-101.127.2.115
-101.127.242.163
-101.127.42.171
-101.127.78.178
-101.127.94.108
+101.132.104.116
+101.132.128.224
  101.132.129.198
  101.132.149.193
+101.132.176.52
  101.132.182.76
-101.132.194.66
  101.132.33.79
  101.132.39.115
  101.132.39.85
-101.132.40.25
  101.132.43.162
  101.132.64.225
  101.132.72.117
-101.16.147.120
  101.162.89.250
  101.165.169.151
-101.167.175.224
  101.17.128.126
  101.179.1.53
  101.187.123.101
-101.187.58.167
  101.187.81.254
-101.190.51.102
+101.191.20.97
  101.198.186.254
-101.20.126.98
  101.20.136.171
-101.20.220.240
+101.20.20.147
  101.20.35.78
  101.200.127.75
  101.200.177.198
  101.200.199.157
-101.200.46.43
-101.200.55.9
  101.200.56.138
-101.200.56.77
  101.201.197.108
  101.201.237.252
-101.201.50.1
  101.201.62.45
-101.203.172.89
-101.203.173.119
-101.203.174.34
-101.205.120.211
  101.206.1.250
  101.206.162.139
  101.206.162.156
@@ -1401,12 +1204,10 @@
  101.206.162.249
  101.206.162.250
  101.206.82.84
+101.207.143.124
  101.22.59.61
-101.226.241.22
-101.226.241.74
  101.226.253.162
-101.226.255.173
-101.227.214.80
+101.227.247.85
  101.227.251.235
  101.227.34.23
  101.227.67.35
@@ -1414,13 +1215,9 @@
  101.228.208.82
  101.228.242.137
  101.228.34.153
-101.228.48.108
  101.228.86.200
-101.229.106.34
-101.229.175.49
  101.23.174.141
-101.230.193.54
-101.230.203.42
+101.23.211.205
  101.230.248.162
  101.230.248.163
  101.230.248.164
@@ -1431,33 +1228,21 @@
  101.231.146.34
  101.231.146.36
  101.231.241.170
-101.234.76.51
-101.234.76.77
  101.236.60.31
-101.249.251.39
  101.25.112.240
  101.25.113.28
  101.25.117.141
  101.25.121.141
-101.25.99.80
  101.251.197.238
  101.251.219.100
  101.251.222.158
-101.251.242.165
-101.254.115.179
-101.254.115.180
  101.254.136.130
-101.254.192.54
-101.255.115.122
  101.255.116.61
  101.255.117.2
-101.255.120.161
  101.255.120.65
  101.255.121.105
-101.255.121.49
  101.255.122.185
  101.255.122.73
-101.255.122.9
  101.255.124.35
  101.255.125.57
  101.255.125.59
@@ -1481,18 +1266,11 @@
  101.255.94.130
  101.26.74.69
  101.26.78.186
-101.28.151.135
-101.28.151.171
  101.28.19.61
-101.28.207.13
-101.28.5.216
-101.28.56.162
  101.28.72.208
-101.29.170.223
  101.30.106.196
  101.30.13.197
  101.30.146.120
-101.31.192.88
  101.32.11.194
  101.32.11.54
  101.32.14.145
@@ -1507,7 +1285,6 @@
  101.32.188.89
  101.32.189.31
  101.32.194.166
-101.32.201.221
  101.32.204.126
  101.32.204.171
  101.32.204.213
@@ -1522,12 +1299,10 @@
  101.32.241.102
  101.32.244.25
  101.32.26.159
-101.32.31.176
  101.32.32.155
  101.32.32.9
  101.32.34.76
  101.32.36.242
-101.32.38.12
  101.32.40.216
  101.32.42.126
  101.32.42.252
@@ -1540,6 +1315,7 @@
  101.32.72.24
  101.33.116.189
  101.33.116.60
+101.33.117.161
  101.33.117.207
  101.33.122.149
  101.33.122.243
@@ -1548,47 +1324,40 @@
  101.36.110.215
  101.36.112.191
  101.36.118.168
+101.36.118.82
  101.36.118.86
  101.36.121.111
  101.36.122.11
  101.36.122.64
  101.36.124.151
  101.36.127.47
+101.36.151.139
  101.36.151.78
  101.36.160.91
-101.36.173.44
  101.36.178.20
  101.36.178.48
  101.36.179.145
-101.36.179.159
  101.37.118.54
-101.37.32.165
  101.37.33.19
  101.37.91.238
-101.39.226.100
-101.39.226.178
-101.39.226.30
-101.39.228.55
  101.4.130.235
  101.4.136.34
  101.50.1.2
-101.50.126.41
-101.50.57.47
+101.50.126.5
  101.50.71.139
  101.50.92.176
  101.51.104.180
-101.51.105.169
-101.51.105.193
-101.51.105.230
+101.51.104.80
+101.51.105.191
  101.51.105.25
  101.51.105.5
-101.51.105.67
  101.51.106.70
+101.51.108.89
  101.51.110.53
  101.51.111.91
  101.51.121.203
  101.51.121.29
-101.51.141.106
+101.51.127.236
  101.51.141.11
  101.51.141.118
  101.51.141.122
@@ -1597,17 +1366,18 @@
  101.51.141.20
  101.51.141.81
  101.51.144.22
+101.51.144.253
  101.51.147.67
  101.51.18.20
-101.51.192.250
-101.51.194.196
  101.51.21.48
  101.51.242.135
  101.51.245.39
  101.51.246.21
+101.51.38.86
  101.51.44.94
  101.51.54.79
  101.51.59.100
+101.51.59.108
  101.51.59.135
  101.51.59.136
  101.51.59.173
@@ -1616,117 +1386,78 @@
  101.51.59.217
  101.51.59.245
  101.51.59.249
-101.51.59.25
  101.51.59.251
  101.51.59.252
-101.51.59.26
  101.51.59.38
-101.51.59.48
-101.51.59.59
-101.51.59.61
-101.51.59.62
+101.51.59.71
+101.51.59.72
+101.51.59.74
  101.51.59.97
-101.51.70.209
-101.51.92.77
-101.51.95.135
  101.51.99.7
-101.53.100.115
-101.53.100.155
-101.53.101.16
  101.53.130.51
+101.53.139.153
  101.53.142.39
  101.53.62.166
  101.55.126.239
-101.55.55.143
  101.6.133.27
  101.64.117.49
-101.64.140.28
  101.64.152.149
  101.64.156.130
  101.64.156.58
  101.64.157.103
  101.64.157.146
-101.64.235.70
-101.64.33.227
  101.65.128.150
  101.65.160.13
  101.65.161.87
-101.65.182.99
  101.67.215.7
  101.67.241.95
  101.67.243.158
  101.68.221.18
  101.68.78.194
  101.69.108.136
-101.69.110.197
  101.69.163.110
  101.69.200.162
  101.69.240.94
-101.69.242.242
  101.70.15.84
  101.71.124.202
-101.71.158.209
  101.71.251.202
  101.71.28.72
  101.71.3.53
-101.71.38.82
  101.71.51.192
  101.72.33.145
  101.73.145.214
-101.73.193.189
  101.75.178.180
  101.78.149.142
+101.78.166.151
  101.78.209.39
-101.78.3.247
-101.78.3.29
-101.78.70.200
+101.78.211.80
  101.78.9.235
  101.78.9.237
-101.79.167.114
  101.79.5.58
-101.80.137.164
-101.80.75.83
  101.81.136.34
-101.83.123.106
-101.83.253.57
  101.84.64.157
  101.85.226.21
  101.86.133.244
+101.86.166.156
  101.87.156.121
  101.88.231.209
-101.89.110.1
-101.89.110.204
  101.89.116.39
  101.89.143.15
  101.89.145.133
-101.89.188.88
  101.89.192.64
  101.89.219.59
  101.89.63.136
  101.91.119.172
  101.91.178.122
-101.91.207.208
-101.91.238.43
-101.93.151.32
  101.93.185.199
-101.93.223.168
-101.95.134.170
+101.94.189.182
  101.95.162.58
-101.95.23.198
  101.95.86.34
  101.96.113.50
-101.96.128.182
-101.96.130.113
-101.96.134.166
-101.96.89.172
  101.96.89.207
  101.98.149.170
-101.99.15.57
  101.99.20.59
-101.99.33.197
-101.99.69.20
  101.99.77.62
-101.99.81.155
  101.99.90.116
  101.99.90.128
  101.99.90.141
@@ -1748,71 +1479,59 @@
  101gowrie.com
  101jo.com
  101login-screens.weebly.com
+102.112.127.74
  102.112.30.218
  102.113.224.224
+102.114.116.178
+102.114.154.174
+102.114.36.150
+102.114.38.52
  102.114.42.36
  102.114.43.228
-102.114.71.205
+102.114.54.92
  102.114.88.180
+102.115.236.248
  102.115.237.6
-102.118.204.56
+102.115.239.105
  102.129.175.128
  102.129.175.140
  102.129.175.155
+102.129.175.182
  102.129.199.80
-102.129.224.122
  102.129.249.232
  102.129.79.10
  102.130.113.88
  102.130.119.99
  102.130.120.91
-102.130.24.92
  102.130.64.30
  102.131.244.113
-102.131.57.29
-102.131.60.21
-102.132.201.7
  102.132.245.16
  102.133.167.0
  102.134.147.63
-102.134.168.74
  102.134.176.1
-102.134.176.103
  102.134.176.46
  102.134.176.53
  102.134.176.66
+102.134.176.85
  102.137.241.7
+102.140.213.172
  102.141.197.17
-102.152.16.86
+102.142.137.168
+102.152.40.35
  102.152.48.218
-102.158.251.143
+102.152.50.110
+102.156.46.45
  102.164.108.43
  102.164.214.7
  102.164.248.235
+102.164.5.177
  102.165.126.30
-102.165.27.170
-102.165.27.213
-102.165.27.33
-102.165.30.1
-102.165.30.13
+102.165.27.123
  102.165.30.17
-102.165.30.21
-102.165.30.25
-102.165.30.29
-102.165.30.33
-102.165.30.37
-102.165.30.41
-102.165.30.45
-102.165.30.49
-102.165.30.5
-102.165.30.53
-102.165.30.57
-102.165.30.61
-102.165.30.9
  102.165.52.54
+102.165.52.95
  102.165.54.147
  102.169.88.176
-102.176.13.79
  102.176.160.107
  102.176.160.109
  102.176.160.70
@@ -1820,63 +1539,55 @@
  102.176.161.114
  102.176.189.7
  102.176.197.253
-102.176.2.209
  102.176.3.100
+102.176.58.74
+102.176.62.84
+102.176.65.35
  102.176.8.134
-102.176.81.99
-102.176.9.233
  102.177.105.34
  102.177.141.105
  102.177.141.97
  102.177.142.1
  102.177.147.1
-102.177.192.15
-102.177.193.226
-102.177.198.82
+102.182.156.104
+102.182.163.253
  102.182.204.96
  102.182.93.220
-102.184.204.98
-102.185.25.35
-102.185.77.9
+102.22.221.245
  102.22.223.11
-102.222.180.193
  102.223.124.192
-102.223.209.38
  102.223.73.187
  102.23.221.1
  102.23.242.15
-102.23.247.88
  102.244.120.10
-102.36.161.250
  102.36.164.141
  102.37.10.155
  102.37.40.61
  102.37.42.197
+102.37.43.139
  102.38.49.250
  102.38.50.227
  102.38.50.228
  102.38.50.62
-102.38.50.78
  102.39.111.112
  102.39.236.15
  102.39.67.51
-102.41.151.122
+102.40.139.211
  102.41.215.242
-102.42.250.129
-102.44.102.170
-102.44.105.59
+102.43.92.184
  102.44.139.37
-102.44.140.236
-102.44.39.48
+102.44.181.170
  102.45.138.94
  102.45.143.211
+102.45.55.202
+102.45.91.4
  102.47.178.77
-102.53.7.199
  102.64.122.242
  102.64.123.62
  102.64.33.143
  102.65.12.170
  102.65.13.188
+102.65.184.180
  102.65.190.160
  102.65.48.22
  102.65.89.16
@@ -1894,7 +1605,6 @@
  102.68.17.8
  102.68.17.96
  102.68.74.47
-102.76.70.29
  102020yahoo.weebly.com
  1022408.had.su
  1024-36963.el-alt.com
@@ -1903,6 +1613,7 @@
  102region.online
  103.1.236.126
  103.1.237.174
+103.1.239.213
  103.1.74.198
  103.1.93.184
  103.1.93.59
@@ -1911,45 +1622,35 @@
  103.10.157.9
  103.10.169.212
  103.10.210.17
-103.10.227.36
  103.10.228.221
  103.10.23.161
  103.10.28.129
-103.10.28.163
  103.10.3.104
+103.10.56.190
  103.10.59.73
  103.10.81.172
-103.10.84.60
  103.10.87.54
  103.100.159.162
-103.100.159.194
  103.100.159.21
-103.100.16.199
  103.100.188.51
  103.100.209.152
  103.100.209.24
  103.100.210.136
-103.100.66.230
  103.100.83.238
  103.100.83.253
-103.100.96.174
+103.101.160.81
  103.101.161.33
  103.101.162.158
  103.101.230.179
  103.101.233.13
  103.101.52.48
-103.101.81.138
  103.101.82.238
-103.102.102.231
  103.102.117.34
+103.102.12.11
  103.102.14.231
  103.102.141.56
  103.102.141.61
  103.102.142.184
-103.102.145.34
-103.102.153.108
-103.102.195.178
-103.102.248.98
  103.103.124.145
  103.103.124.169
  103.103.124.177
@@ -1957,31 +1658,24 @@
  103.103.124.230
  103.103.124.233
  103.103.125.98
-103.103.142.212
  103.103.161.10
-103.103.212.222
-103.103.213.122
+103.103.212.25
  103.103.52.40
  103.103.52.5
  103.103.71.8
-103.104.121.231
  103.104.124.33
  103.104.132.2
  103.104.133.178
-103.104.231.111
-103.104.44.116
+103.104.59.179
  103.104.61.102
-103.104.85.2
  103.104.85.88
-103.104.94.236
  103.105.130.136
  103.105.142.132
  103.105.195.2
  103.105.195.230
-103.105.201.155
+103.105.195.84
  103.105.209.26
  103.105.212.106
-103.105.228.10
  103.105.236.1
  103.105.236.120
  103.105.236.153
@@ -1993,18 +1687,14 @@
  103.105.236.209
  103.105.236.217
  103.105.236.225
-103.105.236.253
  103.105.237.245
  103.105.237.249
  103.105.237.254
  103.105.239.1
  103.105.40.1
  103.105.40.145
+103.105.40.161
  103.105.40.70
-103.105.42.23
-103.105.42.66
-103.105.42.91
-103.105.46.23
  103.105.64.253
  103.105.67.146
  103.105.70.148
@@ -2012,6 +1702,7 @@
  103.106.112.11
  103.106.114.134
  103.106.115.22
+103.106.148.209
  103.106.158.252
  103.106.192.245
  103.106.219.121
@@ -2019,9 +1710,6 @@
  103.106.219.222
  103.106.237.182
  103.106.238.209
-103.106.242.26
-103.106.250.248
-103.106.28.206
  103.106.28.78
  103.106.32.1
  103.106.32.105
@@ -2052,8 +1740,8 @@
  103.107.160.169
  103.107.161.54
  103.107.17.205
+103.107.182.17
  103.107.187.252
-103.107.245.45
  103.107.68.1
  103.107.68.13
  103.107.68.17
@@ -2104,13 +1792,9 @@
  103.107.94.61
  103.107.94.85
  103.107.95.9
-103.108.120.12
  103.108.128.178
-103.108.187.194
-103.108.187.195
-103.108.187.252
+103.108.193.224
  103.108.228.42
-103.108.45.247
  103.108.58.212
  103.108.59.212
  103.108.75.153
@@ -2121,9 +1805,7 @@
  103.109.0.242
  103.109.0.46
  103.109.101.216
-103.109.108.26
  103.109.13.228
-103.109.136.208
  103.109.15.141
  103.109.15.196
  103.109.180.20
@@ -2161,11 +1843,11 @@
  103.109.58.54
  103.109.59.137
  103.109.59.209
-103.109.59.242
  103.109.59.81
-103.109.80.236
  103.109.95.81
+103.11.106.25
  103.11.106.69
+103.11.67.138
  103.110.109.17
  103.110.109.2
  103.110.109.33
@@ -2179,20 +1861,15 @@
  103.110.126.111
  103.110.160.218
  103.110.160.222
-103.110.164.114
  103.110.22.211
-103.110.36.195
-103.110.49.104
  103.110.59.3
  103.110.84.196
  103.110.89.148
  103.111.103.254
  103.111.197.194
  103.111.199.18
-103.111.20.74
  103.111.219.132
  103.111.219.149
-103.111.219.245
  103.111.22.26
  103.111.22.65
  103.111.29.130
@@ -2211,12 +1888,9 @@
  103.112.0.220
  103.112.0.221
  103.112.0.231
-103.112.0.247
-103.112.0.251
  103.112.0.26
  103.112.0.46
-103.112.0.67
-103.112.139.13
+103.112.0.9
  103.112.204.190
  103.112.212.133
  103.112.212.30
@@ -2224,6 +1898,7 @@
  103.112.29.124
  103.112.60.2
  103.112.60.33
+103.112.60.42
  103.112.60.5
  103.112.61.13
  103.112.61.229
@@ -2238,14 +1913,12 @@
  103.112.63.121
  103.112.63.33
  103.112.65.136
-103.112.65.139
  103.112.84.10
  103.113.104.176
  103.113.104.225
  103.113.104.43
  103.113.106.226
  103.113.106.227
-103.113.156.143
  103.113.157.206
  103.113.157.9
  103.113.159.250
@@ -2267,12 +1940,9 @@
  103.114.0.3
  103.114.104.35
  103.114.104.68
-103.114.105.0
  103.114.105.83
  103.114.106.11
-103.114.106.80
  103.114.107.128
-103.114.107.129
  103.114.107.249
  103.114.161.166
  103.114.162.198
@@ -2280,7 +1950,6 @@
  103.114.208.198
  103.114.21.169
  103.114.221.16
-103.114.226.99
  103.114.61.150
  103.114.97.1
  103.114.97.69
@@ -2295,12 +1964,10 @@
  103.115.119.226
  103.115.119.250
  103.115.119.254
-103.115.120.249
-103.115.120.250
  103.115.130.177
  103.115.14.1
  103.115.164.158
-103.115.181.204
+103.115.164.65
  103.115.181.40
  103.115.252.129
  103.115.252.26
@@ -2318,13 +1985,9 @@
  103.115.255.86
  103.115.255.90
  103.115.255.93
-103.115.44.245
-103.116.105.30
-103.116.118.10
-103.116.119.110
+103.116.200.12
  103.116.203.244
  103.116.250.194
-103.116.29.83
  103.116.78.107
  103.117.108.106
  103.117.108.154
@@ -2333,20 +1996,11 @@
  103.117.14.240
  103.117.146.210
  103.117.146.98
-103.117.175.74
  103.117.195.22
-103.117.202.215
  103.117.229.46
-103.117.37.165
-103.117.48.5
-103.118.114.118
-103.118.114.219
-103.118.157.59
  103.118.169.85
  103.118.76.54
  103.119.144.206
-103.119.188.34
-103.119.188.37
  103.119.229.130
  103.119.244.10
  103.12.114.38
@@ -2355,15 +2009,14 @@
  103.12.114.61
  103.12.114.62
  103.12.114.78
-103.12.133.52
  103.12.150.14
  103.12.150.254
  103.12.151.6
  103.12.161.194
  103.12.161.196
-103.12.161.38
  103.12.177.34
  103.12.196.90
+103.12.197.246
  103.12.198.115
  103.12.246.10
  103.12.246.105
@@ -2384,40 +2037,27 @@
  103.12.246.81
  103.12.246.97
  103.120.124.142
-103.120.160.167
  103.120.168.3
  103.120.174.92
-103.120.176.240
  103.120.188.1
  103.120.188.9
-103.120.220.128
-103.120.220.130
-103.120.220.131
-103.120.220.132
-103.120.220.133
-103.120.220.134
  103.120.223.27
  103.120.224.222
-103.120.83.9
-103.121.117.181
  103.121.215.249
  103.121.42.229
  103.121.58.235
+103.121.93.96
  103.122.104.114
  103.122.105.242
+103.122.14.168
  103.122.246.8
-103.122.29.35
  103.122.66.184
  103.122.66.200
  103.122.90.181
+103.122.92.103
  103.122.97.58
-103.122.98.194
-103.122.99.141
-103.123.112.2
-103.123.114.1
+103.123.150.122
  103.123.16.126
-103.123.168.74
-103.123.170.16
  103.123.170.18
  103.123.171.197
  103.123.171.34
@@ -2428,35 +2068,25 @@
  103.123.246.66
  103.123.25.80
  103.123.55.121
+103.123.64.19
  103.123.65.186
-103.123.73.74
  103.123.8.75
  103.123.86.147
-103.123.86.3
-103.123.86.81
  103.124.104.232
  103.124.136.77
-103.124.141.248
+103.124.14.25
  103.124.147.22
  103.124.175.139
-103.124.60.24
-103.124.71.130
  103.124.94.169
  103.124.94.243
-103.125.105.39
  103.125.106.2
  103.125.117.202
  103.125.130.113
-103.125.131.167
-103.125.154.103
-103.125.154.203
  103.125.189.52
-103.125.190.103
  103.125.191.106
  103.125.191.123
  103.125.191.153
  103.125.191.182
-103.125.191.184
  103.125.191.233
  103.125.191.55
  103.125.191.78
@@ -2467,16 +2097,16 @@
  103.126.100.18
  103.126.100.225
  103.126.100.31
+103.126.100.5
  103.126.172.6
  103.126.217.129
  103.126.218.68
  103.126.218.70
  103.126.247.86
-103.126.254.10
  103.126.6.144
  103.127.108.96
  103.127.124.117
-103.127.207.30
+103.127.157.210
  103.127.41.103
  103.129.13.45
  103.129.194.1
@@ -2489,6 +2119,7 @@
  103.129.223.98
  103.129.64.189
  103.129.88.7
+103.129.97.111
  103.13.224.53
  103.13.229.170
  103.13.236.246
@@ -2499,7 +2130,6 @@
  103.130.173.110
  103.130.192.135
  103.130.196.154
-103.130.201.19
  103.130.209.251
  103.130.213.21
  103.130.214.215
@@ -2512,43 +2142,33 @@
  103.130.215.57
  103.130.218.98
  103.130.219.182
-103.130.70.19
-103.131.0.61
  103.131.104.52
  103.131.104.63
  103.131.104.73
-103.131.11.106
  103.131.16.76
  103.131.169.92
  103.131.17.83
+103.131.44.122
  103.131.80.2
-103.132.150.109
-103.132.150.110
-103.132.58.13
  103.133.106.244
-103.133.107.234
+103.133.107.251
+103.133.108.10
  103.133.109.40
-103.133.110.13
+103.133.110.62
  103.133.214.144
  103.133.223.122
-103.133.248.20
  103.134.115.194
-103.134.133.29
  103.134.177.163
  103.134.200.26
  103.134.203.26
  103.134.25.80
-103.134.4.161
-103.134.93.18
+103.134.255.103
  103.134.94.98
  103.135.174.130
  103.135.174.142
-103.135.32.238
  103.135.33.74
  103.135.38.239
  103.135.95.134
-103.136.184.248
-103.136.247.3
  103.136.40.50
  103.136.40.88
  103.136.40.90
@@ -2571,30 +2191,20 @@
  103.137.66.29
  103.137.66.5
  103.137.81.105
-103.138.10.6
-103.138.110.163
  103.138.4.102
  103.138.4.34
+103.138.4.37
  103.138.5.138
-103.138.5.179
  103.138.5.189
+103.138.5.191
  103.138.5.83
-103.138.8.165
-103.138.8.176
  103.139.102.113
  103.139.163.210
  103.139.163.219
-103.139.170.164
+103.139.190.18
  103.139.212.205
-103.139.212.206
-103.139.212.208
-103.139.212.210
-103.139.212.211
-103.139.212.212
-103.139.212.213
  103.139.219.20
-103.139.224.9
-103.139.44.99
+103.139.44.218
  103.139.58.117
  103.139.8.9
  103.139.89.51
@@ -2604,9 +2214,9 @@
  103.14.244.190
  103.14.27.174
  103.14.33.223
-103.14.34.212
  103.14.35.204
  103.14.36.218
+103.14.36.226
  103.14.38.130
  103.14.38.133
  103.14.38.136
@@ -2621,19 +2231,15 @@
  103.14.38.186
  103.14.38.188
  103.14.45.98
-103.140.127.227
-103.140.186.124
+103.140.189.97
  103.140.234.102
  103.140.234.9
  103.140.238.246
-103.140.246.221
-103.140.250.119
-103.140.250.135
-103.140.31.146
-103.140.35.94
+103.140.250.183
  103.140.66.5
  103.140.82.1
  103.140.83.1
+103.140.83.101
  103.140.83.12
  103.140.83.129
  103.140.83.17
@@ -2647,9 +2253,8 @@
  103.140.83.94
  103.140.83.97
  103.141.108.142
+103.141.108.161
  103.141.108.185
-103.141.108.26
-103.141.136.224
  103.141.136.70
  103.141.138.119
  103.141.138.133
@@ -2658,11 +2263,8 @@
  103.141.142.47
  103.141.158.160
  103.141.177.194
-103.141.246.186
-103.141.41.46
  103.141.46.154
  103.142.111.146
-103.142.115.30
  103.142.164.37
  103.142.164.38
  103.142.164.40
@@ -2673,8 +2275,6 @@
  103.142.25.172
  103.142.68.166
  103.142.68.2
-103.142.98.84
-103.143.14.194
  103.143.147.2
  103.143.20.82
  103.143.20.84
@@ -2693,47 +2293,26 @@
  103.143.235.17
  103.143.235.21
  103.143.235.37
+103.143.46.248
  103.143.73.41
  103.143.84.72
+103.144.146.206
  103.144.146.210
  103.144.146.214
  103.144.146.52
-103.144.167.4
-103.144.180.2
-103.144.180.22
  103.144.181.106
-103.144.200.251
  103.144.200.5
-103.144.201.138
  103.144.213.13
  103.144.77.24
  103.145.12.11
-103.145.12.221
-103.145.12.47
  103.145.12.91
-103.145.13.10
-103.145.13.109
-103.145.13.115
-103.145.13.143
-103.145.13.15
-103.145.13.169
-103.145.13.18
-103.145.13.188
-103.145.13.228
-103.145.13.24
-103.145.13.42
-103.145.13.43
  103.145.13.58
-103.145.13.60
  103.145.172.202
  103.145.252.171
  103.145.252.23
  103.145.252.39
  103.145.253.136
-103.145.253.187
-103.145.253.87
  103.145.51.208
-103.145.62.255
  103.145.67.246
  103.145.67.58
  103.145.8.146
@@ -2747,13 +2326,8 @@
  103.146.202.4
  103.146.204.60
  103.147.10.222
-103.147.132.104
-103.147.3.220
-103.147.3.94
  103.147.4.177
  103.147.4.248
-103.147.4.9
-103.147.41.254
  103.148.121.91
  103.148.195.11
  103.148.195.18
@@ -2768,15 +2342,14 @@
  103.148.233.218
  103.148.244.153
  103.148.57.129
+103.148.79.114
+103.148.92.202
  103.148.94.36
  103.149.12.183
  103.149.170.15
  103.149.26.234
  103.15.140.140
-103.15.140.142
-103.15.140.185
  103.15.226.14
-103.15.242.204
  103.15.242.210
  103.15.242.212
  103.15.242.214
@@ -2786,48 +2359,40 @@
  103.15.251.75
  103.15.251.76
  103.15.36.109
-103.15.40.122
  103.15.40.202
  103.15.51.23
-103.15.62.119
-103.15.62.18
-103.15.80.8
  103.15.83.74
  103.15.83.83
  103.150.215.101
  103.150.215.115
  103.150.238.214
+103.150.238.218
  103.150.43.246
  103.151.122.165
  103.151.122.3
  103.151.176.21
  103.151.182.6
-103.151.47.167
  103.152.101.19
-103.152.118.244
  103.152.198.209
  103.152.242.19
  103.152.242.87
-103.152.244.254
  103.152.5.2
  103.152.5.70
+103.153.157.39
+103.153.182.59
  103.153.2.43
-103.153.2.46
  103.153.66.27
-103.154.188.186
+103.153.78.194
+103.153.79.236
  103.154.241.253
  103.154.9.66
  103.154.9.67
  103.154.9.68
  103.154.9.69
  103.155.92.72
-103.156.168.189
-103.156.221.10
-103.156.221.11
-103.156.221.28
  103.156.225.17
  103.156.225.18
-103.156.80.80
+103.156.92.236
  103.156.93.74
  103.157.116.199
  103.157.25.1
@@ -2841,7 +2406,9 @@
  103.16.131.157
  103.16.132.195
  103.16.132.210
-103.16.199.133
+103.16.144.74
+103.16.145.56
+103.16.145.62
  103.16.199.165
  103.16.202.187
  103.16.228.20
@@ -2856,23 +2423,21 @@
  103.16.63.125
  103.17.117.40
  103.17.117.43
-103.17.244.79
+103.17.250.249
  103.17.39.26
  103.17.49.2
-103.17.51.234
-103.17.90.6
+103.18.167.158
+103.18.167.171
  103.18.179.196
  103.18.179.212
+103.18.242.58
  103.18.245.174
-103.18.71.130
  103.18.77.46
  103.18.78.54
  103.19.110.38
  103.19.110.39
-103.19.132.194
  103.19.133.218
  103.19.229.150
-103.19.251.210
  103.19.252.130
  103.19.252.210
  103.19.253.133
@@ -2886,21 +2451,15 @@
  103.192.156.169
  103.192.156.171
  103.192.158.214
-103.192.213.92
  103.192.226.19
  103.192.226.70
  103.192.226.88
  103.192.226.99
-103.192.254.248
  103.193.117.112
  103.193.129.52
-103.193.190.120
-103.193.202.56
-103.193.242.138
  103.193.4.120
  103.193.4.174
  103.193.4.182
-103.194.104.98
  103.194.171.205
  103.194.192.29
  103.194.193.13
@@ -2909,35 +2468,28 @@
  103.194.248.166
  103.194.251.42
  103.194.89.238
+103.194.90.171
  103.195.100.91
-103.195.141.61
-103.195.205.43
  103.195.39.153
  103.195.7.97
  103.195.83.59
  103.195.90.115
  103.195.90.7
-103.196.127.210
  103.196.233.199
-103.196.52.230
+103.196.52.235
  103.196.53.209
  103.197.134.18
  103.197.134.22
  103.197.168.21
-103.197.222.158
  103.197.48.178
  103.197.48.98
  103.197.93.2
-103.198.10.47
-103.198.10.52
  103.198.124.45
  103.198.139.3
  103.198.192.14
-103.199.100.194
-103.199.100.74
  103.199.103.67
+103.199.108.30
  103.199.110.42
-103.199.113.41
  103.199.155.26
  103.199.156.121
  103.199.156.145
@@ -2978,8 +2530,8 @@
  103.199.159.246
  103.199.16.37
  103.199.16.50
+103.199.161.243
  103.199.162.153
-103.199.163.186
  103.199.84.41
  103.199.84.42
  103.199.97.129
@@ -2992,39 +2544,31 @@
  103.20.188.94
  103.20.189.126
  103.20.191.242
-103.20.215.187
  103.20.3.15
  103.20.3.45
  103.20.33.185
  103.20.34.163
  103.20.34.169
-103.20.53.107
-103.20.60.15
  103.200.116.12
-103.200.128.226
  103.200.135.226
  103.200.135.228
  103.200.135.229
  103.200.135.230
  103.200.20.222
-103.200.30.12
  103.200.39.102
  103.200.40.194
  103.200.95.82
  103.200.97.70
-103.201.140.6
-103.201.141.10
  103.203.65.2
  103.203.66.144
+103.204.109.135
  103.204.109.181
  103.204.110.141
  103.204.110.147
  103.204.110.174
  103.204.111.139
-103.204.156.100
-103.204.162.59
  103.204.166.206
-103.204.79.174
+103.204.52.66
  103.205.128.129
  103.205.128.7
  103.205.128.81
@@ -3034,11 +2578,11 @@
  103.205.130.195
  103.205.130.196
  103.205.130.20
-103.205.130.201
+103.205.130.200
  103.205.130.204
-103.205.130.207
+103.205.130.206
  103.205.130.208
-103.205.130.212
+103.205.130.213
  103.205.130.214
  103.205.130.216
  103.205.130.220
@@ -3052,7 +2596,6 @@
  103.205.130.240
  103.205.130.246
  103.205.130.25
-103.205.130.250
  103.205.130.252
  103.205.130.254
  103.205.130.27
@@ -3062,12 +2605,10 @@
  103.205.130.34
  103.205.130.36
  103.205.130.38
+103.205.130.4
  103.205.130.40
-103.205.130.42
  103.205.130.45
-103.205.130.46
  103.205.130.48
-103.205.130.5
  103.205.130.50
  103.205.130.53
  103.205.130.57
@@ -3081,8 +2622,9 @@
  103.205.130.71
  103.205.130.74
  103.205.130.76
+103.205.130.79
  103.205.130.8
-103.205.130.83
+103.205.130.82
  103.205.130.84
  103.205.130.87
  103.205.130.88
@@ -3098,44 +2640,31 @@
  103.205.25.27
  103.205.5.158
  103.205.5.176
-103.205.5.179
  103.205.68.2
-103.205.7.115
  103.205.7.247
  103.205.7.83
  103.205.7.84
-103.205.7.89
+103.206.102.20
  103.206.105.193
  103.206.118.166
  103.206.118.169
-103.206.118.201
  103.206.118.53
  103.206.128.137
-103.206.130.2
  103.206.130.201
  103.206.131.213
-103.206.179.132
-103.206.179.4
-103.206.179.40
  103.206.209.238
-103.206.225.88
  103.206.227.22
  103.206.246.110
  103.206.247.227
  103.206.253.58
  103.206.254.242
  103.207.0.193
-103.207.1.146
-103.207.1.201
  103.207.11.10
  103.207.11.6
  103.207.14.243
  103.207.156.207
  103.207.165.9
-103.207.168.229
  103.207.169.26
-103.207.3.82
-103.207.36.87
  103.207.37.133
  103.207.37.184
  103.207.37.189
@@ -3143,16 +2672,17 @@
  103.207.38.215
  103.207.38.31
  103.207.39.131
-103.207.39.8
-103.207.39.85
-103.207.58.103
+103.207.42.133
+103.207.5.35
+103.207.7.106
+103.207.7.117
+103.207.7.175
+103.207.7.69
  103.207.96.21
  103.207.96.225
  103.207.96.226
  103.207.97.33
  103.208.120.125
-103.208.152.184
-103.208.152.225
  103.208.152.34
  103.208.152.37
  103.208.200.114
@@ -3164,10 +2694,8 @@
  103.208.220.139
  103.208.220.142
  103.208.220.226
-103.208.53.236
  103.209.100.238
  103.209.131.55
-103.209.141.188
  103.209.178.208
  103.209.178.66
  103.209.194.101
@@ -3180,11 +2708,8 @@
  103.209.89.66
  103.209.9.2
  103.21.116.249
-103.21.118.154
  103.21.142.12
  103.21.148.54
-103.21.149.102
-103.21.149.92
  103.21.150.184
  103.21.160.10
  103.21.161.105
@@ -3192,15 +2717,14 @@
  103.21.163.76
  103.21.163.81
  103.21.183.248
-103.21.232.76
  103.21.40.35
  103.21.53.11
  103.21.58.156
  103.210.120.40
-103.210.133.21
-103.210.134.5
  103.210.142.54
+103.210.23.56
  103.210.236.229
+103.210.236.47
  103.210.237.13
  103.210.29.113
  103.210.29.193
@@ -3214,8 +2738,8 @@
  103.211.11.57
  103.211.11.69
  103.211.15.214
+103.211.15.58
  103.211.167.11
-103.211.179.72
  103.211.184.130
  103.211.190.194
  103.211.218.202
@@ -3257,8 +2781,6 @@
  103.212.128.253
  103.212.144.215
  103.212.144.41
-103.212.209.139
-103.212.209.87
  103.212.211.2
  103.212.211.4
  103.212.222.13
@@ -3290,23 +2812,20 @@
  103.212.93.253
  103.212.93.254
  103.212.94.253
-103.213.116.84
  103.213.128.145
-103.213.213.185
  103.213.240.29
  103.213.245.102
  103.213.248.45
  103.213.96.15
-103.214.108.23
+103.214.112.18
  103.214.112.19
  103.214.112.239
-103.214.136.248
  103.214.146.12
+103.214.171.18
  103.214.191.253
  103.214.201.17
  103.214.202.145
  103.214.219.49
-103.214.229.236
  103.214.235.10
  103.214.235.243
  103.214.35.116
@@ -3324,13 +2843,6 @@
  103.215.148.4
  103.215.177.153
  103.215.177.231
-103.215.203.25
-103.215.245.240
-103.215.247.12
-103.215.247.154
-103.215.247.197
-103.215.247.68
-103.215.247.8
  103.215.80.182
  103.215.81.107
  103.215.81.74
@@ -3340,19 +2852,15 @@
  103.216.145.242
  103.216.147.49
  103.216.169.253
-103.216.216.10
-103.216.216.194
-103.216.216.206
-103.216.218.159
-103.216.218.183
-103.216.218.189
+103.216.216.250
+103.216.218.207
  103.216.239.202
  103.216.48.83
-103.216.50.68
  103.216.82.146
  103.216.82.153
  103.216.82.18
  103.216.82.186
+103.216.82.19
  103.216.82.190
  103.216.82.196
  103.216.82.198
@@ -3372,7 +2880,6 @@
  103.216.82.46
  103.216.82.52
  103.217.119.75
-103.217.133.211
  103.217.154.105
  103.217.173.210
  103.217.213.129
@@ -3383,25 +2890,19 @@
  103.218.2.188
  103.218.241.161
  103.218.26.169
-103.219.112.31
  103.219.112.48
  103.219.112.63
  103.219.112.88
-103.219.165.194
-103.219.186.130
  103.219.187.55
  103.219.187.56
  103.219.207.118
-103.219.207.124
  103.219.212.87
-103.219.31.133
-103.219.31.178
-103.219.31.207
+103.219.45.222
+103.22.142.154
  103.22.143.58
  103.22.144.67
-103.22.191.144
-103.22.191.168
  103.22.251.45
+103.220.157.30
  103.220.204.101
  103.220.206.110
  103.220.206.122
@@ -3419,7 +2920,7 @@
  103.221.222.30
  103.221.232.111
  103.221.232.137
-103.221.232.143
+103.221.232.180
  103.221.232.231
  103.221.232.61
  103.221.234.144
@@ -3431,7 +2932,6 @@
  103.221.234.79
  103.221.246.154
  103.221.252.38
-103.221.252.46
  103.221.253.145
  103.221.253.242
  103.221.254.102
@@ -3454,12 +2954,10 @@
  103.224.185.208
  103.224.185.4
  103.224.185.48
-103.224.185.54
  103.224.250.94
  103.224.48.38
  103.224.49.34
  103.224.5.5
-103.224.54.222
  103.224.81.90
  103.224.82.238
  103.224.82.5
@@ -3467,12 +2965,9 @@
  103.224.83.36
  103.224.83.71
  103.224.83.91
-103.225.101.98
  103.225.136.151
-103.225.138.70
  103.225.139.230
  103.225.206.22
-103.225.207.51
  103.225.212.13
  103.225.22.118
  103.225.221.6
@@ -3504,7 +2999,6 @@
  103.225.228.97
  103.225.229.10
  103.225.48.173
-103.225.9.47
  103.225.92.8
  103.225.93.2
  103.225.99.36
@@ -3518,6 +3012,7 @@
  103.227.145.6
  103.227.147.142
  103.227.176.23
+103.227.176.5
  103.227.254.59
  103.227.255.43
  103.228.1.170
@@ -3528,12 +3023,9 @@
  103.228.119.125
  103.228.119.129
  103.228.119.137
-103.228.143.116
  103.228.152.25
-103.228.181.206
  103.228.46.11
  103.228.53.155
-103.228.53.59
  103.228.71.39
  103.229.120.26
  103.229.124.198
@@ -3570,16 +3062,13 @@
  103.23.119.60
  103.23.21.127
  103.23.224.89
-103.230.107.229
  103.230.155.154
  103.231.101.57
  103.231.162.10
  103.231.162.68
  103.231.191.7
  103.231.218.126
-103.231.252.120
  103.231.253.20
-103.231.30.4
  103.231.40.144
  103.231.44.187
  103.231.46.197
@@ -3589,7 +3078,6 @@
  103.232.120.109
  103.232.121.152
  103.232.123.175
-103.232.123.229
  103.232.244.253
  103.232.244.26
  103.232.244.42
@@ -3598,13 +3086,10 @@
  103.232.64.73
  103.232.65.78
  103.233.0.121
-103.233.1.167
  103.233.103.233
  103.233.103.237
  103.233.103.241
-103.233.110.175
  103.233.118.226
-103.233.119.221
  103.233.122.197
  103.233.122.50
  103.233.122.79
@@ -3620,26 +3105,23 @@
  103.233.2.162
  103.233.3.137
  103.233.5.24
-103.233.65.158
-103.233.68.9
-103.233.76.246
  103.233.80.154
  103.233.80.25
  103.233.80.26
+103.233.95.3
  103.234.137.130
  103.234.139.86
-103.234.21.3
  103.234.220.195
  103.234.220.197
+103.234.226.111
  103.234.254.10
  103.234.254.164
-103.234.40.145
-103.234.94.45
  103.235.164.110
-103.235.164.28
  103.235.164.9
+103.235.165.159
  103.235.165.163
  103.235.170.162
+103.235.170.195
  103.235.197.42
  103.235.198.60
  103.235.199.46
@@ -3649,7 +3131,6 @@
  103.235.230.196
  103.235.232.218
  103.236.114.38
-103.236.152.228
  103.236.160.129
  103.236.161.11
  103.236.161.12
@@ -3669,14 +3150,15 @@
  103.236.162.206
  103.236.179.162
  103.236.201.88
-103.236.252.80
  103.236.253.28
-103.236.254.101
-103.236.254.18
  103.237.144.150
  103.237.144.182
  103.237.145.182
  103.237.36.82
+103.237.38.215
+103.237.56.36
+103.237.58.102
+103.237.58.227
  103.237.58.59
  103.238.14.242
  103.238.203.168
@@ -3690,36 +3172,27 @@
  103.238.69.169
  103.239.147.129
  103.239.19.142
-103.239.204.57
  103.239.252.234
-103.239.252.66
  103.239.253.161
  103.239.254.114
  103.239.254.70
  103.239.255.170
-103.239.29.171
  103.239.29.196
-103.239.29.219
-103.239.29.229
  103.239.55.73
  103.24.107.234
-103.24.107.75
-103.24.110.174
  103.24.110.89
  103.24.177.84
  103.24.177.95
  103.24.179.138
  103.24.179.85
-103.24.75.8
  103.24.97.250
-103.240.100.100
  103.240.100.106
  103.240.100.214
  103.240.160.21
  103.240.161.101
  103.240.161.108
+103.240.161.109
  103.240.168.138
-103.240.202.37
  103.240.206.196
  103.240.237.61
  103.240.250.169
@@ -3763,26 +3236,17 @@
  103.242.107.226
  103.242.107.241
  103.242.107.82
-103.242.119.230
+103.242.119.217
  103.242.132.33
  103.242.14.68
  103.242.14.8
  103.242.15.37
  103.242.168.14
-103.242.173.118
  103.242.180.65
  103.242.2.176
-103.242.224.105
-103.242.224.107
-103.242.224.98
-103.242.239.123
  103.242.45.68
  103.242.56.122
  103.242.56.137
-103.242.60.33
-103.242.60.39
-103.242.61.214
-103.242.62.23
  103.242.66.56
  103.242.72.7
  103.243.115.230
@@ -3796,19 +3260,13 @@
  103.243.25.92
  103.243.27.175
  103.243.27.23
-103.243.44.61
  103.243.46.6
-103.243.46.95
  103.243.81.252
  103.243.82.198
  103.243.82.234
  103.244.108.160
  103.244.177.250
-103.244.193.25
  103.244.205.146
-103.244.241.176
-103.244.6.102
-103.244.80.148
  103.245.181.2
  103.245.189.38
  103.245.19.202
@@ -3831,14 +3289,11 @@
  103.246.1.220
  103.246.1.222
  103.246.106.118
-103.246.113.9
-103.246.161.146
  103.246.240.26
  103.246.240.30
  103.246.245.253
  103.247.13.129
  103.247.13.45
-103.247.142.178
  103.247.151.109
  103.247.151.117
  103.247.151.122
@@ -3856,7 +3311,6 @@
  103.247.151.88
  103.247.151.91
  103.247.162.218
-103.247.196.147
  103.247.216.121
  103.247.216.17
  103.247.217.162
@@ -3868,20 +3322,14 @@
  103.247.22.133
  103.247.22.150
  103.247.22.161
-103.248.119.110
  103.248.14.26
-103.248.172.17
-103.248.175.15
  103.248.219.172
  103.248.248.146
  103.248.33.51
  103.248.85.244
-103.249.132.236
-103.249.132.238
-103.249.132.239
  103.249.133.51
  103.249.155.109
-103.249.155.137
+103.249.155.141
  103.249.155.145
  103.249.155.149
  103.249.155.169
@@ -3890,10 +3338,6 @@
  103.249.155.197
  103.249.155.245
  103.249.155.97
-103.249.192.70
-103.249.192.87
-103.249.207.22
-103.249.239.230
  103.249.28.142
  103.249.28.195
  103.249.28.87
@@ -3907,20 +3351,18 @@
  103.25.123.193
  103.25.123.197
  103.25.128.55
-103.25.128.75
  103.25.130.114
+103.25.132.150
+103.25.134.147
+103.25.134.158
  103.25.134.34
-103.25.155.202
+103.25.167.200
  103.25.21.34
  103.25.3.82
+103.25.36.194
  103.25.45.38
-103.25.81.4
  103.25.84.109
-103.25.84.154
-103.25.84.176
-103.25.84.207
  103.250.148.82
-103.250.15.155
  103.250.152.30
  103.250.153.203
  103.250.156.22
@@ -3938,7 +3380,6 @@
  103.250.166.4
  103.250.167.226
  103.250.184.59
-103.250.69.86
  103.250.69.94
  103.250.71.33
  103.251.189.129
@@ -3951,8 +3392,6 @@
  103.251.221.101
  103.251.221.17
  103.251.221.21
-103.251.221.219
-103.251.221.222
  103.251.221.25
  103.251.221.29
  103.251.221.33
@@ -3977,17 +3416,15 @@
  103.251.45.235
  103.251.57.23
  103.251.59.116
-103.251.60.4
  103.251.83.14
  103.252.117.100
+103.252.117.51
  103.252.13.13
  103.252.13.153
  103.252.16.224
-103.252.168.75
  103.252.19.30
  103.252.196.150
-103.252.219.163
-103.252.52.68
+103.253.105.34
  103.253.113.54
  103.253.14.43
  103.253.140.66
@@ -3997,14 +3434,13 @@
  103.253.146.142
  103.253.146.56
  103.253.146.88
+103.253.146.90
  103.253.153.21
  103.253.154.155
  103.253.154.52
  103.253.2.185
  103.253.200.161
  103.253.208.96
-103.253.238.234
-103.253.251.238
  103.253.27.108
  103.253.41.63
  103.253.41.98
@@ -4014,10 +3450,10 @@
  103.253.73.158
  103.253.73.192
  103.253.73.196
-103.254.113.98
  103.254.12.207
  103.254.155.207
  103.254.167.74
+103.254.185.233
  103.254.185.6
  103.254.198.67
  103.254.207.197
@@ -4026,37 +3462,30 @@
  103.254.94.190
  103.254.94.91
  103.255.121.135
-103.255.122.5
  103.255.146.202
  103.255.15.24
  103.255.191.76
-103.255.234.251
  103.255.237.203
  103.255.237.7
  103.255.53.98
-103.255.74.208
+103.255.74.112
  103.255.74.51
  103.26.136.173
  103.26.213.117
  103.26.213.151
-103.26.213.228
  103.26.213.37
  103.26.246.122
  103.26.40.145
-103.26.87.0
  103.27.108.113
  103.27.109.164
  103.27.109.166
  103.27.202.58
-103.27.203.79
  103.27.236.10
  103.27.239.185
  103.27.239.216
-103.27.32.42
  103.27.32.8
  103.27.4.161
  103.27.61.222
-103.27.7.85
  103.27.79.136
  103.27.79.185
  103.28.112.2
@@ -4067,23 +3496,16 @@
  103.28.149.180
  103.28.149.201
  103.28.149.72
-103.28.161.26
  103.28.21.133
  103.28.22.27
  103.28.36.173
+103.28.36.185
  103.28.37.131
  103.28.52.84
  103.28.52.93
  103.28.53.138
  103.28.56.214
  103.28.57.122
-103.28.60.220
-103.28.60.225
-103.28.60.245
-103.28.60.253
-103.28.60.33
-103.28.60.36
-103.28.70.87
  103.28.84.31
  103.28.86.241
  103.29.156.142
@@ -4100,16 +3522,14 @@
  103.29.70.69
  103.29.90.134
  103.3.21.53
+103.3.222.97
  103.3.46.213
  103.3.46.92
-103.3.65.162
  103.30.0.249
  103.30.0.5
-103.30.149.153
  103.30.151.17
  103.30.183.173
  103.30.188.130
-103.30.190.58
  103.30.40.248
  103.30.92.91
  103.30.93.170
@@ -4129,6 +3549,7 @@
  103.31.227.158
  103.31.227.183
  103.31.227.29
+103.31.232.173
  103.31.232.93
  103.31.250.122
  103.31.250.197
@@ -4146,16 +3567,15 @@
  103.35.109.142
  103.35.111.101
  103.35.111.102
+103.35.123.224
  103.35.132.50
-103.35.146.52
  103.35.171.178
-103.35.173.132
+103.35.64.12
  103.35.64.36
  103.35.74.74
  103.36.10.5
  103.36.100.248
  103.36.101.8
-103.36.103.48
  103.36.11.161
  103.36.11.162
  103.36.11.164
@@ -4170,16 +3590,11 @@
  103.36.35.135
  103.36.48.103
  103.36.48.110
-103.36.84.180
  103.36.9.7
  103.36.92.112
  103.37.205.47
  103.37.82.38
  103.38.102.182
-103.38.13.207
-103.38.14.217
-103.38.235.28
-103.38.235.44
  103.38.24.46
  103.38.25.130
  103.38.25.138
@@ -4201,19 +3616,17 @@
  103.38.25.218
  103.38.25.226
  103.38.67.13
-103.38.89.49
-103.39.117.68
  103.39.131.88
  103.39.133.156
  103.39.15.232
  103.39.212.96
  103.39.213.170
+103.39.214.102
  103.39.214.9
  103.39.214.93
-103.39.215.2
+103.39.220.205
  103.39.235.166
  103.39.236.214
-103.39.237.158
  103.39.29.101
  103.4.146.220
  103.4.147.82
@@ -4224,17 +3637,14 @@
  103.4.233.93
  103.4.234.39
  103.4.94.178
-103.40.123.18
  103.40.160.194
-103.40.162.226
  103.40.162.37
+103.40.172.173
  103.40.172.174
+103.40.172.189
  103.40.172.190
-103.40.187.34
  103.40.194.111
  103.40.197.163
-103.40.203.21
-103.40.21.41
  103.40.22.97
  103.40.240.244
  103.40.241.21
@@ -4247,7 +3657,6 @@
  103.40.248.195
  103.40.248.203
  103.40.249.242
-103.40.73.134
  103.40.8.183
  103.40.8.188
  103.40.8.192
@@ -4260,25 +3669,20 @@
  103.40.8.93
  103.41.106.89
  103.41.147.137
-103.41.164.71
  103.41.177.33
  103.41.177.35
  103.41.212.186
+103.41.27.14
+103.41.27.167
  103.41.27.67
  103.41.28.70
  103.41.28.98
  103.41.29.134
-103.41.31.25
  103.41.66.179
  103.41.66.250
-103.41.67.202
  103.41.96.94
-103.42.126.68
-103.42.126.99
-103.42.127.5
-103.42.127.78
-103.42.127.84
  103.42.162.30
+103.42.195.70
  103.42.214.181
  103.42.216.92
  103.42.217.74
@@ -4291,7 +3695,6 @@
  103.42.254.108
  103.42.254.194
  103.42.56.116
-103.42.74.42
  103.43.129.227
  103.43.151.46
  103.43.16.146
@@ -4299,102 +3702,60 @@
  103.43.185.142
  103.43.185.166
  103.43.202.18
-103.43.203.212
  103.43.42.85
  103.43.93.26
  103.44.12.37
  103.44.13.246
  103.44.136.9
-103.44.139.216
-103.44.139.230
-103.44.139.55
  103.44.14.129
-103.44.144.4
-103.44.164.33
+103.44.15.193
  103.44.18.233
  103.44.18.248
-103.44.240.67
  103.44.243.5
  103.44.245.166
  103.44.246.33
  103.44.248.252
  103.44.253.18
-103.44.254.237
  103.44.27.65
  103.44.28.78
  103.44.50.114
  103.44.50.121
  103.44.50.125
  103.45.102.170
-103.45.103.181
  103.45.103.207
  103.45.107.149
  103.45.112.197
  103.45.115.211
-103.45.115.96
-103.45.116.183
  103.45.116.188
-103.45.118.124
-103.45.118.136
-103.45.118.45
-103.45.128.242
  103.45.128.37
  103.45.130.32
-103.45.131.11
  103.45.131.47
  103.45.150.170
-103.45.172.11
-103.45.173.167
-103.45.173.18
-103.45.174.210
-103.45.174.218
  103.45.175.158
  103.45.175.247
-103.45.176.4
-103.45.176.61
-103.45.180.157
-103.45.182.128
-103.45.182.133
-103.45.182.140
-103.45.182.22
-103.45.183.104
-103.45.183.110
-103.45.183.119
-103.45.183.226
-103.45.183.27
-103.45.183.47
-103.45.183.70
  103.45.184.227
-103.45.185.118
  103.45.185.45
-103.45.187.100
  103.45.188.134
-103.45.189.20
  103.45.189.232
  103.45.190.126
  103.45.190.6
  103.45.190.70
-103.45.249.170
  103.46.128.41
  103.46.128.43
  103.46.234.129
  103.46.239.133
-103.47.104.248
+103.46.242.210
+103.47.104.243
  103.47.14.246
-103.47.150.11
  103.47.17.16
-103.47.19.79
-103.47.216.182
  103.47.216.248
  103.47.217.245
  103.47.217.45
  103.47.218.76
  103.47.219.114
  103.47.219.127
-103.47.219.154
  103.47.219.243
  103.47.219.249
-103.47.66.154
  103.47.92.17
  103.47.92.33
  103.47.93.113
@@ -4417,7 +3778,6 @@
  103.47.94.34
  103.47.94.97
  103.48.119.116
-103.48.180.104
  103.48.180.131
  103.48.181.189
  103.48.183.113
@@ -4425,21 +3785,15 @@
  103.48.186.125
  103.48.192.48
  103.48.193.7
-103.48.25.131
  103.48.25.195
-103.48.25.250
-103.48.27.10
-103.49.153.141
  103.49.28.58
  103.49.28.64
  103.49.53.129
-103.5.144.98
+103.49.62.182
  103.5.191.150
-103.5.6.37
  103.5.72.15
  103.50.148.129
  103.50.150.225
-103.50.152.226
  103.50.162.156
  103.50.170.105
  103.50.170.113
@@ -4447,7 +3801,6 @@
  103.50.170.121
  103.50.170.13
  103.50.170.137
-103.50.170.177
  103.50.170.181
  103.50.170.197
  103.50.170.201
@@ -4461,17 +3814,16 @@
  103.50.170.81
  103.50.170.9
  103.50.170.97
-103.50.255.24
  103.51.12.206
  103.51.12.32
+103.51.136.246
+103.51.139.153
  103.51.139.82
  103.51.145.196
  103.51.145.214
  103.51.146.22
  103.51.146.63
  103.51.153.218
-103.51.192.102
-103.51.28.222
  103.51.44.17
  103.51.44.221
  103.51.44.253
@@ -4492,52 +3844,26 @@
  103.52.209.81
  103.52.211.186
  103.52.211.206
-103.52.216.127
-103.52.216.136
-103.52.216.170
-103.52.216.181
-103.52.216.216
-103.52.216.40
-103.52.216.52
-103.52.216.85
-103.52.217.100
-103.52.217.123
-103.52.217.136
-103.52.217.138
-103.52.217.139
-103.52.217.150
  103.52.217.157
-103.52.217.17
-103.52.217.172
-103.52.217.227
-103.52.217.236
-103.52.217.57
-103.52.217.65
-103.52.217.89
  103.52.220.1
  103.52.250.99
  103.52.37.1
  103.52.37.65
  103.53.0.178
  103.53.110.45
-103.53.113.238
-103.53.168.112
-103.53.171.164
+103.53.113.10
  103.53.197.158
  103.53.197.202
  103.53.197.211
  103.53.197.78
  103.53.198.89
  103.53.199.244
-103.53.208.224
-103.53.208.225
  103.53.225.47
  103.53.229.239
  103.53.229.41
  103.53.231.144
  103.53.27.1
  103.53.41.195
-103.53.44.85
  103.53.76.82
  103.54.101.28
  103.54.12.194
@@ -4546,7 +3872,6 @@
  103.54.148.54
  103.54.148.58
  103.54.19.137
-103.54.202.220
  103.54.221.122
  103.54.28.234
  103.54.28.43
@@ -4557,27 +3882,21 @@
  103.55.144.70
  103.55.190.65
  103.55.191.113
+103.55.191.141
  103.55.24.37
-103.55.26.207
  103.55.33.21
  103.55.33.76
  103.55.36.28
-103.55.37.38
-103.55.91.131
  103.56.113.172
  103.56.115.142
  103.56.115.156
  103.56.115.76
-103.56.158.12
  103.56.191.87
-103.56.199.229
  103.56.205.114
-103.56.207.182
  103.56.207.230
  103.56.207.81
+103.56.235.186
  103.56.43.225
-103.56.61.21
-103.56.77.104
  103.57.120.249
  103.57.121.10
  103.57.123.1
@@ -4587,7 +3906,6 @@
  103.57.220.28
  103.57.222.230
  103.57.254.49
-103.57.43.170
  103.57.70.231
  103.57.70.248
  103.57.71.137
@@ -4614,7 +3932,6 @@
  103.57.83.192
  103.57.83.224
  103.57.85.244
-103.58.144.60
  103.58.16.106
  103.58.16.254
  103.58.17.246
@@ -4626,10 +3943,7 @@
  103.58.74.2
  103.58.92.14
  103.59.103.87
-103.59.113.128
  103.59.134.166
-103.59.149.92
-103.59.151.21
  103.59.190.2
  103.59.190.209
  103.59.200.14
@@ -4637,17 +3951,9 @@
  103.59.200.58
  103.59.38.130
  103.6.104.104
-103.6.133.42
-103.6.133.45
-103.6.140.230
  103.6.150.17
  103.6.184.222
-103.6.198.246
  103.6.219.60
-103.6.6.90
-103.60.114.19
-103.60.114.211
-103.60.114.9
  103.60.125.66
  103.60.137.117
  103.60.173.250
@@ -4666,14 +3972,12 @@
  103.61.198.234
  103.62.141.133
  103.62.144.152
-103.62.235.11
-103.62.48.227
  103.63.108.25
  103.63.158.153
  103.63.2.148
  103.63.2.210
-103.64.13.131
  103.65.182.26
+103.65.238.115
  103.65.28.230
  103.66.176.45
  103.66.176.81
@@ -4682,6 +3986,7 @@
  103.66.178.43
  103.66.212.153
  103.66.218.41
+103.66.219.242
  103.66.232.1
  103.66.232.201
  103.66.232.5
@@ -4692,34 +3997,31 @@
  103.66.47.126
  103.66.68.82
  103.66.69.74
-103.66.76.174
-103.66.77.78
-103.66.79.29
+103.66.79.223
  103.66.96.230
-103.67.15.35
-103.67.152.211
  103.67.16.6
  103.67.17.1
  103.67.235.10
-103.67.235.28
+103.67.235.119
  103.67.235.8
  103.68.0.114
  103.68.0.188
-103.68.0.67
  103.68.1.194
  103.68.1.46
  103.68.181.35
  103.68.206.91
  103.68.250.2
  103.68.3.187
-103.68.34.185
  103.68.35.162
  103.68.35.166
  103.68.54.66
-103.68.9.150
+103.68.9.118
  103.69.118.77
  103.69.124.247
  103.69.125.151
+103.69.186.11
+103.69.186.14
+103.69.193.48
  103.69.194.114
  103.69.20.100
  103.69.20.108
@@ -4733,23 +4035,20 @@
  103.69.21.128
  103.69.21.192
  103.69.216.138
-103.69.216.24
  103.69.220.11
  103.69.224.57
-103.69.245.55
  103.69.44.211
-103.7.248.122
  103.7.8.105
  103.70.128.23
  103.70.130.24
  103.70.130.26
-103.70.131.59
  103.70.142.87
  103.70.145.211
  103.70.146.106
-103.70.191.124
+103.70.196.21
  103.70.196.210
  103.70.196.243
+103.70.196.41
  103.70.204.1
  103.70.204.194
  103.70.204.201
@@ -4760,40 +4059,31 @@
  103.70.220.145
  103.70.77.18
  103.70.79.2
-103.71.192.38
-103.71.192.40
  103.71.236.244
  103.71.239.144
  103.71.252.18
-103.72.11.188
  103.72.144.228
  103.72.166.55
-103.72.168.71
  103.72.172.20
  103.72.221.125
  103.72.4.148
  103.73.101.126
-103.73.101.14
  103.73.101.250
  103.73.102.130
-103.73.152.220
  103.73.152.24bin.sh
  103.73.153.35
-103.73.155.81
  103.73.162.156
+103.73.182.109
  103.73.182.234
  103.73.183.40
  103.73.254.200
  103.73.35.38
  103.73.65.116
-103.73.66.130
  103.73.66.182
  103.73.66.188
  103.73.66.242
  103.73.66.251
  103.73.66.68
-103.73.68.219
-103.73.96.111
  103.74.108.145
  103.74.111.76
  103.74.120.101
@@ -4802,7 +4092,6 @@
  103.74.123.158
  103.74.227.130
  103.74.227.177
-103.74.244.157
  103.74.244.244
  103.74.245.185
  103.74.246.110
@@ -4811,7 +4100,6 @@
  103.75.1.198
  103.75.1.252
  103.75.101.59
-103.75.125.226
  103.75.148.103
  103.75.148.17
  103.75.148.203
@@ -4823,13 +4111,10 @@
  103.75.149.97
  103.75.161.38
  103.75.180.242
-103.75.182.8
-103.75.189.154
+103.75.188.154
  103.75.190.11
  103.75.208.53
  103.75.217.122
-103.75.217.210
-103.75.218.18
  103.75.225.101
  103.75.225.37
  103.75.225.45
@@ -4837,12 +4122,10 @@
  103.75.27.250
  103.75.27.86
  103.75.33.195
-103.76.14.244
  103.76.14.250
  103.76.148.239
  103.76.148.241
  103.76.16.193
-103.76.172.162
  103.76.172.230
  103.76.175.130
  103.76.175.88
@@ -4856,6 +4139,7 @@
  103.76.189.1
  103.76.190.1
  103.76.190.129
+103.76.190.153
  103.76.190.193
  103.76.190.209
  103.76.190.210
@@ -4867,7 +4151,6 @@
  103.76.201.181
  103.76.201.246
  103.76.204.26
-103.76.208.98
  103.76.21.58
  103.76.228.45
  103.76.252.6
@@ -4876,16 +4159,12 @@
  103.76.50.41
  103.76.50.58
  103.76.50.86
-103.76.53.42
  103.76.85.149
  103.77.107.190
-103.77.11.226
-103.77.157.24
  103.77.159.59
  103.77.189.122
  103.77.189.126
  103.77.20.1
-103.77.202.169
  103.77.23.129
  103.77.23.137
  103.77.23.141
@@ -4896,36 +4175,25 @@
  103.77.23.241
  103.77.23.9
  103.77.37.110
-103.77.37.131
-103.77.37.141
-103.77.37.145
-103.77.37.151
-103.77.37.171
-103.77.37.173
-103.77.37.188
  103.77.49.194
  103.77.8.129
  103.77.8.149
-103.78.113.64
  103.78.114.250
  103.78.133.219
-103.78.141.187
  103.78.141.27
  103.78.143.4
-103.78.15.226
  103.78.150.32
  103.78.151.117
  103.78.151.222
  103.78.16.194
  103.78.164.201
-103.78.168.105
+103.78.180.147
  103.78.180.97
  103.78.210.205
  103.78.213.73
  103.78.219.237
  103.78.23.26
  103.78.23.58
-103.78.242.19
  103.78.25.206
  103.78.254.78
  103.78.254.82
@@ -4943,33 +4211,29 @@
  103.78.27.62
  103.78.37.102
  103.78.37.98
-103.78.38.158
  103.78.38.34
-103.78.73.92
+103.78.73.91
+103.78.73.93
  103.78.81.186
  103.78.81.227
-103.78.88.117
-103.78.9.44
  103.78.98.234
  103.79.117.5
-103.79.141.107
  103.79.141.158
-103.79.169.129
  103.79.169.153
  103.79.170.241
-103.79.170.244
  103.79.176.31
-103.79.221.146
-103.79.35.102
  103.79.35.159
  103.79.35.176
  103.79.35.192
+103.79.35.194
  103.79.74.26
  103.79.74.3
+103.79.77.44
  103.79.90.72
  103.8.115.27
  103.8.119.166
  103.8.119.17
+103.8.12.100
  103.8.195.34
  103.8.250.211
  103.8.27.10
@@ -4979,7 +4243,6 @@
  103.80.167.205
  103.80.36.34
  103.80.51.61
-103.80.55.29
  103.80.70.254
  103.80.83.161
  103.81.104.141
@@ -4989,21 +4252,14 @@
  103.81.104.93
  103.81.114.182
  103.81.153.133
-103.81.171.227
+103.81.215.34
  103.81.223.227
-103.81.93.230
  103.82.11.209
  103.82.11.237
-103.82.143.84
  103.82.143.89
  103.82.145.110
  103.82.145.111
-103.82.145.79
  103.82.146.154
-103.82.147.222
-103.82.147.33
-103.82.223.90
-103.82.233.2
  103.82.24.179
  103.82.24.89
  103.82.241.2
@@ -5011,24 +4267,18 @@
  103.82.54.154
  103.82.54.88
  103.82.55.64
-103.82.66.115
  103.82.67.158
-103.82.67.40
-103.82.67.51
  103.82.8.189
  103.82.8.193
  103.82.8.197
  103.82.8.201
  103.82.81.18
-103.82.81.91
  103.82.98.151
  103.82.98.170
  103.82.99.37
  103.83.109.228
  103.83.110.21
  103.83.116.202
-103.83.118.10
-103.83.144.99
  103.83.156.112
  103.83.156.113
  103.83.156.138
@@ -5047,34 +4297,26 @@
  103.83.179.153
  103.83.179.154
  103.83.179.156
-103.83.184.52
  103.83.185.1
  103.83.185.193
  103.83.187.250
  103.83.205.57
  103.83.79.69
+103.83.81.152
  103.83.95.82
-103.84.109.18
-103.84.110.133
  103.84.131.14
-103.84.131.243
  103.84.134.1
  103.84.134.9
-103.84.164.87
  103.84.238.3
-103.84.240.237
-103.84.241.117
  103.84.241.145
+103.84.241.63
  103.84.241.74
  103.84.37.142
-103.84.38.243
  103.84.63.5
  103.84.84.250
-103.85.125.86
  103.85.149.195
  103.85.150.201
  103.85.150.253
-103.85.162.62
  103.85.204.181
  103.85.205.93
  103.85.228.243
@@ -5084,7 +4326,6 @@
  103.85.67.114
  103.85.67.169
  103.85.67.94
-103.85.84.193
  103.86.1.17
  103.86.1.2
  103.86.1.22
@@ -5093,21 +4334,17 @@
  103.86.1.34
  103.86.1.41
  103.86.1.9
-103.86.103.85
  103.86.130.43
-103.86.132.253
  103.86.134.194
  103.86.135.42
  103.86.135.62
  103.86.155.102
  103.86.155.78
-103.86.158.210
  103.86.160.29
  103.86.161.243
  103.86.180.10
  103.86.195.186
  103.86.195.190
-103.86.197.219
  103.86.200.144
  103.86.44.122
  103.86.49.11
@@ -5117,10 +4354,17 @@
  103.86.70.222
  103.86.86.71
  103.87.160.177
+103.87.168.125
+103.87.168.179
  103.87.168.30
+103.87.169.235
+103.87.170.108
  103.87.170.110
  103.87.170.119
-103.87.173.139
+103.87.171.157
+103.87.171.160
+103.87.171.196
+103.87.171.37
  103.87.174.54
  103.87.206.101
  103.87.206.249
@@ -5133,14 +4377,11 @@
  103.87.237.41
  103.87.25.106
  103.87.25.193
-103.87.25.42
  103.87.251.146
  103.87.26.125
  103.87.48.1
  103.87.48.45
  103.87.48.57
-103.87.49.202
-103.87.49.60
  103.88.127.46
  103.88.169.6
  103.88.221.105
@@ -5151,14 +4392,12 @@
  103.89.176.73
  103.89.176.74
  103.89.252.123
-103.89.252.222
  103.89.254.138
  103.89.5.116
  103.89.5.26
-103.89.57.131
  103.89.84.202
  103.89.88.39
-103.89.89.248
+103.89.89.210
  103.89.90.115
  103.89.90.17
  103.89.91.205
@@ -5169,34 +4408,27 @@
  103.9.114.230
  103.9.115.38
  103.9.124.210
-103.9.125.60
  103.9.134.114
  103.9.134.196
  103.9.174.120
  103.9.188.229
-103.9.191.215
-103.9.227.110
  103.9.227.210
  103.9.79.132
+103.90.145.196
  103.90.190.54
  103.90.200.226
+103.90.203.152
  103.90.220.97
  103.90.228.121
  103.90.228.165
  103.90.233.35
-103.90.237.212
-103.90.237.254
  103.90.248.9
-103.90.72.211
-103.91.123.148
  103.91.128.182
  103.91.130.1
+103.91.16.36
  103.91.17.136
  103.91.172.224
-103.91.176.170
-103.91.176.171
  103.91.181.25
-103.91.204.30
  103.91.210.187
  103.91.245.11
  103.91.245.12bin.sh
@@ -5209,24 +4441,17 @@
  103.91.245.27bin.sh
  103.91.245.28
  103.91.245.3
-103.91.245.30
  103.91.245.3bin.sh
  103.91.245.41
  103.91.245.44
  103.91.245.45
+103.91.245.47
  103.91.245.5
-103.91.245.54
+103.91.245.55
  103.91.53.18
-103.91.65.216
  103.91.65.55
-103.91.66.99
-103.91.90.101
-103.91.90.103
-103.91.90.186
  103.91.90.221
-103.91.90.99
  103.92.101.178
-103.92.121.218
  103.92.212.1
  103.92.212.17
  103.92.212.242
@@ -5237,31 +4462,22 @@
  103.92.213.41
  103.92.214.1
  103.92.225.95
-103.92.225.98
  103.92.24.248
  103.92.25.90
  103.92.25.95
  103.92.26.252
-103.92.29.247
  103.92.29.50
  103.93.17.149
  103.93.17.208
  103.93.180.102
  103.93.181.10
  103.93.220.182
-103.93.51.30
-103.93.97.214
  103.94.0.178
  103.94.121.27
-103.94.135.178
-103.94.139.183
  103.94.16.129
-103.94.172.102
-103.94.180.72
  103.94.2.110
  103.94.6.18
  103.94.6.69
-103.94.65.230
  103.94.7.250
  103.94.7.254
  103.95.207.30
@@ -5280,20 +4496,14 @@
  103.95.99.229
  103.96.149.187
  103.96.220.115
-103.96.221.192
  103.96.232.202
-103.96.43.115
-103.96.46.148
  103.96.73.160
  103.96.73.208
-103.97.100.15
  103.97.124.53
-103.97.138.192
-103.97.138.251
-103.97.138.63
+103.97.136.37
+103.97.138.100
  103.97.164.98
  103.97.179.141
-103.97.213.136
  103.97.240.193
  103.97.240.201
  103.97.240.217
@@ -5309,12 +4519,8 @@
  103.97.243.241
  103.97.243.81
  103.97.3.164
-103.97.3.65
  103.97.3.83
  103.97.6.230
-103.97.63.5
-103.98.109.181
-103.98.112.218
  103.98.120.89
  103.98.128.51
  103.98.14.77
@@ -5324,12 +4530,9 @@
  103.98.17.94
  103.98.176.188
  103.98.19.22
-103.98.19.39
-103.99.0.36
  103.99.1.31
-103.99.109.123
+103.99.1.48
  103.99.149.250
-103.99.15.136
  103.99.168.100
  103.99.168.130
  103.99.168.140
@@ -5338,18 +4541,16 @@
  103.99.170.220
  103.99.176.32
  103.99.177.247
+103.99.189.254
+103.99.189.37
  103.99.196.212
+103.99.197.139
  103.99.197.150
  103.99.198.182
-103.99.207.129
  103.99.207.151
-103.99.207.158
  103.99.207.179
-103.99.207.183
  103.99.207.219
-103.99.207.99
  103.99.251.189
-103.99.26.161
  1030408.servicesndt1.club
  103298943.snapchatprime.com
  10350.psdzy.com
@@ -5359,8 +4560,8 @@
  104.12.66.70
  104.128.172.37
  104.128.228.113
+104.128.228.69
  104.128.237.22
-104.128.35.50
  104.128.48.202
  104.128.65.89
  104.128.92.120
@@ -5368,6 +4569,7 @@
  104.128.95.31
  104.129.13.74
  104.129.131.148
+104.129.15.142
  104.129.15.161
  104.129.171.121
  104.129.184.232
@@ -5402,21 +4604,22 @@
  104.129.206.103
  104.129.206.111
  104.129.206.176
+104.129.255.134
  104.129.255.137
  104.129.3.234
  104.129.4.186
-104.129.40.143
  104.129.40.156
-104.129.41.139
+104.129.40.83
  104.129.48.14
  104.129.48.23
  104.129.48.52
  104.129.61.39
  104.129.9.12
+104.129.9.13
  104.129.9.166
+104.129.9.23
  104.129.9.26
  104.129.9.39
-104.129.9.44
  104.129.9.51
  104.129.9.6
  104.130.11.17
@@ -5461,7 +4664,7 @@
  104.131.112.44
  104.131.114.87
  104.131.115.14
-104.131.118.197
+104.131.118.34
  104.131.12.181
  104.131.12.184
  104.131.123.210
@@ -5473,10 +4676,10 @@
  104.131.131.140
  104.131.135.41
  104.131.136.164
+104.131.138.121
  104.131.140.246
  104.131.142.224
  104.131.150.100
-104.131.150.216
  104.131.150.35
  104.131.154.154
  104.131.156.223
@@ -5532,7 +4735,6 @@
  104.131.40.97
  104.131.41.185
  104.131.41.46
-104.131.43.102
  104.131.44.150
  104.131.45.150
  104.131.45.190
@@ -5585,11 +4787,9 @@
  104.131.92.77
  104.131.93.1
  104.131.93.254
-104.131.96.46
  104.131.97.47
  104.131.98.30
  104.139.74.25
-104.140.102.10
  104.140.103.118
  104.140.103.41
  104.140.114.103
@@ -5599,34 +4799,18 @@
  104.140.151.116
  104.140.18.100
  104.140.18.106
-104.140.188.10
-104.140.188.14
-104.140.188.18
-104.140.188.2
-104.140.188.22
-104.140.188.26
-104.140.188.30
-104.140.188.34
-104.140.188.38
-104.140.188.42
-104.140.188.46
-104.140.188.50
-104.140.188.54
-104.140.188.58
  104.140.188.6
  104.140.242.35
-104.140.242.37
  104.140.242.38
+104.140.242.43
  104.140.242.72
  104.140.245.66
-104.140.246.251
  104.140.83.182
+104.140.83.225
  104.140.83.230
  104.140.83.252
-104.140.83.58
  104.143.14.92
  104.143.2.195
-104.143.83.242
  104.144.103.105
  104.144.103.109
  104.144.103.110
@@ -5688,6 +4872,7 @@
  104.144.180.220
  104.144.180.221
  104.144.180.222
+104.144.183.105
  104.144.185.94
  104.144.19.226
  104.144.191.18
@@ -5697,6 +4882,7 @@
  104.144.202.140
  104.144.202.226
  104.144.203.26
+104.144.206.159
  104.144.207.207
  104.144.207.229
  104.144.210.151
@@ -5715,7 +4901,6 @@
  104.144.210.62
  104.144.210.8
  104.144.213.105
-104.144.213.106
  104.144.215.74
  104.144.217.142
  104.144.22.133
@@ -5733,18 +4918,17 @@
  104.144.22.232
  104.144.22.237
  104.144.22.242
+104.144.22.250
  104.144.22.251
  104.144.220.11
  104.144.220.14
  104.144.227.70
  104.144.228.225
  104.144.228.226
-104.144.230.23
  104.144.236.25
-104.144.236.63
  104.144.248.190
  104.144.248.217
-104.144.249.122
+104.144.249.125
  104.144.249.7
  104.144.249.72
  104.144.250.254
@@ -5777,6 +4961,7 @@
  104.144.83.45
  104.144.83.47
  104.144.83.9
+104.144.91.62
  104.145.225.68
  104.145.225.69
  104.145.225.70
@@ -5829,23 +5014,19 @@
  104.148.100.157
  104.148.114.139
  104.148.124.120
-104.148.18.187
  104.148.41.165
-104.148.5.120
-104.148.5.125
  104.148.57.2
  104.148.64.26
+104.149.134.114
  104.149.134.218
  104.149.141.66
  104.149.213.18
  104.149.50.108
  104.152.168.29
  104.152.191.110
-104.152.59.111
  104.152.59.121
  104.153.101.197
  104.153.102.152
-104.153.103.134
  104.153.109.243
  104.153.96.154
  104.154.147.52
@@ -5889,19 +5070,19 @@
  104.156.227.84
  104.156.230.231
  104.156.237.22
+104.156.237.36
  104.156.239.55
  104.156.245.57
  104.156.250.138
  104.156.251.135
  104.156.59.29
  104.156.62.228
-104.157.12.31
-104.157.61.95
-104.158.198.141
-104.158.231.22
+104.159.241.170
+104.160.11.176
  104.160.11.177
  104.160.14.181
  104.160.14.196
+104.160.14.201
  104.160.14.215
  104.160.15.121
  104.160.15.233
@@ -5921,7 +5102,6 @@
  104.167.114.241
  104.167.12.146
  104.167.2.39
-104.167.85.18
  104.167.9.194
  104.168.102.178
  104.168.115.184
@@ -5938,7 +5118,7 @@
  104.168.169.224
  104.168.170.195
  104.168.170.196
-104.168.170.80
+104.168.171.41
  104.168.173.110
  104.168.173.244
  104.168.173.248
@@ -5952,7 +5132,7 @@
  104.168.211.161
  104.168.213.6
  104.168.214.20
-104.168.219.179
+104.168.218.91
  104.168.219.72
  104.168.234.200
  104.168.242.175
@@ -5969,41 +5149,39 @@
  104.168.44.166
  104.168.51.151
  104.168.51.155
+104.168.51.157
  104.168.52.171
  104.168.65.162
  104.168.65.220
-104.168.71.124
  104.168.82.4
+104.168.82.5
  104.168.82.51
  104.168.86.222
+104.168.92.82
  104.168.94.130
  104.168.96.11
  104.168.96.168
-104.168.99.116
  104.168.99.168
  104.168.99.220
-104.171.114.170
  104.171.124.226
  104.171.242.155
  104.171.250.233
  104.172.138.77
-104.174.61.206
  104.175.168.148
  104.175.99.243
-104.178.56.243
  104.182.129.38
+104.182.205.241
  104.183.217.130
  104.192.0.122
  104.192.0.18
  104.192.0.226
-104.192.1.154
  104.192.102.43
  104.192.103.3
  104.192.103.78
  104.192.108.19
  104.192.2.58
-104.192.225.34
  104.192.5.49
+104.192.70.252
  104.192.74.19
  104.192.74.22
  104.192.74.29
@@ -6013,8 +5191,6 @@
  104.192.74.41
  104.192.74.44
  104.193.103.61
-104.193.141.10
-104.193.226.121
  104.193.252.183
  104.193.252.207
  104.193.252.208
@@ -6100,7 +5276,6 @@
  104.198.19.60
  104.198.192.174
  104.198.200.69
-104.198.205.99
  104.198.21.19
  104.198.216.178
  104.198.220.180
@@ -6135,18 +5310,16 @@
  104.199.216.0
  104.199.234.214
  104.199.35.3
-104.199.42.93
  104.199.53.197
  104.199.56.247
  104.199.63.17
+104.199.86.98
  104.2.96.26
  104.20.22.42
-104.200.134.181
+104.200.152.25
  104.200.154.103
  104.200.154.57
  104.200.154.79
-104.200.16.116
-104.200.16.191
  104.200.20.133
  104.200.21.61
  104.200.25.118
@@ -6163,26 +5336,6 @@
  104.206.106.34
  104.206.106.4
  104.206.106.9
-104.206.128.10
-104.206.128.14
-104.206.128.18
-104.206.128.2
-104.206.128.22
-104.206.128.26
-104.206.128.30
-104.206.128.34
-104.206.128.38
-104.206.128.42
-104.206.128.46
-104.206.128.50
-104.206.128.54
-104.206.128.58
-104.206.128.6
-104.206.128.62
-104.206.128.66
-104.206.128.70
-104.206.128.74
-104.206.128.78
  104.206.203.38
  104.206.252.71
  104.206.81.132
@@ -6228,8 +5381,6 @@
  104.211.164.221
  104.211.177.255
  104.211.18.235
-104.211.183.247
-104.211.227.138
  104.211.230.17
  104.211.27.49
  104.211.28.157
@@ -6237,103 +5388,59 @@
  104.211.29.96
  104.211.49.188
  104.211.8.210
-104.214.106.56
-104.214.113.80
  104.214.51.167
  104.214.51.93
  104.214.58.237
  104.214.59.120
-104.215.100.93
+104.214.59.255
  104.215.124.156
  104.215.127.44
  104.215.15.26
  104.215.151.21
  104.215.152.162
-104.215.176.78
  104.215.19.167
-104.215.22.114
  104.215.49.64
  104.215.5.88
-104.215.84.209
-104.215.87.57
  104.217.252.25
  104.217.253.76
-104.218.136.190
-104.218.242.18
+104.218.240.68
  104.218.48.11
  104.218.48.98
  104.218.63.119
  104.219.250.10
  104.219.250.36
-104.220.15.160
-104.220.152.112
-104.220.168.124
-104.220.195.245
-104.220.211.171
-104.220.36.195
  104.222.109.85
  104.222.96.61
  104.223.105.140
  104.223.114.36
  104.223.123.98
  104.223.124.234
+104.223.127.169
  104.223.127.176
  104.223.143.150
  104.223.143.234
  104.223.17.18
  104.223.170.68
  104.223.170.93
-104.223.197.140
  104.223.197.227
  104.223.225.55
  104.223.225.56
  104.223.24.70
-104.223.249.10
-104.223.249.109
-104.223.249.124
  104.223.249.129
-104.223.249.132
-104.223.249.14
-104.223.249.142
-104.223.249.145
-104.223.249.150
-104.223.249.169
  104.223.249.172
-104.223.249.182
-104.223.249.184
-104.223.249.189
-104.223.249.190
-104.223.249.20
-104.223.249.207
-104.223.249.219
-104.223.249.221
-104.223.249.224
-104.223.249.234
  104.223.249.236
-104.223.249.25
  104.223.249.28
-104.223.249.37
-104.223.249.38
-104.223.249.50
-104.223.249.60
-104.223.249.70
-104.223.249.80
-104.223.249.84
-104.223.249.90
-104.223.249.97
-104.223.249.98
+104.223.249.91
  104.223.25.136
  104.223.25.145
  104.223.28.164
  104.223.28.233
  104.223.28.241
-104.223.29.137
  104.223.29.180
  104.223.29.202
  104.223.31.24
-104.223.31.28
-104.223.31.33
  104.223.31.45
+104.223.31.59
  104.223.31.75
  104.223.31.93
  104.223.32.193
@@ -6344,8 +5451,8 @@
  104.223.38.139
  104.223.38.83
  104.223.42.101
-104.223.42.78
-104.223.42.92
+104.223.42.114
+104.223.69.219
  104.223.79.124
  104.223.79.77
  104.223.79.80
@@ -6368,7 +5475,6 @@
  104.224.184.30
  104.224.185.114
  104.224.186.29
-104.224.186.65
  104.224.187.120
  104.224.189.157
  104.224.191.210
@@ -6382,12 +5488,11 @@
  104.225.187.44
  104.225.188.63
  104.225.190.163
+104.225.220.233
  104.225.233.10
  104.225.236.41
  104.225.251.29
-104.226.31.67
  104.227.112.240
-104.227.116.231
  104.227.124.149
  104.227.124.151
  104.227.124.153
@@ -6403,7 +5508,7 @@
  104.227.146.123
  104.227.146.125
  104.227.146.15
-104.227.146.55
+104.227.146.59
  104.227.167.116
  104.227.168.130
  104.227.169.9
@@ -6430,15 +5535,12 @@
  104.227.50.242
  104.227.56.18
  104.227.57.94
-104.227.58.59
  104.227.6.48
  104.227.6.50
  104.227.6.51
  104.227.6.52
  104.227.6.61
  104.227.61.190
-104.227.63.43
-104.227.65.22
  104.227.72.157
  104.227.77.147
  104.227.77.152
@@ -6483,6 +5585,7 @@
  104.236.117.221
  104.236.118.20
  104.236.118.6
+104.236.12.241
  104.236.120.31
  104.236.121.248
  104.236.122.214
@@ -6491,6 +5594,7 @@
  104.236.127.247
  104.236.130.131
  104.236.130.51
+104.236.133.77
  104.236.136.200
  104.236.137.72
  104.236.139.208
@@ -6536,7 +5640,6 @@
  104.236.21.114
  104.236.210.185
  104.236.211.236
-104.236.212.203
  104.236.213.3
  104.236.213.97
  104.236.214.8
@@ -6582,7 +5685,9 @@
  104.236.39.38
  104.236.4.161
  104.236.40.85
+104.236.41.231
  104.236.43.56
+104.236.45.171
  104.236.48.174
  104.236.48.178
  104.236.49.107
@@ -6592,7 +5697,6 @@
  104.236.52.89
  104.236.52.94
  104.236.54.196
-104.236.55.217
  104.236.58.164
  104.236.59.151
  104.236.6.235
@@ -6600,6 +5704,7 @@
  104.236.61.188
  104.236.62.50
  104.236.63.99
+104.236.65.234
  104.236.69.31
  104.236.7.135
  104.236.70.126
@@ -6622,6 +5727,7 @@
  104.236.95.128
  104.236.95.170
  104.236.96.48
+104.236.97.175
  104.236.99.42
  104.237.121.67
  104.237.130.171
@@ -6643,13 +5749,10 @@
  104.237.232.152
  104.237.233.103
  104.237.233.111
-104.237.234.74
-104.237.240.112
-104.237.240.6
-104.237.241.29
  104.237.252.12
  104.237.255.248
  104.237.255.254
+104.237.51.77
  104.238.111.150
  104.238.111.218
  104.238.116.19
@@ -6669,7 +5772,6 @@
  104.238.173.60
  104.238.174.93
  104.238.179.190
-104.238.179.55
  104.238.180.123
  104.238.181.224
  104.238.182.103
@@ -6685,7 +5787,7 @@
  104.238.220.24
  104.238.223.126
  104.238.235.186
-104.238.44.43
+104.238.44.37
  104.238.59.109
  104.238.59.220
  104.238.59.236
@@ -6695,7 +5797,6 @@
  104.238.97.215
  104.239.138.208
  104.239.149.183
-104.239.163.85
  104.239.164.100
  104.239.165.55
  104.239.170.93
@@ -6710,10 +5811,9 @@
  104.243.21.205
  104.243.24.211
  104.243.31.81
+104.243.32.222
  104.243.44.219
  104.243.44.36
-104.244.168.11
-104.244.228.19
  104.244.72.104
  104.244.72.115
  104.244.72.168
@@ -6728,13 +5828,13 @@
  104.244.73.205
  104.244.73.43
  104.244.73.46
-104.244.73.54
  104.244.73.85
  104.244.73.93
  104.244.74.121
  104.244.74.211
  104.244.74.248
  104.244.74.28
+104.244.74.34
  104.244.74.57
  104.244.74.97
  104.244.75.218
@@ -6753,7 +5853,6 @@
  104.244.77.254
  104.244.77.53
  104.244.77.95
-104.244.78.139
  104.244.78.163
  104.244.78.231
  104.244.78.233
@@ -6766,7 +5865,6 @@
  104.245.42.120
  104.245.42.220
  104.245.44.233
-104.245.95.243
  104.245.99.48
  104.247.159.123
  104.247.159.173
@@ -6778,10 +5876,8 @@
  104.248.114.239
  104.248.114.67
  104.248.116.140
-104.248.121.227
  104.248.122.140
  104.248.123.197
-104.248.126.166
  104.248.128.10
  104.248.128.125
  104.248.129.112
@@ -6804,7 +5900,6 @@
  104.248.139.211
  104.248.139.236
  104.248.14.71
-104.248.14.84
  104.248.140.108
  104.248.142.140
  104.248.142.60
@@ -6815,38 +5910,30 @@
  104.248.144.16
  104.248.144.214
  104.248.145.254
-104.248.145.47
  104.248.145.89
  104.248.146.167
  104.248.146.21
-104.248.146.253
  104.248.147.78
-104.248.148.11
  104.248.148.129
  104.248.149.130
  104.248.149.132
  104.248.151.112
  104.248.151.229
-104.248.153.246
-104.248.154.162
  104.248.154.84
-104.248.155.249
  104.248.155.45
  104.248.155.81
  104.248.156.168
  104.248.157.169
  104.248.157.66
  104.248.158.95
+104.248.158.98
  104.248.159.104
-104.248.159.195
  104.248.159.69
-104.248.16.234
  104.248.160.118
  104.248.160.58
  104.248.161.191
  104.248.163.35
  104.248.165.25
-104.248.169.127
  104.248.17.207
  104.248.170.40
  104.248.172.238
@@ -6863,7 +5950,6 @@
  104.248.201.153
  104.248.202.160
  104.248.205.24
-104.248.205.67
  104.248.206.51
  104.248.208.227
  104.248.208.33
@@ -6871,7 +5957,6 @@
  104.248.21.247
  104.248.216.243
  104.248.218.189
-104.248.22.82
  104.248.225.14
  104.248.226.215
  104.248.228.193
@@ -6882,6 +5967,7 @@
  104.248.231.110
  104.248.231.44
  104.248.231.46
+104.248.233.195
  104.248.233.34
  104.248.236.10
  104.248.236.112
@@ -6898,7 +5984,6 @@
  104.248.243.134
  104.248.244.119
  104.248.245.250
-104.248.245.74
  104.248.246.25
  104.248.247.218
  104.248.247.250
@@ -6925,9 +6010,9 @@
  104.248.38.48
  104.248.38.5
  104.248.39.81
+104.248.40.246
  104.248.41.56
  104.248.42.245
-104.248.44.26
  104.248.45.204
  104.248.48.161
  104.248.48.169
@@ -6968,18 +6053,14 @@
  104.248.75.224
  104.248.76.28
  104.248.8.188
-104.248.80.252
  104.248.81.158
  104.248.82.153
  104.248.84.82
-104.248.84.96
  104.248.85.6
  104.248.87.32
  104.248.88.112
-104.248.89.7
  104.248.89.91
  104.248.90.45
-104.248.90.77
  104.248.94.133
  104.248.94.72
  104.249.28.86
@@ -7034,7 +6115,6 @@
  104.250.98.53
  104.250.98.58
  104.250.98.59
-104.252.222.149
  104.254.244.100
  104.254.90.203
  104.254.92.61
@@ -7043,18 +6123,17 @@
  104.32.136.154
  104.32.43.13
  104.35.13.161
+104.36.182.197
  104.36.71.132
  104.36.71.171
  104.36.71.215
  104.37.104.44
  104.37.168.253
-104.37.174.139
  104.37.187.23
  104.37.212.5
  104.37.212.67
  104.37.216.117
  104.40.159.206
-104.40.197.65
  104.40.221.195
  104.40.27.190
  104.40.31.157
@@ -7078,6 +6157,7 @@
  104.41.52.218
  104.41.57.96
  104.41.60.236
+104.42.0.20
  104.42.48.216
  104.42.48.29
  104.43.163.249
@@ -7086,7 +6166,6 @@
  104.43.222.126
  104.43.222.200
  104.43.225.122
-104.43.249.112
  104.45.130.1
  104.45.134.2
  104.45.142.247
@@ -7096,14 +6175,13 @@
  104.46.15.169
  104.46.227.151
  104.46.32.152
+104.46.99.17
  104.47.145.50
  104.47.147.196
  104.47.152.29
  104.47.167.206
  104.50.180.85
  104.50.201.209
-104.50.4.139
-104.52.29.49
  104.57.101.171
  104.57.20.130
  104.60.247.230
@@ -7118,7 +6196,6 @@
  1041469-dot-n-e-w-me-ss-age-po-rt-al.wl.r.appspot.com
  104722155613106546.002.sh.cn
  105.101.86.13
-105.102.160.68
  105.103.160.197
  105.105.162.145
  105.107.36.211
@@ -7128,13 +6205,11 @@
  105.112.91.234
  105.154.151.250
  105.154.191.59
-105.155.137.245
  105.155.159.11
-105.155.254.205
  105.156.11.61
-105.156.252.39
-105.157.10.117
+105.156.70.125
  105.157.152.87
+105.157.84.253
  105.158.91.157
  105.159.149.193
  105.159.253.46
@@ -7146,30 +6221,24 @@
  105.163.47.37
  105.174.19.169
  105.174.38.250
-105.174.4.110
-105.178.112.46
  105.178.119.233
-105.191.33.149
+105.184.173.207
  105.208.44.183
+105.209.0.32
  105.209.180.19
  105.209.235.113
  105.21.40.54
-105.212.115.3
  105.212.56.107
  105.213.108.157
  105.213.115.255
  105.213.120.142
-105.213.126.106
  105.224.160.58
  105.226.107.208
-105.226.14.199
  105.226.188.16
-105.226.76.189
  105.226.97.186
  105.229.22.206
  105.233.34.9
  105.235.106.59
-105.235.137.19
  105.235.193.226
  105.235.197.150
  105.235.197.162
@@ -7179,10 +6248,8 @@
  105.235.202.186
  105.235.203.238
  105.235.205.90
-105.235.66.91
+105.235.22.114
  105.236.93.198
-105.246.19.82
-105.246.20.240
  105.247.148.210
  105.247.152.34
  105.247.158.94
@@ -7193,62 +6260,23 @@
  105.27.143.190
  105.27.152.206
  105.27.155.182
-105.27.177.130
-105.27.245.249
-105.27.245.252
  105.28.114.169
  105.29.64.133
  105.29.64.195
  105.29.67.20
-105.30.250.108
-105.66.7.100
-105.96.106.11
-105.96.109.13
-105.96.11.148
+105.66.134.161
  105.96.11.65
-105.96.111.37
-105.97.55.64
  1051a2e8-48cf-4f98-988c-b1aa7ec7e290.htmlcomponentservice.com
  1052068-dot-n-e-w-me-ss-age-po-rt-al.wl.r.appspot.com
  106-365.net
-106.0.4.31
-106.0.5.140
-106.0.5.69
-106.0.6.236
-106.0.6.240
-106.0.6.33
-106.1.113.10
-106.1.113.97
-106.1.164.65
-106.1.164.90
-106.1.188.97
-106.1.189.54
-106.1.19.97
-106.1.246.6
-106.1.77.127
-106.1.94.110
-106.104.134.174
+106.0.57.24
+106.0.59.34
  106.104.148.2
  106.104.151.142
-106.104.151.175
-106.104.162.72
  106.104.170.66
-106.104.182.106
-106.104.192.43
  106.104.193.155
-106.104.7.28
-106.104.7.88
-106.105.135.230
-106.105.141.181
-106.105.147.146
-106.105.147.84
-106.105.192.100
-106.105.197.109
-106.105.219.3
-106.107.189.57
-106.107.209.4
+106.105.33.43
  106.109.112.zoom-lab.com
-106.110.104.127
  106.110.104.29
  106.110.105.60
  106.110.107.114
@@ -7276,7 +6304,8 @@
  106.110.93.140
  106.110.93.16
  106.110.94.54
-106.111.118.136
+106.110.96.130
+106.111.13.52
  106.111.139.53
  106.111.139.66
  106.111.155.239
@@ -7288,58 +6317,40 @@
  106.111.47.40
  106.111.55.123
  106.111.85.197
-106.112.159.178
-106.112.217.203
-106.114.118.132
  106.116.16.60
  106.116.166.64
-106.117.207.186
-106.117.235.78
-106.117.239.19
-106.117.240.11
-106.118.214.220
  106.12.10.21
  106.12.10.72
  106.12.10.8
-106.12.100.164
  106.12.100.206
+106.12.100.7
  106.12.100.73
  106.12.102.202
-106.12.102.210
  106.12.102.54
  106.12.105.130
  106.12.105.161
-106.12.106.140
-106.12.106.221
-106.12.106.34
  106.12.107.61
  106.12.108.61
-106.12.109.165
-106.12.11.245
  106.12.110.2
  106.12.111.189
  106.12.111.201
  106.12.112.120
  106.12.112.236
-106.12.112.253
  106.12.112.49
-106.12.113.111
  106.12.113.155
  106.12.113.204
  106.12.113.21
+106.12.113.223
  106.12.114.101
  106.12.115.169
  106.12.116.75
-106.12.119.8
  106.12.12.205
  106.12.12.242
  106.12.121.148
  106.12.123.239
  106.12.127.136
  106.12.127.47
-106.12.13.185
  106.12.13.20
-106.12.130.189
  106.12.130.83
  106.12.131.102
  106.12.132.224
@@ -7357,7 +6368,6 @@
  106.12.146.9
  106.12.148.127
  106.12.148.179
-106.12.148.201
  106.12.150.36
  106.12.153.211
  106.12.154.24
@@ -7373,7 +6383,6 @@
  106.12.165.53
  106.12.166.167
  106.12.167.216
-106.12.17.214
  106.12.171.65
  106.12.172.48
  106.12.173.184
@@ -7385,35 +6394,31 @@
  106.12.175.226
  106.12.176.2
  106.12.178.228
-106.12.18.125
  106.12.18.219
  106.12.182.38
-106.12.183.209
  106.12.185.102
  106.12.185.18
  106.12.186.130
  106.12.186.74
  106.12.187.250
  106.12.190.100
-106.12.190.254
  106.12.190.37
  106.12.190.49
  106.12.192.204
-106.12.192.91
  106.12.193.217
  106.12.193.6
+106.12.194.154
  106.12.194.204
  106.12.194.26
  106.12.196.118
  106.12.196.38
-106.12.197.52
  106.12.198.236
  106.12.199.117
  106.12.199.30
  106.12.2.221
-106.12.20.15
  106.12.20.195
  106.12.200.176
+106.12.200.225
  106.12.200.239
  106.12.201.16
  106.12.201.95
@@ -7431,18 +6436,13 @@
  106.12.207.236
  106.12.207.92
  106.12.208.211
-106.12.209.57
-106.12.209.81
-106.12.210.115
  106.12.210.127
  106.12.211.254
-106.12.212.89
  106.12.213.58
  106.12.214.128
  106.12.215.238
  106.12.217.122
  106.12.217.128
-106.12.217.176
  106.12.217.204
  106.12.217.78
  106.12.218.171
@@ -7450,6 +6450,7 @@
  106.12.219.184
  106.12.220.109
  106.12.220.84
+106.12.221.169
  106.12.221.83
  106.12.222.209
  106.12.23.44
@@ -7458,15 +6459,10 @@
  106.12.242.19
  106.12.242.58
  106.12.25.152
-106.12.252.122
-106.12.26.160
  106.12.26.167
  106.12.26.237
  106.12.28.152
-106.12.28.157
  106.12.29.204
-106.12.30.41
-106.12.30.87
  106.12.31.186
  106.12.33.134
  106.12.33.174
@@ -7480,13 +6476,9 @@
  106.12.37.20
  106.12.37.38
  106.12.38.109
-106.12.38.143
  106.12.38.70
  106.12.4.158
-106.12.42.251
-106.12.43.54
  106.12.45.110
-106.12.45.214
  106.12.46.121
  106.12.46.179
  106.12.47.108
@@ -7495,16 +6487,11 @@
  106.12.5.168
  106.12.5.190
  106.12.51.10
-106.12.51.110
  106.12.52.34
-106.12.52.98
  106.12.55.129
  106.12.55.170
-106.12.55.57
  106.12.56.126
  106.12.57.149
-106.12.57.165
-106.12.59.23
  106.12.6.122
  106.12.60.40
  106.12.60.66
@@ -7517,15 +6504,11 @@
  106.12.69.90
  106.12.69.94
  106.12.7.40
-106.12.70.112
  106.12.70.118
-106.12.70.99
-106.12.71.159
  106.12.71.167
  106.12.71.193
  106.12.71.88
  106.12.73.198
-106.12.73.204
  106.12.74.23
  106.12.74.99
  106.12.76.35
@@ -7539,7 +6522,6 @@
  106.12.8.149
  106.12.80.200
  106.12.80.246
-106.12.82.13
  106.12.82.22
  106.12.82.242
  106.12.82.80
@@ -7556,19 +6538,16 @@
  106.12.86.56
  106.12.87.149
  106.12.87.168
-106.12.87.83
  106.12.88.121
  106.12.88.165
  106.12.88.246
  106.12.88.95
  106.12.89.154
  106.12.89.173
-106.12.89.206
  106.12.9.207
  106.12.90.29
  106.12.90.45
  106.12.90.63
-106.12.91.102
  106.12.91.209
  106.12.91.225
  106.12.92.246
@@ -7578,7 +6557,6 @@
  106.12.94.119
  106.12.94.186
  106.12.94.65
-106.12.94.83
  106.12.95.45
  106.12.96.191
  106.12.96.23
@@ -7587,21 +6565,13 @@
  106.12.97.46
  106.120.198.90
  106.120.75.98
-106.121.160.119
  106.121.4.178
-106.123.47.40
  106.123.60.134
-106.124.131.194
-106.124.131.70
  106.124.136.103
  106.124.136.227
-106.124.137.103
-106.124.137.108
  106.124.137.130
  106.124.141.229
-106.124.143.24
  106.124.188.160
-106.124.205.142
  106.124.205.42
  106.124.252.3
  106.124.93.69
@@ -7610,7 +6580,7 @@
  106.13.10.242
  106.13.101.232
  106.13.102.197
-106.13.103.158
+106.13.104.41
  106.13.104.8
  106.13.105.97
  106.13.107.196
@@ -7621,9 +6591,10 @@
  106.13.113.91
  106.13.115.131
  106.13.115.17
-106.13.118.175
+106.13.119.139
  106.13.119.163
  106.13.119.176
+106.13.120.112
  106.13.123.29
  106.13.123.73
  106.13.125.248
@@ -7634,23 +6605,18 @@
  106.13.131.132
  106.13.136.240
  106.13.136.53
-106.13.138.162
  106.13.138.253
  106.13.139.79
  106.13.140.138
-106.13.140.200
  106.13.141.110
  106.13.142.161
  106.13.142.93
-106.13.144.233
  106.13.144.8
  106.13.146.233
  106.13.146.93
  106.13.147.89
-106.13.149.57
  106.13.160.249
  106.13.160.55
-106.13.163.236
  106.13.164.39
  106.13.165.83
  106.13.167.3
@@ -7658,12 +6624,11 @@
  106.13.167.77
  106.13.168.107
  106.13.168.33
+106.13.17.16
  106.13.171.116
  106.13.171.239
  106.13.173.136
  106.13.173.228
-106.13.173.73
-106.13.174.171
  106.13.176.163
  106.13.176.235
  106.13.177.231
@@ -7679,7 +6644,6 @@
  106.13.184.139
  106.13.184.174
  106.13.184.234
-106.13.184.7
  106.13.187.27
  106.13.188.129
  106.13.188.35
@@ -7691,32 +6655,25 @@
  106.13.190.84
  106.13.191.25
  106.13.191.26
-106.13.194.25
  106.13.194.64
  106.13.195.132
  106.13.195.32
  106.13.196.51
  106.13.197.35
-106.13.198.167
  106.13.199.185
-106.13.20.229
  106.13.20.31
  106.13.201.127
  106.13.201.44
-106.13.201.85
-106.13.203.240
  106.13.203.62
  106.13.206.111
  106.13.206.183
  106.13.206.35
-106.13.207.159
  106.13.207.205
  106.13.207.219
  106.13.208.101
-106.13.209.80
+106.13.210.44
  106.13.210.81
  106.13.212.162
-106.13.213.76
  106.13.214.38
  106.13.215.17
  106.13.215.207
@@ -7734,7 +6691,6 @@
  106.13.228.21
  106.13.228.33
  106.13.228.62
-106.13.229.254
  106.13.23.86
  106.13.230.219
  106.13.230.36
@@ -7743,6 +6699,7 @@
  106.13.233.32
  106.13.233.4
  106.13.234.36
+106.13.237.158
  106.13.237.170
  106.13.238.1
  106.13.25.242
@@ -7756,20 +6713,16 @@
  106.13.34.131
  106.13.34.173
  106.13.35.121
-106.13.35.176
  106.13.35.232
-106.13.35.87
  106.13.36.10
  106.13.36.215
  106.13.37.202
  106.13.37.213
  106.13.37.33
-106.13.38.121
  106.13.4.132
  106.13.4.86
  106.13.40.23
  106.13.40.65
-106.13.41.25
  106.13.41.87
  106.13.42.140
  106.13.42.150
@@ -7785,9 +6738,9 @@
  106.13.50.51
  106.13.52.107
  106.13.52.192
-106.13.52.83
  106.13.56.204
  106.13.56.219
+106.13.56.38
  106.13.58.240
  106.13.6.214
  106.13.6.70
@@ -7800,14 +6753,9 @@
  106.13.65.237
  106.13.66.103
  106.13.68.142
-106.13.68.145
  106.13.69.159
-106.13.70.177
-106.13.70.60
  106.13.70.63
  106.13.71.1
-106.13.72.139
-106.13.73.235
  106.13.73.59
  106.13.74.61
  106.13.75.154
@@ -7816,7 +6764,6 @@
  106.13.75.227
  106.13.78.198
  106.13.78.210
-106.13.79.92
  106.13.8.46
  106.13.81.54
  106.13.82.151
@@ -7828,9 +6775,7 @@
  106.13.86.50
  106.13.86.54
  106.13.87.131
-106.13.87.145
  106.13.88.44
-106.13.89.231
  106.13.89.237
  106.13.9.153
  106.13.90.60
@@ -7841,25 +6786,19 @@
  106.13.94.131
  106.13.94.193
  106.13.95.100
-106.13.96.65
  106.13.96.85
-106.13.97.228
  106.13.97.37
  106.13.99.107
-106.13.99.145
  106.14.1.209
-106.14.135.136
  106.14.142.205
  106.14.163.216
  106.14.188.79
-106.14.211.77
+106.14.21.174
  106.14.224.228
  106.14.241.0
  106.15.178.16
-106.15.202.130
-106.15.231.104
  106.15.250.167
-106.15.34.199
+106.15.35.211
  106.15.90.186
  106.15.93.147
  106.157.214.199
@@ -7889,23 +6828,15 @@
  106.2.13.189
  106.2.207.106
  106.2.233.226
-106.2.45.15
-106.201.193.234
-106.201.233.16
-106.201.238.227
  106.201.34.160
  106.207.8.33
-106.212.225.184
-106.215.10.57
+106.210.179.16
+106.215.246.65
  106.225.192.140
-106.225.199.113
  106.225.211.193
-106.225.211.248
-106.225.219.144
-106.240.113.157
  106.240.131.5
  106.240.86.211
-106.241.228.2
+106.240.89.60
  106.241.33.158
  106.242.20.219
  106.242.204.101
@@ -7920,72 +6851,37 @@
  106.245.183.60
  106.245.197.234
  106.245.228.122
-106.245.60.9
  106.245.95.116
+106.246.224.219
  106.246.92.234
  106.247.210.55
  106.247.232.252
  106.247.237.179
  106.248.143.195
  106.248.143.198
-106.249.139.5
  106.250.11.246
-106.250.156.76
  106.250.34.36
  106.251.66.171
  106.253.177.150
  106.253.59.78
  106.255.222.195
-106.255.234.34
  106.255.248.19
  106.255.253.178
-106.3.129.209
-106.3.130.102
-106.3.136.52
  106.3.38.73
-106.3.40.99
-106.3.44.107
-106.3.44.116
-106.3.44.15
-106.3.44.48
-106.3.45.45
  106.37.121.250
-106.37.178.165
-106.37.178.172
-106.37.205.223
-106.37.205.250
-106.37.205.251
-106.37.205.253
-106.37.221.182
+106.37.198.3
  106.37.223.54
-106.37.239.65
-106.37.239.66
-106.37.240.20
  106.37.72.234
  106.37.74.142
-106.38.104.179
  106.38.112.196
  106.38.121.162
  106.38.158.131
-106.38.169.59
  106.38.205.205
-106.38.53.234
  106.38.65.28
-106.38.70.178
-106.38.84.164
-106.38.99.138
  106.38.99.158
-106.39.10.134
-106.39.16.2
-106.39.16.242
  106.39.21.10
-106.39.63.130
-106.41.132.12
  106.46.169.193
-106.5.126.30
-106.51.139.44
  106.51.164.41
-106.51.18.191
  106.51.2.56
  106.51.227.10
  106.51.234.102
@@ -7994,6 +6890,8 @@
  106.51.36.64
  106.51.48.117
  106.51.63.3
+106.51.68.69
+106.51.71.65
  106.51.73.204
  106.51.76.223
  106.51.78.18
@@ -8005,18 +6903,15 @@
  106.52.105.158
  106.52.105.178
  106.52.107.167
-106.52.107.79
  106.52.11.167
  106.52.114.125
  106.52.115.154
  106.52.115.36
  106.52.117.111
  106.52.12.21
-106.52.122.20
  106.52.122.203
  106.52.127.250
  106.52.128.100
-106.52.129.43
  106.52.130.172
  106.52.132.186
  106.52.133.87
@@ -8027,28 +6922,29 @@
  106.52.140.195
  106.52.141.222
  106.52.141.36
+106.52.141.88
  106.52.150.93
-106.52.150.94
  106.52.152.16
-106.52.152.168
  106.52.152.237
  106.52.155.197
  106.52.162.134
  106.52.162.140
  106.52.166.245
+106.52.174.51
  106.52.177.213
  106.52.178.166
  106.52.179.227
  106.52.181.236
  106.52.181.73
-106.52.188.250
+106.52.196.163
  106.52.197.126
  106.52.199.111
  106.52.199.130
-106.52.2.174
+106.52.2.22
  106.52.20.112
  106.52.201.203
  106.52.203.17
+106.52.205.211
  106.52.209.104
  106.52.209.36
  106.52.210.175
@@ -8059,10 +6955,10 @@
  106.52.22.64
  106.52.222.11
  106.52.23.108
-106.52.231.125
  106.52.231.46
  106.52.235.246
  106.52.236.23
+106.52.239.224
  106.52.243.17
  106.52.244.46
  106.52.249.134
@@ -8076,11 +6972,9 @@
  106.52.33.94
  106.52.35.184
  106.52.44.179
-106.52.51.73
  106.52.52.52
  106.52.54.192
  106.52.55.146
-106.52.56.193
  106.52.56.26
  106.52.6.77
  106.52.63.37
@@ -8090,8 +6984,6 @@
  106.52.69.233
  106.52.70.240
  106.52.79.68
-106.52.82.200
-106.52.86.172
  106.52.89.135
  106.52.9.154
  106.52.90.84
@@ -8142,6 +7034,7 @@
  106.53.232.157
  106.53.232.163
  106.53.232.38
+106.53.234.167
  106.53.234.72
  106.53.235.41
  106.53.236.114
@@ -8149,19 +7042,17 @@
  106.53.237.190
  106.53.238.111
  106.53.238.15
+106.53.238.97
  106.53.239.130
  106.53.239.28
  106.53.240.126
-106.53.241.29
  106.53.245.89
  106.53.249.204
  106.53.249.98
+106.53.252.12
  106.53.26.197
-106.53.38.62
-106.53.40.211
  106.53.5.85
  106.53.52.232
-106.53.55.209
  106.53.55.86
  106.53.61.167
  106.53.62.73
@@ -8178,35 +7069,28 @@
  106.53.91.250
  106.53.92.254
  106.53.92.85
-106.53.96.219
  106.53.97.54
  106.54.1.58
  106.54.101.141
  106.54.105.9
  106.54.108.8
-106.54.111.75
  106.54.112.173
  106.54.117.51
  106.54.126.152
  106.54.129.202
-106.54.129.69
  106.54.137.199
  106.54.139.117
  106.54.140.165
  106.54.141.196
  106.54.166.168
-106.54.167.195
  106.54.167.68
  106.54.17.221
-106.54.170.236
  106.54.171.167
  106.54.173.124
  106.54.174.159
  106.54.182.137
  106.54.182.161
-106.54.183.246
  106.54.184.180
-106.54.184.192
  106.54.189.18
  106.54.190.173
  106.54.194.35
@@ -8218,14 +7102,13 @@
  106.54.206.184
  106.54.212.215
  106.54.217.12
+106.54.220.51
  106.54.222.51
  106.54.227.32
  106.54.236.220
-106.54.236.226
  106.54.238.208
  106.54.241.104
-106.54.243.65
-106.54.244.76
+106.54.241.235
  106.54.245.12
  106.54.247.167
  106.54.253.152
@@ -8240,15 +7123,12 @@
  106.54.48.130
  106.54.48.208
  106.54.48.241
-106.54.52.141
  106.54.52.35
  106.54.57.203
  106.54.62.168
  106.54.64.147
-106.54.64.77
  106.54.65.139
  106.54.65.144
-106.54.67.189
  106.54.67.233
  106.54.67.25
  106.54.7.118
@@ -8270,7 +7150,6 @@
  106.54.91.157
  106.54.92.106
  106.54.92.214
-106.54.93.182
  106.54.93.84
  106.54.94.167
  106.54.94.237
@@ -8288,7 +7167,6 @@
  106.55.146.113
  106.55.146.46
  106.55.146.67
-106.55.148.138
  106.55.149.162
  106.55.150.24
  106.55.154.240
@@ -8299,7 +7177,6 @@
  106.55.163.74
  106.55.165.136
  106.55.166.113
-106.55.167.157
  106.55.168.173
  106.55.168.232
  106.55.169.74
@@ -8311,7 +7188,6 @@
  106.55.233.29
  106.55.236.107
  106.55.236.71
-106.55.24.145
  106.55.240.104
  106.55.240.205
  106.55.240.252
@@ -8328,33 +7204,21 @@
  106.55.37.171
  106.55.37.174
  106.55.4.113
-106.55.41.76
-106.55.47.184
  106.55.47.205
  106.55.48.134
  106.55.49.141
  106.55.5.192
  106.55.53.121
  106.55.58.118
-106.55.59.149
+106.55.59.64
  106.55.61.15
  106.55.9.52
-106.57.21.42
  106.58.169.162
-106.58.175.97
-106.58.178.14
-106.58.179.215
  106.58.179.217
-106.58.185.232
-106.58.215.95
-106.58.6.188
-106.59.16.71
-106.59.7.222
+106.59.252.230
  106.66.3.226
  106.66.36.49
-106.68.148.67
  106.68.158.60
-106.68.49.127
  106.69.246.17
  106.72.36.96
  106.75.10.4
@@ -8366,32 +7230,20 @@
  106.75.114.98
  106.75.119.13
  106.75.119.202
-106.75.12.245
  106.75.12.247
  106.75.122.28
-106.75.123.210
  106.75.123.47
-106.75.123.95
-106.75.129.76
-106.75.13.173
  106.75.132.3
  106.75.133.250
  106.75.133.57
-106.75.138.38
-106.75.141.155
  106.75.141.160
  106.75.141.219
-106.75.141.223
-106.75.143.154
-106.75.143.233
  106.75.146.217
  106.75.146.67
  106.75.147.233
  106.75.148.111
  106.75.148.228
-106.75.148.48
  106.75.15.152
-106.75.152.124
  106.75.152.83
  106.75.153.166
  106.75.153.31
@@ -8399,11 +7251,8 @@
  106.75.156.124
  106.75.157.9
  106.75.16.115
-106.75.161.98
  106.75.162.164
  106.75.163.101
-106.75.164.156
-106.75.165.127
  106.75.166.88
  106.75.167.133
  106.75.168.159
@@ -8415,22 +7264,16 @@
  106.75.174.87
  106.75.175.39
  106.75.176.189
-106.75.176.38
  106.75.179.87
  106.75.181.139
-106.75.20.231
  106.75.209.179
-106.75.21.25
  106.75.211.130
  106.75.211.166
  106.75.211.48
  106.75.214.198
  106.75.214.72
  106.75.215.151
-106.75.216.180
-106.75.217.16
  106.75.218.71
-106.75.22.216
  106.75.224.132
  106.75.225.193
  106.75.230.208
@@ -8444,9 +7287,6 @@
  106.75.24.196
  106.75.240.243
  106.75.240.86
-106.75.241.193
-106.75.241.252
-106.75.241.94
  106.75.246.176
  106.75.247.206
  106.75.247.8
@@ -8454,97 +7294,65 @@
  106.75.249.26
  106.75.249.8
  106.75.25.148
-106.75.25.86
  106.75.250.31
  106.75.251.140
  106.75.254.114
  106.75.254.207
  106.75.26.61
-106.75.29.239
-106.75.3.35
-106.75.30.102
-106.75.30.190
+106.75.3.52
  106.75.31.126
-106.75.34.41
  106.75.37.235
-106.75.4.19
-106.75.48.8
  106.75.5.94
  106.75.52.178
-106.75.52.43
  106.75.55.46
  106.75.6.230
  106.75.61.147
-106.75.61.203
-106.75.62.25
-106.75.63.218
  106.75.66.108
  106.75.66.70
  106.75.67.6
-106.75.7.109
  106.75.72.84
-106.75.74.225
+106.75.74.22
  106.75.75.160
  106.75.77.230
-106.75.78.135
  106.75.8.139
-106.75.8.155
  106.75.80.203
-106.75.84.197
  106.75.84.97
-106.75.85.189
-106.75.85.37
  106.75.86.180
  106.75.9.141
  106.75.91.171
-106.75.92.239
-106.75.92.78
  106.75.95.6
  106.75.97.141
  106.76.73.57
-106.76.95.100
-106.8.213.157
-106.8.216.169
  106.80.118.104
-106.81.42.184
+106.83.241.94
  106.86.52.15
+106.87.30.105
  106.87.31.29
+106.87.91.242
  106373423597656-dot-hi0-492-net.appspot.com
  106b.com
  107.0.135.4
-107.0.200.227
  107.1.80.147
-107.10.3.169
-107.126.99.25
  107.13.140.129
  107.13.141.32
  107.13.176.58
  107.132.88.42
+107.139.157.90
  107.14.227.90
  107.143.246.110
  107.143.249.158
-107.144.64.190
-107.145.103.110
  107.145.58.245
  107.147.178.243
  107.147.249.75
  107.148.130.122
-107.148.130.125
-107.148.189.72
  107.15.154.173
-107.15.159.1
-107.15.40.62
-107.150.100.234
-107.150.107.143
  107.150.2.29
  107.150.2.35
  107.150.23.199
  107.150.23.230
  107.150.3.60
-107.150.31.136
  107.150.37.26
  107.150.41.179
-107.150.44.154
  107.150.50.226
  107.150.50.234
  107.150.58.196
@@ -8553,23 +7361,22 @@
  107.150.65.129
  107.150.70.11
  107.150.70.236
-107.150.70.87
-107.150.89.204
+107.150.71.70
+107.150.89.150
  107.150.89.214
-107.150.98.51
-107.150.98.77
  107.151.152.210
  107.151.195.171
  107.151.197.46
  107.151.218.131
  107.151.64.146
+107.152.129.241
  107.152.139.218
  107.152.139.219
-107.152.139.238
  107.152.139.246
  107.152.139.247
  107.152.139.249
  107.152.139.253
+107.152.140.15
  107.152.140.55
  107.152.140.95
  107.152.145.126
@@ -8603,7 +7410,6 @@
  107.152.239.55
  107.152.239.57
  107.152.242.71
-107.152.243.220
  107.152.243.232
  107.152.243.233
  107.152.243.236
@@ -8647,11 +7453,8 @@
  107.152.255.218
  107.152.255.219
  107.152.255.220
-107.152.255.98
-107.152.35.192
  107.152.35.198
  107.155.132.187
-107.155.153.98
  107.155.160.204
  107.155.162.15
  107.155.25.41
@@ -8659,7 +7462,6 @@
  107.155.65.34
  107.155.69.26
  107.158.154.111
-107.158.154.114
  107.158.154.121
  107.158.154.126
  107.158.154.76
@@ -8669,8 +7471,16 @@
  107.158.154.99
  107.158.202.12
  107.158.202.63
+107.158.43.10
+107.158.43.11
+107.158.43.12
+107.158.43.2
+107.158.43.3
+107.158.43.4
+107.158.43.5
+107.158.43.7
+107.158.43.9
  107.158.49.20
-107.158.49.23
  107.158.85.115
  107.158.85.160
  107.158.85.167
@@ -8680,26 +7490,21 @@
  107.158.85.55
  107.158.85.68
  107.158.85.73
+107.158.85.9
  107.158.86.127
-107.158.86.141
-107.158.86.65
  107.158.9.182
  107.158.93.121
  107.158.93.137
-107.158.93.155
  107.158.93.165
  107.158.93.216
  107.158.93.241
-107.158.93.26
  107.158.93.6
  107.159.93.103
  107.160.167.130
  107.160.249.14
  107.160.249.6
  107.160.249.8
-107.161.179.138
  107.161.23.47
-107.161.72.231
  107.165.127.99
  107.167.112.245
  107.167.177.39
@@ -8711,6 +7516,7 @@
  107.167.2.78
  107.167.2.81
  107.167.23.66
+107.167.244.67
  107.167.64.4
  107.167.98.190
  107.170.10.239
@@ -8725,6 +7531,7 @@
  107.170.131.23
  107.170.134.125
  107.170.135.29
+107.170.14.145
  107.170.14.209
  107.170.160.61
  107.170.162.155
@@ -8743,7 +7550,6 @@
  107.170.20.247
  107.170.200.113
  107.170.200.19
-107.170.203.195
  107.170.208.126
  107.170.208.150
  107.170.210.211
@@ -8772,7 +7578,6 @@
  107.170.249.6
  107.170.250.177
  107.170.251.238
-107.170.254.53
  107.170.27.84
  107.170.32.181
  107.170.34.12
@@ -8792,7 +7597,6 @@
  107.170.76.170
  107.170.77.69
  107.170.8.24
-107.170.86.182
  107.170.9.195
  107.170.91.121
  107.170.96.6
@@ -8801,6 +7605,7 @@
  107.172.100.204
  107.172.104.125
  107.172.13.68
+107.172.13.73
  107.172.131.186
  107.172.131.187
  107.172.131.211
@@ -8811,13 +7616,9 @@
  107.172.132.230
  107.172.134.156
  107.172.138.139
-107.172.138.142
-107.172.139.249
  107.172.140.127
-107.172.142.113
  107.172.142.122
  107.172.146.81
-107.172.148.136
  107.172.148.137
  107.172.148.139
  107.172.148.140
@@ -8842,16 +7643,15 @@
  107.172.157.125
  107.172.157.131
  107.172.188.107
-107.172.193.13
  107.172.197.101
  107.172.197.166
-107.172.198.118
  107.172.198.146
  107.172.206.82
  107.172.22.132
  107.172.22.136
-107.172.22.197
  107.172.221.106
+107.172.228.25
+107.172.234.125
  107.172.235.154
  107.172.235.243
  107.172.3.146
@@ -8863,19 +7663,18 @@
  107.172.44.250
  107.172.45.226
  107.172.5.116
-107.172.51.254
-107.172.56.198
  107.172.63.251
+107.172.66.131
  107.172.67.242
  107.172.68.220
+107.172.68.41
  107.172.78.127
+107.172.79.205
  107.172.80.100
  107.172.80.103
  107.172.80.109
  107.172.80.114
  107.172.80.126
-107.172.80.130
-107.172.80.132
  107.172.80.74
  107.172.80.75
  107.172.80.78
@@ -8884,7 +7683,6 @@
  107.172.89.15
  107.172.89.165
  107.172.94.142
-107.172.95.115
  107.172.99.16
  107.172.99.33
  107.172.99.37
@@ -8898,12 +7696,9 @@
  107.173.129.119
  107.173.129.124
  107.173.137.253
-107.173.141.112
  107.173.141.130
-107.173.141.161
  107.173.149.104
  107.173.159.130
-107.173.171.150
  107.173.176.100
  107.173.176.172
  107.173.178.155
@@ -8922,18 +7717,16 @@
  107.173.201.237
  107.173.201.238
  107.173.201.244
-107.173.202.178
  107.173.202.198
+107.173.202.205
+107.173.202.228
  107.173.204.16
  107.173.204.160
-107.173.209.241
  107.173.209.244
  107.173.213.43
  107.173.219.103
-107.173.219.152
  107.173.219.51
  107.173.222.153
-107.173.229.72
  107.173.230.200
  107.173.230.222
  107.173.230.223
@@ -8946,42 +7739,42 @@
  107.173.230.251
  107.173.233.12
  107.173.233.120
-107.173.246.131
-107.173.248.100
-107.173.248.115
  107.173.248.116
  107.173.248.133
  107.173.248.151
  107.173.248.91
  107.173.248.95
-107.173.25.10
  107.173.251.100
+107.173.254.125
  107.173.27.180
  107.173.28.34
  107.173.28.37
  107.173.28.61
  107.173.4.154
-107.173.46.175
+107.173.40.130
+107.173.44.146
  107.173.48.253
  107.173.49.10
  107.173.50.143
  107.173.50.146
  107.173.50.149
+107.173.50.205
  107.173.50.217
  107.173.50.220
  107.173.50.223
  107.173.51.246
  107.173.67.131
  107.173.70.254
+107.173.73.102
+107.173.73.78
  107.173.85.110
  107.173.91.164
  107.174.108.114
-107.174.128.180
  107.174.13.220
  107.174.133.119
  107.174.144.155
+107.174.148.39
  107.174.150.158
-107.174.150.66
  107.174.150.98
  107.174.151.199
  107.174.170.139
@@ -8990,17 +7783,15 @@
  107.174.205.28
  107.174.206.110
  107.174.224.151
-107.174.224.153
  107.174.224.163
  107.174.224.181
  107.174.224.184
  107.174.224.185
-107.174.233.116
+107.174.233.122
  107.174.24.12
  107.174.240.42
+107.174.245.119
  107.174.245.4
-107.174.25.205
-107.174.250.128
  107.174.26.181
  107.174.33.134
  107.174.33.135
@@ -9008,22 +7799,16 @@
  107.174.33.143
  107.174.33.144
  107.174.33.153
-107.174.37.143
  107.174.37.152
  107.174.39.102
  107.174.39.118
-107.174.44.190
+107.174.5.131
  107.174.5.137
-107.174.61.111
-107.174.61.115
  107.174.69.137
-107.174.76.247
  107.175.0.13
  107.175.108.141
  107.175.108.149
  107.175.108.254
-107.175.123.241
-107.175.128.141
  107.175.146.118
  107.175.146.122
  107.175.146.85
@@ -9043,7 +7828,6 @@
  107.175.158.116
  107.175.158.118
  107.175.158.125
-107.175.158.200
  107.175.158.74
  107.175.158.92
  107.175.184.197
@@ -9055,14 +7839,12 @@
  107.175.197.164
  107.175.2.124
  107.175.216.111
+107.175.220.112
  107.175.229.145
-107.175.237.209
-107.175.240.120
  107.175.32.103
  107.175.32.124
  107.175.33.240
  107.175.33.29
-107.175.35.150
  107.175.35.151
  107.175.35.168
  107.175.35.174
@@ -9071,11 +7853,9 @@
  107.175.36.163
  107.175.38.14
  107.175.38.20
-107.175.38.42
  107.175.39.104
-107.175.58.126
+107.175.46.123
  107.175.58.180
-107.175.58.82
  107.175.61.58
  107.175.64.101
  107.175.64.176
@@ -9092,7 +7872,6 @@
  107.175.77.60
  107.175.8.68
  107.175.8.75
-107.175.8.76
  107.175.8.78
  107.175.81.135
  107.175.83.17
@@ -9102,15 +7881,12 @@
  107.175.87.114
  107.175.93.102
  107.175.93.120
-107.175.93.254
  107.175.93.67
  107.175.94.166
-107.175.94.179
  107.175.94.18
  107.178.6.30
  107.178.91.53
  107.178.98.66
-107.179.70.130
  107.179.95.6
  107.179.96.11
  107.180.100.223
@@ -9122,16 +7898,24 @@
  107.180.108.24
  107.180.108.32
  107.180.108.7
+107.180.111.12
  107.180.111.13
-107.180.120.35
+107.180.111.21
+107.180.111.5
+107.180.111.8
  107.180.120.45
+107.180.120.51
+107.180.120.52
  107.180.120.55
  107.180.120.61
+107.180.120.70
  107.180.121.26
  107.180.122.10
-107.180.122.17
+107.180.122.15
+107.180.122.60
  107.180.122.7
-107.180.123.10
+107.180.123.20
+107.180.123.24
  107.180.227.163
  107.180.239.203
  107.180.44.78
@@ -9140,9 +7924,11 @@
  107.180.84.251
  107.180.88.189
  107.180.88.41
+107.180.89.170
  107.180.95.43
  107.180.95.70
  107.181.136.147
+107.181.161.85
  107.181.174.175
  107.181.175.112
  107.181.180.163
@@ -9167,7 +7953,6 @@
  107.182.25.146
  107.184.39.22
  107.185.149.136
-107.185.206.112
  107.186.120.130
  107.189.10.119
  107.189.10.140
@@ -9188,9 +7973,7 @@
  107.190.148.202
  107.190.169.128
  107.190.175.81
-107.190.207.63
  107.190.47.97
-107.190.64.40
  107.191.110.183
  107.191.116.103
  107.191.125.124
@@ -9198,13 +7981,12 @@
  107.191.40.221
  107.191.45.65
  107.191.49.16
-107.191.50.201
+107.191.50.50
  107.191.51.136
  107.191.61.187
  107.191.63.217
  107.191.63.62
  107.191.98.220
-107.197.61.78
  107.2.139.165
  107.2.2.28
  107.20.132.54
@@ -9251,42 +8033,9 @@
  107.4.112.187
  107.4.147.118
  107.5.122.110
-107.5.163.129
-107.6.162.218
-107.6.162.219
-107.6.162.220
-107.6.162.221
-107.6.162.222
  107.6.162.34
-107.6.162.35
-107.6.162.36
-107.6.162.37
-107.6.162.38
  107.6.163.34
-107.6.163.35
-107.6.163.36
-107.6.163.37
-107.6.163.38
-107.6.168.210
-107.6.168.211
-107.6.168.212
-107.6.168.213
-107.6.168.214
-107.6.168.242
-107.6.168.243
-107.6.168.244
-107.6.168.245
-107.6.168.246
  107.6.171.186
-107.6.171.187
-107.6.171.188
-107.6.171.189
-107.6.171.190
-107.6.180.154
-107.6.180.155
-107.6.180.156
-107.6.180.157
-107.6.180.158
  107.6.182.210
  107.6.242.130
  107.6.242.131
@@ -9380,27 +8129,24 @@
  107.77.90.90
  107.77.94.82
  107.77.94.83
+107.9.20.25
  107217279.snapchatprime.com
  1073.co.jp
  108-365.net
-108.11.29.107
-108.12.147.7
  108.16.0.72
  108.160.138.55
  108.160.141.213
  108.160.193.48
-108.160.95.80
  108.161.122.223
-108.161.128.164
+108.161.128.7
+108.161.129.118
  108.161.131.41
-108.161.134.78
-108.162.215.124
-108.162.215.68
+108.161.134.8
+108.162.219.224
  108.162.219.24
-108.162.219.46
-108.162.229.112
-108.162.229.146
-108.162.229.186
+108.162.219.48
+108.162.229.114
+108.162.229.142
  108.162.229.210
  108.162.229.238
  108.162.229.35
@@ -9409,12 +8155,6 @@
  108.162.246.36
  108.162.246.54
  108.162.28.6
-108.162.4.138
-108.163.220.2
-108.163.220.3
-108.163.220.4
-108.163.220.5
-108.163.220.6
  108.163.250.106
  108.165.192.113
  108.165.192.133
@@ -9438,7 +8178,6 @@
  108.169.166.42
  108.170.11.243
  108.170.16.154
-108.170.29.90
  108.170.31.68
  108.170.31.69
  108.170.54.227
@@ -9453,27 +8192,22 @@
  108.171.241.18
  108.171.94.90
  108.172.246.109
-108.173.197.6
  108.173.64.161
+108.174.115.43
  108.174.153.215
-108.174.191.182
  108.174.195.240
  108.174.196.234
  108.174.198.231
-108.174.199.129
  108.174.199.180
-108.174.199.184
  108.174.199.54
  108.174.81.136
  108.175.154.212
-108.175.225.220
  108.175.233.202
  108.175.86.73
  108.176.59.82
  108.178.10.50
  108.178.15.210
  108.178.75.172
-108.179.217.85
  108.179.219.114
  108.179.222.230
  108.179.223.98
@@ -9482,8 +8216,6 @@
  108.185.142.237
  108.186.6.161
  108.186.6.193
-108.189.182.190
-108.189.32.20
  108.19.140.2
  108.190.109.107
  108.190.181.145
@@ -9491,15 +8223,13 @@
  108.191.179.69
  108.191.2.72
  108.191.42.82
+108.195.234.233
  108.199.239.172
  108.20.186.210
  108.20.207.31
  108.200.255.200
  108.201.79.41
-108.207.11.152
  108.21.72.56
-108.211.115.210
-108.212.188.189
  108.212.98.124
  108.213.205.103
  108.222.149.83
@@ -9508,46 +8238,33 @@
  108.234.193.106
  108.247.173.170
  108.248.87.92
-108.249.74.114
-108.26.234.213
-108.27.36.189
  108.28.146.102
-108.28.153.128
  108.29.164.150
  108.29.164.250
-108.29.207.253
  108.29.77.74
-108.29.95.252
  108.30.14.21
  108.30.209.194
  108.30.47.79
  108.31.147.13
  108.31.26.131
  108.33.213.8
-108.35.101.26
  108.36.253.227
  108.4.207.148
  108.41.142.8
  108.41.2.202
-108.45.109.14
  108.46.207.204
  108.46.29.236
  108.48.169.20
-108.48.176.222
  108.5.154.248
-108.5.49.62
  108.51.195.30
  108.51.85.97
  108.52.18.169
-108.53.145.212
  108.53.194.184
-108.53.229.37
  108.53.71.98
  108.54.250.156
  108.56.134.33
  108.56.153.217
  108.58.123.210
-108.58.84.194
  108.59.192.147
  108.59.8.80
  108.6.112.175
@@ -9556,6 +8273,7 @@
  108.60.219.24
  108.60.35.139
  108.60.47.123
+108.60.47.178
  108.61.119.36
  108.61.123.69
  108.61.123.70
@@ -9582,6 +8300,7 @@
  108.61.207.145
  108.61.214.254
  108.61.215.110
+108.61.219.104
  108.61.223.143
  108.61.224.74
  108.61.229.7
@@ -9592,8 +8311,6 @@
  108.61.75.251
  108.61.86.34
  108.61.87.179
-108.62.121.176
-108.62.121.210
  108.62.21.154
  108.62.56.0
  108.62.56.1
@@ -11649,10 +10366,7 @@
  108.67.148.87
  108.7.205.58
  108.72.209.30
-108.75.3.147
  108.78.162.234
-108.83.25.163
-108.85.84.173
  108.9.195.212
  108.92.68.190
  1080wallpapers.xyz
@@ -11662,22 +10376,14 @@
  108studija.lt
  109-365.net
  109.1.105.79
-109.1.186.234
  109.10.122.157
  109.100.123.228
  109.101.137.162
  109.101.139.106
  109.101.196.50
-109.101.210.69
  109.102.228.130
  109.102.254.170
  109.102.83.31
-109.103.167.204
-109.103.174.2
-109.103.235.116
-109.103.235.145
-109.103.88.14
-109.104.162.96
  109.104.164.105
  109.104.216.148
  109.104.243.204
@@ -11686,34 +10392,28 @@
  109.104.87.199
  109.105.205.229
  109.105.205.230
+109.105.205.232
  109.106.139.225
-109.107.85.110
-109.107.95.226
  109.108.136.103
-109.108.50.221
  109.108.87.136
  109.108.88.156
-109.108.89.130
  109.110.52.77
+109.110.54.210
  109.110.73.106
  109.110.73.176
  109.110.81.90
+109.111.154.108
  109.111.164.63
  109.111.237.38
  109.115.114.214
  109.116.14.186
-109.116.152.107
  109.116.173.154
-109.116.20.230
-109.116.245.220
  109.116.245.80
  109.116.41.170
  109.116.41.238
-109.117.125.132
-109.117.165.131
-109.117.222.13
  109.117.250.76
  109.117.53.230
+109.118.99.39
  109.12.26.252
  109.120.141.160
  109.120.141.220
@@ -11721,9 +10421,7 @@
  109.120.172.1
  109.120.194.136
  109.120.226.236
-109.121.212.233
  109.121.59.114
-109.122.221.59
  109.122.80.234
  109.122.81.1
  109.122.81.11
@@ -11736,49 +10434,37 @@
  109.123.66.206
  109.124.65.86
  109.125.128.53
-109.125.132.143
-109.125.133.156
  109.125.136.233
  109.125.137.170
-109.125.140.9
-109.125.209.0
-109.126.12.162
  109.130.41.110
  109.133.195.236
+109.133.31.73
  109.134.232.81
+109.134.89.132
  109.136.104.217
-109.136.135.101
  109.146.74.95
-109.147.219.51
  109.148.140.120
-109.149.158.112
  109.149.177.137
-109.156.74.144
+109.150.163.99
  109.160.22.211
+109.160.23.105
  109.160.41.198
-109.160.41.56
-109.160.41.69
  109.160.55.202
-109.160.72.219
-109.160.72.231
-109.160.72.232
  109.160.88.135
-109.160.96.13
-109.160.96.222
-109.160.97.161
  109.160.97.49
  109.161.56.19
  109.162.127.192
  109.162.234.222
  109.162.242.76
-109.162.35.86
+109.162.67.234
  109.163.159.61
  109.163.234.5
  109.164.113.55
  109.164.32.98
+109.165.25.15
  109.165.43.131
+109.166.128.4
  109.166.213.12
-109.166.70.172
  109.166.89.91
  109.167.132.201
  109.167.134.253
@@ -11786,7 +10472,6 @@
  109.167.200.10
  109.167.207.72
  109.167.210.163
-109.167.219.42
  109.167.226.107
  109.167.231.99
  109.167.249.41
@@ -11805,38 +10490,32 @@
  109.169.66.142
  109.169.73.23
  109.169.74.123
-109.170.24.253
  109.170.96.18
  109.170.97.146
-109.172.180.157
-109.172.67.82
-109.173.131.184
-109.173.131.67
+109.172.57.64
  109.173.168.105
  109.173.41.43
  109.173.41.95
+109.173.87.173
  109.173.98.149
  109.174.19.134
  109.175.10.239
+109.180.71.175
  109.183.189.238
  109.183.251.77
-109.183.32.106
-109.184.159.251
  109.184.197.228
  109.185.141.61
  109.185.180.87
  109.185.186.177
  109.185.44.56
-109.186.229.64
-109.187.93.97
  109.188.132.86
  109.188.69.113
+109.188.72.176
  109.188.79.159
  109.188.86.168
  109.188.95.148
-109.190.153.173
-109.190.199.30
  109.190.35.249
+109.191.108.108
  109.191.194.31
  109.193.77.109
  109.194.163.190
@@ -11845,29 +10524,20 @@
  109.194.174.78
  109.194.175.108
  109.194.175.135
-109.194.3.165
-109.195.115.13
  109.195.177.136
  109.195.179.88
  109.195.18.45
  109.195.194.79
-109.195.215.52
  109.195.23.223
  109.195.49.86
  109.195.83.165
  109.196.172.252
+109.196.252.216
  109.196.68.236
  109.196.82.214
-109.197.80.85
-109.197.81.0
-109.197.81.131
-109.197.81.133
-109.197.81.36
  109.197.93.133
-109.198.17.237
  109.199.133.161
  109.199.241.148
-109.20.110.179
  109.200.132.161
  109.200.156.102
  109.200.24.116
@@ -11875,11 +10545,12 @@
  109.200.24.98
  109.200.26.99
  109.201.133.100
+109.201.133.30
  109.201.140.50
  109.201.140.9
  109.201.142.116
+109.201.142.34
  109.201.189.48
-109.201.29.112
  109.201.96.222
  109.202.10.22
  109.202.107.147
@@ -11889,22 +10560,16 @@
  109.205.45.246
  109.206.139.119
  109.206.168.240
-109.206.245.10
  109.207.102.183
  109.207.104.125
-109.207.186.155
  109.207.46.111
-109.207.68.19
-109.207.68.24
  109.207.79.248
  109.21.2.25
  109.210.97.157
-109.210.98.161
+109.214.236.21
  109.215.93.107
  109.218.221.35
-109.219.76.96
  109.224.1.210
-109.224.11.238
  109.224.12.170
  109.224.12.174
  109.224.16.110
@@ -11913,24 +10578,22 @@
  109.224.22.38
  109.224.34.18
  109.224.34.21
-109.224.4.130
  109.224.45.138
  109.224.54.18
  109.224.55.10
  109.224.55.6
  109.226.213.125
-109.226.220.205
  109.226.220.93
  109.227.199.25
  109.227.63.3
  109.228.12.92
  109.228.159.154
  109.228.168.80
+109.228.204.162
  109.228.21.246
  109.228.50.121
  109.228.53.116
  109.229.0.46
-109.229.171.58
  109.229.2.152
  109.229.210.6
  109.229.4.87
@@ -11966,16 +10629,13 @@
  109.236.88.245
  109.236.90.117
  109.236.91.15
-109.237.103.132
-109.237.103.136
-109.237.103.138
  109.237.103.140
+109.237.103.145
+109.237.103.146
+109.237.103.147
  109.237.103.148
-109.237.108.50
  109.237.147.213
  109.237.214.77
-109.237.233.239
-109.237.24.164
  109.237.26.218
  109.237.92.138
  109.238.11.95
@@ -11996,16 +10656,11 @@
  109.24.144.155
  109.241.164.89
  109.242.142.225
-109.242.147.182
  109.242.153.9
-109.242.197.81
-109.242.34.125
  109.244.102.27
  109.244.103.150
  109.244.35.32
-109.244.35.47
  109.244.35.48
-109.244.96.201
  109.244.97.16
  109.244.99.20
  109.245.214.49
@@ -12017,17 +10672,17 @@
  109.245.242.105
  109.247.106.144
  109.247.217.24
-109.248.12.187
  109.248.128.9
  109.248.129.241
  109.248.13.11
  109.248.13.247
+109.248.138.129
  109.248.139.244
  109.248.14.33
  109.248.14.90
+109.248.142.116
  109.248.142.223
  109.248.142.99
-109.248.143.191
  109.248.147.150
  109.248.148.57
  109.248.149.25
@@ -12037,8 +10692,6 @@
  109.248.167.117
  109.248.167.56
  109.248.200.189
-109.248.200.192
-109.248.203.27
  109.248.203.4
  109.248.205.252
  109.248.205.94
@@ -12047,7 +10700,7 @@
  109.248.55.51
  109.248.62.207
  109.248.9.32
-109.250.247.140
+109.250.249.254
  109.250.252.107
  109.251.252.123
  109.251.76.229
@@ -12057,11 +10710,11 @@
  109.252.240.202
  109.252.255.162
  109.252.28.102
+109.252.57.32
  109.254.6.40
  109.255.19.91
  109.28.39.119
  109.31.131.82
-109.59.140.162
  109.61.10.121
  109.61.112.10
  109.61.112.33
@@ -12069,26 +10722,25 @@
  109.61.112.53
  109.61.14.0
  109.61.2.166
-109.61.231.7
+109.61.212.131
+109.61.233.186
  109.61.248.82
-109.62.104.11
  109.62.232.111
  109.63.158.71
  109.63.163.233
  109.63.235.38
  109.64.229.66
  109.64.231.189
-109.64.95.221
  109.65.21.48
  109.67.81.251
  109.68.189.22
+109.68.212.106
  109.68.212.165
  109.69.0.68
  109.69.0.69
  109.69.1.234
  109.69.10.116
  109.69.161.131
-109.69.6.118
  109.69.67.17
  109.69.75.5
  109.7.44.186
@@ -12126,16 +10778,13 @@
  109.70.100.60
  109.70.132.150
  109.70.189.51
-109.70.189.56
  109.70.189.70
  109.70.189.88
  109.70.3.229
  109.70.36.102
-109.71.213.41
  109.71.41.50
  109.71.44.143
-109.72.239.244
-109.72.245.114
+109.72.192.90
  109.72.83.127
  109.72.85.41
  109.72.87.206
@@ -12157,19 +10806,22 @@
  109.74.206.146
  109.74.5.95
  109.74.51.83
+109.74.66.102
  109.75.140.158
  109.75.178.101
  109.75.185.95
+109.75.250.110
  109.75.34.152
  109.75.34.183
  109.75.36.93
-109.75.41.71
  109.75.42.231
  109.75.43.17
+109.75.45.34
+109.76.115.169
+109.78.252.38
  109.80.128.210
  109.86.121.118
  109.86.134.93
-109.86.187.241
  109.86.190.92
  109.86.198.220
  109.86.219.161
@@ -12179,7 +10831,6 @@
  109.86.226.133
  109.86.244.225
  109.86.248.118
-109.86.255.206
  109.86.71.186
  109.87.11.192
  109.87.122.206
@@ -12190,6 +10841,8 @@
  109.87.78.144
  109.89.72.188
  109.89.73.188
+109.89.73.236
+109.89.77.20
  109.9.175.65
  109.9.64.130
  109.90.2.70
@@ -12204,16 +10857,16 @@
  109.93.179.72
  109.93.51.185
  109.94.115.108
-109.94.119.6
  109.94.182.128
  109.94.182.9
+109.94.220.47
  109.95.255.82
-109.95.38.206
  109.96.127.90
  109.96.172.102
  109.96.66.75
-109.97.116.131
+109.98.109.101
  109.99.146.210
+109.99.198.44
  109.99.37.97
  109.99.63.159
  10925verify.com
@@ -12255,16 +10908,17 @@
  110.10.178.251
  110.10.179.64
  110.10.179.65
-110.10.183.98
  110.10.9.158
  110.12.123.11
-110.12.159.89
+110.12.221.72
+110.12.4.132
  110.12.64.96
  110.13.128.178
  110.132.199.200
  110.136.129.228
  110.136.241.180
-110.136.67.193
+110.137.133.45
+110.137.88.135
  110.138.195.86
  110.138.228.198
  110.139.116.156
@@ -12273,24 +10927,16 @@
  110.139.160.249
  110.139.206.102
  110.139.24.72
-110.14.163.111
-110.14.163.112
-110.14.184.43
-110.14.58.190
  110.140.161.226
  110.141.221.58
-110.141.252.2
  110.142.161.90
-110.142.178.43
  110.142.236.207
  110.143.155.171
  110.143.84.202
  110.145.101.66
  110.145.11.73
  110.145.77.103
-110.15.30.242
  110.15.56.173
-110.152.110.39
  110.154.150.247
  110.154.175.68
  110.154.208.185
@@ -12306,31 +10952,20 @@
  110.156.55.125
  110.156.65.88
  110.157.217.111
-110.157.232.46
  110.157.28.43
  110.159.150.137
-110.16.13.180
-110.16.79.74
-110.16.95.206
+110.159.160.15
  110.16.95.6
  110.164.101.129
-110.164.129.40
-110.164.147.189
  110.164.163.54
  110.164.189.53
  110.164.86.203
  110.164.91.50
  110.164.93.99
  110.165.19.77
-110.165.35.52
-110.165.37.61
  110.166.254.84
  110.166.87.119
-110.167.133.45
-110.167.200.6
  110.167.30.50
-110.167.76.76
-110.169.175.6
  110.169.70.204
  110.17.41.183
  110.17.41.93
@@ -12342,17 +10977,15 @@
  110.171.226.67
  110.171.25.62
  110.171.29.219
-110.172.135.66
  110.172.160.42
  110.172.166.161
  110.172.174.249
-110.172.189.7
-110.173.54.100
  110.174.148.117
  110.174.223.95
  110.174.39.158
  110.175.118.246
  110.175.128.62
+110.177.104.58
  110.177.12.230
  110.177.3.152
  110.177.40.96
@@ -12366,51 +10999,37 @@
  110.18.194.228
  110.18.194.234
  110.18.194.236
-110.18.243.70
  110.182.107.42
-110.182.146.123
  110.182.186.127
  110.182.246.105
  110.182.62.68
  110.183.108.189
  110.184.225.77
+110.184.31.150
  110.185.104.126
  110.185.125.69
-110.185.125.70
  110.185.125.78
-110.185.160.106
-110.185.164.158
+110.185.125.94
+110.185.164.133
  110.185.185.17
-110.185.229.188
-110.185.229.247
-110.185.229.4
+110.185.5.246
  110.187.228.55
-110.188.131.189
  110.188.23.170
-110.188.66.133
  110.188.70.99
-110.189.152.59
  110.191.211.250
  110.225.109.167
-110.225.99.118
  110.227.118.199
-110.227.250.72
  110.227.254.75
  110.228.184.20
-110.228.187.210
  110.228.217.244
  110.228.219.153
  110.228.244.79
  110.228.91.170
-110.229.19.181
-110.230.20.228
  110.230.58.147
-110.231.192.253
  110.232.248.62
  110.232.249.177
  110.232.249.226
  110.232.252.145
-110.232.64.157
  110.232.74.51
  110.232.74.55
  110.232.76.39
@@ -12426,93 +11045,55 @@
  110.235.65.178
  110.235.89.5
  110.240.164.57
-110.240.20.110
+110.240.205.139
  110.240.205.93
-110.242.149.160
  110.243.178.147
  110.243.21.44
-110.243.3.205
  110.243.5.243
-110.244.158.234
-110.244.230.28
  110.244.51.22
-110.246.104.29
-110.246.2.106
  110.247.16.64
  110.247.180.69
-110.248.189.161
-110.248.216.91
  110.248.38.0
-110.248.38.151
-110.249.137.131
-110.249.143.202
-110.249.183.3
-110.249.183.67
-110.249.216.130
-110.249.251.154
-110.25.88.109
-110.25.94.142
-110.250.154.161
  110.251.132.10
-110.251.166.118
+110.251.210.22
  110.251.212.85
-110.251.221.121
  110.251.72.158
-110.251.72.251
-110.252.176.55
-110.252.56.8
-110.253.97.117
+110.253.212.183
  110.255.141.230
  110.255.141.95
-110.255.8.242
+110.255.186.199
  110.255.9.218
  110.255.95.62
  110.32.29.185
-110.34.122.196
  110.34.166.35
  110.34.166.38
  110.34.166.52
-110.34.181.45
  110.34.5.96
-110.34.70.88
-110.34.70.96
-110.34.80.215
-110.35.10.120
  110.35.136.73
-110.35.200.29
  110.35.221.15
  110.35.234.192
  110.35.235.57
  110.35.245.72
  110.35.29.85
-110.35.49.72
  110.35.79.23
  110.35.80.82
  110.36.200.165
-110.36.216.62
-110.36.218.194
+110.36.218.246
  110.36.220.101
  110.36.234.146
-110.37.207.98
  110.37.216.118
  110.37.224.243
  110.37.226.83
  110.37.227.139
-110.38.28.92
  110.39.1.138
  110.39.135.46
  110.39.160.132
-110.39.160.141
  110.39.174.58
  110.39.199.89
-110.39.23.154
-110.39.8.26
  110.4.27.27
  110.4.45.150
  110.4.45.230
-110.40.13.121
-110.40.13.164
-110.40.13.165
+110.4.45.30
  110.42.1.213
  110.42.10.141
  110.42.66.111
@@ -12520,20 +11101,15 @@
  110.43.242.170
  110.43.42.91
  110.43.46.88
-110.43.50.203
  110.43.52.158
  110.43.52.211
  110.43.52.246
-110.43.64.132
+110.43.69.204
  110.44.113.187
-110.44.116.2
  110.44.117.26
-110.44.122.214
-110.44.122.76
  110.44.123.116
+110.44.124.220
  110.44.126.235
-110.44.240.194
-110.44.240.199
  110.45.139.12
  110.45.145.165
  110.45.146.84
@@ -12541,11 +11117,6 @@
  110.45.147.248
  110.45.147.77
  110.45.155.101
-110.46.12.14
-110.46.12.15
-110.46.15.133
-110.46.15.134
-110.46.15.136
  110.47.218.84
  110.49.101.58
  110.49.11.50
@@ -12553,41 +11124,26 @@
  110.49.127.88
  110.49.167.189
  110.49.47.242
-110.49.60.66
  110.5.102.238
-110.50.52.65
-110.50.53.11
  110.50.84.162
  110.50.84.231
  110.50.85.162
-110.52.230.57
-110.52.27.102
-110.52.28.162
-110.52.28.81
-110.52.29.146
-110.52.29.193
  110.53.182.126
  110.54.126.94
  110.54.132.3
-110.54.135.189
  110.54.194.31
+110.54.237.24
  110.54.237.48
  110.55.117.248
-110.6.144.203
-110.7.114.186
-110.7.232.166
  110.7.239.144
-110.7.247.253
-110.7.52.209
-110.74.147.160
+110.72.251.22
  110.74.177.198
-110.74.179.67
  110.74.193.108
  110.74.193.200
  110.74.195.64
  110.74.199.16
  110.74.200.14
-110.74.211.10
+110.74.208.154
  110.74.221.18
  110.74.221.89
  110.74.222.159
@@ -12595,7 +11151,6 @@
  110.74.222.213
  110.74.222.71
  110.76.128.53
-110.76.129.95
  110.76.155.145
  110.77.132.217
  110.77.135.131
@@ -12607,23 +11162,26 @@
  110.77.145.159
  110.77.149.227
  110.77.149.76
+110.77.152.150
  110.77.154.55
+110.77.164.149
  110.77.173.178
  110.77.178.106
  110.77.180.31
+110.77.184.143
  110.77.184.207
  110.77.184.212
  110.77.184.35
+110.77.186.22
  110.77.187.127
  110.77.189.93
  110.77.191.61
-110.77.192.210
  110.77.196.76
  110.77.197.116
  110.77.197.161
+110.77.202.159
  110.77.207.179
  110.77.210.204
-110.77.216.57
  110.77.217.219
  110.77.217.238
  110.77.226.214
@@ -12632,10 +11190,7 @@
  110.77.232.141
  110.77.232.210
  110.77.232.219
-110.77.232.53
-110.77.235.110
  110.77.235.209
-110.77.235.251
  110.77.236.116
  110.77.236.121
  110.77.236.165
@@ -12643,7 +11198,7 @@
  110.77.240.174
  110.77.242.165
  110.77.242.2
-110.77.243.206
+110.77.246.15
  110.77.250.185
  110.78.136.97
  110.78.137.118
@@ -12653,21 +11208,23 @@
  110.78.141.136
  110.78.141.249
  110.78.141.97
+110.78.143.187
  110.78.143.20
  110.78.145.121
  110.78.145.138
+110.78.145.36
  110.78.146.141
  110.78.146.208
-110.78.146.32
  110.78.146.65
+110.78.147.102
  110.78.147.12
  110.78.147.163
  110.78.147.208
+110.78.147.82
  110.78.148.115
  110.78.148.126
  110.78.148.194
-110.78.148.230
-110.78.148.249
+110.78.148.99
  110.78.149.164
  110.78.149.18
  110.78.149.196
@@ -12677,6 +11234,7 @@
  110.78.149.59
  110.78.149.85
  110.78.151.2
+110.78.152.14
  110.78.152.164
  110.78.153.120
  110.78.153.50
@@ -12690,17 +11248,12 @@
  110.78.175.117
  110.78.186.216
  110.78.186.218
-110.78.186.224
  110.78.186.228
-110.78.186.231
-110.78.186.238
  110.78.186.252
+110.78.186.68
  110.78.186.94
  110.78.20.62
-110.78.208.24
-110.78.4.26
  110.78.81.107
-110.8.237.75
  110.8.67.146
  110.8.71.166
  110.8.84.231
@@ -12712,44 +11265,33 @@
  110.82.2.212
  110.83.163.21
  110.83.40.160
-110.83.51.25
-110.84.220.26
-110.85.5.210
+110.85.180.215
+110.85.90.4
  110.85.99.187
  110.85.99.220
  110.87.80.53
  110.88.160.179
  110.88.160.233
-110.88.29.23
-110.88.31.42
+110.88.98.102
  110.89.122.207
-110.89.158.158
-110.90.170.183
  110.93.13.182
  110.93.13.190
  110.93.13.33
  110.93.200.118
-110.93.205.190
  110.93.214.35
  110.93.214.37
+110.93.222.250
  110.93.226.177
  110.93.82.212
  110.93.87.254
  1105355415.rsc.cdn77.org
-111.0.124.124
  111.0.124.232
-111.1.62.189
-111.10.19.16
-111.10.63.36
-111.11.107.130
-111.11.117.90
+111.0.80.7
+111.102.66.22
  111.11.181.53
-111.11.95.137
-111.113.106.70
  111.117.122.246
  111.117.123.245
  111.118.104.86
-111.118.115.206
  111.118.117.93
  111.118.124.110
  111.118.124.115
@@ -12761,37 +11303,23 @@
  111.118.150.193
  111.118.155.61
  111.118.171.103
-111.118.202.18
-111.118.32.26
-111.118.51.101
-111.118.64.140
  111.118.65.24
  111.118.79.22
  111.118.88.61
  111.118.96.2
  111.118.98.110
  111.119.183.58
+111.119.187.19
  111.119.187.3
-111.119.187.54
  111.119.210.10
-111.119.218.179
+111.119.231.114
  111.119.233.65
  111.119.245.114
-111.119.249.129
-111.12.191.174
-111.12.255.42
-111.12.60.50
  111.120.16.2
+111.121.104.173
  111.121.110.139
-111.121.192.228
-111.122.175.73
-111.122.182.17
  111.122.228.38
-111.122.228.76
-111.122.232.6
-111.124.98.136
  111.125.119.235
-111.125.143.143
  111.125.70.22
  111.125.87.199
  111.125.88.186
@@ -12801,14 +11329,11 @@
  111.132.5.132
  111.132.7.174
  111.14.221.8
-111.14.222.130
  111.14.86.53
-111.160.112.142
  111.160.226.178
-111.160.231.251
-111.160.66.22
  111.161.41.156
  111.161.43.208
+111.161.66.123
  111.161.72.99
  111.161.74.100
  111.161.74.105
@@ -12820,27 +11345,15 @@
  111.161.74.125
  111.162.139.208
  111.162.175.250
-111.162.224.162
-111.162.54.255
-111.164.173.131
+111.162.32.150
  111.165.242.26
  111.165.249.192
  111.165.25.192
  111.165.58.138
  111.165.9.204
  111.166.196.42
-111.167.12.255
  111.167.149.163
  111.167.160.161
-111.167.190.148
-111.17.169.120
-111.17.181.27
-111.17.181.28
-111.17.181.30
-111.17.192.26
-111.17.215.190
-111.17.215.213
-111.17.223.104
  111.170.105.135
  111.170.84.158
  111.170.84.160
@@ -12848,162 +11361,89 @@
  111.171.32.248
  111.172.166.248
  111.175.186.150
-111.175.92.195
  111.176.156.126
  111.176.46.94
-111.177.114.5
  111.177.178.19
  111.177.18.194
  111.177.18.62
-111.177.32.73
+111.177.188.137
  111.178.105.147
-111.179.115.13
-111.179.38.202
  111.18.177.62
-111.180.108.79
-111.182.234.255
+111.18.82.53
  111.182.236.146
  111.182.236.65
  111.182.237.131
-111.185.124.87
-111.185.125.139
  111.185.16.56
  111.185.18.26
-111.185.19.107
  111.185.230.136
-111.185.52.150
+111.185.4.94
  111.186.57.17
  111.186.58.61
-111.187.45.87
-111.19.137.116
-111.19.162.235
-111.19.255.10
-111.19.255.11
-111.19.255.20
-111.19.255.21
-111.19.255.22
-111.19.255.23
-111.19.255.7
-111.19.83.248
-111.192.78.37
-111.196.128.196
-111.198.29.247
-111.198.3.54
+111.19.141.16
+111.19.198.4
+111.197.133.63
  111.198.33.54
-111.198.48.187
  111.198.48.204
  111.199.45.186
  111.2.23.244
  111.20.159.74
+111.20.190.16
  111.20.195.30
  111.200.175.175
-111.200.197.227
-111.200.244.226
-111.200.54.113
-111.202.12.190
+111.200.216.72
  111.202.130.168
-111.202.133.66
  111.202.211.10
-111.203.185.38
-111.203.196.62
  111.203.200.213
  111.203.200.216
  111.203.200.217
-111.203.206.13
-111.204.110.202
-111.204.119.227
  111.204.176.209
  111.204.204.72
-111.204.215.181
-111.205.13.85
-111.205.151.162
-111.205.170.2
  111.205.6.222
-111.206.120.250
-111.206.132.40
-111.206.170.103
-111.206.170.115
-111.206.170.119
-111.206.170.99
  111.206.221.95
-111.206.250.198
-111.206.86.149
-111.206.87.226
-111.207.1.42
-111.207.1.43
-111.207.1.55
-111.207.167.147
-111.207.167.151
+111.206.250.230
  111.207.182.2
-111.207.231.250
-111.207.36.124
  111.207.49.186
  111.207.92.209
-111.21.174.101
-111.21.176.77
-111.21.176.78
-111.21.176.79
-111.21.176.80
-111.21.185.67
  111.21.255.2
-111.21.66.42
  111.21.72.18
+111.21.84.170
  111.21.99.227
-111.22.120.137
-111.22.216.175
-111.22.3.148
  111.220.13.120
  111.220.180.249
  111.220.71.156
  111.220.86.1
  111.223.3.83
-111.223.34.205
-111.223.40.158
-111.223.49.131
-111.223.49.147
-111.223.68.56
-111.223.90.7
-111.224.12.189
-111.224.131.131
  111.224.166.146
-111.224.166.180
  111.224.166.189
+111.224.166.203
+111.224.166.212
  111.224.166.221
  111.224.166.244
-111.224.166.46
-111.224.166.54
  111.224.166.60
  111.224.166.88
-111.224.166.93
+111.224.166.89
  111.224.167.148
  111.224.167.223
-111.224.167.229
-111.224.167.253
  111.224.167.35
-111.224.167.44
  111.224.167.62
-111.224.167.68
-111.224.52.123
  111.224.52.190
+111.224.52.247
  111.224.52.52
-111.224.52.53
-111.224.53.125
-111.224.53.145
+111.224.52.66
+111.224.52.91
+111.224.53.1
+111.224.53.148
+111.224.53.189
+111.224.53.240
+111.224.53.27
+111.224.53.94
  111.225.205.11
-111.225.205.72
-111.225.216.67
-111.225.222.156
-111.225.222.236
-111.225.222.248
-111.225.91.129
-111.225.94.7
  111.229.1.180
  111.229.101.155
-111.229.101.82
  111.229.104.94
-111.229.105.245
  111.229.107.219
  111.229.108.132
+111.229.109.26
  111.229.110.107
  111.229.115.198
  111.229.116.118
@@ -13013,7 +11453,6 @@
  111.229.120.173
  111.229.121.142
  111.229.124.215
-111.229.128.136
  111.229.128.169
  111.229.128.9
  111.229.129.100
@@ -13027,10 +11466,8 @@
  111.229.137.10
  111.229.137.13
  111.229.139.95
-111.229.141.225
  111.229.141.64
  111.229.143.243
-111.229.147.125
  111.229.147.229
  111.229.148.198
  111.229.152.101
@@ -13043,22 +11480,23 @@
  111.229.16.97
  111.229.160.86
  111.229.163.149
+111.229.163.217
  111.229.165.227
  111.229.165.57
  111.229.167.10
  111.229.167.91
  111.229.168.229
+111.229.170.148
  111.229.171.178
  111.229.174.65
-111.229.176.206
  111.229.176.235
  111.229.177.38
+111.229.180.198
  111.229.181.50
  111.229.186.15
  111.229.187.172
  111.229.187.216
  111.229.188.72
-111.229.19.221
  111.229.19.254
  111.229.191.103
  111.229.191.150
@@ -13072,12 +11510,11 @@
  111.229.198.182
  111.229.199.239
  111.229.199.67
-111.229.204.204
+111.229.204.148
  111.229.205.33
  111.229.206.250
  111.229.208.88
  111.229.21.39
-111.229.211.16
  111.229.211.5
  111.229.211.66
  111.229.212.104
@@ -13088,8 +11525,6 @@
  111.229.218.192
  111.229.218.60
  111.229.219.39
-111.229.220.11
-111.229.222.112
  111.229.222.118
  111.229.222.155
  111.229.222.7
@@ -13102,41 +11537,31 @@
  111.229.233.142
  111.229.234.57
  111.229.235.119
-111.229.239.203
  111.229.24.104
  111.229.241.24
  111.229.242.108
  111.229.242.119
-111.229.242.156
  111.229.244.205
  111.229.245.135
-111.229.246.117
  111.229.246.143
  111.229.246.59
  111.229.247.151
  111.229.248.87
  111.229.250.170
-111.229.251.35
-111.229.251.83
  111.229.251.89
  111.229.252.157
-111.229.252.23
  111.229.253.130
  111.229.253.8
  111.229.26.129
  111.229.26.25
-111.229.27.180
  111.229.3.206
  111.229.30.206
  111.229.31.134
-111.229.32.56
  111.229.33.175
  111.229.34.121
  111.229.35.95
  111.229.39.187
  111.229.4.247
-111.229.4.66
-111.229.41.2
  111.229.41.20
  111.229.42.18
  111.229.43.185
@@ -13147,7 +11572,6 @@
  111.229.50.131
  111.229.50.25
  111.229.53.186
-111.229.58.117
  111.229.58.152
  111.229.60.6
  111.229.61.251
@@ -13159,7 +11583,6 @@
  111.229.67.3
  111.229.68.113
  111.229.70.125
-111.229.73.197
  111.229.73.244
  111.229.74.209
  111.229.75.27
@@ -13167,10 +11590,8 @@
  111.229.76.239
  111.229.78.120
  111.229.78.199
-111.229.78.212
  111.229.79.17
-111.229.81.5
-111.229.84.77
+111.229.84.133
  111.229.85.164
  111.229.85.222
  111.229.89.86
@@ -13188,12 +11609,8 @@
  111.230.114.154
  111.230.136.231
  111.230.141.155
-111.230.146.246
-111.230.148.82
  111.230.151.123
-111.230.151.13
  111.230.157.123
-111.230.166.128
  111.230.167.137
  111.230.167.190
  111.230.170.95
@@ -13214,18 +11631,13 @@
  111.230.210.78
  111.230.219.156
  111.230.221.203
-111.230.223.231
-111.230.226.124
-111.230.231.145
  111.230.231.196
  111.230.241.110
  111.230.244.13
-111.230.247.243
  111.230.248.93
  111.230.25.75
  111.230.29.17
  111.230.56.118
-111.230.67.250
  111.230.73.133
  111.230.90.144
  111.230.92.241
@@ -13239,17 +11651,14 @@
  111.231.119.93
  111.231.120.22
  111.231.132.94
-111.231.134.75
  111.231.137.83
  111.231.140.184
-111.231.141.141
  111.231.143.71
  111.231.145.199
  111.231.164.168
  111.231.165.121
  111.231.18.208
  111.231.190.106
-111.231.192.209
  111.231.193.72
  111.231.194.190
  111.231.194.239
@@ -13269,6 +11678,7 @@
  111.231.226.87
  111.231.228.239
  111.231.231.22
+111.231.234.131
  111.231.237.27
  111.231.241.201
  111.231.32.127
@@ -13276,7 +11686,6 @@
  111.231.4.95
  111.231.52.108
  111.231.54.212
-111.231.54.28
  111.231.54.33
  111.231.55.74
  111.231.55.75
@@ -13289,7 +11698,6 @@
  111.231.71.157
  111.231.71.235
  111.231.71.53
-111.231.74.105
  111.231.75.83
  111.231.76.214
  111.231.77.115
@@ -13299,57 +11707,33 @@
  111.231.88.39
  111.231.89.140
  111.231.89.190
-111.231.93.167
-111.231.93.242
  111.231.93.35
-111.235.65.211
  111.239.153.205
  111.239.161.44
-111.241.148.234
-111.241.170.21
+111.242.100.214
  111.243.90.102
-111.246.156.92
  111.246.44.92
  111.248.201.122
-111.249.28.248
-111.250.162.235
+111.250.143.7
  111.250.20.122
  111.251.101.173
  111.251.138.117
-111.251.154.136
  111.251.220.162
  111.251.31.2
-111.251.66.215
-111.251.87.135
  111.252.155.184
-111.252.5.101
  111.253.141.195
-111.253.84.46
  111.255.118.107
  111.255.161.192
-111.255.26.98
+111.255.32.129
  111.255.37.224
-111.255.8.19
-111.26.104.86
-111.26.108.168
  111.26.108.174
-111.26.116.167
-111.26.163.175
-111.26.163.176
  111.26.165.80
-111.26.70.115
-111.3.124.182
-111.30.102.226
+111.30.107.154
  111.30.11.58
  111.30.114.22
-111.30.23.107
-111.30.34.48
-111.30.98.26
  111.31cf4fdae.com
-111.33.112.162
  111.33.112.172
  111.33.152.150
-111.33.37.242
  111.38.10.161
  111.38.102.142
  111.38.103.114
@@ -13362,8 +11746,6 @@
  111.38.104.15
  111.38.104.165
  111.38.106.128
-111.38.113.123
-111.38.117.97
  111.38.121.222
  111.38.121.223
  111.38.121.223bin.sh
@@ -13371,15 +11753,11 @@
  111.38.121.228
  111.38.123.136
  111.38.123.15
-111.38.123.158
  111.38.123.171
  111.38.123.18
  111.38.123.197
  111.38.123.200
  111.38.123.23
-111.38.13.156
-111.38.173.128
-111.38.216.93
  111.38.25.106
  111.38.25.230
  111.38.25.34
@@ -13400,22 +11778,17 @@
  111.38.8.81
  111.38.9.114
  111.38.9.115
-111.39.13.152
-111.39.13.153
-111.39.188.124
-111.39.38.6
-111.39.88.92
-111.4.120.225
-111.4.121.189
+111.39.109.29
  111.40.111.206
-111.40.13.254
+111.40.119.33
+111.40.161.105
+111.40.161.166
+111.40.161.242
+111.40.165.46
  111.40.214.20
  111.40.217.172
  111.40.217.92
  111.40.50.116
-111.40.7.67
-111.40.7.84
-111.40.7.85
  111.40.79.79
  111.40.93.212
  111.42.102.113
@@ -13432,12 +11805,7 @@
  111.42.103.28
  111.42.103.48
  111.42.103.55
-111.42.174.193
-111.42.174.39
-111.42.36.197
-111.42.36.228
-111.42.37.234
-111.42.37.52
+111.42.175.101
  111.42.66.142
  111.42.66.179
  111.42.66.18
@@ -13449,11 +11817,7 @@
  111.42.66.93
  111.42.67.31
  111.42.67.92
-111.42.71.33
  111.42.89.137
-111.43.104.225
-111.43.106.245
-111.43.16.12
  111.43.223.100
  111.43.223.120
  111.43.223.121
@@ -13472,57 +11836,24 @@
  111.43.223.52
  111.43.223.59
  111.43.223.80
-111.43.3.36
-111.43.41.18
  111.43.41.78
-111.47.170.42
-111.47.171.44
  111.47.18.22
-111.47.22.111
-111.47.58.199
  111.48.132.225
-111.50.0.220
-111.50.1.149
  111.50.110.214
  111.52.240.13
-111.53.120.12
  111.53.13.253
-111.56.143.50
-111.56.143.94
-111.56.37.46
-111.56.44.126
-111.56.57.180
  111.56.79.217
  111.56.79.25
-111.56.79.3
  111.57.0.90
-111.59.114.54
  111.59.120.60
-111.59.149.75
-111.59.40.20
-111.59.67.40
-111.59.83.16
-111.6.78.13
-111.6.78.17
  111.6.79.41
-111.6.96.72
  111.61.122.78
  111.61.177.158
-111.61.223.67
-111.61.27.213
-111.61.77.89
-111.61.81.13
  111.61.98.37
  111.62.40.36
-111.62.81.15
-111.63.22.72
-111.63.26.7
-111.63.47.238
-111.63.48.202
  111.65.255.131
  111.67.12.221
  111.67.12.222
-111.67.159.3
  111.67.192.130
  111.67.192.149
  111.67.193.204
@@ -13530,10 +11861,8 @@
  111.67.193.54
  111.67.194.123
  111.67.194.41
-111.67.194.68
  111.67.194.94
  111.67.195.174
-111.67.195.5
  111.67.195.77
  111.67.197.214
  111.67.198.184
@@ -13554,86 +11883,54 @@
  111.67.204.220
  111.67.206.248
  111.67.206.4
-111.67.207.170
-111.67.207.183
  111.67.207.218
  111.67.74.242
  111.67.92.66
  111.68.101.16
-111.68.101.236
-111.68.103.248
  111.68.117.164
-111.68.15.172
-111.68.15.174
  111.68.15.226
  111.68.2.58
  111.68.27.38
-111.68.27.46
  111.68.31.134
  111.68.46.68
+111.68.97.22
  111.68.98.152
  111.69.49.122
  111.69.49.124
-111.7.82.18
-111.7.82.19
-111.7.82.25
-111.7.82.35
-111.70.2.74
-111.70.8.33
+111.72.102.17
  111.72.193.136
-111.72.193.31
-111.72.193.43
-111.72.193.62
-111.72.194.170
-111.72.194.192
-111.72.194.21
+111.72.193.143
  111.72.194.217
-111.72.194.247
  111.72.194.93
-111.72.195.185
  111.72.195.204
  111.72.195.30
  111.73.45.204
-111.73.46.105
  111.73.46.99
  111.74.11.81
  111.74.11.82
-111.74.153.234
  111.75.124.111
  111.75.125.152
  111.75.149.221
+111.75.164.130
  111.75.164.131
  111.75.164.133
+111.75.164.134
  111.75.164.137
+111.75.164.139
  111.75.164.155
-111.75.210.58
-111.75.226.53
-111.75.54.114
-111.75.54.86
  111.76.126.65
-111.76.17.219
  111.77.234.243
  111.77.250.65
-111.77.76.170
-111.78.210.191
  111.79.228.13
  111.79.45.186
-111.79.70.10
-111.8.183.145
-111.8.34.154
+111.8.122.227
  111.8.57.61
-111.85.191.131
  111.85.191.157
  111.85.96.173
-111.88.116.74
-111.88.117.146
  111.88.4.191
  111.88.40.91
-111.88.42.163
+111.88.42.197
  111.88.42.211
-111.88.5.62
-111.88.6.119
-111.88.6.31
  111.89.169.113
  111.90.138.208
  111.90.140.136
@@ -13682,7 +11979,6 @@
  111.93.10.213
  111.93.121.26
  111.93.145.146
-111.93.145.20
  111.93.169.90
  111.93.2.53
  111.93.200.50
@@ -13691,15 +11987,15 @@
  111.93.214.67
  111.93.235.74
  111.93.24.98
-111.93.244.230
+111.93.25.91
  111.93.30.66
-111.93.4.46
-111.93.62.26
  111.93.71.219
  111.95.108.234
  111.95.141.34
  111.95.18.251
+111.95.18.32
  111.95.203.73
+111.95.98.185
  111.zc6555.com
  111.zc8333.com
  111361112586123.002.sh.cn
@@ -13708,80 +12004,39 @@
  111qqq.vip
  112-111-vip888.com
  112-365.net
-112.1.148.88
  112.1.17.70
-112.102.207.101
-112.102.225.157
-112.103.160.1
-112.103.198.2
-112.104.112.28
-112.104.17.11
-112.104.18.52
-112.105.209.17
-112.105.57.190
  112.109.198.106
-112.11.246.158
  112.111.0.245
  112.111.119.237
  112.111.162.131
  112.111.163.184
  112.111.163.88
  112.111.172.124
-112.111.31.199
  112.112.16.137
-112.112.16.158
  112.112.7.202
-112.113.159.89
-112.114.1.60
-112.115.105.132
-112.116.125.77
  112.116.155.205
-112.116.191.64
-112.118.182.158
-112.118.185.172
-112.118.30.212
-112.119.168.156
-112.119.212.25
+112.118.32.52
  112.119.240.159
-112.119.28.92
-112.119.84.20
-112.119.87.63
  112.120.108.249
  112.120.108.72
-112.120.139.92
-112.120.174.220
-112.120.212.195
-112.120.77.3
-112.120.79.94
-112.121.10.7
  112.121.164.154
-112.121.184.245
-112.121.223.254
-112.122.1.34
  112.122.175.233
-112.122.189.40
-112.122.189.52
-112.122.189.8
  112.122.5.6
-112.122.51.12
  112.122.58.155
  112.122.58.205
  112.122.63.102
-112.122.63.240
  112.123.109.120
  112.123.109.145
  112.123.109.162
  112.123.109.196
  112.123.187.171
+112.123.193.128
  112.123.61.18
  112.123.62.14
  112.123.62.154
-112.123.76.217
  112.124.32.163
-112.124.46.131
  112.125.89.61
  112.126.65.178
-112.13.101.77
  112.13.203.175
  112.13.203.209
  112.13.91.29
@@ -13793,33 +12048,17 @@
  112.132.144.66
  112.132.144.79
  112.132.147.165
-112.133.160.209
-112.133.162.97
-112.133.187.188
-112.133.194.62
+112.133.192.83
  112.133.195.55
-112.133.197.113
-112.133.206.138
-112.133.206.59
-112.133.219.167
  112.133.219.171
-112.133.222.158
  112.133.231.146
  112.133.240.52
-112.133.254.146
  112.133.26.29
-112.134.140.134
-112.134.183.40
  112.134.70.134
-112.135.12.127
  112.135.3.80
-112.135.4.102
-112.135.7.110
  112.137.164.101
  112.14.158.86
-112.14.184.94
  112.14.3.200
-112.14.45.199
  112.14.47.6
  112.14.59.120
  112.140.185.101
@@ -13827,68 +12066,42 @@
  112.146.109.225
  112.147.156.78
  112.147.92.51
-112.15.71.219
-112.15.71.71
  112.15.9.120
  112.15.9.22
-112.154.4.155
-112.155.200.108
-112.155.3.177
-112.16.120.2
-112.16.143.202
-112.16.197.77
  112.16.211.200
-112.16.35.157
-112.16.75.225
-112.16.81.235
-112.160.21.250
  112.160.228.146bin.sh
  112.160.238.138
-112.160.86.34
-112.161.111.172
  112.161.174.44
  112.161.211.65
  112.161.72.78
  112.162.103.224
  112.162.153.65bin.sh
  112.162.221.29
+112.162.228.19
  112.163.19.153
-112.163.197.187
  112.163.245.186
  112.164.139.12
  112.164.225.19
  112.164.225.19bin.sh
  112.164.242.29
-112.164.245.34
  112.164.25.228
-112.164.46.108
-112.164.49.124
-112.164.67.234
  112.165.0.158
  112.165.209.225
  112.165.209.227
-112.165.59.63
  112.165.75.57
  112.165.78.23
-112.165.86.212
  112.165.89.170
-112.165.98.31
  112.166.133.216
  112.166.159.199
-112.166.63.243
  112.167.144.118
-112.167.232.73
  112.168.0.84bin.sh
  112.168.53.22
  112.169.53.30
  112.17.104.45
  112.17.106.99
-112.17.107.86
  112.17.119.125
  112.17.123.56
  112.17.136.83
-112.17.156.234
-112.17.157.241
  112.17.163.139
  112.17.166.114
  112.17.166.210
@@ -13915,60 +12128,38 @@
  112.171.241.251
  112.172.129.46
  112.172.135.239
-112.172.139.163
  112.172.173.99
-112.172.54.157
-112.172.71.46
  112.175.137.20
  112.175.184.36
  112.175.232.169
-112.18.27.169
  112.18.69.127
  112.184.130.55
-112.184.15.8
-112.184.206.118
  112.184.214.127
  112.185.172.96
  112.185.64.233
-112.186.124.197
-112.186.228.30
-112.186.243.10
  112.186.78.13
-112.187.166.172
  112.187.6.59
-112.187.63.162
  112.19.174.226
-112.19.94.19
  112.192.159.136
  112.192.159.4
  112.192.160.242
  112.192.161.70
-112.193.159.163
-112.194.138.3
-112.195.80.114
-112.195.83.50
-112.196.13.90
+112.193.164.61
  112.196.16.26
  112.196.16.50
-112.196.166.216
  112.196.188.51
+112.196.26.202
  112.196.26.203
  112.196.43.202
  112.196.54.35
  112.196.72.188
  112.196.9.88
  112.197.0.125
-112.197.187.253
-112.197.231.184
  112.198.103.183
-112.198.166.143
  112.198.64.19
  112.198.77.219
  112.199.118.195
-112.199.171.237
-112.199.174.86
  112.199.227.115
-112.199.229.174
  112.199.65.114
  112.199.65.118
  112.199.76.44
@@ -13977,11 +12168,11 @@
  112.201.176.54
  112.201.91.20
  112.202.160.210
-112.202.208.124
  112.202.39.210
  112.203.97.204
  112.204.183.90
  112.205.132.16
+112.206.148.5
  112.206.85.168
  112.207.220.102
  112.207.248.247
@@ -13993,28 +12184,24 @@
  112.210.59.106
  112.211.148.194
  112.211.85.172
-112.212.60.88
-112.213.105.24
-112.213.108.82
  112.213.124.220
  112.213.179.18
+112.213.89.56
  112.213.97.102
  112.213.97.105
  112.213.97.106
-112.213.97.79
  112.214.127.42
  112.214.127.42bin.sh
-112.214.82.93
  112.215.113.10
  112.215.113.11
  112.215.205.236
  112.216.153.186
  112.216.17.106
+112.216.226.146
  112.216.3.211
  112.216.39.234
  112.216.7.50
  112.217.11.203
-112.217.149.228
  112.217.184.90
  112.217.188.122
  112.217.207.130
@@ -14024,21 +12211,17 @@
  112.218.231.43
  112.218.245.11
  112.218.66.90
+112.218.66.91
  112.218.73.138
  112.219.201.124
  112.220.106.164
  112.220.151.204
-112.220.17.35
-112.220.89.114
  112.221.132.26
-112.221.173.170
-112.221.77.54
  112.222.150.126
  112.222.61.180
  112.225.15.188
  112.225.186.20
  112.225.187.19
-112.225.197.116
  112.225.204.1
  112.225.29.179
  112.225.33.145
@@ -14048,10 +12231,10 @@
  112.225.73.162
  112.225.81.178
  112.225.87.22
+112.226.109.196
  112.226.113.205
  112.226.116.82bin.sh
  112.226.122.28
-112.226.125.1
  112.226.127.163
  112.226.180.205
  112.226.186.68
@@ -14061,55 +12244,45 @@
  112.226.203.94
  112.226.203.94bin.sh
  112.226.205.102
-112.226.21.183
  112.226.211.59
  112.226.211.59bin.sh
  112.226.227.146
  112.226.4.182
-112.226.43.103
+112.226.47.75
+112.226.7.138
  112.226.71.247
  112.226.75.90
  112.226.80.198
  112.228.11.40
  112.228.178.129
  112.228.96.209
-112.229.138.227
-112.229.188.79
-112.229.209.125
  112.229.239.39
-112.229.63.165
-112.23.7.224
-112.230.251.82
  112.230.251.85
  112.230.253.51
  112.230.80.85
-112.231.161.193
  112.231.245.67
-112.232.111.228
-112.232.137.135
-112.232.192.181
+112.231.55.81
+112.232.14.23
  112.232.21.137
-112.232.72.124
  112.233.100.32
+112.233.152.239
  112.233.250.152
  112.233.61.230bin.sh
  112.233.88.214
  112.234.193.59
  112.234.212.26
-112.234.217.230
+112.234.214.191
  112.234.222.114
  112.235.147.85
  112.235.210.15
-112.235.217.106
  112.235.234.75
  112.235.25.25
-112.236.188.131
  112.236.198.224
  112.236.208.47
  112.236.223.222
  112.236.32.76
  112.236.34.152
-112.236.69.59
+112.236.37.47
  112.237.102.40
  112.237.105.199
  112.237.106.240
@@ -14120,18 +12293,17 @@
  112.237.142.90
  112.237.168.32
  112.237.17.226bin.sh
-112.237.182.149
-112.237.199.122
  112.237.210.126
  112.237.210.126bin.sh
  112.237.216.146
+112.237.22.25
  112.237.225.100
  112.237.229.122
  112.237.25.84
  112.237.4.196
  112.237.53.242
  112.237.6.56
-112.237.60.125
+112.237.81.93
  112.238.105.41
  112.238.107.61
  112.238.12.199
@@ -14142,24 +12314,21 @@
  112.238.150.245
  112.238.152.67
  112.238.16.209
-112.238.169.226
  112.238.174.240
  112.238.175.170
-112.238.18.168
  112.238.193.99
-112.238.198.123
  112.238.216.117
-112.238.217.78
  112.238.222.216
-112.238.23.54
+112.238.223.121
  112.238.230.190
  112.238.29.24
  112.238.36.97
+112.238.45.68
  112.238.63.223
  112.239.127.14
  112.239.25.41
  112.24.104.228
-112.240.155.8
+112.240.159.225
  112.240.173.23
  112.240.252.210
  112.240.252.86
@@ -14170,58 +12339,47 @@
  112.242.119.70bin.sh
  112.242.129.242
  112.242.129.242bin.sh
-112.242.136.57
  112.242.156.206
  112.242.16.64
  112.242.163.6
-112.242.231.154
  112.242.241.18
  112.242.244.187
  112.242.41.208
-112.242.5.148
  112.242.53.15
  112.242.58.230
-112.242.6.180
  112.242.62.171
-112.242.76.197
  112.242.76.95
  112.242.92.75
-112.242.95.139
  112.243.167.181
-112.243.171.121
-112.244.215.200
-112.244.39.140
  112.245.108.219
  112.245.115.241
  112.245.17.202
  112.245.215.249
  112.245.51.48
-112.246.124.14
  112.246.16.56
  112.246.160.53
  112.246.162.50
  112.246.163.98
  112.246.184.97
-112.246.23.73
+112.246.22.217
  112.246.42.101
+112.246.97.164
  112.247.130.46
  112.247.132.89
  112.247.134.59
  112.247.147.160
  112.247.158.19
  112.247.174.45
-112.247.174.86
  112.247.189.28
  112.247.191.75bin.sh
+112.247.204.35
  112.247.218.226
  112.247.224.140
  112.247.247.199
-112.247.251.11
  112.247.58.185
  112.247.61.131
  112.247.80.248
  112.247.80.64
-112.247.81.208
  112.247.87.101
  112.247.87.225
  112.248.102.109
@@ -14230,7 +12388,6 @@
  112.248.115.154
  112.248.115.180
  112.248.125.144
-112.248.134.113
  112.248.14.241
  112.248.166.187
  112.248.169.138bin.sh
@@ -14238,55 +12395,48 @@
  112.248.195.208
  112.248.209.231
  112.248.212.95
-112.248.215.31
-112.248.240.217
  112.248.47.171
  112.248.85.54
  112.248.87.147
-112.248.98.133
  112.249.114.118
  112.249.116.109
  112.249.117.97
+112.249.122.192
  112.249.176.15
+112.249.192.76
  112.249.199.33
  112.249.207.89
  112.249.233.24
-112.249.237.57
  112.249.239.249
  112.249.24.140
-112.249.27.39
  112.249.34.188
  112.249.44.140
  112.249.6.180
  112.249.61.143
  112.249.64.120
+112.249.66.214
  112.249.72.201
  112.249.79.230
  112.249.82.57
  112.249.87.120
-112.25.184.142
-112.25.72.56
-112.250.159.120
+112.250.147.51
  112.250.17.156
  112.250.194.219
-112.250.51.167
  112.250.52.142
  112.250.97.126
+112.251.16.149
  112.251.21.221
  112.251.219.229
  112.251.221.45
  112.251.23.189
  112.251.23.8
  112.251.26.95
-112.251.27.211
-112.251.52.42
+112.252.117.195
  112.252.125.248
  112.252.166.193
  112.252.213.72
-112.252.65.192
  112.252.74.188
-112.253.33.14
-112.254.115.196
+112.254.134.167
  112.254.140.8
  112.254.144.197
  112.254.150.197
@@ -14296,7 +12446,6 @@
  112.254.177.210
  112.254.180.220
  112.254.201.248
-112.254.4.254
  112.254.45.156
  112.254.68.30
  112.254.94.5
@@ -14307,20 +12456,18 @@
  112.255.192.107
  112.255.237.56
  112.255.240.32
-112.255.28.46
  112.255.32.166
  112.255.35.70
-112.255.51.104
+112.255.36.3
  112.255.72.130
-112.255.83.128
  112.255.83.242
  112.255.92.233
  112.26.113.106
-112.26.118.226
  112.26.160.67
  112.26.44.112
  112.26.44.67
-112.26.7.149
+112.26.7.140
+112.26.7.145
  112.26.98.122
  112.27.115.8
  112.27.121.163
@@ -14400,9 +12547,7 @@
  112.27.127.155bin.sh
  112.27.128.13
  112.27.141.90
-112.27.148.125
  112.27.202.63
-112.27.213.121
  112.27.232.189
  112.27.250.128
  112.27.250.128bin.sh
@@ -14428,9 +12573,6 @@
  112.27.91.236
  112.27.91.241
  112.27.91.247
-112.27.97.202
-112.28.14.229
-112.28.74.38
  112.28.98.52
  112.28.98.61
  112.28.98.69
@@ -14439,24 +12581,9 @@
  112.29.149.198
  112.29.149.201
  112.29.149.209
-112.29.170.188
-112.29.170.202
-112.29.170.219
  112.29.170.59
-112.29.171.156
-112.29.171.34
-112.29.172.134
-112.29.172.197
-112.29.172.224
-112.29.173.10
-112.29.173.144
-112.29.174.147
-112.29.174.226
  112.29.221.228
  112.29.238.18
-112.29.69.80
-112.29.73.98
-112.3.20.155
  112.30.1.119
  112.30.1.133
  112.30.1.139
@@ -14531,24 +12658,18 @@
  112.30.110.62
  112.30.110.62bin.sh
  112.30.110.63
+112.30.110.64
  112.30.110.65
  112.30.110.66
  112.30.126.156
  112.30.126.161
-112.30.133.206
-112.30.133.210
-112.30.133.36
  112.30.136.31
-112.30.195.171
-112.30.210.50
-112.30.213.192
  112.30.35.237
  112.30.38.100
  112.30.38.100bin.sh
  112.30.38.101
  112.30.38.19
  112.30.38.19bin.sh
-112.30.38.42
  112.30.38.98
  112.30.38.98bin.sh
  112.30.4.103
@@ -14568,6 +12689,7 @@
  112.30.4.53
  112.30.4.53bin.sh
  112.30.4.57
+112.30.4.60
  112.30.4.61
  112.30.4.68
  112.30.4.68bin.sh
@@ -14578,100 +12700,60 @@
  112.30.4.90
  112.30.4.90bin.sh
  112.30.97.184
-112.31.106.236
-112.31.12.214
  112.31.176.16
-112.31.191.217
  112.31.211.135
-112.31.218.39
  112.31.240.239
  112.31.65.24
  112.31.87.98
-112.33.254.28
+112.33.40.113
  112.33.45.247
  112.33.46.163
  112.33.47.27
-112.35.127.243
-112.35.133.231
-112.35.184.193
  112.35.27.97
  112.35.27.98
  112.35.62.225
-112.35.75.53
-112.4.114.31
-112.4.116.70
-112.4.132.173
  112.4.79.70
-112.44.118.2
  112.44.95.132
  112.47.3.53
-112.48.19.111
-112.49.34.179
  112.49.37.106
-112.5.112.230
-112.5.129.206
-112.5.179.25
-112.5.232.96
  112.51.249.235
-112.51.97.38
+112.53.198.180
  112.53.227.57
  112.53.227.57bin.sh
  112.53.227.65
  112.53.227.66
-112.53.234.29
-112.53.236.114
  112.53.68.114
-112.53.69.244
-112.53.70.174
-112.53.84.94
-112.53.86.78
-112.54.205.204
-112.54.87.186
  112.6.132.95
-112.6.234.82
-112.6.40.5
-112.64.136.62
+112.6.44.28
  112.64.32.118
  112.64.33.38
  112.65.125.190
-112.65.131.190
-112.65.233.110
  112.65.48.157
-112.65.52.171
-112.65.53.109
  112.65.61.85
  112.65.63.62
-112.66.246.51
-112.67.174.135
+112.67.170.164
  112.67.183.162
-112.67.252.237
-112.67.253.202
-112.69.139.98
-112.70.195.26
+112.67.190.178
+112.72.128.57
  112.72.132.49
  112.72.133.118
  112.72.137.94
  112.72.14.40
-112.72.143.172
-112.72.143.181
+112.72.143.77
  112.72.162.159
  112.72.162.49
  112.72.175.124
  112.72.176.112
  112.72.180.41
  112.72.181.141
+112.72.181.92
  112.72.182.143
  112.72.195.47
  112.72.200.38
-112.72.244.135
  112.72.245.132
-112.72.95.152
-112.72.98.151
-112.73.67.137
  112.74.203.41
-112.74.43.100
  112.74.44.120
-112.74.94.219
+112.74.48.31
  112.78.0.37
  112.78.1.134
  112.78.1.240
@@ -14690,60 +12772,49 @@
  112.78.156.179
  112.78.156.187
  112.78.160.51
-112.78.162.193
-112.78.162.61
+112.78.163.141
  112.78.163.47
  112.78.164.164
-112.78.164.214
+112.78.165.129
  112.78.165.236
-112.78.165.238
  112.78.165.44
  112.78.165.84
  112.78.166.19
  112.78.166.55
  112.78.167.198
-112.78.167.40
  112.78.167.77
  112.78.178.122
-112.78.180.122
  112.78.183.21
-112.78.185.146
  112.78.186.110
  112.78.188.194
-112.78.191.254
  112.78.193.229
+112.78.211.46
  112.78.3.150
  112.78.3.39
  112.78.39.198
  112.78.43.58
  112.78.44.122
  112.78.44.142
+112.78.44.154
  112.78.44.177
  112.78.44.178
  112.78.44.229
-112.78.47.130
-112.78.7.175
  112.78.8.133
  112.80.124.90
-112.80.139.254
  112.80.205.20
  112.80.215.101
  112.80.238.37
  112.80.24.235
  112.80.35.2
-112.80.38.210
  112.80.80.136
  112.81.210.3
  112.81.24.144
-112.81.5.136
  112.82.142.161
  112.82.18.255
  112.82.187.188
  112.82.198.79
  112.82.218.4
  112.82.220.87
-112.82.223.34
-112.82.223.35
  112.82.224.139
  112.82.230.179
  112.82.244.91
@@ -14753,8 +12824,6 @@
  112.84.21.184
  112.84.95.189
  112.85.158.10
-112.85.182.245
-112.85.32.130
  112.85.42.102
  112.85.42.110
  112.85.42.112
@@ -14765,7 +12834,6 @@
  112.85.42.13
  112.85.42.143
  112.85.42.151
-112.85.42.17
  112.85.42.172
  112.85.42.174
  112.85.42.176
@@ -14774,10 +12842,8 @@
  112.85.42.183
  112.85.42.184
  112.85.42.185
-112.85.42.186
  112.85.42.187
  112.85.42.188
-112.85.42.194
  112.85.42.195
  112.85.42.196
  112.85.42.200
@@ -14793,346 +12859,216 @@
  112.85.42.67
  112.85.42.72
  112.85.42.73
-112.85.42.74
  112.85.42.81
  112.85.42.85
-112.85.42.87
  112.85.42.88
  112.85.42.89
  112.85.42.94
  112.85.42.96
  112.85.42.98
-112.85.54.88
  112.86.132.95
  112.86.163.224
  112.86.164.46
  112.86.167.192
-112.86.228.194
  112.86.228.83
  112.86.74.14
  112.86.76.27
  112.87.103.152
-112.87.125.51
  112.87.136.109
  112.9.157.102
-112.9.220.29
-112.91.120.20
  112.91.135.184
  112.91.145.58
-112.91.151.133
-112.91.154.114
  112.91.176.67
-112.91.197.64
-112.91.223.116
  112.91.81.100
-112.93.227.63
+112.93.126.235
  112.93.28.227
-112.94.161.92
  112.95.135.77
-112.95.173.174
-112.95.225.156
  112.95.225.158
  112.95.27.178
  112.95.31.203
-112.98.111.138
  112.98.126.100
  112.98.126.98
  112.98.166.81
-112.99.195.110
  1121312.000webhostapp.com
  1123351-dot-n-e-w-me-ss-age-po-rt-al.wl.r.appspot.com
  112sarj.com
  113-365.net
+113.0.105.182
  113.0.109.238
-113.0.56.10
-113.0.65.46
-113.0.97.116
-113.1.147.11
-113.1.40.128
  113.10.154.11
  113.10.156.128
-113.10.207.50
-113.101.246.202
  113.102.165.201
  113.103.57.113
-113.104.198.136
-113.104.219.46
  113.104.248.230
-113.105.137.241
  113.105.247.21
+113.105.71.184
  113.105.94.66
  113.106.106.98
-113.106.11.107
-113.106.11.6
  113.106.111.50
-113.106.12.9
-113.106.58.99
-113.106.66.58
-113.106.8.55
-113.106.88.74
-113.107.139.68
  113.107.166.9
  113.107.244.124
-113.108.119.114
-113.108.126.26
-113.108.127.1
  113.108.127.10
+113.108.127.11
+113.108.127.13
  113.108.127.16
  113.108.127.17
-113.108.127.18
  113.108.127.19
  113.108.127.2
  113.108.127.20
  113.108.127.23
  113.108.127.24
-113.108.130.157
+113.108.127.25
+113.108.127.9
  113.108.195.242
  113.108.88.78
-113.108.9.70
-113.108.95.57
-113.109.76.230
  113.11.110.46
  113.11.136.193
  113.11.136.28
  113.11.16.62
-113.11.20.131
  113.11.254.216
  113.11.255.24
  113.11.3.30
  113.11.34.129
  113.11.64.62
+113.110.150.105
  113.110.164.123
+113.110.164.135
  113.110.164.88
  113.110.166.14
+113.110.166.45
  113.110.166.68
-113.110.195.132
  113.110.197.224
-113.110.202.33
-113.110.230.246
-113.110.43.29
+113.110.198.228
+113.110.236.21
  113.111.244.229
  113.111.48.174
-113.111.7.102
-113.111.8.191
-113.116.106.150
+113.116.104.166
+113.116.105.25
  113.116.12.113
+113.116.128.91
  113.116.142.212
  113.116.144.177
-113.116.147.113
+113.116.145.90
  113.116.147.31
  113.116.171.105
-113.116.171.84
-113.116.206.159
-113.116.206.73
-113.116.226.163
-113.116.40.26
-113.116.44.51
+113.116.176.164
+113.116.178.100
+113.116.194.229
+113.116.217.76
+113.116.246.4
+113.116.41.217
+113.116.43.181
+113.116.45.232
  113.116.5.134
+113.116.55.68
+113.116.56.107
  113.116.88.232
-113.116.9.74
+113.116.89.110
+113.116.90.75
+113.116.91.20
+113.117.11.251
+113.117.29.168
  113.118.100.34
-113.118.104.220
  113.118.106.216
+113.118.107.242
+113.118.13.47
  113.118.132.2
-113.118.134.114
-113.118.14.44
  113.118.15.9
  113.118.185.101
  113.118.185.202
-113.118.19.48
  113.118.198.101
-113.118.218.214
  113.118.46.162
-113.118.46.7
-113.118.47.230
+113.118.46.37
+113.118.46.62
+113.118.5.19
+113.118.73.57
  113.118.85.15
  113.119.197.162
-113.12.120.193
+113.119.68.250
  113.12.64.58
-113.12.67.77
-113.12.77.18
-113.120.32.122
+113.120.32.108
  113.120.32.169
-113.120.32.61
-113.120.33.179
-113.120.34.8
  113.120.35.155
-113.120.35.170
-113.120.35.188
-113.120.35.64
-113.120.37.178
+113.120.36.25
  113.120.37.223
-113.120.37.224
-113.120.38.20
+113.120.37.226
  113.120.39.112
-113.120.39.113
-113.120.39.146
  113.120.39.66
  113.120.61.170
-113.120.61.230
  113.120.61.233
+113.120.62.20
  113.120.62.42
-113.120.62.61
  113.120.63.208
  113.120.63.229
-113.120.68.122
-113.120.74.133
+113.120.63.46
  113.123.140.95
+113.123.231.170
  113.123.98.251
-113.125.146.138
+113.125.148.55
  113.125.21.66
-113.125.67.184
  113.128.10.1
+113.128.10.218
  113.128.10.225
+113.128.10.238
  113.128.11.161
-113.128.120.171
-113.128.121.203
+113.128.120.128
+113.128.121.173
+113.128.121.244
  113.128.121.245
-113.128.122.14
  113.128.123.109
  113.128.123.62
-113.128.131.197
  113.128.15.170
-113.128.226.134
-113.128.231.198
-113.128.24.88
+113.128.24.210
  113.128.246.50
  113.128.26.254
-113.128.26.81
-113.128.27.174
  113.128.27.43
+113.128.27.76
  113.128.28.15
  113.128.29.13
-113.128.29.235
-113.128.29.87
-113.128.29.95
+113.128.30.226
  113.128.31.164
-113.128.31.182
  113.128.31.197
  113.128.31.5
-113.128.31.93
  113.128.32.23
-113.128.37.111
-113.128.39.116
-113.128.65.100
+113.128.33.166
+113.128.34.209
  113.128.8.209
-113.128.9.42
-113.13.176.117
-113.13.188.131
+113.128.8.220
+113.128.8.252
+113.128.9.223
  113.130.126.2
-113.130.223.3
-113.130.247.69
  113.130.68.58
-113.131.118.3
-113.131.118.5
-113.131.118.6
-113.131.125.138
-113.131.125.139
-113.131.125.141
-113.131.125.147
-113.131.125.148
-113.131.156.158
-113.131.169.48
-113.131.169.51
-113.131.169.52
-113.131.169.54
-113.131.169.57
-113.131.177.231
-113.131.182.73
-113.131.183.12
-113.131.183.13
-113.131.183.15
-113.131.183.17
-113.131.183.2
-113.131.200.32
-113.131.200.41
-113.131.200.43
-113.131.200.5
-113.131.201.15
-113.131.201.3
-113.131.201.9
-113.131.224.197
+113.131.203.247
  113.133.224.68
-113.133.227.52
-113.134.211.242
-113.134.211.28
-113.134.211.42
+113.133.229.196
  113.134.240.218
  113.134.88.95
-113.134.94.230
-113.14.152.122
-113.14.181.48
  113.14.237.60
-113.14.6.8
-113.14.68.106
  113.140.1.179
-113.140.17.6
-113.140.23.102
-113.140.4.194
  113.140.48.82
  113.140.68.238
  113.140.80.174
-113.141.166.197
-113.141.64.146
-113.141.64.224
-113.141.64.23
-113.141.64.31
-113.141.64.40
-113.141.65.61
-113.141.66.18
-113.141.66.255
-113.141.66.96
-113.141.67.127
-113.141.67.162
-113.141.67.184
-113.141.70.115
-113.141.70.119
-113.141.70.125
-113.141.70.131
-113.141.70.147
-113.141.70.184
-113.141.70.214
-113.141.70.227
-113.141.70.240
-113.141.70.91
-113.142.54.175
  113.142.58.155
-113.142.72.100
-113.142.72.118
+113.142.72.111
  113.142.72.119
  113.142.72.121
  113.142.72.122
  113.142.72.123
  113.142.72.124
-113.142.72.2
-113.142.73.214
-113.143.36.226
  113.15.205.127
-113.15.230.68
-113.16.152.229
-113.16.155.254
-113.16.195.189
-113.160.1.70
-113.160.117.172
-113.160.117.88
  113.160.130.116
  113.160.130.13
  113.160.142.10
  113.160.142.68
-113.160.150.43
  113.160.188.21
-113.160.201.166
+113.160.20.42
  113.160.206.37
-113.160.209.205
  113.160.219.210
-113.160.219.221
-113.160.223.227
  113.160.234.147
  113.160.234.160
  113.160.235.194
  113.160.235.49
  113.160.247.115
-113.160.247.166
  113.160.247.180
  113.160.247.189
  113.160.248.80
@@ -15149,60 +13085,51 @@
  113.161.151.29
  113.161.158.21
  113.161.160.174
-113.161.160.8
-113.161.163.247
  113.161.176.83
-113.161.177.52
  113.161.186.101
  113.161.207.105
  113.161.207.99
-113.161.4.171
-113.161.4.51
  113.161.43.81
-113.161.44.87
  113.161.52.89
  113.161.53.147
  113.161.62.31
  113.161.68.146
  113.161.70.172
-113.161.70.219
  113.161.73.210
  113.161.78.86
  113.161.79.191
+113.161.82.42
  113.161.88.163
-113.161.88.252
  113.161.92.91
-113.162.146.120
+113.161.94.109
+113.162.145.78
+113.162.169.29
  113.162.184.217
-113.162.185.36
-113.162.55.133
  113.163.157.250
-113.163.161.77
-113.163.85.167
  113.164.79.177
-113.166.92.12
-113.166.92.5
-113.172.112.176
-113.172.123.85
+113.172.129.0
+113.172.141.210
  113.172.159.223
  113.172.167.69
  113.172.184.235
-113.172.223.161
  113.172.230.56
-113.172.253.59
+113.172.25.131
+113.172.253.157
+113.172.33.144
+113.172.35.30
+113.172.61.52
+113.172.62.86
+113.172.63.246
+113.172.96.131
  113.172.99.44
  113.173.126.226
-113.173.153.232
-113.173.169.103
-113.173.192.222
-113.173.208.93
  113.173.218.90
-113.173.22.125
+113.173.235.45
  113.173.27.54
+113.173.31.129
+113.173.6.156
  113.173.68.46
  113.173.7.4
-113.173.8.132
-113.174.224.51
  113.176.195.145
  113.176.62.182
  113.176.7.19
@@ -15212,129 +13139,95 @@
  113.177.113.73
  113.177.120.31
  113.177.194.185
-113.177.218.25
+113.177.196.102
  113.177.27.217
-113.178.237.130
-113.178.48.135
-113.178.51.228
-113.179.193.74
-113.179.193.81
+113.178.49.81
  113.179.50.44
-113.180.148.152
  113.180.163.216
-113.186.72.154
-113.188.234.184
-113.189.129.137
+113.182.156.115
  113.189.16.177
  113.19.72.118
-113.19.72.151
  113.190.114.212
+113.190.117.248
+113.190.145.156
  113.190.154.205
+113.190.161.180
+113.190.190.1
  113.190.205.160
+113.190.205.195
  113.190.222.146
-113.190.227.58
-113.190.229.121
+113.190.225.61
  113.190.230.190
  113.190.235.196
  113.190.235.28
  113.190.235.39
-113.190.253.73
-113.190.254.11
-113.190.254.147
  113.190.254.165
  113.190.254.245
  113.190.254.74
-113.190.254.84
-113.190.255.114
-113.190.255.158
+113.190.32.27
  113.190.37.142
  113.190.40.199
  113.190.5.43
-113.190.6.226
  113.190.63.185
  113.193.191.132
  113.193.240.109
-113.193.30.171
  113.193.6.34
  113.194.128.100
-113.194.128.94
  113.194.129.116
-113.194.130.12
-113.194.130.238
+113.194.129.130
  113.194.130.87
-113.194.131.15
-113.194.131.75
-113.194.133.90
+113.194.132.107
  113.194.134.170
-113.194.134.4
-113.194.135.131
+113.194.134.227
  113.194.137.106
+113.194.138.10
  113.194.141.109
-113.194.141.129
-113.194.141.28
  113.194.141.89
+113.194.142.67
  113.194.143.66
  113.194.49.168
-113.195.133.247
-113.195.145.109
  113.195.152.80
-113.195.163.72
  113.195.164.228
-113.195.164.95
-113.195.168.243
+113.195.168.19
  113.195.168.83
  113.195.169.12
  113.195.169.50
+113.195.169.83
  113.195.170.27
+113.195.171.141
  113.195.171.84
  113.195.175.131
  113.195.175.137
  113.195.207.146
  113.195.230.231
-113.195.243.178
-113.195.99.19
-113.196.35.201
  113.197.137.122
-113.197.214.174
  113.197.239.56
  113.199.108.13
  113.199.244.213
-113.20.86.138
-113.200.100.211
+113.20.31.66
  113.200.105.23
  113.200.156.180
-113.200.201.29
  113.200.212.170
-113.200.219.2
-113.200.236.133
  113.200.60.74
-113.201.175.66
+113.201.20.24
+113.201.219.31
  113.203.236.211
  113.203.238.130
-113.203.240.87
  113.204.183.191
  113.204.228.66
-113.205.105.62
  113.205.164.69
  113.205.51.241
  113.206.191.81
  113.206.45.80
-113.207.26.159
-113.207.27.88
  113.207.43.18
-113.207.68.87
  113.208.112.148
  113.208.119.154
-113.208.119.2
  113.208.119.82
  113.209.128.114
-113.209.128.30
-113.209.197.236
  113.21.115.59
+113.21.123.213
  113.21.231.98
-113.21.64.23
  113.21.70.127
-113.210.54.234
  113.212.162.155
  113.212.68.49
  113.212.69.0
@@ -15849,106 +13742,68 @@
  113.212.70.97
  113.212.70.98
  113.212.70.99
-113.214.20.179
  113.214.25.170
-113.214.26.106
-113.214.26.66
-113.214.34.90
-113.214.6.60
-113.214.6.61
  113.215.180.234
+113.215.222.251
+113.215.222.70
  113.218.211.48
  113.219.126.224
  113.219.200.7
-113.219.213.2
-113.22.4.10
-113.22.87.153
-113.220.229.68
+113.220.53.15
  113.221.13.204
  113.221.50.64
-113.222.151.41
  113.224.133.189
-113.224.215.100
-113.224.254.110
-113.225.22.173
-113.225.24.19
+113.224.16.78
+113.224.231.122
  113.226.123.0
-113.226.60.98
-113.227.1.187
-113.227.167.237
  113.227.37.26
  113.227.42.149bin.sh
-113.228.217.86
-113.228.56.64
-113.228.83.187
-113.229.24.180
  113.229.81.108
-113.23.108.184
  113.23.144.50
-113.230.98.78
+113.23.72.149
  113.231.196.100
+113.231.23.102
+113.231.29.105
  113.232.251.180
-113.232.253.53
-113.233.121.116
  113.233.128.31
  113.233.130.111
  113.234.52.69
-113.235.2.35
-113.235.237.11
-113.235.238.141
+113.235.113.54
  113.236.19.20
-113.236.193.186
-113.237.199.220
-113.237.232.25
+113.237.196.155
  113.238.142.208
-113.239.191.12
  113.24.155.240
-113.24.59.116
-113.24.59.151
  113.240.184.183
  113.240.186.132
  113.240.197.195
-113.240.227.123
  113.243.130.13
  113.245.191.254
-113.245.217.41
+113.246.130.166
  113.246.243.65
  113.247.226.163
  113.247.233.22
-113.247.240.11
  113.248.192.30
-113.25.202.240
  113.250.0.149
  113.251.31.43
-113.252.103.136
-113.252.15.78
  113.252.222.73
-113.252.225.104
-113.252.249.104
  113.252.254.133
-113.252.8.114
-113.252.95.92
-113.253.170.73
  113.253.179.90
-113.253.26.98
-113.253.5.120
-113.254.169.251
+113.254.108.203
  113.254.178.224
-113.254.39.175
-113.255.218.71
+113.254.20.45
  113.255.245.129
-113.255.78.197
-113.28.5.104
  113.30.141.46
  113.30.66.24
  113.30.66.5
  113.31.102.234
  113.31.102.8
+113.31.103.110
  113.31.104.160
  113.31.104.177
  113.31.104.184
  113.31.104.3
  113.31.104.89
+113.31.105.249
  113.31.105.250
  113.31.106.152
  113.31.107.34
@@ -15968,19 +13823,13 @@
  113.31.147.54
  113.31.152.21
  113.31.152.92
-113.4.131.194
-113.4.176.138
-113.4.18.25
-113.4.183.92
+113.4.86.60
  113.41.194.235
  113.52.122.6
  113.52.132.28
  113.52.135.125
  113.53.117.150
  113.53.121.31
-113.53.145.174
-113.53.160.190
-113.53.180.53
  113.53.191.244
  113.53.194.130
  113.53.209.177
@@ -15989,38 +13838,33 @@
  113.53.214.145
  113.53.214.48
  113.53.230.200
-113.53.231.34
  113.53.238.195
  113.53.247.221
  113.53.255.222
-113.53.29.185
  113.53.29.218
  113.53.29.228
  113.53.29.88
  113.53.53.155
  113.53.59.111
  113.53.61.118
+113.53.61.206
  113.53.61.235
  113.53.82.157
  113.53.83.210
  113.53.83.212
+113.53.85.157
  113.53.91.12
  113.53.91.214
  113.53.94.235
-113.56.107.67
-113.56.119.118
-113.56.173.112
-113.56.21.192
  113.57.109.73
  113.57.111.73
-113.57.121.92
  113.57.170.50
  113.57.176.79
-113.57.222.88
-113.57.222.97
  113.57.252.72
  113.57.85.204
  113.58.228.48
+113.59.128.133
+113.59.133.55
  113.59.135.144
  113.59.142.148
  113.59.144.42
@@ -16030,98 +13874,79 @@
  113.59.156.28
  113.59.164.135
  113.59.165.19
-113.59.166.202
-113.59.191.47
-113.59.224.149
-113.59.224.45
-113.59.224.77
-113.6.170.119
-113.6.210.168
  113.60.202.175
  113.60.202.178
-113.61.197.23
-113.61.204.190
-113.61.206.35
-113.61.216.39
-113.61.249.11
  113.61.66.94
-113.62.180.132
-113.64.36.90
  113.65.161.202
  113.65.21.108
  113.65.210.160
  113.65.230.30
  113.66.112.129
  113.68.236.119
-113.69.130.243
+113.68.255.31
  113.69.130.244
-113.7.57.172
-113.70.242.159
-113.71.140.134
+113.69.131.223
+113.70.242.107
  113.71.158.2
  113.72.122.131
  113.72.123.237
-113.72.206.149
  113.74.26.114
-113.75.81.108
-113.76.148.139
  113.76.149.153
  113.77.160.250
-113.77.24.187
-113.8.229.243
-113.8.86.241
  113.81.208.133
-113.81.69.222
-113.81.70.237
-113.83.241.147
-113.83.248.210
+113.81.211.235
+113.83.12.148
  113.85.178.22
+113.85.178.30
  113.87.0.188
+113.87.100.109
  113.87.100.93
-113.87.163.135
  113.87.164.253
  113.87.173.242
-113.87.195.84
+113.87.193.246
  113.87.2.65
  113.87.201.163
  113.87.32.104
-113.87.32.192
-113.87.98.185
-113.88.100.194
+113.87.86.164
+113.87.96.240
+113.87.96.77
+113.88.102.41
+113.88.155.117
  113.88.164.96
  113.88.165.49
  113.88.166.17
  113.88.167.92
-113.88.240.13
-113.88.240.72
+113.88.194.84
+113.88.195.40
  113.88.241.132
-113.88.242.18
-113.88.84.9
+113.88.241.186
+113.88.86.219
  113.89.101.78
-113.89.248.112
  113.89.33.18
-113.89.33.63
-113.89.33.68
+113.89.34.245
+113.89.35.232
+113.89.42.252
  113.89.43.2
-113.89.52.86
-113.89.70.207
+113.89.43.68
+113.9.134.158
  113.9.233.14
-113.90.177.154
-113.90.177.172
+113.90.179.16
  113.90.237.101
  113.90.237.21
  113.90.238.221
  113.90.245.165
-113.90.247.197
-113.91.248.121
-113.91.36.16
+113.90.246.76
+113.91.32.17
+113.91.34.136
  113.91.36.40
+113.91.37.185
  113.91.38.111
+113.91.38.18
+113.92.222.221
  113.93.108.217
  113.93.224.56
  113.93.240.12
  113.93.240.235
-113.93.241.239
  113.93.241.245
  113.93.242.5
  113.95.155.166
@@ -16133,7 +13958,6 @@
  113.96.154.27
  113.96.83.20
  113.96.83.25
-113.98.116.59
  113.98.193.58
  1133ko2.us-south.cf.appdomain.cloud
  1139.31cf4fdae.com
@@ -16142,9 +13966,10 @@
  114.101.246.34
  114.101.246.95
  114.101.247.241
-114.104.164.233
+114.103.137.254
  114.104.189.119
  114.106.156.178
+114.107.61.134
  114.108.130.135
  114.108.140.37
  114.108.150.156
@@ -16153,48 +13978,32 @@
  114.108.177.176
  114.108.218.2
  114.108.47.171
-114.108.67.230
  114.109.172.105
  114.109.179.60
  114.110.21.121
  114.110.21.50
  114.110.21.54
-114.111.195.36
-114.111.246.94
-114.112.104.187
-114.112.104.188
  114.112.161.155
  114.112.70.150
-114.112.72.130
  114.112.75.146
-114.112.79.17
-114.112.81.10
  114.112.96.30
  114.113.237.67
-114.113.238.22
-114.115.208.11
  114.116.103.75
  114.116.110.86
-114.116.200.8
-114.116.232.226
-114.116.54.2
-114.118.10.141
+114.116.67.193
  114.118.12.230
  114.118.16.78
  114.118.5.130
-114.118.5.243
+114.119.135.181
  114.122.71.139
  114.124.130.41
  114.129.17.51
  114.129.225.53
  114.129.225.72
  114.129.242.104
-114.130.5.10
  114.134.186.236
  114.134.186.59
  114.134.187.130
-114.134.187.236
-114.134.188.29
  114.134.191.194
  114.141.132.88
  114.141.167.190
@@ -16202,63 +14011,42 @@
  114.141.196.221
  114.141.49.149
  114.141.55.178
-114.142.153.86
-114.142.153.87
  114.142.160.89
  114.143.100.102
-114.143.247.126
  114.143.25.156
-114.147.20.38
-114.151.50.223
-114.156.234.88
-114.161.216.68
-114.164.19.85
-114.176.201.233
-114.178.68.43
  114.179.127.48
  114.179.13.180
-114.198.172.213
  114.198.173.40
  114.199.111.162
  114.199.113.38
  114.199.113.78
  114.199.116.9
  114.199.123.211
-114.199.124.162
  114.199.159.159
-114.199.192.27
-114.199.204.37
  114.199.204.93
  114.199.215.31
-114.199.241.41
-114.199.250.139
  114.201.120.219
  114.201.236.237
-114.202.13.213
-114.202.139.173
-114.202.2.198
  114.203.1.152
-114.204.162.181
-114.204.178.70
-114.204.214.32
  114.204.218.154
-114.205.36.141
+114.206.161.51
  114.206.60.98
  114.207.139.203
-114.207.177.43
  114.215.103.83
+114.216.155.209
+114.216.164.39
+114.216.17.198
  114.216.17.217
  114.216.202.114
-114.216.206.135
-114.216.46.217
-114.217.106.10
+114.216.206.235
+114.216.206.65
  114.217.106.101
  114.217.128.218
-114.218.122.152
-114.218.123.87
+114.218.128.178
  114.218.152.35
+114.218.152.68
  114.218.57.215
-114.218.9.15
+114.218.79.126
  114.219.127.116
  114.219.133.7
  114.219.157.174
@@ -16266,41 +14054,37 @@
  114.219.157.97
  114.219.18.147
  114.219.92.232
+114.220.119.195
  114.220.119.86
+114.220.132.111
  114.220.17.241
+114.220.188.62
  114.220.30.129
-114.220.63.219
  114.220.74.62
-114.220.76.79
  114.221.195.27
  114.221.21.209
-114.221.85.62
  114.222.42.120
  114.223.48.158
-114.223.61.29
-114.223.94.137
  114.224.212.99
  114.224.85.56
  114.226.129.99
  114.226.139.37
-114.226.172.49
  114.226.174.85
  114.226.2.114
-114.226.214.232
  114.226.23.118
  114.226.23.172
  114.226.232.108
  114.226.233.227
  114.226.234.139
  114.226.234.153
+114.226.244.119
  114.226.249.233
  114.226.249.248
  114.226.25.151
  114.226.255.129
  114.226.26.52
  114.226.26.86
-114.226.30.154
-114.226.54.21
+114.226.35.234
  114.226.80.165
  114.226.81.133
  114.226.82.119
@@ -16311,10 +14095,11 @@
  114.226.85.114
  114.226.85.180
  114.226.89.111
-114.226.89.167
-114.226.89.39
+114.226.89.128
+114.226.89.202
  114.227.0.27
  114.227.1.22
+114.227.111.45
  114.227.15.74
  114.227.26.138
  114.227.28.178
@@ -16326,7 +14111,6 @@
  114.228.141.252
  114.228.141.53
  114.228.142.27
-114.228.185.221
  114.228.201.102
  114.228.205.209
  114.228.248.85
@@ -16339,8 +14123,8 @@
  114.228.31.19
  114.228.57.156
  114.228.63.106
-114.228.97.27
  114.229.1.126
+114.229.122.133
  114.229.165.72
  114.229.18.229
  114.229.205.56
@@ -16350,46 +14134,37 @@
  114.229.42.210
  114.229.46.142
  114.229.47.36
-114.23.122.174
  114.23.142.38
  114.23.246.137
+114.23.246.192
  114.23.254.130
  114.230.177.137
  114.230.177.227
-114.230.24.24
  114.230.240.150
  114.230.56.61
  114.231.104.133
  114.231.104.179
+114.231.110.111
  114.231.110.244
  114.231.243.176
-114.231.41.167
-114.231.41.199
+114.231.41.152
  114.231.42.157
-114.231.42.175
-114.231.42.218
-114.231.42.65
+114.231.42.22
+114.231.45.21
  114.231.45.22
-114.231.45.227
-114.231.45.81
+114.231.46.110
  114.231.46.166
  114.231.8.10
  114.231.8.113
-114.231.82.177
+114.231.82.121
  114.231.82.185
  114.231.82.20
-114.231.82.203
-114.231.82.210
-114.231.82.242
+114.231.82.237
  114.231.82.31
  114.231.82.62
-114.232.109.19
-114.232.109.34
  114.232.110.139
  114.232.110.168
-114.232.110.169
  114.232.110.184
-114.232.110.213
  114.232.176.199
  114.233.112.74
  114.233.123.152
@@ -16427,8 +14202,6 @@
  114.234.195.112
  114.234.195.62
  114.234.195.71
-114.234.211.19
-114.234.228.91
  114.234.253.78
  114.234.32.233
  114.234.33.113
@@ -16447,7 +14220,6 @@
  114.235.0.123
  114.235.0.140
  114.235.114.16
-114.235.12.20
  114.235.122.197
  114.235.137.158
  114.235.139.77
@@ -16461,13 +14233,11 @@
  114.235.203.129
  114.235.208.243
  114.235.210.109
-114.235.210.25
  114.235.22.32
  114.235.222.44
  114.235.231.214
  114.235.24.79
  114.235.248.241
-114.235.249.38
  114.235.251.8
  114.235.252.140
  114.235.3.33
@@ -16478,19 +14248,15 @@
  114.235.5.102
  114.235.52.136
  114.235.52.152
-114.235.52.191
  114.235.57.32
  114.235.7.118
  114.235.81.53
  114.235.81.96
-114.236.135.129
  114.236.152.230
  114.236.16.158
  114.236.17.66
-114.236.209.221
  114.236.23.186
  114.236.29.80
-114.237.17.160
  114.237.188.51
  114.238.167.163
  114.238.171.204
@@ -16541,428 +14307,73 @@
  114.239.92.227
  114.239.95.160
  114.239.95.60
-114.24.147.179
  114.24.35.172
  114.24.58.69
-114.240.34.130
-114.241.244.177
-114.242.113.250
-114.242.125.190
+114.241.52.2
+114.242.225.6
  114.242.236.140
  114.242.25.132
  114.242.34.166
  114.242.68.28
-114.243.196.111
-114.244.71.13
+114.243.209.10
+114.244.139.61
  114.245.243.18
  114.245.70.156
-114.246.34.150
-114.246.34.152
  114.246.34.153
-114.246.9.18
  114.247.226.11
  114.247.226.19
-114.247.63.190
  114.247.79.179
  114.248.173.60
  114.249.112.23
  114.249.119.11
-114.249.210.213
+114.249.211.132
  114.249.219.28
  114.249.225.168
-114.249.236.17
-114.249.236.38
  114.249.237.190
  114.25.133.159
-114.250.19.112
-114.250.24.122
-114.251.170.146
-114.251.216.133
-114.251.97.18
-114.252.201.221
-114.253.70.157
-114.253.9.226
-114.254.151.83
-114.254.46.137
-114.255.146.38
  114.255.187.251
-114.255.216.123
-114.255.90.162
  114.26.111.100
  114.27.160.69
-114.29.105.13
-114.29.236.136
-114.29.237.99
  114.29.238.53
  114.29.239.110
  114.29.239.178
-114.29.243.102
  114.29.66.139
  114.30.121.123
  114.30.54.56
  114.30.55.54
  114.30.77.94
-114.31.10.244
  114.31.15.22
  114.31.20.2
  114.31.4.122
  114.31.5.154
-114.32.11.69
-114.32.113.135
-114.32.117.239
-114.32.123.32
-114.32.135.157
-114.32.142.167
-114.32.144.210
-114.32.152.47
-114.32.170.18
-114.32.180.21
-114.32.184.236
-114.32.185.88
-114.32.192.166
-114.32.198.213
-114.32.2.209
-114.32.20.141
-114.32.200.226
-114.32.204.180
  114.32.205.167
-114.32.207.29
-114.32.212.38
-114.32.217.33
-114.32.219.163
-114.32.226.21
-114.32.229.218
-114.32.23.19
-114.32.232.205
-114.32.233.88
-114.32.234.96
  114.32.236.99
-114.32.245.18
-114.32.246.252
-114.32.27.62
-114.32.32.190
-114.32.60.120
-114.32.63.244
-114.32.75.101
-114.32.76.202
-114.32.80.153
-114.32.80.217
-114.32.81.186
-114.32.82.109
-114.32.86.176
-114.32.9.24
-114.32.91.181
-114.33.0.147
-114.33.10.129
-114.33.104.153
-114.33.107.162
-114.33.108.122
-114.33.11.235
-114.33.110.40
-114.33.114.204
-114.33.114.228
-114.33.114.25
-114.33.119.227
-114.33.119.253
-114.33.120.115
-114.33.121.193
-114.33.121.76
-114.33.122.99
-114.33.123.146
-114.33.124.143
-114.33.125.163
-114.33.133.204
-114.33.133.229
-114.33.134.226
-114.33.137.28
-114.33.146.3
-114.33.147.251
-114.33.149.107
-114.33.149.159
  114.33.15.32
-114.33.150.61
-114.33.152.115
-114.33.154.33
-114.33.158.156
-114.33.161.84
-114.33.168.48
-114.33.169.229
-114.33.170.143
-114.33.171.182
-114.33.172.9
-114.33.177.187
-114.33.178.104
-114.33.178.233
-114.33.178.6
-114.33.182.44
-114.33.195.170
-114.33.196.139
-114.33.197.61
-114.33.198.220
-114.33.2.233
-114.33.201.140
-114.33.202.122
-114.33.204.223
-114.33.204.82
-114.33.206.105
  114.33.206.143
-114.33.206.160
-114.33.21.89
-114.33.210.252
-114.33.211.5
-114.33.214.177
-114.33.219.2
-114.33.220.202
-114.33.221.200
-114.33.224.158
-114.33.236.58
-114.33.237.11
-114.33.243.109
-114.33.243.246
-114.33.243.63
-114.33.249.30
-114.33.249.79
-114.33.25.1
-114.33.250.151
-114.33.252.57
-114.33.28.179
-114.33.30.105
-114.33.31.190
-114.33.41.115
-114.33.42.189
-114.33.48.97
-114.33.51.47
-114.33.53.149
-114.33.56.145
-114.33.63.209
-114.33.64.129
-114.33.64.34
-114.33.66.110
-114.33.66.147
-114.33.66.30
-114.33.72.233
-114.33.73.116
-114.33.73.189
-114.33.74.131
-114.33.74.170
-114.33.80.46
-114.33.82.142
-114.33.85.216
-114.33.86.161
-114.33.86.52
-114.33.87.47
-114.33.88.228
-114.33.89.129
-114.33.91.68
-114.33.92.169
-114.33.92.92
-114.33.97.207
-114.33.99.52
-114.34.104.181
-114.34.107.162
-114.34.127.220
-114.34.132.234
-114.34.143.149
-114.34.154.206
-114.34.156.240
-114.34.159.215
-114.34.163.241
-114.34.166.118
-114.34.166.65
-114.34.176.197
-114.34.176.208
-114.34.179.65
-114.34.183.158
-114.34.185.118
-114.34.185.180
-114.34.185.93
-114.34.19.199
-114.34.191.121
-114.34.192.168
-114.34.193.108
-114.34.193.29
-114.34.2.185
-114.34.203.140
-114.34.203.250
-114.34.211.77
-114.34.213.7
-114.34.216.190
-114.34.226.44
-114.34.228.1
-114.34.229.141
-114.34.231.197
-114.34.232.189
-114.34.236.166
-114.34.245.113
-114.34.254.156
-114.34.254.182
-114.34.26.51
-114.34.37.56
-114.34.40.176
-114.34.45.243
-114.34.47.232
-114.34.50.141
  114.34.53.250
-114.34.56.147
-114.34.56.80
-114.34.56.88
-114.34.58.56
-114.34.88.246
-114.34.94.93
-114.35.102.127
-114.35.107.108
-114.35.107.136
-114.35.108.212
-114.35.11.159
-114.35.11.62
-114.35.11.64
-114.35.110.56
-114.35.116.76
-114.35.119.31
-114.35.12.74
-114.35.12.93
-114.35.120.213
-114.35.126.13
-114.35.127.21
-114.35.128.31
-114.35.13.97
-114.35.137.52
-114.35.138.140
-114.35.139.55
-114.35.140.245
-114.35.148.77
-114.35.150.79
-114.35.152.129
-114.35.152.247
-114.35.153.250
-114.35.153.58
-114.35.153.6
-114.35.156.83
-114.35.157.58
-114.35.158.20
-114.35.159.197
-114.35.159.251
-114.35.160.115
-114.35.167.248
-114.35.169.191
-114.35.17.207
-114.35.170.147
-114.35.177.126
-114.35.178.73
-114.35.179.146
-114.35.179.165
-114.35.179.196
-114.35.179.55
-114.35.180.196
-114.35.181.80
-114.35.182.22
  114.35.188.117
-114.35.19.141
-114.35.192.87
-114.35.194.4
-114.35.195.112
-114.35.20.110
-114.35.200.107
-114.35.200.248
-114.35.202.20
-114.35.206.244
-114.35.207.32
-114.35.209.203
-114.35.211.156
-114.35.211.220
-114.35.213.76
-114.35.218.3
-114.35.218.4
-114.35.22.149
-114.35.220.181
-114.35.221.18
-114.35.223.157
-114.35.224.177
-114.35.224.43
-114.35.225.2
-114.35.23.68
-114.35.233.30
-114.35.235.89
  114.35.237.73
-114.35.245.202
-114.35.245.71
-114.35.252.193
-114.35.253.71
-114.35.26.118
-114.35.26.217
-114.35.26.83
-114.35.27.175
-114.35.28.41
-114.35.29.203
-114.35.30.25
-114.35.31.116
-114.35.32.155
-114.35.32.159
-114.35.33.151
-114.35.33.170
-114.35.40.242
-114.35.44.105
-114.35.44.197
-114.35.44.21
+114.35.243.41
  114.35.44.253
-114.35.47.210
-114.35.52.89
-114.35.56.140
-114.35.56.32
-114.35.59.108
-114.35.59.169
-114.35.61.60
-114.35.62.35
-114.35.62.53
-114.35.62.97
-114.35.63.6
-114.35.64.87
-114.35.68.22
-114.35.7.211
-114.35.71.248
-114.35.74.193
-114.35.77.79
-114.35.79.130
-114.35.8.22
-114.35.80.160
-114.35.80.43
-114.35.83.220
-114.35.84.236
-114.35.88.142
-114.35.88.75
-114.35.89.24
-114.35.92.178
-114.35.92.186
-114.35.92.69
-114.35.93.59
-114.35.94.178
-114.35.95.192
-114.37.175.122
+114.36.115.116
  114.37.220.186
  114.37.84.35
-114.38.168.156
-114.39.104.242
-114.39.154.167
  114.4.110.189
  114.4.192.17
  114.4.227.194
  114.4.78.82
  114.4.8.14
  114.40.189.44
-114.40.26.243
+114.41.151.151
  114.41.211.35
-114.42.18.251
-114.42.22.41
  114.42.222.55
  114.42.225.59
-114.43.26.203
-114.43.99.112
-114.43.99.229
+114.43.30.67
  114.44.1.165
-114.44.184.121
  114.45.101.18
-114.45.57.128
-114.47.152.37
+114.45.156.27
+114.46.181.53
+114.47.162.211
  114.47.227.212
  114.47.71.79
  114.5.12.34
@@ -16979,7 +14390,6 @@
  114.55.254.102
  114.57.185.12
  114.57.189.130
-114.57.33.222
  114.57.49.242
  114.6.176.180
  114.6.227.28
@@ -16989,15 +14399,12 @@
  114.6.87.177
  114.6.88.238
  114.6.94.94
-114.64.253.153
  114.67.102.54
  114.67.103.151
  114.67.104.107
-114.67.104.176
  114.67.104.59
  114.67.105.220
  114.67.106.197
-114.67.107.234
  114.67.108.60
  114.67.110.126
  114.67.110.227
@@ -17006,35 +14413,27 @@
  114.67.113.90
  114.67.117.120
  114.67.117.219
-114.67.117.93
  114.67.123.3
  114.67.125.253
  114.67.127.162
  114.67.127.240
  114.67.168.0
  114.67.168.173
-114.67.168.255
  114.67.171.58
  114.67.179.254
-114.67.180.177
  114.67.198.134
  114.67.199.133
-114.67.200.2
-114.67.201.156
  114.67.202.170
  114.67.212.197
  114.67.219.159
  114.67.224.239
  114.67.225.91
  114.67.229.212
-114.67.235.6
  114.67.239.47
-114.67.250.15
  114.67.250.30
  114.67.253.227
  114.67.254.244
  114.67.66.26
-114.67.67.11
  114.67.67.148
  114.67.68.255
  114.67.69.0
@@ -17045,9 +14444,7 @@
  114.67.82.217
  114.67.83.42
  114.67.85.74
-114.67.87.218
  114.67.87.255
-114.67.88.223
  114.67.90.104
  114.67.95.121
  114.67.95.61
@@ -17071,7 +14468,6 @@
  114.69.232.81
  114.69.233.146
  114.69.233.182
-114.69.235.204
  114.69.240.214
  114.69.243.1
  114.69.243.25
@@ -17100,86 +14496,69 @@
  114.7.96.178
  114.7.97.193
  114.70.235.64
+114.78.128.204
  114.78.163.71
-114.79.136.69
-114.79.151.157
-114.79.157.4
-114.79.160.52
-114.80.118.153
  114.80.156.113
  114.80.157.205
-114.80.222.226
-114.80.246.172
-114.80.62.205
  114.80.96.138
-114.83.179.135
  114.83.197.217
-114.84.212.242
  114.84.242.116
-114.84.27.192
-114.84.31.165
  114.84.31.218
  114.84.81.121
  114.85.215.252
-114.86.135.36
+114.86.129.9
  114.86.186.78
  114.88.100.120
  114.88.100.86
  114.88.101.18
  114.88.126.211
-114.88.154.55
  114.88.155.186
  114.88.209.24
  114.88.92.236
  114.88.93.48
  114.88.96.116
-114.92.249.74
  114.93.255.241
  114.93.26.195
  114.93.35.123
  114.93.73.42
-114.95.149.112
  114.95.162.117
-114.95.172.20
-114.95.248.48
-114.96.69.118
-114.96.69.154
+114.96.18.9
+114.96.19.129
  114.96.69.211
  114.96.69.247
-114.96.70.21
-114.97.185.59
  114.97.240.205
  114.98.231.143
-114.98.236.124
+114.98.231.233
  114.99.13.78
-114.99.131.225
+114.99.130.2
+114.99.131.116
+114.99.131.33
+114.99.131.65
  114.99.131.87
  114.99.224.219
-114.99.25.198
+114.99.26.87
+114.99.63.220
  114.99.9.162
  1147.org
  114oldest.com
  115.100.249.238
  115.110.167.212
  115.111.91.67
-115.112.120.83
  115.112.36.91
-115.112.36.92
  115.112.75.70
  115.124.102.10
  115.124.123.73
-115.124.45.59
+115.124.127.201
  115.124.64.234
  115.124.66.82
-115.124.69.162
  115.124.71.110
  115.124.71.26
  115.124.75.225
+115.124.75.6
  115.124.75.86
  115.124.78.54
  115.124.86.169
  115.126.167.71
-115.126.242.64
  115.127.109.2
  115.127.114.76
  115.127.115.226
@@ -17189,17 +14568,16 @@
  115.127.65.66
  115.127.65.69
  115.127.65.70
-115.127.7.2
  115.127.75.18
  115.127.78.138
  115.127.82.124
  115.127.92.179
-115.129.136.135
  115.133.1.97
-115.133.33.136
  115.134.128.90
  115.134.130.53
  115.134.160.64
+115.134.174.8
+115.134.176.137
  115.134.194.193
  115.134.194.216
  115.135.248.250
@@ -17207,22 +14585,17 @@
  115.143.107.221
  115.144.238.26
  115.144.238.94
-115.144.26.3
  115.144.69.105
  115.146.121.108
  115.146.122.237
-115.148.72.28
  115.149.138.108
-115.149.182.19
-115.151.137.10
-115.152.253.34
-115.152.253.35
+115.150.23.129
+115.150.23.8
+115.153.12.103
  115.159.105.200
  115.159.106.132
  115.159.109.101
-115.159.112.224
  115.159.112.66
-115.159.113.142
  115.159.114.146
  115.159.115.17
  115.159.117.250
@@ -17231,23 +14604,21 @@
  115.159.123.146
  115.159.124.199
  115.159.126.215
+115.159.143.109
  115.159.143.51
  115.159.145.240
-115.159.145.80
  115.159.147.151
  115.159.148.133
  115.159.148.72
  115.159.150.172
  115.159.151.171
  115.159.153.180
-115.159.155.22
  115.159.155.33
  115.159.156.187
  115.159.157.154
  115.159.161.81
  115.159.195.53
  115.159.197.34
-115.159.199.209
  115.159.199.238
  115.159.200.183
  115.159.201.15
@@ -17263,13 +14634,9 @@
  115.159.214.200
  115.159.214.247
  115.159.216.109
-115.159.221.187
  115.159.225.156
  115.159.226.82
  115.159.226.89
-115.159.227.17
-115.159.23.54
-115.159.24.230
  115.159.24.96
  115.159.25.145
  115.159.25.60
@@ -17278,79 +14645,60 @@
  115.159.3.29
  115.159.33.215
  115.159.34.134
-115.159.35.27
  115.159.39.248
  115.159.43.125
  115.159.47.78
  115.159.53.215
-115.159.54.212
  115.159.54.82
  115.159.56.60
-115.159.58.110
-115.159.64.121
  115.159.65.146
+115.159.65.25
  115.159.66.109
  115.159.66.188
  115.159.71.95
  115.159.74.68
  115.159.78.65
+115.159.82.216
  115.159.83.182
  115.159.90.137
  115.159.90.184
  115.159.93.67
  115.159.96.114
-115.159.96.160
  115.159.98.28
-115.164.94.199
-115.165.166.169
-115.165.198.25
-115.165.205.17
-115.165.212.231
-115.165.213.31
-115.165.213.8
  115.165.216.112
-115.165.217.51
  115.166.128.230
  115.171.238.70
  115.171.238.92
  115.171.238.92bin.sh
  115.171.91.155
  115.177.188.104
-115.178.119.110
  115.178.49.238
  115.178.98.62
  115.182.105.68
-115.182.255.234
-115.182.75.28
-115.182.8.30
-115.182.90.3
-115.186.149.166
  115.186.169.57
-115.186.190.126
-115.186.30.38
-115.192.61.226
  115.192.78.50
-115.193.126.195
-115.195.138.109
  115.195.214.241
+115.195.72.212
+115.195.72.98
+115.195.73.236
+115.195.75.178
+115.196.21.3
  115.197.173.196
-115.197.188.170
-115.197.194.227
  115.197.83.141
-115.198.227.193
-115.199.104.232
-115.199.182.47
-115.20.180.18
-115.200.85.202
+115.20.174.59
+115.200.77.215
  115.201.37.74
  115.201.40.70
  115.201.42.185
  115.201.47.10
-115.201.6.99
+115.202.187.124
  115.202.237.182
-115.203.78.136
+115.204.120.193
+115.204.121.32
+115.204.123.174
+115.204.123.180
+115.204.123.218
  115.204.25.141
-115.206.166.11
  115.206.40.187
  115.206.60.63
  115.207.199.11
@@ -17358,8 +14706,8 @@
  115.207.47.14
  115.207.6.201
  115.207.9.109
-115.208.109.168
  115.208.117.143
+115.208.125.10
  115.208.126.111
  115.208.134.3
  115.208.181.196
@@ -17367,163 +14715,122 @@
  115.208.34.169
  115.208.35.169
  115.208.50.106
-115.213.228.215
+115.212.97.143
  115.214.114.237
-115.214.238.91
  115.215.121.172
-115.215.134.227
+115.216.112.45
+115.216.112.97
+115.216.113.15
+115.216.113.39
+115.216.113.93
+115.216.114.60
+115.216.115.163
+115.216.115.204
+115.216.115.224
+115.216.116.22
  115.216.26.149
-115.216.33.181
-115.218.131.30
-115.22.160.29
-115.22.214.36
-115.22.53.146
-115.22.53.147
-115.220.10.112
-115.220.160.225
-115.220.178.183
-115.220.2.163
+115.216.43.37
+115.216.75.126
+115.218.89.124
+115.219.0.43
  115.220.59.32
-115.221.113.215
+115.221.242.123
  115.221.243.197
-115.221.247.246
  115.221.247.81
  115.222.100.216
+115.222.97.96
  115.223.34.141
  115.223.7.110
  115.224.153.61
  115.224.155.130
  115.224.157.42
  115.224.158.238
-115.224.53.182
+115.224.223.55
  115.224.88.245
  115.226.146.227
  115.226.149.158
  115.226.67.132
  115.226.67.150
  115.226.67.190
-115.226.69.22
+115.227.122.80
+115.227.123.50
+115.227.123.66
+115.227.177.136
+115.227.177.34
  115.227.239.55
-115.227.49.108
  115.229.203.63
  115.229.249.129
-115.23.172.118
  115.23.196.182
-115.23.223.53
-115.23.58.131
-115.23.58.207
-115.23.68.166
-115.230.124.112
-115.230.126.27
-115.230.127.135
  115.230.23.133
-115.230.64.50
  115.231.0.56
  115.231.163.85
  115.231.175.80
-115.231.176.170
-115.231.19.187
-115.231.195.42
  115.231.209.94
-115.231.218.80
-115.231.218.91
-115.231.218.98
-115.231.219.25
-115.231.219.47
-115.231.231.3
-115.231.241.146
-115.231.242.206
  115.231.67.2
-115.231.69.78
  115.233.210.218
  115.233.224.130
-115.233.230.70
+115.233.227.46
  115.236.100.36
  115.236.119.140
-115.236.13.186
-115.236.182.133
  115.236.182.186
  115.236.185.227
  115.236.19.35
  115.236.32.130
-115.236.61.2
-115.236.62.43
  115.236.67.42
  115.236.8.253
  115.236.83.94
-115.236.87.26
  115.237.184.224
  115.237.186.87
-115.237.190.185
  115.237.254.215
-115.237.78.73
  115.238.153.174
-115.238.46.69
-115.238.49.107
  115.238.61.222
  115.238.62.154
+115.238.65.122
  115.238.65.26
+115.238.94.18
  115.238.97.174
  115.238.97.2
+115.239.166.14
  115.239.166.82
-115.239.2.86
+115.239.194.78
  115.239.202.98
  115.239.227.106
-115.239.238.242
-115.239.255.5
-115.239.65.63
-115.239.67.17
  115.241.1.66
  115.242.198.102
-115.248.28.145
  115.254.63.50
-115.28.172.65
-115.28.2.178
  115.28.208.35
+115.28.211.230
  115.28.241.52
-115.29.5.153
+115.29.102.204
+115.29.141.60
  115.29.7.25
  115.29.7.45
-115.31.111.202
-115.31.141.129
-115.31.167.28
+115.37.102.87
  115.38.178.51
-115.41.28.249
+115.4.56.5
  115.42.127.133
  115.42.151.75
  115.42.32.106
  115.42.66.248
-115.42.71.32
-115.43.97.27
  115.44.108.114
-115.44.137.111
  115.44.80.25
-115.45.102.227
  115.45.104.103
+115.45.93.13
+115.46.148.235
  115.47.53.34
-115.48.129.138
-115.48.130.96
  115.48.146.206
-115.48.151.146
-115.48.151.232
-115.48.156.31
-115.48.187.37
-115.48.189.73
-115.48.197.138
+115.48.182.86
+115.48.187.208
+115.48.206.150
  115.48.209.135
  115.48.46.61
-115.48.48.120
-115.48.6.85
-115.48.9.58
-115.49.146.120
-115.49.20.206
+115.49.179.130
  115.49.210.221
  115.49.215.114
  115.49.227.139
+115.49.252.120
  115.49.37.180
  115.49.37.204bin.sh
-115.49.44.79
-115.49.46.223
  115.49.72.68
  115.49.72.8
  115.49.75.131
@@ -17531,207 +14838,183 @@
  115.49.96.91
  115.49.97.55
  115.50.0.131
-115.50.0.213
-115.50.10.216
-115.50.123.232
+115.50.130.11
+115.50.133.199
  115.50.144.74
-115.50.144.79
-115.50.147.103
  115.50.158.179
-115.50.159.65
-115.50.175.189
+115.50.173.77
  115.50.187.9
-115.50.206.224
-115.50.208.125
-115.50.216.190
-115.50.217.10
+115.50.20.39
+115.50.215.20
+115.50.217.46
  115.50.219.28
-115.50.222.248
  115.50.225.17
-115.50.229.31
-115.50.23.247
-115.50.236.177
+115.50.227.124
+115.50.233.76
  115.50.236.82
  115.50.241.36
+115.50.244.16
  115.50.247.130
+115.50.33.254
  115.50.34.125
+115.50.43.91
  115.50.44.154
-115.50.48.248
+115.50.47.71
  115.50.50.90
-115.50.52.248
  115.50.56.92
  115.50.6.143
-115.50.69.41
-115.50.72.167
+115.50.69.208
  115.50.80.203
-115.50.88.102
-115.50.88.169
+115.50.88.55
+115.50.96.8
+115.50.99.2
+115.51.107.195
  115.51.110.122
-115.51.124.93
  115.51.125.125
+115.51.125.67
+115.51.126.218
+115.51.23.220
  115.51.29.184
  115.51.31.134
-115.51.42.198
-115.51.42.36
-115.51.44.246
  115.51.47.80
-115.51.93.219
-115.51.95.51
  115.52.105.136
  115.52.107.178
  115.52.12.28
  115.52.163.111
  115.52.17.135
-115.52.172.196
-115.52.18.184
+115.52.172.63
  115.52.18.43
-115.52.23.234
+115.52.23.221
  115.52.58.160
-115.52.62.2
-115.52.62.87
  115.53.201.201
-115.53.249.129
  115.53.255.199
-115.53.79.106
  115.53.79.183
-115.54.102.54
+115.54.104.6
  115.54.129.10
-115.54.131.88
  115.54.183.113
-115.54.198.128
-115.54.213.20
+115.54.202.217
  115.54.214.163
-115.54.214.226
  115.54.236.42
+115.54.239.54
  115.54.71.22
+115.55.119.48
  115.55.130.195
  115.55.130.55
  115.55.131.30
-115.55.134.122
+115.55.134.215
  115.55.136.161
-115.55.136.243
  115.55.137.118
  115.55.137.158
+115.55.138.119
+115.55.138.187
  115.55.139.119
-115.55.139.21
-115.55.140.109
-115.55.141.233
+115.55.141.252
  115.55.141.81
  115.55.144.195
  115.55.145.253
+115.55.146.231
  115.55.146.3
-115.55.148.106
  115.55.149.192
  115.55.149.197
  115.55.149.253
+115.55.150.106
  115.55.150.245
  115.55.150.81
+115.55.151.209
  115.55.153.105
  115.55.153.83
  115.55.154.201
+115.55.156.18
  115.55.156.206
  115.55.157.190
  115.55.157.2
-115.55.158.116
  115.55.158.52bin.sh
+115.55.158.94
  115.55.159.46
  115.55.159.76
  115.55.159.87
  115.55.161.184
-115.55.165.177
  115.55.181.126
  115.55.185.186
+115.55.185.250
+115.55.190.179
  115.55.202.175
-115.55.202.182
-115.55.207.162
  115.55.208.186
-115.55.246.166
+115.55.237.149
  115.55.32.190
  115.55.41.246
-115.55.72.142
+115.55.63.12
  115.55.90.41
  115.56.114.233
+115.56.114.8
  115.56.115.248
-115.56.120.55
-115.56.122.60
-115.56.123.87
-115.56.127.186
  115.56.128.232
  115.56.128.237
  115.56.129.141
+115.56.130.246
  115.56.130.85
  115.56.131.72
+115.56.132.184
  115.56.132.235
-115.56.133.154
  115.56.135.102
  115.56.135.103bin.sh
  115.56.135.247
-115.56.137.117
  115.56.137.47
-115.56.139.42
+115.56.137.59
  115.56.139.86
  115.56.140.163
  115.56.140.64
-115.56.141.193
-115.56.141.43
  115.56.143.125
  115.56.143.13
  115.56.143.67
-115.56.144.3
  115.56.146.213
+115.56.147.223
  115.56.147.73
  115.56.148.240
  115.56.152.203
-115.56.152.209
  115.56.153.210bin.sh
+115.56.157.108
+115.56.157.158
  115.56.161.84
-115.56.172.109
+115.56.169.231
  115.56.176.146
-115.56.177.29
-115.56.179.245
+115.56.178.45
+115.56.180.128
  115.56.181.151
  115.56.181.237
  115.56.182.87
  115.56.183.10
  115.56.187.197
-115.56.187.74
  115.56.188.184
  115.56.189.174
  115.56.189.61
-115.56.190.229
+115.56.190.166
  115.56.190.55
+115.56.218.141
  115.56.219.88
  115.56.24.68
-115.56.59.154
-115.58.11.193
  115.58.132.230
  115.58.132.6
  115.58.133.121
-115.58.134.165
  115.58.135.221
  115.58.141.145
  115.58.150.229
  115.58.2.34
  115.58.209.70
-115.58.91.240
-115.58.95.60
+115.58.9.149
  115.59.119.162
-115.59.12.163
-115.59.19.122
-115.59.19.66
  115.59.193.90
  115.59.199.35
+115.59.209.219
  115.59.210.228
-115.59.213.90
+115.59.215.240
+115.59.219.114
  115.59.225.214
+115.59.23.33
  115.59.230.79
-115.59.240.136
-115.59.242.218
-115.59.245.4
  115.59.255.136
  115.59.255.40
-115.59.3.207
-115.59.52.161
+115.59.27.115
  115.59.76.195
  115.59.82.114
  115.59.86.127
@@ -17741,62 +15024,49 @@
  115.61.10.132
  115.61.102.167
  115.61.108.102
-115.61.109.183
  115.61.121.109
-115.61.124.35
-115.61.128.154
+115.61.126.127
  115.61.137.57
  115.61.144.220
  115.61.144.8
-115.61.170.220
+115.61.158.90
+115.61.172.204
  115.61.173.60
-115.61.180.196
  115.61.181.80
-115.61.185.21
-115.61.193.75
+115.61.198.5
+115.61.48.71
  115.61.98.191
+115.61.99.26
  115.62.134.206
  115.62.144.135
  115.62.144.29
-115.62.153.224
-115.62.165.68
-115.62.26.72
-115.63.1.244
  115.63.133.17
+115.63.138.200
  115.63.139.114
-115.63.16.23
-115.63.182.60
-115.63.185.105
-115.63.185.53
  115.63.186.148
  115.63.189.176
  115.63.19.124
-115.63.200.185
-115.63.37.225
  115.63.38.190
-115.63.8.229
+115.63.49.228
+115.63.66.206
  115.63.81.88
  115.64.115.132
-115.66.110.55
+115.66.109.141
+115.66.110.181
  115.66.132.234
  115.66.138.57
-115.66.2.150
  115.68.109.9
  115.68.182.197
  115.68.190.124
  115.68.2.144
  115.68.207.186
-115.68.228.71
  115.68.232.221
  115.68.232.45
-115.68.45.163
  115.68.52.240
  115.69.106.48
  115.69.120.90
-115.69.210.107
  115.69.222.107
  115.69.222.76
-115.69.247.242
  115.69.253.113
  115.70.110.4
  115.70.133.4
@@ -17806,6 +15076,7 @@
  115.70.45.132
  115.71.1.70
  115.71.236.98
+115.71.237.56
  115.71.238.18
  115.71.239.208
  115.72.129.137
@@ -17818,21 +15089,17 @@
  115.72.135.15
  115.72.135.67
  115.72.182.36
-115.72.7.253
  115.73.0.119
  115.73.213.182
-115.74.215.136
-115.74.97.226
  115.75.1.156
  115.75.1.184
  115.75.153.9
  115.75.181.168
  115.75.2.213
+115.75.254.132
  115.75.3.137
  115.75.5.17
-115.75.54.24
  115.75.72.103
-115.76.114.164
  115.76.152.55
  115.76.161.144
  115.76.162.145
@@ -17845,60 +15112,45 @@
  115.76.172.42
  115.76.174.186
  115.76.174.87
-115.76.253.152
  115.76.7.101
  115.76.7.86
  115.77.187.194
  115.77.188.228
-115.77.19.34
-115.77.191.180
  115.78.1.222
-115.78.118.58
  115.78.126.92
  115.78.161.106
  115.78.235.164
  115.78.4.219
-115.78.73.125
-115.78.73.217
  115.78.88.0
  115.78.9.72
-115.78.93.4
  115.78.96.99
-115.79.103.119
  115.79.139.177
  115.79.142.229
  115.79.193.105
  115.79.193.109
  115.79.193.113
+115.79.193.125
  115.79.195.246
  115.79.208.56
  115.79.209.221
-115.79.214.222
  115.79.220.245
  115.79.253.123
-115.79.31.56
  115.79.35.110
  115.79.4.223
  115.79.59.157
-115.79.60.184
  115.79.94.107
-115.79.94.63
  115.84.101.78
-115.84.107.186
  115.84.148.8
  115.84.178.112
  115.84.235.77
  115.84.91.211
-115.84.91.215
  115.84.92.149
-115.84.92.15
  115.84.92.198
  115.84.92.214
  115.84.92.51
-115.84.99.192
+115.84.92.92
+115.84.99.60
  115.84.99.72
-115.85.192.91
-115.85.207.122
  115.85.41.104
  115.85.53.91
  115.85.65.150
@@ -17907,18 +15159,13 @@
  115.85.83.197
  115.85.86.234
  115.85.86.235
-115.86.108.221
-115.86.132.35
-115.86.216.16
-115.86.98.11
+115.87.244.131
  115.88.138.251
  115.88.240.91
  115.88.38.58
  115.88.60.251
-115.90.147.170
  115.90.219.181
  115.91.39.126
-115.91.68.213
  115.91.83.42
  115.92.118.52
  115.92.174.231
@@ -17928,6 +15175,7 @@
  115.94.207.204
  115.94.207.99
  115.96.135.5
+115.96.27.146
  115.97.24.198
  115.97.31.199
  115.97.83.137
@@ -17937,13 +15185,13 @@
  115.99.115.105
  115.99.139.31
  115.99.148.82
-115.99.152.182
  115.99.191.95
  115.99.224.194
  11515-dot-phonic-obelisk-274214.uk.r.appspot.com
  1152crump.com
  115video.com
  116.0.1.138
+116.0.121.239
  116.0.2.162
  116.0.23.217
  116.0.23.221
@@ -17952,16 +15200,12 @@
  116.0.54.30
  116.0.56.34
  116.0.6.14
-116.1.148.184
  116.1.149.196
  116.1.180.22
-116.1.30.135
-116.10.189.116
  116.100.113.187
-116.100.154.157
-116.100.202.233
  116.101.106.82
-116.101.27.183
+116.101.151.123
+116.101.24.105
  116.101.81.155
  116.101.96.146
  116.102.239.51
@@ -17980,22 +15224,15 @@
  116.105.219.146
  116.105.219.63
  116.105.221.120
+116.105.221.200
  116.105.222.103
-116.105.222.59
  116.105.223.191
  116.105.223.208
-116.106.126.31
  116.106.16.148
  116.106.16.4
-116.107.121.220
-116.107.175.9
-116.107.56.49
  116.108.157.109
  116.109.1.51
-116.109.101.159
  116.109.132.2
-116.109.64.253
-116.11.186.63
  116.110.1.97
  116.110.10.91
  116.110.115.170
@@ -18017,7 +15254,6 @@
  116.110.218.200
  116.110.220.7
  116.110.223.50
-116.110.4.183
  116.110.51.130
  116.110.65.247
  116.110.68.87
@@ -18044,14 +15280,10 @@
  116.110.94.182
  116.110.94.198
  116.110.95.183
-116.111.119.118
-116.111.2.124
-116.111.31.162
-116.111.67.2
-116.112.130.238
+116.111.83.120
+116.111.85.14
  116.112.207.235
  116.112.30.108
-116.112.42.103
  116.112.92.5
  116.113.17.210
  116.113.180.183
@@ -18109,18 +15341,11 @@
  116.114.95.92
  116.114.95.94
  116.114.95.98
-116.115.75.88
+116.115.13.89
  116.116.108.101
  116.116.109.84
-116.116.249.113
-116.116.67.196
  116.116fddw.top
-116.117.116.183
  116.117.134.134
-116.117.157.241
-116.117.252.190
-116.117.51.150
-116.118.119.218
  116.12.187.58
  116.12.51.206
  116.12.52.141
@@ -18131,32 +15356,21 @@
  116.122.36.61
  116.122.38.203
  116.124.233.101
-116.125.119.34
  116.125.124.226
  116.125.141.182
  116.125.141.56
-116.125.199.23
  116.127.121.116
  116.127.121.39
  116.127.123.40
+116.128.201.50
  116.129.254.88
-116.131.195.238
  116.131.212.180
  116.131.219.138
-116.132.215.135
+116.131.220.87
  116.132.47.50
-116.139.201.244
-116.14.127.155
  116.14.148.129
-116.14.149.146
-116.14.17.87
-116.14.228.23
-116.14.34.160
+116.14.49.49
  116.14.61.160
-116.14.66.240
-116.14.89.27
-116.140.132.63
-116.147.2.94
  116.149.119.209
  116.149.121.83
  116.149.195.56bin.sh
@@ -18166,21 +15380,15 @@
  116.149.240.29
  116.149.242.230
  116.149.243.161
-116.149.243.48
  116.149.246.201
  116.149.247.125
  116.149.247.146
-116.15.138.162
-116.15.24.24
-116.15.243.96
  116.15.28.236
-116.15.34.152
-116.15.51.206
-116.15.9.217
  116.153.38.221
  116.153.38.247
  116.153.43.156
  116.154.20.15
+116.167.73.63
  116.17.102.99
  116.177.178.206
  116.177.179.202
@@ -18188,20 +15396,17 @@
  116.177.181.195
  116.177.181.237
  116.177.20.50
-116.177.248.202
  116.178.28.2
  116.179.139.142
  116.179.149.121
+116.179.32.221
+116.179.32.66
  116.179.32.99
-116.19.127.9
-116.193.159.66
+116.193.153.109
  116.193.160.116
-116.193.160.118
  116.193.172.237
  116.193.216.209
-116.193.216.74
  116.193.218.18
-116.193.219.251
  116.196.105.232
  116.196.108.9
  116.196.119.146
@@ -18213,7 +15418,7 @@
  116.196.90.254
  116.196.94.108
  116.196.95.239
-116.197.129.243
+116.197.129.242
  116.197.131.18
  116.197.133.146
  116.197.134.146
@@ -18221,7 +15426,6 @@
  116.198.162.103
  116.198.162.181
  116.198.162.65
-116.198.198.71
  116.199.168.1
  116.199.169.1
  116.199.170.17
@@ -18229,8 +15433,9 @@
  116.199.172.209
  116.199.172.213
  116.199.172.29
+116.199.63.224
+116.2.53.1
  116.2.64.96
-116.20.21.76
  116.202.0.237
  116.202.10.123
  116.202.103.223
@@ -18251,11 +15456,10 @@
  116.202.226.159
  116.202.227.86
  116.202.237.37
-116.202.241.174
  116.202.245.89
  116.202.25.235
+116.202.250.253
  116.202.251.195
-116.202.28.244
  116.202.35.157
  116.202.51.11
  116.202.51.176
@@ -18271,7 +15475,6 @@
  116.203.151.175
  116.203.185.207
  116.203.188.228
-116.203.191.77
  116.203.200.229
  116.203.203.28
  116.203.211.9
@@ -18294,14 +15497,12 @@
  116.203.92.131
  116.206.138.222
  116.206.196.227
-116.206.197.95
  116.206.233.10
  116.206.233.130
  116.206.233.133
  116.206.233.134
  116.206.235.2
  116.206.253.7
-116.206.56.51
  116.206.58.245
  116.206.60.10
  116.206.61.177
@@ -18309,36 +15510,33 @@
  116.206.61.221
  116.206.61.225
  116.206.61.33
-116.206.94.26
+116.206.94.73
  116.209.181.243
  116.21.228.98
+116.21.229.149
  116.21.229.200
  116.21.230.180
+116.21.40.215
  116.21.40.85
-116.211.118.246
  116.211.144.153
-116.211.145.37
  116.212.129.58
  116.212.131.174
  116.212.152.30
  116.212.66.214
-116.213.171.173
  116.213.40.6
  116.213.43.5
  116.213.52.200
  116.213.52.252
-116.214.35.254
  116.22.199.15
  116.22.20.200
+116.22.204.161
  116.22.45.115
-116.224.158.35
+116.220.83.221
  116.228.114.182
  116.228.160.22
  116.228.183.38
  116.228.196.210
-116.228.198.133
  116.228.233.91
-116.228.247.11
  116.228.37.90
  116.228.53.227
  116.23.17.174
@@ -18354,152 +15552,132 @@
  116.234.100.129
  116.234.249.136
  116.235.182.147
-116.235.59.153
-116.236.145.14
-116.236.17.59
  116.236.195.189
-116.236.222.106
-116.236.225.218
-116.236.24.140
  116.236.243.130
-116.236.32.222
  116.236.60.114
  116.236.91.34
+116.236.95.180
  116.237.139.23
  116.237.239.42
-116.238.253.26
-116.239.104.147
-116.239.104.155
-116.239.104.7
+116.239.104.249
  116.239.105.220
+116.239.105.235
+116.239.105.239
  116.239.105.54
-116.239.106.163
+116.239.106.102
+116.239.106.115
  116.239.106.214
+116.239.106.53
  116.239.107.127
+116.239.107.167
  116.239.107.178
-116.239.13.149
-116.239.15.26
+116.239.107.254
+116.239.107.81
  116.239.22.11
+116.239.252.101
+116.239.252.118
+116.239.252.123
+116.239.252.171
+116.239.252.228
+116.239.252.44
  116.239.252.74
-116.239.253.223
+116.239.252.97
+116.239.253.104
+116.239.253.128
+116.239.253.142
+116.239.253.160
+116.239.253.164
+116.239.253.178
+116.239.253.211
+116.239.253.242
+116.239.253.244
+116.239.253.41
  116.239.253.65
+116.239.253.81
+116.239.254.167
+116.239.254.181
  116.239.254.196
-116.239.255.116
+116.239.254.231
+116.239.254.80
+116.239.255.114
+116.239.255.135
+116.239.255.156
+116.239.255.187
+116.239.255.191
  116.239.255.212
+116.239.255.241
+116.239.255.247
  116.239.27.145
  116.239.4.130
-116.24.102.211
  116.24.152.107
  116.24.64.164
+116.24.64.27
  116.24.65.251
  116.24.67.132
-116.24.83.122
  116.240.199.84
-116.241.108.189
-116.241.176.182
-116.241.219.248
  116.241.23.133
-116.241.79.252
-116.242.30.148
-116.242.5.253
-116.247.101.100
  116.247.69.42
  116.247.81.99
-116.247.82.9
-116.247.87.66
-116.248.88.225
-116.249.127.46
-116.249.18.83
-116.249.53.204
-116.25.133.214
-116.25.134.129
-116.25.134.130
  116.25.135.195
+116.25.145.233
  116.25.39.59
  116.250.214.32
  116.251.128.163
  116.251.211.12
-116.252.204.88
-116.252.254.223
-116.252.36.218
-116.252.36.92
-116.252.80.130
  116.252.80.181
-116.252.95.211
  116.254.100.165
-116.254.101.173
  116.254.124.110
  116.255.10.118
-116.255.118.91
  116.255.129.3
  116.255.131.3
  116.255.155.36
  116.255.163.100
-116.255.168.78
  116.255.175.72
-116.255.198.57
  116.255.213.176
  116.255.216.34
-116.255.220.8
-116.255.93.79
  116.26.113.138
  116.26.114.6
-116.28.63.212
  116.3.201.185
+116.30.123.137
  116.30.195.149
-116.30.198.194
-116.30.216.173
  116.30.222.153
-116.30.248.142
+116.30.251.23
  116.30.251.244
  116.31.102.82
-116.31.75.162
  116.36.188.81
-116.36.195.112
-116.4.97.165
-116.47.32.25
  116.48.136.128
-116.48.251.131
-116.48.66.104
-116.48.97.219
-116.49.0.233
+116.49.165.15
  116.52.1.211
-116.52.10.198
-116.52.130.115
+116.52.144.172
  116.52.9.220
  116.52.9.90
  116.53.225.204
-116.55.13.36
-116.55.227.143
-116.55.229.234
  116.55.245.26
-116.55.248.101
  116.55.248.214
  116.58.171.67
-116.58.179.3
  116.58.224.56
  116.58.226.207
  116.58.226.36
  116.58.226.94
  116.58.227.131
  116.58.227.182
+116.58.227.242
  116.58.227.39
  116.58.227.40
-116.58.228.124
  116.58.229.149
  116.58.232.111
-116.58.232.114
-116.58.232.128
  116.58.232.136
  116.58.232.163
-116.58.232.223
  116.58.232.234
  116.58.232.236
+116.58.232.7
+116.58.232.88
  116.58.232.91
  116.58.233.29
  116.58.235.18
  116.58.235.69
  116.58.247.140
+116.58.247.176
  116.58.247.199
  116.58.247.221
  116.58.247.222
@@ -18507,8 +15685,11 @@
  116.58.247.239
  116.58.247.5
  116.58.247.50
+116.58.247.70
+116.58.247.90
  116.58.247.92
  116.58.251.151
+116.58.251.161
  116.58.251.85
  116.58.254.3
  116.58.254.40
@@ -18523,18 +15704,11 @@
  116.59.25.200
  116.59.25.201
  116.6.107.172
-116.6.135.132
  116.6.18.115
-116.6.195.84
-116.6.195.85
-116.6.195.86
-116.6.216.50
-116.6.217.140
-116.6.84.186
  116.62.11.138
+116.62.223.176
  116.62.229.19
  116.62.51.6
-116.66.190.83
  116.66.191.161
  116.66.191.217
  116.66.197.148
@@ -18544,101 +15718,53 @@
  116.68.162.105
  116.68.162.86
  116.68.162.99
-116.68.192.130
  116.68.244.203
-116.68.96.88
+116.68.96.16
+116.68.97.171
+116.68.99.212
+116.68.99.32
  116.68.99.64
-116.7.226.66
-116.7.29.199
  116.71.132.53
-116.72.225.229
+116.72.195.25
  116.72.225.6
-116.72.230.210
-116.73.24.9
  116.73.66.179
-116.74.111.230
  116.74.17.255
  116.74.223.188
  116.75.103.58
  116.75.117.40bin.sh
-116.75.192.159
-116.75.196.64
+116.75.192.18
+116.75.212.171
  116.75.34.61
-116.76.60.119
  116.77.33.59
  116.82.26.242
  116.85.13.82
  116.85.26.21
-116.85.31.216
-116.85.33.141
  116.85.4.240
  116.85.40.181
  116.85.41.190
  116.85.56.252
  116.85.66.176
  116.85.71.133
-116.86.10.254
-116.86.164.149
-116.86.201.179
-116.86.209.155
-116.86.240.28
-116.86.253.69
  116.86.30.42
-116.86.61.221
  116.86.88.161
-116.87.117.103
-116.87.127.224
-116.87.136.6
  116.87.15.244
-116.87.153.119
-116.87.173.213
-116.87.201.100
-116.87.29.117
-116.87.48.52
-116.87.94.34
-116.88.128.116
-116.88.13.236
-116.88.132.194
-116.88.148.126
-116.88.152.27
-116.88.157.10
-116.88.167.89
-116.88.214.163
-116.88.218.69
-116.88.220.67
-116.88.233.101
-116.88.24.82
-116.88.92.59
-116.89.36.149
-116.89.45.207
  116.89.71.215
-116.89.87.106
-116.89.89.80
  116.90.118.1
  116.90.165.26
  116.90.225.58
  116.90.229.186
-116.90.230.243
  116.90.59.223
-116.90.82.181
-116.90.82.184
-116.90.82.186
-116.90.87.11
-116.90.87.210
  116.91.189.208
  116.91.240.96
  116.91.82.17
  116.92.213.114
  116.92.219.162
-116.94.10.164
  116.94.131.109
-116.95.129.30
-116.95.207.39
-116.95.32.99
  116.96.128.232
  116.98.160.160
  116.98.160.70
  116.98.161.47
+116.98.161.77
  116.98.162.209
  116.98.163.103
  116.98.164.248
@@ -18649,22 +15775,21 @@
  116.98.167.200
  116.98.167.59
  116.98.168.231
-116.98.169.139
  116.98.170.208
  116.98.170.49
+116.98.171.118
  116.98.172.215
+116.98.175.101
  116.99.54.34
  116151147136715.002.sh.cn
  1164e4989ededf518a4.yolasite.com
  1169732-dot-phonic-obelisk-274214.uk.r.appspot.com
-117.1.124.164
  117.1.16.131
-117.1.161.139
  117.1.165.190
-117.1.33.119
-117.10.211.26
+117.1.171.130
  117.10.53.123
  117.102.102.155
+117.102.103.146
  117.102.104.44
  117.102.105.91
  117.102.107.154
@@ -18681,7 +15806,6 @@
  117.102.5.19
  117.102.77.2
  117.102.77.204
-117.102.80.66
  117.102.82.42
  117.102.82.43
  117.102.82.44
@@ -18691,59 +15815,36 @@
  117.102.86.174
  117.102.87.138
  117.102.92.10
-117.103.192.36
  117.103.5.186
  117.103.6.238
  117.103.86.62
-117.103.91.137
  117.104.181.164
  117.107.193.98
  117.107.213.244
  117.107.213.245
  117.107.213.246
  117.107.213.251
-117.107.216.67
  117.109.52.203
-117.11.159.202
  117.114.138.246
-117.114.161.11
-117.114.161.4
-117.114.171.227
-117.114.175.67
  117.117.165.131
-117.117.96.24
-117.119.84.43
+117.119.83.20
  117.12.115.70
-117.12.194.112
-117.12.197.32
-117.12.237.87
  117.120.1.103
  117.120.7.93
-117.121.0.81
-117.121.1.254
-117.121.100.11
  117.121.204.80
-117.121.207.179
-117.121.214.50
  117.121.215.101
-117.121.241.3
  117.121.38.172
  117.121.38.246
  117.121.38.28
-117.121.9.115
  117.121.97.95
-117.122.225.219
  117.123.120.3
  117.123.171.105
-117.126.243.9
  117.127.16.205
  117.127.16.207
  117.127.16.208
  117.13.171.227
  117.13.254.117
-117.13.62.253
  117.13.81.168
-117.131.253.170
  117.131.29.87
  117.131.43.194
  117.131.43.195
@@ -18753,299 +15854,219 @@
  117.132.193.134
  117.132.4.151
  117.132.4.84
-117.135.226.82
-117.135.226.98
  117.135.251.235
-117.139.162.180
  117.139.166.27
-117.139.86.217
  117.14.20.21
  117.14.20.221
  117.14.21.88
-117.141.105.44
-117.141.117.229
-117.141.132.186
  117.141.155.241
-117.141.244.71
-117.141.97.237
  117.144.189.69
-117.144.200.236
-117.145.34.55
-117.145.49.54
-117.146.53.211
-117.148.157.48
-117.148.159.17
  117.148.160.16
-117.148.171.83
  117.149.10.58
  117.149.20.18
  117.149.21.145
-117.154.147.253
  117.156.119.39
  117.157.71.49
-117.157.78.2
-117.158.107.189
-117.158.112.27
-117.158.152.86
  117.158.155.26
  117.158.175.162
-117.158.208.67
+117.158.198.130
  117.158.56.11
-117.158.61.254
-117.158.65.15
-117.158.66.137
-117.158.77.41
  117.158.87.112
-117.158.94.153
-117.159.197.158
-117.159.242.215
-117.159.246.38
-117.159.246.44
-117.159.7.101
-117.160.210.211
-117.160.220.49
-117.161.11.93
+117.158.88.118
  117.161.25.202
-117.161.92.17
-117.161.92.18
  117.169.1.47
-117.172.253.135
-117.172.59.37
  117.172.79.4
  117.173.67.119
-117.174.165.36
  117.175.101.74
  117.175.101.79
  117.175.101.82
  117.175.101.85
  117.175.101.86
-117.175.160.70
-117.175.44.34
-117.176.173.180
  117.176.236.10
+117.18.15.11
  117.18.4.157
  117.18.5.133
  117.18.5.208
-117.184.200.154
-117.184.200.185
-117.185.43.198
+117.184.55.86
  117.186.117.22
  117.186.172.126
-117.186.220.86
-117.186.244.210
  117.186.248.18
  117.186.96.54
-117.187.123.235
-117.187.251.82
  117.187.63.201
-117.190.242.69
  117.191.50.162
-117.192.224.156
-117.192.224.237
-117.192.227.162
-117.192.227.230
-117.192.227.232
-117.192.227.74
+117.192.224.120
+117.192.224.235
+117.192.225.112
+117.192.225.184
+117.192.225.57
+117.192.226.109
+117.192.226.125
+117.192.226.5
+117.192.226.6
+117.192.227.206
+117.192.227.38
  117.192.237.19
-117.192.42.33
  117.192.46.40
  117.192.8.86
+117.193.122.94
  117.193.162.210
-117.193.77.254
+117.193.165.60
+117.193.165.61
  117.193.79.162
-117.194.148.159
-117.194.148.93
-117.194.149.187
-117.194.149.5
-117.194.150.216
-117.194.151.89
-117.194.160.31
-117.194.160.77
-117.194.161.226
-117.194.163.168
-117.194.163.232
-117.194.164.124
-117.194.165.181
-117.194.166.186
-117.194.167.207
-117.194.167.240
+117.194.148.208
+117.194.148.46
+117.194.149.169
+117.194.161.90
+117.194.163.181
+117.194.164.181
+117.194.165.12
+117.194.166.15
+117.194.166.78
+117.194.167.76
  117.194.177.120
-117.194.98.151
  117.196.238.216
-117.196.238.232
  117.196.239.146
-117.196.48.159
-117.196.48.232
+117.196.48.86
  117.196.49.142
-117.196.50.123
-117.196.50.62
-117.196.51.100
+117.196.50.7
+117.196.51.106
  117.197.102.195
  117.197.126.130
  117.197.127.98
+117.197.188.189
  117.197.191.60
-117.197.56.209
-117.198.101.213
  117.198.218.70
  117.198.97.220
-117.199.178.20
-117.2.126.94
  117.2.133.106
  117.2.139.117
  117.2.155.83
  117.2.165.12
-117.2.165.159
-117.2.191.166
  117.2.22.85
  117.2.58.248
-117.2.67.93
-117.2.97.232
  117.20.192.45
-117.20.195.117
-117.20.195.95
-117.20.202.6
  117.20.202.61
  117.20.204.5
+117.20.207.53
  117.20.220.126
  117.20.220.127
-117.20.229.13
+117.20.221.2
  117.20.230.39
-117.20.247.111
-117.20.247.156
+117.20.247.30
  117.20.56.203
-117.20.63.60
  117.200.48.82
  117.200.48.94
-117.200.72.40
-117.200.74.116
-117.202.64.212
-117.202.64.36
-117.202.65.140
-117.202.65.157
-117.202.66.121
-117.202.66.124
-117.202.67.40
-117.202.67.79
-117.202.68.110
-117.202.69.217
-117.202.70.200
-117.202.78.158
+117.202.123.34
+117.202.127.209
+117.202.64.101
+117.202.64.170
+117.202.64.177
+117.202.64.19
+117.202.65.110
+117.202.65.153
+117.202.65.183
+117.202.66.127
+117.202.67.121
+117.202.67.52
+117.202.67.7
+117.202.69.233
+117.202.71.47
+117.202.78.103
+117.202.78.145
+117.202.78.225
+117.202.78.84
  117.202.8.55
  117.203.103.209
  117.203.245.98
  117.204.243.13
  117.204.252.122
+117.204.253.111
  117.204.253.159
-117.204.87.100
  117.206.149.225
  117.206.155.158
  117.206.155.82
  117.206.159.20
  117.206.83.142
-117.207.212.179
-117.207.213.2
-117.207.39.164
-117.208.132.243
-117.208.133.86
+117.208.132.105
+117.208.132.217
+117.208.132.45
+117.208.133.17
+117.208.133.53
+117.208.134.224
  117.208.134.96
  117.208.176.11
-117.21.178.45
-117.21.77.34
  117.210.210.145
-117.211.10.118
  117.211.126.230
-117.211.14.120
  117.211.147.57
  117.211.166.168
  117.211.192.70
-117.211.40.132
-117.211.40.35
-117.211.41.74
-117.211.43.17
-117.211.72.6
+117.211.40.130
+117.211.40.234
+117.211.43.71
+117.212.193.79
  117.212.194.131
-117.212.86.23
  117.212.92.55
  117.212.95.48
+117.212.95.5
+117.213.152.61
  117.213.202.5
+117.213.252.18
  117.213.40.159
-117.213.41.143
-117.213.43.187
-117.213.45.120
-117.213.46.213
-117.213.46.53
-117.213.46.98
-117.213.47.119
-117.213.47.161
+117.213.41.225
+117.213.41.34
+117.213.44.203
+117.213.45.45
+117.213.45.60
+117.213.47.70
  117.214.123.217
  117.214.225.41
-117.215.133.36
-117.217.122.93
-117.217.123.62
-117.218.174.250
  117.218.245.194
-117.22.144.222
-117.22.144.71
-117.22.182.14
+117.22.144.234
  117.22.228.62
  117.22.74.131
-117.22.76.179
-117.220.110.69
-117.220.12.23
  117.220.15.119
-117.220.17.123
  117.220.170.193
  117.220.171.105
  117.220.171.209
  117.220.201.138
-117.220.22.51
+117.220.201.181
+117.220.201.63
  117.221.157.158
+117.221.209.230
  117.221.224.51
-117.221.65.129
-117.222.160.141
-117.222.160.178
-117.222.161.154
-117.222.163.17
-117.222.163.208
-117.222.163.63
-117.222.165.249
-117.222.166.48
+117.222.160.142
+117.222.161.116
+117.222.161.174
+117.222.162.154
+117.222.162.96
+117.222.163.194
+117.222.165.134
+117.222.166.122
+117.222.166.155
+117.222.166.159
+117.222.167.46
  117.222.61.0
+117.222.61.198
  117.222.94.97
  117.223.136.107
  117.223.181.82
-117.223.181.90
  117.223.76.210
-117.223.92.37
-117.23.5.151
  117.232.127.51
  117.232.96.204
  117.236.139.53
-117.239.136.179
+117.236.139.55
  117.239.182.152
  117.239.183.185
  117.239.209.24
  117.239.226.81
-117.239.238.70
  117.239.240.202
  117.239.39.51
-117.239.5.133
-117.239.66.74
-117.239.69.202
-117.24.12.38
-117.24.132.81
-117.240.160.178
  117.240.166.51
  117.240.238.230
  117.240.28.81
  117.240.59.115
-117.240.94.122
-117.241.150.112
-117.241.169.25
-117.241.173.40
-117.241.65.152
-117.241.65.25
-117.241.67.73
+117.241.64.113
+117.241.66.101
+117.241.66.112
  117.242.147.101
  117.242.147.109
  117.242.147.5
@@ -19055,169 +16076,122 @@
  117.242.188.82
  117.242.188.84
  117.242.188.86
-117.242.208.140
-117.242.208.44
-117.242.208.80
-117.242.209.15
-117.242.210.2
-117.242.210.236
-117.242.211.102
-117.242.211.157
-117.242.211.248
-117.242.223.88
-117.247.148.68
-117.247.159.10
+117.242.209.42
+117.242.210.161
+117.242.210.184
+117.242.211.123
+117.242.211.199
+117.247.145.61
  117.247.179.136
-117.247.191.243
-117.247.204.177
-117.247.204.47
-117.247.206.217
+117.247.204.180
+117.247.204.198
+117.247.204.239
+117.247.205.147
+117.247.205.18
+117.247.205.213
  117.247.206.241
-117.247.207.161
-117.247.207.247
-117.247.209.137
+117.247.206.36
+117.247.207.115
+117.247.207.12
+117.247.207.168
+117.247.207.223
+117.247.207.226
+117.247.207.25
+117.247.207.64
+117.247.207.74
  117.247.236.51
  117.247.238.10
-117.247.70.91
-117.247.72.173
  117.247.83.240
-117.247.88.232
-117.247.88.238
  117.247.92.104
-117.248.109.35
-117.248.60.178
-117.248.62.248
-117.25.133.10
+117.248.60.13
+117.248.60.177
+117.248.62.104
+117.248.62.157
+117.248.63.105
  117.25.145.151
-117.25.149.254
-117.25.182.90
-117.251.200.50
-117.251.21.23
-117.251.56.158
-117.251.57.36
-117.251.58.0
-117.251.60.32
-117.251.61.166
-117.251.63.160
-117.251.63.229
-117.252.215.59
+117.251.56.182
+117.251.58.176
+117.251.59.105
+117.251.59.244
+117.251.60.11
+117.251.60.165
+117.251.63.107
+117.251.63.92
+117.252.210.148
+117.252.217.241
  117.252.222.4
  117.252.69.70
  117.252.70.164
  117.253.175.52
  117.253.232.181
  117.254.186.98
-117.254.197.13
-117.254.50.51
  117.255.220.201
-117.26.110.98
+117.26.110.24
  117.26.241.78
  117.26.242.171
-117.27.117.46
-117.27.136.42
-117.27.143.206
-117.27.150.170
-117.27.154.44
  117.27.253.235
  117.27.88.61
  117.28.12.124
  117.28.25.50
  117.28.254.143
-117.28.255.165
  117.29.245.204
  117.30.124.219
  117.30.38.71
-117.31.188.8
+117.30.84.242
+117.31.76.162
  117.32.249.174
-117.32.96.34
  117.33.128.218
  117.33.137.19
-117.33.225.111
  117.34.105.233
-117.34.118.112
-117.34.118.137
-117.34.25.155
-117.34.66.245
-117.34.76.69
+117.34.117.155
+117.34.118.44
  117.34.80.178
-117.34.91.22
  117.34.99.31
  117.35.118.42
-117.35.50.142
-117.36.152.11
-117.36.198.91
-117.39.63.34
-117.39.63.46
+117.36.24.140
  117.4.107.199
  117.4.136.11
  117.4.139.62
  117.4.145.16
  117.4.241.135
-117.4.98.133
-117.40.139.82
-117.40.198.163
-117.40.83.115
  117.40.91.118
-117.44.60.110
-117.48.192.245
+117.44.46.218
+117.44.46.220
+117.44.60.98
+117.48.234.141
  117.5.219.52
  117.5.250.2
  117.5.36.187
+117.5.58.97
  117.5.59.2
+117.50.10.113
  117.50.10.244
-117.50.100.216
-117.50.101.117
-117.50.104.206
  117.50.106.150
  117.50.11.106
-117.50.11.192
-117.50.115.156
-117.50.116.120
-117.50.116.16
-117.50.116.98
-117.50.126.4
  117.50.13.5
-117.50.137.13
  117.50.15.96
  117.50.18.243
  117.50.19.117
-117.50.2.38
  117.50.20.103
  117.50.20.123
  117.50.20.77
  117.50.21.232
  117.50.22.148
-117.50.22.197
-117.50.23.52
-117.50.25.188
-117.50.3.142
-117.50.35.29
+117.50.34.131
  117.50.36.137
  117.50.36.174
  117.50.36.250
  117.50.39.62
-117.50.40.157
  117.50.43.204
-117.50.44.5
  117.50.45.241
-117.50.5.37
-117.50.50.186
  117.50.55.132
  117.50.60.36
  117.50.63.120
-117.50.63.227
-117.50.63.253
-117.50.65.167
-117.50.77.220
  117.50.82.156
-117.50.82.6
-117.50.84.240
  117.50.9.191
  117.50.9.239
  117.50.92.209
  117.50.93.157
-117.50.93.75
-117.51.137.24
  117.51.137.82
  117.51.138.89
  117.51.142.47
@@ -19242,9 +16216,11 @@
  117.54.236.25
  117.54.238.133
  117.54.250.58
+117.55.194.138
  117.55.209.126
  117.55.232.193
  117.55.241.178
+117.55.241.61
  117.57.22.161
  117.58.240.177
  117.58.241.69
@@ -19252,15 +16228,12 @@
  117.58.245.114
  117.58.245.66
  117.58.247.20
-117.6.112.67
  117.6.128.250
  117.6.161.118
-117.6.162.47
  117.6.240.170
+117.6.254.97
  117.6.86.134
-117.6.99.108
  117.60.204.195
-117.60.212.94
  117.60.239.70
  117.60.25.22
  117.60.8.16
@@ -19278,88 +16251,79 @@
  117.63.195.220
  117.63.223.200
  117.63.248.179
+117.63.252.194
+117.63.252.44
+117.63.253.112
+117.63.254.11
+117.63.254.151
  117.63.51.128
-117.64.224.64
-117.64.225.148
-117.64.225.190
+117.64.225.28
  117.64.225.89
  117.64.234.95
-117.64.235.183
  117.64.235.65
-117.64.237.106
+117.64.236.201
  117.65.42.220
  117.66.172.46
+117.67.4.21
+117.67.4.223
  117.67.5.214
+117.67.5.42
+117.67.5.78
+117.67.72.23
+117.67.72.234
+117.67.72.73
+117.67.73.108
+117.67.73.239
  117.68.116.88
-117.68.116.91
  117.68.193.148
-117.68.194.35
-117.68.195.37
+117.68.193.229
  117.69.12.95
-117.69.159.87
  117.69.239.236
  117.69.24.218
+117.69.36.111
  117.69.50.34
-117.7.154.106
  117.7.236.110
-117.70.61.114
  117.70.61.151
-117.70.74.67
+117.70.93.4
+117.70.93.8
  117.71.107.24
  117.71.50.240
  117.71.57.195
-117.71.58.159
-117.71.59.108
-117.71.61.187
-117.73.13.212
  117.74.120.224
-117.74.136.106
  117.74.45.247
  117.74.98.18
  117.76.1.113
-117.78.27.167
-117.78.7.86
  117.79.80.90
  117.79.80.93
  117.79.80.94
-117.80.10.48
-117.80.167.239
-117.80.186.67
+117.80.164.131
  117.80.203.176
+117.80.203.37
  117.80.212.113
  117.80.224.192
-117.80.237.141
  117.80.237.246
-117.80.237.68
  117.80.3.54
-117.80.83.57
-117.80.87.37
  117.81.137.165
-117.81.151.106
+117.81.139.112
  117.81.151.176
  117.81.199.128
  117.81.230.49
  117.81.242.138
-117.81.60.28
  117.81.64.187
  117.81.74.221
-117.82.137.219
-117.82.212.67
  117.82.229.86
  117.82.37.146
+117.82.37.235
+117.82.37.38
  117.82.37.63
-117.82.37.69
  117.82.70.22
-117.82.79.153
  117.83.152.139
  117.83.152.56
  117.83.196.250
  117.83.83.109
-117.83.83.235
  117.84.146.251
  117.84.75.169
  117.85.121.167
-117.85.218.227
  117.85.89.213
  117.86.14.163
  117.86.212.189
@@ -19379,7 +16343,6 @@
  117.87.171.39
  117.87.208.98
  117.87.209.179
-117.87.220.112
  117.87.225.69
  117.87.239.145
  117.87.239.200
@@ -19394,8 +16357,8 @@
  117.88.173.4
  117.88.213.193
  117.88.213.210
-117.88.213.54
  117.89.15.159
+117.9.85.61
  117.9.96.238
  117.90.119.186
  117.90.119.63
@@ -19410,6 +16373,7 @@
  117.90.89.67
  117.90.89.95
  117.90.94.211
+117.91.164.3
  117.91.186.77
  117.93.114.188
  117.93.118.225
@@ -19419,8 +16383,6 @@
  117.93.176.207
  117.93.177.56
  117.93.216.98
-117.93.33.55
-117.93.6.51
  117.93.98.93
  117.94.174.64
  117.94.50.123
@@ -19449,84 +16411,49 @@
  1171j.projectsbit.org
  1177857-dot-n-e-w-me-ss-age-po-rt-al.wl.r.appspot.com
  117cbf81fba6f4aaa4363ed99db7fce674427f2d.info
-118.100.182.44
  118.100.73.219
  118.101.192.62
  118.101.192.81
+118.101.194.69
  118.101.233.183
-118.101.93.119
  118.102.168.199
-118.103.229.254
  118.103.229.94
-118.103.236.200
  118.107.12.23
  118.107.14.227
  118.107.14.243
  118.107.14.5
  118.107.162.36
-118.107.47.210
  118.110.105.140
  118.110.236.121
-118.112.186.58
-118.113.15.27
-118.113.163.121
-118.113.17.7
+118.113.95.60
  118.114.237.176
-118.114.237.85
-118.114.239.144
-118.116.10.93
  118.116.107.70
  118.116.108.221
  118.116.111.170
-118.116.178.9
-118.116.8.215
-118.118.234.138
+118.116.127.119
+118.116.127.143
+118.116.127.166
  118.120.145.eliterv.ca
  118.121.198.24
-118.121.244.174
  118.121.38.89
  118.121.57.64
  118.121.61.158
-118.121.62.53
-118.122.119.226
-118.122.124.78
-118.122.124.84
-118.122.124.85
-118.122.124.86
-118.122.124.87
  118.122.168.205
  118.122.38.61
-118.122.4.173
-118.122.6.219
  118.122.77.22
-118.122.86.80
-118.122.9.55
  118.122.91.148
-118.122.94.151
  118.123.11.175
-118.123.13.29
-118.123.15.235
-118.123.15.247
-118.123.167.107
-118.123.168.142
-118.123.168.143
-118.123.243.250
+118.123.19.159
+118.123.19.249
+118.123.213.74
  118.123.244.100
-118.123.245.76
  118.123.246.101
-118.123.247.7
-118.123.249.143
-118.123.249.150
-118.123.6.216
  118.123.7.217
  118.125.106.12
-118.125.244.240
  118.126.105.207
+118.126.107.106
  118.126.109.155
-118.126.113.29
-118.126.114.208
  118.126.114.94
-118.126.116.101
  118.126.117.140
  118.126.117.168
  118.126.65.74
@@ -19534,7 +16461,6 @@
  118.126.90.104
  118.126.90.89
  118.126.91.71
-118.126.93.16
  118.126.97.184
  118.126.98.159
  118.127.110.54
@@ -19550,88 +16476,61 @@
  118.129.34.166
  118.129.55.169
  118.130.153.101
-118.130.73.15
  118.131.21.125
  118.131.36.38
+118.136.203.77
  118.136.229.206
-118.137.248.30
  118.139.178.67
-118.140.104.238
  118.140.150.74
  118.140.151.98
  118.140.160.93
-118.140.187.226
  118.140.205.198
  118.140.38.6
-118.140.57.146
  118.142.26.226
-118.144.68.87
-118.144.93.67
  118.145.4.109
  118.145.8.50
-118.150.144.180
-118.150.161.157
-118.150.225.52
-118.151.209.34
  118.151.210.242
-118.159.81.206
  118.16.177.248
  118.16.181.243
  118.160.208.111
  118.160.230.91
  118.160.84.81
  118.161.159.142
+118.161.188.22
  118.161.189.175
+118.161.191.34
  118.161.91.197
-118.163.115.234
  118.163.120.179
  118.163.120.181
  118.163.122.208
  118.163.13.200
-118.163.13.244
-118.163.146.70
-118.163.167.20
-118.163.180.2
-118.163.180.3
-118.163.180.57
  118.163.199.180
  118.163.207.67
-118.163.222.45
-118.163.224.139
-118.163.45.178
  118.163.47.37
  118.163.58.117
  118.163.74.160
-118.163.89.86
+118.163.74.161
  118.163.91.125
  118.163.97.19
-118.165.224.9
-118.166.109.236
-118.167.112.199
+118.166.194.90
  118.168.124.67
  118.168.192.226
  118.168.6.210
-118.169.108.175
  118.169.40.146
  118.169.44.151
  118.169.73.205
-118.171.140.212
-118.171.23.66
  118.172.0.250
  118.172.1.71
-118.172.116.242
+118.172.124.72
  118.172.130.230
  118.172.132.57
  118.172.135.51
  118.172.141.11
-118.172.148.21
  118.172.158.138
-118.172.158.243
  118.172.176.41
  118.172.181.147
  118.172.185.85
  118.172.201.105
-118.172.201.211
  118.172.201.32
  118.172.201.49
  118.172.201.5
@@ -19640,38 +16539,32 @@
  118.172.212.119
  118.172.227.89
  118.172.228.108
-118.172.228.67
-118.172.237.77
+118.172.253.64
  118.172.37.210
  118.172.47.97
  118.172.51.84
-118.172.54.66
  118.172.60.204
  118.172.61.183
  118.172.8.36
  118.172.97.120
-118.173.116.82
-118.173.117.102
  118.173.128.131
  118.173.145.3
  118.173.162.44
-118.173.163.173
  118.173.163.181
-118.173.164.235
-118.173.167.226
+118.173.168.201
  118.173.17.162
  118.173.17.208
  118.173.173.127
+118.173.177.129
  118.173.181.146
+118.173.182.204
  118.173.182.230
  118.173.197.241
  118.173.212.147
  118.173.214.125
+118.173.216.59
  118.173.220.29
-118.173.221.42
-118.173.223.32
  118.173.225.65
-118.173.230.15
  118.173.232.160
  118.173.232.170
  118.173.232.215
@@ -19684,10 +16577,10 @@
  118.173.233.37
  118.173.233.39
  118.173.233.80
+118.173.5.183
  118.173.73.4
-118.173.75.106
  118.174.0.244
-118.174.12.126
+118.174.178.86
  118.174.183.120
  118.174.196.112
  118.174.196.130
@@ -19697,6 +16590,7 @@
  118.174.209.116
  118.174.209.65
  118.174.211.220
+118.174.219.170
  118.174.219.194
  118.174.219.210
  118.174.219.246
@@ -19726,23 +16620,20 @@
  118.174.65.137
  118.174.65.140
  118.174.65.251
-118.174.79.50
  118.174.81.148
  118.174.89.139
+118.174.90.169
  118.175.183.190
  118.175.207.180
  118.175.207.205
  118.175.207.84
  118.175.228.167
-118.175.229.94
  118.175.235.110
  118.175.235.247
-118.175.235.38
  118.175.235.85
  118.175.236.208
  118.175.240.205
  118.175.244.111
-118.175.46.191
  118.175.7.114
  118.175.93.103
  118.175.93.112
@@ -19762,20 +16653,16 @@
  118.179.168.202
  118.179.173.253
  118.179.200.131
-118.179.201.114
  118.179.208.162
  118.179.55.190
  118.179.96.158
-118.182.21.102
-118.182.21.13
-118.182.65.82
+118.180.63.84
  118.182.79.251
+118.182.79.83
  118.183.121.79
  118.184.104.230
  118.184.13.225
  118.184.13.228
-118.184.168.111
-118.184.168.4
  118.184.33.170
  118.184.39.132
  118.184.39.140
@@ -19788,30 +16675,13 @@
  118.185.208.3
  118.185.38.173
  118.186.2.18
-118.186.203.146
-118.186.203.147
-118.186.203.148
-118.186.203.149
-118.186.203.153
-118.186.203.154
-118.186.203.156
-118.186.203.157
-118.186.203.34
-118.186.211.20
  118.186.227.161
-118.186.244.134
-118.186.3.75
-118.187.65.147
  118.188.20.229
  118.188.20.5
  118.189.139.212
  118.189.187.219
-118.189.22.67
-118.189.42.121
  118.189.74.228
  118.19.126.68
-118.190.90.36
-118.193.140.131
  118.193.151.250
  118.193.151.253
  118.193.151.51
@@ -19822,14 +16692,9 @@
  118.193.168.32
  118.193.170.21
  118.193.170.22
-118.193.21.186
  118.193.238.164
  118.193.241.118
  118.193.245.4
-118.193.28.58
-118.193.31.179
-118.193.31.181
-118.193.31.182
  118.193.32.219
  118.193.33.186
  118.193.34.198
@@ -19840,68 +16705,35 @@
  118.193.45.28
  118.193.47.131
  118.200.149.106
-118.200.212.191
  118.200.237.7
-118.200.37.9
+118.200.41.3
  118.200.63.97
-118.200.78.74
-118.200.79.74
  118.201.212.230
  118.201.226.233
-118.201.247.28
  118.201.65.165
  118.202.255.141
-118.21.43.84
+118.208.135.77
+118.208.178.102
  118.210.106.104
  118.210.128.220
-118.211.61.208
  118.212.113.187
  118.212.114.209
-118.212.115.80
  118.212.117.61
-118.212.143.46
  118.212.37.33
  118.213.176.234
-118.213.225.102
-118.216.209.85
  118.217.181.116
  118.217.183.234
  118.217.216.132
-118.217.27.248
  118.219.254.105
-118.219.29.175
  118.220.255.156
  118.221.200.196
-118.223.101.208
  118.223.32.74
  118.223.5.149bin.sh
  118.223.72.141
-118.232.117.137
-118.232.125.120
-118.232.127.101
-118.232.14.129
-118.232.160.215
-118.232.195.18
-118.232.195.28
-118.232.209.228
-118.232.214.125
-118.232.214.145
-118.232.246.87
-118.232.247.5
-118.232.56.77
  118.232.96.6
-118.232.97.232
  118.232.99.124
-118.233.164.32
-118.233.192.121
-118.233.29.163
-118.233.40.125
-118.233.61.112
  118.233.63.194
  118.233.63.194bin.sh
-118.233.63.9
-118.233.65.76
-118.233.92.135
  118.238.236.25
  118.238.251.42
  118.239.20.14
@@ -19919,7 +16751,6 @@
  118.24.107.179
  118.24.108.239
  118.24.108.3
-118.24.108.75
  118.24.109.221
  118.24.109.222
  118.24.109.70
@@ -19930,12 +16761,11 @@
  118.24.117.134
  118.24.118.97
  118.24.119.36
+118.24.119.45
  118.24.119.49
-118.24.12.102
  118.24.120.26
  118.24.121.168
  118.24.121.227
-118.24.121.69
  118.24.122.226
  118.24.122.242
  118.24.122.246
@@ -19947,25 +16777,21 @@
  118.24.129.68
  118.24.13.153
  118.24.134.15
+118.24.136.188
  118.24.14.106
-118.24.14.64
  118.24.140.195
  118.24.142.170
  118.24.146.186
  118.24.146.66
-118.24.149.173
  118.24.149.248
  118.24.150.138
-118.24.150.71
+118.24.150.145
  118.24.151.254
-118.24.153.198
-118.24.153.214
  118.24.154.33
  118.24.156.184
  118.24.156.209
  118.24.158.103
  118.24.158.42
-118.24.160.242
  118.24.17.28
  118.24.175.151
  118.24.181.184
@@ -19977,10 +16803,9 @@
  118.24.211.170
  118.24.212.114
  118.24.214.45
-118.24.217.162
  118.24.219.30
  118.24.219.84
-118.24.22.5
+118.24.23.164
  118.24.231.93
  118.24.233.84
  118.24.234.79
@@ -19988,7 +16813,6 @@
  118.24.237.118
  118.24.238.132
  118.24.241.217
-118.24.241.97
  118.24.243.39
  118.24.243.53
  118.24.245.56
@@ -20000,10 +16824,9 @@
  118.24.28.68
  118.24.30.97
  118.24.35.31
-118.24.35.5
  118.24.36.247
  118.24.48.15
-118.24.49.241
+118.24.49.139
  118.24.5.125
  118.24.51.76
  118.24.53.35
@@ -20023,28 +16846,26 @@
  118.24.83.41
  118.24.84.55
  118.24.89.224
+118.24.9.239
  118.24.90.64
  118.24.92.39
  118.241.9.15
  118.243.22.87
  118.244.128.0
  118.244.128.17
-118.244.128.20
  118.244.128.29
  118.244.206.195
-118.249.80.41
  118.25.1.48
  118.25.103.178
  118.25.104.200
  118.25.108.201
  118.25.11.153
  118.25.11.8
+118.25.114.195
  118.25.114.245
  118.25.123.42
-118.25.125.17
  118.25.125.187
  118.25.128.221
-118.25.129.131
  118.25.131.80
  118.25.133.121
  118.25.133.220
@@ -20055,13 +16876,10 @@
  118.25.146.128
  118.25.150.183
  118.25.154.146
-118.25.154.210
  118.25.159.106
  118.25.176.15
  118.25.177.117
-118.25.18.97
  118.25.182.118
-118.25.182.61
  118.25.184.174
  118.25.191.102
  118.25.191.88
@@ -20073,7 +16891,7 @@
  118.25.196.31
  118.25.2.60
  118.25.21.173
-118.25.210.143
+118.25.211.189
  118.25.216.77
  118.25.22.185
  118.25.221.16
@@ -20089,14 +16907,12 @@
  118.25.35.202
  118.25.39.110
  118.25.40.183
-118.25.43.101
  118.25.44.66
  118.25.46.60
  118.25.49.119
  118.25.5.184
  118.25.53.252
  118.25.53.96
-118.25.55.155
  118.25.57.174
  118.25.57.184
  118.25.59.57
@@ -20104,8 +16920,8 @@
  118.25.64.152
  118.25.66.61
  118.25.69.157
-118.25.69.61
  118.25.7.83
+118.25.70.54
  118.25.74.248
  118.25.84.146
  118.25.88.204
@@ -20115,7 +16931,7 @@
  118.250.0.166
  118.250.49.91
  118.255.57.210
-118.26.168.179
+118.26.168.39
  118.26.65.146
  118.27.1.112
  118.27.1.124
@@ -20176,71 +16992,45 @@
  118.27.80.234
  118.27.9.23
  118.31.164.48
-118.31.187.234
  118.31.33.126
  118.31.52.208
-118.31.78.74
-118.32.142.136
-118.32.170.122
+118.32.187.73
  118.32.210.177
  118.32.210.177bin.sh
  118.33.129.88
  118.33.221.70
  118.33.238.201
-118.33.87.170
  118.34.12.117
-118.34.27.146
  118.34.86.75
-118.35.184.185
-118.36.193.82
  118.36.66.178
  118.36.66.178bin.sh
  118.38.183.12
  118.38.183.87
-118.38.20.126
-118.38.252.136
  118.38.3.75
  118.39.135.11
  118.39.165.115
-118.39.21.39
-118.39.219.78
-118.39.91.14
  118.40.139.200
-118.40.189.26
-118.40.189.36
  118.40.214.181
  118.40.248.20
-118.40.53.127
  118.40.56.149
-118.40.95.236
-118.41.162.161
-118.41.23.106
+118.41.170.115
  118.42.125.246
  118.42.233.90
  118.42.69.158
  118.42.74.177
  118.42.74.237
-118.43.100.125
  118.43.114.17
-118.43.144.196
-118.45.13.114
-118.45.182.174
  118.45.190.163
  118.45.190.167
  118.45.35.46
-118.46.90.128
  118.53.254.235
  118.67.201.40
  118.67.216.94
  118.67.217.41
  118.67.220.102
-118.67.244.21
-118.67.248.16
+118.67.248.98
  118.67.249.115
-118.67.249.209
-118.67.249.23
-118.68.229.104
-118.68.239.56
+118.68.78.125
  118.69.119.82
  118.69.161.67
  118.69.173.199
@@ -20250,10 +17040,9 @@
  118.69.219.185
  118.69.226.194
  118.69.228.63
-118.69.34.216
+118.69.34.146
  118.69.34.46
  118.69.35.0
-118.69.35.93
  118.69.50.154
  118.69.56.68
  118.69.61.212
@@ -20261,79 +17050,65 @@
  118.69.77.91
  118.69.82.233
  118.70.12.171
-118.70.133.226
  118.70.148.117
-118.70.165.84
  118.70.170.120
  118.70.175.209
  118.70.180.174
  118.70.180.189
-118.70.187.108
  118.70.196.124
-118.70.209.5
-118.70.21.50
  118.70.213.14
  118.70.220.116
  118.70.233.117
  118.70.233.163
  118.70.233.206
  118.70.33.125
-118.70.67.38
  118.70.72.103
-118.70.80.213
  118.70.81.207
-118.71.124.194
  118.71.137.185
  118.71.234.198
  118.71.253.20
  118.71.84.115
  118.75.119.214
-118.75.123.147
  118.75.152.221
-118.75.170.93
-118.75.171.55
  118.75.184.240
  118.75.190.221
  118.75.202.227
  118.75.218.74
-118.75.253.72
  118.75.44.143
  118.75.46.196
  118.75.48.151
  118.75.50.82
  118.75.65.168
  118.76.143.108
-118.76.192.235
  118.76.252.59
+118.77.190.71
+118.79.1.236
  118.79.145.69
  118.79.146.100
  118.79.146.190
  118.79.146.212
  118.79.162.114
-118.79.167.41
  118.79.178.29
+118.79.189.190
  118.79.198.108
  118.79.199.54
  118.79.200.81
  118.79.218.67
  118.79.226.198
-118.79.229.115
  118.79.237.9
  118.79.238.200
-118.79.25.38
  118.79.4.250
  118.79.58.128
  118.79.60.121
  118.79.60.183
-118.79.61.129
  118.79.74.237
+118.79.74.7
  118.79.75.183
-118.79.99.251
  118.80.139.187
-118.81.214.248
  118.83.154.64
  118.83.180.76
  118.83.85.71
+118.86.79.172
  118.89.106.11
  118.89.108.152
  118.89.108.37
@@ -20350,10 +17125,7 @@
  118.89.162.187
  118.89.163.105
  118.89.167.20
-118.89.170.192
  118.89.171.146
-118.89.173.215
-118.89.177.212
  118.89.186.200
  118.89.19.73
  118.89.228.58
@@ -20361,11 +17133,9 @@
  118.89.230.159
  118.89.230.32
  118.89.231.121
-118.89.235.114
  118.89.235.169
  118.89.235.84
  118.89.237.61
-118.89.238.63
  118.89.240.128
  118.89.241.126
  118.89.241.214
@@ -20374,15 +17144,14 @@
  118.89.247.113
  118.89.248.224
  118.89.248.40
-118.89.27.72
  118.89.29.49
  118.89.30.90
  118.89.46.81
  118.89.47.205
  118.89.48.148
-118.89.52.171
  118.89.61.51
  118.89.63.234
+118.89.65.15
  118.89.66.102
  118.89.69.159
  118.89.91.134
@@ -20390,19 +17159,15 @@
  118.91.171.97
  118.91.175.210
  118.91.178.228
-118.91.178.68
+118.91.184.205
  118.91.228.30
-118.91.234.47
-118.91.28.52
  118.92.41.104
  118.93.123.108
  118.93.227.236
  118.93.251.45
-118.96.225.133
  118.97.107.65
  118.97.108.18
  118.97.119.130
-118.97.13.146
  118.97.16.106
  118.97.16.109
  118.97.164.19
@@ -20413,7 +17178,6 @@
  118.97.203.101
  118.97.204.93
  118.97.221.211
-118.97.221.251
  118.97.224.2
  118.97.23.26
  118.97.235.234
@@ -20434,23 +17198,26 @@
  118.98.127.138
  118.98.218.11
  118.98.233.226
+118.98.90.22
  118.98.96.184
  118.99.100.109
+118.99.100.72
+118.99.100.90
  118.99.102.110
  118.99.102.5
  118.99.102.76
  118.99.103.0
  118.99.103.185
  118.99.104.135
-118.99.104.15
  118.99.104.151
  118.99.108.170
-118.99.108.178
+118.99.108.181
  118.99.108.182
  118.99.108.185
  118.99.108.186
  118.99.113.107
  118.99.114.209
+118.99.114.245
  118.99.114.61
  118.99.115.134
  118.99.115.209
@@ -20460,14 +17227,15 @@
  118.99.122.166
  118.99.122.28
  118.99.122.36
-118.99.122.64
-118.99.187.57
-118.99.188.171
+118.99.13.148
+118.99.153.83
  118.99.28.130
  118.99.65.169
  118.99.65.176
+118.99.67.86
  118.99.79.16
  118.99.86.134
+118.99.86.47
  118.99.88.107
  118.99.90.130
  118.99.95.90
@@ -20477,8 +17245,6 @@
  118921-dot-n-e-w-me-ss-age-po-rt-al.wl.r.appspot.com
  118fk.net
  119-18-62-120.cprapid.com
-119.1.105.246
-119.1.209.98
  119.1.210.139
  119.10.114.137
  119.10.116.177
@@ -20490,141 +17256,88 @@
  119.10.180.55
  119.10.180.56
  119.102.153.184
-119.102.80.190
-119.108.231.227
+119.108.234.240
  119.109.18.200
-119.109.94.121
  119.11.240.78
  119.110.204.62
  119.110.205.66
  119.110.96.195
-119.112.247.0
-119.114.108.216
-119.114.29.21
  119.114.33.172
  119.114.46.254
  119.115.128.2
-119.115.35.122
-119.115.51.70
-119.116.249.67
-119.116.54.18
-119.117.14.233
+119.115.156.16
  119.118.172.168
  119.118.218.36
-119.118.243.238
-119.118.247.198
-119.118.91.37
-119.119.248.91
-119.122.114.201
-119.122.213.94
-119.122.214.79
-119.123.125.228
+119.118.93.82
+119.119.135.30
+119.122.215.224
+119.123.126.205
+119.123.172.171
+119.123.174.147
  119.123.175.56
-119.123.176.208
  119.123.176.98
  119.123.177.49
+119.123.178.1
  119.123.179.183
-119.123.217.210
-119.123.218.45
-119.123.219.51
-119.123.221.217
-119.123.223.148
+119.123.216.206
+119.123.219.69
+119.123.222.58
+119.123.224.15
  119.123.225.124
-119.123.225.208
  119.123.225.212
  119.123.225.24
-119.123.236.31
-119.123.242.102
  119.123.244.77
-119.123.28.140
-119.123.3.157
+119.123.28.117
  119.123.73.19
  119.123.77.25
-119.124.0.80
  119.125.129.86
  119.125.130.70
  119.126.143.0
-119.127.11.52
  119.130.155.171
+119.130.161.122
  119.130.161.165
  119.130.231.180
  119.130.231.182
-119.131.244.13
  119.135.0.140
  119.135.84.74
-119.136.115.193
  119.136.18.142
  119.136.90.199
  119.136.91.195
-119.136.91.31
-119.139.199.4
-119.139.199.84
+119.139.32.49
  119.14.143.145
-119.141.25.204
-119.145.101.190
-119.145.147.23
-119.145.29.160
-119.145.70.196
+119.140.120.201
  119.146.131.247
-119.146.131.89
-119.146.189.84
  119.147.137.79
-119.147.144.22
-119.147.144.35
-119.147.209.169
  119.147.210.236
-119.147.211.178
-119.147.212.2
-119.147.37.232
-119.147.44.59
  119.147.71.174
-119.148.160.109
-119.148.162.86
  119.148.36.141
-119.148.8.34
  119.149.136.46
-119.15.136.244
-119.15.136.245
-119.15.80.203
  119.15.89.106
+119.15.93.38
  119.15.95.158
-119.15.95.6
-119.152.138.18
-119.152.235.38
-119.152.246.150
-119.155.42.183
+119.155.138.229
+119.155.138.230
  119.156.28.130
  119.157.0.144
  119.159.150.176
-119.159.229.245
+119.160.131.219
  119.160.172.201
-119.160.219.5
  119.161.137.20
-119.161.98.132
-119.161.98.139
-119.161.98.141
  119.162.65.162
-119.163.172.198
  119.163.196.146
  119.163.228.106
  119.163.89.89
  119.163.94.12
  119.164.161.2
-119.164.170.179
  119.164.172.144
-119.164.254.136
  119.164.64.189
  119.164.89.226
  119.165.107.65
-119.165.11.32
-119.165.119.254
  119.165.165.210
-119.165.187.241
  119.165.191.220
  119.165.201.170
  119.165.226.221
  119.165.234.33
-119.165.238.22
  119.165.238.248
  119.165.24.5
  119.165.3.61
@@ -20636,41 +17349,33 @@
  119.166.154.237
  119.166.169.115
  119.166.173.173
+119.166.177.109
  119.166.196.21
  119.166.226.110
-119.166.230.87
  119.166.245.102
  119.166.247.214bin.sh
  119.166.39.54
-119.166.43.234
+119.166.68.186
  119.166.79.167
  119.166.89.127
-119.167.111.58
  119.167.18.7
-119.167.182.251
  119.167.2.49
  119.167.21.135
  119.167.31.210
  119.167.41.123
  119.167.44.96
  119.167.60.114
-119.167.67.70
  119.17.151.61
  119.17.221.61
-119.175.155.220
  119.176.202.206
  119.176.73.133
  119.176.95.121
  119.177.216.203
-119.177.218.229
-119.177.240.117
  119.177.240.202
+119.177.77.83
  119.178.131.223
  119.178.178.79
  119.178.246.244
-119.178.251.186
-119.178.42.217
-119.179.106.33
  119.179.119.79
  119.179.150.233
  119.179.153.191
@@ -20678,10 +17383,6 @@
  119.179.165.18
  119.179.18.206
  119.179.19.159
-119.179.19.176
-119.179.197.33
-119.179.27.83
-119.179.84.168
  119.179.87.247
  119.18.147.125
  119.18.147.81
@@ -20689,7 +17390,6 @@
  119.18.149.24
  119.18.149.38
  119.18.149.58
-119.18.151.132
  119.18.152.138
  119.18.152.140
  119.18.153.154
@@ -20708,93 +17408,72 @@
  119.18.159.34
  119.18.159.6
  119.18.194.168
-119.18.2.221
  119.18.34.97
-119.18.38.144
  119.18.38.176
  119.18.52.177
  119.180.108.79
  119.180.112.41
-119.180.13.187
  119.180.130.226
  119.180.134.107
  119.180.18.198
  119.180.195.200
  119.180.204.103
-119.180.220.220
-119.180.25.38
  119.180.32.217
  119.180.33.34
-119.180.35.211
  119.180.54.193
-119.180.63.138
-119.180.9.117
-119.180.96.143
  119.181.54.70
-119.182.24.49
  119.182.60.251
  119.182.67.204
-119.182.83.27
+119.183.117.139
  119.183.123.28
  119.183.14.177
  119.183.18.102
+119.183.182.22
  119.183.46.127
  119.183.47.246
  119.183.47.246bin.sh
  119.183.54.121
  119.183.67.38
-119.183.69.173
  119.184.48.147bin.sh
  119.184.53.56
-119.185.104.237
  119.185.149.74
  119.185.153.86
  119.185.155.1
  119.186.15.123
-119.186.22.244
-119.186.235.156
-119.186.41.245
  119.187.109.170
-119.187.110.17
-119.187.120.38
  119.187.129.48
-119.187.149.238
  119.187.17.176
  119.187.213.181
-119.187.234.106
+119.187.234.114
  119.187.235.23
+119.187.237.239
  119.187.239.228
  119.187.29.196
+119.187.42.199
  119.187.58.145
  119.187.77.195
  119.187.88.165
  119.187.88.218
  119.187.99.58
  119.188.116.69
-119.188.248.210
  119.189.129.35
-119.189.137.252
  119.189.181.172
  119.189.201.50bin.sh
-119.189.201.88
  119.189.207.105
  119.190.125.199
  119.190.144.131
-119.190.164.100
+119.190.154.100
  119.190.180.197
  119.190.203.178
  119.190.208.210
-119.190.215.200
  119.190.216.70
-119.190.221.99
  119.190.240.25
  119.190.247.205
  119.190.247.226
-119.190.27.19
+119.190.249.107
  119.190.64.150
  119.191.101.189
  119.191.138.151
-119.191.141.113
  119.191.177.243
  119.191.178.42
  119.191.182.131
@@ -20809,89 +17488,62 @@
  119.192.254.1
  119.193.113.86
  119.193.148.213
-119.193.238.60
  119.193.33.143
  119.193.33.206
-119.193.58.95
  119.194.214.43
  119.194.240.249
  119.194.240.249bin.sh
  119.194.61.38
-119.195.180.227
  119.195.181.125
-119.195.181.35
-119.195.181.49
  119.195.239.91
  119.195.7.123
  119.195.9.174
  119.195.9.174bin.sh
-119.196.112.10
  119.196.115.20
  119.196.148.40
  119.196.216.112
  119.196.216.112bin.sh
-119.196.222.53
-119.196.92.193
  119.196.99.80bin.sh
-119.197.133.120
  119.197.143.204
  119.197.175.60
  119.197.176.241
-119.197.219.237
-119.197.37.37
-119.197.67.165
  119.197.84.133
  119.198.226.91
-119.198.236.28
-119.198.244.159
  119.198.87.162
  119.199.137.64
+119.199.155.16
  119.199.155.17bin.sh
  119.199.156.76
  119.199.182.207
-119.199.188.236
+119.2.122.12
  119.2.51.150
-119.2.53.222
  119.2.54.204
  119.2.65.121
-119.2.7.34
  119.2.7.98
  119.2.88.37
  119.2.9.129
-119.200.113.45
  119.200.186.168
-119.200.73.123
-119.200.73.32
-119.200.92.82
-119.201.196.37
  119.201.252.238
  119.201.68.12
-119.202.138.166
+119.202.16.215
  119.202.160.81
  119.202.219.88
  119.202.76.160
  119.203.43.45
  119.203.6.115
-119.203.68.69
+119.204.110.102
  119.204.96.131
-119.205.1.58
-119.205.4.199
  119.205.95.101
-119.206.190.198
-119.206.51.189
+119.206.255.171
  119.206.62.129
  119.206.62.129bin.sh
  119.207.126.21
-119.207.227.167
  119.207.76.245
  119.224.102.107
-119.224.65.26
  119.226.226.116
-119.226.30.54
  119.228.75.211
  119.23.104.38
  119.23.128.199
-119.23.141.228
  119.23.21.39
  119.23.238.165
  119.23.31.104
@@ -20908,57 +17560,25 @@
  119.235.50.8
  119.235.51.241
  119.235.54.45
-119.236.104.145
  119.236.142.67
-119.236.15.53
-119.236.163.213
-119.236.199.223
-119.236.54.160
-119.236.70.53
-119.236.91.153
-119.237.113.97
-119.237.161.190
-119.237.192.171
  119.237.6.208
  119.237.68.175
-119.237.75.119
-119.237.90.7
-119.241.28.28
  119.245.138.143
-119.245.91.241
  119.246.154.102
  119.246.156.63
  119.246.39.250
-119.246.4.178
-119.246.88.21
-119.246.95.207
-119.247.152.226
-119.247.35.8
-119.247.53.247
-119.248.201.103
  119.249.16.203
-119.249.236.105
-119.25.91.239
  119.250.219.121
  119.251.105.65
  119.251.106.204
-119.251.143.51
-119.251.155.194
-119.251.155.212
  119.252.143.6
  119.252.160.165
  119.252.169.173
  119.252.170.2
-119.252.174.201
  119.254.12.66
  119.254.145.18
  119.254.155.187
-119.254.36.2
-119.254.65.12
  119.254.84.87
-119.254.85.220
-119.27.160.25
-119.27.162.224
  119.27.163.185
  119.27.165.49
  119.27.166.126
@@ -20971,35 +17591,24 @@
  119.27.189.46
  119.27.189.65
  119.27.191.172
-119.27.191.202
  119.28.1.253
-119.28.100.67
  119.28.102.147
-119.28.102.86
  119.28.104.69
  119.28.106.162
  119.28.108.96
  119.28.112.213
  119.28.112.246
  119.28.113.242
-119.28.115.13
-119.28.115.130
  119.28.116.248
  119.28.128.211
  119.28.13.154
  119.28.132.211
-119.28.135.75
+119.28.133.37
  119.28.140.134
-119.28.149.239
  119.28.151.166
-119.28.152.128
-119.28.152.247
  119.28.155.202
-119.28.157.230
  119.28.159.34
  119.28.160.192
-119.28.160.239
-119.28.163.155
  119.28.164.144
  119.28.164.149
  119.28.164.31
@@ -21011,34 +17620,30 @@
  119.28.19.167
  119.28.19.237
  119.28.194.66
-119.28.2.174
  119.28.2.199
-119.28.20.131
  119.28.20.208
  119.28.215.129
  119.28.221.132
  119.28.223.229
  119.28.224.121
  119.28.225.211
-119.28.232.240
-119.28.233.140
-119.28.234.30
  119.28.238.101
  119.28.238.229
-119.28.239.205
-119.28.239.222
-119.28.239.239
-119.28.239.36
  119.28.26.57
+119.28.27.201
+119.28.27.53
+119.28.30.17
  119.28.32.60
  119.28.4.12
  119.28.4.87
+119.28.41.136
+119.28.41.222
+119.28.41.54
  119.28.44.92
  119.28.51.99
  119.28.54.131
  119.28.55.239
  119.28.55.81
-119.28.57.226
  119.28.6.128
  119.28.61.162
  119.28.61.72
@@ -21047,11 +17652,9 @@
  119.28.67.221
  119.28.7.27
  119.28.73.193
-119.28.74.39
  119.28.74.68
  119.28.75.193
  119.28.83.164
-119.28.83.66
  119.28.88.198
  119.28.89.228
  119.28.9.138
@@ -21066,7 +17669,6 @@
  119.29.102.152
  119.29.102.4
  119.29.105.6
-119.29.108.252
  119.29.113.233
  119.29.115.153
  119.29.116.2
@@ -21074,10 +17676,8 @@
  119.29.121.229
  119.29.128.126
  119.29.13.97
-119.29.130.24
  119.29.131.163
  119.29.131.41
-119.29.135.29
  119.29.136.114
  119.29.138.191
  119.29.14.219
@@ -21087,20 +17687,15 @@
  119.29.143.78
  119.29.144.4
  119.29.146.13
-119.29.149.214
  119.29.150.218
  119.29.151.107
-119.29.152.81
-119.29.155.106
  119.29.159.20
  119.29.159.227
  119.29.16.190
  119.29.161.236
  119.29.163.13
-119.29.166.249
  119.29.167.254
  119.29.168.187
-119.29.169.67
  119.29.170.235
  119.29.171.249
  119.29.172.85
@@ -21128,8 +17723,9 @@
  119.29.23.193
  119.29.231.121
  119.29.234.23
-119.29.235.60
  119.29.237.201
+119.29.242.162
+119.29.242.180
  119.29.245.130
  119.29.246.210
  119.29.247.187
@@ -21137,18 +17733,18 @@
  119.29.3.45
  119.29.33.131
  119.29.34.123
-119.29.34.71
  119.29.35.116
  119.29.37.47
+119.29.5.68
  119.29.53.107
  119.29.53.168
  119.29.54.159
  119.29.56.139
-119.29.60.52
  119.29.62.131
  119.29.62.253
  119.29.69.117
  119.29.70.143
+119.29.73.204
  119.29.73.218
  119.29.73.73
  119.29.74.28
@@ -21159,47 +17755,37 @@
  119.29.86.132
  119.29.87.51
  119.29.9.19
-119.29.90.144
  119.29.91.153
  119.29.91.228
  119.29.91.252
  119.29.91.38
-119.29.94.69
  119.29.95.80
  119.29.98.53
  119.3.208.236
-119.3.214.64
-119.3.226.246
  119.36.133.142
-119.36.217.92
  119.36.24.200
  119.36.24.32
-119.36.29.9
-119.39.191.135
  119.39.54.10
-119.39.94.183
-119.4.208.188
  119.4.225.31
  119.4.229.224
+119.4.229.35
  119.40.37.126
-119.40.55.96
-119.40.55.97
-119.40.55.98
-119.40.55.99
  119.40.82.185
  119.40.82.210
  119.40.83.242
  119.40.83.250
  119.40.92.17
+119.40.93.34
  119.41.197.19
-119.41.202.23
+119.41.203.14
  119.41.236.180
+119.42.100.189
  119.42.100.52
  119.42.105.204
  119.42.106.25
-119.42.109.236
  119.42.115.210
  119.42.121.231
+119.42.121.239
  119.42.121.37
  119.42.121.58
  119.42.121.65
@@ -21213,8 +17799,9 @@
  119.42.122.225
  119.42.122.237
  119.42.122.47
-119.42.122.69
+119.42.122.6
  119.42.123.100
+119.42.123.125
  119.42.123.182
  119.42.123.209
  119.42.123.242
@@ -21229,29 +17816,28 @@
  119.42.168.14
  119.42.168.26
  119.42.168.46
+119.42.169.18
  119.42.170.27
  119.42.176.46
  119.42.178.6
  119.42.67.118
  119.42.67.121
-119.42.67.124
  119.42.67.138
  119.42.67.144
-119.42.67.161
+119.42.67.146
  119.42.67.214
-119.42.67.226
  119.42.67.228
+119.42.70.85
  119.42.72.237
  119.42.80.144
  119.42.80.178
  119.42.80.190
  119.42.80.236
  119.42.80.251
-119.42.86.81
  119.42.90.78
  119.42.92.138
+119.42.92.194
  119.42.95.106
-119.42.95.92
  119.42.97.195
  119.42.97.226
  119.45.10.225
@@ -21276,9 +17862,7 @@
  119.45.137.52
  119.45.138.133
  119.45.138.160
-119.45.138.92
  119.45.139.59
-119.45.140.59
  119.45.141.115
  119.45.142.15
  119.45.142.38
@@ -21288,11 +17872,9 @@
  119.45.148.115
  119.45.148.171
  119.45.149.173
-119.45.149.82
  119.45.151.125
  119.45.151.50
  119.45.154.156
-119.45.155.151
  119.45.159.142
  119.45.159.220
  119.45.160.126
@@ -21300,13 +17882,13 @@
  119.45.163.65
  119.45.165.211
  119.45.165.219
+119.45.168.153
  119.45.171.183
  119.45.173.117
  119.45.176.109
  119.45.176.133
  119.45.176.17
  119.45.177.202
-119.45.178.44
  119.45.18.205
  119.45.181.168
  119.45.183.182
@@ -21331,12 +17913,11 @@
  119.45.194.246
  119.45.194.63
  119.45.195.57
-119.45.198.117
  119.45.199.200
  119.45.199.253
  119.45.201.244
-119.45.201.6
  119.45.202.43
+119.45.202.79
  119.45.203.143
  119.45.203.170
  119.45.205.97
@@ -21357,7 +17938,6 @@
  119.45.214.43
  119.45.215.155
  119.45.215.195
-119.45.216.2
  119.45.218.253
  119.45.219.203
  119.45.22.71
@@ -21367,18 +17947,15 @@
  119.45.222.252
  119.45.223.241
  119.45.223.42
-119.45.225.144
  119.45.229.79
  119.45.231.207
-119.45.231.51
  119.45.231.71
  119.45.235.14
+119.45.236.83
  119.45.238.130
  119.45.239.102
  119.45.239.75
-119.45.240.155
  119.45.242.149
-119.45.243.118
  119.45.243.232
  119.45.243.54
  119.45.246.214
@@ -21386,7 +17963,6 @@
  119.45.250.197
  119.45.250.223
  119.45.252.106
-119.45.252.21
  119.45.252.94
  119.45.254.116
  119.45.254.159
@@ -21399,12 +17975,9 @@
  119.45.33.80
  119.45.34.52
  119.45.36.123
-119.45.36.139
  119.45.36.221
  119.45.39.188
-119.45.39.207
  119.45.4.37
-119.45.41.248
  119.45.42.241
  119.45.43.2
  119.45.45.185
@@ -21421,21 +17994,18 @@
  119.45.5.55
  119.45.50.126
  119.45.51.206
+119.45.51.32
  119.45.52.133
  119.45.52.138
-119.45.52.153
  119.45.52.194
  119.45.52.62
  119.45.54.166
-119.45.55.249
  119.45.57.14
-119.45.57.178
  119.45.57.49
  119.45.57.90
  119.45.58.111
  119.45.6.81
  119.45.6.9
-119.45.60.140
  119.45.60.204
  119.45.60.62
  119.45.61.53
@@ -21450,63 +18020,38 @@
  119.46.2.250
  119.46.2.251
  119.46.2.253
-119.47.92.20
-119.48.36.28
  119.5.1.72
  119.5.157.124
  119.5.36.234
-119.50.154.160
  119.50.17.236
-119.50.178.209
  119.50.22.222
-119.50.220.84
-119.50.64.67
-119.51.9.237
+119.50.27.228
+119.50.41.211
  119.53.130.138
  119.53.130.182
-119.53.149.66
-119.53.160.230
-119.53.26.51
-119.55.217.32
-119.55.60.194
  119.56.130.60
  119.56.131.155
-119.56.138.33
  119.56.143.46
  119.56.143.51
-119.56.143.71
-119.56.144.75
  119.56.144.8
  119.56.144.98
-119.56.148.101
  119.56.148.115
  119.56.151.120
-119.56.151.86
  119.56.153.16
  119.56.155.57
-119.56.165.33
-119.56.189.19
  119.56.194.105
  119.56.195.122
-119.56.195.81
-119.56.196.144
  119.56.196.92
  119.56.199.35
  119.56.206.171
-119.56.206.43
-119.56.220.241
+119.56.212.130
+119.56.212.155
  119.56.238.145
  119.56.251.123
-119.57.116.152
-119.57.116.174
  119.57.117.248
-119.57.142.10
-119.57.160.59
  119.57.162.18
  119.57.17.20
  119.57.247.86
-119.57.44.114
-119.57.93.23
  119.59.104.25
  119.59.116.21
  119.59.124.163
@@ -21514,50 +18059,34 @@
  119.6.253.56
  119.6.54.5
  119.6.85.112
-119.60.2.249
  119.60.25.234
  119.60.255.62
-119.60.27.162
  119.60.28.118
  119.60.29.46
-119.61.17.85
  119.61.19.84
  119.61.19.87
  119.62.142.225
-119.62.190.40
  119.63.129.222
  119.63.130.53
  119.63.130.62
-119.63.135.116
-119.63.250.31
  119.63.84.130
-119.64.199.203
  119.68.194.119
-119.69.131.73
  119.69.199.43
  119.69.240.250
  119.7.237.43
  119.7.32.126
  119.73.179.114
-119.74.131.198
+119.74.144.45
  119.74.212.81
-119.74.226.149
-119.74.253.76
-119.74.66.157
-119.75.127.99
-119.75.32.18
  119.76.140.113
  119.76.177.214
  119.76.190.126
-119.76.50.168
  119.77.100.101
  119.8.1.173
  119.8.190.130
  119.8.232.221
  119.8.47.225
  119.8.85.186
-119.80.182.30
-119.80.182.6
  119.81.115.90
  119.81.115.92
  119.81.184.27
@@ -21582,16 +18111,14 @@
  119.82.253.175
  119.82.253.24
  119.82.253.63
-119.82.34.20
  119.82.65.194
  119.82.65.217
  119.82.75.82
  119.84.128.40
-119.84.66.170
  119.84.8.43
  119.86.16.83
-119.86.17.186
  119.86.183.187
+119.86.19.75
  119.88.176.134
  119.9.110.100
  119.9.110.234
@@ -21609,81 +18136,42 @@
  119.9.75.6
  119.9.93.85
  119.90.61.10
-119.90.63.249
  119.92.243.101
  119.92.77.17
  119.93.122.233
  119.93.123.229
  119.93.129.34
-119.93.149.82
  119.93.234.41
  119.93.235.205
  119.93.90.155
  119.94.166.6
  119.94.175.103
  119.96.100.222
-119.96.109.21
  119.96.120.113
-119.96.124.131
-119.96.125.185
-119.96.155.102
-119.96.157.188
-119.96.158.238
-119.96.158.87
-119.96.159.237
-119.96.171.99
  119.96.172.152
-119.96.172.179
-119.96.172.95
-119.96.173.202
-119.96.173.87
-119.96.174.75
-119.96.175.156
-119.96.175.184
-119.96.175.185
-119.96.175.244
-119.96.189.177
-119.96.192.177
  119.96.193.238
-119.96.193.246
-119.96.201.136
-119.96.213.159
-119.96.221.131
  119.96.223.211
-119.96.227.154
-119.96.227.221
-119.96.230.103
  119.96.230.241
-119.96.230.32
-119.96.231.110
  119.96.235.35
-119.96.235.73
-119.96.237.94
-119.96.239.27
  119.96.68.99
  119.96.82.131
  119.96.83.86
-119.96.86.168
  119.96.86.193
-119.96.93.33
  119.97.150.32
  119.97.159.52
  119.97.184.205
-119.97.221.82
-119.97.221.92
-119.97.221.94
  119.97.236.4
  119.97.252.154
  119.98.111.234
+119.98.154.55
  119.98.19.101
-119.98.30.6
-119.98.34.142
  119.99.244.180bin.sh
  119.99.30.19
  11983914-0a5c-4955-a866-bae101828b59.htmlcomponentservice.com
  119968911814491.002.sh.cn
  11degrees.org
  11duurzaam.sencwork.nl
+11infopaypal-update05.duckdns.org
  11iu.000webhostapp.com
  11jamesjacksondrive.com
  11k7fwp6g18d.safhboiewngr.club
@@ -21703,23 +18191,16 @@
  12.132.115.37
  12.146.219.131
  12.154.10.186
-12.154.167.177
  12.154.232.122
  12.154.232.27
  12.154.232.62
  12.154.232.80
-12.156.112.9
  12.162.84.2
  12.162.84.9
  12.163.208.58
-12.166.193.125
  12.169.96.50
  12.171.244.204
  12.176.19.218
-12.178.187.6
-12.178.187.7
-12.178.187.8
-12.178.187.9
  12.179.46.6
  12.182.181.129
  12.183.171.36
@@ -21729,14 +18210,12 @@
  12.191.193.202
  12.192.33.18
  12.20.165.35
+12.205.96.102
  12.215.14.204
  12.218.209.130
-12.218.61.83
  12.219.211.130
  12.229.155.122
-12.229.215.19
  12.229.217.226
-12.23.129.68
  12.231.109.141
  12.232.141.28
  12.232.141.29
@@ -21750,26 +18229,15 @@
  12.43.46.162
  12.43.46.163
  12.43.46.164
-12.44.194.23
-12.48.236.66
  12.53.219.68
  12.89.124.138
  12.90.218.58
-12.96.187.243
-12.97.172.196
+120.0.142.213
  120.0.147.75
-120.0.237.216
  120.0.32.59
-120.1.206.234
  120.1.225.148
-120.10.216.26
-120.11.176.85
-120.11.184.181
  120.11.189.201
-120.11.255.234
-120.11.90.27
  120.12.116.245
-120.12.133.69
  120.12.149.242
  120.12.217.91
  120.131.11.49
@@ -21778,75 +18246,50 @@
  120.131.14.125
  120.131.2.210
  120.131.3.191
-120.131.5.2
-120.131.6.210
  120.131.9.167
  120.132.103.67
  120.132.106.211
-120.132.11.151
  120.132.117.254
  120.132.12.162
-120.132.124.179
  120.132.13.131
  120.132.13.206
-120.132.22.30
  120.132.22.92
  120.132.28.86
-120.132.33.210
-120.132.38.222
  120.132.6.27
  120.132.68.57
  120.132.8.64
  120.132.81.130
-120.132.84.193
  120.132.84.44
  120.132.99.101
-120.133.136.35
  120.133.136.75
  120.133.136.76
  120.133.22.121
-120.133.35.4
-120.133.48.52
-120.133.52.105
  120.133.60.230
  120.133.60.235
  120.136.123.202
  120.136.169.155
  120.138.117.102
-120.138.125.204
  120.138.19.16
  120.142.173.160
  120.142.222.22
  120.142.90.95
  120.144.161.12
  120.148.210.84
+120.148.35.240
  120.15.13.74
  120.150.213.110
  120.150.216.161
  120.150.218.241
  120.150.247.164
  120.150.60.189
-120.150.94.177
-120.151.245.78
-120.151.88.152
  120.151.90.157
-120.156.92.47
+120.154.7.172
  120.157.105.208
  120.157.105.208bin.sh
-120.157.42.37
-120.157.70.233
+120.157.57.30
  120.157.79.233
  120.17.187.30
-120.192.246.107
-120.192.31.142
-120.192.31.171
-120.192.31.173
-120.192.73.235
-120.193.155.140
-120.193.184.98
  120.193.249.214
-120.193.252.189
-120.193.91.174
  120.193.91.177
  120.193.91.177bin.sh
  120.193.91.178
@@ -21886,54 +18329,19 @@
  120.193.91.214bin.sh
  120.193.91.215
  120.193.91.233
-120.193.93.227
-120.194.104.162
-120.194.104.164
  120.194.173.75
-120.194.177.249
  120.194.189.235
-120.194.194.105
-120.194.194.86
-120.194.195.226
-120.194.199.231
-120.194.212.85
-120.194.214.10
-120.194.227.16
-120.194.4.158
-120.194.42.194
-120.194.52.143
-120.194.6.70
-120.194.83.50
-120.194.83.99
-120.194.98.74
-120.194.98.76
+120.195.23.27
  120.195.30.152
-120.195.31.201
-120.195.95.165
  120.196.182.41
  120.196.182.41bin.sh
-120.196.251.51
-120.197.57.237
-120.198.146.228
-120.198.219.69
-120.198.23.239
-120.198.64.4
  120.198.76.45
  120.199.0.43
+120.200.225.238
  120.201.250.44
-120.202.128.23
  120.202.19.215
  120.202.21.189
-120.202.47.21
-120.202.58.110
-120.202.61.45
  120.203.160.18
-120.203.5.92
-120.203.64.215
-120.204.194.170
-120.204.196.181
-120.204.232.146
-120.205.198.158
  120.205.45.252
  120.209.121.243
  120.209.126.206
@@ -21953,7 +18361,6 @@
  120.209.126.74
  120.209.127.64
  120.209.127.79
-120.209.8.14
  120.209.98.100
  120.209.99.118
  120.209.99.122
@@ -21966,53 +18373,33 @@
  120.210.89.180
  120.210.89.79
  120.211.100.18
+120.211.103.67
  120.211.140.166
-120.211.145.66
  120.211.149.103
  120.211.228.14
-120.211.39.164
  120.211.61.239
-120.211.61.55
  120.212.210.199
-120.213.209.21
  120.213.213.54
-120.220.15.5
-120.221.130.109
  120.221.160.125
  120.221.160.3
-120.224.221.119
-120.224.222.37
  120.224.223.66
-120.224.237.82
-120.224.242.151
-120.224.244.226
-120.224.45.161
-120.224.49.60
  120.224.50.233
  120.224.50.64
-120.224.55.8
-120.224.61.184
-120.224.64.195
-120.224.95.43
  120.227.8.39
  120.229.1.138
  120.230.102.16
-120.230.140.225
-120.230.93.235
+120.230.77.56
+120.231.208.28
  120.232.150.110
  120.232.150.42
  120.232.182.40
  120.234.134.139
  120.234.138.100
  120.234.138.99
-120.234.227.172
  120.234.53.91
  120.236.105.190
  120.236.117.205
-120.236.128.52
-120.236.168.120
  120.236.212.67
-120.236.229.50
  120.236.248.254
  120.236.249.220
  120.236.251.37
@@ -22021,17 +18408,11 @@
  120.236.252.210
  120.236.254.184
  120.236.255.120
-120.236.55.130
-120.236.87.3
-120.236.87.54
  120.237.118.139
-120.237.123.242
  120.237.140.219
+120.237.44.57
  120.238.131.23
-120.238.16.141
-120.239.196.24
  120.239.196.34
-120.239.196.73
  120.239.196.8
  120.24.148.204
  120.24.40.26
@@ -22047,70 +18428,48 @@
  120.25.241.243
  120.25.60.70
  120.25.80.195
+120.253.167.238
  120.253.26.219
-120.253.32.69
  120.253.40.91
  120.26.118.68
-120.26.176.252
  120.26.199.103
  120.26.208.102
-120.26.38.159
-120.26.76.47
  120.27.114.140
  120.27.133.211
  120.27.153.72
-120.27.220.200
  120.28.109.188
  120.28.110.61
-120.28.150.82
  120.28.151.136
  120.28.201.50
  120.28.45.202
-120.29.109.58
+120.28.90.188
+120.29.105.31
  120.29.124.131
-120.29.125.194
-120.29.125.226
  120.29.125.240
+120.29.140.226
  120.29.67.39
-120.29.86.141
-120.29.99.185
+120.29.67.65
  120.31.131.172
-120.31.132.35
-120.31.136.232
  120.31.138.79
-120.31.140.237
  120.31.71.238
-120.32.74.136
-120.33.89.115
  120.34.13.123
  120.34.181.192
+120.34.182.220
  120.34.183.112
-120.34.183.204
-120.35.101.83
  120.35.189.82
  120.35.26.129
-120.36.106.168
-120.36.211.153
  120.36.3.101
-120.36.99.1
-120.39.243.192
-120.39.243.84
-120.39.244.134
+120.39.142.33
  120.40.130.70
-120.40.38.55
  120.40.81.105
-120.41.186.32
-120.41.186.94
-120.43.228.143
+120.41.99.191
  120.43.33.124
+120.43.58.221
  120.48.0.89
  120.48.1.167
  120.48.12.238
  120.48.12.77
-120.48.14.129
-120.48.16.217
  120.48.16.228
-120.48.19.10
  120.48.2.34
  120.48.21.157
  120.48.21.252
@@ -22125,25 +18484,20 @@
  120.50.100.247
  120.50.13.38
  120.50.13.41
-120.50.18.42
  120.50.27.182
  120.50.6.146
  120.50.66.60
  120.50.8.2
-120.50.96.179
  120.50.96.236
  120.51.34.254
  120.52.120.11
  120.52.136.248
  120.52.139.130
  120.52.146.211
-120.52.152.3
-120.52.191.190
  120.52.93.191
  120.52.93.223
  120.53.0.176
  120.53.1.97
-120.53.10.102
  120.53.10.17
  120.53.10.40
  120.53.102.80
@@ -22157,6 +18511,7 @@
  120.53.122.66
  120.53.124.220
  120.53.125.66
+120.53.13.169
  120.53.2.190
  120.53.220.148
  120.53.222.133
@@ -22166,8 +18521,6 @@
  120.53.225.13
  120.53.225.81
  120.53.23.24
-120.53.23.65
-120.53.232.114
  120.53.233.146
  120.53.235.101
  120.53.235.224
@@ -22178,7 +18531,6 @@
  120.53.243.163
  120.53.243.210
  120.53.243.211
-120.53.243.241
  120.53.244.247
  120.53.245.68
  120.53.249.78
@@ -22188,15 +18540,9 @@
  120.53.28.165
  120.53.31.96
  120.53.4.192
-120.53.9.188
  120.55.212.226
-120.56.118.99
  120.56.119.118
  120.57.112.132
-120.57.112.41
-120.57.213.116
-120.57.32.25
-120.57.32.52
  120.57.33.11
  120.57.96.224
  120.59.16.52
@@ -22210,10 +18556,7 @@
  120.6.4.64
  120.63.135.40
  120.63.136.58
-120.63.177.14
-120.63.249.202
-120.68.108.190
-120.68.111.82
+120.63.197.32
  120.68.2.66
  120.68.238.139
  120.68.239.224
@@ -22222,98 +18565,76 @@
  120.69.6.8
  120.69.88.106
  120.69.89.50
-120.7.146.8
  120.7.162.58
  120.7.192.80
  120.7.5.67
  120.70.100.13
-120.70.100.88
  120.70.100.89
  120.70.102.16
  120.70.102.239
  120.70.103.239
  120.70.103.27
-120.70.98.132
-120.70.98.195
-120.71.13.11
-120.71.145.189
  120.71.145.254
-120.71.146.45
-120.71.147.93
-120.71.154.24
  120.71.181.52
-120.71.181.83
-120.72.17.35
+120.72.117.91
  120.72.18.91
-120.72.90.246
-120.76.140.189
-120.76.22.182
+120.76.216.147
+120.76.220.37
  120.76.244.212
  120.76.99.200
-120.77.223.59
+120.77.145.154
+120.77.157.98
  120.77.253.219
+120.77.3.221
  120.77.36.28
+120.77.60.26
  120.77.60.48
  120.78.144.149
-120.78.182.195
-120.78.2.189
+120.78.193.26
  120.78.2.215
  120.78.203.123
  120.78.4.233
+120.78.5.145
  120.78.68.241
  120.79.0.86
  120.79.106.130
-120.79.113.168
  120.79.151.95
  120.79.169.174
+120.79.186.104
  120.79.188.144
  120.79.194.12
  120.79.212.174
  120.79.218.202
-120.79.222.186
  120.79.226.20
-120.79.25.8
-120.79.32.117
  120.79.48.236
  120.79.92.64
  120.8.111.160
  120.8.84.207
  120.82.168.76
-120.82.192.196
+120.83.108.195
  120.83.109.193
  120.83.109.62
-120.84.96.24
-120.84.96.87
  120.85.100.193
  120.85.101.231
-120.85.170.36
-120.85.171.229
-120.85.175.15
-120.85.175.7
-120.85.197.107
-120.85.197.63
-120.85.211.84
-120.85.237.129
-120.85.253.203
+120.85.174.24
+120.85.184.122
+120.85.185.0
+120.85.187.188
+120.85.197.49
+120.85.210.9
+120.85.254.4
  120.85.61.92
-120.86.113.106
-120.86.123.211
+120.88.33.58
  120.88.46.226
  120.9.177.189
  120.92.10.24
-120.92.102.213
  120.92.103.143
  120.92.107.174
  120.92.107.97
-120.92.109.187
-120.92.109.191
-120.92.109.29
  120.92.109.67
-120.92.109.69
  120.92.11.9
  120.92.111.13
  120.92.111.227
-120.92.111.92
  120.92.114.71
  120.92.117.182
  120.92.118.155
@@ -22331,13 +18652,10 @@
  120.92.149.231
  120.92.15.26
  120.92.151.17
-120.92.153.21
  120.92.153.253
  120.92.154.149
-120.92.155.231
  120.92.164.193
  120.92.166.166
-120.92.169.165
  120.92.169.65
  120.92.169.82
  120.92.172.28
@@ -22345,9 +18663,7 @@
  120.92.192.187
  120.92.208.106
  120.92.210.196
-120.92.253.6
  120.92.33.108
-120.92.33.68
  120.92.34.203
  120.92.38.187
  120.92.38.249
@@ -22355,7 +18671,6 @@
  120.92.78.70
  120.92.79.133
  120.92.80.120
-120.92.83.246
  120.92.89.30
  120.92.92.40
  120.97.20.106
@@ -22367,15 +18682,7 @@
  120fsbyy4.com
  120pet.com
  121.1.38.228
-121.10.139.68
-121.10.140.187
  121.10.141.208
-121.10.143.200
-121.10.208.12
-121.10.236.252
-121.10.249.5
-121.10.252.143
-121.10.3.83
  121.100.114.164
  121.100.17.42
  121.100.19.18
@@ -22385,7 +18692,6 @@
  121.100.96.8
  121.101.130.41
  121.101.130.42
-121.101.132.241
  121.101.159.29
  121.101.176.31
  121.101.186.242
@@ -22393,31 +18699,26 @@
  121.102.58.214
  121.105.215.185
  121.11.110.200
-121.11.117.252
  121.11.98.127
  121.111.247.200
  121.114.118.247
  121.117.147.153
  121.119.179.133
  121.12.124.36
-121.12.155.218
-121.12.252.206
-121.120.243.155
  121.120.80.170
  121.121.120.197
-121.121.141.225
  121.121.160.102
  121.121.177.138
  121.121.177.174
-121.121.185.11
  121.121.215.85
  121.121.44.222
+121.121.70.226
  121.122.103.40
  121.122.109.35
-121.122.122.221
  121.122.139.104bin.sh
  121.122.48.61
  121.122.50.157
+121.122.70.4
  121.122.75.150
  121.123.67.79
  121.123.85.135
@@ -22428,23 +18729,17 @@
  121.124.127.164
  121.125.68.90
  121.126.31.66
-121.127.226.242
  121.127.234.54
  121.127.249.45
  121.127.252.30
  121.128.154.155
  121.129.127.209
  121.129.205.122
-121.13.225.194
-121.13.252.100
-121.13.64.11
  121.130.176.55
  121.130.29.11
  121.130.29.21
-121.130.76.251
-121.131.17.107
-121.131.206.165
  121.132.213.174
+121.133.0.232
  121.134.159.21
  121.134.174.236
  121.134.198.156
@@ -22454,84 +18749,45 @@
  121.135.150.153
  121.135.150.73
  121.135.237.32
+121.135.52.86
  121.136.180.124
  121.137.106.165
  121.137.138.140
-121.137.241.118
  121.138.119.52
  121.138.155.41
  121.138.171.77
-121.139.152.196
  121.139.152.6
-121.139.152.79
  121.139.172.133
  121.139.172.4
  121.139.172.4bin.sh
-121.139.204.101
-121.139.207.163
-121.139.207.227
  121.139.218.165
-121.139.235.234
-121.139.235.249
  121.139.69.202
-121.14.17.168
-121.14.17.172
-121.14.2.50
  121.140.0.70
  121.140.118.26
-121.140.203.59
-121.140.60.108
  121.141.123.214
-121.141.125.213
  121.141.34.205
-121.142.158.97
-121.142.250.26
  121.142.76.87
  121.142.87.218
-121.143.16.208
-121.143.236.48
-121.144.235.179
-121.145.133.127
-121.145.54.134
-121.147.227.130
-121.147.227.160
-121.147.227.164
  121.147.241.223
  121.148.141.82
  121.148.170.225
  121.148.198.136
  121.148.244.119
  121.148.3.198
-121.149.104.170
-121.149.104.51
-121.149.104.83
-121.149.112.111
-121.149.112.99
-121.149.114.59
  121.149.121.199bin.sh
-121.149.20.12
-121.149.20.13
-121.149.20.28
-121.149.20.29
-121.149.20.31
-121.15.137.137
  121.15.2.178
  121.15.2.6
  121.15.220.61
  121.15.245.215
  121.15.4.92
  121.15.7.26
-121.150.32.33
  121.150.5.25
-121.151.152.80
-121.151.201.96
  121.151.78.166
  121.151.78.166bin.sh
-121.152.227.213
-121.153.103.135
  121.153.131.147
  121.153.37.78
  121.154.148.202
+121.154.190.19
  121.154.229.125
  121.154.48.197
  121.154.5.65
@@ -22540,30 +18796,20 @@
  121.155.231.222
  121.155.247.168
  121.155.70.67
-121.155.70.86
  121.156.126.101
  121.157.129.16
-121.157.136.108
-121.157.136.229
-121.157.136.71
-121.157.225.132
+121.157.82.202
  121.159.170.231
  121.159.172.93
  121.159.53.15
  121.159.53.15bin.sh
  121.159.95.49
-121.16.117.41
  121.16.144.186
-121.160.117.156
-121.160.147.70
  121.161.20.122
-121.161.20.59
  121.161.35.243
  121.162.131.223
  121.162.235.44
-121.163.183.204
  121.163.94.158
-121.164.224.61
  121.165.140.242
  121.165.180.33
  121.165.21.76
@@ -22573,86 +18819,45 @@
  121.169.10.188
  121.169.110.121
  121.169.110.121bin.sh
-121.169.111.186
-121.169.175.58
  121.169.222.192
-121.169.25.46
-121.169.34.103
-121.169.34.119
-121.169.34.14
-121.169.34.15
-121.169.34.176
-121.169.34.194
-121.169.34.201
-121.169.34.231
-121.169.34.24
-121.169.34.252
-121.169.34.66
-121.169.34.67
-121.17.147.46
  121.17.156.146
-121.17.178.75
-121.17.180.136
  121.17.210.114
  121.17.210.61
-121.170.19.103
+121.170.17.92
  121.170.19.226
  121.170.45.176
-121.170.8.145
  121.171.166.170
-121.172.49.87
-121.172.7.158
-121.173.126.110
-121.173.126.111
+121.171.33.120
+121.172.183.4
+121.173.200.200
+121.173.200.33
  121.173.238.41
  121.173.65.71
  121.173.82.5
  121.173.82.5bin.sh
  121.173.85.76
+121.174.105.197
+121.174.105.223
  121.174.121.97
-121.174.123.168
  121.174.247.238
-121.175.70.221
-121.175.84.205
-121.176.110.107
-121.176.139.142
+121.176.110.20
  121.176.181.191
-121.177.192.126
-121.178.170.205
-121.178.195.197
-121.178.231.59
-121.178.231.89
-121.178.247.156
-121.178.247.206
-121.178.247.226
-121.178.247.233
-121.178.247.243
-121.178.247.49
-121.179.39.53
-121.179.60.188
+121.176.198.180
  121.179.88.44
-121.18.128.26
  121.18.85.114
  121.18.88.186
-121.18.97.11
  121.180.106.112
  121.180.106.112bin.sh
  121.180.203.139
-121.181.50.96
  121.183.117.232
  121.183.117.235
-121.183.188.85
+121.183.191.200
  121.183.203.76
+121.183.243.178
  121.184.131.249
  121.184.19.115
  121.185.31.185
-121.186.147.16
  121.186.193.6
-121.186.60.63
-121.186.96.167
-121.187.128.97
-121.187.13.62
-121.187.138.81
  121.188.43.201
  121.188.99.144
  121.189.111.104bin.sh
@@ -22660,49 +18865,38 @@
  121.190.192.77
  121.191.47.134
  121.196.12.93
-121.196.57.160
  121.196.59.48
-121.2.66.61
+121.196.99.154
  121.20.150.177
  121.20.202.25
  121.200.48.201
  121.200.48.58
  121.200.48.98
-121.200.68.233
  121.200.8.230
  121.201.10.82
-121.201.108.7
  121.201.119.61
  121.201.124.251
-121.201.26.46
-121.201.3.121
-121.201.33.222
  121.201.45.212
+121.201.51.128
  121.201.61.205
-121.201.65.142
  121.201.69.10
  121.201.74.154
-121.201.75.161
  121.201.76.118
  121.201.76.119
  121.201.76.123
  121.201.93.66
  121.201.94.17
  121.201.95.66
-121.201.95.79
-121.202.100.26
  121.202.109.75
  121.202.41.3
-121.202.69.123
+121.202.60.54
  121.202.8.123
  121.202.98.253
  121.203.221.85
-121.203.226.15
+121.203.228.83
  121.204.134.41
  121.204.148.63
  121.204.153.151
-121.204.154.158
-121.204.164.170
  121.204.164.89
  121.204.164.96
  121.204.166.76
@@ -22710,38 +18904,23 @@
  121.204.213.37
  121.204.247.190
  121.205.212.118
-121.205.96.188
-121.206.120.194
  121.206.38.180
-121.206.38.3
  121.206.38.51
+121.208.99.245
  121.21.80.157
  121.21.92.217
  121.211.20.23
  121.211.201.98
  121.214.69.148
  121.215.45.82
-121.216.100.100
  121.217.69.205
-121.22.124.83
-121.22.19.213
-121.22.248.40
-121.22.248.47
-121.22.47.34
-121.22.5.137
-121.22.5.139
-121.22.5.146
-121.22.5.156
-121.22.6.45
  121.22.95.58
-121.224.179.33
-121.224.59.192
-121.224.77.121
-121.225.85.100
+121.225.218.117
  121.226.131.122
  121.226.131.146
  121.226.142.226
  121.226.158.186
+121.226.166.95
  121.226.177.125
  121.226.179.144
  121.226.206.89
@@ -22754,46 +18933,33 @@
  121.226.232.27
  121.226.239.118
  121.226.254.10
-121.226.52.52
  121.226.85.10
  121.226.94.109
  121.227.0.117
  121.227.0.17
-121.227.153.232
  121.227.181.3
  121.227.236.101
  121.227.255.14
  121.227.255.76
-121.227.31.13
  121.227.88.16
  121.227.95.161
+121.228.156.209
+121.228.156.245
  121.228.89.73
  121.229.0.116
  121.229.10.130
-121.229.124.211
  121.229.132.247
-121.229.15.146
  121.229.15.6
-121.229.19.200
-121.229.20.121
  121.229.20.250
  121.229.20.84
-121.229.4.236
  121.229.48.89
-121.229.58.8
-121.229.62.94
  121.229.63.151
  121.229.9.72
-121.23.107.198
-121.23.244.129
  121.23.26.72
-121.23.52.122
  121.23.88.92
  121.230.209.240
  121.230.211.141
-121.230.235.173
  121.230.239.87
-121.230.24.114
  121.230.24.151
  121.230.24.97
  121.230.254.53
@@ -22802,18 +18968,13 @@
  121.231.101.240
  121.231.101.42
  121.231.102.55
-121.231.112.204
-121.231.123.247
  121.231.14.1
-121.231.155.176
  121.231.164.108
-121.231.196.110
  121.231.216.30
  121.231.22.145
-121.231.221.177
-121.231.53.156
  121.231.83.134
  121.232.179.201
+121.232.18.163
  121.232.39.129bin.sh
  121.233.1.189
  121.233.101.155
@@ -22824,7 +18985,6 @@
  121.233.116.178
  121.233.116.232
  121.233.117.174
-121.233.117.246
  121.233.122.225
  121.233.124.124
  121.233.124.80
@@ -22833,6 +18993,7 @@
  121.233.127.169
  121.233.127.174
  121.233.15.177
+121.233.15.84
  121.233.16.42
  121.233.17.27
  121.233.19.170
@@ -22840,37 +19001,24 @@
  121.233.31.125
  121.233.68.89
  121.233.73.203
-121.234.0.189
-121.234.123.20
  121.234.46.5
  121.234.67.0
-121.234.99.53
-121.235.175.55
-121.235.243.124
  121.235.46.19
  121.236.128.204
-121.236.128.252
  121.236.175.251
  121.236.221.24
  121.236.32.208
  121.237.108.90
  121.237.169.232
  121.237.225.11bin.sh
-121.237.35.140
-121.237.45.218
  121.238.202.13
  121.238.245.139
  121.238.245.197
  121.238.245.84
-121.239.169.50
-121.239.26.17
-121.239.26.42
-121.239.26.66
-121.239.46.113
+121.239.203.42
+121.239.8.230
  121.241.244.92
-121.241.7.122
  121.241.90.242
-121.242.232.157
  121.244.147.176
  121.245.174.107
  121.25.148.55
@@ -22878,211 +19026,144 @@
  121.25.51.0
  121.25.78.196
  121.25.79.69
-121.254.123.250
  121.254.153.195
  121.254.171.246
  121.254.172.27
  121.254.228.21
  121.254.231.87
  121.254.235.62
-121.254.31.166
-121.254.76.36
-121.254.84.9
-121.26.195.166
  121.26.219.202
-121.27.223.23
-121.28.10.116
-121.28.12.105
-121.28.13.16
-121.28.131.226
-121.28.131.229
-121.28.131.230
-121.28.133.226
-121.28.199.78
-121.28.255.234
-121.28.255.240
-121.28.255.243
-121.28.38.235
-121.28.56.246
-121.28.95.243
-121.30.208.197
  121.30.252.106
  121.30.41.41
-121.31.110.41
-121.31.111.37
-121.31.126.134
-121.31.41.77
-121.31.66.220
  121.32.150.82
  121.32.88.181
-121.33.144.235
-121.33.200.43
  121.33.220.158
  121.33.237.102
-121.33.254.10
+121.34.149.216
  121.34.150.176
  121.34.151.175
-121.34.32.79
+121.34.32.137
+121.34.51.182
  121.35.184.178
-121.35.240.245
-121.36.245.140
-121.36.39.185
-121.37.26.162
  121.37.69.105
-121.4.33.6
+121.4.36.195
  121.4.41.100
-121.4.46.37
  121.4.51.142
  121.4.51.147
+121.4.52.49
  121.4.61.80
-121.4.66.32
  121.4.74.61
  121.40.105.124
  121.40.141.226
  121.40.162.239
-121.40.199.102
  121.40.203.142
  121.40.21.205
-121.40.48.174
  121.40.66.129
  121.40.70.132
  121.40.87.87
-121.42.145.216
+121.41.24.64
+121.42.160.48
  121.43.116.52
-121.43.145.115
  121.43.163.43
  121.44.242.85
  121.44.29.69
-121.45.201.12
-121.46.22.1
-121.46.232.15
-121.46.239.154
-121.46.239.167
  121.46.244.194
-121.46.253.2
  121.46.26.126
  121.46.26.17
-121.46.28.38
  121.46.4.194
-121.48.164.130
+121.46.84.5
  121.48.165.121
  121.48.165.2
  121.52.132.186
-121.52.149.124
  121.52.153.5
  121.52.154.36
-121.52.155.57
-121.52.157.112
-121.52.202.226
-121.52.214.63
  121.52.66.102
+121.52.71.23
  121.54.164.151
  121.54.168.251
  121.54.168.252
  121.54.168.253
  121.54.169.69
  121.54.58.242
-121.54.71.217
-121.57.179.186
  121.58.195.140
-121.58.200.190
  121.58.212.108
  121.58.243.202
  121.58.243.204
  121.58.246.247
-121.6.107.224
  121.6.118.26
  121.6.219.179
-121.6.39.204
  121.6.44.96
-121.6.90.44
-121.60.113.251
+121.60.122.124
  121.61.100.176
  121.61.105.23
  121.61.106.104
  121.61.109.190
  121.61.110.239
  121.61.111.145
-121.61.17.245
  121.61.217.18
  121.61.65.135
  121.61.67.219
-121.61.75.113
+121.61.74.53
  121.61.78.91
  121.61.98.189
-121.61.99.225
  121.61.99.85
  121.63.0.245
-121.63.207.130
-121.63.247.49
-121.63.247.74
  121.63.80.219
  121.63.82.89
  121.63.82.89bin.sh
  121.65.173.82
  121.66.154.171
  121.66.198.76
-121.66.205.3
+121.66.35.37
  121.67.169.230
  121.67.246.152
  121.69.135.162
-121.69.135.6
-121.69.26.214
  121.69.44.6
-121.69.93.226
  121.7.127.92
-121.7.129.59
-121.7.146.78
  121.7.31.214
  121.7.36.20
-121.7.45.3
+121.74.125.158
+121.75.213.133
  121.75.218.237
  121.78.116.203
  121.78.116.209
  121.78.129.7
  121.78.145.242
-121.78.147.110
-121.78.147.32
  121.78.223.195
  121.78.236.175
  121.78.246.82
  121.8.146.99
-121.8.164.114
-121.8.219.186
  121.88.4.141
  121.88.4.74
  121.89.176.79
  121.89.193.102
  121.89.194.147
-121.9.250.202
  121.9.252.250
+121.96.41.242
  121.98.205.100
  121.98.205.102
  121.99.28.126
  121008.yolasite.com
  1215-qualitative.com
  122.10.119.32
+122.10.84.252
  122.10.85.55
  122.10.90.18
  122.10.98.183
+122.100.105.17
  122.100.140.213
  122.100.188.50
-122.100.210.2
  122.100.76.205
  122.102.118.14
  122.102.26.41
  122.102.36.10
  122.102.43.82
-122.11.141.26
  122.11.148.38
-122.11.36.18
  122.112.180.33
-122.112.71.214
  122.114.116.59
  122.114.14.153
  122.114.149.176
  122.114.15.68
-122.114.156.206
  122.114.166.8
  122.114.171.79
  122.114.175.35
@@ -23090,12 +19171,8 @@
  122.114.188.97
  122.114.189.67
  122.114.198.163
-122.114.206.123
  122.114.215.140
-122.114.218.101
-122.114.237.5
  122.114.246.149
-122.114.247.201
  122.114.31.112
  122.114.37.11
  122.114.4.186
@@ -23103,219 +19180,54 @@
  122.114.5.160
  122.114.65.210
  122.114.66.97
-122.114.67.120
  122.114.70.12
  122.114.72.110
-122.114.72.60
  122.114.72.81
  122.114.73.130
-122.114.73.97
  122.114.75.180
-122.114.77.186
-122.114.9.77
  122.114.95.158
  122.114.96.59
  122.114.99.178
-122.115.225.170
  122.115.230.204
-122.115.35.254
-122.115.43.228
-122.115.46.82
  122.115.51.155
  122.115.52.2
  122.115.57.174
-122.116.100.82
-122.116.104.129
-122.116.104.167
-122.116.106.217
-122.116.108.152
-122.116.110.169
-122.116.115.30
-122.116.124.137
-122.116.13.219
-122.116.135.1
-122.116.138.32
-122.116.142.4
-122.116.148.152
-122.116.151.92
-122.116.152.142
-122.116.153.195
-122.116.160.150
-122.116.161.235
-122.116.164.89
-122.116.174.33
-122.116.194.37
-122.116.2.223
-122.116.203.147
-122.116.206.25
-122.116.209.151
  122.116.213.28
-122.116.22.184
-122.116.220.163
-122.116.220.46
-122.116.222.52
  122.116.233.207
-122.116.237.12
-122.116.253.71
-122.116.31.25
-122.116.32.122
-122.116.40.250
  122.116.41.237
  122.116.42.140
-122.116.47.42
-122.116.5.156
-122.116.51.152
-122.116.54.116
-122.116.54.59
-122.116.58.146
-122.116.64.204
-122.116.66.244
  122.116.7.143
-122.116.73.178
-122.116.84.16
  122.116.90.171
-122.116.91.28
-122.117.0.192
-122.117.102.93
-122.117.105.218
-122.117.11.183
-122.117.110.160
-122.117.112.233
-122.117.112.83
-122.117.113.67
-122.117.115.4
-122.117.117.103
-122.117.118.233
-122.117.120.29
-122.117.122.2
-122.117.122.42
-122.117.124.198
-122.117.125.56
-122.117.129.72
-122.117.13.213
-122.117.131.150
-122.117.132.221
-122.117.134.16
-122.117.136.11
-122.117.141.253
-122.117.143.167
-122.117.143.175
-122.117.143.191
-122.117.149.222
-122.117.151.158
-122.117.151.7
-122.117.151.93
-122.117.152.204
-122.117.153.59
-122.117.157.113
-122.117.158.119
-122.117.158.189
  122.117.159.191
-122.117.165.14
-122.117.169.252
-122.117.181.211
-122.117.184.252
-122.117.187.39
-122.117.190.194
-122.117.190.202
-122.117.195.49
-122.117.196.108
-122.117.196.226
-122.117.20.58
-122.117.207.110
-122.117.208.98
-122.117.211.131
-122.117.213.174
-122.117.215.84
-122.117.22.61
-122.117.222.39
-122.117.224.85
-122.117.226.239
-122.117.227.239
-122.117.228.118
-122.117.233.105
-122.117.235.135
-122.117.239.53
-122.117.246.250
-122.117.253.174
-122.117.33.177
-122.117.35.177
-122.117.35.204
-122.117.38.231
-122.117.41.99
-122.117.44.207
  122.117.44.59
-122.117.48.156
-122.117.58.95
-122.117.62.152
-122.117.67.130
-122.117.67.211
-122.117.72.137
-122.117.75.226
-122.117.77.22
-122.117.79.17
-122.117.85.144
-122.117.88.64
-122.117.89.127
-122.117.90.235
-122.117.91.179
-122.117.91.36
-122.117.97.217
-122.117.98.59
-122.118.115.84
-122.118.13.252
  122.118.155.59
-122.121.102.140
  122.121.88.198
-122.128.205.140
-122.128.211.132
-122.128.213.251
-122.128.246.57
-122.128.253.80
-122.128.55.25
+122.128.19.253
  122.129.112.209
-122.129.121.226
  122.129.121.228
-122.129.121.240
-122.129.74.58
  122.133.186.3
-122.137.35.73
-122.138.37.157
-122.138.50.140
+122.136.84.78
  122.14.195.58
  122.14.198.75
  122.14.200.208
  122.14.200.79
+122.14.209.13
  122.14.210.153
  122.14.211.208
  122.14.216.28
  122.14.217.48
  122.14.222.202
-122.140.173.85
-122.141.123.47
  122.141.177.112
-122.141.183.14
-122.141.234.178
-122.141.234.179
-122.143.114.155
-122.143.117.250
-122.143.12.21
-122.143.133.150
-122.143.19.73
-122.144.131.74
-122.144.131.75
-122.144.133.18
+122.142.211.198
  122.144.212.144
-122.144.221.149
  122.146.196.217
  122.147.131.89
  122.147.141.151
-122.147.42.3
+122.147.9.162
  122.148.216.33
  122.15.131.65
  122.152.194.123
  122.152.195.84
-122.152.196.222
  122.152.202.214
  122.152.204.42
  122.152.209.120
@@ -23330,7 +19242,6 @@
  122.154.141.244
  122.154.151.202
  122.154.162.2
-122.154.178.202
  122.154.251.22
  122.154.56.18
  122.154.57.100
@@ -23341,82 +19252,63 @@
  122.155.11.89
  122.155.13.112
  122.155.160.151
-122.155.164.118
  122.155.166.193
  122.155.17.174
  122.155.174.36
-122.155.187.152
  122.155.202.93
  122.155.223.20
  122.155.223.59
  122.155.223.9
  122.155.3.147
  122.155.38.205
-122.155.39.250
  122.155.7.117
  122.155.9.169
-122.156.219.194
  122.156.219.212
-122.156.44.55
  122.159.81.8
  122.16.180.244
  122.160.112.27
+122.160.199.200
  122.160.31.101
-122.160.48.10
-122.160.48.9
  122.160.51.88
-122.160.52.173
  122.160.61.100
  122.160.99.22
  122.161.241.62
-122.161.246.17
  122.161.247.29
  122.163.120.143
  122.163.126.206
-122.165.117.169
  122.165.131.7
  122.165.149.75
  122.165.194.191
  122.165.196.72
  122.165.20.209
+122.165.202.65
  122.165.206.136
  122.165.207.151
-122.165.247.254
-122.166.171.166
+122.166.144.74
  122.166.216.212
  122.166.227.27
  122.166.237.117
  122.168.125.226
-122.168.196.12
  122.168.197.113
  122.169.114.254
-122.169.202.72
-122.170.105.227
  122.170.109.61
-122.170.110.46
  122.170.111.175
  122.170.152.36
  122.170.5.123
-122.170.6.71
  122.173.185.125
  122.173.41.23
  122.174.12.93
  122.175.102.150
-122.175.62.51
  122.176.10.199
  122.176.101.76
  122.176.112.13
-122.176.122.38
  122.176.169.143
  122.176.49.139
  122.176.55.24
  122.176.56.5
-122.176.67.232
-122.176.70.232
  122.176.71.91
  122.178.115.118
  122.179.129.138
-122.179.132.118
  122.179.247.75
  122.180.163.12
  122.180.254.6
@@ -23426,196 +19318,130 @@
  122.183.244.67
  122.185.108.70
  122.185.137.98
-122.185.174.134
-122.185.22.171
+122.185.65.147
  122.191.189.91
  122.192.206.55
-122.193.10.180
-122.193.104.186
-122.193.118.58
-122.193.235.70
+122.193.233.0
  122.193.254.231
  122.194.168.84
  122.194.192.247
  122.194.197.177
-122.194.229.120
  122.194.229.122
  122.194.229.3
  122.194.229.54
  122.194.229.59
  122.194.44.48
  122.194.49.136
-122.194.75.215
  122.195.134.68
-122.195.67.226
-122.199.105.167
  122.199.140.158
  122.199.72.23
+122.199.72.78
+122.199.79.27
  122.199.79.34
-122.2.16.227
-122.200.121.252
  122.200.144.42
  122.200.145.41
  122.200.150.129
  122.200.150.153
  122.200.150.17
+122.200.150.225
  122.200.150.249
  122.200.151.249
  122.200.80.28
-122.200.93.45
-122.200.93.95
  122.201.113.87
-122.201.124.3
-122.201.19.99
  122.201.23.122
  122.201.76.100
  122.201.82.218
-122.202.220.186
+122.202.32.118
  122.202.32.70
  122.202.48.251
  122.202.50.76
  122.202.51.74
-122.204.161.122
-122.204.88.5
  122.205.137.11
  122.221.52.143
-122.224.126.58
-122.224.131.115
  122.224.158.58
-122.224.19.43
-122.224.20.110
-122.224.20.214
  122.224.217.42
-122.224.222.58
  122.224.232.66
  122.224.240.99
  122.224.65.197
-122.224.95.158
  122.225.139.180
  122.225.196.203
-122.225.202.74
  122.225.203.162
  122.225.218.234
  122.225.61.30
-122.225.77.122
-122.225.85.14
-122.225.91.14
-122.225.96.157
-122.226.100.233
-122.226.122.7
+122.225.94.226
  122.226.206.254
-122.226.238.138
  122.226.42.106
  122.226.57.70
-122.226.73.22
-122.226.73.50
-122.226.73.54
  122.226.94.138
  122.227.126.129
-122.227.160.110
  122.227.164.71
-122.227.174.246
-122.227.183.126
-122.227.185.101
-122.227.188.90
-122.227.198.250
-122.227.214.155
-122.227.42.48
-122.227.63.194
-122.227.9.146
-122.227.98.90
-122.228.118.43
-122.228.118.47
-122.228.120.190
+122.227.26.90
  122.228.19.10
  122.228.19.79
-122.228.19.80
  122.228.246.206
+122.228.246.210
+122.23.173.183
  122.230.132.209
  122.230.133.47
  122.230.65.7
  122.230.70.119
  122.231.47.237
+122.231.96.137
  122.232.105.252
-122.234.233.65
  122.234.77.121
  122.235.47.240
-122.235.78.170
  122.236.184.229
  122.236.184.238
-122.236.188.182
  122.236.188.187
  122.236.192.162
  122.237.155.229
-122.239.133.255
-122.240.35.84
  122.241.0.14
+122.241.16.136
  122.241.2.4
-122.244.212.117
-122.245.63.9
-122.247.242.191
  122.248.103.64
-122.248.32.54
  122.248.33.1
  122.248.37.50
  122.248.38.1
  122.248.38.4
  122.248.38.41
-122.248.45.35
-122.252.181.58
-122.252.205.212
  122.252.225.165
  122.252.229.2
-122.252.234.203
  122.252.239.5
-122.252.246.206
  122.252.250.22
-122.252.72.2
-122.254.17.166
  122.254.183.207
-122.254.234.196
-122.254.27.134
-122.254.33.146
-122.254.33.161
-122.254.74.169
  122.254.74.181
-122.254.87.60
+122.254.82.105
  122.27.45.76
  122.27.61.199
  122.3.145.89
  122.3.255.114
-122.3.55.209
  122.35.120.59
  122.37.68.61
  122.4.199.239
-122.4.240.189
  122.4.249.171
  122.4.29.127
-122.4.40.198
  122.4.40.243
-122.4.42.170
+122.4.41.106
+122.4.42.245
  122.4.42.95
+122.4.43.244
  122.4.44.200
+122.4.44.31
  122.4.45.179
-122.4.46.215
+122.4.46.109
  122.4.47.149
-122.4.47.153
-122.4.49.252
+122.4.47.4
+122.4.48.195
  122.4.49.68
  122.4.50.117
-122.4.50.239
+122.4.50.22
  122.4.50.30
-122.4.51.140
  122.4.51.169
+122.4.52.211
  122.4.53.96
+122.4.54.168
  122.4.54.251
-122.4.55.174
-122.42.206.235
-122.46.191.204
-122.49.208.36
-122.49.44.124
  122.50.5.148
-122.51.10.43
  122.51.100.145
  122.51.101.136
  122.51.102.227
@@ -23625,7 +19451,6 @@
  122.51.114.226
  122.51.115.240
  122.51.125.104
-122.51.125.231
  122.51.125.71
  122.51.126.75
  122.51.127.75
@@ -23633,6 +19458,7 @@
  122.51.136.128
  122.51.137.21
  122.51.147.181
+122.51.147.221
  122.51.15.197
  122.51.150.134
  122.51.151.154
@@ -23642,40 +19468,30 @@
  122.51.158.27
  122.51.16.84
  122.51.160.62
-122.51.161.231
  122.51.163.237
  122.51.166.84
  122.51.167.43
  122.51.168.254
-122.51.170.88
  122.51.175.20
  122.51.178.207
  122.51.178.89
  122.51.18.119
-122.51.185.54
  122.51.186.219
  122.51.187.118
  122.51.189.179
-122.51.190.182
  122.51.192.105
  122.51.196.235
-122.51.198.232
  122.51.199.173
  122.51.200.223
-122.51.200.252
  122.51.201.158
  122.51.201.5
  122.51.202.157
  122.51.204.45
-122.51.204.47
  122.51.204.51
-122.51.205.69
  122.51.208.128
  122.51.208.60
-122.51.208.66
  122.51.209.153
  122.51.209.252
-122.51.210.116
  122.51.211.131
  122.51.211.249
  122.51.214.44
@@ -23688,6 +19504,7 @@
  122.51.228.41
  122.51.229.116
  122.51.230.155
+122.51.230.234
  122.51.231.165
  122.51.231.211
  122.51.234.65
@@ -23696,12 +19513,12 @@
  122.51.240.195
  122.51.241.109
  122.51.241.12
+122.51.241.15
  122.51.241.65
  122.51.243.223
  122.51.248.146
  122.51.248.76
  122.51.250.133
-122.51.250.3
  122.51.254.201
  122.51.254.221
  122.51.254.9
@@ -23717,7 +19534,6 @@
  122.51.32.91
  122.51.33.61
  122.51.34.215
-122.51.36.254
  122.51.39.232
  122.51.40.61
  122.51.41.109
@@ -23733,8 +19549,6 @@
  122.51.64.115
  122.51.64.150
  122.51.66.91
-122.51.67.249
-122.51.68.119
  122.51.68.7
  122.51.69.116
  122.51.7.103
@@ -23751,18 +19565,16 @@
  122.51.85.3
  122.51.85.95
  122.51.86.120
-122.51.86.161
  122.51.89.18
+122.51.90.196
  122.51.92.78
  122.51.96.21
  122.51.96.57
  122.51.99.88
  122.52.107.94
  122.52.127.96
-122.52.131.214
  122.52.183.184
  122.52.183.184bin.sh
-122.52.211.194
  122.52.215.80
  122.52.48.92
  122.53.152.40
@@ -23771,21 +19583,14 @@
  122.54.119.182
  122.54.131.137
  122.54.134.176
-122.54.143.156
  122.54.20.213
  122.54.20.216
-122.55.108.14
  122.55.190.12
  122.55.196.253
  122.55.202.100
-122.55.79.116
  122.58.118.224
-122.70.178.5
  122.9.67.134
  122.96.103.242
-122.96.236.235
-122.96.254.112
-122.96.92.246
  122.97.130.196
  122.97.162.201
  122177-dot-n-e-w-me-ss-age-po-rt-al.wl.r.appspot.com
@@ -23795,12 +19600,6 @@
  122uc.com
  123.0.207.189
  123.0.211.219
-123.0.217.141
-123.0.226.124
-123.0.250.82
-123.0.34.96
-123.1.0.188
-123.1.148.100
  123.1.154.200
  123.1.180.246
  123.1.187.49
@@ -23810,104 +19609,83 @@
  123.1.189.170
  123.1.189.204
  123.1.189.244
-123.1.189.249
  123.1.189.70
  123.10.0.118
  123.10.129.234
  123.10.130.193
-123.10.143.168
-123.10.143.78
+123.10.143.213
  123.10.153.139
  123.10.157.219
  123.10.159.123
+123.10.160.56
  123.10.160.80
  123.10.165.76
  123.10.179.118
-123.10.185.89
  123.10.2.38
  123.10.210.180
  123.10.213.244
-123.10.233.129
+123.10.226.219
+123.10.24.183
+123.10.24.204
  123.10.28.162
-123.10.30.220
+123.10.52.142
  123.10.52.160
-123.10.65.173
  123.10.66.106
-123.100.226.245
-123.101.174.165
  123.101.207.79
  123.103.204.38
  123.103.242.12
  123.103.88.252
  123.108.189.102
-123.108.191.173
  123.108.200.102
  123.108.201.133
  123.108.249.82
  123.108.252.170
  123.108.35.186
  123.108.50.41
-123.108.97.50
+123.109.52.57
  123.11.13.233
-123.11.15.31
-123.11.15.60
-123.11.153.26
  123.11.167.88
  123.11.193.137
  123.11.195.214
+123.11.2.198
  123.11.235.95
-123.11.3.55
  123.11.4.120
  123.11.4.81
  123.11.73.104
-123.11.78.100
  123.11.78.153
  123.11.78.82
  123.11.79.213
  123.11.88.180
  123.11.9.175
-123.11.94.15
  123.110.11.185
+123.110.117.146
  123.110.176.246
-123.110.179.122
  123.110.185.95
  123.110.19.248
  123.110.199.248
-123.110.232.8
-123.110.247.60
-123.110.41.115
-123.110.78.74
  123.111.109.117
+123.112.124.121
  123.112.125.5
-123.114.245.46
+123.114.205.46
  123.116.203.148
  123.116.223.45
-123.117.165.200
-123.117.172.179
-123.117.216.130
  123.117.76.23
  123.118.0.183
-123.118.137.175
  123.118.176.61
  123.118.76.18
  123.118.99.56
-123.119.233.28
-123.119.239.202
-123.12.151.137
  123.12.181.91
  123.12.196.134
  123.12.197.46
  123.12.221.108
-123.12.228.167
  123.12.229.211
  123.12.231.175
  123.12.233.247
  123.12.235.180
+123.12.242.241
  123.12.243.129
-123.12.38.151
  123.12.65.254
  123.120.191.135
-123.120.255.214
  123.120.8.253
  123.122.119.82
  123.122.160.149
@@ -23928,21 +19706,13 @@
  123.122.163.49
  123.122.232.190
  123.123.137.247
-123.124.16.125
-123.124.21.253
-123.124.21.254
-123.124.66.20
-123.124.71.106
-123.124.71.107
  123.125.194.150
  123.126.106.88
+123.126.34.176
  123.126.40.65
+123.126.77.34
  123.127.198.100
-123.127.222.120
-123.127.226.216
-123.127.226.217
  123.127.244.100
-123.128.124.161
  123.128.129.94
  123.128.131.167
  123.128.136.48
@@ -23958,30 +19728,20 @@
  123.128.245.251bin.sh
  123.129.130.188
  123.129.166.147
-123.129.217.141
  123.129.60.134
-123.129.60.221
  123.129.85.92
  123.129.93.210
-123.13.120.136
  123.13.120.172
-123.13.122.197
+123.13.123.114
  123.13.14.133
-123.13.155.31
  123.13.182.16
-123.13.197.221
-123.13.2.228
  123.13.210.89
-123.13.214.215
-123.13.22.13
  123.13.22.7
-123.13.245.203
  123.13.27.197
-123.13.57.220
+123.13.56.72
  123.13.62.125
-123.13.86.177
+123.13.99.117
  123.130.0.231
-123.130.1.189
  123.130.112.6
  123.130.112.86
  123.130.145.71
@@ -23991,14 +19751,12 @@
  123.130.19.225
  123.130.216.147
  123.130.236.87
-123.130.38.57
  123.130.39.60
  123.130.46.90
+123.130.5.239
  123.130.58.14
  123.130.92.27
  123.130.94.147
-123.131.134.18
-123.131.165.105
  123.132.129.11
  123.132.133.34
  123.132.138.160
@@ -24006,17 +19764,16 @@
  123.132.174.126
  123.132.227.30
  123.132.232.254
-123.132.46.188
-123.132.65.176
+123.132.34.120
  123.132.65.76
  123.133.147.228
  123.133.168.134
  123.133.186.156
  123.133.67.2
-123.133.78.120
-123.133.84.163
  123.133.86.55
+123.134.16.210
  123.134.16.254
+123.134.63.228
  123.135.10.227
  123.135.117.210
  123.135.144.82
@@ -24024,77 +19781,66 @@
  123.135.204.14
  123.135.205.139
  123.135.231.4
-123.135.48.209
  123.135.68.123
-123.135.81.20
  123.135.87.12
  123.136.104.2
  123.136.128.13
  123.136.26.35
  123.136.27.202
-123.139.189.43
-123.139.189.44
-123.139.189.45
-123.139.243.8
+123.139.156.3
+123.139.249.215
+123.139.29.34
+123.139.43.2
  123.139.56.148
  123.139.56.171
  123.139.56.238
-123.139.90.97
  123.14.104.224
-123.14.112.43
-123.14.116.89
+123.14.106.4
  123.14.117.157
-123.14.145.152
-123.14.145.35
-123.14.149.73
-123.14.173.12
+123.14.123.242
+123.14.147.215
+123.14.148.22
  123.14.199.130
-123.14.203.182
-123.14.248.189
-123.14.248.226
-123.14.255.78
+123.14.206.99
+123.14.248.128
  123.14.5.115
+123.14.64.111
+123.14.68.33
  123.14.71.183
  123.14.81.79
+123.14.84.40
  123.140.114.196
  123.140.114.252
  123.140.151.110
  123.140.250.171
  123.142.108.122
-123.142.205.52
-123.142.205.53
  123.142.37.166
  123.142.41.244
  123.142.5.138
-123.142.6.107
  123.143.203.194
  123.143.203.67
  123.143.224.42
-123.143.26.34
-123.143.3.46
  123.143.77.180
  123.143.77.252
  123.143.98.5
-123.144.114.131
-123.145.217.114
  123.146.114.40
-123.146.120.121
-123.146.133.207
-123.146.23.149
  123.148.140.145
  123.149.208.208
+123.149.208.50
  123.149.209.159
  123.149.209.245
  123.149.210.157
  123.149.210.245
+123.149.210.92
  123.149.212.118
  123.149.212.121
  123.149.212.162
  123.149.212.177
  123.149.213.142
+123.149.213.193
+123.149.213.196
  123.149.213.212
  123.149.215.168
-123.150.143.184
  123.150.244.226
  123.150.9.163
  123.150.9.74
@@ -24102,134 +19848,86 @@
  123.152.114.180
  123.152.47.110
  123.152.63.119
-123.153.120.49
-123.153.168.94
-123.153.56.209
  123.154.156.170
-123.154.183.219
  123.154.25.157
  123.154.25.32
  123.154.251.103
+123.154.54.4
  123.154.95.216
  123.155.118.136
  123.155.120.60
-123.156.225.30
  123.156.29.62
-123.157.102.179
-123.157.164.142
  123.157.234.230
  123.158.48.119
  123.158.61.81
-123.159.11.126
-123.159.139.67
-123.159.144.210
  123.159.167.26
-123.159.68.31
  123.159.70.163
-123.16.128.216
-123.16.137.11
  123.16.15.201
-123.16.150.82
+123.16.184.171
  123.16.188.2
  123.16.195.44
-123.16.237.181
-123.16.255.18
+123.16.233.239
+123.16.243.159
  123.16.32.175
  123.16.32.204
-123.16.56.159
+123.16.38.140
+123.16.53.97
  123.16.64.233
-123.161.103.25
  123.161.202.55
-123.161.211.7
-123.162.182.243
  123.163.115.63
  123.163.116.132
  123.163.116.241
  123.163.122.122
  123.163.97.210
  123.164.108.177
-123.166.133.109
  123.169.102.82
  123.169.103.130
  123.169.37.105
  123.169.96.133
  123.170.221.178
  123.170.236.117
-123.171.1.153
-123.171.1.175
-123.171.1.226
  123.172.249.109
  123.176.158.247
  123.176.25.234
-123.176.38.66
  123.176.38.70
  123.177.19.13
-123.178.140.234
  123.178.150.230
  123.178.21.139
-123.178.214.189
-123.178.214.195
-123.178.30.66
-123.18.206.15
  123.180.140.101
  123.181.235.123
  123.181.235.187
  123.182.143.222
-123.182.176.13
  123.182.255.52
  123.183.117.82
  123.183.119.42
  123.183.119.98
-123.183.163.66
  123.183.17.66
  123.183.172.85
-123.184.16.66
+123.183.174.220
  123.185.202.12
-123.187.108.223
-123.189.100.171
-123.189.136.62
-123.189.185.164
-123.190.197.40
-123.190.84.174
+123.190.190.225
+123.190.69.57
  123.191.241.120
  123.192.101.163bin.sh
-123.192.208.68
-123.192.33.121
-123.193.115.68
  123.193.149.235
  123.193.196.232
-123.193.21.119
-123.193.229.224
-123.193.231.14
-123.193.81.252
-123.193.89.161
-123.194.118.231
-123.194.186.211
  123.194.52.79
-123.194.80.150
-123.194.80.219
-123.195.106.186
-123.195.60.186
  123.195.60.250
-123.195.84.119
-123.195.84.47
  123.195.98.141
  123.195.99.9
-123.196.116.245
  123.20.123.129
-123.20.141.34
-123.20.170.77
-123.20.181.92
-123.20.183.152
-123.20.184.42
-123.20.250.77
+123.20.125.129
+123.20.152.167
+123.20.211.250
+123.20.24.214
+123.20.245.146
+123.20.25.76
  123.20.38.154
  123.20.4.98
  123.20.5.138
-123.20.50.245
-123.20.57.23
+123.20.59.185
+123.20.95.249
  123.200.11.230
-123.200.117.29
  123.200.143.234
  123.200.15.218
  123.200.20.242
@@ -24242,29 +19940,18 @@
  123.200.9.53
  123.200.94.152
  123.201.124.74
-123.201.150.244
  123.201.165.121
  123.201.178.131
-123.201.192.217
  123.201.21.234
  123.201.24.38
  123.202.163.232
-123.202.194.67
  123.203.134.234
  123.203.163.128
  123.203.64.91
-123.204.228.37
-123.204.47.34
-123.205.162.201
-123.205.163.69
-123.205.169.115
-123.205.179.16
-123.205.179.79
-123.205.185.248
-123.205.46.27
  123.206.103.61
  123.206.104.110
  123.206.104.162
+123.206.111.243
  123.206.111.27
  123.206.118.47
  123.206.13.48
@@ -24273,9 +19960,7 @@
  123.206.21.48
  123.206.216.65
  123.206.219.211
-123.206.220.246
  123.206.228.179
-123.206.229.59
  123.206.23.158
  123.206.230.43
  123.206.232.235
@@ -24285,15 +19970,12 @@
  123.206.30.76
  123.206.31.61
  123.206.33.56
-123.206.34.88
  123.206.38.253
  123.206.41.68
-123.206.45.179
  123.206.46.250
+123.206.50.168
  123.206.51.192
  123.206.53.230
-123.206.54.218
-123.206.54.78
  123.206.62.112
  123.206.63.78
  123.206.67.211
@@ -24303,7 +19985,6 @@
  123.206.81.59
  123.206.82.140
  123.206.83.78
-123.206.87.233
  123.206.90.149
  123.206.95.243
  123.207.1.67
@@ -24320,12 +20001,7 @@
  123.207.140.131
  123.207.142.208
  123.207.144.186
-123.207.145.66
  123.207.146.122
-123.207.153.52
-123.207.154.28
-123.207.155.210
-123.207.156.55
  123.207.175.111
  123.207.186.215
  123.207.186.225
@@ -24342,17 +20018,13 @@
  123.207.221.66
  123.207.23.120
  123.207.237.163
-123.207.241.112
  123.207.241.226
  123.207.250.132
-123.207.251.54
  123.207.27.242
-123.207.34.86
  123.207.36.21
  123.207.52.90
  123.207.54.49
  123.207.58.160
-123.207.60.21
  123.207.66.80
  123.207.74.24
  123.207.78.75
@@ -24370,58 +20042,47 @@
  123.209.202.47
  123.209.243.236
  123.209.93.122
-123.21.166.54
+123.21.117.183
+123.21.148.12
+123.21.148.249
  123.21.179.41
-123.21.185.125
  123.21.199.55
  123.21.2.115
-123.21.205.98
+123.21.221.199
  123.21.235.72
-123.21.236.155
-123.21.25.104
-123.21.254.19
+123.21.247.221
  123.21.29.80
+123.21.6.239
+123.21.7.59
+123.21.97.134
  123.212.124.25
  123.212.29.154
  123.213.147.113
-123.213.230.85
  123.213.70.176
  123.214.143.122
-123.22.212.99
  123.22.221.53
+123.22.227.178
  123.220.219.202
  123.220.251.190
-123.225.49.249
-123.225.50.199
  123.231.105.103
-123.231.105.12
  123.231.105.169
  123.231.124.97
-123.231.132.202
  123.231.160.98
-123.231.165.18
  123.231.230.58
-123.231.239.246
  123.231.65.170
  123.232.170.69
-123.232.19.194
-123.232.192.179
  123.232.42.210
-123.233.116.36
  123.233.138.83
  123.233.185.116
  123.234.100.128
-123.234.112.149
  123.234.124.66
  123.234.124.66bin.sh
  123.234.131.230
-123.234.174.226
  123.234.191.51
  123.234.231.32
  123.234.250.15
  123.234.45.126
  123.234.7.109
-123.234.75.130
  123.235.120.142
  123.235.16.150
  123.235.162.73
@@ -24435,101 +20096,78 @@
  123.235.241.128
  123.235.247.118
  123.235.254.223
-123.235.49.206
  123.235.82.206
  123.235.97.38
  123.236.91.45
  123.24.206.9
+123.24.249.50
  123.24.26.248
  123.240.124.159
-123.240.147.79
-123.240.157.169
-123.240.224.116
-123.240.7.178
-123.241.11.33
+123.240.199.36
  123.241.140.20
-123.241.18.52
  123.241.195.209
-123.241.211.103
-123.241.250.241
-123.241.32.184
-123.241.64.244
+123.241.195.237
  123.242.179.10
-123.243.36.101
  123.245.4.100
+123.245.4.192
  123.245.4.194
  123.245.4.200
  123.245.4.21
  123.245.4.250
  123.245.4.38
  123.245.4.56
+123.245.5.24
  123.245.58.142
-123.245.58.187
+123.245.58.226
  123.245.58.227
+123.245.58.89
  123.249.26.47
  123.25.1.66
  123.25.116.228
  123.25.239.31
-123.25.30.146
  123.252.161.249
  123.252.188.186
  123.252.203.196
  123.252.218.62
  123.253.0.42
+123.253.125.193
+123.253.126.227
  123.253.36.99
  123.254.111.40
  123.26.153.152
  123.27.3.246
  123.27.56.144
-123.27.75.127
-123.28.129.193
-123.29.69.17
-123.30.100.180
-123.30.109.198
  123.30.109.21
-123.30.109.56
  123.30.111.19
  123.30.127.139
  123.30.128.138
  123.30.143.144
  123.30.149.34
  123.30.149.76
-123.30.154.157
  123.30.169.120
-123.30.176.62
-123.30.181.234
  123.30.186.170
  123.30.186.171
-123.30.188.213
  123.30.191.186
  123.30.211.6
  123.30.236.149
-123.30.237.51
-123.30.246.169
  123.30.249.49
+123.30.50.74
  123.31.12.113
-123.31.17.69
  123.31.27.102
  123.31.31.12
  123.31.32.150
  123.31.41.31
-123.31.43.116
-123.31.43.238
  123.31.45.49
-123.4.146.231
+123.4.132.237
  123.4.166.226
-123.4.179.121
-123.4.203.168
-123.4.218.115
-123.4.246.182
  123.4.249.127
-123.4.48.201
-123.4.48.70
  123.4.54.219
+123.4.64.97
+123.4.69.190
  123.4.69.229
-123.4.79.178
+123.4.80.152
  123.4.80.153
-123.4.80.199
+123.4.82.179
  123.4.83.114
  123.4.85.148
  123.4.85.211
@@ -24540,66 +20178,45 @@
  123.4.91.169
  123.4.92.201
  123.4.92.227
-123.4.93.5
-123.4.93.61
-123.4.94.88
+123.4.94.253
  123.4.95.197
  123.49.41.129
-123.49.47.238
-123.49.47.241
  123.49.59.150
-123.5.128.203
-123.5.136.162
-123.5.148.65
-123.5.149.207
+123.5.150.0
+123.5.150.105
  123.5.151.192
+123.5.180.175
  123.5.184.250
-123.5.186.207
-123.5.188.109
-123.5.188.3
  123.5.189.23
+123.5.189.27
  123.5.4.107
  123.50.145.89
-123.50.153.161
-123.50.65.214
-123.50.89.54
  123.51.152.54
  123.51.168.240
  123.51.185.103
  123.51.185.39
  123.52.102.167
-123.52.43.85
  123.52.44.189
  123.53.181.22
-123.53.181.61
  123.53.181.8
-123.54.106.35
-123.55.106.173
-123.55.73.209
+123.54.3.154
  123.55.98.30
  123.56.115.29
-123.56.178.207
-123.56.211.174
-123.56.226.102
-123.56.243.82
-123.56.83.239
-123.57.137.43
+123.56.12.117
+123.56.41.101
+123.56.41.15
  123.57.150.34
  123.57.181.90
-123.57.208.161
-123.57.215.49
-123.57.216.112
  123.57.254.84
  123.57.61.38
  123.57.72.201
-123.57.82.217
+123.57.72.45
  123.58.109.42
-123.58.2.89
-123.58.33.249
  123.58.5.243
  123.58.5.36
  123.58.55.162
  123.58.7.223
+123.58.8.34
  123.59.1.83
  123.59.116.47
  123.59.118.224
@@ -24607,63 +20224,46 @@
  123.59.120.167
  123.59.120.251
  123.59.147.250
-123.59.182.184
-123.59.194.116
  123.59.194.227
-123.59.194.242
-123.59.194.42
-123.59.194.83
-123.59.195.125
  123.59.195.16
  123.59.195.173
-123.59.195.207
-123.59.195.7
-123.59.198.48
  123.59.209.197
  123.59.210.198
  123.59.210.240
  123.59.210.252
  123.59.213.10
-123.59.213.173
-123.59.229.55
-123.59.230.66
-123.59.232.188
-123.59.28.230
-123.59.28.66
  123.59.62.57
  123.59.72.15
  123.6.5.104
-123.6.51.133
  123.60.167.10
  123.63.133.253
  123.63.242.115
  123.63.54.229
-123.7.40.185
  123.7.63.49
-123.7.66.13
+123.8.128.204
  123.8.129.19
-123.8.173.147
+123.8.178.95
  123.8.189.177
  123.8.190.0
  123.8.190.236
-123.8.229.217
+123.8.244.110
+123.8.249.153
  123.8.250.11
-123.8.27.131
-123.9.100.109
-123.9.101.178
+123.8.33.87
+123.8.49.187
+123.8.52.193
  123.9.111.220
  123.9.177.30
  123.9.181.216
-123.9.200.51
+123.9.194.233
+123.9.200.113
  123.9.204.224
-123.9.237.160
-123.9.238.17
-123.9.85.83
-123.9.99.32
-123.97.104.255
-123.97.145.47
+123.9.216.214
+123.9.232.39
+123.9.246.168
+123.97.128.233
+123.97.136.125
  123.97.154.113
-123.99.120.184
  123.ltscr.cn
  123123123112312323.000webhostapp.com
  123123231.xyz
@@ -24704,6 +20304,7 @@
  124.105.173.17
  124.105.29.181
  124.105.55.176
+124.106.227.40
  124.106.31.181
  124.107.185.189
  124.107.185.3
@@ -24712,30 +20313,24 @@
  124.109.1.58
  124.109.27.226
  124.109.3.193
-124.109.36.145
  124.109.44.126
  124.109.52.72
-124.109.55.182
-124.11.16.21
-124.110.78.97
  124.111.53.213
-124.113.224.207
-124.114.128.90
+124.112.88.20
+124.112.88.242
+124.112.89.151
+124.112.89.70
+124.112.90.214
+124.112.90.98
+124.112.91.189
  124.114.141.46
-124.114.177.237
-124.114.203.162
-124.115.106.150
  124.115.137.150
-124.115.139.42
  124.115.146.99
  124.115.205.246
-124.115.220.123
  124.115.39.135
-124.116.188.139
-124.117.248.14
  124.118.137.10
-124.118.16.178
  124.118.186.230
+124.118.4.24
  124.118.9.75
  124.119.107.231
  124.119.138.104
@@ -24744,46 +20339,34 @@
  124.119.139.173
  124.119.139.245
  124.119.63.243
-124.119.89.207
  124.120.187.152
  124.120.45.128
  124.120.86.148
-124.120.86.209
-124.120.86.33
  124.121.172.60
+124.121.173.78
  124.121.18.123
  124.121.18.41
  124.121.18.67
  124.121.183.190
-124.121.19.231
-124.121.191.123
  124.121.193.81
  124.121.20.21
  124.121.20.243
+124.121.202.109
  124.122.120.17
  124.122.28.96
  124.122.55.37
-124.123.107.115
  124.123.165.230
  124.123.175.174
  124.123.77.175
  124.123.98.19
-124.123.99.116
  124.124.197.72
  124.126.18.130
  124.126.18.162
-124.126.229.98
-124.127.133.114
-124.127.38.154
  124.127.42.42
-124.127.43.244
-124.127.43.245
-124.128.157.147
+124.128.103.74
  124.128.39.226
  124.128.57.114
-124.128.90.220
  124.129.126.228
-124.129.136.27
  124.129.153.168
  124.129.161.127
  124.129.169.133
@@ -24794,13 +20377,8 @@
  124.129.50.45
  124.129.57.35
  124.129.59.57
-124.13.164.71
-124.13.201.68
  124.13.248.206
  124.130.164.91
-124.130.35.151
-124.130.66.234
-124.130.73.97
  124.130.81.63
  124.131.106.204
  124.131.109.149
@@ -24808,40 +20386,29 @@
  124.131.133.20
  124.131.135.61
  124.131.139.201
-124.131.147.209
  124.131.148.49
-124.131.148.50
  124.131.149.131
  124.131.152.148
+124.131.152.183
  124.131.154.106
  124.131.155.162
  124.131.159.142
-124.131.16.31
  124.131.239.254
  124.131.38.88
-124.131.41.91
  124.131.42.44
  124.131.51.163
-124.131.92.104
-124.132.151.53
  124.133.183.40
-124.133.2.16
  124.133.229.90
-124.133.230.74
  124.133.246.74
  124.133.252.204
-124.133.253.178
-124.133.28.50
  124.133.34.186
  124.133.99.67
-124.134.160.83
  124.135.11.47
  124.135.165.168
  124.135.38.251
  124.135.42.214
  124.135.5.0
  124.135.57.53
-124.135.90.60
  124.136.23.172
  124.137.205.59
  124.138.115.131
@@ -24859,9 +20426,7 @@
  124.152.109.123
  124.152.118.131
  124.152.118.194
-124.152.140.133
  124.152.158.35
-124.152.47.154
  124.152.57.24
  124.152.76.174
  124.153.136.175
@@ -24872,12 +20437,12 @@
  124.156.108.171
  124.156.112.181
  124.156.114.53
+124.156.121.192
  124.156.135.221
  124.156.138.134
  124.156.139.91
  124.156.139.95
  124.156.140.217
-124.156.143.42
  124.156.146.132
  124.156.148.119
  124.156.149.127
@@ -24889,248 +20454,67 @@
  124.156.154.194
  124.156.157.84
  124.156.168.117
-124.156.180.178
  124.156.180.189
-124.156.192.221
-124.156.192.62
+124.156.185.140
  124.156.193.90
-124.156.194.166
-124.156.196.246
-124.156.197.29
-124.156.198.92
-124.156.200.106
-124.156.200.237
-124.156.200.92
-124.156.204.178
  124.156.205.236
-124.156.208.90
-124.156.210.134
-124.156.210.20
-124.156.210.250
-124.156.211.107
-124.156.211.137
-124.156.211.97
  124.156.217.41
-124.156.218.111
-124.156.218.232
  124.156.218.50
  124.156.218.80
  124.156.225.138
  124.156.225.159
-124.156.228.197
  124.156.228.210
-124.156.238.241
-124.156.240.118
-124.156.240.138
-124.156.240.14
-124.156.240.194
-124.156.240.215
-124.156.240.219
-124.156.240.58
-124.156.240.79
-124.156.241.168
-124.156.241.17
-124.156.241.170
-124.156.241.180
-124.156.241.185
-124.156.241.217
-124.156.241.236
-124.156.241.237
-124.156.241.29
-124.156.241.4
-124.156.241.52
-124.156.241.62
-124.156.241.88
-124.156.244.126
-124.156.244.173
-124.156.244.21
-124.156.244.4
-124.156.244.69
-124.156.245.149
-124.156.245.155
-124.156.245.157
-124.156.245.159
-124.156.245.162
-124.156.245.194
-124.156.245.248
-124.156.245.249
-124.156.50.108
-124.156.50.110
-124.156.50.111
-124.156.50.118
-124.156.50.12
-124.156.50.120
-124.156.50.129
-124.156.50.145
-124.156.50.148
-124.156.50.149
-124.156.50.158
-124.156.50.171
-124.156.50.191
-124.156.50.196
-124.156.50.229
-124.156.50.239
-124.156.50.241
-124.156.50.249
-124.156.50.36
-124.156.50.43
-124.156.50.52
-124.156.50.64
-124.156.50.77
-124.156.50.82
-124.156.50.88
-124.156.50.89
-124.156.50.94
-124.156.50.96
-124.156.51.16
-124.156.54.103
-124.156.54.111
-124.156.54.114
-124.156.54.162
-124.156.54.177
-124.156.54.190
-124.156.54.234
-124.156.54.244
-124.156.54.249
-124.156.54.50
-124.156.54.68
-124.156.54.74
-124.156.54.88
-124.156.55.107
-124.156.55.141
-124.156.55.143
-124.156.55.156
-124.156.55.167
-124.156.55.172
-124.156.55.181
-124.156.55.20
-124.156.55.202
-124.156.55.205
-124.156.55.21
-124.156.55.214
-124.156.55.222
-124.156.55.225
-124.156.55.236
-124.156.55.244
-124.156.55.248
-124.156.55.36
-124.156.55.45
-124.156.55.67
-124.156.55.99
-124.156.62.116
-124.156.62.138
-124.156.62.15
-124.156.62.183
-124.156.62.187
-124.156.62.201
-124.156.63.188
-124.156.63.192
-124.156.63.221
-124.156.64.11
-124.156.64.176
-124.156.64.185
-124.156.64.22
-124.156.64.236
-124.156.64.50
-124.156.64.88
  124.156.98.11
  124.156.98.172
  124.156.99.101
  124.158.105.58
-124.158.11.197
  124.158.12.202
-124.158.125.75
  124.158.144.186
  124.158.144.187
  124.158.150.205
  124.158.160.131
-124.158.164.146
  124.158.175.2
-124.158.177.171
  124.158.179.122
  124.158.179.13
  124.158.179.158
  124.158.179.222
-124.16.102.20
-124.16.128.251
-124.16.161.211
-124.16.183.248
  124.16.4.5
  124.16.75.148
  124.16.75.150
-124.16.75.28
-124.160.121.90
  124.160.126.238
-124.160.130.12
-124.160.165.27
  124.160.17.218
  124.160.83.138
-124.160.91.132
  124.160.96.242
  124.160.96.249
  124.163.103.219
  124.163.131.196
  124.163.144.140
+124.163.165.71
  124.163.174.166
-124.163.212.124
-124.163.231.73
  124.163.39.35
+124.163.64.105
  124.163.96.71
-124.165.157.101
-124.165.210.78
-124.165.227.18
-124.166.146.115
-124.166.153.233
-124.166.22.25
-124.166.254.253
  124.167.226.214
  124.167.248.230
-124.167.82.187
  124.169.36.212
  124.170.100.48
  124.170.109.83
-124.172.190.9
-124.172.220.153
+124.170.27.79
+124.172.152.184
  124.172.232.49
  124.172.232.57
-124.182.230.85
+124.176.30.150
  124.187.40.93
-124.189.0.10
  124.190.217.63
  124.193.106.107
-124.193.191.52
-124.193.212.34
-124.193.218.66
-124.193.236.144
  124.193.98.166
  124.194.83.172
-124.195.164.216
  124.195.190.173
-124.195.191.112
-124.195.213.235
-124.195.228.39
-124.195.254.146
-124.199.97.140
-124.200.103.26
-124.200.176.54
-124.200.190.42
  124.202.180.190
-124.202.199.146
-124.204.45.66
-124.204.74.226
  124.205.108.64
-124.205.111.60
  124.205.119.183
  124.205.139.75
-124.205.183.42
-124.205.183.45
-124.205.194.34
-124.205.211.194
  124.205.224.202
-124.205.226.1
-124.205.230.78
-124.205.29.18
-124.205.72.95
  124.205.84.11
  124.205.84.12
  124.205.84.14
@@ -25144,114 +20528,63 @@
  124.205.84.8
  124.205.84.9
  124.205.91.182
-124.206.162.195
-124.207.102.94
  124.207.128.234
  124.207.165.138
-124.207.183.107
-124.207.197.130
  124.207.221.66
  124.207.29.72
-124.207.55.171
  124.207.98.213
  124.217.230.195
  124.217.235.180
  124.217.235.186
  124.217.242.70
  124.217.249.34
-124.218.17.12
-124.218.87.192
-124.218.91.132
-124.219.105.17
-124.219.176.139
  124.219.23.225
-124.225.17.145
-124.225.66.198
-124.226.213.129
-124.226.233.227
-124.226.235.42
-124.226.29.18
+124.226.219.166
  124.227.115.39
-124.227.119.143
+124.227.196.97
  124.228.213.100
-124.229.160.53
-124.230.173.73
+124.228.54.171
  124.230.175.141
  124.230.175.167
  124.230.175.209
  124.232.133.205
-124.232.150.148
-124.232.154.47
  124.232.163.10
-124.233.2.82
-124.234.141.247
-124.234.141.254
-124.234.220.222
-124.235.118.14
  124.235.171.114
  124.235.216.248
-124.235.241.20
-124.235.249.87
  124.236.111.11
-124.236.118.135
  124.236.22.12
-124.236.22.92
-124.236.24.220
-124.236.24.225
-124.236.24.233
-124.236.24.249
  124.237.75.74
  124.238.113.126
-124.238.118.20
-124.238.57.35
-124.238.62.250
  124.239.148.63
  124.239.153.215
  124.239.168.74
+124.239.215.250
  124.239.216.233
-124.239.221.236
  124.239.79.194
  124.240.198.66
  124.244.12.242
  124.244.153.2
-124.244.180.110
  124.248.165.247
  124.248.165.54
-124.248.173.184
-124.248.173.186
-124.248.177.136
  124.248.177.193
  124.248.177.196
  124.248.190.215
-124.248.190.76
  124.248.227.130
  124.248.240.40
-124.248.48.106
-124.25.179.234
  124.250.244.4
  124.250.50.135
  124.251.110.147
  124.251.110.148
  124.251.23.153
-124.253.120.244
-124.253.137.125
  124.253.204.157
  124.28.218.130
  124.29.200.215
  124.29.200.46
-124.29.205.2
-124.29.209.22
+124.29.232.90
  124.29.236.163
  124.29.237.240
-124.29.240.185
-124.29.245.141
-124.29.248.208
+124.29.244.83
  124.30.44.214
-124.31.204.116
-124.31.204.119
-124.31.244.89
-124.40.244.229
-124.40.244.254
  124.40.248.202
  124.41.197.40
  124.41.211.110
@@ -25276,49 +20609,28 @@
  124.41.243.22
  124.41.243.31
  124.41.243.72
-124.42.239.151
  124.43.12.185
-124.43.129.107
  124.43.177.160
-124.43.8.43
  124.43.9.184
  124.44.105.167
  124.45.106.173
  124.47.8.10
  124.49.100.254
  124.5.55.197
-124.5.74.161
  124.5.74.161bin.sh
  124.50.73.93
  124.51.247.48
-124.51.60.134
-124.6.1.218
  124.6.153.84
  124.61.214.44
-124.64.16.68
  124.64.64.3
  124.65.117.38
-124.65.120.30
-124.65.130.234
  124.65.130.86
  124.65.144.38
-124.65.152.42
-124.65.158.254
-124.65.165.2
-124.65.168.58
  124.65.181.218
  124.65.181.78
  124.65.241.154
-124.65.244.6
-124.65.50.126
-124.65.51.34
  124.65.9.5
  124.66.49.34
-124.67.203.87
-124.67.255.183
-124.67.66.46
-124.67.66.74
-124.67.89.112
  124.67.89.18
  124.67.89.238
  124.67.89.3
@@ -25330,18 +20642,7 @@
  124.67.89.70
  124.67.89.74
  124.67.89.76
-124.67.90.239
  124.7.132.100
-124.7.139.210
-124.70.142.171
-124.70.158.102
-124.70.183.112
-124.70.194.254
-124.70.76.65
-124.70.88.117
-124.71.166.56
-124.71.35.81
-124.74.10.122
  124.74.248.218
  124.75.27.100
  124.75.27.102
@@ -25349,14 +20650,11 @@
  124.77.101.222
  124.77.141.225
  124.77.94.83
-124.78.10.187
-124.78.116.110
-124.78.9.28
  124.80.43.108
  124.81.236.122
  124.81.239.170
-124.81.84.130
  124.82.119.11
+124.82.222.209
  124.83.101.49
  124.89.116.178
  124.89.2.42
@@ -25365,8 +20663,6 @@
  124.90.48.120
  124.90.48.129
  124.90.48.134
-124.90.54.231
-124.90.55.170
  124.91.132.236
  124.91.133.220
  124.91.134.195
@@ -25374,116 +20670,123 @@
  124.91.186.192bin.sh
  124.91.187.47
  124.91.21.155
-124.91.210.88
  124.91.223.31
  124.91.226.216
  124.91.236.160
  124.91.236.96
  124.91.6.249
-124.92.132.221
-124.92.143.3
  124.93.201.59
  124.93.222.211
-124.94.144.184
  124.94.18.108
  124.95.143.135
-124.95.165.194
+124.95.171.196
+124.95.171.230
  124.cpanel.realwebsitesite.com
  1241.31cf4fdae.com
  124667.prohoster.biz
  124insta3gram.000webhostapp.com
-125.104.101.249
+125.104.104.187
+125.104.105.147
  125.104.107.122
  125.104.231.209
  125.104.252.53
-125.104.96.181
+125.104.99.185
  125.105.68.167
  125.106.67.140
-125.108.195.244
-125.109.132.50
+125.109.195.229
  125.111.76.228
-125.115.182.47
-125.119.15.1
+125.117.170.114
+125.118.8.84
+125.119.40.168
+125.119.40.244
+125.119.42.132
+125.119.42.17
+125.119.42.6
+125.119.43.188
+125.119.43.43
+125.119.43.57
+125.119.44.117
+125.119.45.62
+125.119.46.118
+125.119.64.111
+125.119.64.204
+125.119.64.8
+125.119.65.251
+125.119.65.91
+125.119.66.168
+125.119.66.217
+125.119.67.138
+125.119.67.95
  125.119.69.93
  125.120.109.141
  125.120.149.124
  125.120.220.40
  125.120.237.87
+125.121.128.236
+125.121.129.124
+125.121.130.181
+125.121.133.98
+125.121.134.150
+125.121.134.38
+125.121.134.48
+125.121.136.16
+125.121.136.163
+125.121.136.59
+125.121.137.202
+125.121.138.158
+125.121.139.19
+125.121.169.61
+125.121.170.72
+125.121.171.130
+125.121.172.187
+125.121.174.118
+125.121.175.119
+125.121.175.66
+125.121.175.75
+125.121.175.89
  125.121.182.88
  125.121.237.146
-125.123.241.164
  125.123.64.152
-125.124.115.158
-125.124.117.226
-125.124.120.123
  125.124.157.48
  125.124.179.36
-125.124.188.37
-125.124.193.203
-125.124.209.123
  125.124.215.222
  125.124.254.31
-125.124.30.186
  125.124.38.96
  125.124.44.135
-125.124.54.29
  125.124.59.64
-125.124.69.65
-125.124.70.104
  125.124.72.157
-125.124.97.15
  125.125.116.242
  125.125.17.45
-125.125.239.233
  125.125.26.252
  125.125.70.253
-125.125.75.138
  125.126.254.180
  125.126.84.109
  125.126.86.109
  125.128.163.100
-125.128.241.71
  125.129.2.104
-125.129.212.72
  125.130.148.206
  125.131.73.90
  125.132.218.97
-125.132.224.207
-125.132.66.184
  125.132.73.28
-125.133.112.38
-125.133.196.136
-125.133.244.178
  125.133.92.3
  125.134.100.153
  125.134.100.165
  125.134.140.83
  125.134.140.85
  125.134.140.86
-125.134.168.91
  125.134.170.112
  125.134.170.114
-125.134.191.228
  125.134.21.20
  125.134.88.34
  125.135.221.94
+125.135.252.3
  125.135.44.75
-125.136.164.203
-125.136.225.170
-125.136.25.86
-125.136.25.89
-125.136.34.241
-125.136.34.91
-125.136.45.119
-125.136.45.8
-125.136.93.202
  125.137.11.141
  125.137.15.15
  125.137.191.115
  125.137.191.215
  125.137.60.235
  125.138.129.101
-125.138.191.58
  125.139.236.180
  125.140.106.67
  125.140.159.29
@@ -25513,13 +20816,9 @@
  125.141.56.231
  125.141.63.90
  125.141.91.138
-125.142.174.184
-125.142.180.120
  125.142.211.237
+125.143.229.253
  125.143.3.230
-125.143.66.146
-125.143.70.215
-125.143.76.198
  125.143.76.27
  125.16.134.218
  125.16.217.170
@@ -25529,12 +20828,14 @@
  125.160.207.65
  125.160.213.234
  125.160.52.182
+125.160.61.129
  125.161.111.107
+125.161.131.74
+125.161.136.22
  125.161.138.6
  125.161.31.225
  125.162.120.80
  125.162.84.130
-125.163.113.88
  125.163.135.83
  125.163.144.220
  125.163.145.164
@@ -25542,25 +20843,21 @@
  125.163.160.229
  125.163.161.151
  125.163.169.49
-125.163.37.58
+125.163.58.244
  125.163.61.108
-125.164.139.233
-125.164.179.58
-125.164.217.2
-125.164.239.37
  125.164.40.226
-125.164.84.157
-125.164.89.93
  125.164.97.0
  125.165.108.192
-125.165.114.188
+125.165.112.210
+125.165.112.254
  125.165.179.254
-125.165.190.185
  125.165.96.116
  125.166.12.118
  125.166.121.24
-125.166.42.15
-125.167.149.171
+125.166.127.218
+125.166.211.112
+125.166.68.125
+125.167.190.58
  125.167.32.158
  125.167.61.243
  125.167.71.89
@@ -25568,51 +20865,39 @@
  125.168.111.80
  125.168.13.64
  125.168.145.66bin.sh
-125.168.226.251
  125.17.115.94
+125.17.90.10
+125.173.165.160
  125.178.227.57
  125.179.61.164
+125.18.26.61
  125.187.28.18
-125.189.150.159
  125.19.153.156
-125.19.16.194
  125.19.99.90
  125.191.113.212
  125.206.38.159bin.sh
-125.208.8.240
-125.208.83.123
  125.208.95.222
  125.209.115.186
  125.209.116.138
  125.209.116.234
  125.209.127.30
-125.209.16.112
-125.209.173.153
  125.209.235.170
  125.209.235.175
  125.209.235.182
  125.209.235.183
  125.209.67.74
-125.209.75.222
-125.209.81.202
  125.209.82.78
-125.209.98.218
+125.21.123.234
  125.21.43.82
-125.211.111.19
-125.211.166.243
-125.211.197.145
-125.211.197.254
-125.211.197.87
-125.211.216.221
-125.212.192.7
+125.212.144.250
  125.212.193.1
  125.212.193.207
  125.212.193.208
  125.212.193.46
  125.212.193.96
  125.212.203.113
-125.212.217.214
  125.212.219.42
+125.212.221.113
  125.212.224.103
  125.212.224.41
  125.212.225.167
@@ -25623,68 +20908,42 @@
  125.212.251.61
  125.213.128.88
  125.213.150.219
-125.215.121.155
+125.215.164.86
  125.215.205.180
  125.215.207.40
  125.215.207.44
  125.22.246.216
  125.22.9.186
-125.224.213.99
-125.224.94.91
-125.227.0.210
-125.227.118.14
-125.227.120.209
-125.227.120.79
+125.224.204.248
  125.227.130.2
  125.227.141.115
  125.227.141.116
-125.227.166.78
-125.227.183.142
-125.227.200.196
-125.227.216.167
  125.227.221.223
-125.227.226.9
-125.227.228.203
-125.227.229.220
  125.227.236.60
  125.227.237.199
-125.227.24.10
-125.227.251.91
  125.227.255.79
-125.227.60.13
  125.227.60.218
-125.227.64.128
-125.227.65.86
  125.227.69.217
-125.227.94.131
-125.227.97.161
-125.227.99.136
  125.23.240.146
  125.231.101.159
  125.231.162.72
-125.234.162.22
-125.234.254.184
-125.235.235.116
-125.235.237.214
+125.234.144.160
+125.235.233.137
  125.236.215.133
  125.236.232.228
  125.24.1.52
-125.24.11.100
-125.24.11.253
  125.24.13.76
  125.24.13.89
+125.24.14.248
  125.24.15.112
  125.24.2.71
-125.24.36.71
-125.24.72.122
+125.24.230.154
  125.245.165.135
  125.247.211.3
  125.248.150.84
  125.25.101.186
  125.25.112.77
  125.25.114.166
-125.25.119.190
-125.25.126.238
  125.25.165.22
  125.25.165.28
  125.25.165.88
@@ -25693,20 +20952,14 @@
  125.25.165.97
  125.25.184.10
  125.25.184.78
-125.25.187.93
+125.25.203.112
  125.25.204.69
-125.25.235.25
-125.25.35.18
+125.25.23.218
+125.25.5.115
  125.25.78.8
  125.25.79.38
  125.25.80.86
-125.25.82.14
-125.25.83.117
-125.25.83.71
-125.25.83.81
  125.25.89.223
-125.25.89.9
-125.251.116.4
  125.251.133.3
  125.251.136.194
  125.251.147.194
@@ -25714,22 +20967,22 @@
  125.253.112.84
  125.253.125.138
  125.253.126.158
-125.253.126.175
  125.254.90.166
  125.254.91.1
  125.26.100.113
  125.26.108.170
-125.26.121.107
+125.26.109.183
  125.26.15.67
+125.26.15.68
  125.26.165.17
  125.26.165.244
+125.26.169.243
  125.26.178.210
  125.26.183.167
  125.26.183.223
-125.26.19.41
  125.26.192.248
-125.26.197.200
  125.26.23.244
+125.26.249.132
  125.26.49.154
  125.26.7.124
  125.26.7.83
@@ -25741,13 +20994,10 @@
  125.26.99.223
  125.26.99.228
  125.26.99.244
-125.26.99.76
  125.27.10.243
  125.27.10.84
  125.27.107.33
  125.27.121.139
-125.27.132.254
-125.27.201.164
  125.27.23.26
  125.27.251.124
  125.27.251.160
@@ -25759,326 +21009,220 @@
  125.27.251.57
  125.27.251.79
  125.27.251.87
-125.27.26.16
  125.27.26.201
-125.27.27.204
  125.27.27.80
  125.27.29.181
  125.27.30.81
  125.27.31.150
+125.27.4.8
  125.27.48.227
  125.27.6.104
  125.30.85.189
-125.32.95.22
  125.33.195.127
  125.33.29.134
  125.34.114.175
  125.34.240.29
  125.34.240.33
  125.34.25.228
-125.35.251.74
-125.36.149.81
  125.36.208.161
-125.36.92.10
  125.37.93.78
  125.38.22.176
-125.39.100.166
-125.39.11.27
-125.40.106.44
+125.38.82.168
  125.40.113.83
  125.40.114.24
-125.40.138.26
  125.40.146.254
-125.40.151.78
-125.40.18.126
-125.40.19.0
-125.40.2.139
-125.40.22.177
+125.40.160.7
  125.40.24.244
-125.40.24.80
  125.40.73.220
-125.40.74.20
  125.40.75.47
  125.40.8.189
-125.40.8.232
  125.40.91.15
-125.41.1.188
+125.41.0.253
  125.41.1.44
  125.41.109.123
+125.41.11.175
  125.41.113.122
  125.41.119.178
+125.41.12.155
  125.41.13.245
  125.41.13.34
-125.41.14.251
-125.41.158.182
-125.41.158.42
-125.41.161.20
+125.41.142.167
  125.41.172.19
-125.41.187.60
-125.41.190.42
  125.41.190.49
-125.41.190.85
  125.41.2.87
  125.41.204.217
  125.41.205.24bin.sh
-125.41.206.16
  125.41.207.209
  125.41.208.142
-125.41.208.98
  125.41.215.56
+125.41.219.11
+125.41.223.3
  125.41.227.161
-125.41.227.97
+125.41.230.214
  125.41.3.218
-125.41.5.183
-125.41.5.6
-125.41.6.77
+125.41.5.31
+125.41.75.14
  125.41.76.96
  125.41.80.120
  125.41.9.198
+125.41.96.91
+125.41.97.11
  125.41.97.114
  125.41.97.234
-125.41.97.81
  125.42.120.161
  125.42.120.183
  125.42.121.170
+125.42.121.196
  125.42.121.67
  125.42.122.137
  125.42.122.180
  125.42.122.72
-125.42.123.187
-125.42.127.109
+125.42.126.67
  125.42.127.139
+125.42.127.53
  125.42.127.80
  125.42.13.137
  125.42.192.48
+125.42.236.6
  125.42.239.99
-125.42.4.7
  125.42.42.75
  125.42.90.144
-125.42.96.110
-125.42.96.184
  125.42.97.24
-125.43.11.31
-125.43.112.116
+125.42.98.176
+125.43.10.90
  125.43.112.132
  125.43.113.1
-125.43.116.166
-125.43.124.206
-125.43.137.247
+125.43.124.135
  125.43.137.96
-125.43.203.167
-125.43.210.75
-125.43.214.189
-125.43.33.95
-125.43.34.181
-125.43.37.14
-125.43.37.155
+125.43.173.172
+125.43.20.224
  125.43.39.163
  125.43.50.22
-125.43.52.125
-125.43.6.138
+125.43.60.199
  125.43.62.27
-125.43.64.218
  125.43.69.155
  125.43.93.226
-125.44.10.37
-125.44.11.166
-125.44.11.25
+125.44.10.225
+125.44.152.42
  125.44.194.40
+125.44.211.98
  125.44.212.30
  125.44.215.58
-125.44.226.46
-125.44.228.179
  125.44.231.212
-125.44.234.84
-125.44.241.177
-125.44.29.66
-125.44.41.246
-125.44.44.47
-125.44.59.9
-125.44.61.26
+125.44.232.200
+125.44.28.115
+125.44.30.159
  125.44.8.248
-125.44.8.75
-125.45.125.107
+125.45.153.194
+125.45.154.84
  125.45.176.212
  125.45.179.132
+125.45.185.89
  125.45.186.236bin.sh
  125.45.25.13
+125.45.25.99
+125.45.40.27
  125.45.58.23
-125.45.64.197
  125.45.67.112bin.sh
  125.45.77.161
  125.45.78.176
  125.45.79.125
  125.45.81.145
-125.45.89.52
-125.45.91.189
-125.45.98.180
-125.46.11.67
+125.46.137.175
  125.46.163.117
-125.46.165.132
  125.46.167.195
-125.46.174.48
  125.46.182.194
+125.46.188.74
+125.46.190.31
  125.46.196.119
  125.46.197.224
  125.46.200.72
-125.46.201.224
  125.46.201.92
-125.46.206.152
-125.46.216.143
-125.46.218.211
+125.46.207.81
+125.46.218.213
+125.46.231.192
+125.46.236.173
  125.46.240.171
  125.46.240.179
  125.46.241.184
-125.46.32.106
-125.46.32.112
-125.46.32.98
  125.46.81.106
-125.46.97.138
  125.47.13.218
-125.47.143.224
-125.47.200.82
-125.47.201.44
  125.47.204.174
+125.47.205.117
+125.47.205.224
  125.47.211.71
-125.47.215.131
-125.47.22.75
  125.47.226.141
  125.47.226.219
  125.47.227.224
-125.47.232.198
  125.47.241.6
  125.47.241.60
+125.47.241.90
  125.47.243.187
  125.47.243.204
-125.47.244.206
  125.47.245.184
  125.47.245.198
  125.47.247.112
  125.47.249.227
-125.47.254.130
-125.47.255.106
-125.47.255.41
-125.47.34.120
-125.47.47.168
+125.47.251.145
+125.47.52.28
+125.47.53.172
  125.47.55.90
+125.47.63.120
+125.47.64.172
  125.47.65.10
  125.47.65.136
  125.47.74.248
  125.47.85.43
-125.47.87.242
  125.47.89.119
+125.47.89.43
  125.47.90.241
  125.47.91.191
  125.47.95.163
  125.47.99.95
  125.5.180.84
  125.5.184.218
-125.56.118.132
  125.57.214.79
-125.58.101.67
  125.59.157.236
-125.59.190.15
-125.59.215.25
-125.62.178.185
+125.62.192.132
  125.62.198.65
  125.62.213.18
  125.62.213.30
  125.62.213.94
  125.62.214.174
-125.62.221.161
-125.62.221.205
-125.62.222.189
-125.62.222.216
-125.62.223.19
-125.64.103.101
-125.64.103.2
-125.64.103.3
-125.64.103.8
-125.64.103.9
-125.64.103.91
-125.64.103.93
-125.64.103.94
-125.64.103.95
-125.64.103.96
-125.64.103.98
-125.64.16.53
-125.64.228.173
  125.64.54.23
-125.64.94.136
-125.64.94.137
-125.64.94.138
-125.65.112.130
  125.65.112.161
  125.65.112.168
-125.65.112.226
+125.65.42.38
  125.65.77.120
  125.65.79.156
  125.65.79.161
  125.65.79.68
  125.65.82.7
  125.65.92.104
-125.66.103.101
  125.66.106.2
-125.66.2.157
-125.66.243.1
-125.67.228.232
  125.67.239.82
-125.68.150.36
+125.67.9.113
  125.68.172.20
-125.68.57.100
-125.69.149.161
+125.69.101.110
  125.69.161.113
-125.69.164.105
-125.69.56.139
-125.69.67.94
-125.69.78.131
-125.69.92.178
  125.69.92.5
-125.70.163.216
-125.70.227.25
  125.70.244.4
  125.70.253.149
-125.70.26.198
-125.71.118.229
-125.71.214.48
-125.71.239.135
-125.71.239.216
-125.72.100.110
  125.72.106.75
-125.72.17.5
-125.72.218.35
-125.73.131.213
-125.73.206.164
  125.74.193.194
  125.74.196.136
-125.74.27.36
  125.74.28.200
  125.74.28.28
  125.74.55.161
-125.75.114.6
-125.75.128.12
-125.75.128.231
-125.75.8.68
-125.76.161.136
  125.76.177.233
  125.76.177.240
-125.76.228.32
  125.76.230.10
  125.76.230.17
-125.76.235.86
-125.76.246.18
-125.76.246.24
-125.76.246.46
-125.77.166.16
-125.77.217.141
  125.77.22.106
  125.77.23.30
+125.77.81.86
  125.78.32.186
-125.78.49.82
  125.81.129.130
-125.82.183.60
  125.84.217.97
  125.86.181.173
  125.86.185.192
@@ -26086,41 +21230,44 @@
  125.87.80.146
  125.87.83.141
  125.87.84.159
+125.87.84.182
  125.87.84.242
  125.87.86.174
+125.87.87.84
+125.87.88.95
  125.87.91.71
+125.87.94.32
  125.88.169.233
  125.89.152.87
-125.90.175.66
-125.91.106.231
  125.91.109.200
-125.91.111.197
-125.91.17.101
-125.91.17.134
-125.91.17.216
-125.91.32.168
-125.91.35.36
+125.93.108.125
+125.93.108.134
  125.93.108.215
+125.93.109.109
  125.93.109.141
  125.93.109.198
+125.93.109.212
+125.93.109.31
  125.93.109.40
+125.93.110.147
  125.93.110.241
+125.93.110.243
  125.93.110.252
+125.93.110.77
+125.93.111.0
  125.93.111.108
+125.93.111.181
+125.93.111.37
  125.93.111.69
  125.93.111.94
-125.93.180.194
-125.93.183.178
-125.93.55.34
-125.94.117.128
-125.94.149.76
+125.93.111.99
  125.94.180.225
-125.94.219.188
  125.94.236.109
  125.99.100.193
  125.99.120.166
  125.99.147.56
  125.99.173.162
+125.99.204.161
  125.99.242.202
  125.99.252.110
  125.99.39.234
@@ -26140,10 +21287,8 @@
  126.12.77.221
  126.145.224.154
  126.15.109.101
-126.28.194.126
-126.39.157.11
+126.243.226.11
  126.4.98.212
-126.75.106.199
  126.90.59.69
  126.94.58.245
  126bus.cn
@@ -26152,10 +21297,10 @@
  1272125-dot-n-e-w-me-ss-age-po-rt-al.wl.r.appspot.com
  12774.psdzy.com
  128.0.129.192
+128.0.135.167
  128.0.143.49
  128.0.179.234
  128.0.190.26
-128.1.112.210
  128.1.133.114
  128.1.133.165
  128.1.135.72
@@ -26167,70 +21312,36 @@
  128.1.223.244
  128.1.223.245
  128.1.223.246
-128.106.115.24
  128.106.129.40
-128.106.133.188
-128.106.135.14
  128.106.136.18
  128.106.163.173
  128.106.166.8
  128.106.195.126
-128.106.199.169
  128.106.2.250
-128.106.213.231
  128.106.93.221
-128.106.98.60
  128.116.130.101
-128.116.134.251
  128.116.154.5
+128.116.203.198
  128.121.136.192
  128.121.17.146
  128.121.17.148
  128.121.17.154
  128.121.17.155
  128.125.100.2
+128.127.105.193
  128.127.106.37
+128.127.164.156
  128.127.90.34
  128.134.178.1
-128.134.30.79
  128.134.58.164
  128.136.35.30
  128.14.11.107
  128.14.11.108
  128.14.11.109
  128.14.11.110
-128.14.132.42
-128.14.141.107
-128.14.141.108
-128.14.156.186
  128.14.16.156
  128.14.16.233
-128.14.163.92
-128.14.163.94
  128.14.178.94
-128.14.209.156
-128.14.209.158
-128.14.209.178
-128.14.209.179
-128.14.209.180
-128.14.209.181
-128.14.209.182
-128.14.209.226
-128.14.209.227
-128.14.209.230
-128.14.209.234
-128.14.209.235
-128.14.209.236
-128.14.209.238
-128.14.209.242
-128.14.209.243
-128.14.209.244
-128.14.209.246
-128.14.209.250
-128.14.209.251
-128.14.209.252
-128.14.209.253
-128.14.209.254
  128.14.3.110
  128.14.3.84
  128.14.30.178
@@ -26252,8 +21363,16 @@
  128.177.105.225
  128.187.32.223
  128.197.11.187
+128.197.128.198
+128.197.128.205
+128.197.128.214
  128.197.128.217
+128.197.128.222
+128.197.128.231
  128.197.128.236
+128.197.128.238
+128.197.128.249
+128.197.128.250
  128.199.0.70
  128.199.1.140
  128.199.1.184
@@ -26264,7 +21383,6 @@
  128.199.103.239
  128.199.105.232
  128.199.105.239
-128.199.106.210
  128.199.106.232
  128.199.106.97
  128.199.107.111
@@ -26279,20 +21397,18 @@
  128.199.111.241
  128.199.112.240
  128.199.113.231
-128.199.114.104
-128.199.114.138
  128.199.114.177
  128.199.114.22
  128.199.114.65
  128.199.115.160
  128.199.115.175
  128.199.117.43
-128.199.118.130
  128.199.118.165
-128.199.118.61
  128.199.119.78
  128.199.12.141
  128.199.120.132
+128.199.120.160
+128.199.121.144
  128.199.121.192
  128.199.121.196
  128.199.121.32
@@ -26304,10 +21420,8 @@
  128.199.123.216
  128.199.124.216
  128.199.124.53
-128.199.126.221
  128.199.127.0
  128.199.127.217
-128.199.127.62
  128.199.128.169
  128.199.128.186
  128.199.128.215
@@ -26316,7 +21430,6 @@
  128.199.13.22
  128.199.130.114
  128.199.130.118
-128.199.130.137
  128.199.130.31
  128.199.130.34
  128.199.131.150
@@ -26324,8 +21437,6 @@
  128.199.132.213
  128.199.133.186
  128.199.133.235
-128.199.133.47
-128.199.133.8
  128.199.136.255
  128.199.136.56
  128.199.138.67
@@ -26343,7 +21454,6 @@
  128.199.145.5
  128.199.146.1
  128.199.146.137
-128.199.147.188
  128.199.148.20
  128.199.148.70
  128.199.149.111
@@ -26354,7 +21464,6 @@
  128.199.151.198
  128.199.152.105
  128.199.152.154
-128.199.152.5
  128.199.154.189
  128.199.156.159
  128.199.156.25
@@ -26363,6 +21472,7 @@
  128.199.158.182
  128.199.158.89
  128.199.159.148
+128.199.160.116
  128.199.160.192
  128.199.161.93
  128.199.162.108
@@ -26391,7 +21501,6 @@
  128.199.177.52
  128.199.178.145
  128.199.178.41
-128.199.179.171
  128.199.180.123
  128.199.180.80
  128.199.182.19
@@ -26402,19 +21511,18 @@
  128.199.185.97
  128.199.186.46
  128.199.187.177
-128.199.19.153
-128.199.19.31
+128.199.188.2
  128.199.190.137
  128.199.192.135
-128.199.192.202
  128.199.193.246
+128.199.194.131
+128.199.195.231
  128.199.195.239
  128.199.197.21
  128.199.198.6
  128.199.198.79
  128.199.2.33
  128.199.2.81
-128.199.20.64
  128.199.200.209
  128.199.202.107
  128.199.202.168
@@ -26423,7 +21531,6 @@
  128.199.206.90
  128.199.209.227
  128.199.209.250
-128.199.21.1
  128.199.210.138
  128.199.211.68
  128.199.212.194
@@ -26445,7 +21552,6 @@
  128.199.224.183
  128.199.225.104
  128.199.226.44
-128.199.226.68
  128.199.227.155
  128.199.227.214
  128.199.227.236
@@ -26453,12 +21559,9 @@
  128.199.231.162
  128.199.232.56
  128.199.232.6
-128.199.233.143
  128.199.234.115
  128.199.235.176
  128.199.236.70
-128.199.237.120
-128.199.237.233
  128.199.239.9
  128.199.24.29
  128.199.240.120
@@ -26488,12 +21591,9 @@
  128.199.26.250
  128.199.26.69
  128.199.26.97
-128.199.27.125
-128.199.28.210
  128.199.28.57
  128.199.28.71
  128.199.29.126
-128.199.29.37
  128.199.30.160
  128.199.31.95
  128.199.32.51
@@ -26539,7 +21639,6 @@
  128.199.7.196
  128.199.70.58
  128.199.71.227
-128.199.73.213
  128.199.73.94
  128.199.74.117
  128.199.78.229
@@ -26555,27 +21654,22 @@
  128.199.84.135
  128.199.84.251
  128.199.87.167
+128.199.87.28
  128.199.88.23
-128.199.89.47
  128.199.90.84
  128.199.92.162
  128.199.92.187
  128.199.92.53
  128.199.93.4
  128.199.94.218
-128.199.95.17
  128.199.95.60
  128.199.95.74
  128.199.95.86
  128.199.96.1
  128.199.98.15
-128.199.98.233
  128.199.99.204
  128.201.100.84
-128.201.101.28
  128.201.161.2
-128.201.51.244
-128.201.66.90
  128.201.75.86
  128.201.76.184
  128.201.77.94
@@ -26585,39 +21679,41 @@
  128.201.96.199
  128.204.207.215
  128.22.133.151
-128.232.21.75
  128.237.154.145
  128.241.54.188
  128.244.119.135
  128.244.119.161
  128.244.119.162
  128.31.0.13
-128.32.43.222
  128.59.10.116
  128.68.107.25
-128.68.235.229
+128.68.212.52
  128.68.35.49
  128.68.42.219
+128.69.146.254
  128.69.218.253
+128.69.246.68
+128.69.36.189
  128.69.51.27
  128.70.129.90
  128.70.182.88
  128.70.50.97
-128.70.61.98
  128.71.211.251
  128.71.92.84
+128.72.113.81
+128.72.114.166
+128.72.173.230
  128.72.197.9
  128.72.199.60
  128.72.240.132
+128.72.36.129
  128.73.173.22
-128.74.221.91
-128.75.123.198
+128.74.100.56
  128.75.151.66
  128.75.209.162
  128.78.170.162
+128.90.164.65
  128.92.203.42
-128.92.210.156
-128.92.64.172
  128.98.26.242
  128988158812897-dot-fix-file-upstream.appspot.com
  129.10.65.146
@@ -26632,11 +21728,8 @@
  129.126.200.59
  129.126.205.225
  129.126.207.227
-129.126.207.90
-129.126.221.21
-129.126.221.37
+129.126.207.40
  129.126.244.51
-129.126.246.122
  129.126.65.78
  129.126.99.254
  129.13.189.206
@@ -26647,80 +21740,23 @@
  129.144.181.142
  129.144.183.81
  129.144.9.93
-129.145.193.194
-129.146.104.160
-129.146.105.242
-129.146.106.78
-129.146.106.85
-129.146.108.140
-129.146.109.154
-129.146.110.153
-129.146.112.55
-129.146.113.156
-129.146.115.73
-129.146.116.115
-129.146.116.141
-129.146.119.22
-129.146.120.122
-129.146.121.245
-129.146.122.158
-129.146.129.37
-129.146.130.179
-129.146.161.178
  129.146.162.202
-129.146.162.96
-129.146.165.255
-129.146.166.253
-129.146.167.203
  129.146.171.142
  129.146.171.254
  129.146.173.56
-129.146.179.118
  129.146.182.101
-129.146.185.87
-129.146.186.248
-129.146.189.31
-129.146.189.34
-129.146.189.70
-129.146.190.190
-129.146.191.254
-129.146.201.116
-129.146.201.28
-129.146.202.223
-129.146.203.132
-129.146.243.66
-129.146.245.194
  129.146.246.249
  129.146.247.244
  129.146.250.102
-129.146.250.11
  129.146.251.138
  129.146.253.35
-129.146.254.139
-129.146.254.88
-129.146.29.10
-129.146.44.129
-129.146.51.15
-129.146.55.123
-129.146.55.85
  129.146.56.11
-129.146.56.91
  129.146.57.47
-129.146.61.244
-129.146.64.177
-129.146.67.150
-129.146.67.29
-129.146.71.40
  129.146.73.109
+129.146.73.86
  129.146.75.180
-129.146.78.29
-129.146.79.127
-129.146.79.186
  129.146.81.43
-129.146.82.3
-129.146.86.56
  129.146.96.214
-129.146.96.59
  129.150.194.230
  129.152.141.71
  129.158.74.141
@@ -26737,45 +21773,32 @@
  129.204.131.146
  129.204.131.218
  129.204.132.123
-129.204.139.26
-129.204.148.56
  129.204.152.84
-129.204.16.2
  129.204.166.67
-129.204.169.82
  129.204.17.191
-129.204.175.119
  129.204.175.252
-129.204.177.133
  129.204.177.7
-129.204.181.118
  129.204.186.151
-129.204.188.97
  129.204.197.29
  129.204.20.248
  129.204.203.218
  129.204.208.231
  129.204.208.34
  129.204.210.108
-129.204.212.52
  129.204.216.119
  129.204.223.236
-129.204.225.65
  129.204.23.5
  129.204.231.225
  129.204.233.194
  129.204.233.214
-129.204.237.30
  129.204.238.250
  129.204.245.6
  129.204.249.11
  129.204.249.36
-129.204.252.75
  129.204.253.6
  129.204.254.71
  129.204.33.4
  129.204.35.171
-129.204.36.70
  129.204.42.59
  129.204.45.118
  129.204.46.170
@@ -26784,31 +21807,30 @@
  129.204.65.129
  129.204.67.133
  129.204.77.136
+129.204.77.236
  129.204.82.4
-129.204.88.17
  129.204.89.159
  129.204.89.21
  129.204.9.210
  129.205.106.123
  129.205.112.253
-129.205.118.115
  129.205.138.194
  129.205.201.133
  129.205.201.239
  129.205.201.27
  129.205.210.90
  129.205.244.158
+129.205.26.106
  129.205.98.54
  129.211.10.111
  129.211.10.113
  129.211.108.143
  129.211.124.120
  129.211.124.29
+129.211.134.62
  129.211.135.174
-129.211.137.239
  129.211.138.177
  129.211.14.195
-129.211.140.239
  129.211.141.131
  129.211.146.50
  129.211.149.34
@@ -26818,43 +21840,33 @@
  129.211.167.92
  129.211.169.241
  129.211.171.24
-129.211.174.145
  129.211.18.180
-129.211.18.65
-129.211.182.71
  129.211.183.213
-129.211.183.61
  129.211.184.174
  129.211.185.246
-129.211.187.67
  129.211.188.162
  129.211.191.185
  129.211.22.160
-129.211.23.74
  129.211.24.104
  129.211.25.66
  129.211.28.16
  129.211.32.25
-129.211.33.43
  129.211.36.4
+129.211.4.81
  129.211.42.153
  129.211.49.17
-129.211.49.227
  129.211.49.44
  129.211.50.239
  129.211.54.120
  129.211.54.147
  129.211.70.87
  129.211.71.55
-129.211.72.48
  129.211.74.252
  129.211.75.184
  129.211.77.44
  129.211.79.208
-129.211.80.52
  129.211.81.113
  129.211.84.224
-129.211.87.88
  129.211.91.170
  129.211.91.213
  129.211.92.41
@@ -26862,37 +21874,28 @@
  129.211.94.30
  129.211.99.254
  129.213.107.56
-129.213.110.15
  129.213.117.100
  129.213.118.2
  129.213.134.30
  129.213.145.100
  129.213.15.42
+129.213.154.213
  129.213.157.222
  129.213.161.37
-129.213.167.71
  129.213.203.59
  129.213.21.173
  129.213.213.245
-129.213.24.79
-129.213.30.150
-129.213.38.154
  129.213.40.170
  129.213.40.181
  129.213.55.239
-129.213.60.4
-129.213.62.187
-129.213.63.8
  129.213.76.238
-129.213.80.214
  129.213.82.215
  129.213.83.203
  129.213.89.205
-129.213.90.181
+129.213.93.76
  129.213.94.19
  129.213.98.196
  129.22.143.241
-129.226.112.181
  129.226.118.209
  129.226.119.176
  129.226.12.233
@@ -26906,15 +21909,12 @@
  129.226.138.179
  129.226.141.113
  129.226.147.146
-129.226.149.146
  129.226.149.160
  129.226.150.63
  129.226.150.93
  129.226.151.51
  129.226.153.187
  129.226.154.6
-129.226.154.67
-129.226.156.168
  129.226.156.186
  129.226.156.4
  129.226.157.108
@@ -26933,7 +21933,6 @@
  129.226.225.117
  129.226.227.234
  129.226.227.72
-129.226.50.36
  129.226.51.112
  129.226.60.49
  129.226.61.157
@@ -26941,29 +21940,26 @@
  129.226.64.39
  129.226.64.51
  129.226.68.181
+129.226.70.74
  129.226.72.77
  129.226.73.12
  129.226.76.90
  129.226.77.174
-129.227.129.163
-129.227.129.164
  129.232.208.51
  129.232.208.54
  129.232.208.55
  129.232.208.60
  129.232.220.11
  129.28.103.85
+129.28.113.46
  129.28.12.228
  129.28.14.23
  129.28.142.81
  129.28.150.119
-129.28.152.90
  129.28.154.240
  129.28.155.113
  129.28.157.146
  129.28.157.148
-129.28.158.174
-129.28.160.215
  129.28.160.44
  129.28.162.79
  129.28.163.90
@@ -26981,7 +21977,6 @@
  129.28.183.62
  129.28.185.107
  129.28.185.31
-129.28.187.11
  129.28.189.173
  129.28.192.71
  129.28.193.154
@@ -26989,6 +21984,8 @@
  129.28.195.191
  129.28.198.205
  129.28.199.85
+129.28.39.234
+129.28.78.146
  129.28.78.8
  129.28.82.148
  129.28.92.64
@@ -27020,7 +22017,6 @@
  13.112.109.34
  13.112.123.148
  13.112.175.43
-13.112.20.9
  13.112.218.4
  13.113.116.175
  13.114.100.101
@@ -27053,19 +22049,18 @@
  13.125.97.172
  13.126.144.12
  13.126.181.139
+13.126.207.244
  13.126.218.145
  13.126.39.244
  13.126.42.55
  13.126.49.193
  13.126.69.46
-13.126.80.100
-13.127.101.178
  13.127.108.110
  13.127.120.216
  13.127.130.18
+13.127.141.26
  13.127.153.0
  13.127.225.183
-13.127.34.136
  13.127.8.76
  13.127.94.172
  13.209.0.41
@@ -27083,6 +22078,7 @@
  13.211.157.229
  13.211.210.18
  13.211.79.130
+13.212.101.152
  13.212.141.79
  13.212.145.52
  13.212.16.28
@@ -27140,8 +22136,8 @@
  13.232.135.122
  13.232.146.139
  13.232.187.242
-13.232.198.202
  13.232.223.53
+13.232.233.86
  13.232.238.113
  13.232.35.153
  13.232.38.92
@@ -27156,8 +22152,6 @@
  13.233.207.68
  13.233.82.105
  13.233.97.177
-13.234.119.179
-13.234.120.252
  13.234.59.38
  13.235.126.138
  13.235.76.5
@@ -27165,7 +22159,6 @@
  13.236.132.166
  13.236.204.65
  13.236.97.169
-13.237.11.30
  13.237.201.19
  13.237.210.134
  13.238.116.2
@@ -27176,6 +22169,7 @@
  13.239.114.62
  13.239.12.139
  13.239.131.117
+13.239.32.239
  13.239.85.6
  13.244.102.90
  13.244.104.103
@@ -27205,6 +22199,7 @@
  13.250.51.173
  13.250.7.111
  13.250.83.68
+13.250.99.143
  13.251.129.186
  13.251.168.86
  13.251.176.17
@@ -27224,6 +22219,7 @@
  13.49.240.49
  13.49.72.71
  13.49.77.201
+13.52.14.169
  13.52.185.39
  13.52.60.115
  13.53.107.75
@@ -27241,7 +22237,6 @@
  13.55.244.216
  13.55.65.255
  13.56.120.30
-13.56.155.237
  13.56.171.121
  13.56.174.246
  13.56.183.143
@@ -27253,7 +22248,6 @@
  13.56.227.131
  13.56.248.193
  13.56.255.74
-13.56.33.64
  13.56.56.48
  13.56.76.234
  13.56.79.45
@@ -27263,9 +22257,11 @@
  13.57.224.254
  13.57.246.225
  13.57.250.92
+13.57.48.26
  13.57.51.100
  13.57.96.35
  13.58.134.165
+13.58.137.137
  13.58.152.3
  13.58.196.60
  13.58.2.126
@@ -27282,7 +22278,6 @@
  13.59.11.163
  13.59.111.77
  13.59.13.13
-13.59.132.206
  13.59.153.150
  13.59.154.158
  13.59.155.220
@@ -27312,10 +22307,11 @@
  13.64.77.225
  13.65.147.163
  13.65.147.40
-13.65.202.208
+13.65.168.14
  13.65.215.106
  13.65.246.58
  13.65.42.254
+13.65.56.62
  13.65.80.18
  13.66.128.69
  13.66.131.233
@@ -27343,14 +22339,11 @@
  13.66.50.148
  13.66.52.131
  13.67.106.218
+13.67.143.51
  13.67.236.36
-13.68.131.171
-13.68.139.64
  13.68.153.168
  13.68.191.162
-13.68.216.44
  13.68.225.165
-13.68.228.133
  13.68.229.202
  13.68.249.191
  13.69.103.14
@@ -27360,11 +22353,11 @@
  13.70.7.22
  13.71.120.139
  13.71.136.69
-13.71.2.244
  13.71.21.123
  13.71.46.226
  13.71.68.160
-13.72.102.159
+13.72.103.144
+13.72.65.7
  13.72.80.225
  13.72.82.82
  13.73.1.69
@@ -27378,39 +22371,34 @@
  13.74.46.65
  13.75.117.200
  13.75.125.174
-13.75.179.194
  13.75.193.159
  13.75.194.31
  13.75.220.102
+13.75.227.196
  13.76.100.168
-13.76.132.123
+13.76.141.135
  13.76.142.50
  13.76.165.246
  13.76.167.207
-13.76.190.188
  13.76.241.217
  13.76.242.131
  13.76.242.146
-13.76.244.185
  13.76.246.8
  13.76.248.36
  13.76.34.31
+13.76.38.86
  13.76.46.136
-13.76.91.32
-13.77.150.217
-13.77.151.83
  13.77.204.88
  13.77.205.248
  13.77.207.76
  13.77.209.51
-13.77.215.39
  13.78.126.105
  13.78.129.158
-13.78.129.205
  13.78.142.46
  13.78.144.200
  13.78.189.149
  13.78.190.103
+13.78.231.185
  13.78.231.32
  13.78.235.113
  13.78.236.203
@@ -27418,14 +22406,13 @@
  13.78.99.2
  13.79.242.9
  13.79.6.157
+13.79.87.14
  13.80.104.33
  13.80.123.101
  13.80.147.35
  13.80.183.119
-13.80.46.69
  13.80.67.162
  13.80.7.168
-13.81.223.168
  13.81.251.173
  13.81.50.85
  13.81.6.165
@@ -27435,7 +22422,6 @@
  13.82.105.123
  13.82.147.112
  13.82.149.166
-13.82.175.242
  13.82.179.224
  13.82.18.238
  13.82.186.165
@@ -27448,7 +22434,6 @@
  13.82.29.22
  13.82.58.15
  13.82.60.6
-13.82.81.171
  13.83.94.147
  13.84.135.5
  13.84.146.71
@@ -27457,6 +22442,7 @@
  13.84.160.222
  13.84.174.25
  13.84.182.32
+13.84.203.158
  13.84.216.48
  13.84.219.153
  13.84.219.35
@@ -27465,14 +22451,12 @@
  13.84.48.87
  13.84.52.63
  13.85.152.27
-13.85.18.13
  13.85.27.116
  13.85.65.196
  13.85.74.198
  13.88.177.3
  13.88.18.211
  13.88.18.49
-13.88.251.59
  13.88.30.112
  13.89.190.30
  13.89.33.27
@@ -27486,20 +22470,15 @@
  13.90.208.238
  13.90.26.128
  13.90.38.253
-13.90.57.183
  13.90.98.107
  13.90.98.3
  13.91.41.140
  13.91.41.232
  13.91.42.81
  13.91.44.93
-13.91.49.163
  13.91.97.179
-13.92.116.167
  13.92.119.142
  13.92.134.151
-13.92.137.49
-13.92.152.24
  13.92.16.89
  13.92.184.128
  13.92.195.99
@@ -27507,7 +22486,6 @@
  13.92.27.130
  13.92.32.34
  13.92.38.69
-13.92.41.219
  13.92.63.137
  13.92.82.166
  13.92.84.233
@@ -27517,7 +22495,6 @@
  13.93.223.243
  13.93.238.15
  13.93.24.50
-13.93.52.193
  13.93.68.121
  13.93.87.165
  13.94.119.209
@@ -27529,13 +22506,13 @@
  13.95.129.132
  13.95.130.2
  130.0.234.16
-130.0.24.3
  130.0.25.194
  130.105.197.224
  130.105.205.143
  130.111.10.87
  130.149.80.199
  130.149.80.221
+130.162.64.72
  130.162.71.237
  130.180.28.106
  130.180.47.146
@@ -27545,9 +22522,9 @@
  130.185.109.17
  130.185.122.170
  130.185.122.84
-130.185.125.206
-130.185.127.225
+130.185.124.223
  130.185.152.185
+130.185.153.10
  130.185.153.155
  130.185.153.182
  130.185.153.183
@@ -27615,11 +22592,11 @@
  130.61.122.70
  130.61.127.112
  130.61.134.151
-130.61.20.112
+130.61.176.229
  130.61.21.249
+130.61.222.175
  130.61.227.100
  130.61.233.14
-130.61.253.198
  130.61.255.187
  130.61.30.186
  130.61.33.94
@@ -27631,7 +22608,6 @@
  130.61.83.191
  130.61.90.106
  130.61.92.43
-130.61.96.72
  130.76.24.29
  130.89.162.39
  130.zuole.ml
@@ -27646,15 +22622,8 @@
  131.0.246.154
  131.0.246.157
  131.0.246.158
-131.0.252.126
-131.0.253.17
-131.0.253.194
-131.0.253.196
-131.0.253.219
-131.0.253.225
-131.0.253.231
-131.0.253.235
  131.0.87.225
+131.100.137.198
  131.100.212.230
  131.100.213.118
  131.100.239.122
@@ -27662,20 +22631,14 @@
  131.100.239.29
  131.100.239.62
  131.100.239.94
-131.100.25.223
-131.100.47.32
-131.106.69.35
-131.108.103.132
+131.106.20.23
  131.108.116.92
  131.108.118.103
-131.108.118.27
-131.108.140.252
-131.108.142.6
  131.108.16.170
  131.108.16.207
-131.108.166.216
-131.108.166.218
-131.108.32.147
+131.108.244.124
+131.108.244.178
+131.108.244.208
  131.108.45.72
  131.108.45.78
  131.108.60.30
@@ -27684,15 +22647,10 @@
  131.117.150.106
  131.117.208.242
  131.147.11.231
-131.147.134.57
  131.147.86.142
-131.148.13.222
-131.148.180.189
-131.150.232.218
  131.153.18.87
  131.153.22.134
  131.153.38.126
-131.153.41.220
  131.153.49.120
  131.161.10.200
  131.161.10.206
@@ -27704,17 +22662,13 @@
  131.161.11.226
  131.161.11.227
  131.161.11.234
-131.161.13.23
  131.161.189.120
  131.161.204.38
-131.161.205.117
-131.161.222.5
  131.161.224.94
  131.161.238.14
  131.161.253.190
  131.161.255.6
  131.161.35.20
-131.161.54.50
  131.161.65.47
  131.161.68.13
  131.161.68.17
@@ -27728,9 +22682,11 @@
  131.188.40.191
  131.188.43.61
  131.193.220.15
-131.196.14.82
  131.196.141.10
+131.196.141.123
+131.196.141.145
  131.196.141.150
+131.196.141.162
  131.196.141.177
  131.196.141.179
  131.196.141.206
@@ -27741,50 +22697,51 @@
  131.196.141.238
  131.196.141.248
  131.196.141.27
+131.196.141.31
  131.196.141.45
  131.196.141.58
  131.196.141.6
-131.196.141.62
-131.196.141.64
  131.196.141.77
+131.196.141.84
  131.196.141.88
+131.196.141.9
  131.196.141.92
  131.196.143.107
  131.196.143.112
  131.196.143.12
  131.196.143.121
  131.196.143.122
+131.196.143.124
  131.196.143.135
  131.196.143.139
  131.196.143.146
+131.196.143.153
  131.196.143.160
  131.196.143.175
-131.196.143.188
  131.196.143.206
  131.196.143.21
  131.196.143.210
  131.196.143.213
  131.196.143.224
-131.196.143.238
  131.196.143.24
  131.196.143.242
-131.196.143.253
-131.196.143.33
+131.196.143.32
+131.196.143.41
  131.196.143.45
  131.196.143.51
  131.196.143.62
-131.196.143.65
  131.196.143.66
  131.196.143.71
  131.196.143.72
  131.196.143.74
  131.196.143.96
-131.196.143.99
-131.196.169.137
-131.196.233.8
  131.196.4.226
-131.196.44.136
+131.196.86.72
+131.196.86.79
  131.196.87.198
+131.196.93.196
+131.196.95.0
+131.196.95.56
  131.221.148.76
  131.221.173.40
  131.221.183.5
@@ -27798,61 +22755,45 @@
  131.221.217.174
  131.221.217.176
  131.221.31.36
-131.221.32.56
  131.221.42.94
+131.221.64.152
  131.221.88.217
+131.228.66.202
  131.255.212.106
-131.255.228.119
  131.255.249.55
  131.255.32.45
  131.255.32.69
  131.255.4.96
  131.255.82.68
  131.72.139.150
-131.72.153.227
  131.72.205.98
-131.72.222.136
-131.72.230.151
-131.72.75.82
+131.72.236.178
+131.93.94.41
  131.94.129.191
  13123431043915105561.002.sh.cn
  131425.000webhostapp.com
  1314520bet.com
  1314huadian.com
  131987449-518886016577583774.preview.editmysite.com
-132.145.127.44
  132.145.128.157
-132.145.128.53
-132.145.131.149
-132.145.135.35
  132.145.137.125
-132.145.140.209
  132.145.141.166
-132.145.144.212
-132.145.148.146
-132.145.150.0
+132.145.146.10
  132.145.150.210
  132.145.154.95
  132.145.159.137
  132.145.159.39
-132.145.165.161
-132.145.165.79
-132.145.165.9
-132.145.169.65
  132.145.171.60
  132.145.172.100
-132.145.195.162
-132.145.198.88
-132.145.207.221
  132.145.213.44
-132.145.213.74
+132.145.30.158
  132.145.80.239
+132.145.88.30
  132.145.90.22
-132.147.104.183
-132.147.72.76
  132.147.80.96
  132.148.104.132
  132.148.104.133
+132.148.120.37
  132.148.141.147
  132.148.144.101
  132.148.153.156
@@ -27861,21 +22802,23 @@
  132.148.166.149
  132.148.166.225
  132.148.17.38
+132.148.197.208
  132.148.22.79
  132.148.28.20
  132.148.37.253
  132.148.42.109
+132.148.80.37
  132.148.91.227
  132.148.99.126
  132.232.1.109
  132.232.1.155
  132.232.10.144
-132.232.100.223
  132.232.103.60
  132.232.108.149
  132.232.11.218
  132.232.110.111
  132.232.112.96
+132.232.115.212
  132.232.120.145
  132.232.129.118
  132.232.132.103
@@ -27884,85 +22827,78 @@
  132.232.143.211
  132.232.144.76
  132.232.160.102
-132.232.161.51
  132.232.19.205
  132.232.2.100
-132.232.2.249
  132.232.2.70
  132.232.200.163
  132.232.21.175
  132.232.21.19
  132.232.21.67
  132.232.230.220
+132.232.246.204
  132.232.251.171
  132.232.26.42
-132.232.29.131
  132.232.3.234
-132.232.31.157
  132.232.31.9
  132.232.32.203
  132.232.32.228
  132.232.33.160
-132.232.35.108
-132.232.35.65
+132.232.33.174
+132.232.35.199
+132.232.37.219
  132.232.37.63
  132.232.4.140
  132.232.4.33
-132.232.41.170
  132.232.43.111
  132.232.45.171
  132.232.47.138
  132.232.47.59
  132.232.49.143
+132.232.5.28
  132.232.55.173
  132.232.57.135
  132.232.58.9
  132.232.59.247
  132.232.59.78
  132.232.60.183
-132.232.66.128
  132.232.66.227
  132.232.67.52
  132.232.68.138
  132.232.70.247
  132.232.73.139
-132.232.75.27
  132.232.76.77
  132.232.77.85
  132.232.78.91
-132.232.79.249
  132.232.79.28
+132.232.8.58
  132.232.80.76
-132.232.82.237
  132.232.82.240
  132.232.84.44
  132.232.85.32
  132.232.87.247
  132.232.88.59
-132.232.88.9
-132.232.89.147
  132.232.89.186
  132.232.89.96
  132.232.91.214
  132.232.92.86
  132.232.94.80
-132.232.95.158
  132.232.97.167
  132.232.98.228
-132.232.99.203
  132.232.99.91
  132.247.18.65
-132.248.110.203
  132.248.117.152
  132.248.44.99
-132.248.65.245
  132.248.96.3
+132.251.252.21
  132.255.164.194
  132.255.196.255
  132.255.21.58
+132.255.226.234
  132.255.226.74
  132.255.28.153
  132.255.44.48
+132.255.7.2
+132.255.78.236
  132.255.94.2
  132010958-437778554689293951.preview.editmysite.com
  13221.wang
@@ -27990,11 +22926,12 @@
  133.167.95.209
  133.19.7.20
  133.208.23.52
-133.232.87.13
  133.242.132.209
  133.242.155.85
+133.242.207.163
  133.242.231.162
  133.27.228.131
+133.86.253.49
  13317x.000webhostapp.com
  1336062-dot-oaao-274308.uc.r.appspot.com
  133627593977191-dot-wetransfer-auth-file-343.appspot.com
@@ -28006,32 +22943,27 @@
  134.0.116.219
  134.0.117.117
  134.0.119.176
-134.0.14.5
  134.0.63.134
-134.101.151.200
+134.101.128.7
  134.102.228.73
-134.119.1.138
  134.119.179.146
+134.119.214.194
  134.119.218.243
-134.119.219.93
+134.119.219.71
  134.119.220.165
  134.119.220.174
-134.119.3.172
  134.122.0.192
  134.122.100.130
-134.122.102.131
  134.122.103.82
-134.122.105.123
  134.122.108.236
  134.122.111.15
  134.122.111.162
  134.122.112.132
  134.122.113.222
  134.122.113.81
-134.122.115.140
  134.122.115.191
  134.122.118.167
-134.122.121.4
+134.122.120.49
  134.122.121.74
  134.122.121.86
  134.122.124.193
@@ -28039,10 +22971,8 @@
  134.122.130.38
  134.122.130.39
  134.122.145.149
-134.122.162.8
  134.122.17.13
  134.122.17.146
-134.122.178.47
  134.122.18.5
  134.122.19.0
  134.122.20.138
@@ -28061,19 +22991,11 @@
  134.122.40.5
  134.122.44.93
  134.122.47.206
-134.122.49.69
-134.122.49.74
-134.122.49.77
-134.122.50.162
-134.122.50.29
  134.122.52.187
  134.122.52.217
  134.122.54.200
-134.122.54.241
-134.122.56.235
  134.122.56.44
  134.122.57.181
-134.122.58.7
  134.122.58.96
  134.122.61.189
  134.122.62.253
@@ -28090,17 +23012,16 @@
  134.122.81.145
  134.122.87.117
  134.122.90.113
-134.122.90.115
  134.122.94.113
  134.122.95.167
  134.122.95.213
  134.122.96.20
  134.122.98.55
-134.17.26.116
  134.17.5.55
-134.17.94.100
+134.17.94.150
  134.17.94.158
  134.17.94.221
+134.175.110.112
  134.175.111.215
  134.175.113.143
  134.175.118.218
@@ -28117,7 +23038,6 @@
  134.175.146.231
  134.175.148.100
  134.175.150.132
-134.175.154.145
  134.175.161.251
  134.175.17.32
  134.175.18.153
@@ -28135,6 +23055,7 @@
  134.175.227.112
  134.175.236.132
  134.175.236.187
+134.175.236.98
  134.175.28.62
  134.175.29.140
  134.175.37.159
@@ -28144,9 +23065,8 @@
  134.175.64.60
  134.175.70.122
  134.175.79.82
-134.175.83.105
  134.175.89.31
-134.175.92.233
+134.175.93.231
  134.175.99.237
  134.19.146.45
  134.19.188.27
@@ -28154,9 +23074,10 @@
  134.19.215.196
  134.19.231.200
  134.19.254.2
-134.19.48.98
+134.19.57.121
  134.195.209.94
  134.208.10.111
+134.209.1.200
  134.209.100.103
  134.209.102.44
  134.209.103.101
@@ -28167,17 +23088,13 @@
  134.209.107.228
  134.209.107.99
  134.209.108.118
-134.209.111.46
-134.209.112.122
  134.209.113.3
  134.209.113.59
-134.209.114.117
  134.209.115.165
  134.209.115.227
  134.209.117.155
+134.209.118.106
  134.209.118.201
-134.209.119.201
-134.209.119.215
  134.209.123.101
  134.209.144.106
  134.209.146.100
@@ -28192,21 +23109,14 @@
  134.209.155.213
  134.209.156.55
  134.209.157.198
-134.209.157.35
  134.209.158.177
-134.209.159.10
-134.209.159.220
  134.209.159.76
  134.209.164.184
-134.209.169.202
  134.209.172.2
  134.209.173.74
-134.209.174.161
  134.209.176.202
  134.209.178.4
-134.209.179.35
  134.209.179.57
-134.209.18.129
  134.209.181.49
  134.209.182.43
  134.209.185.191
@@ -28214,37 +23124,29 @@
  134.209.186.168
  134.209.186.72
  134.209.188.212
-134.209.190.208
  134.209.191.148
  134.209.194.46
  134.209.196.169
  134.209.196.235
  134.209.197.46
  134.209.200.146
-134.209.204.95
  134.209.205.100
-134.209.208.32
-134.209.208.34
-134.209.208.60
-134.209.208.90
  134.209.21.133
  134.209.21.242
  134.209.211.69
  134.209.214.204
  134.209.215.11
+134.209.215.14
  134.209.215.174
  134.209.215.176
  134.209.216.249
  134.209.217.255
-134.209.217.28
  134.209.217.73
  134.209.218.129
  134.209.219.91
  134.209.22.36
  134.209.220.147
-134.209.221.91
  134.209.222.174
-134.209.223.106
  134.209.223.214
  134.209.224.93
  134.209.224.98
@@ -28259,7 +23161,6 @@
  134.209.234.54
  134.209.236.154
  134.209.236.191
-134.209.237.105
  134.209.237.158
  134.209.238.156
  134.209.238.164
@@ -28280,7 +23181,6 @@
  134.209.253.245
  134.209.254.186
  134.209.30.141
-134.209.35.77
  134.209.36.254
  134.209.38.215
  134.209.39.6
@@ -28288,10 +23188,9 @@
  134.209.47.189
  134.209.53.17
  134.209.57.3
-134.209.58.167
-134.209.63.140
  134.209.64.28
  134.209.65.43
+134.209.67.45
  134.209.69.183
  134.209.69.207
  134.209.7.179
@@ -28319,8 +23218,6 @@
  134.209.92.203
  134.209.93.91
  134.209.94.132
-134.209.96.131
-134.209.97.113
  134.209.97.199
  134.209.98.180
  134.213.138.127
@@ -28328,95 +23225,84 @@
  134.213.138.161
  134.213.138.164
  134.220.183.36
-134.228.109.240
  134.236.0.211
  134.236.0.215
+134.236.0.87
  134.236.1.105
-134.236.147.82
  134.236.16.234
  134.236.2.141
  134.236.2.164
-134.236.2.247
  134.236.205.2
  134.236.212.2
-134.236.24.110
+134.236.224.60
  134.236.242.161
  134.236.243.28
  134.236.247.106
  134.236.3.140
  134.249.101.197
  134.249.106.21
-134.249.116.14
  134.249.116.78
  134.249.117.3
  134.249.130.151
  134.249.133.197
-134.249.134.61
  134.249.141.83
-134.249.144.168
  134.249.146.35
  134.249.151.4
-134.249.155.251
  134.249.156.3
  134.249.161.145
  134.249.165.49
  134.249.167.184
+134.249.189.77
  134.249.198.205
-134.249.198.208
  134.249.198.7
-134.249.199.212
  134.249.232.83
  134.249.53.96
  134.249.54.230
  134.249.55.71
-134.249.96.246
  134.255.225.20
-134.255.233.62
  134.3.217.87
  134.3.227.7
  134.3.9.30
+134.34.68.31
  134.35.234.76
  134.41.12.68
-134.41.140.61
  134.56.2.9
  134.56.3.108
-134.56.49.2
-134.73.146.161
-134.73.146.47
-134.73.146.57
+134.73.121.194
+134.73.146.11
  134.73.154.173
  134.73.199.154
-134.73.30.66
-134.73.73.100
-134.73.73.117
+134.73.55.161
  134.73.73.161
  134.90.149.147
  134.90.149.150
+134.90.250.114
+134.90.250.134
  134.90.250.15
  134.90.250.163
  134.90.250.192
+134.90.250.249
  134.90.250.39
-134.90.250.53
-134.90.251.173
+134.90.252.130
+134.90.252.135
+134.90.252.145
  134.90.252.175
-134.90.252.208
+134.90.252.191
+134.90.252.213
  134.90.252.224
  134.90.252.251
-134.90.252.3
  134.90.252.40
+134.90.252.91
  134.90.253.130
-134.90.253.238
-134.90.253.255
-134.90.253.56
+134.90.253.40
  134.90.254.119
  134.90.254.156
-134.90.254.200
+134.90.254.173
+134.90.254.203
  134.90.254.245
-134.90.254.76
-134.90.255.139
+134.90.255.68
  13453765871837679316.googlegroups.com
  134d384annuyy.000webhostapp.com
-135.148.13.59
  135.148.26.211
  135.148.26.213
  135.148.3.218
@@ -28449,12 +23335,13 @@
  135.181.147.187
  135.181.16.238
  135.181.18.180
-135.181.18.96
  135.181.23.13
+135.181.29.13
  135.181.3.124
  135.181.31.42
  135.181.34.91
  135.181.41.129
+135.181.41.206
  135.181.43.201
  135.181.43.48
  135.181.49.56
@@ -28464,17 +23351,15 @@
  135.181.68.88
  135.181.92.33
  135.181.94.15
-135.181.97.134
-135.19.212.144
-135.19.91.189
  135.19.91.243
+135.23.228.90
  135.23.95.229
  1356657.servicesgsp1.club
  135athome.com
  136.1.1.165
  136.1.1.173
+136.143.147.1
  136.143.151.123
-136.143.157.177
  136.143.43.222
  136.143.76.68
  136.144.174.206
@@ -28497,46 +23382,29 @@
  136.169.169.175
  136.169.169.5
  136.169.30.131
+136.185.218.86
+136.185.6.104
  136.2.1.104
  136.2.1.164
  136.2.1.169
  136.228.128.101
-136.228.128.145
  136.228.128.159
  136.228.128.164
-136.228.128.166
-136.228.128.38
  136.228.128.51
-136.228.129.13
-136.228.129.156
-136.228.129.251
-136.228.129.30
-136.228.129.90
  136.228.131.104
  136.228.131.109
-136.228.131.157
-136.228.131.45
-136.228.131.46
-136.228.131.76
  136.228.160.250
  136.228.161.66
  136.228.161.67
-136.228.163.150
-136.228.163.6
  136.228.168.53
-136.232.171.50
-136.232.186.6
  136.232.209.70
  136.232.214.110
  136.232.226.202
  136.232.243.134
  136.232.30.174
  136.232.57.210
-136.233.116.73
-136.233.136.41
  136.233.23.226
  136.24.119.249
-136.24.120.166
  136.24.133.49
  136.24.8.157
  136.243.10.242
@@ -28593,25 +23461,26 @@
  136.244.65.212
  136.244.66.101
  136.244.77.163
+136.244.90.54
  136.244.99.133
  136.25.131.81
  136.255.144.2
  136.26.158.204
-136.29.17.198
+136.32.165.193
  136.32.20.188
  136.32.230.54
-136.32.27.143
  136.33.189.193
-136.33.238.17
  136.34.203.180
  136.34.243.158
  136.35.54.2
+136.35.57.213
  136.36.137.179
  136.37.176.126
  136.49.109.217
  136.49.130.150
  136.49.140.142
  136.49.30.217
+136.49.45.108
  136.52.114.123
  136.55.169.166
  136.55.40.183
@@ -28620,7 +23489,6 @@
  136.56.27.214
  136.56.33.208
  136.56.91.16
-136.57.182.187
  136.58.99.43
  136.61.209.73
  136.62.88.166
@@ -28635,19 +23503,17 @@
  137.116.133.111
  137.116.144.63
  137.116.164.112
-137.116.32.97
-137.116.59.46
  137.116.84.38
  137.117.168.216
  137.117.178.120
  137.117.21.137
  137.117.212.72
-137.118.108.10
+137.117.96.99
+137.118.173.27
  137.119.105.66
  137.119.36.33
  137.119.55.25
  137.135.101.9
-137.135.24.114
  137.135.86.36
  137.175.13.129
  137.175.13.130
@@ -28656,7 +23522,6 @@
  137.175.29.33
  137.175.29.34
  137.175.9.65
-137.186.143.210
  137.208.57.186
  137.220.130.237
  137.220.134.134
@@ -28666,12 +23531,12 @@
  137.220.228.52
  137.220.232.221
  137.220.233.48
-137.220.236.82
  137.220.35.191
-137.226.113.56
+137.220.62.118
  137.226.34.46
  137.25.140.167
  137.25.157.66
+137.25.217.243
  137.25.30.200
  137.255.9.46
  137.26.29.118
@@ -28684,19 +23549,13 @@
  137.59.18.149
  137.59.18.162
  137.59.18.190
-137.59.184.111
-137.59.184.225
  137.59.187.107
  137.59.187.126
  137.59.19.132
-137.59.226.221
  137.59.243.42
  137.59.253.52
-137.59.44.61
  137.59.50.225
  137.59.54.252
-137.59.66.229
-137.59.87.87
  137.74.0.3
  137.74.100.178
  137.74.103.64
@@ -28709,6 +23568,8 @@
  137.74.119.50
  137.74.137.211
  137.74.139.64
+137.74.139.82
+137.74.139.83
  137.74.139.87
  137.74.139.88
  137.74.139.91
@@ -28754,37 +23615,28 @@
  138.0.143.55
  138.0.207.18
  138.0.210.114
-138.0.219.62
-138.0.224.232
  138.0.230.49
  138.0.231.66
+138.0.255.145
  138.0.255.23
  138.0.7.132
+138.0.7.140
  138.0.7.191
-138.0.7.193
-138.0.7.194
-138.0.7.223
-138.0.7.226
-138.0.7.252
+138.0.7.199
+138.0.7.210
+138.0.7.232
  138.117.143.226
-138.117.161.122
-138.117.224.2
  138.117.37.244
  138.117.79.182
-138.117.81.45
  138.117.85.17
  138.117.85.97
-138.118.147.247
+138.118.166.15
+138.118.213.213
  138.118.224.36
-138.118.232.69
-138.118.41.207
-138.118.56.22
-138.121.104.49
-138.121.104.68
  138.121.113.182
  138.121.128.19
  138.121.128.34
-138.121.16.120
+138.121.16.102
  138.121.16.92
  138.121.16.94
  138.121.170.141
@@ -28793,25 +23645,27 @@
  138.121.245.93
  138.121.32.133
  138.121.32.182
-138.121.52.139
  138.122.105.118
-138.122.135.231
  138.122.140.72
  138.122.192.102
  138.122.192.126
+138.122.192.18
  138.122.192.181
-138.122.192.187
  138.122.192.197
  138.122.192.216
  138.122.192.227
-138.122.192.23
  138.122.192.53
  138.122.192.81
+138.122.222.126
  138.122.240.1
+138.122.36.42
+138.122.39.33
+138.122.39.70
  138.122.7.25
  138.122.7.33
  138.122.8.49
-138.122.85.136
+138.122.96.197
+138.128.1.150
  138.128.1.154
  138.128.1.155
  138.128.1.162
@@ -28821,12 +23675,12 @@
  138.128.1.180
  138.128.1.186
  138.128.1.187
+138.128.1.189
  138.128.1.191
  138.128.1.224
  138.128.1.233
-138.128.1.79
-138.128.10.137
  138.128.10.206
+138.128.11.131
  138.128.11.138
  138.128.11.140
  138.128.11.141
@@ -28858,7 +23712,6 @@
  138.128.13.94
  138.128.14.103
  138.128.14.230
-138.128.16.186
  138.128.160.90
  138.128.196.177
  138.128.201.92
@@ -28870,12 +23723,12 @@
  138.128.242.121
  138.128.3.20
  138.128.34.117
+138.128.4.100
  138.128.4.231
  138.128.4.233
  138.128.4.237
  138.128.4.238
  138.128.4.239
-138.128.4.241
  138.128.4.246
  138.128.4.25
  138.128.4.250
@@ -28886,7 +23739,6 @@
  138.128.6.43
  138.128.7.198
  138.128.7.201
-138.128.7.203
  138.128.77.104
  138.128.84.129
  138.128.84.132
@@ -28906,26 +23758,24 @@
  138.128.9.190
  138.128.97.61
  138.134.102.16
-138.185.180.146
-138.185.189.133
  138.185.56.166
-138.186.105.141
  138.186.122.105
+138.186.138.105
  138.186.138.162
  138.186.138.204
  138.186.138.250
  138.186.138.31
-138.186.138.33
  138.186.138.46
+138.186.138.81
  138.186.165.181
-138.186.177.212
  138.186.179.249
-138.186.238.224
+138.186.238.222
+138.186.238.234
+138.186.239.141
+138.186.239.246
  138.186.61.178
-138.186.88.86
-138.188.48.62
+138.188.54.107
  138.19.114.68
-138.19.231.164
  138.195.139.17
  138.197.10.226
  138.197.101.210
@@ -28954,6 +23804,7 @@
  138.197.132.55
  138.197.135.102
  138.197.136.156
+138.197.136.6
  138.197.136.68
  138.197.137.31
  138.197.138.77
@@ -28977,14 +23828,12 @@
  138.197.150.132
  138.197.151.129
  138.197.151.213
-138.197.152.12
  138.197.153.117
  138.197.153.151
  138.197.153.4
  138.197.153.44
  138.197.154.176
  138.197.157.80
-138.197.159.143
  138.197.159.227
  138.197.161.96
  138.197.162.193
@@ -29000,19 +23849,15 @@
  138.197.168.65
  138.197.170.198
  138.197.171.138
-138.197.171.198
  138.197.171.66
  138.197.171.79
  138.197.172.32
-138.197.175.169
  138.197.175.236
  138.197.177.12
  138.197.177.202
-138.197.177.9
  138.197.178.228
  138.197.180.102
  138.197.180.164
-138.197.180.60
  138.197.181.43
  138.197.181.95
  138.197.182.110
@@ -29053,7 +23898,6 @@
  138.197.211.83
  138.197.212.153
  138.197.212.204
-138.197.213.122
  138.197.213.134
  138.197.213.160
  138.197.213.192
@@ -29066,8 +23910,6 @@
  138.197.216.234
  138.197.217.164
  138.197.221.218
-138.197.221.37
-138.197.222.141
  138.197.222.97
  138.197.225.93
  138.197.231.81
@@ -29082,7 +23924,6 @@
  138.197.30.13
  138.197.35.217
  138.197.35.84
-138.197.36.189
  138.197.38.119
  138.197.4.141
  138.197.41.104
@@ -29099,13 +23940,11 @@
  138.197.7.128
  138.197.7.63
  138.197.70.156
-138.197.73.253
  138.197.75.165
  138.197.77.159
  138.197.78.167
  138.197.81.215
  138.197.85.25
-138.197.89.186
  138.197.89.212
  138.197.89.92
  138.197.94.209
@@ -29113,7 +23952,6 @@
  138.197.96.224
  138.197.97.134
  138.197.97.88
-138.199.18.102
  138.199.18.77
  138.199.26.169
  138.199.26.207
@@ -29126,7 +23964,6 @@
  138.201.127.112
  138.201.130.12
  138.201.134.144
-138.201.147.232
  138.201.172.95
  138.201.18.80
  138.201.19.159
@@ -29148,6 +23985,7 @@
  138.201.36.109
  138.201.36.73
  138.201.36.87
+138.201.42.81
  138.201.44.27
  138.201.44.8
  138.201.52.218
@@ -29163,17 +24001,12 @@
  138.204.100.70
  138.204.127.1
  138.204.140.199
-138.204.141.154
  138.204.143.203
  138.204.171.108
  138.204.179.162
-138.204.226.186
-138.204.227.14
  138.204.24.67
-138.204.240.46
-138.204.27.222
+138.204.25.15
  138.204.27.243
-138.204.70.65
  138.204.78.248
  138.204.78.249
  138.210.192.120
@@ -29185,25 +24018,21 @@
  138.210.231.22
  138.219.100.78
  138.219.133.22
-138.219.14.181
  138.219.147.197
-138.219.161.1
-138.219.168.18
  138.219.223.166
+138.219.23.248
  138.219.236.4
  138.219.247.6
-138.229.101.112
-138.229.104.123
  138.229.109.162
-138.229.114.30
+138.229.110.110
  138.229.234.41
  138.229.25.140
  138.229.26.42
  138.231.64.152
  138.255.0.27
+138.255.109.21
  138.255.148.35
  138.255.179.94
-138.255.222.10
  138.255.227.17
  138.255.227.2
  138.255.227.5
@@ -29211,12 +24040,8 @@
  138.255.240.66
  138.255.32.65
  138.255.36.255
-138.255.75.96
-138.36.1.24
  138.36.1.72
-138.36.158.2
  138.36.159.188
-138.36.170.115
  138.36.201.17
  138.36.22.108
  138.36.40.54
@@ -29248,13 +24073,12 @@
  138.59.176.243
  138.59.176.254
  138.59.18.110
-138.59.204.72
  138.59.213.79
  138.68.0.64
  138.68.0.87
  138.68.100.102
-138.68.103.131
  138.68.105.178
+138.68.105.248
  138.68.106.62
  138.68.106.82
  138.68.109.96
@@ -29336,7 +24160,6 @@
  138.68.244.82
  138.68.245.12
  138.68.245.255
-138.68.246.36
  138.68.247.194
  138.68.250.106
  138.68.250.124
@@ -29349,11 +24172,8 @@
  138.68.255.120
  138.68.255.17
  138.68.26.102
-138.68.26.189
  138.68.27.152
  138.68.29.144
-138.68.3.21
-138.68.30.35
  138.68.30.47
  138.68.31.242
  138.68.4.8
@@ -29371,7 +24191,6 @@
  138.68.5.192
  138.68.50.177
  138.68.52.34
-138.68.52.53
  138.68.52.58
  138.68.53.146
  138.68.53.187
@@ -29379,13 +24198,10 @@
  138.68.55.189
  138.68.55.201
  138.68.58.121
-138.68.58.186
  138.68.59.55
-138.68.59.77
  138.68.6.157
  138.68.6.189
  138.68.60.140
-138.68.60.142
  138.68.62.14
  138.68.64.153
  138.68.65.159
@@ -29398,16 +24214,13 @@
  138.68.70.116
  138.68.72.162
  138.68.72.167
-138.68.73.195
-138.68.73.41
  138.68.74.244
  138.68.75.113
-138.68.75.16
  138.68.76.39
  138.68.77.143
-138.68.8.198
  138.68.8.225
  138.68.80.11
+138.68.80.235
  138.68.81.162
  138.68.82.175
  138.68.82.194
@@ -29426,32 +24239,28 @@
  138.68.93.86
  138.68.94.173
  138.68.95.204
-138.68.96.222
  138.68.97.63
  138.68.98.102
  138.68.98.38
-138.75.10.168
-138.75.16.42
-138.75.162.113
-138.75.38.33
-138.75.56.81
  138.91.120.191
  138.91.123.237
  138.91.145.18
  138.91.162.26
  138.91.186.213
-138.91.2.248
  138.91.255.66
  138.91.29.108
  138.91.41.216
  138.91.48.77
-138.94.156.43
+138.94.0.18
+138.94.0.6
  138.94.160.161
  138.94.162.220
  138.94.162.254
  138.94.189.96
  138.94.199.19
+138.94.210.29
  138.94.218.251
+138.94.234.162
  138.94.28.234
  138.94.49.70
  138.94.58.11
@@ -29461,7 +24270,6 @@
  138.97.116.170
  138.97.116.190
  138.97.12.150
-138.97.137.11
  138.97.2.93
  138.97.22.186
  138.97.236.11
@@ -29475,33 +24283,28 @@
  138.97.236.3
  138.97.236.30
  138.97.236.33
-138.97.236.5
  138.97.244.130
-138.97.34.38
-138.97.37.225
+138.97.54.188
+138.97.54.89
  138.97.60.140
-138.97.93.140
+138.97.64.20
+138.97.93.152
+138.97.93.182
+138.97.93.188
  138.97.93.251
-138.97.94.166
  138.97.94.234
  138.97.94.54
  138.97.94.69
  138.97.94.77
  138.97.95.150
  138.97.95.156
-138.99.204.23
-138.99.216.104
  138.99.216.112
-138.99.216.142
-138.99.216.151
-138.99.216.238
+138.99.216.147
  138.99.224.223
  138.99.6.177
  138.99.6.198
-138.99.7.29
  138.99.7.75
  138.99.77.70
-138.99.79.192
  138.99.93.224
  138.99.93.227
  138.99.93.62
@@ -29511,29 +24314,24 @@
  13871234567.mer.lstest.siquality.com
  139.0.10.183
  139.0.115.44
-139.0.188.181
+139.0.189.34
  139.0.22.50
  139.0.24.187
  139.0.244.109
-139.0.254.90
  139.0.6.36
  139.0.77.165
  139.129.206.8
-139.129.243.167
  139.130.206.73
  139.130.228.72
  139.130.233.254
  139.130.242.43
-139.138.153.194
-139.138.8.214
  139.150.79.164
  139.153.255.107
  139.155.1.214
  139.155.1.35
-139.155.10.97
+139.155.102.123
  139.155.11.173
  139.155.11.230
-139.155.123.84
  139.155.127.59
  139.155.13.21
  139.155.13.245
@@ -29545,12 +24343,9 @@
  139.155.172.71
  139.155.174.181
  139.155.175.148
-139.155.179.86
  139.155.181.145
  139.155.182.156
-139.155.2.183
-139.155.2.218
-139.155.2.240
+139.155.2.190
  139.155.2.51
  139.155.2.6
  139.155.204.28
@@ -29560,6 +24355,7 @@
  139.155.226.188
  139.155.229.38
  139.155.23.172
+139.155.231.29
  139.155.232.231
  139.155.237.8
  139.155.238.60
@@ -29568,36 +24364,27 @@
  139.155.24.139
  139.155.24.93
  139.155.240.73
-139.155.241.89
  139.155.242.21
  139.155.242.226
-139.155.242.36
-139.155.243.41
  139.155.245.25
  139.155.246.185
  139.155.246.196
-139.155.246.221
  139.155.247.50
  139.155.248.228
-139.155.249.7
  139.155.250.133
  139.155.250.135
-139.155.250.38
  139.155.253.90
  139.155.255.117
+139.155.26.47
  139.155.26.79
  139.155.29.40
-139.155.3.20
-139.155.30.122
  139.155.34.16
  139.155.34.181
  139.155.35.220
  139.155.35.47
-139.155.38.13
  139.155.39.22
  139.155.39.62
  139.155.42.189
-139.155.42.30
  139.155.43.222
  139.155.44.102
  139.155.46.147
@@ -29607,33 +24394,29 @@
  139.155.54.93
  139.155.68.58
  139.155.69.205
+139.155.72.204
  139.155.73.2
  139.155.73.60
-139.155.74.147
  139.155.74.238
-139.155.75.8
  139.155.76.42
+139.155.77.44
  139.155.79.24
-139.155.79.7
  139.155.80.151
-139.155.81.79
  139.155.84.160
  139.155.86.130
  139.155.86.214
-139.155.87.149
  139.155.87.17
+139.155.87.225
  139.155.87.35
  139.155.87.53
-139.155.88.128
-139.155.89.11
-139.155.89.150
  139.155.94.123
  139.159.1.1
  139.159.1.129
+139.159.136.243
  139.159.152.237
-139.159.197.228
  139.159.232.235
  139.159.47.22
+139.159.48.155
  139.162.1.13
  139.162.10.119
  139.162.10.125
@@ -29641,36 +24424,21 @@
  139.162.10.72
  139.162.100.78
  139.162.101.216
-139.162.104.208
-139.162.106.178
  139.162.106.19
  139.162.107.112
-139.162.108.62
  139.162.109.221
-139.162.109.43
  139.162.11.191
-139.162.110.42
  139.162.110.97
-139.162.112.248
  139.162.113.159
  139.162.113.163
-139.162.113.212
-139.162.115.221
  139.162.115.29
  139.162.115.31
-139.162.116.22
-139.162.118.251
  139.162.119.235
-139.162.120.76
-139.162.121.165
  139.162.121.170
-139.162.121.251
  139.162.122.33
-139.162.123.29
  139.162.124.224
  139.162.127.185
  139.162.128.239
-139.162.134.137
  139.162.144.235
  139.162.146.174
  139.162.146.72
@@ -29718,10 +24486,10 @@
  139.162.253.168
  139.162.28.242
  139.162.30.134
-139.162.30.36
  139.162.31.115
  139.162.38.253
  139.162.39.15
+139.162.39.152
  139.162.40.187
  139.162.42.15
  139.162.44.232
@@ -29736,32 +24504,22 @@
  139.162.57.114
  139.162.57.254
  139.162.60.124
-139.162.65.76
-139.162.69.98
  139.162.7.42
  139.162.70.46
  139.162.71.110
-139.162.72.191
  139.162.75.112
  139.162.75.91
-139.162.75.99
  139.162.76.176
-139.162.77.6
  139.162.80.119
  139.162.81.219
  139.162.82.183
-139.162.84.112
  139.162.84.50
  139.162.85.221
  139.162.85.248
-139.162.86.84
  139.162.87.102
-139.162.90.220
  139.162.90.81
  139.162.91.117
  139.162.97.52
-139.162.98.244
-139.162.99.58
  139.170.118.203
  139.170.150.189
  139.170.150.250
@@ -29775,15 +24533,9 @@
  139.170.175.36
  139.170.180.147
  139.170.180.78
-139.170.229.124
  139.170.231.168
-139.170.8.128
+139.170.8.131
  139.178.69.251
-139.178.83.134
-139.178.83.82
-139.178.84.194
-139.178.84.250
-139.178.85.6
  139.180.128.190
  139.180.134.177
  139.180.147.93
@@ -29798,53 +24550,39 @@
  139.180.214.151
  139.180.220.15
  139.180.220.179
-139.180.229.182
+139.180.224.63
  139.186.10.91
-139.186.122.226
  139.186.131.174
  139.186.132.77
  139.186.146.152
-139.186.148.93
  139.186.149.75
  139.186.155.116
-139.186.155.45
-139.186.24.82
  139.186.4.114
-139.186.64.239
  139.186.65.24
  139.186.67.188
  139.186.67.94
  139.186.68.226
  139.186.68.53
-139.186.69.133
  139.186.69.195
  139.186.69.226
-139.186.69.92
-139.186.72.74
  139.186.73.140
-139.186.76.101
  139.186.77.120
  139.186.77.174
  139.186.77.243
  139.186.77.46
  139.186.78.122
  139.186.8.212
-139.186.82.72
+139.190.238.37
  139.190.238.83
-139.193.121.173
+139.192.74.249
  139.193.2.101
-139.194.188.2
  139.194.188.242
+139.194.189.140
  139.194.189.224
  139.194.220.97
-139.194.231.117
  139.194.89.156
-139.194.89.234
-139.194.90.182
  139.194.90.92
  139.196.124.205
-139.196.156.254
-139.196.55.3
  139.198.120.226
  139.198.121.63
  139.198.122.116
@@ -29855,10 +24593,9 @@
  139.198.177.151
  139.198.18.230
  139.198.187.154
-139.198.189.45
+139.198.190.246
  139.198.191.240
  139.198.191.86
-139.198.23.115
  139.198.254.11
  139.198.5.138
  139.198.5.79
@@ -29880,8 +24617,7 @@
  139.199.18.200
  139.199.189.158
  139.199.200.182
-139.199.204.61
-139.199.208.176
+139.199.22.202
  139.199.223.208
  139.199.228.133
  139.199.23.233
@@ -29895,13 +24631,11 @@
  139.199.35.168
  139.199.4.191
  139.199.4.219
-139.199.4.28
  139.199.45.83
  139.199.48.124
  139.199.5.50
  139.199.62.142
  139.199.62.48
-139.199.64.247
  139.199.67.185
  139.199.74.11
  139.199.74.92
@@ -29911,37 +24645,28 @@
  139.199.80.75
  139.199.87.1
  139.199.88.244
-139.199.89.157
  139.199.94.100
-139.199.94.51
+139.199.99.195
  139.199.99.77
+139.201.164.223
  139.201.165.44
-139.208.133.119
-139.208.133.94
-139.208.160.136
-139.208.31.114
-139.209.34.34
-139.210.210.5
-139.210.4.206
  139.210.98.218
-139.211.33.77
-139.213.137.24
-139.214.251.230
  139.214.62.96
-139.214.92.142
  139.215.195.61
+139.215.208.125
  139.215.217.180
  139.215.217.181
  139.215.223.77
+139.216.239.223
  139.217.113.71
  139.217.115.144
  139.217.129.158
+139.217.134.138
  139.217.218.93
-139.217.236.198
-139.217.7.111
  139.217.82.115
  139.217.82.205
  139.217.95.45
+139.218.112.227
  139.219.0.154
  139.219.0.186
  139.219.1.61
@@ -29963,10 +24688,6 @@
  139.219.199.4
  139.219.2.114
  139.219.2.21
-139.219.2.86
-139.219.233.114
-139.219.239.76
-139.219.3.210
  139.219.4.181
  139.219.4.224
  139.219.5.251
@@ -29978,15 +24699,12 @@
  139.219.9.241
  139.219.9.34
  139.220.192.57
-139.224.104.83
  139.224.24.215
  139.224.37.83
  139.226.32.89
  139.226.34.78
  139.227.191.2
-139.227.66.99
-139.228.25.71
-139.228.27.134
+139.228.91.49
  139.255.100.235
  139.255.116.122
  139.255.17.58
@@ -30006,16 +24724,11 @@
  139.255.58.94
  139.255.69.149
  139.255.86.189
-139.255.86.19
-139.255.87.213
  139.255.87.236
  139.255.91.122
-139.255.93.198
  139.255.94.122
-139.28.218.34
  139.28.38.70
  139.28.38.80
-139.47.130.253
  139.47.135.215
  139.5.132.105
  139.5.153.177
@@ -30023,9 +24736,9 @@
  139.5.16.174
  139.5.177.10
  139.5.237.163
-139.5.237.238
  139.5.29.97
  139.5.31.211
+139.5.71.46
  139.5.71.70
  139.5.75.3
  139.59.1.162
@@ -30043,8 +24756,10 @@
  139.59.101.84
  139.59.102.170
  139.59.104.33
+139.59.104.65
  139.59.105.118
  139.59.105.246
+139.59.106.165
  139.59.106.168
  139.59.106.180
  139.59.107.34
@@ -30057,11 +24772,9 @@
  139.59.111.36
  139.59.112.158
  139.59.114.121
-139.59.114.138
  139.59.116.115
-139.59.116.238
  139.59.116.242
-139.59.116.243
+139.59.116.255
  139.59.118.196
  139.59.118.220
  139.59.118.3
@@ -30070,13 +24783,17 @@
  139.59.12.47
  139.59.12.63
  139.59.12.65
+139.59.121.143
  139.59.121.221
  139.59.122.42
  139.59.122.99
-139.59.124.74
+139.59.124.158
+139.59.124.51
  139.59.125.50
  139.59.125.61
  139.59.127.178
+139.59.127.21
+139.59.127.28
  139.59.129.216
  139.59.129.44
  139.59.129.45
@@ -30095,9 +24812,7 @@
  139.59.137.184
  139.59.138.115
  139.59.139.1
-139.59.139.32
  139.59.14.210
-139.59.14.54
  139.59.141.179
  139.59.142.220
  139.59.142.223
@@ -30106,12 +24821,11 @@
  139.59.145.220
  139.59.145.231
  139.59.146.28
-139.59.147.218
  139.59.148.20
  139.59.148.209
  139.59.148.56
  139.59.150.181
-139.59.151.124
+139.59.153.133
  139.59.154.228
  139.59.154.235
  139.59.154.65
@@ -30151,13 +24865,12 @@
  139.59.211.245
  139.59.212.98
  139.59.213.25
+139.59.214.109
  139.59.215.103
-139.59.215.171
  139.59.215.185
  139.59.215.241
  139.59.22.194
  139.59.22.201
-139.59.224.172
  139.59.225.255
  139.59.225.77
  139.59.226.129
@@ -30165,16 +24878,14 @@
  139.59.228.154
  139.59.228.20
  139.59.229.150
-139.59.229.152
  139.59.229.172
-139.59.230.117
-139.59.230.228
-139.59.233.59
  139.59.234.147
  139.59.236.25
  139.59.237.159
  139.59.237.165
+139.59.238.136
  139.59.238.14
+139.59.238.187
  139.59.239.193
  139.59.239.38
  139.59.240.39
@@ -30198,6 +24909,7 @@
  139.59.251.156
  139.59.251.222
  139.59.252.33
+139.59.254.203
  139.59.254.44
  139.59.255.101
  139.59.255.166
@@ -30220,7 +24932,6 @@
  139.59.39.109
  139.59.39.169
  139.59.39.170
-139.59.39.211
  139.59.4.21
  139.59.40.187
  139.59.40.233
@@ -30229,6 +24940,8 @@
  139.59.43.246
  139.59.43.75
  139.59.44.143
+139.59.44.232
+139.59.44.233
  139.59.45.128
  139.59.45.35
  139.59.46.243
@@ -30240,7 +24953,6 @@
  139.59.56.149
  139.59.57.169
  139.59.57.2
-139.59.57.30
  139.59.57.39
  139.59.59.165
  139.59.59.187
@@ -30250,7 +24962,6 @@
  139.59.60.9
  139.59.61.103
  139.59.61.144
-139.59.61.186
  139.59.61.215
  139.59.65.77
  139.59.66.248
@@ -30265,24 +24976,19 @@
  139.59.7.225
  139.59.7.251
  139.59.7.31
-139.59.7.5
  139.59.70.186
  139.59.70.72
-139.59.72.100
-139.59.72.191
  139.59.72.222
  139.59.72.96
  139.59.75.162
  139.59.75.249
  139.59.76.99
-139.59.78.239
  139.59.79.138
  139.59.79.235
  139.59.79.56
  139.59.8.10
  139.59.8.213
  139.59.80.147
-139.59.80.198
  139.59.80.88
  139.59.81.182
  139.59.82.142
@@ -30295,8 +25001,6 @@
  139.59.87.254
  139.59.88.246
  139.59.88.86
-139.59.9.135
-139.59.9.187
  139.59.90.148
  139.59.90.210
  139.59.90.37
@@ -30304,11 +25008,10 @@
  139.59.92.213
  139.59.92.53
  139.59.92.87
-139.59.93.40
  139.59.93.93
  139.59.94.1
  139.59.94.200
-139.59.95.139
+139.59.94.33
  139.59.95.250
  139.59.95.60
  139.59.96.171
@@ -30323,7 +25026,6 @@
  139.64.238.149
  139.87.64.65
  139.87.66.54
-139.87.66.55
  139.9.179.96
  139.99.102.114
  139.99.104.233
@@ -30332,7 +25034,6 @@
  139.99.105.5
  139.99.113.2
  139.99.114.108
-139.99.114.152
  139.99.118.62
  139.99.120.130
  139.99.123.236
@@ -30346,6 +25047,7 @@
  139.99.135.92
  139.99.140.52
  139.99.148.4
+139.99.155.187
  139.99.155.60
  139.99.156.128
  139.99.158.11
@@ -30367,7 +25069,6 @@
  139.99.237.109
  139.99.239.230
  139.99.26.68
-139.99.33.94
  139.99.37.27
  139.99.40.151
  139.99.40.44
@@ -30376,10 +25077,10 @@
  139.99.43.235
  139.99.49.202
  139.99.5.210
-139.99.52.183
  139.99.54.20
  139.99.55.149
  139.99.66.231
+139.99.69.189
  139.99.79.185
  139.99.8.31
  139.99.88.87
@@ -30403,13 +25104,7 @@
  13r.lg.ua
  13stages.com
  13suntrust4.7m.pl
-14.0.67.44
-14.0.82.115
-14.1.112.177
-14.102.101.102
-14.102.112.178
  14.102.113.39
-14.102.119.102
  14.102.13.244
  14.102.150.246
  14.102.154.66
@@ -30429,36 +25124,19 @@
  14.102.74.99
  14.102.97.201
  14.102.97.204
-14.104.208.86
-14.105.184.107
-14.105.36.32
  14.105.63.32
  14.109.112.100
  14.11.128.0
  14.110.223.90
-14.115.28.34
  14.115.29.33
+14.115.30.160
  14.115.30.26
-14.116.146.226
-14.116.147.38
-14.116.185.238
-14.116.189.231
-14.116.189.80
-14.116.190.241
-14.116.191.100
-14.116.193.5
-14.116.195.245
-14.116.207.212
-14.116.215.155
-14.116.216.39
  14.116.217.62
-14.117.190.128
  14.118.128.194
  14.118.213.112
-14.118.215.21
-14.12.147.161
-14.120.183.254
-14.127.248.160
+14.118.213.64
+14.120.180.73
+14.126.30.108
  14.128.9.199
  14.128.9.202
  14.128.9.238
@@ -30471,199 +25149,170 @@
  14.128.9.53
  14.128.9.57
  14.136.104.38
-14.136.108.203
  14.136.192.222
  14.136.201.82
  14.136.204.41
-14.136.249.138
+14.136.5.140
  14.136.80.242
  14.137.7.149
  14.138.109.129
  14.138.109.133
  14.138.139.91bin.sh
+14.138.8.215
  14.139.107.211
  14.139.125.117
  14.139.125.36
  14.139.155.134
-14.139.171.142
-14.139.181.195
  14.139.185.114
  14.139.185.82
-14.139.208.130
-14.139.209.210
  14.139.225.151
  14.139.229.44
  14.139.239.22
-14.139.242.247
-14.139.37.3
  14.139.56.14
-14.139.62.246
-14.139.86.76
-14.140.151.194
  14.140.195.165
  14.140.95.157
  14.141.175.107
-14.141.232.124
  14.141.61.171
-14.141.67.86
  14.141.73.10
  14.141.93.162
  14.142.128.237
-14.142.160.243
-14.142.197.114
  14.142.20.142
  14.142.243.82
  14.142.57.66
  14.143.13.67
  14.143.151.170
-14.143.158.186
  14.143.3.30
-14.143.46.147
+14.145.145.51
  14.145.172.78
-14.145.22.171
-14.146.94.30
-14.152.103.106
+14.145.175.12
  14.152.17.180
-14.152.19.20
-14.152.77.205
+14.152.19.24
  14.152.95.91
-14.154.30.146
+14.153.78.24
+14.154.28.235
+14.154.29.23
  14.154.30.159
  14.154.31.220
-14.155.19.12
-14.155.19.169
+14.155.17.112
+14.155.223.254
  14.155.223.83
  14.155.91.235
-14.156.51.232
+14.157.82.72
  14.160.196.69
  14.160.23.139
  14.160.26.18
  14.160.26.203
-14.160.61.18
-14.160.70.110
  14.160.93.230
  14.161.0.62
-14.161.14.123
-14.161.18.134
  14.161.19.186
-14.161.19.53
  14.161.2.15
  14.161.20.194
-14.161.238.39
-14.161.24.171
  14.161.29.242
-14.161.43.45
+14.161.34.184
+14.161.43.229
  14.161.44.120
  14.161.45.187
  14.161.46.132
  14.161.47.128
  14.161.48.145
  14.161.48.4
+14.161.49.29
  14.161.50.104
  14.161.6.201
  14.161.6.49
-14.161.78.191
  14.162.136.41
+14.162.141.125
  14.162.142.239
  14.162.144.102
  14.162.145.116
  14.162.145.182
  14.162.146.128
+14.162.146.31
  14.162.146.38
-14.162.147.86
-14.162.202.207
-14.162.210.250
+14.162.158.8
+14.162.211.78
  14.162.232.245
-14.162.240.224
+14.162.234.207
+14.162.36.198
  14.162.38.86
+14.162.61.99
  14.162.63.101
+14.162.72.120
+14.162.89.40
  14.163.113.156
-14.164.180.137
  14.164.207.148
+14.164.55.233
+14.165.105.17
  14.165.125.174
-14.167.228.160
-14.169.105.133
+14.169.104.133
  14.169.115.168
  14.169.116.153
-14.169.123.93
+14.169.120.246
  14.169.130.17
  14.169.147.194
+14.169.157.1
  14.169.161.179
+14.169.171.31
+14.169.185.107
  14.169.200.149
  14.169.203.244
-14.169.205.14
-14.169.64.104
-14.17.100.33
+14.169.239.57
  14.17.114.65
-14.170.190.70
-14.171.137.220
  14.171.199.142
  14.171.30.157
  14.172.101.9
-14.175.100.28
+14.173.241.48
+14.175.8.60
  14.176.157.95
+14.177.137.21
  14.177.156.159
-14.177.162.174
-14.177.182.2
-14.177.212.77
+14.177.189.147
+14.177.222.210
  14.177.235.178
-14.179.134.206
-14.18.101.26
-14.18.136.118
-14.18.151.181
+14.177.44.248
  14.18.154.186
-14.18.189.240
-14.18.236.20
  14.18.236.41
-14.184.157.180
+14.181.71.167
  14.184.233.226
  14.184.8.45
  14.185.106.195
+14.186.102.226
+14.186.111.169
+14.186.12.57
  14.186.151.33
  14.186.154.210
-14.186.156.72
-14.186.199.230
-14.186.200.86
+14.186.159.202
  14.186.211.158
+14.186.213.145
  14.186.223.13
  14.186.242.159
-14.186.249.240
-14.186.27.240
  14.186.32.66
-14.186.47.109
-14.186.63.185
-14.186.9.232
+14.186.40.183
  14.187.11.75
+14.187.118.222
+14.187.124.227
+14.187.127.94
+14.187.165.192
  14.187.180.143
+14.187.215.51
  14.187.24.32
+14.187.27.176
  14.187.28.189
-14.187.28.35
-14.187.49.194
  14.187.51.189
-14.187.60.11
-14.187.68.169
-14.187.68.9
  14.188.10.84
  14.189.142.90
-14.191.127.14
  14.191.173.88
  14.192.10.189
  14.192.128.222
-14.192.143.104
  14.192.147.250
  14.192.208.68
-14.192.244.154
-14.192.244.94
  14.192.248.5
  14.192.31.17
  14.192.31.4
  14.192.49.32
-14.193.27.238
-14.198.132.14
  14.198.163.2
  14.198.45.199
  14.199.2.59
-14.199.40.24
  14.20.187.22
  14.200.1.238
  14.200.197.130
@@ -30673,23 +25322,21 @@
  14.201.234.2
  14.202.250.110
  14.203.57.50
-14.204.145.108
  14.204.20.35
-14.204.211.122
  14.204.5.250
-14.204.84.96
-14.205.209.199
  14.207.121.109
  14.207.126.117
+14.207.126.197
  14.207.137.230
+14.207.146.73
  14.207.150.145
-14.207.150.58
  14.207.153.206
  14.207.16.69
  14.207.161.178
  14.207.177.235
  14.207.19.104
  14.207.22.38
+14.207.27.76
  14.207.28.162
  14.207.36.110
  14.207.36.50
@@ -30697,16 +25344,14 @@
  14.207.58.179
  14.207.59.166
  14.207.60.207
-14.207.61.226
-14.207.71.129
-14.207.81.41
+14.207.69.29
  14.207.83.187
+14.207.83.212
  14.207.85.55
  14.21.36.84
  14.21.42.158
-14.21.80.5
+14.211.1.137
  14.213.136.17
-14.213.138.123
  14.213.138.194
  14.215.107.171
  14.215.158.100
@@ -30714,10 +25359,7 @@
  14.215.166.17
  14.215.166.18
  14.215.166.25
-14.215.213.142
-14.215.236.114
  14.215.237.205
-14.215.49.234
  14.221.4.153
  14.221.97.10
  14.221.98.88
@@ -30729,30 +25371,22 @@
  14.225.8.27
  14.226.229.22
  14.226.229.81
-14.226.230.207
+14.226.231.56
  14.226.232.8
-14.226.244.212
+14.226.245.86
  14.226.250.170
  14.227.145.74
  14.228.205.15
-14.228.45.100
  14.229.120.6
-14.23.110.172
-14.23.110.173
+14.23.106.202
  14.23.122.98
  14.23.154.114
  14.23.170.234
-14.23.42.202
-14.23.91.82
  14.231.105.238
-14.231.109.226
  14.231.132.60
-14.231.168.82
-14.231.170.141
-14.231.190.33
+14.231.149.253
  14.231.48.39
-14.232.140.40
-14.232.152.13
+14.231.70.43
  14.232.160.197
  14.232.160.213
  14.232.160.247
@@ -30763,133 +25397,93 @@
  14.232.210.96
  14.232.214.138
  14.232.214.184
-14.232.225.200
  14.232.226.92
-14.232.232.128
+14.232.231.168
  14.232.243.36
  14.232.245.245
-14.233.175.8
+14.232.54.107
  14.233.34.102
  14.236.17.205
-14.236.23.206
-14.239.192.207
  14.241.120.185
  14.241.123.73
  14.241.133.178
  14.241.209.27
  14.241.231.21
-14.241.236.73
-14.241.240.245
  14.241.245.179
-14.241.39.247
-14.241.63.2
  14.242.86.216
-14.242.87.89
  14.243.144.147
  14.244.27.84
  14.245.237.59
  14.245.86.179
+14.246.174.119
  14.246.249.69
  14.247.149.40
  14.247.253.244
-14.248.104.69
  14.248.137.211
  14.248.143.144
+14.248.155.153
  14.248.170.121
+14.248.191.131
  14.248.226.229
  14.248.82.19
  14.248.83.32
  14.248.85.39
  14.248.94.127
+14.248.98.199
+14.248.99.200
  14.251.74.231
-14.29.118.34
+14.252.176.239
  14.29.126.53
  14.29.148.201
-14.29.162.139
-14.29.171.178
-14.29.179.228
-14.29.184.45
  14.29.185.188
  14.29.198.185
-14.29.201.72
-14.29.205.61
-14.29.222.225
  14.29.239.215
-14.29.242.40
  14.29.247.69
-14.29.249.7
  14.29.254.239
-14.29.64.243
  14.29.64.91
  14.32.164.18
  14.32.164.26
  14.32.18.38
-14.32.233.131
  14.33.227.93
-14.33.252.133
-14.33.28.222
-14.33.41.201
  14.33.45.230
+14.33.51.150
  14.33.77.170
+14.33.99.234
  14.34.157.101
-14.34.189.136
  14.34.207.70
-14.34.99.173
-14.34.99.226
  14.35.229.148
-14.36.13.11
-14.36.244.66
-14.36.251.30
-14.37.230.1
  14.37.244.28
  14.37.43.23
  14.38.231.114
-14.40.10.202
  14.40.102.160bin.sh
  14.40.23.66
  14.42.131.21
-14.42.144.228
  14.42.144.52
  14.42.155.140
-14.42.160.123
+14.42.65.9
  14.42.89.179
-14.44.96.65
-14.45.2.198
  14.46.12.180
  14.46.12.180bin.sh
  14.46.190.42bin.sh
-14.46.202.222
  14.46.230.78
  14.46.83.55
-14.47.77.176
-14.48.140.134
-14.48.243.15
-14.48.79.14
-14.48.93.118
+14.47.237.72
  14.49.37.103
  14.49.37.250
  14.49.38.105
  14.49.38.161
  14.49.38.47
-14.5.17.232
-14.50.39.53
-14.51.177.167
-14.51.242.131
  14.51.6.13
  14.51.6.13bin.sh
  14.52.178.230
  14.52.190.204
  14.52.249.27
  14.52.26.75
-14.52.70.46
-14.53.67.51
+14.53.68.4
  14.54.148.146
  14.54.16.206
-14.55.110.211
  14.55.133.64
-14.55.61.9
  14.56.180.103
-14.58.114.122
  14.6.215.163
  14.63.1.108
  14.63.160.219
@@ -30905,6 +25499,7 @@
  14.63.228.217
  14.63.55.164
  14.63.9.114
+14.98.115.50
  14.98.117.60
  14.98.134.74
  14.98.242.101
@@ -30916,24 +25511,19 @@
  14.99.140.82
  14.99.176.210
  14.99.221.102
-14.99.221.134
  14.99.233.222
-14.99.64.171
  14.99.68.91
-14.99.81.182
  14.99.81.218
  14.ip-51-178-42.eu
  140-365.net
  140.113.212.4
-140.113.220.165
  140.113.88.236
  140.114.91.139
-140.123.97.148
  140.127.218.25
  140.127.218.27
  140.127.218.40
  140.128.85.2
-140.137.63.175
+140.136.158.199
  140.143.0.121
  140.143.0.127
  140.143.0.226
@@ -30960,17 +25550,15 @@
  140.143.153.79
  140.143.154.22
  140.143.155.17
-140.143.156.205
-140.143.17.113
  140.143.18.119
  140.143.18.2
  140.143.183.71
  140.143.187.21
  140.143.189.177
  140.143.189.29
-140.143.189.58
  140.143.19.124
  140.143.19.237
+140.143.19.50
  140.143.190.76
  140.143.193.52
  140.143.195.157
@@ -30986,7 +25574,6 @@
  140.143.210.92
  140.143.22.35
  140.143.222.87
-140.143.224.170
  140.143.225.42
  140.143.226.19
  140.143.228.18
@@ -30996,15 +25583,10 @@
  140.143.230.109
  140.143.230.28
  140.143.231.85
-140.143.233.133
  140.143.233.218
  140.143.233.29
-140.143.236.227
-140.143.236.54
-140.143.238.108
  140.143.239.86
  140.143.24.26
-140.143.241.10
  140.143.243.27
  140.143.244.192
  140.143.247.30
@@ -31024,26 +25606,20 @@
  140.143.38.123
  140.143.39.177
  140.143.39.186
-140.143.45.215
  140.143.46.240
  140.143.5.175
  140.143.5.181
  140.143.56.61
-140.143.57.159
  140.143.57.195
  140.143.61.200
  140.143.7.232
-140.143.8.235
-140.143.8.92
  140.143.9.175
  140.143.9.192
-140.143.90.154
  140.143.93.31
  140.143.95.102
  140.147.236.194
-140.148.239.235
+140.186.202.202
  140.186.212.146
-140.186.235.254
  140.190.17.138
  140.190.21.8
  140.203.155.11
@@ -31056,62 +25632,47 @@
  140.206.242.34
  140.206.242.83
  140.206.72.238
+140.206.86.124
  140.206.86.125
  140.207.100.82
  140.207.101.90
  140.207.114.2
-140.207.165.114
  140.207.232.13
  140.207.48.242
  140.207.96.235
  140.210.90.209
  140.210.90.211
-140.210.91.54
  140.210.92.32
-140.210.92.44
  140.210.92.82
-140.224.142.128
+140.227.11.26
  140.237.255.239
  140.237.28.156
  140.237.31.18
  140.238.13.149
  140.238.14.203
  140.238.14.40
+140.238.152.136
  140.238.177.23
  140.238.177.83
  140.238.19.193
-140.238.191.43
  140.238.212.126
  140.238.213.21
-140.238.227.168
  140.238.229.147
-140.238.23.148
  140.238.231.247
  140.238.231.250
  140.238.246.32
  140.238.25.151
-140.238.251.99
  140.238.30.111
  140.238.49.143
  140.238.7.133
-140.240.111.6
-140.240.148.160
+140.238.77.68
  140.240.81.70
-140.246.125.203
-140.246.225.169
-140.249.17.94
+140.240.82.167
  140.249.172.136
-140.249.19.110
  140.249.191.246
  140.249.193.85
-140.249.20.167
-140.249.204.167
-140.249.205.149
  140.249.205.58
-140.249.213.243
-140.249.48.49
  140.250.112.6
-140.82.21.163
  140.82.3.102
  140.82.31.143
  140.82.32.116
@@ -31130,9 +25691,10 @@
  14079.url.snwxn.com
  140bd7dca2f0a46e46c62254903e7589-dot-dbenitonline.ey.r.appspot.com
  140teakwood.com
-141.0.226.105
-141.101.104.55
-141.101.107.164
+141.101.104.241
+141.101.105.84
+141.101.105.92
+141.101.107.54
  141.101.143.11
  141.101.143.15
  141.101.143.21
@@ -31154,54 +25716,44 @@
  141.101.143.7
  141.101.143.9
  141.101.25.191
-141.101.68.38
-141.101.69.105
+141.101.68.16
  141.101.69.143
-141.101.69.165
  141.101.69.181
-141.101.69.193
-141.101.69.199
-141.101.69.247
-141.101.69.31
-141.101.69.39
-141.101.69.9
+141.101.76.110
+141.101.76.77
  141.101.8.36
-141.101.96.5
-141.101.98.16
+141.101.96.161
+141.101.98.20
  141.101.98.52
-141.101.98.68
-141.101.99.163
-141.101.99.167
+141.101.98.54
+141.101.99.5
+141.101.99.63
+141.105.104.153
  141.105.104.167
  141.105.105.147
  141.105.105.22
  141.105.132.43
  141.105.132.91
-141.105.174.47
  141.105.65.254
  141.105.68.25
-141.105.69.130
  141.105.69.69
  141.108.255.109
-141.134.172.52
  141.135.2.95
  141.136.189.168
  141.136.33.173
  141.136.35.150
  141.136.44.228
-141.149.36.27
+141.138.37.33
  141.151.238.243
  141.154.76.46
  141.157.202.138
  141.170.137.113
  141.193.115.2
-141.193.155.171
  141.193.158.218
  141.223.5.11
  141.223.82.131
  141.223.82.138
  141.223.82.61
-141.226.1.11
  141.226.122.122
  141.226.18.9
  141.239.148.100
@@ -31218,7 +25770,6 @@
  141.255.186.142
  141.255.186.145
  141.255.186.148
-141.48.223.253
  141.8.143.138
  141.8.143.163
  141.8.143.191
@@ -31226,7 +25777,6 @@
  141.8.143.205
  141.8.143.228
  141.8.55.249bin.sh
-141.85.192.66
  141.85.216.231
  141.98.10.0
  141.98.10.136
@@ -31240,22 +25790,18 @@
  141.98.10.212
  141.98.10.213
  141.98.10.214
-141.98.10.55
  141.98.10.59
  141.98.100.71
  141.98.100.86
-141.98.103.162
-141.98.252.162
+141.98.102.148
  141.98.252.163
-141.98.255.154
+141.98.255.150
+141.98.255.152
  141.98.80.177
-141.98.80.242
-141.98.80.39
  141.98.80.79
+141.98.80.80
+141.98.80.81
  141.98.80.87
-141.98.81.139
-141.98.81.141
-141.98.81.154
  141.98.81.192
  141.98.81.194
  141.98.81.196
@@ -31263,10 +25809,6 @@
  141.98.81.199
  141.98.81.200
  141.98.81.202
-141.98.82.19
-141.98.83.187
-141.98.87.229
-141.98.87.43
  141.98.9.162
  141.98.9.163
  141.98.9.164
@@ -31287,7 +25829,6 @@
  142.0.135.2
  142.0.138.34
  142.105.247.84
-142.11.110.71
  142.11.194.209
  142.11.195.117
  142.11.195.135
@@ -31337,18 +25878,15 @@
  142.114.208.141
  142.122.95.159
  142.126.207.173
-142.126.240.97
  142.126.71.50
-142.147.110.218
-142.147.111.75
+142.147.107.103
  142.147.96.198
-142.161.93.145
-142.165.181.78
+142.165.167.117
  142.169.145.97
+142.190.12.250
  142.190.28.198
  142.190.70.125
  142.202.222.17
-142.234.202.20
  142.252.248.65
  142.4.102.226
  142.4.109.196
@@ -31367,15 +25905,13 @@
  142.4.223.249
  142.4.23.62
  142.4.26.59
+142.4.30.19
  142.4.4.229
-142.4.9.131
  142.44.132.248
  142.44.133.80
  142.44.136.19
  142.44.139.12
  142.44.142.126
-142.44.142.226
-142.44.145.245
  142.44.146.33
  142.44.156.131
  142.44.160.40
@@ -31392,9 +25928,7 @@
  142.44.211.179
  142.44.211.27
  142.44.211.57
-142.44.213.196
  142.44.213.234
-142.44.214.3
  142.44.218.192
  142.44.232.99
  142.44.242.38
@@ -31434,7 +25968,6 @@
  142.93.102.204
  142.93.102.231
  142.93.103.141
-142.93.103.225
  142.93.104.92
  142.93.105.212
  142.93.106.56
@@ -31457,9 +25990,8 @@
  142.93.121.236
  142.93.121.47
  142.93.122.58
-142.93.123.228
-142.93.123.239
  142.93.124.101
+142.93.126.181
  142.93.127.129
  142.93.130.169
  142.93.131.1
@@ -31469,21 +26001,17 @@
  142.93.137.184
  142.93.138.116
  142.93.138.73
-142.93.139.122
  142.93.141.192
-142.93.142.192
  142.93.143.85
  142.93.145.85
  142.93.152.19
  142.93.152.23
  142.93.153.126
-142.93.158.162
  142.93.159.172
  142.93.160.215
  142.93.162.140
  142.93.162.220
  142.93.163.135
-142.93.163.152
  142.93.165.104
  142.93.166.13
  142.93.168.249
@@ -31503,15 +26031,12 @@
  142.93.174.231
  142.93.174.237
  142.93.175.121
-142.93.175.144
-142.93.176.138
  142.93.178.254
  142.93.179.74
  142.93.18.203
  142.93.180.113
  142.93.181.21
  142.93.182.82
-142.93.183.128
  142.93.183.4
  142.93.191.114
  142.93.191.61
@@ -31539,11 +26064,8 @@
  142.93.206.202
  142.93.206.246
  142.93.207.94
-142.93.208.205
  142.93.208.24
-142.93.209.158
  142.93.21.188
-142.93.21.58
  142.93.210.229
  142.93.211.192
  142.93.211.36
@@ -31551,37 +26073,28 @@
  142.93.212.10
  142.93.212.91
  142.93.213.254
-142.93.214.86
  142.93.215.19
  142.93.216.97
-142.93.218.104
  142.93.218.202
  142.93.218.225
-142.93.220.54
  142.93.220.75
  142.93.222.121
  142.93.223.118
  142.93.223.152
-142.93.224.117
  142.93.224.234
  142.93.225.198
  142.93.225.68
  142.93.226.42
  142.93.228.111
-142.93.23.172
  142.93.23.235
-142.93.231.137
  142.93.235.47
  142.93.236.246
-142.93.237.57
-142.93.238.233
  142.93.239.251
  142.93.240.141
  142.93.240.192
  142.93.240.24
  142.93.241.133
  142.93.241.19
-142.93.242.246
  142.93.243.133
  142.93.244.184
  142.93.244.77
@@ -31600,22 +26113,18 @@
  142.93.251.1
  142.93.252.120
  142.93.252.89
+142.93.253.189
  142.93.254.122
  142.93.254.126
  142.93.255.200
  142.93.3.119
  142.93.30.86
  142.93.32.85
-142.93.34.169
  142.93.34.237
  142.93.35.169
  142.93.35.230
-142.93.36.219
  142.93.37.1
-142.93.37.178
  142.93.38.61
-142.93.38.96
-142.93.40.98
  142.93.42.177
  142.93.42.206
  142.93.43.120
@@ -31624,11 +26133,9 @@
  142.93.44.20
  142.93.45.249
  142.93.45.250
-142.93.46.198
  142.93.49.148
  142.93.52.174
  142.93.52.3
-142.93.55.166
  142.93.56.57
  142.93.57.0
  142.93.57.247
@@ -31637,7 +26144,6 @@
  142.93.58.97
  142.93.6.38
  142.93.62.240
-142.93.65.72
  142.93.65.9
  142.93.66.172
  142.93.67.236
@@ -31650,12 +26156,9 @@
  142.93.72.206
  142.93.72.250
  142.93.76.102
-142.93.77.12
  142.93.78.168
  142.93.79.125
-142.93.8.147
  142.93.8.99
-142.93.82.229
  142.93.83.242
  142.93.85.123
  142.93.85.97
@@ -31670,94 +26173,60 @@
  142.93.98.144
  142.93.98.88
  142.93.99.114
-142.93.99.56
  142.ip-164-132-197.eu
  1423-thurman.com
  143.0.177.198
  143.0.178.142
  143.0.179.55
+143.0.64.145
  143.0.87.101
  143.110.120.90
  143.110.128.19
  143.110.137.82
  143.110.143.51
+143.110.144.158
  143.110.147.13
  143.110.153.150
-143.110.154.62
  143.110.157.157
  143.110.157.215
  143.110.158.176
  143.110.159.19
  143.110.160.178
  143.110.162.99
-143.110.164.154
-143.110.167.116
-143.110.167.127
-143.110.167.131
-143.110.171.147
-143.110.171.167
-143.110.171.187
  143.110.171.191
-143.110.171.203
-143.110.171.223
-143.110.171.238
  143.110.171.5
  143.110.174.177
  143.110.175.239
  143.110.175.241
  143.110.175.248
  143.110.175.69
+143.110.176.193
  143.110.177.152
  143.110.177.168
  143.110.177.183
-143.110.177.44
  143.110.178.161
  143.110.179.108
  143.110.179.92
-143.110.180.128
  143.110.181.10
-143.110.181.119
-143.110.181.250
  143.110.181.32
-143.110.181.63
  143.110.181.68
  143.110.181.81
-143.110.181.90
-143.110.181.93
-143.110.182.156
-143.110.182.209
-143.110.182.219
  143.110.182.228
-143.110.182.239
  143.110.182.24
-143.110.182.32
-143.110.182.79
  143.110.183.1
-143.110.183.16
-143.110.183.26
-143.110.183.29
-143.110.183.33
  143.110.183.91
-143.110.184.78
+143.110.184.52
  143.110.184.88
  143.110.185.146
  143.110.186.116
  143.110.186.17
-143.110.186.22
-143.110.186.250
  143.110.187.136
  143.110.187.204
  143.110.188.224
-143.110.188.239
  143.110.188.254
-143.110.188.4
  143.110.188.7
  143.110.189.226
-143.110.189.241
-143.110.189.248
  143.110.189.44
-143.110.189.97
-143.110.190.212
  143.110.190.26
  143.110.190.71
  143.110.216.174
@@ -31768,10 +26237,9 @@
  143.110.226.68
  143.110.228.192
  143.110.228.219
+143.110.228.92
  143.110.229.124
  143.110.234.241
-143.110.234.84
-143.110.237.196
  143.110.237.57
  143.110.238.129
  143.110.238.132
@@ -31781,10 +26249,8 @@
  143.110.240.26
  143.110.240.87
  143.110.240.88
-143.110.244.9
  143.110.248.63
  143.110.250.87
-143.110.250.88
  143.110.250.97
  143.110.250.98
  143.110.250.99
@@ -31799,6 +26265,7 @@
  143.137.126.39
  143.137.126.40
  143.137.127.46
+143.137.128.254
  143.137.130.1
  143.137.72.94
  143.159.142.54
@@ -31806,7 +26273,6 @@
  143.176.224.104
  143.178.139.0
  143.178.35.162
-143.178.39.248
  143.178.44.93
  143.178.64.10
  143.202.136.18
@@ -31824,35 +26290,30 @@
  143.202.227.60
  143.202.227.81
  143.202.97.193
-143.208.128.6
-143.208.137.6
-143.208.239.86
  143.225.81.253
  143.244.39.190
  143.244.39.197
  143.244.44.211
-143.244.54.172
+143.244.44.51
+143.244.47.102
  143.244.57.107
-143.244.57.115
  143.244.57.233
  143.244.59.138
  143.248.144.60
-143.255.123.101
  143.255.130.2
  143.255.140.164
  143.255.140.204
  143.255.140.232
  143.255.142.80
  143.255.198.246
-143.255.237.1
-143.255.242.204
  143.255.52.102
  143.255.52.195
  143.255.52.198
  143.255.52.67
-143.59.105.199
  143.59.208.91
  143.89.60.134
+143.92.36.12
+143.92.45.244
  143.92.47.107
  143.92.51.12
  143.92.51.14
@@ -31862,53 +26323,39 @@
  143.92.51.90
  143.92.51.91
  143.92.51.93
-143.92.56.232
-143.92.57.144
-143.92.57.145
-143.92.57.146
-143.92.57.147
-143.92.57.149
-143.92.57.156
-143.92.57.188
-143.92.57.190
-143.92.57.196
-143.92.57.197
-143.92.57.200
-143.92.57.230
  143.92.61.230
  143.95.101.72
+143.95.146.76
  143.95.156.174
-143.95.34.59
-144.0.67.171
  144.121.29.100
  144.123.160.129
  144.123.160.165
-144.123.36.14
  144.123.5.178
  144.126.204.133
  144.126.204.230
  144.137.208.140
  144.137.29.181
  144.139.158.155
-144.139.195.70
  144.139.228.113
  144.139.247.220
  144.139.56.105
  144.139.91.187
  144.168.164.26
-144.168.166.198
  144.168.166.204
  144.168.166.222
-144.168.183.9
+144.168.183.35
+144.168.191.86
  144.168.201.146
  144.168.201.154
  144.168.201.162
  144.168.201.223
+144.168.213.126
  144.168.225.113
  144.168.225.77
  144.168.225.87
  144.168.225.95
  144.168.227.123
+144.168.227.196
  144.168.227.254
  144.168.227.80
  144.168.230.26
@@ -31973,8 +26420,8 @@
  144.208.65.145
  144.217.101.245
  144.217.105.118
-144.217.105.209
  144.217.117.146
+144.217.12.237
  144.217.12.95
  144.217.128.227
  144.217.13.109
@@ -31996,22 +26443,17 @@
  144.217.190.197
  144.217.190.215
  144.217.191.227
-144.217.207.37
-144.217.207.56
-144.217.207.64
  144.217.209.252
-144.217.211.2
  144.217.240.89
  144.217.241.5
  144.217.243.216
  144.217.245.243
  144.217.252.102
  144.217.252.18
+144.217.253.110
  144.217.29.74
-144.217.34.148
-144.217.34.151
+144.217.39.93
  144.217.40.115
-144.217.50.88
  144.217.54.7
  144.217.6.61
  144.217.60.211
@@ -32029,10 +26471,12 @@
  144.217.84.165
  144.217.85.124
  144.217.85.4
+144.217.86.167
  144.217.87.192
  144.217.87.197
  144.217.89.55
  144.22.98.225
+144.255.17.164
  144.255.17.185
  144.34.130.253
  144.34.144.21
@@ -32041,6 +26485,7 @@
  144.34.161.65
  144.34.162.249
  144.34.163.191
+144.34.170.72
  144.34.172.241
  144.34.178.219
  144.34.178.90
@@ -32063,11 +26508,8 @@
  144.48.109.179
  144.48.109.180
  144.48.109.182
-144.48.167.215
+144.48.167.71
  144.48.168.128
-144.48.168.133
-144.48.168.149
-144.48.170.198
  144.48.220.43
  144.48.220.44
  144.48.220.45
@@ -32100,6 +26542,7 @@
  144.76.13.207
  144.76.134.212
  144.76.136.174
+144.76.138.23
  144.76.15.207
  144.76.15.232
  144.76.15.240
@@ -32107,6 +26550,7 @@
  144.76.156.185
  144.76.158.79
  144.76.16.52
+144.76.162.37
  144.76.163.213
  144.76.164.43
  144.76.176.150
@@ -32154,7 +26598,6 @@
  144.76.64.115
  144.76.64.79
  144.76.67.215
-144.76.68.124
  144.76.71.116
  144.76.75.28
  144.76.76.109
@@ -32176,7 +26619,6 @@
  144.76.98.163
  144.76.99.197
  144.76.99.207
-144.91.104.26
  144.91.111.114
  144.91.116.44
  144.91.120.173
@@ -32193,9 +26635,9 @@
  144.91.77.184
  144.91.82.22
  144.91.83.122
+144.91.84.50
  144.91.85.29
  144.91.86.14
-144.91.87.106
  144.91.87.159
  144.91.89.108
  144.91.94.215
@@ -32204,6 +26646,7 @@
  1445.3190cfdae.com
  145-365.net
  145.130.46.204
+145.131.24.179
  145.131.24.242
  145.131.25.134
  145.131.25.239
@@ -32212,7 +26655,6 @@
  145.132.117.235
  145.132.50.204
  145.14.157.145
-145.14.158.234
  145.14.192.206
  145.239.10.50
  145.239.103.151
@@ -32221,7 +26663,6 @@
  145.239.120.129
  145.239.123.117
  145.239.133.16
-145.239.135.159
  145.239.139.202
  145.239.14.218
  145.239.144.188
@@ -32235,7 +26676,6 @@
  145.239.19.186
  145.239.201.0
  145.239.201.1
-145.239.205.156
  145.239.209.0
  145.239.21.235
  145.239.211.242
@@ -32260,11 +26700,9 @@
  145.239.41.207
  145.239.41.210
  145.239.41.248
-145.239.6.55
  145.239.64.167
  145.239.69.74
  145.239.76.62
-145.239.78.59
  145.239.8.65
  145.239.80.14
  145.239.82.102
@@ -32296,6 +26734,8 @@
  145.249.106.174
  145.249.107.19
  145.249.107.35
+145.249.132.152
+145.249.147.209
  145.249.153.223
  145.253.118.157
  145.253.133.50
@@ -32326,11 +26766,8 @@
  146.0.77.66
  146.0.77.96
  146.0.78.51
-146.115.58.159
-146.120.101.114
-146.120.168.191
+146.120.168.98
  146.120.197.77
-146.120.214.61
  146.120.215.106
  146.148.101.151
  146.148.114.236
@@ -32347,10 +26784,10 @@
  146.148.86.107
  146.148.88.9
  146.148.90.200
+146.155.246.2
  146.158.130.171
  146.158.173.164
  146.158.175.76
-146.158.73.218
  146.164.54.5
  146.168.111.70
  146.185.128.111
@@ -32404,6 +26841,7 @@
  146.185.182.59
  146.185.200.112
  146.185.200.114
+146.185.200.117
  146.185.200.121
  146.185.200.125
  146.185.200.13
@@ -32416,8 +26854,6 @@
  146.185.200.147
  146.185.200.15
  146.185.200.154
-146.185.200.162
-146.185.200.167
  146.185.200.170
  146.185.200.176
  146.185.200.179
@@ -32444,21 +26880,18 @@
  146.185.200.246
  146.185.200.31
  146.185.200.35
-146.185.200.52
  146.185.200.55
  146.185.200.61
  146.185.200.65
  146.185.200.67
  146.185.200.70
-146.185.200.73
  146.185.200.74
-146.185.200.75
  146.185.200.81
  146.185.200.86
  146.185.200.99
  146.185.201.127
+146.185.201.152
  146.185.201.19
-146.185.201.199
  146.185.201.33
  146.185.201.82
  146.185.201.84
@@ -32467,6 +26900,7 @@
  146.185.202.11
  146.185.202.133
  146.185.202.199
+146.185.202.211
  146.185.202.72
  146.185.203.101
  146.185.203.180
@@ -32477,31 +26911,24 @@
  146.185.253.134
  146.185.253.157
  146.196.108.78
-146.196.120.5
-146.196.54.91
  146.196.55.156
+146.196.60.13
  146.196.63.192
  146.196.63.66
  146.196.63.89
-146.196.64.137
  146.196.67.88
  146.196.98.202
  146.199.19.131
-146.199.25.227
-146.199.25.233
  146.20.103.191
  146.20.103.208
  146.20.110.77
-146.20.66.233
  146.241.39.245
  146.247.158.29
  146.247.158.29bin.sh
-146.247.241.242
  146.247.25.80
  146.247.25.81
  146.247.25.88
  146.255.24.28
-146.255.81.98
  146.255.96.214
  146.52.147.13
  146.52.206.114
@@ -32512,34 +26939,26 @@
  146.56.198.246
  146.56.200.181
  146.56.201.34
-146.56.203.227
-146.56.203.75
-146.56.207.177
  146.56.216.83
  146.56.217.44
  146.56.220.95
-146.56.221.82
  146.56.223.228
  146.56.229.128
-146.59.133.163
  146.59.146.249
  146.59.153.189
  146.59.154.120
  146.59.154.68
  146.59.155.27
  146.59.157.181
-146.59.158.165
  146.59.158.228
  146.59.159.162
-146.59.160.240
  146.59.196.219
  146.59.196.252
  146.59.198.37
  146.59.225.194
  146.59.225.195
-146.59.225.221
-146.59.225.232
  146.59.228.182
+146.59.231.129
  146.59.232.162
  146.59.235.27
  146.59.236.152
@@ -32554,10 +26973,11 @@
  146.83.216.186
  146.83.222.25
  146.88.237.35
+146.88.237.43
  146.88.240.4
-146.88.78.130
  1469-squid.com
  147.114.226.194
+147.123.11.44
  147.135.1.79
  147.135.10.96
  147.135.105.62
@@ -32583,7 +27003,6 @@
  147.135.210.182
  147.135.211.73
  147.135.231.210
-147.135.246.41
  147.135.252.43
  147.135.3.105
  147.135.39.240
@@ -32591,25 +27010,23 @@
  147.135.6.179
  147.135.76.206
  147.135.93.56
-147.139.130.224
  147.139.132.12
-147.139.135.159
+147.139.134.59
  147.139.135.212
  147.139.138.39
-147.139.138.57
-147.139.168.137
+147.139.168.106
  147.139.168.215
  147.139.172.122
+147.139.176.65
  147.139.177.71
-147.139.179.112
  147.139.181.138
-147.139.183.18
  147.139.192.155
  147.139.29.173
-147.139.32.154
-147.139.33.16
+147.139.31.22
+147.139.32.95
  147.139.34.238
  147.139.34.79
+147.139.36.235
  147.139.37.49
  147.139.5.160
  147.139.5.254
@@ -32619,44 +27036,35 @@
  147.147.231.166
  147.147.84.206
  147.161.193.51
-147.194.162.214
-147.203.238.18
  147.229.13.210
  147.229.146.52
  147.231.106.250
  147.27.70.36
-147.30.87.117
-147.75.118.234
+147.30.50.97
+147.75.113.110
  147.75.118.239
  147.75.118.241
  147.75.118.247
+147.75.118.249
  147.75.124.130
  147.75.47.199
-147.78.168.30
  147.78.64.212
  147.78.65.253
  147.78.66.149
  147.83.195.55
  147.91.111.132
  147.91.111.134
-147.91.111.17
  1475a390633025231.temporary.link
  1477304571.storage.googleapis.com
-148.0.11.252
  148.0.110.233
+148.0.12.149
  148.0.237.76
-148.0.27.109
-148.0.41.207
  148.101.9.69
  148.102.19.144
  148.102.22.76
-148.102.48.43
  148.103.9.41
  148.153.11.58
-148.153.12.207
-148.153.12.214
  148.153.23.18
-148.153.37.2
  148.163.113.10
  148.163.168.124
  148.163.168.6
@@ -32665,7 +27073,6 @@
  148.204.63.249
  148.216.17.38
  148.217.94.54
-148.222.45.3
  148.223.120.122
  148.223.66.57
  148.228.214.141
@@ -32677,12 +27084,8 @@
  148.235.82.68
  148.240.238.91
  148.240.70.42
-148.240.92.126
  148.240.94.2
  148.240.94.5
-148.243.155.217
-148.243.170.66
-148.243.243.65
  148.243.72.112
  148.245.13.21
  148.245.79.115
@@ -32691,13 +27094,14 @@
  148.251.110.53
  148.251.110.54
  148.251.12.132
+148.251.123.50
  148.251.124.172
  148.251.131.164
  148.251.136.130
  148.251.139.241
  148.251.144.116
  148.251.144.220
-148.251.153.114
+148.251.153.6
  148.251.155.70
  148.251.178.165
  148.251.178.72
@@ -32711,6 +27115,7 @@
  148.251.208.48
  148.251.22.104
  148.251.22.209
+148.251.234.104
  148.251.236.212
  148.251.236.72
  148.251.237.73
@@ -32723,7 +27128,6 @@
  148.251.51.132
  148.251.52.4
  148.251.68.199
-148.251.69.139
  148.251.69.164
  148.251.70.148
  148.251.75.60
@@ -32733,8 +27137,8 @@
  148.251.84.22
  148.251.87.112
  148.255.120.74
+148.255.226.150
  148.255.76.53
-148.56.84.67
  148.63.215.173
  148.66.128.51
  148.66.129.116
@@ -32748,6 +27152,7 @@
  148.66.145.135
  148.66.145.146
  148.66.145.32
+148.66.145.6
  148.66.146.2
  148.66.146.23
  148.66.146.42
@@ -32773,40 +27178,29 @@
  148.70.129.112
  148.70.132.213
  148.70.14.121
-148.70.149.216
  148.70.149.39
  148.70.151.100
  148.70.152.56
-148.70.153.21
  148.70.154.166
-148.70.171.31
  148.70.178.70
-148.70.18.216
-148.70.181.166
  148.70.195.242
  148.70.201.162
  148.70.209.112
+148.70.211.175
  148.70.229.221
-148.70.241.101
-148.70.241.56
  148.70.250.254
  148.70.251.58
  148.70.29.243
-148.70.29.56
  148.70.31.188
  148.70.33.136
  148.70.34.160
  148.70.38.183
-148.70.53.219
  148.70.70.55
+148.70.77.116
  148.70.84.202
-148.70.88.43
  148.70.89.212
-148.70.93.176
  148.72.105.246
-148.72.153.203
  148.72.160.176
-148.72.168.23
  148.72.202.188
  148.72.208.210
  148.72.209.9
@@ -32830,6 +27224,7 @@
  148.72.232.36
  148.72.232.39
  148.72.232.63
+148.72.248.42
  148.72.59.154
  148.72.64.192
  148.72.65.173
@@ -32838,59 +27233,51 @@
  148.77.34.196
  148.77.34.200
  148117-dot-n-e-w-me-ss-age-po-rt-al.wl.r.appspot.com
-149.0.204.57
-149.0.218.138
  149.107.0.76
  149.12.129.227
  149.129.101.217
  149.129.102.110
+149.129.106.113
+149.129.128.16
  149.129.129.91
-149.129.131.134
-149.129.134.59
-149.129.136.24
+149.129.137.131
  149.129.137.193
-149.129.138.104
-149.129.139.238
-149.129.139.95
+149.129.139.48
+149.129.139.90
+149.129.167.249
+149.129.174.104
  149.129.174.48
-149.129.182.216
  149.129.182.60
  149.129.184.49
  149.129.186.134
-149.129.190.133
-149.129.191.24
+149.129.186.98
  149.129.191.88
+149.129.220.95
  149.129.222.49
  149.129.222.54
  149.129.222.60
+149.129.227.63
  149.129.233.28
  149.129.235.128
  149.129.235.234
  149.129.236.66
  149.129.237.83
-149.129.241.106
-149.129.244.23
-149.129.244.83
-149.129.253.48
+149.129.242.144
+149.129.245.133
+149.129.251.229
  149.129.254.198
-149.129.254.65
  149.129.255.55
  149.129.34.80
-149.129.35.250
  149.129.41.70
  149.129.44.63
-149.129.50.175
  149.129.52.21
  149.129.56.121
  149.129.57.134
  149.129.57.246
-149.129.60.107
-149.129.68.143
  149.129.90.72
  149.129.95.189
-149.20.243.155
+149.20.244.69
  149.200.79.132
-149.202.102.36
  149.202.103.119
  149.202.103.250
  149.202.110.47
@@ -32945,30 +27332,29 @@
  149.202.8.66
  149.202.81.92
  149.202.83.78
+149.202.86.68
  149.202.87.175
  149.202.89.125
  149.202.93.136
  149.210.143.165
-149.210.144.73
  149.210.155.74
  149.210.160.125
  149.210.169.10
  149.210.189.102
-149.224.178.160
  149.224.19.165
+149.224.241.19
+149.224.252.84
  149.224.63.219
-149.224.71.113
  149.224.86.73
  149.248.10.11
+149.248.101.82
  149.248.13.187
  149.248.58.177
  149.248.59.143
  149.248.8.73
  149.248.9.85
  149.255.154.62
-149.255.31.216
  149.255.36.133
-149.255.59.20
  149.255.62.89
  149.28.112.35
  149.28.113.236
@@ -33004,7 +27390,6 @@
  149.28.247.47
  149.28.29.196
  149.28.30.77
-149.28.39.130
  149.28.43.92
  149.28.46.48
  149.28.54.28
@@ -33031,14 +27416,8 @@
  149.3.170.237
  149.3.170.238
  149.3.170.244
-149.3.170.68
-149.3.170.69
+149.3.170.79
  149.3.36.210
-149.3.73.159
-149.3.73.225
-149.3.73.242
-149.3.73.249
-149.3.85.81
  149.31.6.24
  149.34.0.174
  149.34.6.162
@@ -33066,45 +27445,36 @@
  149.56.141.170
  149.56.142.1
  149.56.147.33
-149.56.15.107
  149.56.151.196
  149.56.170.37
-149.56.186.152
  149.56.19.4
  149.56.192.110
  149.56.202.35
-149.56.22.52
-149.56.222.226
  149.56.223.104
  149.56.223.241
  149.56.228.38
  149.56.229.16
-149.56.23.18
-149.56.234.191
-149.56.250.246
  149.56.26.173
-149.56.29.118
-149.56.31.218
  149.56.38.93
  149.56.41.33
  149.56.44.101
  149.56.44.47
-149.56.45.139
  149.56.47.75
  149.56.70.122
  149.56.71.53
  149.56.79.215
  149.56.84.16
  149.56.84.18
-149.56.9.64
  149.56.97.139
  149.56.97.144
  149.56.97.145
  149.56.99.85
+149.62.172.42
  149.62.172.62
  149.62.173.247
  149.62.42.30
  149.7.217.27
+149.72.133.95
  149.74.120.231
  149.81.153.3
  149.81.157.0
@@ -33158,17 +27528,16 @@
  15.207.108.70
  15.207.111.189
  15.207.116.17
+15.207.117.8
  15.207.19.192
  15.207.19.34
  15.207.247.178
-15.207.254.245
  15.207.50.109
  15.207.6.9
  15.207.71.62
  15.207.87.172
  15.223.114.10
  15.223.116.208
-15.223.28.73
  15.228.41.112
  15.228.63.254
  15.228.87.193
@@ -33182,23 +27551,19 @@
  150.107.142.17
  150.107.142.77
  150.107.142.81
-150.107.149.11
  150.107.152.116
  150.107.205.196
  150.107.205.20
  150.107.205.22
  150.107.207.137
-150.107.222.146
  150.107.31.176
  150.107.42.160
-150.107.92.192
  150.107.92.209
-150.107.93.155
  150.109.100.228
  150.109.100.65
+150.109.102.56
  150.109.104.153
  150.109.11.106
-150.109.11.232
  150.109.113.116
  150.109.113.139
  150.109.113.158
@@ -33207,7 +27572,6 @@
  150.109.118.237
  150.109.12.207
  150.109.12.71
-150.109.120.253
  150.109.121.246
  150.109.145.113
  150.109.146.235
@@ -33215,92 +27579,10 @@
  150.109.15.69
  150.109.150.77
  150.109.151.206
-150.109.16.122
-150.109.164.127
-150.109.164.133
-150.109.164.15
-150.109.164.235
-150.109.167.106
-150.109.167.136
-150.109.167.141
-150.109.167.155
-150.109.167.182
-150.109.167.20
-150.109.167.218
-150.109.167.235
-150.109.167.243
-150.109.167.32
-150.109.167.71
-150.109.167.75
  150.109.17.222
-150.109.170.100
-150.109.170.114
-150.109.170.115
-150.109.170.124
-150.109.170.179
-150.109.170.185
-150.109.170.192
-150.109.170.203
-150.109.170.240
-150.109.170.254
-150.109.170.49
-150.109.170.60
-150.109.170.68
-150.109.170.73
-150.109.170.84
-150.109.170.97
  150.109.18.221
-150.109.180.100
-150.109.180.125
-150.109.180.126
-150.109.180.135
-150.109.180.156
-150.109.180.237
-150.109.180.250
-150.109.181.149
-150.109.181.161
-150.109.181.212
-150.109.181.217
-150.109.181.25
-150.109.181.254
-150.109.181.27
-150.109.181.99
-150.109.182.127
-150.109.182.140
-150.109.182.163
-150.109.182.197
-150.109.182.32
-150.109.182.55
-150.109.183.223
-150.109.183.239
-150.109.183.94
-150.109.194.156
-150.109.194.59
  150.109.198.242
-150.109.203.21
-150.109.203.239
-150.109.205.227
-150.109.205.242
-150.109.205.70
-150.109.229.166
-150.109.229.30
-150.109.23.158
  150.109.23.183
-150.109.23.216
-150.109.23.36
-150.109.230.162
-150.109.230.219
-150.109.231.12
-150.109.231.201
-150.109.231.21
-150.109.231.90
-150.109.234.173
-150.109.235.105
-150.109.236.199
-150.109.237.188
-150.109.238.123
-150.109.238.211
-150.109.239.89
  150.109.246.14
  150.109.253.19
  150.109.34.205
@@ -33308,8 +27590,6 @@
  150.109.39.213
  150.109.39.220
  150.109.49.174
-150.109.5.248
-150.109.57.135
  150.109.57.43
  150.109.6.69
  150.109.61.134
@@ -33320,18 +27600,14 @@
  150.109.69.193
  150.109.76.59
  150.109.82.109
-150.109.93.241
  150.109.99.243
  150.109.99.68
-150.117.89.55
  150.129.115.118
  150.129.151.42
  150.129.170.13
  150.129.171.123
-150.129.176.42
  150.129.182.164
  150.129.201.30
-150.129.239.44
  150.129.250.28
  150.129.42.7
  150.129.52.74
@@ -33340,74 +27616,48 @@
  150.129.8.32
  150.129.8.7
  150.129.80.200
-150.136.10.152
-150.136.100.141
-150.136.104.20
  150.136.111.241
  150.136.112.212
  150.136.116.126
-150.136.116.163
-150.136.118.166
-150.136.119.48
  150.136.12.28
-150.136.120.73
  150.136.127.89
  150.136.13.2
  150.136.132.142
  150.136.136.254
  150.136.137.192
-150.136.139.181
-150.136.139.197
-150.136.149.77
  150.136.152.126
  150.136.152.190
-150.136.155.49
  150.136.160.141
-150.136.171.143
  150.136.172.1
  150.136.180.136
-150.136.180.218
  150.136.183.102
-150.136.183.178
  150.136.196.4
  150.136.203.151
  150.136.208.168
  150.136.21.3
  150.136.21.93
  150.136.211.2
-150.136.214.39
-150.136.214.93
  150.136.220.58
-150.136.229.10
+150.136.220.72
  150.136.229.65
-150.136.232.28
-150.136.232.77
  150.136.238.74
  150.136.241.199
-150.136.246.125
-150.136.246.232
  150.136.248.239
  150.136.248.42
  150.136.251.129
  150.136.31.34
+150.136.4.232
  150.136.40.83
-150.136.43.148
  150.136.5.77
-150.136.62.107
+150.136.51.125
  150.136.62.179
  150.136.66.17
-150.136.74.27
-150.136.76.156
-150.136.79.229
-150.136.81.147
  150.136.81.55
-150.136.84.35
+150.136.83.122
  150.136.9.171
  150.136.99.11
  150.136.99.111
  150.138.106.174
-150.138.118.252
-150.138.119.203
  150.138.154.164
  150.138.253.71
  150.138.253.72
@@ -33426,12 +27676,8 @@
  150.158.153.58
  150.158.155.139
  150.158.155.52
-150.158.156.160
  150.158.158.34
-150.158.159.165
-150.158.159.243
  150.158.159.248
-150.158.159.37
  150.158.161.133
  150.158.161.204
  150.158.161.245
@@ -33441,7 +27687,6 @@
  150.158.163.46
  150.158.165.134
  150.158.165.167
-150.158.165.173
  150.158.165.181
  150.158.165.46
  150.158.167.200
@@ -33454,40 +27699,28 @@
  150.158.174.174
  150.158.174.229
  150.158.174.230
-150.158.175.171
  150.158.175.63
  150.158.175.66
  150.158.176.248
  150.158.176.98
-150.158.179.35
  150.158.181.16
  150.158.185.227
-150.158.186.50
  150.158.187.126
  150.158.193.244
  150.158.196.205
  150.158.198.131
-150.158.198.220
  150.158.212.170
  150.158.213.234
  150.158.213.73
  150.158.4.230
  150.158.5.97
-150.161.49.111
-150.162.80.240
  150.165.74.41
  150.187.5.100
  150.214.182.250
-150.223.13.155
-150.223.15.149
-150.238.229.185
  150.242.169.74
-150.242.185.17
  150.242.219.5
-150.242.22.116
  150.242.22.235
  150.242.24.152
-150.242.249.193
  150.242.254.235
  150.242.254.51
  150.242.87.230
@@ -33500,6 +27733,7 @@
  150.95.108.112
  150.95.108.246
  150.95.110.27
+150.95.110.62
  150.95.113.198
  150.95.131.174
  150.95.132.74
@@ -33531,7 +27765,6 @@
  150.95.223.60
  150.95.24.106
  150.95.27.32
-150.95.30.158
  150.95.31.150
  150.95.52.70
  150.95.54.138
@@ -33541,31 +27774,16 @@
  150.95.64.26
  150.95.82.145
  150.95.82.240
-150.95.82.25
  150.95.82.42
  15006000001.mer.lstest.siquality.com
  150100.cn
  1504setup.com
  151-248-126-42.ovz.vps.regruhosting.ru
  151.0.173.145
-151.0.250.162
-151.0.56.211
-151.0.56.65
-151.0.57.37
-151.0.58.5
-151.0.59.30
-151.0.60.156
-151.0.60.242
-151.0.61.134
-151.0.61.75
-151.0.62.71
-151.0.62.73
-151.0.63.18
-151.0.63.242
-151.1.181.72
-151.1.181.74
+151.0.63.50
  151.1.253.1
  151.104.36.204
+151.104.39.110
  151.106.13.150
  151.106.13.158
  151.106.15.247
@@ -33580,48 +27798,24 @@
  151.106.55.86
  151.106.56.234
  151.106.59.205
-151.106.6.142
-151.106.8.41
-151.115.32.138
-151.115.33.110
-151.115.35.59
-151.115.43.144
  151.115.43.170
-151.115.43.190
-151.115.47.35
-151.115.52.210
-151.115.54.209
  151.115.54.212
-151.115.58.216
  151.124.247.200
  151.13.11.231
  151.15.217.86
-151.16.137.101
-151.16.59.96
  151.177.108.50
-151.177.19.42
-151.182.29.25
  151.182.44.17
  151.19.203.113
-151.192.146.156
-151.192.248.125
-151.197.61.55
  151.20.160.72
-151.20.231.197
  151.20.252.115
-151.20.44.147
-151.203.196.245
-151.21.165.238
  151.217.31.131
-151.225.189.4
  151.226.169.59
  151.228.114.115
  151.228.255.154
  151.231.130.16
-151.233.53.144
  151.234.26.128
  151.234.27.32
-151.235.123.71
+151.234.33.120
  151.236.193.195
  151.236.217.200
  151.236.218.195
@@ -33636,75 +27830,59 @@
  151.237.186.207
  151.237.36.220
  151.237.80.166
+151.24.53.12
  151.248.157.162
-151.248.220.245
-151.250.116.134
+151.248.168.243
+151.248.63.206
  151.252.105.151
+151.252.145.168
+151.252.28.169
  151.253.125.136
  151.253.125.137
  151.253.128.234
  151.253.43.75
  151.27.234.155
-151.28.223.141
-151.33.249.164
  151.34.166.64
-151.35.128.186
+151.34.200.235
+151.34.73.247
  151.35.137.123
-151.35.91.13
  151.36.13.48
-151.36.14.228
  151.36.18.70
-151.36.210.21
-151.36.61.44
+151.36.7.213
  151.36.7.38
-151.36.8.204
-151.36.84.8
+151.36.88.202
  151.36.94.234
-151.38.156.116
-151.38.156.237
-151.38.166.42
-151.38.51.252
-151.38.78.102
+151.36.94.241
+151.38.0.165
  151.38.80.227
-151.40.85.4
+151.40.78.24
  151.41.36.18
-151.45.155.161
-151.45.87.167
-151.46.166.76
  151.46.184.216
-151.46.80.73
-151.47.80.133
-151.49.118.123
-151.49.170.162
-151.50.96.141
  151.50.97.232
  151.51.121.187
-151.53.220.242
  151.54.165.92
  151.54.202.137
  151.55.117.0
  151.55.84.241
  151.57.205.107
  151.59.48.222
-151.60.225.156
+151.60.69.251
  151.61.215.10
-151.62.135.185
  151.62.142.169
  151.62.218.64
-151.62.38.207
+151.62.32.188
  151.62.52.39
-151.62.91.163
+151.62.66.226
+151.62.74.61
+151.62.88.64
  151.62.92.46
-151.67.162.63
-151.68.136.16
  151.68.188.223
  151.68.203.244
+151.69.103.101
  151.69.170.146
  151.69.206.10
-151.70.105.45
  151.70.243.14
  151.70.64.197
-151.75.102.207
  151.80.100.80
  151.80.111.52
  151.80.113.101
@@ -33714,6 +27892,7 @@
  151.80.144.233
  151.80.149.223
  151.80.149.75
+151.80.152.125
  151.80.155.98
  151.80.159.18
  151.80.162.250
@@ -33736,7 +27915,6 @@
  151.80.203.46
  151.80.211.128
  151.80.211.158
-151.80.230.21
  151.80.237.221
  151.80.245.160
  151.80.248.125
@@ -33756,7 +27934,6 @@
  151.80.61.159
  151.80.61.249
  151.80.65.175
-151.80.70.167
  151.80.80.7
  151.80.83.249
  151.80.9.153
@@ -33766,37 +27943,28 @@
  151.84.122.105
  151.84.131.163
  151.84.203.155
-151.95.238.39
-151.95.76.15
  151.rs
  151051-dot-n-e-w-me-ss-age-po-rt-al.wl.r.appspot.com
  151114327519139.002.sh.cn
  151856.com
  151dab420864259635697e632e7f1cdf-dot-dbenitonline.ey.r.appspot.com
-152.0.143.245
-152.0.179.184
  152.0.238.81
  152.0.4.193
  152.114.1.50
  152.115.191.196
  152.136.101.207
  152.136.101.65
-152.136.104.88
-152.136.11.110
  152.136.11.211
  152.136.110.246
  152.136.111.240
  152.136.111.65
-152.136.113.227
  152.136.114.118
-152.136.115.104
  152.136.115.27
  152.136.121.150
  152.136.122.172
  152.136.126.129
  152.136.128.30
  152.136.130.218
-152.136.131.171
  152.136.131.242
  152.136.133.109
  152.136.133.34
@@ -33808,10 +27976,8 @@
  152.136.145.235
  152.136.145.25
  152.136.145.40
-152.136.145.69
  152.136.148.36
  152.136.149.160
-152.136.150.115
  152.136.150.219
  152.136.151.194
  152.136.151.70
@@ -33819,7 +27985,6 @@
  152.136.152.55
  152.136.165.226
  152.136.169.198
-152.136.17.25
  152.136.170.159
  152.136.170.27
  152.136.173.58
@@ -33840,7 +28005,6 @@
  152.136.215.222
  152.136.220.127
  152.136.221.23
-152.136.224.205
  152.136.226.15
  152.136.227.172
  152.136.230.126
@@ -33848,36 +28012,31 @@
  152.136.234.179
  152.136.237.229
  152.136.237.47
-152.136.252.216
  152.136.253.146
  152.136.254.204
  152.136.31.184
  152.136.34.209
  152.136.36.250
+152.136.41.189
+152.136.43.147
  152.136.71.133
  152.136.90.196
  152.136.90.84
-152.136.96.220
  152.136.96.25
  152.136.98.80
-152.168.178.185
-152.168.61.2
  152.168.97.134
  152.169.106.145
-152.169.208.63
  152.169.22.67
  152.169.32.143
  152.169.48.128
  152.170.65.133
  152.170.66.244
  152.170.70.57
-152.171.115.238
-152.171.208.189
  152.182.83.182
  152.182.83.199
  152.182.83.213
  152.182.83.253
-152.200.138.182
+152.200.141.74
  152.200.143.218
  152.204.128.190
  152.204.128.46
@@ -33888,43 +28047,44 @@
  152.231.140.150
  152.231.29.163
  152.231.29.72
-152.231.55.96
-152.231.68.18
  152.231.79.186
  152.231.89.226
-152.231.89.61
  152.231.93.130
-152.241.178.169
-152.242.127.63
+152.241.91.177
+152.242.105.204
  152.242.34.51
-152.243.217.147
+152.242.44.202
+152.242.74.240
  152.246.131.87
+152.246.255.120
+152.246.48.63
  152.247.31.84
  152.247.86.47
-152.249.150.250
+152.249.244.169
+152.249.36.215
+152.249.86.228
  152.252.12.85
  152.254.168.237
  152.26.66.140
+152.32.112.126
  152.32.128.40
  152.32.129.40
  152.32.130.121
-152.32.130.162
  152.32.130.79
-152.32.132.164
  152.32.133.119
  152.32.133.184
  152.32.139.56
-152.32.144.204
  152.32.144.26
  152.32.145.9
+152.32.150.70
+152.32.151.42
  152.32.162.4
  152.32.170.57
  152.32.175.137
  152.32.175.24
  152.32.187.25
-152.32.187.41
-152.32.189.97
  152.32.192.114
+152.32.210.208
  152.32.212.62
  152.32.214.84
  152.32.222.107
@@ -33932,34 +28092,30 @@
  152.32.223.180
  152.32.223.231
  152.32.223.89
-152.32.240.104
+152.32.234.124
+152.32.234.96
  152.32.243.103
  152.32.243.114
+152.32.253.113
  152.32.253.118
-152.32.64.105
  152.32.75.74
  152.32.78.24
  152.32.92.86
-152.32.99.117
  152.36.193.2
+152.57.9.16
  152.57.95.217
  152.67.11.98
-152.67.167.101
-152.67.188.75
  152.67.224.129
  152.67.224.67
-152.67.225.33
  152.67.226.175
  152.67.24.187
  152.67.25.98
  152.67.30.228
  152.67.33.163
  152.67.35.185
-152.67.41.131
  152.67.44.88
  152.67.47.139
  152.67.58.141
-152.67.63.151
  152.67.63.172
  152.67.7.93
  152.89.10.199
@@ -33977,47 +28133,40 @@
  153.0.225.56
  153.101.139.211
  153.101.167.242
-153.101.226.188
  153.101.29.178
  153.101.37.132
  153.101.57.34
  153.101.57.40
  153.120.166.129
  153.120.170.120
+153.120.181.184
  153.120.217.194
  153.120.33.139
-153.120.43.42
+153.121.36.194
  153.122.56.134
  153.122.8.97
-153.124.169.23
-153.124.169.24
-153.124.169.25
  153.125.138.187
  153.126.156.217
  153.126.179.109
  153.126.187.46
+153.126.193.197
  153.127.37.59
  153.127.63.142
  153.127.67.228
  153.127.68.121
  153.129.15.63
  153.137.36.142
-153.142.49.250
  153.149.175.190
  153.149.184.190
-153.156.189.219
  153.165.155.66
  153.168.51.231
-153.178.224.27
+153.177.100.70
  153.183.25.24
  153.19.33.231
  153.204.122.254
-153.212.231.159
-153.213.131.145
  153.229.219.1
  153.230.169.165
  153.246.145.238
-153.246.90.133
  153.254.105.16
  153.3.124.100
  153.3.124.234
@@ -34028,7 +28177,6 @@
  153.3.37.6
  153.3.39.83
  153.3.45.8
-153.3.52.118
  153.3.99.51
  153.3.99.51bin.sh
  153.34.107.3
@@ -34037,7 +28185,7 @@
  153.34.135.92
  153.34.153.225
  153.34.211.38
-153.34.224.224
+153.34.214.210
  153.34.238.220
  153.34.52.54
  153.34.52.92
@@ -34047,34 +28195,29 @@
  153.35.170.75
  153.35.70.244
  153.35.93.175
-153.36.10.29
  153.36.14.49
-153.36.17.171
  153.36.23.219
  153.36.233.60
-153.36.247.221
-153.37.149.157
  153.37.181.92
  153.92.127.168
  153.92.127.216
  153.92.4.153
-153.92.6.13
+153.92.93.114
+153.99.207.186
  153.99.224.118
-153.99.98.68
  153284594738391.statictab.com
  15333291-5189-4750-a96c-2f9deb7920f7.htmlcomponentservice.com
  153884c0b3f5e35925a6a8b37e6eccb3-dot-maintance-online-pass.ey.r.appspot.com
  154.0.168.252
+154.0.170.103
+154.0.170.41
  154.0.173.83
  154.0.175.203
-154.0.57.205
  154.0.57.219
-154.0.57.240
-154.0.57.81
  154.0.59.4
-154.0.7.58
+154.0.59.59
+154.0.59.95
  154.113.1.142
-154.113.122.218
  154.113.16.226
  154.117.143.126
  154.117.155.42
@@ -34082,32 +28225,30 @@
  154.117.159.228
  154.117.176.102
  154.117.199.8
-154.118.104.14
-154.118.52.188
+154.118.0.196
+154.118.19.99
+154.118.2.72
+154.118.243.138
+154.118.49.148
  154.118.52.216
-154.119.7.3
+154.118.9.174
  154.119.79.254
  154.120.133.190
-154.120.217.250
  154.120.227.206
  154.120.232.182
  154.120.243.194
-154.124.129.88
-154.124.37.68
-154.125.126.74
+154.120.90.246
  154.126.32.138
  154.126.33.210
  154.126.79.130
  154.127.120.18
+154.127.153.156
  154.127.25.148
  154.127.32.105
  154.127.32.116
-154.127.32.89
-154.127.38.65
+154.127.36.138
  154.127.82.66
-154.127.82.93
  154.127.91.114
-154.134.200.238
  154.16.10.249
  154.16.113.203
  154.16.136.119
@@ -34117,7 +28258,6 @@
  154.16.166.27
  154.16.173.92
  154.16.2.197
-154.16.203.19
  154.16.206.52
  154.16.226.201
  154.16.226.250
@@ -34136,17 +28276,17 @@
  154.16.48.140
  154.16.49.148
  154.16.52.110
+154.16.52.218
  154.16.53.182
  154.16.57.215
-154.16.6.237
+154.16.57.244
  154.16.60.184
  154.16.64.204
+154.16.70.152
  154.160.30.82
  154.160.73.154
-154.163.5.2
  154.198.2.4
  154.20.3.240
-154.20.94.22
  154.202.3.44
  154.202.60.154
  154.204.10.246
@@ -34157,7 +28297,6 @@
  154.209.228.228
  154.209.4.76
  154.209.69.123
-154.21.22.104
  154.21.23.101
  154.211.13.133
  154.211.14.244
@@ -34416,7 +28555,6 @@
  154.221.17.32
  154.221.19.204
  154.221.22.236
-154.221.23.106
  154.221.23.210
  154.221.23.90
  154.221.25.187
@@ -34426,19 +28564,17 @@
  154.223.189.86
  154.238.161.171
  154.28.188.140
-154.3.40.186
+154.28.188.69
+154.29.131.211
  154.34.24.212
  154.44.190.122
  154.48.251.89
-154.56.206.203
-154.57.3.32
  154.58.23.3bin.sh
  154.61.227.8
  154.62.250.81
  154.65.14.19
  154.66.107.189
  154.66.109.105
-154.66.11.89
  154.66.122.130
  154.66.122.90
  154.66.125.18
@@ -34450,9 +28586,8 @@
  154.66.245.47
  154.67.10.204
  154.67.143.229
-154.68.195.101
  154.68.49.86
-154.70.116.130
+154.70.125.147
  154.70.158.97
  154.70.198.146
  154.70.208.66
@@ -34462,7 +28597,6 @@
  154.70.32.103
  154.72.187.26
  154.72.187.90
-154.72.188.230
  154.72.192.26
  154.72.197.106
  154.72.199.38
@@ -34478,7 +28612,6 @@
  154.73.137.131
  154.73.137.157
  154.73.159.138
-154.73.175.193
  154.73.53.186
  154.73.81.106
  154.73.84.37
@@ -34495,7 +28628,6 @@
  154.79.244.66
  154.79.244.94
  154.79.246.178
-154.79.248.124
  154.79.250.100
  154.79.250.161
  154.79.252.214
@@ -34525,23 +28657,19 @@
  154.8.183.204
  154.8.192.65
  154.8.195.36
-154.8.196.197
-154.8.213.126
  154.8.226.52
  154.8.229.57
  154.8.232.15
  154.8.232.212
-154.8.232.34
  154.83.12.107
  154.83.14.164
  154.83.15.91
  154.83.16.140
-154.85.189.174
+154.85.15.202
  154.85.48.199
  154.85.49.127
  154.85.49.196
  154.85.49.245
-154.85.50.185
  154.85.52.187
  154.85.52.23
  154.85.55.187
@@ -34551,16 +28679,14 @@
  154.85.60.61
  154.85.63.225
  154.86.24.250
-154.89.120.204
-154.89.4.160
  154.89.4.170
  154.89.75.44
  154.90.1.148
  154.90.14.41
  154.91.144.44
-154.91.148.89
  154.91.195.121
  154.91.2.187
+154.91.3.239
  154.91.33.137
  154.92.14.131
  154.92.14.211
@@ -34570,18 +28696,18 @@
  154.92.18.41
  154.92.19.140
  154.92.22.106
-154.92.22.190
  154.92.23.198
  154.94.5.212
  155.0.18.149
  155.0.181.254
  155.0.202.254
-155.101.8.216
+155.0.203.24
  155.12.21.118
  155.12.78.102
  155.12.83.75
  155.133.129.18
  155.133.131.208
+155.133.53.85
  155.133.83.1
  155.133.83.109
  155.133.83.117
@@ -34595,7 +28721,6 @@
  155.138.160.98
  155.138.175.7
  155.138.197.254
-155.138.202.94
  155.138.203.155
  155.138.217.118
  155.138.222.174
@@ -34606,24 +28731,22 @@
  155.138.237.187
  155.159.252.25
  155.186.0.121
+155.186.9.160
+155.230.36.199
  155.235.2.132
  155.254.28.168
  155.254.35.8
  155.254.49.4
  155.4.116.169
  155.4.152.237
-155.4.184.91
  155.4.208.184
  155.4.234.183
  155.4.70.11
-155.4.86.196
  155.4.97.214
-155.41.19.178
  155.54.237.1
  155.93.108.170
  155.93.109.218
  155.93.115.4
-155.93.125.107
  155.94.131.150
  155.94.134.152
  155.94.134.246
@@ -34633,10 +28756,9 @@
  155.94.145.193
  155.94.147.218
  155.94.149.156
-155.94.171.100
-155.94.180.164
+155.94.160.13
  155.94.196.171
-155.94.220.148
+155.94.220.137
  155.94.224.207
  155.94.252.252
  155.94.67.7
@@ -34646,10 +28768,9 @@
  155361.streeteone.com
  15565556239457741.us-south.cf.appdomain.cloud
  156.0.229.194
-156.146.117.176
  156.146.34.65
  156.146.35.29
-156.146.55.142
+156.146.41.102
  156.146.57.38
  156.146.59.118
  156.146.63.114
@@ -34657,40 +28778,40 @@
  156.19.19.90
  156.194.0.223
  156.194.171.2
-156.194.46.86
-156.196.122.131
-156.196.92.128
-156.200.160.14
+156.194.219.237
+156.196.169.61
+156.197.128.66
+156.199.50.77
  156.200.232.198
-156.201.180.4
  156.203.134.143
  156.203.188.151
  156.204.130.53
  156.204.152.252
-156.204.154.86
+156.204.25.147
  156.204.37.191
  156.204.56.139
-156.204.59.96
  156.204.9.178
+156.207.21.63
  156.212.108.176
-156.212.20.240
  156.212.24.134
+156.213.10.41
+156.213.15.56
+156.213.252.36
+156.213.34.251
+156.213.45.216
  156.213.47.189
  156.214.118.164
+156.214.234.12
  156.216.254.250
  156.218.240.136
  156.218.36.206
  156.219.87.189
  156.220.166.99
-156.220.19.167
  156.222.106.2
-156.222.39.22
  156.223.27.113
-156.223.33.57
  156.225.7.181
  156.230.55.158
  156.234.201.139
-156.234.201.238
  156.234.74.18
  156.235.188.114
  156.236.69.234
@@ -34707,7 +28828,6 @@
  156.251.125.148
  156.255.213.198
  156.54.148.152
-156.57.208.14
  156.67.106.36
  156.67.115.5
  156.67.214.80
@@ -34715,70 +28835,56 @@
  156.67.222.163
  156.67.222.17
  156.67.222.193
+156.67.222.2
  156.67.222.217
  156.67.222.30
+156.67.222.59
  156.67.222.70
-156.67.222.94
-156.96.107.247
-156.96.112.67
-156.96.112.69
-156.96.113.99
  156.96.114.195
-156.96.114.73
  156.96.118.179
-156.96.118.40
+156.96.118.41
  156.96.118.48
  156.96.118.58
-156.96.128.142
-156.96.128.166
  156.96.150.252
-156.96.150.32
+156.96.150.253
+156.96.150.254
  156.96.150.5
  156.96.151.236
-156.96.155.226
-156.96.155.229
-156.96.156.246
-156.96.156.48
-156.96.156.75
-156.96.156.98
+156.96.154.51
  156.96.157.99
+156.96.47.12
  156.96.48.136
-156.96.48.176
  156.96.48.220
  156.96.56.117
-156.96.56.35
-156.96.56.41
-156.96.56.46
+156.96.56.139
+156.96.56.148
+156.96.56.24
+156.96.56.92
+156.96.56.94
  156.96.58.239
-156.96.61.117
-156.96.61.123
+156.96.59.24
  156.96.62.219
-156.96.62.45
+156.96.62.223
  156.96.62.75
-156.96.62.81
  15688c.com
  1569webappssupport.com
  157.0.1.211
  157.0.134.164
  157.100.230.82
+157.100.53.249
+157.100.56.24
  157.119.117.22
  157.119.186.174
-157.119.200.84
  157.119.207.10
  157.119.207.13
  157.119.207.36
-157.119.213.85
-157.119.215.97
+157.119.212.82
  157.119.222.180
  157.119.222.182
-157.119.234.144
-157.119.250.57
-157.119.47.100
  157.119.50.106
  157.119.50.49
  157.119.50.70
  157.119.50.74
-157.119.83.234
  157.13.61.66
  157.13.61.69
  157.13.61.72
@@ -34802,34 +28908,14 @@
  157.185.144.68
  157.185.144.69
  157.185.145.131
-157.185.145.34
  157.185.145.79
  157.185.145.80
-157.185.156.157
-157.185.156.158
-157.185.156.57
-157.185.158.52
-157.185.158.53
-157.185.160.190
-157.185.160.191
-157.185.163.230
-157.185.163.231
  157.185.163.69
  157.185.163.71
-157.185.165.180
-157.185.165.183
-157.185.168.67
-157.185.169.195
-157.185.170.119
-157.185.170.120
  157.185.172.139
-157.185.172.92
-157.185.172.93
-157.185.175.63
  157.185.177.206
  157.185.177.66
  157.185.179.115
-157.185.179.66
  157.185.179.73
  157.185.179.87
  157.191.147.146
@@ -34842,13 +28928,14 @@
  157.230.103.17
  157.230.103.189
  157.230.103.91
+157.230.105.48
  157.230.106.108
  157.230.106.49
  157.230.109.166
  157.230.109.54
+157.230.11.154
  157.230.111.16
  157.230.111.49
-157.230.112.195
  157.230.112.69
  157.230.113.5
  157.230.114.180
@@ -34863,15 +28950,14 @@
  157.230.118.118
  157.230.119.220
  157.230.12.231
-157.230.120.21
  157.230.121.242
  157.230.122.80
  157.230.123.233
  157.230.123.3
+157.230.125.2
  157.230.125.204
  157.230.125.207
  157.230.128.135
-157.230.131.34
  157.230.132.100
  157.230.133.189
  157.230.14.14
@@ -34899,15 +28985,12 @@
  157.230.19.32
  157.230.19.72
  157.230.190.90
-157.230.198.225
  157.230.2.112
-157.230.2.160
  157.230.2.161
  157.230.2.208
  157.230.20.18
  157.230.208.124
  157.230.209.141
-157.230.210.20
  157.230.210.84
  157.230.211.219
  157.230.212.3
@@ -34922,21 +29005,14 @@
  157.230.224.52
  157.230.225.70
  157.230.225.72
-157.230.226.7
-157.230.229.156
  157.230.229.23
  157.230.230.152
-157.230.230.183
  157.230.231.39
  157.230.233.211
  157.230.234.117
  157.230.234.234
-157.230.235.243
  157.230.238.19
  157.230.238.91
-157.230.239.99
-157.230.24.80
-157.230.240.140
  157.230.241.235
  157.230.243.163
  157.230.243.22
@@ -34947,31 +29023,26 @@
  157.230.248.89
  157.230.249.202
  157.230.249.74
-157.230.249.90
  157.230.251.115
  157.230.251.239
  157.230.251.95
  157.230.252.123
  157.230.27.66
  157.230.3.103
-157.230.3.19
-157.230.30.98
  157.230.31.141
-157.230.31.237
  157.230.31.64
  157.230.33.158
-157.230.33.62
  157.230.35.44
  157.230.36.200
  157.230.36.55
  157.230.38.102
  157.230.38.176
  157.230.39.223
+157.230.41.178
  157.230.42.155
+157.230.42.76
  157.230.43.113
-157.230.45.12
  157.230.45.31
-157.230.46.26
  157.230.46.86
  157.230.47.159
  157.230.47.241
@@ -34980,48 +29051,41 @@
  157.230.48.247
  157.230.5.169
  157.230.5.99
-157.230.51.144
  157.230.52.207
  157.230.52.241
-157.230.54.248
  157.230.55.177
  157.230.55.192
  157.230.57.43
  157.230.58.223
-157.230.59.176
  157.230.6.213
  157.230.62.50
-157.230.7.142
-157.230.8.26
+157.230.78.61
  157.230.80.232
  157.230.80.53
  157.230.81.78
  157.230.82.112
  157.230.82.202
-157.230.82.214
-157.230.83.142
  157.230.83.80
  157.230.85.106
-157.230.87.239
  157.230.89.219
  157.230.9.227
  157.230.90.18
-157.230.93.237
  157.230.93.62
  157.230.94.83
  157.230.96.7
  157.230.98.82
  157.230.98.89
+157.230.99.190
  157.231.102.250
  157.231.110.14
  157.231.113.130
  157.245.0.68
-157.245.10.196
  157.245.100.56
  157.245.101.31
  157.245.102.24
  157.245.103.203
  157.245.103.90
+157.245.104.163
  157.245.104.19
  157.245.106.153
  157.245.107.118
@@ -35042,7 +29106,6 @@
  157.245.140.49
  157.245.140.69
  157.245.140.86
-157.245.142.252
  157.245.149.151
  157.245.150.18
  157.245.150.64
@@ -35079,11 +29142,10 @@
  157.245.216.168
  157.245.218.233
  157.245.220.153
-157.245.221.219
  157.245.224.13
  157.245.224.29
  157.245.227.165
-157.245.230.74
+157.245.231.155
  157.245.231.62
  157.245.232.155
  157.245.233.164
@@ -35092,16 +29154,11 @@
  157.245.237.33
  157.245.238.196
  157.245.239.72
-157.245.240.102
-157.245.241.150
-157.245.241.161
  157.245.242.125
  157.245.242.172
  157.245.243.14
  157.245.244.123
-157.245.244.202
  157.245.245.159
-157.245.245.98
  157.245.246.132
  157.245.249.158
  157.245.249.18
@@ -35110,13 +29167,14 @@
  157.245.252.154
  157.245.252.34
  157.245.253.245
+157.245.32.33
  157.245.35.47
  157.245.37.203
  157.245.37.65
+157.245.38.42
  157.245.39.243
  157.245.42.253
  157.245.42.46
-157.245.5.133
  157.245.5.202
  157.245.5.45
  157.245.53.23
@@ -35130,37 +29188,38 @@
  157.245.69.233
  157.245.7.25
  157.245.72.129
-157.245.74.28
  157.245.75.41
  157.245.80.19
  157.245.81.223
  157.245.85.53
  157.245.86.248
  157.245.91.229
+157.245.91.33
  157.245.91.36
  157.245.91.72
  157.245.91.88
  157.245.92.141
  157.245.94.69
  157.245.97.107
-157.245.97.208
  157.245.97.218
+157.245.97.36
  157.245.98.160
  157.245.98.161
-157.245.98.175
  157.245.98.68
  157.245.99.39
  157.25.23.231
  157.25.67.194
  157.34.156.93
  157.38.25.81
+157.38.77.112
  157.39.107.200
  157.39.117.22
+157.39.202.45
  157.39.215.8
+157.40.1.176
  157.44.64.76
  157.45.62.91
  157.52.151.84
-157.52.193.130
  157.52.252.141
  157.55.165.3
  157.55.175.69
@@ -35286,21 +29345,17 @@
  157.55.39.98
  157.55.80.72
  157.65.160.67
-157.7.105.183
-157.7.106.153
  157.7.106.170
-157.7.106.171
  157.7.143.24
  157.7.164.178
  157.7.188.226
  157.7.188.97
  157.7.190.240
+157.7.208.50
  157.7.211.107
-157.7.214.153
  157.7.233.185
  157.7.85.245
  157.92.13.105
-157.92.13.155
  157.92.49.151
  157.97.132.45
  157.97.2.215
@@ -35309,81 +29364,48 @@
  1572599.com
  15780.url.7878j.com
  1579850.xyz
-158.101.103.175
  158.101.108.255
-158.101.11.105
-158.101.11.113
-158.101.11.135
-158.101.111.128
-158.101.112.162
-158.101.118.190
  158.101.12.235
  158.101.120.79
  158.101.123.169
  158.101.124.78
-158.101.13.146
  158.101.14.253
  158.101.144.53
-158.101.149.76
-158.101.15.165
-158.101.151.37
  158.101.17.220
  158.101.19.129
-158.101.21.146
-158.101.22.156
  158.101.224.115
-158.101.228.218
-158.101.28.106
-158.101.7.0
-158.101.7.100
-158.101.8.11
+158.101.230.156
  158.106.211.78
  158.106.67.181
  158.106.84.137
  158.110.145.243
-158.116.202.32
  158.129.140.201
  158.130.48.250
-158.140.136.26
-158.140.141.100
  158.140.144.78
  158.140.167.148
  158.140.169.104
-158.140.170.188
  158.140.173.212
  158.140.174.9
  158.140.189.235
  158.140.237.185
-158.140.63.162
+158.140.96.235
+158.140.97.7
  158.170.64.23
-158.174.107.222
-158.174.121.254
+158.174.104.16
  158.174.122.199
  158.174.126.228
-158.174.127.190
-158.174.133.112
  158.174.166.88
-158.174.18.149
  158.174.183.202
-158.174.186.232
-158.174.192.242
-158.174.193.163
  158.174.194.14
  158.174.209.140
  158.174.213.128
-158.174.227.12
-158.174.23.6
-158.174.23.94
+158.174.218.129
  158.174.231.241
-158.174.235.165
  158.174.239.183
  158.174.249.109
-158.174.25.132
-158.174.46.138
  158.174.49.48
  158.174.54.161
  158.174.61.67
-158.174.8.218
  158.175.132.168
  158.177.12.124
  158.181.125.150
@@ -35395,6 +29417,8 @@
  158.222.14.171
  158.222.14.189
  158.222.14.196
+158.222.14.233
+158.222.14.246
  158.222.14.44
  158.222.14.5
  158.222.14.72
@@ -35405,10 +29429,9 @@
  158.248.198.75
  158.248.64.234
  158.255.213.71
-158.255.215.217
+158.255.215.44
  158.255.23.146
  158.255.249.58
-158.255.26.229
  158.255.31.93
  158.255.51.213
  158.255.7.157
@@ -35416,11 +29439,8 @@
  158.255.7.48
  158.255.7.49
  158.255.80.210
-158.255.85.12
-158.39.30.218
  158.46.127.222
  158.51.124.112
-158.51.127.185
  158.58.131.27
  158.58.133.187
  158.58.168.61
@@ -35465,7 +29485,7 @@
  158.69.225.35
  158.69.225.36
  158.69.225.37
-158.69.226.175
+158.69.226.152
  158.69.227.12
  158.69.228.225
  158.69.236.148
@@ -35476,6 +29496,7 @@
  158.69.243.148
  158.69.245.223
  158.69.248.120
+158.69.250.210
  158.69.252.212
  158.69.252.83
  158.69.253.57
@@ -35484,14 +29505,13 @@
  158.69.26.193
  158.69.27.192
  158.69.27.201
-158.69.28.206
  158.69.31.216
  158.69.31.229
  158.69.35.227
  158.69.38.243
  158.69.42.209
  158.69.48.64
-158.69.53.211
+158.69.52.131
  158.69.54.200
  158.69.59.241
  158.69.62.6
@@ -35501,10 +29521,10 @@
  158.69.72.200
  158.69.72.5
  158.69.74.240
-158.69.76.108
  158.69.78.207
  158.69.78.32
  158.69.79.136
+158.69.83.144
  158.69.87.231
  158.69.87.97
  158.69.89.61
@@ -35535,32 +29555,26 @@
  159.138.117.89
  159.138.21.170
  159.138.22.112
-159.138.23.173
-159.138.42.154
  159.138.5.222
  159.138.57.38
  159.138.87.18
  159.138.9.109
-159.146.30.117
  159.146.90.232
  159.148.186.196
  159.148.3.177
-159.180.26.97
  159.192.104.53
  159.192.105.152
  159.192.114.231
  159.192.114.232
+159.192.114.235
  159.192.114.236
  159.192.114.237
-159.192.114.238
  159.192.120.228
  159.192.121.240
-159.192.131.197
  159.192.136.166
  159.192.141.89
  159.192.142.42
  159.192.143.249
-159.192.146.250
  159.192.148.4
  159.192.166.87
  159.192.167.97
@@ -35573,12 +29587,18 @@
  159.192.240.220
  159.192.246.38
  159.192.249.38
+159.192.250.203
+159.192.253.130
  159.192.253.198
  159.192.253.5
+159.192.67.240
+159.192.68.4
  159.192.71.189
  159.192.74.85
  159.192.8.4
+159.192.82.62
  159.192.84.54
+159.192.86.217
  159.192.91.184
  159.192.95.86
  159.192.97.181
@@ -35618,7 +29638,6 @@
  159.203.126.65
  159.203.127.137
  159.203.128.202
-159.203.128.47
  159.203.130.215
  159.203.130.254
  159.203.135.82
@@ -35638,7 +29657,6 @@
  159.203.166.93
  159.203.167.242
  159.203.168.167
-159.203.17.107
  159.203.17.75
  159.203.172.159
  159.203.173.97
@@ -35684,7 +29702,6 @@
  159.203.230.136
  159.203.232.29
  159.203.234.176
-159.203.24.167
  159.203.241.242
  159.203.242.122
  159.203.242.199
@@ -35695,7 +29712,6 @@
  159.203.26.252
  159.203.27.168
  159.203.28.251
-159.203.3.64
  159.203.30.113
  159.203.30.127
  159.203.30.226
@@ -35711,8 +29727,8 @@
  159.203.36.241
  159.203.37.43
  159.203.37.91
-159.203.38.197
  159.203.39.156
+159.203.39.94
  159.203.4.15
  159.203.40.143
  159.203.41.170
@@ -35722,7 +29738,6 @@
  159.203.42.192
  159.203.44.177
  159.203.44.237
-159.203.44.244
  159.203.46.190
  159.203.47.216
  159.203.5.139
@@ -35782,21 +29797,14 @@
  159.224.121.221
  159.224.166.129
  159.224.189.250
-159.224.19.187
  159.224.220.63
-159.224.223.92
  159.224.226.164
+159.224.232.35
  159.224.243.185
  159.224.244.11
-159.224.255.154
  159.224.37.181
  159.224.86.124
-159.224.91.220
-159.226.165.11
-159.226.165.173
-159.226.165.208
-159.226.165.67
-159.232.214.8
+159.224.94.95
  159.242.228.116
  159.242.228.219
  159.246.29.101
@@ -35828,12 +29836,6 @@
  159.253.7.218
  159.255.167.89
  159.255.250.241
-159.28.170.60
-159.45.146.133
-159.45.146.135
-159.45.221.181
-159.45.221.182
-159.45.99.71
  159.65.1.41
  159.65.1.74
  159.65.1.81
@@ -35841,17 +29843,11 @@
  159.65.100.45
  159.65.100.95
  159.65.101.201
-159.65.102.195
  159.65.102.46
-159.65.106.141
-159.65.107.160
-159.65.107.251
  159.65.108.19
-159.65.108.223
  159.65.11.115
  159.65.11.5
  159.65.110.10
-159.65.110.124
  159.65.110.27
  159.65.111.89
  159.65.113.13
@@ -35862,6 +29858,7 @@
  159.65.115.115
  159.65.115.130
  159.65.115.218
+159.65.116.225
  159.65.116.46
  159.65.118.229
  159.65.119.25
@@ -35872,7 +29869,6 @@
  159.65.122.111
  159.65.122.192
  159.65.123.91
-159.65.124.123
  159.65.124.177
  159.65.124.186
  159.65.124.47
@@ -35894,9 +29890,7 @@
  159.65.133.176
  159.65.133.234
  159.65.135.148
-159.65.136.194
  159.65.136.44
-159.65.137.122
  159.65.137.48
  159.65.139.163
  159.65.139.237
@@ -35916,13 +29910,10 @@
  159.65.147.19
  159.65.147.235
  159.65.148.176
-159.65.148.192
  159.65.149.54
  159.65.15.143
  159.65.150.135
-159.65.150.139
  159.65.150.151
-159.65.150.181
  159.65.151.183
  159.65.152.201
  159.65.152.45
@@ -35930,10 +29921,8 @@
  159.65.154.48
  159.65.155.229
  159.65.156.139
-159.65.157.238
  159.65.157.70
  159.65.158.172
-159.65.158.243
  159.65.162.189
  159.65.169.25
  159.65.169.76
@@ -35956,6 +29945,7 @@
  159.65.187.247
  159.65.19.77
  159.65.192.108
+159.65.192.210
  159.65.195.247
  159.65.196.143
  159.65.196.65
@@ -35963,12 +29953,14 @@
  159.65.200.212
  159.65.202.125
  159.65.203.229
+159.65.205.43
  159.65.206.156
+159.65.206.167
+159.65.207.131
  159.65.207.22
  159.65.207.32
  159.65.216.84
  159.65.219.142
-159.65.220.170
  159.65.220.18
  159.65.220.54
  159.65.221.193
@@ -35979,11 +29971,8 @@
  159.65.224.8
  159.65.226.229
  159.65.227.64
-159.65.228.105
-159.65.228.224
  159.65.229.162
  159.65.229.200
-159.65.229.229
  159.65.232.195
  159.65.233.97
  159.65.234.65
@@ -36002,7 +29991,6 @@
  159.65.245.182
  159.65.245.203
  159.65.250.120
-159.65.253.235
  159.65.254.144
  159.65.254.174
  159.65.3.132
@@ -36012,7 +30000,6 @@
  159.65.34.36
  159.65.39.11
  159.65.4.159
-159.65.41.104
  159.65.41.159
  159.65.5.106
  159.65.5.164
@@ -36033,9 +30020,7 @@
  159.65.67.149
  159.65.68.152
  159.65.68.239
-159.65.71.237
  159.65.72.148
-159.65.73.143
  159.65.73.172
  159.65.77.254
  159.65.77.99
@@ -36045,16 +30030,14 @@
  159.65.8.71
  159.65.81.246
  159.65.81.49
-159.65.83.126
  159.65.83.68
  159.65.84.183
  159.65.85.131
+159.65.86.130
  159.65.86.35
  159.65.88.193
  159.65.88.97
  159.65.91.105
-159.65.94.82
-159.65.97.8
  159.65.98.176
  159.65.99.102
  159.65.99.15
@@ -36063,7 +30046,6 @@
  159.69.133.211
  159.69.159.112
  159.69.16.67
-159.69.16.9
  159.69.167.252
  159.69.167.254
  159.69.221.109
@@ -36085,7 +30067,6 @@
  159.89.102.175
  159.89.102.206
  159.89.102.65
-159.89.103.156
  159.89.103.207
  159.89.104.111
  159.89.104.48
@@ -36100,16 +30081,14 @@
  159.89.109.72
  159.89.11.236
  159.89.111.102
-159.89.112.239
  159.89.112.44
  159.89.112.83
  159.89.114.40
  159.89.115.126
  159.89.115.74
  159.89.116.255
-159.89.117.48
  159.89.119.127
-159.89.119.241
+159.89.119.40
  159.89.120.240
  159.89.121.240
  159.89.121.86
@@ -36130,12 +30109,10 @@
  159.89.130.178
  159.89.131.205
  159.89.132.200
-159.89.133.144
  159.89.134.87
  159.89.135.34
  159.89.136.42
  159.89.137.243
-159.89.139.149
  159.89.14.107
  159.89.14.129
  159.89.14.213
@@ -36177,10 +30154,8 @@
  159.89.172.207
  159.89.172.219
  159.89.173.162
-159.89.173.165
  159.89.173.232
  159.89.174.217
-159.89.174.51
  159.89.174.9
  159.89.18.157
  159.89.18.80
@@ -36192,11 +30167,8 @@
  159.89.187.165
  159.89.188.167
  159.89.19.171
-159.89.193.157
  159.89.193.91
  159.89.194.103
-159.89.194.64
-159.89.195.18
  159.89.196.17
  159.89.196.41
  159.89.196.75
@@ -36213,7 +30185,6 @@
  159.89.20.204
  159.89.200.182
  159.89.202.113
-159.89.202.95
  159.89.203.135
  159.89.203.94
  159.89.205.184
@@ -36244,8 +30215,6 @@
  159.89.245.69
  159.89.250.3
  159.89.27.2
-159.89.29.214
-159.89.3.10
  159.89.3.120
  159.89.30.137
  159.89.34.234
@@ -36255,10 +30224,11 @@
  159.89.42.118
  159.89.42.205
  159.89.44.62
+159.89.46.105
  159.89.47.106
-159.89.47.115
  159.89.48.246
  159.89.48.31
+159.89.48.56
  159.89.48.69
  159.89.49.225
  159.89.5.237
@@ -36267,7 +30237,6 @@
  159.89.51.228
  159.89.53.183
  159.89.54.88
-159.89.55.157
  159.89.55.36
  159.89.7.14
  159.89.7.191
@@ -36276,7 +30245,6 @@
  159.89.82.29
  159.89.85.200
  159.89.86.176
-159.89.87.139
  159.89.89.191
  159.89.89.39
  159.89.89.44
@@ -36312,13 +30280,13 @@
  15uaer.coragem.cf
  15w12pa9khzfq658043xrdgv7e2yi84sb076.xyz
  160.0.197.35
+160.0.201.178
  160.0.203.129
  160.0.203.134
  160.0.203.147
  160.0.203.39
  160.0.203.57
  160.1.93.241
-160.116.0.21
  160.119.128.102
  160.119.128.70
  160.119.131.114
@@ -36327,6 +30295,7 @@
  160.119.42.70
  160.119.50.93
  160.119.70.109
+160.120.162.108
  160.124.136.24
  160.124.140.153
  160.124.157.76
@@ -36339,26 +30308,37 @@
  160.153.146.164
  160.153.146.165
  160.153.146.79
+160.153.147.129
+160.153.147.132
+160.153.147.133
+160.153.147.135
+160.153.147.137
  160.153.147.139
  160.153.147.141
  160.153.147.142
  160.153.147.143
+160.153.147.152
+160.153.147.153
  160.153.147.154
-160.153.147.155
+160.153.147.158
  160.153.147.16
+160.153.147.160
  160.153.147.161
+160.153.147.162
  160.153.147.23
-160.153.147.35
-160.153.153.134
+160.153.147.37
+160.153.153.28
  160.153.153.29
+160.153.153.30
  160.153.153.31
  160.153.154.1
  160.153.154.10
  160.153.154.11
+160.153.154.18
  160.153.154.19
  160.153.154.2
-160.153.154.20
  160.153.154.21
+160.153.154.23
  160.153.154.24
  160.153.154.26
  160.153.154.27
@@ -36370,10 +30350,12 @@
  160.153.154.6
  160.153.154.7
  160.153.154.8
+160.153.156.130
  160.153.156.135
  160.153.156.136
  160.153.156.137
  160.153.156.138
+160.153.156.141
  160.153.156.33
  160.153.156.38
  160.153.203.129
@@ -36386,11 +30368,8 @@
  160.153.252.187
  160.153.252.9
  160.154.39.6
-160.154.43.146
  160.155.113.19
  160.155.113.22
-160.155.197.194
-160.155.252.54
  160.155.53.22
  160.16.0.30
  160.16.101.124
@@ -36400,7 +30379,6 @@
  160.16.145.25
  160.16.198.89
  160.16.203.190
-160.16.208.139
  160.16.215.81
  160.16.219.87
  160.16.230.197
@@ -36408,8 +30386,6 @@
  160.16.63.41
  160.16.76.83
  160.16.84.152
-160.174.129.174
-160.174.130.100
  160.178.122.95
  160.19.227.20
  160.19.246.57
@@ -36433,17 +30409,8 @@
  160.238.163.2
  160.238.163.20
  160.238.163.29
-160.238.218.211
  160.238.227.153
  160.238.227.163
-160.238.229.24
-160.238.74.117
-160.238.74.183
-160.238.74.70
-160.238.75.101
-160.238.75.56
-160.238.75.89
-160.242.192.126
  160.251.0.114
  160.251.13.147
  160.251.15.119
@@ -36459,10 +30426,8 @@
  160.251.8.225
  160.251.9.131
  160.251.9.25
-160.3.126.158
  160.39.192.136
  160.39.48.77
-160.46.252.15
  160.80.87.201
  160holiganbet.com
  161.0.153.60
@@ -36479,19 +30444,17 @@
  161.117.181.101
  161.117.189.202
  161.117.189.30
-161.117.191.130
  161.117.191.59
+161.117.248.141
  161.117.251.247
-161.117.39.197
  161.117.44.63
-161.117.57.88
+161.117.7.137
  161.117.7.172
+161.117.83.239
  161.117.9.216
  161.117.9.99
-161.129.144.75
  161.129.35.214
  161.129.67.114
-161.129.67.154
  161.132.113.242
  161.132.181.182
  161.132.181.238
@@ -36499,9 +30462,8 @@
  161.139.21.37
  161.142.180.213
  161.156.160.12
-161.189.114.127
+161.189.111.230
  161.189.128.226
-161.189.179.239
  161.189.183.198
  161.189.7.126
  161.200.98.10
@@ -36511,7 +30473,10 @@
  161.202.226.194
  161.202.41.12
  161.221.12.55
+161.230.174.193
+161.29.255.120
  161.35.0.206
+161.35.1.55
  161.35.10.226
  161.35.101.70
  161.35.103.43
@@ -36520,7 +30485,6 @@
  161.35.108.241
  161.35.11.118
  161.35.111.169
-161.35.116.30
  161.35.118.14
  161.35.120.184
  161.35.121.130
@@ -36532,16 +30496,16 @@
  161.35.13.123
  161.35.13.253
  161.35.13.78
-161.35.134.63
  161.35.138.131
-161.35.148.121
+161.35.146.222
  161.35.148.134
  161.35.148.75
-161.35.15.187
  161.35.15.34
+161.35.150.254
  161.35.152.224
  161.35.152.252
-161.35.156.136
+161.35.156.92
+161.35.158.138
  161.35.158.217
  161.35.158.99
  161.35.161.13
@@ -36571,15 +30535,13 @@
  161.35.206.173
  161.35.207.11
  161.35.212.246
-161.35.218.147
  161.35.225.155
  161.35.225.185
  161.35.225.49
  161.35.227.204
-161.35.227.60
-161.35.230.183
-161.35.230.3
+161.35.231.110
  161.35.231.78
+161.35.232.103
  161.35.232.146
  161.35.232.16
  161.35.232.30
@@ -36587,18 +30549,16 @@
  161.35.233.130
  161.35.234.25
  161.35.235.27
-161.35.236.158
  161.35.237.200
  161.35.238.143
-161.35.238.241
  161.35.239.33
  161.35.24.244
  161.35.26.90
  161.35.30.208
  161.35.32.43
  161.35.36.90
-161.35.39.170
  161.35.4.152
+161.35.4.201
  161.35.45.62
  161.35.47.220
  161.35.49.47
@@ -36614,14 +30574,11 @@
  161.35.57.121
  161.35.58.35
  161.35.59.167
-161.35.6.143
  161.35.6.188
  161.35.6.6
  161.35.60.129
-161.35.60.49
-161.35.61.129
  161.35.63.129
-161.35.63.220
+161.35.63.5
  161.35.70.5
  161.35.72.39
  161.35.77.82
@@ -36631,6 +30588,7 @@
  161.35.89.147
  161.35.9.18
  161.35.90.45
+161.35.91.199
  161.35.95.168
  161.35.95.195
  161.35.98.45
@@ -36640,7 +30598,6 @@
  161.35.99.73
  161.47.70.199
  161.49.168.38
-161.53.116.99
  161.53.179.226
  161.53.179.227
  161.53.179.233
@@ -36648,10 +30605,10 @@
  161.53.201.185
  161.53.240.18
  161.53.240.25
-161.77.38.98
+161.53.47.239
+161.81.220.160
  161.81.36.21
  161.82.136.56
-161.97.100.76
  161.97.107.17
  161.97.111.195
  161.97.116.25
@@ -36660,34 +30617,32 @@
  161.97.128.127
  161.97.128.227
  161.97.129.105
-161.97.130.192
  161.97.131.168
  161.97.131.255
  161.97.131.71
  161.97.133.225
+161.97.134.146
+161.97.134.175
  161.97.135.149
-161.97.140.205
  161.97.141.120
  161.97.141.205
  161.97.144.87
+161.97.158.85
  161.97.64.156
  161.97.64.180
  161.97.67.106
  161.97.67.157
  161.97.68.59
  161.97.70.157
-161.97.70.19
  161.97.70.3
  161.97.70.30
  161.97.73.29
  161.97.77.70
  161.97.78.179
-161.97.82.97
+161.97.81.188
  161.97.84.78
  161.97.87.67
  161.97.88.4
-161.97.91.103
-161.97.92.89
  161.97.93.47
  161.97.94.184
  161.97.95.63
@@ -36720,86 +30675,31 @@
  162.0.236.13
  162.112.41.65
  162.13.14.243
-162.13.14.8
  162.134.72.6
  162.14.11.184
-162.14.134.114
-162.14.177.172
-162.14.177.181
-162.14.177.184
  162.14.18.148
  162.14.18.58
  162.14.22.99
  162.14.8.119
-162.142.125.16
-162.142.125.17
-162.142.125.18
-162.142.125.19
-162.142.125.20
-162.142.125.21
-162.142.125.22
-162.142.125.23
-162.142.125.24
-162.142.125.25
-162.142.125.26
-162.142.125.27
  162.142.125.28
-162.142.125.29
-162.142.125.30
-162.142.125.31
  162.142.125.38
-162.142.125.39
  162.142.125.40
  162.142.125.54
  162.142.125.55
  162.142.125.56
-162.142.125.64
-162.142.125.65
-162.142.125.66
-162.142.125.67
-162.142.125.68
-162.142.125.69
-162.142.125.70
-162.142.125.71
-162.142.125.72
-162.142.125.73
-162.142.125.74
-162.142.125.75
-162.142.125.76
-162.142.125.77
-162.142.125.78
-162.142.125.79
-162.142.125.80
-162.142.125.81
-162.142.125.82
-162.142.125.83
-162.142.125.84
-162.142.125.85
-162.142.125.86
-162.142.125.87
-162.142.125.88
-162.142.125.89
-162.142.125.90
-162.142.125.91
-162.142.125.92
-162.142.125.93
-162.142.125.94
-162.142.125.95
  162.144.107.199
  162.144.108.177
  162.144.128.76
  162.144.141.141
  162.144.146.65
-162.144.150.118
  162.144.152.46
-162.144.213.238
+162.144.153.135
  162.144.221.185
  162.144.34.109
  162.144.34.147
  162.144.35.84
  162.144.38.125
  162.144.38.233
-162.144.38.240
  162.144.39.157
  162.144.49.154
  162.144.51.3
@@ -36812,30 +30712,24 @@
  162.144.91.33
  162.144.96.64
  162.144.99.9
-162.154.101.112
  162.154.207.147
-162.156.106.150
-162.156.137.222
-162.156.152.192
+162.155.10.150
  162.156.152.42
-162.156.157.234
  162.156.219.13
  162.156.221.80
-162.157.163.246
-162.157.164.74
  162.157.71.213
-162.157.86.21
-162.158.134.74
+162.158.111.125
+162.158.111.191
+162.158.111.204
+162.158.111.92
  162.158.142.101
  162.158.154.131
-162.158.154.155
-162.158.154.215
-162.158.154.35
+162.158.155.252
  162.158.155.48
+162.158.158.159
  162.158.158.199
-162.158.158.217
+162.158.158.243
  162.158.158.31
-162.158.159.80
  162.158.165.129
  162.158.165.132
  162.158.165.133
@@ -36873,7 +30767,6 @@
  162.158.166.84
  162.158.166.86
  162.158.167.13
-162.158.167.157
  162.158.167.196
  162.158.167.197
  162.158.167.27
@@ -36882,21 +30775,18 @@
  162.158.167.51
  162.158.167.57
  162.158.167.9
-162.158.183.151
-162.158.183.157
+162.158.183.107
+162.158.183.153
  162.158.183.199
-162.158.187.125
-162.158.187.153
-162.158.202.177
-162.158.202.242
-162.158.203.33
-162.158.203.35
-162.158.238.236
-162.158.62.27
-162.158.62.43
+162.158.187.213
+162.158.203.29
+162.158.210.134
+162.158.23.59
+162.158.255.248
  162.158.63.114
  162.158.63.191
-162.158.63.84
+162.158.63.238
+162.158.74.107
  162.158.88.135
  162.158.91.54
  162.158.92.107
@@ -36905,15 +30795,14 @@
  162.17.143.229
  162.17.143.234
  162.17.252.5
-162.191.157.181
  162.191.197.222
  162.191.205.27
  162.191.49.51
  162.191.7.122
+162.191.9.211
  162.198.89.189
-162.198.98.220
  162.199.19.25
-162.200.143.124
+162.201.173.42
  162.204.48.113
  162.204.50.89
  162.208.12.122
@@ -36985,6 +30874,7 @@
  162.212.115.88
  162.212.115.93
  162.212.115.95
+162.212.136.24
  162.212.168.76
  162.212.169.190
  162.212.169.213
@@ -37019,7 +30909,6 @@
  162.214.101.36
  162.214.101.56
  162.214.103.187
-162.214.105.56
  162.214.111.167
  162.214.124.51
  162.214.127.101
@@ -37027,6 +30916,7 @@
  162.214.155.215
  162.214.163.117
  162.214.28.25
+162.214.3.98
  162.214.54.162
  162.214.64.156
  162.214.64.229
@@ -37049,9 +30939,7 @@
  162.219.4.93
  162.219.5.83
  162.219.57.21
-162.220.151.98
  162.220.160.211
-162.220.49.71
  162.220.52.228
  162.220.58.238
  162.220.65.143
@@ -37062,7 +30950,6 @@
  162.221.200.177
  162.222.183.190
  162.222.215.164
-162.222.80.246
  162.223.88.228
  162.223.88.243
  162.223.88.42
@@ -37070,17 +30957,14 @@
  162.223.89.69
  162.223.90.202
  162.223.91.231
-162.223.94.31
  162.227.162.49
  162.227.98.110
-162.235.252.48
  162.241.114.56
  162.241.117.105
  162.241.117.179
  162.241.117.180
  162.241.117.37
  162.241.120.164
-162.241.120.177
  162.241.120.67
  162.241.121.37
  162.241.125.106
@@ -37090,7 +30974,6 @@
  162.241.140.129
  162.241.148.33
  162.241.148.86
-162.241.149.130
  162.241.149.45
  162.241.153.151
  162.241.154.215
@@ -37101,21 +30984,18 @@
  162.241.214.166
  162.241.226.34
  162.241.234.55
-162.241.236.188
  162.241.242.173
  162.241.244.134
+162.241.39.144
  162.241.41.111
  162.241.65.37
  162.241.66.190
  162.241.66.242
  162.241.71.212
  162.241.72.243
-162.241.73.2
  162.241.75.116
-162.241.76.74
  162.241.77.166
  162.241.87.45
-162.241.89.243
  162.242.153.132
  162.242.156.81
  162.242.166.11
@@ -37137,103 +31017,13 @@
  162.243.125.182
  162.243.125.54
  162.243.126.220
-162.243.128.102
-162.243.128.103
-162.243.128.104
-162.243.128.109
-162.243.128.11
-162.243.128.112
-162.243.128.114
-162.243.128.116
-162.243.128.118
-162.243.128.119
-162.243.128.12
-162.243.128.120
+162.243.126.96
  162.243.128.125
-162.243.128.127
-162.243.128.129
-162.243.128.13
-162.243.128.131
-162.243.128.132
-162.243.128.133
-162.243.128.14
-162.243.128.141
-162.243.128.147
-162.243.128.149
-162.243.128.158
  162.243.128.16
-162.243.128.160
-162.243.128.161
-162.243.128.166
-162.243.128.167
-162.243.128.170
-162.243.128.171
-162.243.128.174
-162.243.128.176
-162.243.128.177
-162.243.128.18
-162.243.128.180
-162.243.128.181
-162.243.128.183
  162.243.128.185
-162.243.128.186
-162.243.128.188
-162.243.128.189
-162.243.128.190
-162.243.128.193
-162.243.128.195
-162.243.128.197
-162.243.128.199
-162.243.128.20
-162.243.128.202
-162.243.128.204
-162.243.128.208
-162.243.128.209
-162.243.128.21
-162.243.128.214
-162.243.128.215
-162.243.128.220
-162.243.128.224
-162.243.128.225
-162.243.128.226
-162.243.128.227
-162.243.128.228
-162.243.128.230
-162.243.128.237
-162.243.128.238
  162.243.128.245
-162.243.128.25
-162.243.128.29
-162.243.128.30
-162.243.128.32
-162.243.128.36
-162.243.128.37
-162.243.128.38
-162.243.128.39
-162.243.128.4
-162.243.128.43
-162.243.128.48
-162.243.128.49
-162.243.128.50
-162.243.128.52
-162.243.128.53
-162.243.128.57
-162.243.128.58
-162.243.128.64
-162.243.128.69
-162.243.128.71
-162.243.128.76
-162.243.128.84
-162.243.128.9
-162.243.128.90
-162.243.128.91
-162.243.128.92
-162.243.128.94
-162.243.128.96
-162.243.128.97
  162.243.129.124
  162.243.129.240
-162.243.129.4
  162.243.130.20
  162.243.130.82
  162.243.131.199
@@ -37260,6 +31050,7 @@
  162.243.156.130
  162.243.157.103
  162.243.157.200
+162.243.159.4
  162.243.160.106
  162.243.161.215
  162.243.161.222
@@ -37270,6 +31061,7 @@
  162.243.169.210
  162.243.171.112
  162.243.172.179
+162.243.173.129
  162.243.173.202
  162.243.173.29
  162.243.174.115
@@ -37291,7 +31083,6 @@
  162.243.225.74
  162.243.227.35
  162.243.23.246
-162.243.23.57
  162.243.231.148
  162.243.232.174
  162.243.233.102
@@ -37299,6 +31090,7 @@
  162.243.237.95
  162.243.241.183
  162.243.243.223
+162.243.244.206
  162.243.25.182
  162.243.251.166
  162.243.28.212
@@ -37316,7 +31108,6 @@
  162.243.49.119
  162.243.5.209
  162.243.50.8
-162.243.56.43
  162.243.6.103
  162.243.62.118
  162.243.62.246
@@ -37356,15 +31147,17 @@
  162.244.9.13
  162.244.9.190
  162.244.9.70
+162.245.179.135
  162.245.221.122
  162.245.81.151
-162.245.81.36
  162.246.211.27
  162.246.22.20
  162.246.61.20
  162.247.146.230
  162.247.155.129
-162.247.213.106
+162.247.208.45
+162.247.212.190
+162.247.214.99
  162.247.72.199
  162.247.73.192
  162.247.73.206
@@ -37392,88 +31185,38 @@
  162.250.189.53
  162.250.235.127
  162.250.97.78
-162.251.203.212
-162.252.152.187
-162.253.168.86
  162.253.37.208
  162.253.66.50
  162.253.66.76
  162.254.250.6
+162.254.89.69
  162.255.116.244
  162.255.117.11
  162.255.117.34
  162.255.117.35
-162.39.118.249
  162.39.119.102
  162.41.8.12
-162.62.14.159
-162.62.15.18
-162.62.15.22
-162.62.16.10
-162.62.16.102
-162.62.16.131
-162.62.16.15
-162.62.16.194
-162.62.16.235
-162.62.17.103
-162.62.17.159
-162.62.17.164
-162.62.17.185
-162.62.17.202
-162.62.17.216
-162.62.17.226
-162.62.17.230
-162.62.17.4
-162.62.17.42
-162.62.17.83
  162.62.18.226
-162.62.19.137
-162.62.19.220
-162.62.19.79
-162.62.20.10
-162.62.20.238
-162.62.20.74
-162.62.26.10
-162.62.26.113
-162.62.26.121
  162.62.26.122
-162.62.26.128
-162.62.26.17
  162.62.26.182
-162.62.26.192
-162.62.26.206
-162.62.26.207
  162.62.26.218
-162.62.26.223
-162.62.26.228
-162.62.26.238
-162.62.26.240
-162.62.26.56
-162.62.26.7
-162.62.27.117
-162.62.53.163
  162266.bibigor.com
  162783-dot-n-e-w-me-ss-age-po-rt-al.wl.r.appspot.com
  162840-dot-n-e-w-me-ss-age-po-rt-al.wl.r.appspot.com
  163.121.188.3
  163.13.182.105
  163.131.167.23
-163.131.66.106
  163.139.169.79
+163.142.212.156
  163.152.219.201
  163.158.154.126
  163.158.202.112
-163.158.228.81
  163.158.243.230
-163.158.25.90
  163.171.130.78
  163.171.132.59
  163.171.132.60
  163.171.139.132
  163.171.142.18
-163.171.142.37
-163.171.198.22
-163.171.71.31
  163.172.101.137
  163.172.109.132
  163.172.113.108
@@ -37483,7 +31226,6 @@
  163.172.117.155
  163.172.119.82
  163.172.121.98
-163.172.123.20
  163.172.128.177
  163.172.128.98
  163.172.129.30
@@ -37495,35 +31237,34 @@
  163.172.138.81
  163.172.139.91
  163.172.142.149
-163.172.145.20
  163.172.147.94
  163.172.148.34
  163.172.148.62
+163.172.150.155
  163.172.151.250
  163.172.151.47
  163.172.152.52
  163.172.154.178
  163.172.154.72
+163.172.155.154
  163.172.157.193
-163.172.158.87
  163.172.160.182
  163.172.161.31
+163.172.161.81
  163.172.162.215
  163.172.163.85
+163.172.163.95
  163.172.165.74
  163.172.167.110
  163.172.167.225
-163.172.169.34
+163.172.167.227
  163.172.171.163
-163.172.175.43
  163.172.178.167
  163.172.180.18
  163.172.181.191
-163.172.183.142
-163.172.183.24
  163.172.185.11
+163.172.187.114
  163.172.189.32
-163.172.189.38
  163.172.190.160
  163.172.198.85
  163.172.202.116
@@ -37538,10 +31279,8 @@
  163.172.219.130
  163.172.220.146
  163.172.220.221
-163.172.227.110
  163.172.228.25
  163.172.229.188
-163.172.231.34
  163.172.24.40
  163.172.27.213
  163.172.27.234
@@ -37550,9 +31289,7 @@
  163.172.29.30
  163.172.31.79
  163.172.32.190
-163.172.33.18
  163.172.35.247
-163.172.35.49
  163.172.37.72
  163.172.40.218
  163.172.41.228
@@ -37578,28 +31315,21 @@
  163.172.7.233
  163.172.73.194
  163.172.76.63
-163.172.76.69
-163.172.81.203
  163.172.81.70
  163.172.82.118
  163.172.83.41
  163.172.86.64
  163.172.88.136
-163.172.88.67
-163.172.89.133
  163.172.95.196
  163.172.97.112
  163.172.97.118
-163.179.97.16
  163.204.221.1
  163.204.244.152
+163.204.34.1
  163.204.94.150
  163.24.142.52
-163.26.57.88
  163.27.127.131
-163.27.182.223
  163.27.215.117
-163.30.193.105
  163.44.149.204
  163.44.152.32
  163.44.159.123
@@ -37613,6 +31343,7 @@
  163.44.197.129
  163.44.198.43
  163.44.198.59
+163.44.207.206
  163.47.146.118
  163.47.146.74
  163.47.148.185
@@ -37626,20 +31357,15 @@
  163.47.158.6
  163.47.158.73
  163.47.158.77
-163.47.32.110
  163.47.35.102
  163.53.150.138
  163.53.168.122
  163.53.169.62
-163.53.180.51
-163.53.183.67
  163.53.204.182
-163.53.206.228
  163.53.207.52
  163.53.209.7
  163.53.209.8
  163.53.209.9
-163.53.252.6
  163.mailcn.org
  163b7da4b400d8de32f3d9b7df9737c6-dot-dbenitonline.ey.r.appspot.com
  163s.ddns.net
@@ -37649,7 +31375,6 @@
  164.115.22.45
  164.115.241.74
  164.115.32.169
-164.115.32.42
  164.115.5.63
  164.125.234.121
  164.132.103.232
@@ -37683,19 +31408,19 @@
  164.132.236.239
  164.132.24.255
  164.132.28.126
-164.132.3.146
  164.132.38.166
  164.132.40.238
  164.132.42.32
  164.132.44.25
+164.132.44.97
  164.132.45.213
  164.132.46.129
  164.132.46.14
  164.132.47.139
-164.132.47.55
  164.132.47.67
-164.132.49.140
+164.132.48.179
  164.132.54.215
+164.132.55.144
  164.132.56.243
  164.132.57.16
  164.132.73.220
@@ -37707,14 +31432,15 @@
  164.132.95.220
  164.132.96.120
  164.132.98.75
+164.138.221.47
  164.138.236.227
  164.155.127.242
  164.155.127.245
  164.155.127.249
  164.155.127.251
+164.155.127.252
  164.155.231.247
  164.155.231.251
-164.155.64.79
  164.155.66.31
  164.155.93.8
  164.160.128.100
@@ -37725,36 +31451,19 @@
  164.163.21.10
  164.163.23.19
  164.163.250.18
-164.163.40.51
+164.163.250.82
  164.163.44.144
  164.163.99.10
+164.164.87.57
  164.177.104.186
  164.177.158.227
-164.177.60.173
  164.52.24.164
-164.52.24.165
-164.52.24.166
-164.52.24.167
  164.52.24.168
-164.52.24.169
-164.52.24.172
-164.52.24.173
-164.52.24.174
-164.52.24.175
-164.52.24.176
-164.52.24.177
-164.52.24.178
-164.52.24.179
-164.52.24.180
-164.52.24.181
-164.52.24.182
-164.52.24.189
  164.52.24.58
  164.52.33.146
  164.58.29.186
  164.68.104.88
  164.68.106.226
-164.68.106.238
  164.68.107.225
  164.68.108.59
  164.68.109.215
@@ -37767,21 +31476,19 @@
  164.68.119.129
  164.68.120.108
  164.68.120.56
+164.68.123.129
  164.68.124.225
  164.68.125.45
  164.68.126.94
+164.68.127.156
  164.68.97.15
  164.68.98.82
-164.77.112.125
  164.77.114.237
  164.77.117.10
  164.77.133.220
-164.77.141.36
  164.77.147.93
  164.77.175.246
-164.77.221.125
  164.77.221.98
-164.77.87.82
  164.90.144.24
  164.90.146.175
  164.90.150.240
@@ -37796,7 +31503,6 @@
  164.90.191.170
  164.90.194.89
  164.90.198.71
-164.90.201.56
  164.90.206.250
  164.90.208.125
  164.90.210.8
@@ -37810,7 +31516,6 @@
  164.90.227.92
  164.90.241.64
  1643.31cf4fdae.com
-165.0.0.121
  165.0.72.107
  165.132.30.11
  165.138.4.34
@@ -37818,9 +31523,6 @@
  165.138.55.107
  165.139.235.16
  165.139.252.55
-165.16.30.16
-165.16.37.150
-165.16.50.212
  165.16.54.199
  165.16.54.204
  165.16.54.205
@@ -37841,12 +31543,12 @@
  165.16.69.26
  165.16.74.159
  165.16.96.115
+165.16.96.122
  165.165.128.37
  165.165.132.60
  165.165.134.1
  165.165.140.187
  165.165.144.251
-165.165.147.154
  165.169.241.28
  165.194.27.141
  165.22.0.113
@@ -37861,19 +31563,15 @@
  165.22.113.66
  165.22.115.133
  165.22.115.214
-165.22.119.149
  165.22.121.12
  165.22.121.56
-165.22.123.19
  165.22.123.86
-165.22.125.167
  165.22.125.61
  165.22.125.82
  165.22.129.117
  165.22.13.92
  165.22.132.86
  165.22.138.106
-165.22.14.176
  165.22.148.191
  165.22.154.213
  165.22.16.134
@@ -37885,13 +31583,11 @@
  165.22.183.252
  165.22.185.188
  165.22.186.178
-165.22.189.3
  165.22.191.244
  165.22.192.120
-165.22.192.126
+165.22.192.121
  165.22.193.183
  165.22.199.252
-165.22.2.168
  165.22.205.45
  165.22.206.182
  165.22.207.116
@@ -37914,7 +31610,6 @@
  165.22.223.100
  165.22.223.121
  165.22.223.200
-165.22.223.72
  165.22.224.212
  165.22.224.53
  165.22.225.195
@@ -37924,6 +31619,7 @@
  165.22.229.88
  165.22.23.166
  165.22.23.23
+165.22.230.85
  165.22.231.74
  165.22.233.194
  165.22.233.236
@@ -37934,9 +31630,7 @@
  165.22.237.253
  165.22.238.167
  165.22.238.171
-165.22.239.177
  165.22.24.71
-165.22.242.174
  165.22.242.39
  165.22.247.221
  165.22.250.142
@@ -37977,11 +31671,14 @@
  165.22.68.84
  165.22.69.98
  165.22.71.185
+165.22.71.226
  165.22.71.24
  165.22.72.234
  165.22.72.61
  165.22.73.20
+165.22.74.54
  165.22.75.116
+165.22.75.171
  165.22.75.18
  165.22.75.220
  165.22.75.224
@@ -37992,13 +31689,14 @@
  165.22.78.247
  165.22.81.128
  165.22.81.30
+165.22.85.118
  165.22.88.74
  165.22.94.14
  165.22.94.141
-165.22.95.39
  165.22.98.186
  165.22.99.12
  165.22.99.216
+165.225.26.252
  165.227.0.129
  165.227.1.187
  165.227.10.238
@@ -38018,7 +31716,7 @@
  165.227.115.226
  165.227.116.136
  165.227.116.183
-165.227.117.43
+165.227.119.214
  165.227.12.184
  165.227.12.218
  165.227.121.100
@@ -38067,7 +31765,6 @@
  165.227.144.49
  165.227.144.61
  165.227.145.138
-165.227.145.57
  165.227.146.150
  165.227.148.67
  165.227.149.83
@@ -38082,6 +31779,7 @@
  165.227.156.155
  165.227.156.235
  165.227.157.247
+165.227.161.121
  165.227.161.72
  165.227.162.189
  165.227.163.146
@@ -38089,7 +31787,6 @@
  165.227.163.85
  165.227.164.135
  165.227.164.95
-165.227.165.102
  165.227.165.159
  165.227.166.125
  165.227.166.128
@@ -38102,10 +31799,7 @@
  165.227.169.85
  165.227.170.182
  165.227.170.217
-165.227.171.150
-165.227.173.17
  165.227.173.181
-165.227.173.197
  165.227.174.209
  165.227.174.92
  165.227.175.240
@@ -38129,17 +31823,16 @@
  165.227.199.191
  165.227.2.127
  165.227.2.199
-165.227.2.252
  165.227.20.194
  165.227.20.212
  165.227.200.140
  165.227.201.198
  165.227.201.25
+165.227.202.83
  165.227.203.131
  165.227.203.141
  165.227.203.162
  165.227.205.128
-165.227.205.38
  165.227.206.114
  165.227.207.17
  165.227.209.252
@@ -38187,15 +31880,17 @@
  165.227.34.70
  165.227.34.9
  165.227.38.68
-165.227.4.106
+165.227.4.219
  165.227.4.30
  165.227.4.60
+165.227.41.114
  165.227.45.150
  165.227.45.249
  165.227.46.89
  165.227.47.13
  165.227.48.100
  165.227.49.156
+165.227.49.254
  165.227.5.45
  165.227.50.84
  165.227.51.247
@@ -38206,7 +31901,6 @@
  165.227.6.20
  165.227.61.152
  165.227.61.35
-165.227.62.103
  165.227.62.249
  165.227.63.165
  165.227.63.41
@@ -38246,11 +31940,11 @@
  165.227.92.243
  165.227.96.190
  165.231.101.137
+165.231.101.140
  165.231.101.25
  165.231.101.79
  165.231.103.133
  165.231.105.123
-165.231.105.128
  165.231.105.129
  165.231.105.204
  165.231.105.243
@@ -38264,14 +31958,14 @@
  165.231.130.100
  165.231.130.171
  165.231.143.108
-165.231.143.109
  165.231.143.129
-165.231.143.136
+165.231.143.150
+165.231.143.154
  165.231.143.165
  165.231.143.192
  165.231.143.204
-165.231.143.31
-165.231.143.37
+165.231.143.234
+165.231.143.26
  165.231.143.46
  165.231.161.100
  165.231.212.222
@@ -38279,6 +31973,7 @@
  165.231.45.130
  165.231.45.178
  165.231.45.7
+165.231.45.88
  165.231.54.26
  165.231.92.126
  165.231.92.49
@@ -38289,7 +31984,6 @@
  165.232.102.211
  165.232.102.62
  165.232.103.11
-165.232.103.249
  165.232.103.3
  165.232.104.100
  165.232.104.203
@@ -38306,34 +32000,26 @@
  165.232.122.135
  165.232.122.187
  165.232.122.214
-165.232.32.173
  165.232.32.243
-165.232.35.95
  165.232.35.96
  165.232.37.222
  165.232.37.224
  165.232.37.59
+165.232.38.105
  165.232.38.249
-165.232.39.16
  165.232.40.170
-165.232.40.187
  165.232.41.121
  165.232.41.133
  165.232.41.191
-165.232.41.229
-165.232.43.17
-165.232.43.49
+165.232.43.44
  165.232.45.141
  165.232.46.52
-165.232.47.112
-165.232.47.2
  165.232.47.232
  165.232.54.187
  165.232.63.210
  165.232.64.90
  165.232.65.66
  165.232.66.234
-165.232.66.88
  165.232.67.41
  165.232.70.243
  165.232.77.72
@@ -38352,6 +32038,7 @@
  165.255.88.200
  165.255.89.199
  165.255.89.246
+165.255.90.187
  165.3.113.26
  165.3.87.108
  165.3.87.110
@@ -38371,6 +32058,7 @@
  165.3.92.240
  165.3.93.81
  165.56.7.94
+165.73.89.75
  165.84.180.12
  165.84.180.33
  165.84.180.37
@@ -38378,6 +32066,7 @@
  165.84.180.46
  165.84.180.47
  165.84.180.66
+165.90.146.210
  165.90.243.26
  165.90.51.222
  165.90.60.69
@@ -38388,7 +32077,6 @@
  16556.wang
  166.111.152.230
  166.111.60.108
-166.130.129.94
  166.137.10.116
  166.137.10.23
  166.137.10.85
@@ -38418,22 +32106,29 @@
  166.137.8.113
  166.137.90.15
  166.139.150.202
+166.142.243.191
+166.145.181.103
+166.145.209.171
+166.145.209.233
+166.150.168.66
  166.151.5.193
-166.155.19.234
-166.164.193.147
-166.166.49.180
+166.153.157.72
+166.153.157.84
+166.156.66.195
  166.166.84.239
-166.168.3.191
+166.168.3.161
+166.168.3.202
  166.170.0.117
  166.170.14.108
  166.170.14.59
  166.170.15.75
  166.170.5.47
+166.175.188.125
+166.175.188.89
+166.175.61.213
  166.216.165.124
  166.216.165.58
-166.252.97.71
-166.48.211.21
-166.48.72.219
+166.252.236.141
  166.62.117.176
  166.62.37.57
  166.62.39.186
@@ -38444,7 +32139,6 @@
  166.63.127.40
  166.70.198.100
  166.70.198.180
-166.70.202.88
  166.70.207.2
  166.78.101.169
  166.78.111.160
@@ -38467,7 +32161,6 @@
  167.114.12.138
  167.114.122.37
  167.114.129.9
-167.114.140.235
  167.114.144.159
  167.114.150.100
  167.114.152.170
@@ -38494,22 +32187,6 @@
  167.114.23.185
  167.114.235.41
  167.114.237.46
-167.114.24.176
-167.114.24.177
-167.114.24.178
-167.114.24.179
-167.114.24.180
-167.114.24.181
-167.114.24.182
-167.114.24.183
-167.114.24.184
-167.114.24.185
-167.114.24.186
-167.114.24.187
-167.114.24.188
-167.114.24.189
-167.114.24.190
-167.114.24.191
  167.114.25.102
  167.114.251.164
  167.114.254.142
@@ -38536,32 +32213,20 @@
  167.132.252.225
  167.142.179.130
  167.160.12.178
-167.160.184.106
-167.160.184.108
-167.160.184.110
-167.160.184.111
-167.160.184.122
-167.160.184.37
-167.160.184.43
-167.160.184.47
-167.160.184.55
-167.160.184.62
-167.160.184.63
+167.160.184.54
  167.160.184.72
  167.160.184.74
  167.160.36.151
  167.160.67.40
  167.160.74.223
  167.160.74.225
-167.160.74.236
-167.160.76.241
  167.160.76.44
  167.160.79.139
  167.160.79.241
  167.172.0.218
-167.172.102.128
  167.172.109.12
  167.172.110.159
+167.172.115.176
  167.172.117.26
  167.172.124.2
  167.172.125.15
@@ -38588,7 +32253,6 @@
  167.172.146.98
  167.172.147.171
  167.172.149.95
-167.172.150.210
  167.172.151.135
  167.172.151.136
  167.172.153.14
@@ -38621,8 +32285,7 @@
  167.172.194.16
  167.172.194.231
  167.172.195.99
-167.172.20.175
-167.172.200.60
+167.172.200.70
  167.172.201.94
  167.172.204.125
  167.172.205.116
@@ -38635,14 +32298,17 @@
  167.172.213.83
  167.172.215.83
  167.172.216.125
+167.172.219.157
  167.172.22.209
  167.172.222.127
+167.172.222.63
  167.172.226.175
  167.172.23.70
  167.172.233.146
  167.172.233.171
  167.172.235.137
  167.172.235.25
+167.172.236.141
  167.172.238.159
  167.172.242.210
  167.172.242.220
@@ -38666,26 +32332,24 @@
  167.172.46.87
  167.172.47.197
  167.172.49.139
-167.172.54.168
  167.172.54.27
  167.172.55.235
  167.172.55.6
+167.172.56.36
+167.172.57.1
  167.172.58.62
-167.172.58.67
  167.172.59.163
  167.172.59.6
  167.172.61.145
-167.172.61.168
  167.172.63.17
  167.172.78.207
  167.172.78.73
  167.172.98.198
  167.172.98.89
  167.179.109.240
-167.179.13.185
-167.179.13.196
  167.179.139.79
  167.179.153.249
+167.179.157.31
  167.179.4.134
  167.179.64.113
  167.179.77.92
@@ -38694,79 +32358,34 @@
  167.179.88.31
  167.179.96.13
  167.179.96.172
-167.248.133.16
-167.248.133.17
-167.248.133.18
-167.248.133.19
-167.248.133.20
-167.248.133.21
-167.248.133.22
-167.248.133.23
-167.248.133.24
-167.248.133.25
-167.248.133.26
-167.248.133.27
-167.248.133.28
-167.248.133.29
-167.248.133.30
-167.248.133.31
+167.224.230.8
  167.248.133.37
+167.248.133.39
  167.248.133.40
+167.248.133.53
  167.248.133.54
  167.248.133.55
  167.248.133.56
-167.248.133.64
-167.248.133.65
-167.248.133.66
-167.248.133.67
-167.248.133.68
-167.248.133.69
-167.248.133.70
-167.248.133.71
-167.248.133.72
-167.248.133.73
-167.248.133.74
-167.248.133.75
-167.248.133.76
-167.248.133.77
-167.248.133.78
-167.248.133.79
-167.248.133.80
-167.248.133.81
-167.248.133.82
-167.248.133.83
-167.248.133.84
-167.248.133.85
-167.248.133.86
-167.248.133.87
-167.248.133.88
-167.248.133.89
-167.248.133.90
-167.248.133.91
-167.248.133.92
-167.248.133.93
-167.248.133.94
-167.248.133.95
  167.249.170.26
  167.249.181.245
+167.249.211.154
  167.249.212.17
  167.249.225.189
+167.249.39.187
  167.249.66.0
  167.249.9.37
  167.250.127.235
  167.250.160.206
-167.250.180.82
-167.250.180.86
-167.250.189.103
-167.250.190.38
  167.250.206.195
  167.250.48.115
  167.250.49.155
  167.250.65.246
-167.250.99.232
+167.250.97.192
+167.56.230.63
  167.56.252.192
  167.56.7.75
  167.57.140.117
+167.57.43.93
  167.60.77.108
  167.61.133.93
  167.63.41.106
@@ -38775,32 +32394,25 @@
  167.71.10.37
  167.71.102.102
  167.71.102.17
-167.71.102.181
  167.71.102.201
-167.71.102.95
  167.71.104.1
  167.71.108.65
  167.71.109.96
-167.71.11.115
  167.71.11.57
-167.71.110.14
  167.71.111.16
  167.71.112.14
  167.71.112.8
  167.71.113.113
  167.71.114.229
-167.71.115.245
  167.71.117.84
  167.71.118.166
  167.71.119.18
  167.71.127.113
  167.71.127.147
  167.71.128.64
-167.71.13.196
  167.71.130.118
  167.71.130.169
  167.71.130.205
-167.71.134.156
  167.71.139.119
  167.71.139.95
  167.71.143.138
@@ -38810,6 +32422,7 @@
  167.71.147.212
  167.71.152.101
  167.71.153.244
+167.71.154.15
  167.71.159.219
  167.71.161.95
  167.71.161.98
@@ -38821,16 +32434,13 @@
  167.71.168.194
  167.71.172.39
  167.71.174.63
-167.71.175.10
  167.71.176.154
  167.71.177.236
  167.71.185.113
-167.71.186.157
  167.71.188.218
  167.71.193.214
  167.71.194.63
  167.71.196.176
-167.71.197.10
  167.71.20.246
  167.71.202.109
  167.71.202.40
@@ -38840,7 +32450,6 @@
  167.71.209.115
  167.71.209.158
  167.71.209.193
-167.71.209.2
  167.71.210.7
  167.71.211.104
  167.71.213.125
@@ -38848,6 +32457,7 @@
  167.71.213.19
  167.71.213.75
  167.71.216.201
+167.71.216.37
  167.71.218.243
  167.71.218.38
  167.71.219.179
@@ -38862,23 +32472,18 @@
  167.71.227.169
  167.71.228.224
  167.71.228.241
-167.71.229.200
  167.71.229.33
  167.71.230.124
  167.71.230.253
-167.71.230.63
  167.71.230.67
-167.71.230.77
-167.71.231.77
+167.71.232.136
  167.71.232.38
  167.71.234.109
-167.71.234.134
  167.71.234.148
  167.71.234.29
  167.71.235.159
  167.71.236.26
  167.71.237.128
-167.71.237.130
  167.71.239.181
  167.71.252.55
  167.71.254.137
@@ -38900,21 +32505,15 @@
  167.71.56.93
  167.71.59.56
  167.71.6.91
-167.71.63.130
-167.71.63.47
  167.71.64.214
  167.71.7.109
  167.71.70.154
-167.71.70.218
  167.71.70.36
-167.71.72.205
  167.71.72.70
  167.71.73.244
-167.71.73.6
  167.71.74.143
  167.71.74.39
  167.71.76.221
-167.71.76.254
  167.71.77.120
  167.71.81.215
  167.71.83.150
@@ -38939,13 +32538,13 @@
  167.86.115.81
  167.86.116.198
  167.86.116.202
-167.86.116.212
  167.86.117.63
  167.86.126.200
  167.86.67.67
  167.86.71.24
  167.86.73.56
  167.86.75.149
+167.86.75.216
  167.86.78.148
  167.86.80.173
  167.86.81.74
@@ -38953,16 +32552,13 @@
  167.86.87.90
  167.86.90.239
  167.86.90.94
-167.86.93.224
  167.86.94.107
  167.86.95.104
  167.86.98.148
  167.86.98.81
  167.86.99.118
-167.88.125.122
  167.88.15.198
  167.88.161.51
-167.88.176.179
  167.88.177.213
  167.88.178.19
  167.88.179.86
@@ -38971,19 +32567,16 @@
  167.88.181.200
  167.88.181.219
  167.88.7.134
+167.89.100.167
+167.89.100.168
  167.89.27.74
  167.98.71.52
  167.99.0.64
-167.99.100.228
+167.99.101.131
  167.99.101.77
-167.99.103.190
-167.99.103.38
-167.99.104.121
-167.99.104.161
  167.99.104.19
  167.99.105.223
-167.99.106.78
-167.99.107.159
+167.99.107.57
  167.99.109.254
  167.99.11.20
  167.99.110.102
@@ -38991,42 +32584,43 @@
  167.99.110.179
  167.99.110.42
  167.99.112.243
+167.99.12.47
  167.99.129.36
  167.99.13.63
  167.99.13.90
  167.99.130.56
+167.99.131.238
  167.99.131.243
  167.99.132.242
  167.99.132.44
  167.99.133.17
-167.99.134.166
  167.99.134.216
  167.99.134.58
  167.99.135.246
  167.99.136.158
+167.99.137.75
  167.99.138.247
  167.99.139.208
  167.99.139.33
  167.99.14.237
  167.99.141.124
+167.99.141.35
  167.99.142.69
  167.99.143.148
  167.99.143.190
  167.99.144.224
  167.99.144.235
-167.99.146.47
  167.99.148.145
  167.99.148.91
  167.99.155.36
+167.99.156.117
  167.99.159.142
-167.99.160.14
  167.99.160.9
-167.99.163.148
+167.99.161.236
  167.99.164.171
  167.99.166.74
  167.99.167.105
  167.99.167.51
-167.99.167.77
  167.99.169.17
  167.99.170.160
  167.99.170.83
@@ -39053,7 +32647,6 @@
  167.99.2.222
  167.99.202.143
  167.99.203.220
-167.99.204.168
  167.99.204.24
  167.99.204.251
  167.99.205.9
@@ -39108,6 +32701,7 @@
  167.99.4.53
  167.99.40.117
  167.99.42.89
+167.99.44.29
  167.99.45.116
  167.99.46.167
  167.99.49.115
@@ -39129,14 +32723,12 @@
  167.99.64.181
  167.99.64.81
  167.99.65.231
-167.99.65.64
  167.99.66.2
  167.99.66.74
  167.99.67.142
  167.99.68.65
  167.99.69.130
  167.99.69.167
-167.99.7.149
  167.99.7.190
  167.99.7.239
  167.99.7.52
@@ -39159,8 +32751,6 @@
  167.99.90.243
  167.99.90.25
  167.99.91.116
-167.99.91.47
-167.99.92.106
  167.99.95.227
  167.99.96.114
  167.99.96.163
@@ -39168,20 +32758,21 @@
  167.99.98.92
  167.99.99.10
  167.99.99.80
-168.0.149.223
  168.0.155.138
  168.0.155.15
  168.0.172.104
-168.0.68.218
  168.103.13.215
  168.119.0.182
+168.119.1.119
  168.119.101.111
  168.119.103.204
  168.119.104.7
+168.119.105.145
  168.119.12.54
  168.119.122.55
  168.119.13.241
  168.119.144.245
+168.119.15.211
  168.119.153.10
  168.119.153.12
  168.119.155.116
@@ -39210,7 +32801,6 @@
  168.119.18.7
  168.119.227.181
  168.119.232.49
-168.119.236.237
  168.119.243.255
  168.119.247.58
  168.119.249.19
@@ -39221,20 +32811,17 @@
  168.119.84.219
  168.119.86.21
  168.119.86.22
+168.119.86.74
  168.119.96.108
  168.119.96.193
-168.121.104.115
+168.119.98.5
  168.121.137.64
  168.121.139.199
  168.121.139.31
-168.121.4.238
-168.121.72.148
-168.121.8.3
+168.121.45.208
  168.121.97.67
-168.126.149.40
  168.128.130.59
  168.138.14.139
-168.138.140.40
  168.138.213.119
  168.138.219.129
  168.138.221.133
@@ -39249,15 +32836,14 @@
  168.151.228.228
  168.151.229.208
  168.151.229.76
-168.167.50.254
  168.167.85.255
+168.167.91.101
+168.167.91.69
  168.169.146.12
  168.169.96.17
  168.169.96.2
-168.181.120.21
  168.181.121.195
  168.181.121.197
-168.181.123.117
  168.181.128.146
  168.181.128.152
  168.181.128.155
@@ -39265,11 +32851,10 @@
  168.181.131.33
  168.181.134.119
  168.181.145.242
-168.181.196.28
  168.181.196.33
  168.181.242.81
  168.181.245.129
-168.181.56.38
+168.181.51.76
  168.181.62.74
  168.184.14.14
  168.194.13.4
@@ -39281,11 +32866,9 @@
  168.194.165.74
  168.194.201.6
  168.194.207.58
-168.194.76.137
  168.194.83.25
  168.194.83.45
  168.194.96.3
-168.195.181.14
  168.195.182.62
  168.195.196.14
  168.195.196.18
@@ -39293,17 +32876,12 @@
  168.195.196.29
  168.195.205.154
  168.195.229.60
-168.196.105.107
-168.196.105.125
-168.196.105.179
-168.196.105.78
-168.196.105.8
-168.196.106.134
-168.196.107.56
  168.196.114.201
  168.196.114.205
  168.196.114.241
  168.196.114.7
+168.196.12.27
+168.196.180.66
  168.196.52.80
  168.196.96.37
  168.197.105.187
@@ -39311,19 +32889,17 @@
  168.197.176.8
  168.197.252.162
  168.197.52.224
-168.205.124.51
  168.205.140.224
-168.205.178.187
+168.205.192.112
  168.205.192.179
+168.205.192.93
  168.205.217.142
  168.205.217.193
-168.205.217.200
  168.205.217.251
  168.205.217.79
  168.205.218.219
  168.205.218.237
  168.205.218.33
-168.205.218.37
  168.205.218.72
  168.205.220.124
  168.215.65.65
@@ -39336,7 +32912,6 @@
  168.226.214.98
  168.226.218.253
  168.227.106.100
-168.227.116.14
  168.227.146.34
  168.227.147.194
  168.227.147.243
@@ -39352,7 +32927,6 @@
  168.227.158.57
  168.227.158.61
  168.227.158.9
-168.227.169.12
  168.227.212.130
  168.227.78.94
  168.227.88.39
@@ -39365,7 +32939,6 @@
  168.228.204.250
  168.228.207.98
  168.228.220.252
-168.228.4.1
  168.228.51.197
  168.228.51.238
  168.228.8.3
@@ -39379,22 +32952,17 @@
  168.232.198.246
  168.232.20.155
  168.232.20.39
-168.232.20.5
  168.232.214.26
  168.232.214.29
  168.235.144.53
-168.235.197.165
-168.235.64.100
  168.235.67.138
  168.235.69.21
  168.235.74.110
  168.235.76.165
  168.235.83.139
-168.235.89.145
  168.235.90.188
+168.235.94.230
  168.235.98.150
-168.253.115.79
-168.253.117.138
  168.62.174.233
  168.62.175.22
  168.62.218.152
@@ -39403,13 +32971,12 @@
  168.63.14.93
  168.63.151.21
  168.63.54.181
+168.63.78.70
  168.63.98.105
  168.70.107.167
-168.70.37.71
-168.70.62.74
-168.70.8.188
-168.80.119.4
-168.90.113.136
+168.80.100.127
+168.90.110.186
+168.90.110.189
  168.90.15.138
  168.90.196.156
  168.90.196.162
@@ -39419,18 +32986,16 @@
  168.90.196.244
  168.90.196.246
  168.90.196.43
-168.90.197.217
+168.90.196.71
  168.90.197.26
  168.90.197.67
  168.90.199.162
  168.90.199.188
  168.90.199.19
  168.90.199.45
-168.90.253.171
-168.90.254.148
-168.90.254.85
  168.90.28.62
  168.90.29.245
+168.90.34.16
  168.90.34.225
  168.90.50.118
  168.90.65.102
@@ -39446,9 +33011,13 @@
  168.91.46.1
  168.91.76.109
  168.91.76.113
+168.91.76.163
  168.91.76.2
  168.91.76.38
  168.91.76.81
+168.91.80.149
+168.91.81.165
+168.91.82.32
  168.91.90.101
  168.wtuo100.com
  1685602.servicesbpd.club
@@ -39457,15 +33026,12 @@
  168kj.cn
  168ob.com
  169.0.135.187
-169.0.81.76
-169.1.23.11
  169.1.79.231
  169.149.133.127
  169.159.173.9
  169.159.181.61
-169.239.120.11
+169.197.108.22
  169.239.166.134
-169.239.169.190
  169.239.171.59
  169.239.182.217
  169.239.217.22
@@ -39479,12 +33045,10 @@
  169.255.136.14
  169.255.136.8
  169.255.139.10
-169.255.184.29
  169.255.189.57
  169.255.190.18
  169.255.222.227
  169.255.234.166
-169.255.26.53
  169.255.6.26
  169.255.68.148
  169.255.75.117
@@ -39494,7 +33058,6 @@
  169.48.152.135
  169.48.163.176
  169.48.179.124
-169.48.252.42
  169.48.252.52
  169.48.94.101
  169.50.3.171
@@ -39505,12 +33068,10 @@
  169.53.164.127
  169.54.173.210
  169.55.103.85
+169.55.132.212
  169.55.151.117
  169.56.71.180
  169.56.71.185
-169.57.128.136
-169.57.181.110
-169.57.196.86
  169.60.128.104
  169.62.84.7
  16acc1ba3b3001611.temporary.link
@@ -39521,18 +33082,14 @@
  17.5studio.eu
  170.0.113.38
  170.0.126.252
-170.0.190.5
  170.0.202.6
  170.0.203.0
  170.0.203.117
-170.0.36.106
  170.0.37.156
  170.0.52.146
  170.0.52.226
  170.0.52.29
  170.0.52.6
-170.10.240.246
-170.106.104.152
  170.106.151.211
  170.106.155.8
  170.106.3.225
@@ -39541,114 +33098,15 @@
  170.106.34.74
  170.106.35.36
  170.106.35.43
-170.106.36.137
-170.106.36.152
-170.106.36.178
-170.106.36.196
-170.106.36.200
-170.106.36.227
-170.106.36.232
-170.106.36.26
-170.106.36.31
-170.106.36.56
-170.106.36.63
-170.106.36.64
-170.106.36.87
-170.106.36.89
-170.106.36.97
-170.106.37.110
-170.106.37.121
-170.106.37.136
-170.106.37.143
-170.106.37.186
-170.106.37.189
-170.106.37.194
-170.106.37.222
-170.106.37.231
-170.106.37.251
-170.106.37.4
-170.106.37.63
-170.106.38.155
-170.106.38.159
-170.106.38.178
-170.106.38.182
-170.106.38.205
-170.106.38.214
-170.106.38.23
-170.106.38.241
-170.106.38.36
-170.106.38.45
-170.106.38.8
-170.106.38.84
-170.106.38.97
  170.106.39.246
  170.106.5.200
-170.106.64.219
-170.106.64.65
-170.106.65.90
-170.106.67.19
-170.106.67.243
-170.106.67.55
-170.106.72.214
-170.106.74.169
-170.106.74.243
-170.106.74.33
-170.106.76.105
-170.106.76.152
-170.106.76.163
-170.106.76.171
-170.106.76.194
-170.106.76.219
-170.106.76.22
-170.106.76.4
-170.106.76.40
-170.106.76.57
-170.106.76.81
-170.106.80.142
-170.106.80.169
-170.106.80.172
-170.106.80.52
-170.106.80.86
-170.106.81.113
-170.106.81.117
-170.106.81.129
-170.106.81.157
-170.106.81.188
-170.106.81.19
-170.106.81.211
-170.106.81.217
-170.106.81.221
-170.106.81.231
-170.106.81.247
-170.106.81.25
-170.106.81.251
-170.106.81.28
-170.106.81.36
-170.106.81.53
-170.106.84.100
-170.106.84.58
-170.106.84.83
  170.130.126.96
  170.130.172.40
  170.130.172.42
-170.130.187.10
-170.130.187.14
-170.130.187.18
-170.130.187.2
  170.130.187.22
-170.130.187.26
-170.130.187.30
-170.130.187.34
-170.130.187.38
-170.130.187.42
-170.130.187.46
-170.130.187.50
-170.130.187.54
-170.130.187.58
-170.130.187.6
  170.130.205.117
-170.130.205.119
  170.130.29.160
+170.130.29.162
  170.130.31.177
  170.130.55.65
  170.130.58.166
@@ -39664,6 +33122,7 @@
  170.150.101.66
  170.150.101.69
  170.150.102.17
+170.150.103.182
  170.150.52.210
  170.150.52.5
  170.150.52.65
@@ -39675,8 +33134,6 @@
  170.177.253.26
  170.177.253.32
  170.185.68.14
-170.199.77.67
-170.199.81.81
  170.210.121.208
  170.210.136.56
  170.210.176.254
@@ -39689,55 +33146,44 @@
  170.210.4.222
  170.210.71.10
  170.210.83.119
-170.231.160.68
-170.231.163.229
  170.231.187.209
  170.231.232.97
-170.231.247.151
  170.231.56.3
-170.231.59.5
  170.233.117.110
  170.233.30.33
-170.233.51.245
  170.233.69.179
+170.233.69.27
  170.238.117.187
  170.238.119.77
  170.238.141.101
+170.238.143.210
  170.238.156.30
  170.238.255.90
-170.238.74.20
  170.238.74.61
  170.239.108.10
  170.239.108.6
  170.239.108.74
-170.239.128.7
  170.239.148.166
  170.239.204.241
  170.239.47.251
-170.239.84.130
  170.239.84.143
  170.239.84.205
-170.239.85.60
  170.244.0.178
  170.244.0.179
-170.244.0.206
  170.244.106.238
  170.244.17.205
  170.244.188.26
-170.244.188.39
  170.244.44.51
+170.244.5.214
  170.244.64.12
  170.244.64.129
  170.244.64.130
  170.244.64.198
  170.244.64.225
-170.244.72.175
-170.244.72.205
+170.244.7.148
  170.244.88.67
-170.245.127.172
  170.245.200.100
-170.245.244.70
-170.245.249.13
+170.245.66.12
  170.246.107.39
  170.246.3.242
  170.246.69.27
@@ -39746,46 +33192,37 @@
  170.246.85.108
  170.246.85.38
  170.246.85.9
-170.246.86.70
  170.247.1.130
  170.247.112.103
  170.247.112.121
  170.247.112.125
  170.247.112.171
  170.247.112.77
-170.247.158.23
  170.247.20.41
  170.247.200.1
  170.247.200.5
  170.247.202.95
  170.247.41.35
  170.247.43.142
-170.249.178.19
  170.249.191.114
-170.250.150.10
+170.250.251.130
  170.253.138.166
-170.253.41.13
  170.253.41.251
  170.253.50.199
  170.254.148.94
+170.254.193.135
  170.254.224.7
-170.254.226.145
  170.254.226.157
-170.254.230.186
  170.254.248.61
  170.254.87.18
-170.254.87.22
+170.55.134.174
  170.75.149.14
  170.75.150.50
  170.75.162.211
  170.75.162.97
-170.78.232.96
  170.78.37.7
-170.78.38.3
  170.78.38.96
  170.78.39.132
-170.78.39.3
-170.78.39.54
  170.78.39.58bin.sh
  170.78.6.130
  170.78.96.1
@@ -39798,28 +33235,26 @@
  170.79.181.74
  170.79.181.82
  170.79.233.162
-170.79.85.224
  170.79.87.178
  170.79.9.54
  170.79.91.98
-170.79.94.181
-170.79.97.29
-170.79.97.30
+170.80.204.224
  170.80.204.245
+170.80.204.31
+170.80.204.34
  170.80.204.39
+170.80.204.8
  170.80.206.199
-170.80.207.23
  170.80.207.24
  170.80.207.25
-170.80.207.26
+170.80.207.29
  170.80.207.47
-170.80.207.77
+170.80.207.75
  170.80.225.172
  170.80.36.150
  170.80.36.2
-170.80.42.115
+170.80.42.60
  170.80.49.114
-170.80.51.206
  170.80.68.242
  170.80.70.185
  170.80.91.1
@@ -39834,8 +33269,6 @@
  170.81.140.79
  170.81.141.249
  170.81.141.254
-170.81.141.37
-170.81.19.38
  170.81.231.150
  170.81.34.54
  170.81.35.26
@@ -39843,38 +33276,36 @@
  170.81.48.2
  170.81.92.102
  170.81.93.44
-170.82.184.189
  170.82.192.186
-170.82.194.163
  170.82.201.0
  170.82.52.48
  170.82.54.39
-170.82.7.250
  170.83.115.4
  170.83.124.166
  170.83.156.14
  170.83.176.121
+170.83.176.135
+170.83.176.136
  170.83.176.246
+170.83.176.32
  170.83.176.47
  170.83.176.57
-170.83.177.182
+170.83.176.8
  170.83.178.100
  170.83.178.130
  170.83.178.193
-170.83.178.200
  170.83.178.45
  170.83.178.61
-170.83.178.72
  170.83.178.86
  170.83.179.179
  170.83.199.9
-170.83.47.1
  170.84.183.196
  170.84.183.252
  170.84.224.240
  170.84.48.105
  170.84.48.106
  170.84.48.118
+170.84.48.171
  170.84.48.206
  170.84.48.216
  170.84.48.230
@@ -39885,113 +33316,82 @@
  1700restaurant.com
  1702525-dot-n-e-w-me-ss-age-po-rt-al.wl.r.appspot.com
  171.100.102.154
-171.100.58.6
  171.100.59.34
  171.100.8.82
  171.100.9.126
-171.101.53.173
+171.101.130.241
  171.101.95.159
  171.103.138.206
  171.103.180.10
  171.103.185.238
  171.103.190.86
+171.103.197.10
+171.103.197.118
+171.103.197.18
  171.103.197.46
-171.103.199.202
+171.103.200.46
  171.103.32.202
  171.103.9.22
  171.104.126.183
-171.106.31.221
-171.107.184.195
-171.107.73.221
-171.109.118.40
-171.109.5.102
-171.11.109.57
+171.107.184.213
  171.110.231.214
-171.111.153.150
-171.111.153.151
  171.111.183.16
  171.112.45.160
-171.112.96.226
  171.113.40.47
+171.113.43.200
  171.114.121.150
  171.118.24.229
-171.119.123.207
-171.119.156.163
+171.119.197.33
  171.119.209.26
  171.119.223.219
  171.120.163.207
  171.120.211.131
  171.121.122.102
-171.121.123.88
-171.122.46.224
  171.123.109.137
  171.123.120.177
  171.123.147.2
  171.123.15.218
-171.123.237.20
  171.123.30.30
-171.124.78.58
  171.125.108.141
  171.125.16.140
+171.125.19.140
  171.125.195.122
  171.125.227.108
+171.125.24.71
  171.125.248.228
  171.125.250.15
  171.125.29.211
-171.125.39.221
  171.125.40.182
  171.125.50.111
  171.125.50.166
  171.125.72.177
-171.125.82.146
  171.125.96.61
-171.126.32.178
-171.126.44.183
-171.13.138.173
-171.15.132.54
-171.15.16.116
  171.15.17.161
-171.211.199.124
  171.211.92.134
  171.212.103.245
  171.212.200.233
  171.216.84.35
  171.217.59.251
-171.217.92.33
-171.22.121.47
-171.22.122.232
  171.22.123.151
  171.22.123.222
  171.22.123.37
  171.22.123.68
  171.22.24.185
  171.22.253.101
+171.22.253.104
  171.22.253.189
  171.22.255.146
  171.22.255.170
-171.22.255.29
  171.22.255.9
-171.220.191.53
  171.221.147.140
-171.221.199.187
-171.221.2.205
  171.221.200.175
-171.221.209.252
  171.221.210.158
  171.221.217.145
-171.221.236.226
-171.221.242.23
-171.221.247.94
  171.221.43.220
  171.223.111.237
-171.223.210.8
-171.223.215.215
-171.223.90.193
  171.224.227.223
  171.224.76.182
-171.224.9.216
  171.226.1.95
-171.226.104.29
  171.226.2.66
  171.226.2.69
  171.226.4.233
@@ -40010,6 +33410,11 @@
  171.227.22.120
  171.227.24.115
  171.227.24.135
+171.229.109.176
+171.229.221.128
+171.229.235.108
+171.229.247.168
+171.231.135.107
  171.232.242.174
  171.232.243.232
  171.232.244.161
@@ -40017,45 +33422,41 @@
  171.232.246.0
  171.232.246.19
  171.232.246.202
+171.233.26.6
+171.234.74.58
  171.235.52.96
  171.235.53.55
  171.235.55.149
  171.235.58.41
  171.235.59.30
  171.235.60.45
-171.235.61.139
  171.235.61.48
-171.235.71.236
  171.235.81.42
  171.235.83.135
  171.235.84.21
  171.235.86.141
  171.235.86.165
-171.236.129.81
  171.236.159.141
+171.236.197.137
  171.236.82.26
+171.236.82.31
  171.237.144.242
-171.237.151.80
-171.237.213.169
-171.238.37.109
-171.238.97.8
-171.239.176.47
+171.238.29.68
  171.239.248.116
-171.239.248.98
  171.239.249.229
+171.239.250.213
  171.239.251.86
+171.239.252.159
  171.239.252.94
  171.239.253.207
  171.239.253.228
+171.239.255.149
  171.239.255.165
  171.239.255.56
-171.239.89.24
  171.240.131.132
  171.240.192.104
-171.240.192.30
  171.240.194.4
  171.240.194.8
-171.240.195.10
  171.240.195.199
  171.240.195.85
  171.240.197.140
@@ -40065,36 +33466,40 @@
  171.240.198.86
  171.240.199.65
  171.240.202.121
+171.240.203.177
  171.240.207.62
+171.240.46.221
  171.241.15.21
  171.241.23.227
  171.241.3.211
+171.241.51.214
  171.242.35.92
  171.242.52.39
+171.244.0.81
  171.244.1.84
  171.244.139.178
  171.244.139.236
-171.244.139.243
  171.244.139.67
  171.244.140.174
  171.244.142.202
  171.244.142.42
+171.244.16.85
  171.244.18.14
+171.244.19.212
  171.244.22.17
  171.244.38.56
  171.244.45.137
  171.244.48.33
  171.244.49.242
  171.244.51.114
+171.245.5.172
+171.246.113.60
  171.246.66.105
  171.247.101.187
  171.247.103.109
  171.247.103.164
-171.247.162.166
  171.247.210.197
-171.248.238.13
  171.249.137.255
-171.249.137.5
  171.249.139.216
  171.25.193.131
  171.25.193.20
@@ -40103,11 +33508,7 @@
  171.25.193.77
  171.25.193.78
  171.25.209.203
-171.250.115.211
-171.250.123.220
-171.250.39.151
  171.250.60.77
-171.251.159.3
  171.251.16.254
  171.251.18.17
  171.251.19.125
@@ -40118,6 +33519,7 @@
  171.251.24.172
  171.251.26.127
  171.251.26.247
+171.251.26.250
  171.251.27.188
  171.251.27.202
  171.251.27.55
@@ -40125,10 +33527,6 @@
  171.251.31.158
  171.251.31.242
  171.251.31.4
-171.252.126.95
-171.252.189.7
-171.254.10.34
-171.254.209.12
  171.254.227.249
  171.255.199.129
  171.34.113.168
@@ -40136,50 +33534,44 @@
  171.34.115.20
  171.34.115.207
  171.34.173.17
-171.34.176.251
+171.34.176.159
  171.34.176.34
  171.34.177.28
  171.34.178.93
-171.34.42.155
+171.34.179.192
  171.34.70.28
  171.34.78.119
-171.35.162.144
+171.35.161.31
+171.35.161.43
  171.35.162.21
-171.35.163.203
  171.35.163.244
-171.35.166.101
-171.35.167.241
+171.35.168.172
+171.35.168.193
  171.35.168.74
  171.35.168.80
-171.35.169.112
-171.35.169.181
-171.35.169.35
+171.35.169.194
  171.35.169.76
-171.35.169.80
  171.35.170.35
  171.35.170.80
  171.35.171.161
  171.35.171.208
-171.35.171.54
-171.35.173.158
  171.35.173.64
  171.36.146.116
-171.36.182.72
-171.38.147.243
-171.38.18.84
-171.38.218.126
-171.38.68.237
+171.38.145.65
+171.38.149.14
+171.38.192.139
+171.38.192.244
+171.38.74.113
  171.4.240.33
  171.42.161.164bin.sh
-171.42.50.2
  171.43.175.85
+171.5.160.63
  171.5.161.223
  171.5.163.67
  171.5.165.167
-171.5.165.54
+171.5.166.147
  171.5.166.190
  171.5.166.28
-171.5.167.143
  171.5.228.228
  171.5.27.88
  171.5.85.151
@@ -40188,27 +33580,26 @@
  171.6.50.17
  171.7.14.208
  171.7.42.58
-171.7.64.29
+171.76.7.22
+171.8.134.202
+171.8.135.68
  171.8.196.129
  171.8.6.111
  171.8.8.59
  171.80.185.43
  171.80.186.243
-171.80.242.107
  171.84.2.6
-171.84.3.43
  171.88.53.108
-171.90.251.167
-171.90.251.169
-171.90.6.187
+171.91.243.21
  171.96.247.18
  171.97.107.141
  171.97.122.123
  171.97.122.215
  171.97.129.201
+171.97.217.239
  171.97.33.116
-171.97.36.195
  171.97.67.59
+171.97.85.205
  171.98.69.214
  171.98.73.6
  171298-dot-n-e-w-me-ss-age-po-rt-al.wl.r.appspot.com
@@ -40217,35 +33608,22 @@
  172.103.211.146
  172.104.108.126
  172.104.108.70
-172.104.109.160
  172.104.109.205
-172.104.109.88
  172.104.110.107
  172.104.111.181
  172.104.112.110
  172.104.112.161
-172.104.112.244
-172.104.116.36
-172.104.116.44
-172.104.118.175
  172.104.120.61
-172.104.122.237
-172.104.124.169
-172.104.124.229
-172.104.125.180
  172.104.125.36
  172.104.125.55
  172.104.127.123
  172.104.134.52
  172.104.135.188
  172.104.138.222
-172.104.139.66
  172.104.140.179
  172.104.143.34
-172.104.15.219
  172.104.151.93
  172.104.152.224
-172.104.154.134
  172.104.154.25
  172.104.154.29
  172.104.159.202
@@ -40268,20 +33646,19 @@
  172.104.180.44
  172.104.181.119
  172.104.182.103
-172.104.184.235
+172.104.185.31
  172.104.186.166
+172.104.187.50
  172.104.191.206
  172.104.208.218
  172.104.209.142
  172.104.210.175
  172.104.212.199
-172.104.213.182
  172.104.214.199
  172.104.215.170
  172.104.215.48
  172.104.217.210
  172.104.217.224
-172.104.219.143
  172.104.224.21
  172.104.227.51
  172.104.233.225
@@ -40290,14 +33667,12 @@
  172.104.239.8
  172.104.24.110
  172.104.240.81
-172.104.242.173
  172.104.25.117
  172.104.25.158
  172.104.251.75
  172.104.253.228
  172.104.27.206
-172.104.29.61
-172.104.30.146
+172.104.32.253
  172.104.33.72
  172.104.35.203
  172.104.35.46
@@ -40317,55 +33692,36 @@
  172.104.63.159
  172.104.65.126
  172.104.65.176
-172.104.65.226
  172.104.68.108
  172.104.7.181
  172.104.75.136
-172.104.76.217
-172.104.82.225
  172.104.9.251
  172.104.90.95
  172.104.92.108
  172.104.92.138
-172.104.92.168
-172.104.92.209
-172.104.94.253
  172.104.96.149
  172.104.98.243
-172.105.0.195
  172.105.0.241
  172.105.102.124
  172.105.102.93
  172.105.103.11
-172.105.103.153
-172.105.103.158
-172.105.103.83
  172.105.105.174
  172.105.105.55
-172.105.105.87
-172.105.106.64
  172.105.107.134
-172.105.11.150
-172.105.11.170
  172.105.11.88
+172.105.113.69
  172.105.120.76
-172.105.122.57
  172.105.126.56
-172.105.13.127
  172.105.13.165
  172.105.13.31
  172.105.13.66
-172.105.13.75
  172.105.148.57
  172.105.15.118
-172.105.15.33
  172.105.15.70
  172.105.155.137
  172.105.155.211
  172.105.156.16
  172.105.157.81
-172.105.16.137
-172.105.16.42
  172.105.16.93
  172.105.161.96
  172.105.169.117
@@ -40395,40 +33751,27 @@
  172.105.188.191
  172.105.191.116
  172.105.192.152
-172.105.197.151
  172.105.197.157
  172.105.20.100
  172.105.200.179
  172.105.200.40
-172.105.207.40
  172.105.21.16
  172.105.21.216
-172.105.210.107
  172.105.213.30
  172.105.213.36
  172.105.216.76
-172.105.217.71
-172.105.219.236
  172.105.221.73
  172.105.224.137
-172.105.224.78
-172.105.225.204
-172.105.226.61
  172.105.232.203
-172.105.239.183
-172.105.24.105
  172.105.24.200
  172.105.241.190
  172.105.242.140
  172.105.247.88
  172.105.26.181
  172.105.27.218
-172.105.28.152
  172.105.28.192
  172.105.28.64
-172.105.28.83
  172.105.28.96
-172.105.29.176
  172.105.3.67
  172.105.33.148
  172.105.35.249
@@ -40437,8 +33780,6 @@
  172.105.37.98
  172.105.38.103
  172.105.4.158
-172.105.40.13
-172.105.40.85
  172.105.42.61
  172.105.42.93
  172.105.43.143
@@ -40446,7 +33787,6 @@
  172.105.47.179
  172.105.47.82
  172.105.49.146
-172.105.52.207
  172.105.54.175
  172.105.55.193
  172.105.55.198
@@ -40470,113 +33810,57 @@
  172.105.81.174
  172.105.87.200
  172.105.89.150
-172.105.89.161
  172.105.9.197
  172.105.90.171
-172.105.91.100
  172.105.91.109
  172.105.95.10
-172.105.96.211
  172.105.96.80
-172.105.97.26
  172.105.98.119
  172.105.98.240
-172.105.98.26
  172.106.0.67
  172.106.18.236
  172.106.88.4
+172.107.1.105
  172.107.1.163
+172.107.1.249
+172.107.1.44
+172.107.1.83
  172.107.1.89
  172.107.194.103
-172.107.199.18
-172.107.202.66
  172.107.51.66
-172.107.94.66
-172.107.95.30
  172.11.130.230
-172.110.30.81
-172.111.192.141
-172.113.11.218
-172.113.124.84
-172.113.229.200
  172.114.161.190
-172.114.72.186
  172.114.84.139
-172.115.51.194
-172.116.84.144
-172.117.74.75
-172.119.196.96
-172.120.80.242
-172.124.39.100
  172.124.6.152
-172.125.131.67
-172.125.131.74
  172.125.174.154
  172.125.40.123
-172.126.100.253
  172.168.54.2.transfereunits.com
-172.172.23.204
-172.172.23.205
-172.172.23.208
-172.172.23.213
-172.172.23.214
-172.172.26.136
-172.172.26.140
-172.172.26.145
-172.172.26.146
-172.172.26.148
-172.172.26.150
-172.172.26.156
-172.172.26.157
-172.172.26.160
-172.172.26.164
-172.172.26.167
-172.172.26.168
-172.172.30.11
-172.172.30.132
-172.172.30.133
-172.172.30.134
-172.172.30.138
-172.172.30.143
-172.172.30.145
-172.172.30.148
-172.172.30.149
-172.172.30.152
-172.172.30.156
-172.172.30.159
-172.172.30.198
-172.172.30.210
-172.172.30.211
-172.172.30.212
-172.172.30.5
-172.172.30.6
-172.172.30.7
  172.193.53.87
  172.218.182.132
-172.218.53.85
  172.220.172.114
+172.220.197.91
+172.221.10.200
  172.221.36.34
+172.222.157.91
  172.223.66.113
  172.241.129.124
+172.241.243.208
  172.245.10.158
  172.245.10.85
  172.245.100.220
-172.245.100.245
  172.245.100.65
  172.245.104.116
  172.245.104.118
  172.245.105.103
-172.245.106.249
  172.245.110.114
  172.245.110.143
  172.245.112.72
  172.245.124.12
  172.245.135.133
-172.245.153.123
  172.245.154.107
  172.245.158.114
  172.245.158.131
-172.245.16.118
+172.245.179.148
  172.245.179.52
  172.245.179.53
  172.245.181.157
@@ -40584,6 +33868,8 @@
  172.245.181.246
  172.245.184.199
  172.245.185.165
+172.245.191.134
+172.245.196.218
  172.245.205.137
  172.245.208.135
  172.245.208.174
@@ -40601,16 +33887,17 @@
  172.245.224.149
  172.245.224.155
  172.245.224.93
+172.245.228.28
  172.245.228.29
  172.245.228.72
  172.245.228.83
  172.245.228.86
  172.245.230.134
  172.245.230.148
+172.245.230.155
  172.245.230.158
  172.245.230.162
  172.245.24.161
-172.245.242.177
  172.245.244.25
  172.245.244.28
  172.245.248.239
@@ -40619,9 +33906,9 @@
  172.245.253.52
  172.245.253.53
  172.245.253.56
-172.245.254.140
  172.245.254.18
  172.245.254.38
+172.245.40.123
  172.245.40.219
  172.245.41.218
  172.245.41.220
@@ -40639,26 +33926,17 @@
  172.245.64.214
  172.245.64.237
  172.245.64.250
+172.245.64.253
  172.245.7.103
  172.245.7.189
-172.245.71.145
-172.245.79.179
  172.245.8.131
  172.245.8.9
  172.245.82.13
-172.245.87.62
  172.245.92.147
  172.245.97.184
-172.247.193.226
-172.247.246.144
-172.247.31.90
-172.248.13.224
  172.249.112.51
  172.249.171.9
-172.250.164.215
  172.250.245.251
-172.252.15.130
-172.252.242.58
  172.254.154.243
  172.255.125.138
  172.255.80.133
@@ -40666,7 +33944,6 @@
  172.255.81.110
  172.255.81.247
  172.255.81.6
-172.255.81.65
  172.255.81.68
  172.255.81.8
  172.255.82.118
@@ -40680,20 +33957,20 @@
  172.255.83.116
  172.255.83.14
  172.255.83.171
+172.255.83.21
  172.255.83.30
  172.255.83.38
  172.255.83.42
  172.255.83.96
  172.58.188.27
-172.58.203.23
  172.58.92.102
-172.68.10.146
-172.68.10.204
-172.68.10.22
+172.68.10.14
+172.68.10.197
+172.68.10.228
  172.68.10.38
  172.68.11.207
-172.68.132.55
-172.68.141.56
+172.68.11.49
+172.68.11.71
  172.68.144.140
  172.68.144.144
  172.68.146.133
@@ -40702,43 +33979,39 @@
  172.68.146.175
  172.68.146.199
  172.68.146.253
-172.68.182.100
  172.68.211.5
  172.68.238.130
-172.68.238.138
-172.68.238.142
+172.68.238.143
+172.68.238.144
+172.68.238.146
  172.68.238.228
-172.68.238.238
  172.68.238.246
  172.68.239.10
-172.68.239.120
+172.68.239.119
  172.68.239.125
-172.68.239.137
  172.68.239.139
-172.68.239.161
-172.68.239.173
  172.68.239.215
+172.68.239.221
  172.68.239.227
  172.68.239.231
  172.68.239.232
  172.68.239.55
-172.68.239.7
-172.68.244.102
  172.68.244.162
-172.68.245.7
-172.68.246.134
+172.68.244.250
+172.68.246.132
  172.68.246.230
-172.68.246.32
+172.68.246.24
  172.68.46.192
+172.68.62.158
+172.68.94.22
  172.69.10.124
-172.69.10.148
-172.69.10.158
  172.69.10.159
-172.69.10.183
+172.69.10.179
+172.69.10.182
  172.69.10.184
-172.69.10.22
+172.69.10.190
+172.69.10.198
  172.69.10.46
-172.69.10.76
  172.69.134.146
  172.69.134.182
  172.69.135.231
@@ -40751,38 +34024,39 @@
  172.69.138.24
  172.69.138.42
  172.69.138.6
+172.69.190.14
+172.69.190.16
  172.69.190.22
-172.69.190.52
+172.69.190.32
  172.69.190.58
  172.69.190.64
  172.69.190.66
+172.69.190.68
+172.69.190.70
  172.69.190.72
  172.69.190.76
  172.69.194.27
  172.69.202.18
  172.69.202.6
  172.69.22.231
-172.69.33.105
-172.69.34.12
-172.69.55.62
-172.72.80.139
+172.69.33.31
+172.69.33.43
+172.69.34.180
+172.69.35.119
+172.69.54.177
  172.74.184.175
-172.74.238.64
-172.76.4.246
+172.81.129.126
  172.81.177.138
  172.81.182.34
  172.81.183.236
+172.81.203.33
  172.81.204.249
-172.81.204.58
  172.81.206.168
  172.81.208.125
  172.81.208.207
-172.81.208.50
  172.81.210.122
  172.81.210.134
-172.81.211.119
  172.81.211.207
-172.81.215.201
  172.81.226.22
  172.81.227.243
  172.81.234.10
@@ -40792,24 +34066,18 @@
  172.81.239.224
  172.81.240.237
  172.81.241.252
-172.81.241.92
-172.81.242.147
  172.81.242.40
  172.81.243.195
  172.81.251.217
  172.81.252.123
  172.81.253.133
-172.81.254.131
  172.82.128.202
  172.82.149.130
  172.82.149.234
  172.83.43.137
-172.83.45.187
-172.83.64.47
  172.84.114.20
  172.84.166.144
  172.84.243.226
-172.85.183.200
  172.86.120.215
  172.86.121.11
  172.86.186.21
@@ -40820,13 +34088,9 @@
  172.86.84.57
  172.87.1.41
  172.87.193.178
-172.87.28.153
  172.88.195.0
-172.88.54.147
-172.89.32.91
  172.90.13.91
  172.90.46.98
-172.90.97.132
  172.91.208.86
  172.92.205.8
  172.93.101.49
@@ -40834,19 +34098,14 @@
  172.93.120.184
  172.93.165.142
  172.93.165.166
-172.93.165.84
  172.93.166.12
  172.93.166.135
  172.93.189.123
  172.93.38.228
  172.93.39.189
-172.93.4.78
  172.93.40.173
  172.93.45.222
  172.93.49.142
-172.95.161.66
-172.95.161.71
-172.96.16.214
  172.96.161.244
  172.96.166.188
  172.96.176.129
@@ -40873,12 +34132,10 @@
  172.96.251.203
  172.96.254.108
  172.96.84.42
-172.96.92.212
-172.96.95.187
  172.98.153.29
  172.98.193.43
  172.98.193.62
-172.98.196.150
+172.98.64.135
  172.98.67.34
  172.98.67.59
  172.98.67.74
@@ -40895,16 +34152,15 @@
  172princessbet.com
  173.0.49.138
  173.0.52.241
-173.0.57.206
  173.10.184.69
  173.11.122.57
  173.11.150.73
+173.11.194.164
  173.12.0.170
  173.12.15.68
  173.12.157.141
  173.12.181.181
  173.13.139.133
-173.13.190.147
  173.13.234.122
  173.15.162.151
  173.15.162.156
@@ -40916,22 +34172,17 @@
  173.161.87.170
  173.163.39.49
  173.164.210.49
+173.164.81.21
  173.165.96.117
  173.166.196.185
-173.166.254.186
  173.167.226.57
  173.167.85.89
  173.173.254.105
-173.174.174.243
  173.174.181.12
  173.176.184.54
-173.177.165.194
  173.177.237.29
-173.177.32.179
-173.178.89.119
-173.179.72.169
-173.181.44.179
  173.182.141.43
+173.183.191.79
  173.184.104.166
  173.184.128.240
  173.190.106.54
@@ -40941,8 +34192,10 @@
  173.193.136.52
  173.193.219.168
  173.193.22.6
+173.195.15.206
+173.195.15.218
  173.195.15.33
-173.198.52.58
+173.198.226.98
  173.199.114.115
  173.199.114.171
  173.199.114.99
@@ -40960,15 +34213,22 @@
  173.199.143.137
  173.199.186.15
  173.199.71.150
-173.201.196.106
  173.201.196.116
-173.201.196.144
-173.201.196.175
+173.201.196.119
+173.201.196.145
+173.201.196.148
+173.201.196.169
+173.201.196.182
+173.201.196.2
  173.201.196.202
-173.201.196.60
+173.201.196.220
+173.201.196.59
+173.201.196.62
  173.201.196.63
  173.201.196.67
+173.201.196.68
  173.201.196.7
+173.201.196.96
  173.201.196.97
  173.201.31.88
  173.201.39.206
@@ -40998,7 +34258,6 @@
  173.208.168.194
  173.208.169.26
  173.208.169.42
-173.208.173.114
  173.208.176.146
  173.208.177.58
  173.208.177.59
@@ -41020,7 +34279,6 @@
  173.208.249.194
  173.208.46.67
  173.209.44.34
-173.21.9.59
  173.212.19.194
  173.212.192.195
  173.212.197.167
@@ -41053,10 +34311,8 @@
  173.212.231.228
  173.212.232.122
  173.212.232.190
-173.212.232.62
  173.212.235.121
  173.212.235.237
-173.212.236.144
  173.212.239.226
  173.212.240.54
  173.212.241.51
@@ -41068,16 +34324,16 @@
  173.212.252.65
  173.212.253.26
  173.212.254.171
+173.213.87.29
  173.213.96.68
  173.214.174.108
  173.214.181.39
  173.214.185.62
  173.216.245.75
  173.217.255.36
-173.218.133.118
  173.219.43.147
+173.219.72.14
  173.219.86.196
-173.220.199.42
  173.221.41.47
  173.225.104.57
  173.225.106.37
@@ -41103,6 +34359,7 @@
  173.232.226.210
  173.232.226.220
  173.232.226.94
+173.233.191.5
  173.233.72.96
  173.234.100.117
  173.234.100.146
@@ -41111,7 +34368,6 @@
  173.234.100.47
  173.234.100.58
  173.234.143.176
-173.234.151.144
  173.234.151.165
  173.234.151.193
  173.234.151.20
@@ -41121,6 +34377,7 @@
  173.234.153.122
  173.234.159.250
  173.234.194.101
+173.234.194.152
  173.234.194.63
  173.234.194.96
  173.234.196.18
@@ -41903,11 +35160,9 @@
  173.236.176.191
  173.236.176.198
  173.236.176.203
-173.236.176.205
  173.236.176.207
  173.236.176.211
  173.236.176.213
-173.236.176.24
  173.236.176.57
  173.236.176.60
  173.236.176.67
@@ -41915,11 +35170,9 @@
  173.236.177.122
  173.236.177.168
  173.236.177.176
-173.236.177.20
  173.236.177.50
  173.236.177.59
  173.236.177.78
-173.236.177.87
  173.236.178.116
  173.236.178.130
  173.236.178.148
@@ -41928,14 +35181,12 @@
  173.236.178.225
  173.236.178.230
  173.236.178.242
-173.236.178.59
  173.236.178.7
  173.236.178.71
  173.236.178.74
  173.236.178.76
  173.236.178.78
  173.236.179.101
-173.236.179.110
  173.236.179.128
  173.236.179.13
  173.236.179.132
@@ -41943,15 +35194,11 @@
  173.236.179.22
  173.236.179.224
  173.236.179.52
-173.236.179.96
-173.236.180.105
-173.236.180.108
  173.236.180.116
  173.236.180.13
  173.236.180.138
  173.236.180.184
  173.236.180.208
-173.236.180.211
  173.236.180.241
  173.236.180.242
  173.236.180.248
@@ -41988,12 +35235,11 @@
  173.236.255.123
  173.236.61.20
  173.237.189.15
-173.238.92.97
  173.239.16.148
  173.239.3.93
  173.239.33.85
  173.239.33.90
-173.240.36.111
+173.24.53.227
  173.242.112.93
  173.242.116.219
  173.242.118.66
@@ -42009,13 +35255,13 @@
  173.244.209.5
  173.244.36.48
  173.244.48.66
-173.245.52.197
+173.245.202.145
+173.245.203.81
  173.246.13.149
  173.246.39.180
  173.246.39.185
  173.247.228.10
  173.247.239.186
-173.248.226.20
  173.248.241.176
  173.248.241.78
  173.248.242.102
@@ -42024,7 +35270,6 @@
  173.249.0.140
  173.249.0.235
  173.249.1.160
-173.249.14.102
  173.249.2.204
  173.249.2.209
  173.249.2.32
@@ -42045,7 +35290,7 @@
  173.249.42.183
  173.249.42.83
  173.249.44.230
-173.249.45.206
+173.249.44.88
  173.249.45.75
  173.249.46.22
  173.249.46.244
@@ -42067,14 +35312,11 @@
  173.249.60.9
  173.249.7.254
  173.249.8.112
+173.249.8.56
  173.249.9.243
  173.249.9.82
-173.252.18.240
-173.252.208.10
-173.252.25.66
  173.254.192.180
  173.254.198.229
-173.254.201.197
  173.254.204.67
  173.254.204.69
  173.254.204.89
@@ -42083,31 +35325,24 @@
  173.254.222.170
  173.254.225.107
  173.254.225.112
-173.254.225.12
  173.254.225.123
-173.254.225.31
  173.254.225.82
-173.254.225.98
-173.254.225.99
  173.254.233.155
  173.254.242.215
  173.254.250.14
  173.254.87.47
  173.255.115.135
-173.255.192.249
  173.255.193.118
  173.255.193.235
  173.255.197.68
  173.255.199.69
  173.255.204.124
-173.255.209.105
  173.255.209.39
  173.255.210.152
  173.255.218.244
  173.255.219.80
  173.255.224.28
  173.255.224.51
-173.255.228.200
  173.255.233.124
  173.255.236.146
  173.255.236.182
@@ -42116,33 +35351,27 @@
  173.255.240.205
  173.255.248.135
  173.255.250.144
-173.27.39.32
+173.29.209.17
+173.3.31.132
  173.30.96.81
  173.31.204.211
-173.32.178.208
-173.32.68.145
-173.33.12.215
-173.33.240.246
-173.33.65.93
  173.35.147.204
  173.44.123.163
  173.44.152.58
  173.44.153.119
  173.44.153.251
-173.44.165.104
-173.44.165.122
+173.44.165.133
  173.44.165.155
  173.44.165.208
  173.44.165.227
  173.44.165.241
  173.44.165.82
-173.44.165.90
+173.44.165.83
  173.44.166.110
  173.44.166.127
-173.44.166.135
-173.44.166.251
-173.44.166.6
  173.44.166.82
+173.44.166.95
+173.44.167.128
  173.44.167.73
  173.44.167.82
  173.44.167.93
@@ -42151,16 +35380,14 @@
  173.44.223.19
  173.44.223.209
  173.44.223.218
-173.44.223.227
  173.44.223.248
  173.44.223.27
  173.44.223.39
  173.44.223.4
-173.44.223.66
-173.44.223.94
  173.44.227.13
+173.44.227.176
  173.44.227.2
-173.44.227.56
+173.44.227.202
  173.44.227.62
  173.44.34.106
  173.44.41.248
@@ -42179,13 +35406,9 @@
  173.49.88.102
  173.51.177.2
  173.52.95.134
-173.52.97.25
-173.56.121.34
  173.56.92.166
  173.59.224.21
  173.59.247.22
-173.61.181.109
-173.61.88.14
  173.62.236.28
  173.62.253.103
  173.63.104.87
@@ -42194,29 +35417,23 @@
  173.63.97.174
  173.64.72.247
  173.67.202.245
-173.68.173.104
  173.68.185.170
-173.68.20.72
  173.69.174.252
  173.70.12.86
+173.72.175.47
  173.73.115.178
  173.73.137.214
  173.74.84.197
  173.74.84.198
-173.75.237.182
-173.76.131.114
  173.76.247.48
  173.76.250.239
  173.76.31.75
  173.77.219.252
-173.77.7.84
  173.78.219.97
  173.79.107.81
  173.79.160.55
  173.79.252.210
  173.8.134.217
-173.8.236.179
-173.8.46.73
  173.81.218.65
  173.82.105.129
  173.82.119.161
@@ -42236,7 +35453,6 @@
  173.82.143.219
  173.82.180.220
  173.82.193.75
-173.82.196.148
  173.82.219.139
  173.82.22.102
  173.82.22.110
@@ -42247,6 +35463,7 @@
  173.82.22.82
  173.82.22.86
  173.82.22.89
+173.82.232.135
  173.82.243.17
  173.82.243.98
  173.82.255.36
@@ -42262,8 +35479,8 @@
  173.82.97.232
  173.82.97.235
  173.82.97.243
-173.89.22.94
  173.89.28.137
+173.9.150.249
  173.91.11.142
  173.94.183.76
  173.94.215.84
@@ -42275,11 +35492,10 @@
  174-365.net
  174.0.252.47
  174.0.79.91
-174.1.69.54
+174.1.55.251
  174.100.141.37
  174.100.209.2
  174.100.27.229
-174.100.35.151
  174.102.48.180
  174.104.92.172
  174.105.149.112
@@ -42289,11 +35505,9 @@
  174.110.88.87
  174.111.19.140
  174.112.205.57
-174.113.167.27
  174.113.69.136
  174.114.102.41
  174.115.44.214
-174.117.229.132
  174.117.241.235
  174.118.202.24
  174.120.14.42
@@ -42303,18 +35517,17 @@
  174.122.153.66
  174.123.174.34
  174.123.86.2
+174.124.140.169
  174.125.13.169
  174.125.3.152
  174.125.33.241
  174.125.4.14
-174.126.106.138
  174.127.120.35
  174.127.155.118
  174.127.68.49
  174.128.226.101
  174.128.235.243
  174.128.245.209
-174.128.97.199
  174.129.10.127
  174.129.107.95
  174.129.116.139
@@ -42357,13 +35570,12 @@
  174.138.190.233
  174.138.2.114
  174.138.20.105
-174.138.21.0
  174.138.22.37
  174.138.22.97
  174.138.26.171
  174.138.27.165
  174.138.3.159
-174.138.3.81
+174.138.30.233
  174.138.32.113
  174.138.32.22
  174.138.33.122
@@ -42385,7 +35597,6 @@
  174.138.44.201
  174.138.44.34
  174.138.46.137
-174.138.46.240
  174.138.47.227
  174.138.47.35
  174.138.48.84
@@ -42454,15 +35665,11 @@
  174.143.150.20
  174.143.173.119
  174.153.42.217
-174.17.65.204
-174.2.180.201
  174.20.113.180
  174.21.92.42
  174.219.136.142
-174.235.132.91
  174.24.83.84
  174.28.98.165
-174.3.106.45
  174.3.14.10
  174.3.197.218
  174.30.7.253
@@ -42471,8 +35678,6 @@
  174.36.149.83
  174.37.231.112
  174.37.60.226
-174.4.112.92
-174.4.137.104
  174.4.47.130
  174.45.13.118
  174.48.180.23
@@ -42480,21 +35685,18 @@
  174.51.16.33
  174.52.101.82
  174.52.145.246
-174.52.255.98
  174.57.211.200
-174.59.111.141
  174.59.16.76
  174.59.3.38
  174.59.9.9
  174.6.100.50
-174.63.161.120
  174.63.56.150
  174.64.199.79
  174.64.199.82
-174.67.239.42
-174.69.255.208
+174.66.233.44
  174.7.185.78
  174.7.29.42
+174.70.203.3
  174.70.241.10
  174.70.241.14
  174.70.241.17
@@ -42502,10 +35704,8 @@
  174.70.241.27
  174.70.241.7
  174.70.241.8
-174.71.159.170
  174.71.60.232
  174.73.196.196
-174.74.142.43
  174.75.211.222
  174.76.35.7
  174.76.48.225
@@ -42514,6 +35714,7 @@
  174.76.48.232
  174.76.48.233
  174.76.48.235
+174.76.48.237
  174.76.48.246
  174.76.48.249
  174.76.48.251
@@ -42522,17 +35723,15 @@
  174.77.111.197
  174.79.53.21
  174.81.229.190
+174.82.219.6
  174.84.183.72
  174.85.153.0
  174.85.45.37
-174.85.6.114
+174.86.177.92
  174.86.203.236
-174.86.63.178
  174.87.100.122
-174.87.36.71
  174.88.135.210
  174.88.142.129
-174.88.143.68
  174.88.159.10
  174.88.165.121
  174.88.178.92
@@ -42540,19 +35739,16 @@
  174.89.183.25
  174.89.185.50
  174.91.5.72
-174.91.89.231
-174.92.226.162
  174.93.210.51
+174.93.53.225
  174.94.101.110
  174.94.155.224
  174.95.178.64
  175-365.net
  175.0.165.166
-175.0.235.83
  175.10.144.100
  175.10.144.174
  175.10.145.138
-175.10.25.210
  175.10.72.235
  175.10.73.208
  175.100.103.132
@@ -42561,20 +35757,17 @@
  175.100.16.20
  175.100.18.45
  175.100.181.190
-175.100.185.148
  175.100.30.156
  175.100.47.144
-175.100.5.52
  175.100.72.95
  175.100.73.206
-175.100.74.202
  175.100.86.17
  175.101.117.8
  175.101.13.125
  175.101.9.50
  175.102.16.120
-175.102.8.25
  175.103.38.146
+175.103.39.35
  175.103.47.1
  175.106.10.226
  175.106.12.182
@@ -42588,47 +35781,38 @@
  175.107.185.3
  175.107.195.21
  175.107.200.187
-175.107.201.182
  175.107.206.134
  175.107.212.187
  175.107.216.42
-175.107.218.226
  175.11.192.170
  175.11.192.189
  175.11.193.10
  175.11.194.56
  175.11.195.108
-175.11.195.70
  175.11.195.90
  175.11.216.105
-175.11.216.50
-175.11.64.169
+175.11.216.115
  175.11.64.170
  175.11.65.113
  175.11.94.110
  175.110.107.2
  175.110.80.86
+175.111.114.10
  175.111.119.42
  175.111.181.246
-175.111.44.138
  175.111.91.143
  175.113.50.47
-175.115.4.14
  175.116.138.124
  175.116.222.106
  175.116.222.47
  175.117.144.37
  175.117.145.166
  175.117.152.222
-175.117.40.19
  175.117.66.74
-175.117.79.125
  175.118.126.20
  175.118.126.81
  175.118.126.99
  175.118.152.100
-175.119.9.246
-175.120.198.152
  175.121.239.233
  175.123.253.188
  175.123.253.220
@@ -42641,24 +35825,18 @@
  175.126.38.47
  175.126.62.28
  175.126.73.16
-175.126.84.168
-175.127.211.136
  175.136.2.222
  175.136.226.231
-175.137.117.52
  175.137.121.75
  175.137.124.184
  175.138.108.78
-175.138.210.239
  175.138.233.116
  175.138.48.167
  175.138.61.147
-175.138.70.145
  175.139.170.126
  175.139.179.65
  175.139.193.17
  175.139.202.201
-175.139.242.49
  175.139.252.193
  175.139.253.230
  175.140.138.193
@@ -42672,141 +35850,88 @@
  175.141.163.225
  175.141.193.11
  175.141.69.201
-175.142.111.249
  175.143.114.47
  175.143.115.21
-175.143.226.135
  175.143.51.221
-175.144.198.225
+175.144.188.196
  175.144.198.226
-175.144.208.190
-175.144.215.33
  175.144.33.245
  175.145.234.102
+175.146.21.114
  175.147.21.193
-175.147.9.103
-175.148.12.207
-175.148.195.28
-175.149.7.68
-175.149.94.44
-175.150.135.107
  175.150.211.174
-175.150.94.99
  175.151.116.122
-175.151.202.98
-175.153.174.196
-175.155.178.66
-175.157.41.77
+175.152.142.204
+175.157.40.83
  175.158.156.76
  175.158.170.213
  175.158.38.249
  175.158.38.47
  175.158.40.140
-175.16.39.61
+175.160.207.247
  175.162.10.93
  175.162.9.46
  175.162.9.53
  175.164.150.18
+175.164.53.251
  175.165.228.179
-175.165.242.104
-175.166.20.43
-175.167.161.22
+175.168.135.147
  175.168.181.86
-175.169.166.103
-175.169.169.85
+175.169.33.13
  175.17.12.164
  175.170.149.18
-175.170.65.1
-175.170.70.64
-175.172.44.213
+175.172.21.181
+175.172.247.43
  175.173.1.121
  175.174.62.4
-175.175.107.75
-175.176.166.145
+175.176.184.229
  175.176.184.5
  175.176.185.106
-175.176.193.130
-175.176.193.234
-175.176.194.18
  175.176.223.133
+175.176.32.26
+175.176.32.93
+175.176.33.81
  175.176.37.151
-175.176.38.154
-175.18.51.250
-175.18.99.156
-175.180.135.248
+175.176.79.20
  175.182.225.244
-175.182.235.22
-175.183.32.121
-175.183.33.202
-175.183.34.233
-175.183.6.160
-175.183.73.53
  175.184.232.194
  175.184.232.196
  175.184.232.74
  175.184.233.23
  175.186.0.200
  175.186.0.250
-175.188.188.205
-175.19.143.206
  175.19.143.215
  175.19.209.244
+175.19.30.46
  175.19.58.142
-175.192.128.217
-175.192.156.220
-175.192.179.80
  175.192.183.81
  175.193.13.3
  175.193.2.152
  175.193.2.152bin.sh
-175.194.118.22
  175.194.54.93
  175.194.86.99
  175.195.33.102
  175.196.178.167
-175.196.191.156
-175.196.191.70
  175.196.47.32
  175.196.61.1
+175.197.148.40
  175.197.233.197
-175.197.24.56
-175.198.211.109
-175.198.211.226
-175.198.227.215
-175.198.65.114
-175.198.65.138
-175.198.65.34
-175.198.65.74
  175.198.80.24
  175.198.83.204
  175.199.229.203
  175.199.229.203bin.sh
-175.199.26.51
-175.200.3.32
+175.200.136.106
  175.201.110.15
-175.201.126.131
-175.201.126.39
-175.201.126.41
-175.201.126.49
-175.201.127.67
  175.201.40.114
  175.201.64.37
  175.202.121.245
-175.204.189.141
  175.204.225.14
-175.204.82.83
  175.204.98.96
-175.205.194.153
-175.205.98.123
-175.206.147.232
+175.205.46.252
  175.206.182.103
-175.206.183.136
-175.206.56.67
-175.206.74.80
-175.207.109.209
  175.207.12.52
  175.207.13.22
-175.207.13.25
+175.207.196.95
  175.207.29.235
  175.207.55.232
  175.208.119.125
@@ -42816,44 +35941,23 @@
  175.208.251.15
  175.209.141.227
  175.209.190.123
-175.21.1.72
-175.210.238.141
-175.210.46.116
-175.210.72.15
  175.211.69.151
-175.211.89.172
-175.212.159.10
-175.212.159.32
-175.212.159.43
-175.212.159.66
-175.212.159.89
  175.212.180.131
-175.212.21.82
  175.212.6.169
-175.212.89.108
  175.213.24.199
  175.213.81.172
-175.214.158.238
-175.214.191.78
+175.213.81.6
  175.214.206.113
-175.215.114.134
-175.215.141.197
  175.215.202.131
-175.23.226.168
-175.23.248.204
  175.24.100.238
  175.24.101.37
  175.24.102.249
-175.24.103.60
  175.24.103.72
  175.24.105.133
  175.24.106.253
  175.24.107.175
-175.24.107.201
  175.24.107.214
-175.24.113.211
  175.24.113.82
-175.24.114.222
  175.24.116.15
  175.24.116.33
  175.24.117.78
@@ -42861,23 +35965,18 @@
  175.24.119.184
  175.24.123.109
  175.24.123.25
-175.24.124.105
-175.24.124.141
  175.24.125.23
  175.24.125.231
  175.24.126.194
  175.24.127.209
  175.24.128.195
  175.24.131.120
-175.24.132.108
  175.24.132.209
  175.24.135.90
  175.24.138.103
-175.24.138.30
  175.24.139.32
  175.24.147.134
  175.24.15.243
-175.24.152.232
  175.24.152.35
  175.24.16.135
  175.24.16.61
@@ -42902,17 +36001,14 @@
  175.24.34.90
  175.24.36.108
  175.24.41.45
-175.24.41.93
  175.24.42.136
  175.24.42.244
  175.24.42.38
-175.24.45.137
  175.24.45.144
  175.24.46.21
  175.24.49.210
  175.24.49.95
  175.24.51.66
-175.24.54.223
  175.24.57.24
  175.24.62.199
  175.24.63.117
@@ -42920,7 +36016,6 @@
  175.24.67.124
  175.24.67.217
  175.24.68.241
-175.24.71.52
  175.24.72.167
  175.24.74.188
  175.24.8.247
@@ -42930,7 +36025,6 @@
  175.24.84.160
  175.24.85.191
  175.24.85.71
-175.24.90.42
  175.24.93.7
  175.24.95.240
  175.24.96.90
@@ -42945,12 +36039,9 @@
  175.29.184.20
  175.29.188.27
  175.29.188.9
-175.29.190.26
  175.29.197.226
  175.29.199.50
  175.30.130.101
-175.30.75.175
-175.37.220.72
  175.41.218.218
  175.41.44.26
  175.41.44.36
@@ -42961,7 +36052,6 @@
  175.42.100.24
  175.42.123.193
  175.42.32.162
-175.42.41.170
  175.43.176.182
  175.43.240.104
  175.44.158.139
@@ -42972,50 +36062,30 @@
  175.45.18.38
  175.45.187.182
  175.45.187.30
-175.5.139.152
  175.5.20.7
  175.5.35.63
-175.5.66.220
-175.6.102.248
-175.6.108.125
-175.6.108.213
-175.6.130.39
+175.5.86.18
  175.6.146.174
-175.6.146.207
-175.6.24.176
  175.6.254.57
-175.6.27.209
  175.6.35.140
-175.6.35.166
-175.6.35.197
  175.6.35.202
  175.6.35.207
-175.6.35.228
  175.6.35.82
-175.6.35.93
  175.6.40.14
  175.6.6.147
-175.6.67.24
-175.6.70.180
-175.6.73.4
-175.6.77.131
  175.6.99.102
  175.7.184.15
  175.8.115.166
  175.8.142.21
-175.8.174.170
  175.8.41.237
  175.8.61.45
  175.97.136.186
-175.98.34.63
  1758681625.rsc.cdn77.org
  176.10.104.240
  176.10.107.180
  176.10.125.5
  176.10.208.98
  176.10.233.12
-176.10.235.169
-176.10.251.34
  176.10.44.190
  176.10.99.196
  176.10.99.200
@@ -43024,7 +36094,6 @@
  176.101.119.72
  176.101.221.119
  176.101.89.226
-176.102.196.162
  176.102.224.53
  176.102.224.56
  176.102.224.60
@@ -43046,7 +36115,6 @@
  176.106.191.2
  176.106.242.148
  176.106.41.214
-176.106.84.1
  176.107.176.111
  176.107.176.164
  176.107.176.178
@@ -43072,28 +36140,22 @@
  176.108.104.84
  176.108.106.25
  176.108.106.5
-176.108.47.38
  176.108.62.147
-176.108.65.192
  176.109.0.30
-176.109.0.5
-176.109.240.156
-176.109.251.247
  176.110.121.90
  176.110.125.233
  176.110.130.150
-176.110.166.82
+176.110.134.2
  176.111.173.11
  176.111.173.12
-176.111.173.29
+176.111.173.24
  176.111.180.209
-176.111.210.40
  176.111.60.55
  176.111.73.57
  176.112.113.20
+176.112.137.205
  176.112.79.111
  176.113.115.132
-176.113.126.34
  176.113.157.149
  176.113.161.101
  176.113.161.104
@@ -43146,34 +36208,27 @@
  176.113.161.94
  176.113.161.95
  176.113.20.179
-176.113.205.44
  176.113.209.13
  176.113.252.148
-176.113.48.9
  176.113.52.6
  176.113.72.133
  176.113.80.252
+176.113.80.64
  176.114.0.74
  176.114.153.126
  176.114.153.49
  176.114.199.56
+176.114.207.189
  176.114.228.40
  176.115.197.118
-176.115.65.167
  176.116.57.51
  176.117.126.22
-176.117.190.185
  176.117.2.40
-176.117.237.121
  176.117.255.182
  176.117.39.44
-176.117.64.48
-176.117.65.244
  176.118.165.106
  176.118.26.52
-176.118.26.53
  176.118.40.240
-176.118.48.221
  176.118.48.226
  176.118.49.54
  176.118.51.176
@@ -43186,21 +36241,17 @@
  176.119.1.182
  176.119.1.75
  176.119.109.177
-176.119.134.131
-176.119.134.18
  176.119.141.115
-176.119.141.140
-176.119.141.168
  176.119.141.181
  176.119.141.23
  176.119.141.53
  176.119.141.61
  176.119.141.84
+176.119.156.111
  176.119.156.8
-176.119.224.74
  176.119.29.70
  176.119.29.8
-176.119.30.93
+176.119.31.32
  176.119.35.203
  176.119.57.252
  176.12.99.45
@@ -43213,16 +36264,13 @@
  176.120.63.35
  176.121.14.109
  176.121.14.151
-176.121.190.15
-176.121.207.157
-176.121.235.236
+176.122.101.230
  176.122.122.173
  176.122.129.114
  176.122.141.223
  176.122.146.45
  176.122.153.147
-176.122.156.32
-176.122.158.234
+176.122.155.157
  176.122.159.131
  176.122.161.175
  176.122.161.241
@@ -43243,6 +36291,7 @@
  176.123.3.96
  176.123.3.98
  176.123.5.193
+176.123.5.214
  176.123.5.227
  176.123.5.250
  176.123.56.119
@@ -43267,11 +36316,9 @@
  176.123.7.50
  176.123.7.51
  176.123.8.147
-176.123.8.47
  176.123.9.100
  176.123.9.13
  176.123.9.171
-176.123.9.242
  176.123.9.32
  176.124.188.3
  176.124.231.76
@@ -43280,129 +36327,78 @@
  176.126.84.210
  176.126.85.207
  176.127.3.92
-176.136.45.76
  176.14.135.119
  176.14.137.126
  176.14.139.153
  176.14.153.168
  176.14.153.182
  176.14.156.48
-176.14.223.132
-176.14.8.65
+176.14.238.119
  176.142.216.192
  176.143.111.17
  176.145.11.22
+176.147.82.9
  176.15.163.216
  176.15.227.66
  176.15.230.206
  176.15.93.111
-176.150.179.226
  176.154.91.80
  176.158.56.29
  176.159.144.162
  176.163.6.57
-176.165.48.246
-176.165.60.67
  176.174.199.40
+176.178.48.20
  176.181.56.34
  176.187.68.157
  176.189.200.121
  176.191.182.3
-176.192.112.154
+176.192.159.19
  176.192.180.115
  176.192.188.175
-176.192.67.162
  176.192.8.206
-176.193.10.58
  176.193.18.170
-176.193.74.103
-176.194.119.88
-176.194.189.39
  176.194.47.236
-176.195.58.14
  176.196.240.34
  176.196.243.70
  176.196.84.138
  176.197.100.134
  176.197.103.58
  176.197.145.162
-176.197.145.238
  176.197.174.182
-176.197.228.66
  176.198.215.108
  176.198.40.56
-176.20.169.161
-176.20.181.128
-176.20.198.78
+176.20.60.141
  176.202.169.139
  176.202.226.181
  176.202.232.168
-176.202.232.55
-176.202.43.189
-176.205.61.82
+176.202.232.31
+176.202.232.51
+176.205.143.206
  176.210.99.14
-176.212.100.41
-176.212.100.6
-176.212.104.144
-176.212.104.218
-176.212.104.243
-176.212.104.254
-176.212.108.178
-176.212.108.195
-176.212.108.202
-176.212.108.69
-176.212.108.95
+176.212.108.92
  176.212.153.218
  176.212.185.153
  176.212.37.99
  176.212.46.209
  176.212.47.61
  176.212.57.207
-176.212.96.4
-176.213.142.75
  176.213.37.43
-176.214.40.10
-176.214.44.107
-176.214.44.108
-176.214.44.116
-176.214.44.117
-176.214.44.14
-176.214.44.152
-176.214.44.185
-176.214.44.196
-176.214.44.201
-176.214.44.209
-176.214.44.212
-176.214.44.215
-176.214.44.237
-176.214.44.238
-176.214.44.47
-176.214.44.69
-176.214.44.81
-176.214.44.82
-176.214.44.89
-176.214.44.9
  176.215.255.141
-176.215.75.2
  176.221.104.2
  176.221.116.10
-176.221.166.166
  176.221.188.104
  176.221.188.195
  176.221.188.29
  176.221.188.63
-176.221.206.169
  176.221.206.61
  176.221.206.8
  176.221.215.165
  176.221.220.2
  176.221.242.166
-176.221.242.18
  176.221.242.71
  176.221.251.238
  176.221.251.87
  176.221.42.32
-176.221.48.214
  176.222.57.46
  176.222.60.2
  176.223.1.70
@@ -43414,13 +36410,13 @@
  176.223.60.10
  176.226.184.88
  176.226.224.47
-176.226.229.208
  176.227.188.16
  176.227.188.66
  176.227.235.64
  176.227.246.168
  176.227.246.5
  176.229.47.48
+176.235.131.228
  176.235.137.2
  176.235.139.114
  176.235.164.177
@@ -43431,9 +36427,7 @@
  176.235.182.154
  176.235.182.79
  176.235.191.132
-176.235.192.133
  176.235.216.155
-176.235.82.165
  176.235.90.242
  176.235.93.0
  176.235.94.75
@@ -43454,23 +36448,19 @@
  176.237.4.193
  176.239.0.210
  176.241.141.167
-176.241.186.194
  176.241.89.170
  176.241.92.38
  176.241.94.146
  176.241.94.228
  176.248.46.4
-176.25.18.22
-176.254.0.60
  176.26.166.66
-176.26.189.40
  176.28.116.58
-176.28.205.182
  176.30.212.184
  176.30.212.190
  176.30.212.193
  176.31.101.224
  176.31.102.37
+176.31.103.78
  176.31.105.112
  176.31.107.25
  176.31.110.229
@@ -43521,16 +36511,15 @@
  176.31.255.164
  176.31.255.223
  176.31.255.63
-176.31.3.253
  176.31.31.185
  176.31.46.178
  176.31.46.240
  176.31.54.244
  176.31.69.155
  176.32.146.121
+176.32.16.112
  176.32.177.30
  176.32.195.69
-176.32.32.105
  176.32.32.37
  176.32.33.174
  176.32.33.185
@@ -43540,23 +36529,21 @@
  176.34.252.88
  176.34.254.113
  176.34.89.217
-176.35.242.118
  176.36.17.63
  176.36.20.67
  176.36.37.21
-176.37.105.29
-176.37.172.87
+176.36.98.49
  176.37.44.170
  176.37.60.16
-176.37.81.155
-176.37.86.158
  176.37.99.111
  176.38.7.43
  176.40.39.125
-176.40.80.224
  176.41.145.57
  176.42.114.128
-176.43.33.113
+176.44.24.222
+176.48.1.138
+176.48.17.173
+176.48.50.177
  176.48.7.175
  176.48.8.116
  176.48.8.84
@@ -43565,9 +36552,11 @@
  176.50.184.98
  176.50.73.42
  176.51.119.144
+176.51.208.118
  176.51.250.233
-176.51.28.111
+176.51.34.117
  176.51.36.234
+176.51.4.140
  176.51.80.179
  176.52.200.130
  176.52.219.6
@@ -43577,32 +36566,33 @@
  176.53.174.31
  176.53.182.146
  176.53.186.77
+176.53.186.86
  176.53.90.26
+176.56.107.133
  176.56.107.146
  176.56.107.181
-176.56.107.196
+176.56.107.184
  176.56.107.199
  176.56.107.206
-176.56.107.214
  176.56.107.223
+176.56.107.225
  176.56.107.227
  176.56.107.233
  176.56.107.237
-176.56.107.251
-176.56.107.252
-176.56.107.81
+176.56.107.246
+176.56.107.70
+176.56.107.93
  176.56.141.109
  176.56.225.110
  176.56.225.111
  176.56.236.158
+176.56.236.253
  176.56.236.76
  176.56.237.165
  176.56.61.4
-176.56.91.92
  176.57.128.87
  176.57.71.45
  176.57.71.47
-176.57.74.18
  176.57.76.118
  176.58.100.98
  176.58.101.249
@@ -43612,25 +36602,26 @@
  176.58.121.177
  176.58.89.182
  176.58.93.123
-176.59.103.245
  176.61.137.230
  176.61.140.116
  176.61.140.150
-176.61.140.225
  176.61.233.67
  176.61.60.76
-176.62.178.247
  176.62.181.23
-176.62.182.26
  176.62.185.72
  176.62.188.158
+176.62.247.147
  176.62.254.244
  176.63.131.24
  176.63.205.248
  176.63.252.179
+176.66.246.119
  176.67.11.250
  176.67.59.98
+176.67.80.13
+176.67.81.9
  176.67.85.219
+176.67.85.220
  176.67.86.125
  176.67.86.130
  176.67.86.142
@@ -43647,18 +36638,15 @@
  176.67.86.49
  176.67.86.50
  176.67.86.51
+176.67.86.60
  176.67.86.63
  176.67.86.64
  176.67.86.65
  176.67.86.66
  176.74.11.254
-176.74.113.52
  176.74.13.170
  176.74.136.237
-176.8.91.58
-176.82.90.73
-176.85.238.76
-176.85.239.124
+176.74.154.45
  176.86.165.85
  176.9.1.234
  176.9.10.227
@@ -43683,6 +36671,7 @@
  176.9.15.75
  176.9.156.51
  176.9.165.169
+176.9.17.6
  176.9.172.105
  176.9.188.7
  176.9.199.182
@@ -43710,7 +36699,6 @@
  176.9.65.102
  176.9.66.39
  176.9.7.247
-176.9.72.200
  176.9.74.187
  176.9.76.179
  176.9.80.243
@@ -43718,36 +36706,30 @@
  176.9.84.152
  176.9.84.209
  176.9.85.13
-176.9.86.146
  176.9.86.219
  176.9.86.53
  176.9.9.8
  176.9.91.5
  176.9.99.134
  176.90.137.156
-176.93.41.144
-176.93.47.154
-176.93.64.108
  176.94.20.213
  176.95.184.111
  176.96.236.20
  176.96.241.1
  176.96.241.253
-176.97.226.28
  176.97.247.9
+176.97.254.108
  176.98.156.64
-176.98.30.68
  176.98.75.120
  176.98.75.229
-176.98.76.127
  176.98.76.180
  176.98.76.210
  176.98.95.105
  176.98.95.111
  176.98.95.132
  176.99.10.22
-176.99.163.139
  176.99.165.174
+176.99.169.75
  176.99.2.207
  176.99.5.150
  176310687075500-dot-wetransfer-auth-file-343.appspot.com
@@ -43760,7 +36742,6 @@
  177.0.56.204
  177.1.213.19
  177.1.214.207
-177.10.104.117
  177.10.144.22
  177.10.144.222
  177.10.144.94
@@ -43770,47 +36751,41 @@
  177.10.200.245
  177.10.211.198
  177.10.212.166
-177.10.231.97
  177.10.84.121
-177.101.0.252
  177.101.125.251
  177.101.172.14
  177.101.182.136
  177.101.185.91
  177.101.187.181
-177.102.19.240
+177.101.188.245
  177.103.157.126
  177.103.159.44
-177.103.161.205
  177.103.161.56
  177.103.182.12
  177.103.223.147
  177.103.240.93
  177.104.192.122
-177.104.83.16
-177.105.116.214
-177.105.159.83
-177.105.192.121
-177.105.192.76
+177.104.50.63
  177.105.35.54
-177.105.66.146
  177.106.177.194
-177.106.255.79
-177.106.79.37
+177.106.26.75
+177.106.28.163
+177.106.77.113
  177.106.98.235
  177.107.134.94
  177.107.50.18
  177.107.50.20
-177.107.68.21
+177.107.68.19
  177.107.68.24
  177.107.68.26
  177.107.79.214
+177.11.112.125
  177.11.112.171
+177.11.119.44
  177.11.156.246
  177.11.65.126
  177.11.66.223
  177.11.68.184
-177.11.71.135
  177.11.75.18
  177.11.85.77
  177.11.85.9
@@ -43818,74 +36793,73 @@
  177.12.113.84
  177.12.2.53
  177.12.227.131
-177.12.80.246
  177.124.10.53
  177.124.101.103
  177.124.102.135
  177.124.112.12
  177.124.184.72
  177.124.185.0
-177.124.195.194
  177.124.201.61
  177.124.217.185
  177.124.225.106
-177.124.40.7
+177.124.23.113
+177.124.23.95
  177.125.152.233
  177.125.160.120
  177.125.160.152
  177.125.161.142
-177.125.161.204
  177.125.161.215
  177.125.161.97
-177.125.161.98
  177.125.163.216
  177.125.166.100
  177.125.166.205
  177.125.169.6
-177.125.190.56
-177.125.20.175
-177.125.20.36
+177.125.20.141
  177.125.20.54
  177.125.20.67
  177.125.204.200
  177.125.204.222
  177.125.204.32
-177.125.205.181
-177.125.205.194
  177.125.205.44
  177.125.206.160
+177.125.206.216
+177.125.206.226
  177.125.207.248
  177.125.221.51
  177.125.60.12
+177.125.74.136
  177.126.122.190
  177.126.123.82
  177.126.130.112
-177.126.200.17
-177.126.212.175
  177.126.212.219
+177.126.216.149
  177.126.78.10
  177.126.81.185
  177.126.81.33
  177.126.81.62
-177.126.89.109
  177.126.89.59
  177.126.93.170
+177.128.155.83
  177.128.209.58
  177.128.212.30
  177.128.216.2
  177.128.232.30
  177.128.34.116
  177.128.35.51
-177.128.44.22
  177.128.63.184
  177.129.147.59
  177.129.17.170
  177.129.17.52
  177.129.202.92
  177.129.202.97
+177.129.206.158
+177.129.206.234
+177.129.206.62
+177.129.206.98
  177.129.207.23
  177.129.48.34
  177.129.8.18
+177.129.84.79
  177.129.90.94
  177.130.110.87
  177.130.140.227
@@ -43898,32 +36872,31 @@
  177.131.121.174
  177.131.13.9
  177.131.22.186
-177.131.51.52
+177.132.134.180
  177.132.97.130
  177.133.17.121
  177.133.198.2
  177.133.219.23
  177.133.235.25
  177.134.161.154
-177.134.168.29
  177.134.169.118
  177.134.171.12
  177.134.240.239
-177.134.245.171
+177.134.244.134
  177.135.241.75
  177.135.250.32
  177.135.95.245
  177.136.121.145
  177.136.135.209
  177.136.14.178
-177.136.159.1
+177.136.168.147
  177.136.168.82
  177.136.185.200
  177.136.209.108
  177.136.209.50
-177.136.209.80
  177.136.210.205
  177.136.212.109
+177.136.212.187
  177.136.227.157
  177.136.252.7
  177.136.32.70
@@ -43934,10 +36907,8 @@
  177.137.148.193
  177.137.151.249
  177.137.160.233
-177.137.160.235
  177.137.160.239
  177.137.163.52
-177.137.163.55
  177.137.163.56
  177.137.163.67
  177.137.163.77
@@ -43946,6 +36917,7 @@
  177.137.163.84
  177.137.163.86
  177.137.163.90
+177.137.163.93
  177.137.168.130
  177.137.168.132
  177.137.168.134
@@ -43953,20 +36925,19 @@
  177.137.168.140
  177.137.168.142
  177.137.168.146
+177.137.168.148
+177.137.168.152
  177.137.168.154
  177.137.168.156
  177.137.170.162
  177.137.170.164
  177.137.170.170
  177.137.170.180
-177.137.207.51
+177.137.170.207
  177.137.227.14
-177.137.231.131
-177.137.233.62
-177.137.96.14
-177.137.96.2
  177.139.10.191
  177.139.100.143
+177.139.100.201
  177.139.129.17
  177.139.130.157
  177.139.136.73
@@ -43974,73 +36945,69 @@
  177.139.169.206
  177.139.176.122
  177.139.194.62
-177.139.205.107
-177.139.218.249
-177.139.224.55
  177.140.196.172
-177.140.219.187
  177.140.40.11
  177.141.243.225
  177.143.194.63
  177.144.130.105
-177.144.131.226
  177.144.135.2
+177.147.82.189
  177.152.124.19
  177.152.124.20
  177.152.124.21
  177.152.124.23
  177.152.124.24
-177.152.143.74
-177.152.144.58
-177.152.54.6
-177.152.66.41
+177.152.64.255
  177.154.16.102
  177.154.224.206
  177.154.226.110
+177.154.226.185
+177.154.226.187
+177.154.226.205
+177.154.226.216
+177.154.227.110
  177.154.230.121
  177.154.230.126
-177.154.238.177
-177.154.49.130
+177.154.230.149
+177.154.230.155
+177.154.230.156
+177.154.230.203
+177.154.230.22
+177.154.230.232
+177.154.230.237
+177.154.230.26
+177.154.235.236
+177.154.237.117
+177.154.237.73
+177.154.239.158
  177.154.52.34
-177.154.52.48
  177.154.55.114
-177.155.134.68
-177.155.16.219
  177.155.214.139
  177.155.232.15
  177.155.248.159
+177.156.218.123
+177.157.162.21
  177.157.242.172
  177.157.61.39
  177.158.163.109
  177.158.207.37
  177.158.212.173
-177.158.99.27
  177.159.0.228
  177.159.146.68
-177.159.234.74
  177.159.34.250
  177.161.156.79
-177.161.215.156
  177.162.156.208
  177.170.161.140
-177.170.20.252
-177.173.202.104
  177.181.165.129
  177.182.14.203
  177.182.46.225
  177.184.137.165
  177.184.139.81
  177.184.140.222
-177.184.178.54
-177.184.191.22
-177.184.191.30
  177.184.192.50
  177.184.207.125
-177.184.44.10
-177.184.44.17
-177.184.44.24
+177.184.241.120
  177.184.67.61
-177.184.67.65
  177.184.67.69
  177.184.67.77
  177.184.67.85
@@ -44051,16 +37018,12 @@
  177.185.141.93
  177.185.151.27
  177.185.156.241
-177.185.16.131
-177.185.240.209
-177.185.27.32
  177.185.29.80
  177.185.32.1
  177.186.178.149
  177.188.121.26
-177.189.228.188
+177.189.181.30
  177.189.244.193
-177.19.162.67
  177.19.165.26
  177.19.171.23
  177.19.187.79
@@ -44069,41 +37032,36 @@
  177.190.145.43
  177.190.170.11
  177.190.170.8
-177.190.176.21
  177.190.196.170
-177.191.111.78
+177.191.100.119
  177.191.147.157
  177.191.160.42
  177.194.1.187
-177.196.230.99
+177.197.2.238
  177.198.71.186
-177.200.163.118
  177.200.189.205
  177.200.198.134
  177.200.204.145
  177.200.247.235
-177.200.35.241
-177.200.35.242
  177.200.35.38
+177.200.66.124
  177.200.72.214
+177.200.76.57
  177.200.89.62
  177.200.94.150
-177.202.108.18
  177.202.118.44
-177.203.169.17
-177.203.205.246
  177.203.48.179
  177.204.167.141
-177.205.115.255
  177.205.44.166
-177.205.97.111
  177.207.192.137
-177.207.204.230
  177.207.94.161
+177.208.15.207
  177.21.120.102
  177.21.13.206
  177.21.14.194
  177.21.19.87
+177.21.195.105
+177.21.195.124
  177.21.196.169
  177.21.205.90
  177.21.30.45
@@ -44112,7 +37070,7 @@
  177.21.36.73
  177.21.37.106
  177.21.96.222
-177.22.188.15
+177.215.79.229
  177.22.225.200
  177.22.35.126
  177.220.133.158
@@ -44120,20 +37078,17 @@
  177.220.173.135
  177.220.174.41
  177.220.175.120
+177.220.177.86
  177.220.178.203
  177.220.178.240
-177.220.188.143
  177.220.188.213
-177.220.188.216
  177.220.189.111
-177.220.191.137
  177.220.226.122
  177.221.176.66
-177.221.176.77
+177.221.180.131
  177.221.202.246
-177.223.16.58
+177.222.22.194
  177.223.226.104
-177.223.226.238
  177.223.48.126
  177.223.50.130
  177.223.58.68
@@ -44142,45 +37097,33 @@
  177.224.35.86
  177.224.90.29
  177.226.25.78
-177.227.44.37
  177.228.215.21
  177.228.45.8
-177.229.71.72
  177.23.150.222
  177.23.150.75
  177.23.16.17
  177.23.16.73
  177.23.184.166
-177.23.28.37
  177.23.58.23
  177.23.7.151
  177.23.72.200
  177.230.20.38
-177.231.255.110
  177.234.154.77
-177.234.166.226
  177.235.108.253
  177.238.248.101
-177.238.249.14
  177.239.160.121
  177.239.51.129
-177.240.102.153
  177.240.174.84
  177.240.181.106
  177.240.195.235
  177.240.204.200
-177.240.206.74
  177.241.245.226
-177.241.248.22
-177.244.220.235
-177.244.32.106
  177.244.36.134
  177.247.70.91
-177.3.253.61
+177.254.75.192
  177.30.47.9
  177.32.8.85
  177.32.82.99
-177.33.47.135
  177.34.108.108
  177.34.59.115
  177.36.128.162
@@ -44196,6 +37139,7 @@
  177.37.162.57
  177.37.165.88
  177.37.175.11
+177.37.220.3
  177.37.240.52
  177.37.71.40
  177.37.94.10
@@ -44206,55 +37150,55 @@
  177.38.22.209
  177.38.232.40
  177.38.234.33
-177.38.235.118
+177.38.234.43
  177.38.235.125
-177.38.235.41
+177.38.235.52
  177.38.243.90
  177.38.69.111
-177.38.76.5
  177.39.187.70
-177.39.218.94
-177.39.223.210
  177.39.73.97
  177.39.79.20
-177.4.183.114
+177.4.173.226
  177.41.44.76
-177.41.60.111
  177.42.118.254
  177.43.148.112
  177.43.247.17
  177.43.249.42
+177.43.251.153
  177.43.35.6
-177.43.63.62
  177.43.94.109
+177.44.16.121
+177.44.16.136
+177.44.17.171
+177.44.17.65
  177.44.18.114
  177.44.18.124
  177.44.18.96
  177.44.193.243
  177.44.208.107
-177.44.226.177
  177.44.82.232
  177.44.88.168
+177.45.120.235
  177.45.19.92
  177.45.199.16
  177.46.147.89
  177.46.147.94
  177.46.150.62
-177.47.193.74
-177.47.194.59
+177.47.181.1
  177.47.206.98
  177.47.224.1
  177.47.224.19
  177.47.27.234
  177.5.53.176
+177.52.136.127
  177.52.173.62
-177.52.249.220
-177.52.25.8
  177.52.26.194
  177.52.26.234
  177.52.35.33
  177.52.48.225
  177.53.106.76
+177.53.108.119
+177.53.108.51
  177.53.109.117
  177.53.109.77
  177.53.152.36
@@ -44267,19 +37211,15 @@
  177.53.8.175
  177.53.9.41
  177.54.133.170
-177.54.150.171
  177.54.195.48
-177.54.195.55
  177.54.201.168
  177.54.224.203
  177.54.224.222
  177.54.224.245
-177.54.34.9
  177.54.55.219
  177.55.116.244
  177.55.143.141
  177.56.106.211
-177.56.130.55
  177.56.155.167
  177.56.209.234
  177.57.58.189
@@ -44291,32 +37231,25 @@
  177.66.195.116
  177.66.195.118
  177.66.221.5
+177.66.226.125
  177.66.247.233
  177.66.247.81
-177.66.73.84
  177.66.89.50
  177.67.10.15
  177.67.162.42
  177.67.203.135
  177.67.217.30
  177.67.219.1
-177.67.4.131
-177.67.8.15
  177.67.8.223
  177.67.8.80
-177.67.82.164
-177.67.83.215
-177.67.84.204
  177.68.143.100
  177.68.255.48
  177.69.123.101
-177.69.123.31
  177.69.124.245
  177.69.146.181
  177.69.178.158
  177.69.19.49
  177.69.196.49
-177.69.203.7
  177.69.212.153
  177.69.227.169
  177.69.227.170
@@ -44325,22 +37258,18 @@
  177.69.45.188
  177.7.17.230
  177.70.172.242
-177.70.192.15
  177.71.141.222
-177.71.35.174
  177.72.112.161
  177.72.112.169
  177.72.113.161
  177.72.113.193
  177.72.113.225
  177.72.113.233
-177.72.113.234
  177.72.113.237
  177.72.113.246
  177.72.115.141
  177.72.115.145
  177.72.115.65
-177.72.117.194
  177.72.13.80
  177.72.4.74
  177.72.6.18
@@ -44376,17 +37305,23 @@
  177.74.117.158
  177.74.119.222
  177.74.136.194
+177.74.143.144
  177.74.143.175
  177.74.143.97
-177.74.153.190
+177.74.157.89
  177.74.2.10
-177.75.143.241
+177.74.254.0
+177.74.254.165
+177.74.254.189
  177.75.15.162
  177.75.159.200
  177.75.159.24
  177.75.69.142
  177.75.7.171
  177.8.113.61
+177.8.154.144
+177.8.154.39
+177.8.154.88
  177.8.172.137
  177.8.172.141
  177.8.216.114
@@ -44395,6 +37330,7 @@
  177.81.25.145
  177.81.27.78
  177.81.34.69
+177.83.241.227
  177.84.109.10
  177.84.143.142
  177.84.146.16
@@ -44405,11 +37341,6 @@
  177.84.148.47
  177.84.148.71
  177.84.17.22
-177.84.209.192
-177.84.210.191
-177.84.210.47
-177.84.35.6
-177.84.43.202
  177.85.112.158
  177.85.113.63
  177.85.121.36
@@ -44431,84 +37362,73 @@
  177.86.158.102
  177.86.160.4
  177.86.181.206
-177.86.182.51
-177.86.200.13
-177.86.27.94
  177.86.64.1
-177.86.64.253
-177.86.67.94
+177.86.64.205
+177.86.64.241
  177.87.10.186
  177.87.10.53
+177.87.10.56
  177.87.10.76
  177.87.108.93
  177.87.11.40
  177.87.186.90
-177.87.214.102
  177.87.214.84
+177.87.218.54
  177.87.223.194
  177.87.230.1
  177.87.230.29
  177.87.230.31
+177.87.253.112
+177.87.253.120
  177.87.36.193
  177.87.37.28
-177.87.40.62
+177.87.68.0
+177.87.68.120
+177.87.68.62
+177.87.68.85
+177.87.68.99
  177.87.8.104
+177.87.9.17
  177.87.9.215
  177.87.9.242
  177.9.28.148
-177.91.165.49
-177.91.181.234
-177.91.182.242
  177.91.186.60
+177.91.188.98
  177.91.214.89
  177.91.33.131
  177.91.33.17
  177.91.35.21
-177.91.44.6
  177.91.44.96
  177.91.64.37
-177.91.74.157
  177.91.75.107
  177.91.75.193
  177.91.79.21
  177.91.80.11
  177.91.80.8
  177.91.9.17
-177.92.12.74
-177.92.155.6
  177.92.160.254
  177.92.165.73
-177.92.21.2
-177.92.247.133
+177.92.244.63
  177.92.249.112
-177.92.4.58
  177.92.42.115
-177.92.85.186
  177.92.9.10
  177.92.9.12
  177.92.9.14
-177.93.188.22
-177.93.251.45
-177.93.253.8
-177.93.68.157
-177.93.70.64
  177.93.79.18
  177.93.79.34
  177.93.79.57
  177.93.79.65
  177.94.194.249
-177.94.201.56
-177.94.203.150
  177.94.204.150
  177.94.206.67
  177.94.227.188
  177.94.46.136
-177.96.156.242
  177.97.191.18
  177.97.192.95
  177.97.43.252
  177.98.222.211
  177.99.175.58
+177.99.206.82
  177.99.22.141
  177.99.23.182
  177.99.82.83
@@ -44517,67 +37437,64 @@
  1775114384.jclecardinal.com
  177momo.com
  178-365.net
-178.0.238.139
+178.1.138.13
+178.1.138.137
  178.11.178.58
  178.11.179.13
  178.113.110.96
  178.116.213.31
+178.116.86.211
  178.116.96.223
  178.118.161.146
  178.118.89.110
+178.119.122.187
  178.12.221.130
-178.12.226.179
  178.120.22.2
  178.120.48.199
+178.120.95.32
  178.121.128.17
  178.121.178.1
  178.121.186.70
-178.121.193.98
-178.121.26.250
-178.121.56.75
+178.121.187.34
  178.121.69.188
  178.121.69.232
  178.122.0.166
  178.122.148.122
+178.122.19.84
  178.122.200.4
  178.122.205.228
  178.122.22.38
-178.122.53.198
+178.122.45.189
  178.122.97.77
-178.123.172.186
-178.123.212.39
-178.123.220.242
-178.123.222.54
+178.123.219.211
  178.123.25.148
-178.123.50.248
  178.123.55.113
-178.123.60.13
+178.123.82.209
+178.123.91.140
  178.124.0.129
  178.124.131.178
-178.124.134.75
  178.124.162.209
-178.124.202.115
-178.124.202.93
+178.124.209.209
  178.124.214.18
-178.124.217.197
-178.124.22.226
  178.124.7.7
  178.125.140.61
  178.125.17.15
  178.125.183.115
  178.125.221.124
  178.126.176.187
-178.126.191.34
-178.126.48.111
-178.126.48.79
-178.126.51.20
+178.126.178.96
+178.126.186.34
  178.126.51.58
-178.126.55.241
-178.126.57.243
+178.126.56.119
+178.126.60.247
+178.126.61.210
+178.126.63.31
+178.126.63.43
+178.126.79.179
  178.126.85.82
  178.127.142.31
  178.127.229.98
-178.127.40.175
+178.127.238.8
  178.127.46.80
  178.128.1.219
  178.128.10.117
@@ -44585,27 +37502,17 @@
  178.128.105.135
  178.128.105.25
  178.128.105.253
-178.128.106.171
  178.128.106.212
  178.128.106.68
-178.128.107.34
  178.128.107.65
-178.128.108.106
+178.128.108.135
  178.128.108.166
  178.128.109.164
  178.128.11.149
  178.128.11.189
-178.128.110.241
  178.128.111.172
-178.128.112.15
-178.128.112.53
-178.128.114.118
-178.128.114.145
-178.128.114.40
-178.128.114.63
  178.128.116.50
  178.128.116.73
-178.128.117.160
  178.128.117.58
  178.128.117.84
  178.128.118.202
@@ -44619,14 +37526,12 @@
  178.128.120.8
  178.128.121.137
  178.128.122.111
-178.128.122.222
  178.128.122.45
  178.128.123.111
  178.128.124.182
  178.128.124.89
  178.128.125.16
  178.128.125.4
-178.128.126.173
  178.128.127.126
  178.128.127.62
  178.128.131.130
@@ -44637,12 +37542,10 @@
  178.128.147.114
  178.128.147.244
  178.128.148.98
-178.128.149.186
  178.128.15.57
  178.128.150.21
  178.128.151.12
  178.128.152.19
-178.128.154.242
  178.128.155.164
  178.128.156.174
  178.128.157.227
@@ -44652,24 +37555,19 @@
  178.128.158.246
  178.128.158.86
  178.128.159.158
+178.128.160.25
  178.128.161.170
  178.128.162.10
  178.128.162.115
  178.128.162.42
  178.128.163.3
  178.128.163.4
-178.128.164.112
  178.128.164.145
  178.128.166.156
  178.128.169.88
  178.128.17.153
-178.128.171.59
-178.128.173.147
-178.128.175.197
-178.128.18.102
  178.128.18.14
  178.128.18.29
-178.128.181.178
  178.128.181.61
  178.128.189.108
  178.128.19.218
@@ -44678,7 +37576,6 @@
  178.128.198.122
  178.128.199.238
  178.128.20.19
-178.128.200.104
  178.128.201.142
  178.128.201.175
  178.128.201.241
@@ -44693,7 +37590,6 @@
  178.128.208.38
  178.128.209.139
  178.128.209.141
-178.128.209.152
  178.128.209.69
  178.128.209.81
  178.128.21.38
@@ -44711,6 +37607,7 @@
  178.128.217.58
  178.128.218.188
  178.128.22.88
+178.128.220.108
  178.128.220.173
  178.128.221.162
  178.128.221.177
@@ -44720,7 +37617,6 @@
  178.128.225.74
  178.128.226.2
  178.128.227.22
-178.128.230.35
  178.128.230.50
  178.128.232.28
  178.128.234.32
@@ -44739,7 +37635,6 @@
  178.128.242.16
  178.128.242.233
  178.128.243.141
-178.128.243.15
  178.128.243.225
  178.128.243.250
  178.128.244.128
@@ -44755,7 +37650,6 @@
  178.128.248.192
  178.128.248.238
  178.128.248.6
-178.128.25.241
  178.128.250.140
  178.128.250.149
  178.128.251.251
@@ -44778,10 +37672,8 @@
  178.128.28.51
  178.128.29.15
  178.128.31.47
-178.128.32.143
  178.128.33.192
  178.128.34.116
-178.128.34.137
  178.128.34.254
  178.128.35.139
  178.128.36.26
@@ -44792,7 +37684,6 @@
  178.128.39.39
  178.128.40.210
  178.128.41.141
-178.128.41.212
  178.128.42.33
  178.128.48.87
  178.128.49.224
@@ -44806,14 +37697,12 @@
  178.128.55.198
  178.128.58.12
  178.128.58.95
-178.128.59.188
  178.128.60.11
  178.128.61.211
  178.128.63.102
  178.128.63.182
  178.128.63.183
  178.128.63.36
-178.128.64.173
  178.128.64.238
  178.128.68.121
  178.128.7.8
@@ -44830,13 +37719,11 @@
  178.128.8.160
  178.128.8.241
  178.128.80.85
-178.128.81.207
  178.128.84.200
  178.128.84.47
  178.128.87.73
  178.128.88.244
  178.128.89.170
-178.128.89.193
  178.128.89.95
  178.128.91.117
  178.128.91.60
@@ -44850,7 +37737,6 @@
  178.128.98.103
  178.128.98.15
  178.128.98.43
-178.130.27.202
  178.130.36.81
  178.130.99.111
  178.132.2.246
@@ -44858,7 +37744,6 @@
  178.132.206.95
  178.132.220.241
  178.132.3.41
-178.134.147.7
  178.134.152.46
  178.134.153.205
  178.134.155.82
@@ -44866,21 +37751,17 @@
  178.134.185.173
  178.134.185.183
  178.134.185.217
-178.134.185.23
  178.134.185.49
  178.134.185.61
  178.134.185.75
  178.134.185.86
-178.134.190.185
  178.134.190.55
  178.134.208.126
  178.134.216.46
-178.134.41.222
  178.134.71.138
  178.135.51.30
  178.136.2.208
  178.136.56.246
-178.137.115.185
  178.137.16.0
  178.137.16.1
  178.137.16.10
@@ -45140,7 +38021,6 @@
  178.137.163.125
  178.137.166.33
  178.137.208.162
-178.137.31.237
  178.137.82.147
  178.137.83.224
  178.137.83.243
@@ -45151,49 +38031,30 @@
  178.137.93.24
  178.137.95.244
  178.14.78.4
-178.141.126.118
-178.141.126.77
-178.141.150.202
-178.141.171.59
-178.141.22.123
-178.141.226.108
-178.141.237.29
-178.141.3.124
-178.141.44.219
-178.141.48.109
-178.141.5.27
-178.141.83.24
-178.141.91.192
+178.140.108.240
+178.140.98.84
  178.142.57.94
-178.143.12.103
  178.143.52.84
+178.148.0.235
  178.148.172.209
  178.148.226.180
  178.149.157.252
  178.149.192.80
-178.15.51.20
  178.150.102.252
  178.150.139.189
-178.150.148.38
  178.150.15.194
-178.150.175.196
  178.150.194.243
-178.150.20.188
  178.150.237.198
  178.150.237.227
  178.150.47.62
  178.150.93.86
  178.150.97.102
  178.151.143.112
+178.151.198.251
  178.151.205.154
  178.151.238.148
  178.151.24.64
  178.151.241.122
-178.151.70.23
-178.151.83.166
-178.151.97.195
-178.153.101.9
-178.153.23.50
  178.153.38.94
  178.153.41.33
  178.154.225.98
@@ -45201,7 +38062,6 @@
  178.154.235.71
  178.155.12.177
  178.155.5.102
-178.155.5.128
  178.155.5.151
  178.155.5.172
  178.155.5.175
@@ -45210,34 +38070,34 @@
  178.155.5.4
  178.155.5.48
  178.155.5.77
+178.155.5.89
  178.156.31.233
  178.156.44.128
-178.156.67.164
  178.156.67.165
+178.156.67.169
+178.156.67.175
+178.156.67.182
  178.156.67.187
-178.156.67.25
-178.156.77.161
  178.156.77.162
  178.156.77.176
  178.157.91.246
  178.158.1.35
  178.158.15.107
  178.158.18.90
-178.158.182.211
-178.158.197.35
  178.158.35.181
  178.158.35.29
  178.158.51.173
  178.158.64.20
  178.158.67.162
+178.158.69.108
  178.159.107.52
-178.159.237.219
  178.159.240.240
  178.159.242.73
  178.159.242.91
  178.159.245.55
  178.159.3.163
  178.159.36.172
+178.159.36.80
  178.159.37.1
  178.159.37.12
  178.159.37.125
@@ -45245,7 +38105,7 @@
  178.159.37.139
  178.159.37.142
  178.159.37.159
-178.159.37.17
+178.159.37.16
  178.159.37.171
  178.159.37.172
  178.159.37.28
@@ -45262,7 +38122,6 @@
  178.159.37.92
  178.159.43.35
  178.16.222.146
-178.161.192.171
  178.162.192.65
  178.162.196.212
  178.162.196.215
@@ -45283,16 +38142,13 @@
  178.162.216.1
  178.162.218.42
  178.162.222.227
-178.162.27.252
  178.163.24.23
  178.165.103.188
-178.165.128.218
  178.165.21.58
  178.165.44.122
  178.165.48.209
  178.165.72.177
  178.168.120.136
-178.168.120.169
  178.168.144.7
  178.168.19.139
  178.168.196.238
@@ -45305,8 +38161,6 @@
  178.168.43.131
  178.168.67.89
  178.168.99.136
-178.169.248.92
-178.169.80.150
  178.17.127.210
  178.17.145.83
  178.17.166.110
@@ -45342,22 +38196,7 @@
  178.170.146.195
  178.170.168.212
  178.170.220.162
-178.170.40.27
  178.173.171.10
-178.174.136.101
-178.174.136.105
-178.174.136.125
-178.174.136.16
-178.174.136.18
-178.174.136.21
-178.174.136.46
-178.174.137.114
-178.174.137.123
-178.174.137.155
-178.174.137.168
-178.174.137.81
-178.174.137.9
-178.174.148.20
  178.174.148.234
  178.174.148.58
  178.174.159.163
@@ -45370,17 +38209,13 @@
  178.175.132.69
  178.175.132.70
  178.175.132.71
-178.175.132.72
  178.175.132.74
  178.175.132.75
  178.175.142.134
  178.175.144.126
  178.175.148.148
  178.175.148.224
-178.175.8.111
-178.176.193.41
  178.176.224.36
-178.176.249.143
  178.176.61.193
  178.176.79.60
  178.18.138.41
@@ -45388,90 +38223,75 @@
  178.18.17.34
  178.18.18.120
  178.18.19.163
-178.18.34.36
  178.18.38.230
  178.18.69.13
  178.18.84.73
-178.18.94.125
  178.18.94.247
  178.183.1.9
  178.183.99.149
+178.184.245.229
  178.184.69.201
-178.184.87.216
  178.184.96.152
+178.187.103.22
  178.187.113.68
-178.187.91.117
  178.188.235.222
  178.188.67.190
  178.19.106.138
  178.19.106.234
  178.19.107.27
  178.19.247.25
-178.190.217.95
-178.191.186.115
-178.191.244.172
+178.191.251.199
  178.194.110.8
  178.194.193.94
  178.195.53.244
-178.195.62.128
  178.196.1.133
  178.196.1.210
+178.196.112.74
  178.197.235.96
  178.197.249.50
  178.198.130.101
-178.199.127.28
+178.198.228.58
  178.199.129.214
-178.199.86.19
  178.20.100.35
  178.20.137.178
-178.20.189.62
  178.20.227.53
  178.20.55.16
  178.20.55.18
  178.20.74.212
  178.200.152.49
  178.200.202.212
+178.201.176.197
  178.201.247.152
  178.202.3.93
  178.202.32.83
  178.203.120.68
  178.203.146.227
+178.203.228.43
  178.203.40.53
  178.204.52.119
  178.205.101.33
  178.205.101.67
  178.205.136.73
  178.205.141.180
-178.205.253.206
  178.205.254.106
-178.206.224.16
-178.206.228.141
  178.206.229.89
-178.207.9.210
  178.208.255.8
  178.208.75.227
-178.209.126.217
-178.209.126.78
  178.209.170.75
  178.209.42.84
-178.209.55.62
-178.209.66.112
  178.21.20.102
  178.210.11.42
  178.210.16.147
  178.210.163.36
  178.210.24.56
  178.210.66.37
-178.211.173.63
-178.211.179.3
  178.211.45.66
-178.211.96.40
  178.212.133.63
  178.212.176.82
  178.212.54.137
  178.212.64.52
  178.213.0.207
-178.213.112.33
+178.213.123.158
  178.213.130.101
  178.213.130.159
  178.213.184.37
@@ -45492,33 +38312,26 @@
  178.214.245.26
  178.214.246.119
  178.214.248.16
+178.214.248.233
  178.214.250.38
  178.214.251.0
  178.214.251.122
-178.214.251.142
  178.214.251.169
  178.214.251.21
  178.214.251.22
  178.214.253.241
-178.214.46.108
-178.214.77.12
  178.215.163.218
  178.215.190.239
  178.215.190.240
-178.215.88.75
  178.216.0.168
  178.216.165.188
  178.216.2.229
  178.216.200.48
  178.216.202.97
-178.216.233.110
-178.216.24.80
  178.216.248.36
-178.216.251.21
+178.216.48.162
  178.216.49.147
-178.216.64.235
  178.217.106.245
-178.217.152.218
  178.217.152.234
  178.217.169.10
  178.217.172.234
@@ -45526,43 +38339,27 @@
  178.217.216.184
  178.217.40.208
  178.217.43.155
-178.217.8.194
-178.217.98.174
  178.218.104.42
  178.218.104.8
-178.218.156.8
-178.218.200.161
  178.218.207.89
  178.218.222.185
-178.218.58.234
-178.219.168.154
+178.219.118.212
  178.219.171.43
  178.219.173.193
  178.219.175.128
  178.219.31.252
-178.219.37.70
-178.219.49.10
-178.219.49.61
-178.219.9.40
-178.22.111.132
-178.22.120.102
-178.22.123.150
  178.22.168.44
  178.22.221.201
  178.22.65.147
  178.220.30.28
  178.221.110.179
-178.221.129.223
  178.221.39.148
  178.221.41.10
-178.221.74.183
  178.222.148.139
  178.223.62.220
-178.223.64.90
  178.223.68.233
  178.225.106.40
-178.228.52.167
-178.23.236.40
+178.23.151.219
  178.23.244.208
  178.234.37.197
  178.234.40.163
@@ -45570,16 +38367,17 @@
  178.235.209.52
  178.236.137.63
  178.236.232.8
-178.236.43.74
  178.238.10.82
-178.238.131.112
  178.238.133.232
+178.238.224.146
+178.238.224.166
  178.238.224.98
  178.238.225.147
-178.238.225.45
+178.238.225.185
  178.238.229.148
  178.238.232.57
  178.238.237.56
+178.239.147.142
  178.239.168.57
  178.239.169.130
  178.239.173.184
@@ -45587,26 +38385,24 @@
  178.239.50.140
  178.239.59.82
  178.239.62.113
-178.242.126.255
+178.242.114.188
  178.242.41.26
  178.242.91.27
-178.244.201.167
-178.248.106.158
  178.248.108.51
  178.248.200.16
  178.248.255.79
  178.248.57.92
  178.248.87.44
+178.249.122.203
  178.249.95.43
  178.250.156.229
  178.250.157.177
  178.250.54.208
  178.251.140.3
-178.251.142.14
-178.251.245.48
  178.251.71.218
  178.252.122.139
  178.252.127.236
+178.252.190.85
  178.252.197.64
  178.252.199.46
  178.252.75.13
@@ -45620,12 +38416,11 @@
  178.254.148.37
  178.254.149.33
  178.254.149.37
-178.254.171.10
-178.254.171.39
+178.254.171.32
+178.254.171.33
  178.254.171.40
  178.254.171.41
  178.254.171.44
-178.254.171.46
  178.254.171.8
  178.254.174.196
  178.254.179.110
@@ -45636,8 +38431,6 @@
  178.254.36.182
  178.254.6.27
  178.255.154.57
-178.255.168.207
-178.255.168.5
  178.255.215.69
  178.255.229.102
  178.255.42.126
@@ -45646,16 +38439,13 @@
  178.27.101.177
  178.27.198.157
  178.27.205.40
-178.27.242.61
  178.3.36.161
  178.30.241.242
-178.30.79.224
  178.30.86.237
  178.32.1.128
  178.32.121.151
  178.32.121.17
  178.32.123.182
-178.32.125.98
  178.32.144.167
  178.32.167.73
  178.32.181.66
@@ -45665,7 +38455,6 @@
  178.32.198.183
  178.32.205.2
  178.32.213.127
-178.32.215.88
  178.32.216.133
  178.32.218.149
  178.32.218.68
@@ -45677,7 +38466,6 @@
  178.32.44.233
  178.32.58.209
  178.32.88.23
-178.32.97.34
  178.33.122.96
  178.33.131.26
  178.33.132.215
@@ -45693,15 +38481,12 @@
  178.33.159.185
  178.33.159.25
  178.33.167.120
-178.33.169.168
  178.33.18.165
  178.33.216.187
  178.33.216.209
-178.33.227.167
  178.33.228.210
  178.33.232.69
  178.33.233.230
-178.33.3.16
  178.33.38.55
  178.33.48.26
  178.33.67.12
@@ -45715,114 +38500,52 @@
  178.39.116.98
  178.42.255.239
  178.42.48.18
-178.44.151.167
-178.44.180.83
-178.45.159.138
-178.45.180.92
-178.45.28.28
-178.46.154.225
+178.44.133.224
+178.44.203.148
+178.44.236.55
+178.45.199.197
  178.46.163.191
-178.46.208.10
-178.46.208.127
-178.46.208.143
-178.46.208.53
-178.46.208.83
-178.46.208.9
-178.46.209.139
-178.46.209.213
-178.46.209.46
-178.46.209.58
-178.46.209.66
-178.46.209.84
-178.46.210.178
-178.46.210.220
-178.46.210.45
-178.46.210.95
-178.46.210.96
-178.46.211.10
-178.46.211.115
-178.46.211.133
-178.46.211.144
-178.46.211.17
-178.46.211.63
-178.46.212.143
-178.46.212.33
-178.46.212.57
-178.46.213.117
-178.46.213.15
-178.46.213.40
-178.46.213.46
-178.46.213.50
-178.46.213.76
-178.46.213.9
-178.46.214.121
-178.46.214.136
-178.46.214.158
-178.46.214.188
-178.46.214.232
-178.46.215.123
-178.46.215.194
-178.46.215.37
-178.46.215.42
-178.46.215.44
+178.46.206.223
  178.47.131.202
  178.47.139.151
  178.47.139.50
  178.47.141.128
  178.47.141.196
-178.47.141.218
  178.47.141.220
  178.47.141.235
-178.47.142.64
  178.47.143.198
-178.47.144.29
-178.47.154.187
+178.48.162.227
  178.48.165.143
  178.48.221.170
  178.48.31.141
  178.48.53.163
  178.48.68.189
  178.48.68.61
-178.48.88.196
-178.54.121.123
-178.54.16.214
-178.54.231.253
-178.54.78.190
-178.55.153.8
-178.55.170.135
  178.57.115.124
  178.57.125.78
  178.60.28.98
  178.61.141.198
-178.61.147.17
  178.62.0.215
  178.62.1.145
  178.62.10.18
  178.62.100.17
  178.62.101.107
  178.62.101.135
-178.62.103.10
  178.62.103.30
  178.62.103.85
  178.62.104.58
  178.62.104.85
-178.62.105.138
  178.62.106.98
-178.62.107.10
-178.62.108.111
  178.62.110.145
  178.62.114.26
  178.62.115.45
  178.62.115.86
-178.62.116.47
  178.62.117.106
  178.62.117.223
  178.62.118.53
-178.62.119.15
  178.62.119.91
  178.62.12.192
  178.62.121.182
-178.62.123.177
  178.62.124.26
  178.62.125.239
  178.62.127.104
@@ -45830,6 +38553,7 @@
  178.62.139.49
  178.62.147.134
  178.62.158.205
+178.62.17.11
  178.62.17.143
  178.62.182.246
  178.62.183.92
@@ -45837,7 +38561,6 @@
  178.62.19.106
  178.62.19.66
  178.62.194.248
-178.62.195.132
  178.62.195.55
  178.62.195.58
  178.62.198.108
@@ -45874,12 +38597,8 @@
  178.62.23.28
  178.62.230.5
  178.62.231.117
-178.62.233.90
-178.62.235.110
  178.62.24.120
-178.62.240.196
  178.62.241.231
-178.62.241.56
  178.62.242.167
  178.62.243.166
  178.62.243.181
@@ -45899,22 +38618,20 @@
  178.62.26.232
  178.62.27.101
  178.62.27.144
+178.62.27.207
  178.62.29.24
  178.62.29.94
  178.62.32.11
  178.62.33.222
  178.62.33.71
  178.62.37.78
-178.62.39.189
  178.62.40.33
-178.62.43.8
  178.62.44.102
-178.62.44.28
  178.62.47.147
-178.62.47.158
  178.62.47.207
  178.62.48.33
-178.62.49.137
+178.62.5.193
+178.62.5.22
  178.62.5.48
  178.62.50.191
  178.62.52.150
@@ -45922,7 +38639,6 @@
  178.62.52.213
  178.62.53.135
  178.62.53.164
-178.62.55.19
  178.62.56.208
  178.62.57.199
  178.62.57.36
@@ -45957,6 +38673,7 @@
  178.62.9.39
  178.62.92.247
  178.62.99.41
+178.63.120.107
  178.63.127.148
  178.63.127.150
  178.63.13.15
@@ -45968,7 +38685,6 @@
  178.63.189.139
  178.63.2.220
  178.63.229.133
-178.63.246.82
  178.63.246.83
  178.63.247.209
  178.63.253.33
@@ -45987,11 +38703,11 @@
  178.63.97.197
  178.63.97.34
  178.63.98.228
-178.64.136.204
  178.64.162.197
-178.65.84.23
-178.66.182.76
-178.67.19.51
+178.64.166.34
+178.65.67.64
+178.65.80.0
+178.66.27.93
  178.67.195.64
  178.67.205.104
  178.67.48.220
@@ -45999,216 +38715,33 @@
  178.68.44.27
  178.69.12.30
  178.69.124.152
-178.69.16.130
  178.69.191.120
+178.69.211.253
  178.69.226.119
-178.69.236.44
  178.71.124.90
-178.71.186.244
  178.71.7.139
  178.72.162.242
  178.72.163.252
-178.72.68.108
-178.72.68.128
-178.72.68.13
-178.72.68.134
-178.72.68.136
-178.72.68.142
-178.72.68.148
-178.72.68.150
+178.72.68.144
  178.72.68.153
-178.72.68.156
-178.72.68.169
-178.72.68.17
-178.72.68.170
-178.72.68.177
-178.72.68.178
-178.72.68.183
-178.72.68.185
-178.72.68.187
-178.72.68.190
-178.72.68.193
-178.72.68.195
-178.72.68.20
-178.72.68.200
-178.72.68.203
-178.72.68.204
-178.72.68.206
-178.72.68.22
-178.72.68.224
-178.72.68.225
-178.72.68.227
-178.72.68.228
-178.72.68.233
-178.72.68.237
-178.72.68.239
-178.72.68.25
-178.72.68.253
-178.72.68.28
-178.72.68.30
-178.72.68.35
-178.72.68.42
-178.72.68.5
-178.72.68.50
-178.72.68.71
-178.72.68.73
-178.72.68.83
-178.72.68.85
-178.72.68.88
-178.72.69.104
-178.72.69.106
-178.72.69.11
-178.72.69.117
-178.72.69.122
-178.72.69.126
-178.72.69.142
  178.72.69.145
-178.72.69.157
-178.72.69.159
-178.72.69.16
-178.72.69.161
-178.72.69.17
-178.72.69.170
-178.72.69.181
-178.72.69.188
-178.72.69.193
-178.72.69.194
-178.72.69.196
-178.72.69.21
-178.72.69.227
-178.72.69.240
-178.72.69.241
-178.72.69.243
-178.72.69.254
-178.72.69.36
-178.72.69.39
-178.72.69.46
-178.72.69.47
-178.72.69.57
-178.72.69.60
-178.72.69.8
-178.72.69.88
-178.72.69.89
+178.72.69.233
+178.72.69.3
  178.72.69.92
-178.72.70.10
-178.72.70.106
-178.72.70.11
-178.72.70.111
-178.72.70.114
-178.72.70.115
-178.72.70.118
-178.72.70.12
-178.72.70.126
-178.72.70.133
-178.72.70.135
-178.72.70.14
-178.72.70.146
-178.72.70.148
-178.72.70.149
-178.72.70.15
-178.72.70.159
-178.72.70.160
-178.72.70.163
-178.72.70.164
-178.72.70.174
-178.72.70.176
-178.72.70.180
-178.72.70.184
-178.72.70.190
-178.72.70.191
-178.72.70.193
-178.72.70.197
-178.72.70.202
-178.72.70.207
-178.72.70.209
-178.72.70.213
-178.72.70.216
-178.72.70.217
-178.72.70.218
-178.72.70.220
-178.72.70.221
-178.72.70.223
-178.72.70.231
-178.72.70.232
-178.72.70.233
-178.72.70.240
-178.72.70.241
-178.72.70.242
-178.72.70.243
-178.72.70.247
-178.72.70.26
-178.72.70.30
-178.72.70.4
-178.72.70.42
-178.72.70.46
-178.72.70.48
-178.72.70.50
-178.72.70.52
-178.72.70.56
-178.72.70.58
-178.72.70.62
-178.72.70.64
-178.72.70.65
-178.72.70.68
-178.72.70.7
-178.72.70.84
-178.72.70.85
-178.72.70.91
-178.72.70.92
-178.72.70.95
-178.72.71.1
-178.72.71.100
-178.72.71.104
-178.72.71.105
-178.72.71.106
-178.72.71.109
-178.72.71.110
-178.72.71.118
-178.72.71.150
-178.72.71.153
-178.72.71.159
-178.72.71.16
-178.72.71.160
-178.72.71.162
-178.72.71.164
-178.72.71.171
-178.72.71.173
-178.72.71.180
-178.72.71.182
-178.72.71.184
-178.72.71.195
-178.72.71.196
-178.72.71.197
-178.72.71.199
-178.72.71.2
-178.72.71.201
-178.72.71.203
-178.72.71.21
-178.72.71.22
-178.72.71.226
-178.72.71.228
-178.72.71.245
-178.72.71.247
+178.72.70.181
+178.72.70.19
+178.72.70.235
+178.72.70.3
+178.72.70.81
+178.72.71.194
  178.72.71.248
-178.72.71.251
-178.72.71.28
-178.72.71.37
-178.72.71.45
-178.72.71.69
-178.72.71.71
-178.72.71.80
-178.72.71.86
-178.72.71.88
-178.72.71.95
-178.72.71.98
+178.72.71.61
+178.72.71.78
  178.72.74.40
-178.73.210.215
+178.72.91.172
  178.73.215.171
-178.73.6.18
  178.74.56.144
-178.75.143.33
  178.75.27.131
-178.75.65.34
  178.76.234.182
  178.76.238.246
  178.76.254.130
@@ -46224,6 +38757,7 @@
  178.79.162.159
  178.79.163.131
  178.79.166.155
+178.79.168.88
  178.79.170.28
  178.79.183.171
  178.79.183.193
@@ -46239,29 +38773,28 @@
  178.85.103.251
  178.85.133.89
  178.85.82.198
-178.87.50.71
-178.89.21.175
  178.89.32.171
-178.91.184.233
-178.91.63.36
+178.91.32.202
  178.91.95.178
  178.93.11.55
+178.93.12.177
  178.93.20.232
-178.93.23.131
  178.93.27.11
  178.93.27.202
  178.93.27.9
  178.93.31.54
+178.93.33.97
  178.93.34.41
  178.93.34.48
+178.93.35.250
  178.93.40.205
  178.93.40.92
+178.93.47.15
  178.93.53.110
  178.93.57.213
  178.93.59.159
  178.93.59.216
  178.93.6.134
-178.93.6.8
  178.93.60.212
  178.93.63.3
  178.94.146.50
@@ -46270,27 +38803,25 @@
  178j.life
  179.1.1.11
  179.1.91.130
-179.104.51.108
+179.104.42.33
  179.106.150.4
  179.106.150.5
  179.106.150.7
  179.106.159.204
  179.106.223.27
-179.106.26.4
-179.106.83.157
-179.106.96.74
+179.107.190.49
  179.107.34.178
-179.107.56.209
+179.107.56.45
  179.107.57.133
-179.107.57.202
-179.107.57.220
  179.107.57.39
-179.107.58.251
+179.107.57.49
+179.107.58.222
  179.107.58.5
  179.107.58.91
  179.107.59.205
  179.107.59.215
  179.107.59.245
+179.107.60.200
  179.107.60.214
  179.107.60.51
  179.107.61.215
@@ -46308,12 +38839,10 @@
  179.108.249.118
  179.108.249.177
  179.108.57.238
-179.108.87.38
  179.108.94.75
  179.109.33.136
+179.109.35.168
  179.109.38.42
-179.109.40.64
-179.109.41.40
  179.109.60.87
  179.110.52.32
  179.110.79.83
@@ -46321,48 +38850,44 @@
  179.112.212.213
  179.112.230.44
  179.113.197.249
-179.113.225.228
-179.12.201.39
  179.124.136.38
  179.124.137.65
  179.124.240.199
+179.124.36.196
  179.125.118.166
  179.125.118.189
  179.125.172.177
  179.125.172.210
  179.125.25.218
  179.125.39.230
-179.125.43.89
+179.126.140.82
  179.126.3.44
+179.126.5.173
  179.127.13.148
  179.127.140.113
  179.127.140.142
  179.127.156.100
  179.127.156.85
  179.127.175.202
-179.127.193.166
+179.127.195.194
  179.127.35.17
  179.131.10.103
  179.131.11.234
  179.145.52.145
-179.146.77.136
-179.151.65.131
+179.151.29.131
  179.153.19.232
-179.155.127.61
-179.155.87.147
  179.157.206.101
-179.159.251.87
+179.162.176.232
  179.162.200.235
-179.162.207.113
  179.162.46.179
-179.171.39.98
-179.171.47.46
+179.171.115.170
+179.171.127.182
  179.171.95.75
  179.174.51.3
-179.174.53.226
-179.180.86.117
+179.176.34.134
+179.179.105.18
+179.180.141.152
  179.181.165.244
-179.182.123.150
  179.182.143.237
  179.182.27.65
  179.182.6.53
@@ -46375,27 +38900,19 @@
  179.184.247.78
  179.185.179.183
  179.185.50.182
-179.185.65.220
  179.185.66.242
-179.185.80.196
-179.185.89.241
  179.186.152.59
  179.187.244.73
-179.189.101.148
  179.189.125.222
+179.189.196.212
  179.189.253.122
  179.189.27.28
-179.189.48.50
-179.189.85.206
  179.191.245.58
  179.191.53.243
  179.191.68.86
  179.191.69.146
+179.191.99.218
  179.199.3.181
-179.208.167.192
-179.208.176.208
-179.209.196.233
-179.209.88.167
  179.210.162.201
  179.211.32.189
  179.213.95.241
@@ -46403,41 +38920,32 @@
  179.219.96.136
  179.219.98.106
  179.220.229.8
-179.221.113.119
  179.222.115.170
  179.222.67.144
-179.224.214.247
-179.228.127.28
  179.228.74.3
-179.232.145.119
  179.232.71.145
  179.233.3.103
  179.234.1.38
  179.234.232.150
  179.234.40.169
+179.240.210.5
  179.240.245.65
-179.242.79.117
-179.242.83.6
+179.241.2.234
+179.241.27.171
+179.243.215.213
  179.243.68.150
  179.247.252.118
-179.251.87.120
-179.252.114.253
  179.253.179.216
  179.255.2.42
  179.255.2.43
  179.26.236.153
  179.27.60.34
  179.27.66.74
-179.27.67.250
  179.27.73.234
  179.27.83.222
-179.29.217.151
  179.35.6.123
-179.4.136.174
-179.4.138.48
+179.40.67.173
  179.40.75.1
-179.42.107.128
-179.42.205.50
  179.43.101.47
  179.43.128.245
  179.43.134.154
@@ -46447,13 +38955,11 @@
  179.43.146.204
  179.43.146.230
  179.43.148.213
-179.43.149.12
  179.43.149.13
  179.43.149.17
  179.43.149.19
  179.43.149.24
  179.43.149.25
-179.43.151.219
  179.43.157.119
  179.43.157.77
  179.43.160.204
@@ -46475,26 +38981,23 @@
  179.43.176.193
  179.43.60.1
  179.43.80.6
-179.43.82.18
  179.43.97.40
  179.48.156.252
  179.48.251.188
-179.49.133.175
  179.49.57.150
  179.5.118.12
  179.51.193.90
+179.52.121.66
+179.53.58.47
  179.53.73.70
-179.54.191.14
  179.56.248.64
-179.57.254.69
-179.60.127.234
  179.60.127.45
-179.60.127.80
-179.60.215.139
  179.60.215.147
+179.60.215.172
  179.60.243.38
+179.60.245.44
+179.61.134.77
  179.61.146.127
-179.61.153.44
  179.61.155.56
  179.61.156.15
  179.61.158.119
@@ -46503,35 +39006,34 @@
  179.61.162.145
  179.61.162.146
  179.61.162.149
-179.61.166.5
-179.61.167.24
+179.61.167.29
  179.61.167.31
  179.61.169.102
+179.61.188.221
  179.61.251.117
  179.63.254.90
-179.67.21.157
+179.66.104.3
  179.83.160.172
  179.83.182.72
  179.83.245.72
  179.84.172.22
+179.84.173.90
  179.89.48.23
  179.9.160.50
-179.93.120.11
+179.92.174.63
  179.93.149.17
+179.95.197.17
  179.95.232.131
  179.96.184.70
  179.96.20.138
  179.96.28.225
  179.96.62.105
-179.96.62.29
-179.97.151.181
+179.97.151.47
+179.97.16.52
  179.97.230.16
  179.97.231.224
  179.97.241.239
-179.97.241.96
-179.97.45.2
  179.98.61.136
-179.99.180.75
  179.99.195.60
  179.99.200.39
  179.99.203.139
@@ -46588,29 +39090,27 @@
  18.138.254.166
  18.138.58.123
  18.139.212.16
-18.140.1.91
  18.140.148.89
  18.140.158.23
  18.140.197.73
  18.140.214.227
-18.140.52.56
-18.141.175.198
  18.141.210.87
  18.141.215.197
  18.141.237.207
  18.144.49.66
  18.144.54.86
  18.144.73.74
+18.156.120.175
  18.156.64.16
  18.156.81.115
  18.157.86.215
  18.158.93.160
+18.159.127.240
  18.159.226.230
  18.159.53.170
  18.159.60.231
  18.162.120.42
  18.162.142.52
-18.162.154.214
  18.162.156.95
  18.162.184.105
  18.162.207.211
@@ -46631,7 +39131,6 @@
  18.166.209.177
  18.166.212.138
  18.166.226.142
-18.166.64.178
  18.166.71.221
  18.177.13.247
  18.177.144.21
@@ -46643,7 +39142,6 @@
  18.179.60.136
  18.18.248.17
  18.181.109.120
-18.181.147.67
  18.181.173.197
  18.181.19.96
  18.181.194.135
@@ -46660,6 +39158,7 @@
  18.183.186.156
  18.183.189.102
  18.183.19.86
+18.183.7.227
  18.183.89.59
  18.184.117.78
  18.184.168.100
@@ -46684,21 +39183,18 @@
  18.188.2.244
  18.188.210.105
  18.188.211.162
-18.188.23.127
  18.188.25.0
  18.188.34.228
  18.188.40.131
  18.188.66.202
  18.188.69.107
  18.188.8.106
-18.188.95.56
  18.189.171.33
  18.190.125.175
  18.191.109.28
  18.191.145.149
  18.191.159.221
  18.191.17.165
-18.191.170.151
  18.191.174.150
  18.191.174.89
  18.191.177.83
@@ -46719,8 +39215,8 @@
  18.193.113.81
  18.193.249.96
  18.193.3.1
+18.193.5.93
  18.193.6.164
-18.193.94.239
  18.194.101.171
  18.194.12.219
  18.194.124.47
@@ -46743,7 +39239,6 @@
  18.197.121.76
  18.197.130.212
  18.197.142.90
-18.197.159.24
  18.197.172.46
  18.197.194.34
  18.197.34.112
@@ -46759,7 +39254,6 @@
  18.202.173.173
  18.202.230.228
  18.202.248.174
-18.202.254.38
  18.202.48.131
  18.202.91.9
  18.202.97.50
@@ -46776,11 +39270,9 @@
  18.206.238.251
  18.206.58.239
  18.206.79.198
-18.206.96.221
  18.207.105.173
  18.207.110.64
  18.207.123.167
-18.207.220.28
  18.207.230.252
  18.207.3.158
  18.207.34.254
@@ -46793,15 +39285,12 @@
  18.208.206.146
  18.209.109.128
  18.209.163.103
-18.209.196.148
  18.209.3.109
  18.209.98.50
  18.210.131.127
  18.210.151.106
  18.211.184.174
  18.211.61.27
-18.212.104.229
-18.212.144.128
  18.212.155.144
  18.212.169.223
  18.212.222.147
@@ -46846,7 +39335,6 @@
  18.217.66.164
  18.217.75.7
  18.217.87.238
-18.218.104.2
  18.218.114.49
  18.218.130.236
  18.218.137.190
@@ -46879,7 +39367,6 @@
  18.219.151.45
  18.219.162.70
  18.219.171.94
-18.219.182.19
  18.219.249.229
  18.219.26.31
  18.219.34.221
@@ -46904,14 +39391,13 @@
  18.220.215.19
  18.220.223.47
  18.220.27.214
+18.220.32.158
  18.220.44.42
-18.220.53.140
  18.220.55.175
  18.220.61.17
+18.220.68.185
  18.220.72.19
-18.221.124.198
  18.221.130.116
-18.221.138.31
  18.221.143.49
  18.221.162.186
  18.221.162.53
@@ -46926,7 +39412,6 @@
  18.221.73.98
  18.221.80.48
  18.221.93.208
-18.221.97.55
  18.221.98.132
  18.222.120.10
  18.222.149.209
@@ -46986,7 +39471,6 @@
  18.231.24.24
  18.231.64.206
  18.231.83.8
-18.232.123.157
  18.232.133.51
  18.232.177.20
  18.232.77.159
@@ -47000,9 +39484,7 @@
  18.234.174.252
  18.234.208.74
  18.234.221.133
-18.234.228.180
  18.234.79.31
-18.234.84.116
  18.236.105.250
  18.236.113.157
  18.236.117.187
@@ -47027,19 +39509,15 @@
  18.237.9.108
  18.27.197.252
  18.27.79.17
-180.100.206.35
  180.100.243.210
-180.100.74.4
  180.101.145.234
-180.101.147.147
-180.101.186.24
-180.101.186.45
  180.101.221.152
-180.101.248.148
-180.101.9.174
-180.102.133.27
+180.102.249.9
+180.103.154.145
  180.103.154.66
+180.103.180.103
  180.103.180.23
+180.103.250.88
  180.103.58.76
  180.104.124.34
  180.104.13.145
@@ -47055,53 +39533,43 @@
  180.104.195.81
  180.104.214.249
  180.104.223.191
-180.104.228.25
  180.104.239.146
  180.104.239.184
  180.104.247.126
  180.104.36.208
  180.104.39.202
  180.104.59.28
-180.104.61.105
  180.104.61.229
  180.104.74.135
  180.104.76.83
-180.104.77.101
  180.104.79.77
  180.104.85.70
  180.104.9.150
  180.106.122.237
-180.106.151.233
+180.106.195.23
  180.106.246.143
-180.106.81.126
-180.107.109.21
  180.107.128.227
  180.107.134.189
-180.107.135.17
+180.107.134.212
+180.107.135.153
  180.107.58.167
  180.107.76.147
  180.107.94.190
-180.108.121.15
+180.108.121.122
  180.108.207.145
  180.108.207.161
+180.108.52.24
+180.108.79.190
  180.109.32.2
-180.109.36.200
  180.109.38.50
-180.11.20.113
-180.110.165.59
  180.111.186.219
-180.111.4.78
  180.111.90.68
  180.112.185.135
  180.112.189.18
-180.112.191.121
  180.113.199.43
-180.114.100.68
  180.114.101.116
-180.114.152.122
  180.114.169.253
  180.114.194.102
-180.114.205.91
  180.114.77.193
  180.115.100.182
  180.115.112.173
@@ -47142,7 +39610,6 @@
  180.117.195.21
  180.117.216.111
  180.117.217.64
-180.117.232.227
  180.117.232.77
  180.117.89.155
  180.117.89.28
@@ -47153,28 +39620,19 @@
  180.118.34.100
  180.118.34.12
  180.118.50.46
-180.119.111.29
-180.119.153.30
  180.119.153.46
  180.119.183.89
  180.120.12.85
  180.120.175.141
-180.120.208.242
  180.120.208.89
  180.120.212.103
-180.120.29.210
  180.120.79.159
-180.121.129.166
-180.121.131.102
  180.121.132.182
-180.121.134.28
  180.121.247.122
-180.122.53.97
  180.123.108.63
  180.123.111.168
  180.123.118.18
  180.123.151.213
-180.123.153.126
  180.123.170.16
  180.123.171.247
  180.123.182.96
@@ -47194,7 +39652,6 @@
  180.123.65.30
  180.123.68.216
  180.123.77.166
-180.123.82.138
  180.123.83.179
  180.123.85.50
  180.123.89.196
@@ -47210,7 +39667,6 @@
  180.124.127.227
  180.124.132.176
  180.124.134.163
-180.124.135.35
  180.124.146.205
  180.124.167.252
  180.124.174.33
@@ -47229,66 +39685,44 @@
  180.124.65.115
  180.124.66.38
  180.124.66.76
-180.124.67.159
  180.124.73.160
  180.124.75.190
  180.124.76.76
  180.124.80.233
  180.124.90.224
-180.125.124.45
  180.125.169.29
  180.125.170.131
-180.125.212.107
-180.125.227.194
  180.125.238.156
  180.125.239.161
  180.125.243.242
  180.125.245.38
  180.125.249.94
  180.125.44.203
-180.125.96.10
  180.125.98.225
-180.127.71.85
-180.127.76.185
+180.127.111.161
  180.127.77.109
-180.127.93.215
  180.128.0.237
  180.128.1.30
  180.128.1.87
-180.129.14.236
-180.129.172.81
  180.129.37.154
-180.131.52.76
-180.136.133.184
  180.136.96.44
  180.137.148.20
-180.137.239.39
  180.137.45.182
-180.139.113.30
  180.139.124.79
-180.139.220.179
-180.140.153.133
-180.140.177.181
-180.141.33.105
-180.141.35.30
+180.139.124.99
  180.142.130.246
-180.142.158.180
  180.142.58.31
  180.148.215.101
  180.148.33.203
  180.148.4.130
  180.148.4.194
  180.149.125.139
-180.149.225.29
  180.149.240.54
-180.149.243.178
  180.149.245.78
-180.149.67.118
  180.149.96.131
  180.150.19.243
  180.150.21.41
  180.150.226.44
-180.150.226.98
  180.150.226.99
  180.150.227.149
  180.150.227.197
@@ -47307,33 +39741,23 @@
  180.150.86.215
  180.151.130.151
  180.151.198.70
-180.151.3.43
-180.151.3.45
  180.151.43.134
  180.151.56.119
  180.151.56.99
  180.151.63.66
  180.151.80.125
-180.152.152.60
-180.152.233.91
  180.152.238.117
-180.153.57.132
-180.153.65.120
-180.153.68.54
  180.153.91.17
-180.153.91.83
  180.156.116.56
  180.157.10.59
-180.157.134.17
+180.158.13.129
  180.158.177.21
  180.162.157.235
-180.163.220.3
-180.163.220.46
  180.164.100.189
  180.164.168.58
  180.164.58.29
-180.165.229.156
  180.165.229.187
+180.165.9.116
  180.166.114.14
  180.166.117.254
  180.166.208.56
@@ -47341,22 +39765,16 @@
  180.166.220.179
  180.166.228.228
  180.166.233.162
-180.167.101.162
  180.167.126.126
  180.167.168.2
  180.167.195.218
-180.167.201.243
  180.167.207.234
-180.167.216.198
  180.167.220.230
  180.167.225.118
-180.167.227.11
  180.167.240.222
  180.167.53.18
  180.167.60.22
-180.167.67.133
  180.168.112.218
-180.168.135.173
  180.168.141.246
  180.168.144.2
  180.168.201.126
@@ -47364,64 +39782,28 @@
  180.168.37.135
  180.168.47.238
  180.168.5.114
-180.168.51.110
-180.168.76.230
-180.168.87.50
  180.168.95.234
-180.169.12.205
  180.169.128.34
  180.169.131.156
-180.169.166.87
-180.169.17.112
-180.169.17.21
-180.169.17.30
-180.169.17.51
  180.169.214.21
-180.169.241.230
-180.169.52.242
-180.169.76.210
  180.171.17.176
-180.171.66.170
  180.173.0.223
-180.173.1.130
-180.173.1.175
-180.173.1.226
-180.173.1.43
-180.173.3.41
-180.174.234.69
-180.174.250.255
  180.175.196.51
-180.175.199.165
-180.176.166.7
  180.176.214.171
  180.176.214.171bin.sh
  180.176.214.37
-180.176.244.166
-180.176.245.58
-180.176.34.51
  180.176.40.147
  180.176.41.187
-180.177.117.142
-180.177.128.163
  180.177.180.6
-180.177.187.217
-180.177.214.23
-180.177.240.209
-180.177.241.156
  180.177.243.251
-180.177.56.207
-180.177.80.86
-180.178.111.74
  180.178.134.162
  180.178.135.98
  180.178.37.186
-180.178.50.243
-180.178.51.250
  180.178.63.10
-180.178.94.18
  180.178.97.90
  180.179.98.22
  180.180.100.236
+180.180.101.169
  180.180.102.180
  180.180.102.211
  180.180.104.133
@@ -47432,79 +39814,54 @@
  180.180.123.41
  180.180.124.248
  180.180.141.131
-180.180.146.18
-180.180.146.20
  180.180.152.114
  180.180.152.94
  180.180.152.98
  180.180.156.15
-180.180.16.8
  180.180.170.188
  180.180.171.113
  180.180.175.37
  180.180.175.70
  180.180.216.177
-180.180.217.18
  180.180.218.12
-180.180.235.188
  180.180.241.93
  180.180.71.150
  180.180.72.132
  180.180.75.79
  180.180.8.5
  180.180.99.22
-180.182.228.195
-180.182.228.200
-180.182.228.203
-180.182.229.198
-180.182.229.203
-180.182.234.12
-180.182.234.14
-180.182.234.16
-180.182.234.17
-180.182.234.18
-180.182.236.146
-180.182.245.131
-180.182.245.134
-180.182.245.135
-180.182.245.144
-180.182.245.79
-180.182.245.93
-180.182.245.94
-180.182.245.95
+180.181.156.241
+180.181.159.200
  180.182.47.132
  180.183.0.191
+180.183.10.107
  180.183.115.179
  180.183.139.12
  180.183.180.18
  180.183.2.235
  180.183.225.114
+180.183.225.236
  180.183.226.212
  180.183.227.145
-180.183.227.213
-180.183.229.43
  180.183.231.111
  180.183.24.19
-180.183.3.175
+180.183.3.198
  180.183.3.202
  180.183.4.175
  180.183.4.21
  180.183.4.95
  180.183.44.213
-180.183.6.143
  180.183.6.246
  180.183.6.251
-180.188.17.119
-180.188.241.202
-180.188.247.217
-180.188.247.218
-180.188.247.242
  180.189.191.27
  180.190.118.21
  180.191.157.131
  180.191.158.14
  180.191.158.3
  180.191.159.137
+180.191.234.22
+180.191.239.37
+180.210.128.81
  180.210.201.54
  180.210.201.57
  180.210.205.53
@@ -47538,13 +39895,10 @@
  180.211.102.186
  180.211.115.155
  180.211.120.61
-180.211.136.38
  180.211.141.158
  180.211.158.122
-180.211.158.26
  180.211.162.114
  180.211.162.146
-180.211.162.198
  180.211.170.214
  180.211.172.151
  180.211.179.150
@@ -47566,54 +39920,31 @@
  180.211.95.234
  180.211.97.204
  180.213.4.122
-180.214.236.211
  180.214.236.98
-180.214.237.123
-180.214.238.124
+180.214.237.13
  180.214.238.5
-180.214.239.233
  180.214.239.54
-180.215.199.92
  180.215.203.121
-180.215.204.149
  180.215.204.153
  180.215.204.156
-180.215.204.179
-180.215.207.155
  180.215.214.77
  180.215.214.88
-180.215.215.207
-180.215.215.211
-180.215.215.216
  180.215.216.226
-180.215.221.210
+180.215.224.89
  180.215.227.16
  180.215.227.32
  180.216.157.217
  180.216.222.168
-180.218.122.144
-180.218.164.132
-180.218.214.210
-180.218.96.231
-180.218.96.40
  180.226.47.134
  180.231.241.26
  180.232.123.251
-180.232.99.46
  180.233.106.140
-180.233.192.151
-180.233.203.123
-180.233.211.12
-180.233.215.154
-180.233.215.80
-180.233.242.169
-180.233.252.195
  180.234.83.202
  180.235.131.131
  180.235.138.114
  180.235.138.247
  180.235.138.96
-180.235.73.232
+180.235.149.186
  180.241.127.226
  180.241.153.213
  180.241.154.25
@@ -47621,16 +39952,10 @@
  180.241.252.170
  180.241.255.226
  180.241.75.230
-180.242.180.63
-180.243.223.56
-180.244.107.83
+180.244.10.33
  180.244.233.9
-180.244.234.167
  180.244.235.132
-180.244.66.64
  180.244.70.45
-180.244.83.137
-180.245.158.170
  180.245.173.204
  180.246.175.238
  180.246.205.208
@@ -47642,16 +39967,14 @@
  180.247.48.106
  180.247.51.198
  180.248.1.206
-180.248.109.185
  180.248.153.176
  180.248.5.19
-180.249.109.210
  180.249.167.5
  180.249.169.49
  180.249.231.79
-180.249.79.148
  180.250.111.86
  180.250.115.121
+180.250.12.10
  180.250.124.227
  180.250.131.94
  180.250.136.138
@@ -47668,6 +39991,8 @@
  180.250.207.164
  180.250.210.185
  180.250.247.45
+180.250.248.169
+180.250.248.170
  180.250.49.138
  180.250.50.253
  180.250.54.161
@@ -47675,14 +40000,12 @@
  180.250.54.27
  180.250.68.154
  180.250.77.218
+180.250.84.122
  180.250.88.165
  180.250.97.19
  180.251.146.136
  180.251.165.254
  180.252.114.186
-180.252.166.249
-180.252.19.227
-180.252.241.29
  180.253.136.63
  180.253.138.182
  180.253.160.144
@@ -47693,9 +40016,7 @@
  180.253.77.217
  180.253.78.206
  180.254.12.125
-180.254.2.191
  180.254.34.139
-180.28.2.180
  180.33.192.153
  180.64.119.38
  180.66.102.25
@@ -47704,77 +40025,51 @@
  180.69.194.16
  180.69.254.177
  180.69.27.217
-180.70.54.135
+180.69.52.107
  180.71.47.198
  180.71.58.134
  180.76.101.229
-180.76.101.241
  180.76.103.247
  180.76.104.101
  180.76.105.165
-180.76.108.66
-180.76.108.73
-180.76.111.214
  180.76.111.247
-180.76.114.218
-180.76.115.123
-180.76.115.226
  180.76.115.239
-180.76.120.135
  180.76.121.95
  180.76.124.150
-180.76.133.173
  180.76.135.173
-180.76.135.236
  180.76.136.193
  180.76.137.224
-180.76.138.132
-180.76.139.101
-180.76.140.184
  180.76.141.221
  180.76.141.248
-180.76.143.116
-180.76.144.99
-180.76.146.60
  180.76.147.52
-180.76.148.147
  180.76.148.87
  180.76.152.17
  180.76.152.65
  180.76.155.19
  180.76.158.36
-180.76.160.148
  180.76.160.35
-180.76.161.41
  180.76.163.86
-180.76.165.254
  180.76.165.92
  180.76.167.16
  180.76.171.110
  180.76.171.20
  180.76.171.230
-180.76.171.57
+180.76.174.102
  180.76.174.59
  180.76.175.161
-180.76.175.170
  180.76.175.234
-180.76.177.194
  180.76.178.253
  180.76.179.213
  180.76.180.140
  180.76.180.231
  180.76.181.47
-180.76.182.238
  180.76.183.218
  180.76.184.227
  180.76.188.98
-180.76.190.78
  180.76.231.121
-180.76.232.66
  180.76.234.185
  180.76.234.68
  180.76.235.75
-180.76.236.146
  180.76.236.239
  180.76.238.183
  180.76.238.69
@@ -47782,7 +40077,6 @@
  180.76.239.149
  180.76.242.171
  180.76.242.204
-180.76.242.233
  180.76.245.228
  180.76.246.205
  180.76.246.222
@@ -47792,49 +40086,32 @@
  180.76.250.18
  180.76.51.143
  180.76.53.100
+180.76.53.208
  180.76.53.241
-180.76.54.123
  180.76.54.86
  180.76.56.29
  180.76.56.69
  180.76.57.17
-180.76.60.6
+180.76.57.58
  180.76.96.164
  180.76.97.180
-180.83.132.133
  180.87.195.22
  180.89.58.27
-180.92.226.138
  180.92.233.82
  180.92.238.251
  180.92.239.110
  180.92.239.217
-180.94.138.193
  180.94.170.166
  180.94.188.76
  180.94.64.114
-180.94.71.82
-180.95.183.214
-180.95.220.72
  180.96.11.20
-180.96.62.129
  180.96.63.162
  180.97.182.111
  180.97.182.226
-180.97.193.184
  180.97.197.171
-180.97.30.188
-180.97.30.208
-180.97.31.211
  180.97.31.28
-180.97.31.68
-180.97.4.52
-180.97.68.226
-180.97.68.229
  180.97.80.12
-180.97.80.203
  180.97.80.246
-180.97.90.143
  18013.url.789msw.com
  180betper.blogspot.com
  180clubrealestate.com
@@ -47845,7 +40122,6 @@
  181.10.203.18
  181.10.204.106
  181.10.210.99
-181.10.250.146
  181.10.45.170
  181.102.102.57
  181.102.111.47
@@ -47870,7 +40146,6 @@
  181.112.49.206
  181.112.56.94
  181.112.57.2
-181.112.57.62
  181.113.121.158
  181.113.131.98
  181.113.135.214
@@ -47887,40 +40162,37 @@
  181.113.66.146
  181.113.67.54
  181.113.67.74
-181.114.101.78
+181.114.103.37
  181.114.110.217
-181.114.208.184
+181.114.208.78
+181.114.211.150
+181.114.211.83
  181.114.212.131
  181.114.222.250
-181.114.99.237
  181.115.146.34
  181.115.156.59
+181.115.166.241
  181.115.168.69
  181.115.204.74
-181.115.221.99
  181.115.242.114
  181.115.38.146
  181.116.50.170
-181.117.35.243
  181.118.101.22
+181.118.109.202
  181.119.112.188
-181.119.160.58
  181.119.20.201
  181.119.27.62
  181.119.30.26
  181.120.129.151
-181.120.218.5
  181.120.232.66
  181.120.29.49
  181.121.72.54
-181.123.12.241
  181.123.6.86
  181.124.33.92
  181.126.70.117
  181.126.83.37
  181.127.188.79
  181.129.104.139
-181.129.130.226
  181.129.134.18
  181.129.14.218
  181.129.144.59
@@ -47942,7 +40214,6 @@
  181.129.52.154
  181.129.52.156
  181.129.52.158
-181.129.52.98
  181.129.62.2
  181.129.62.67
  181.129.66.138
@@ -47952,8 +40223,6 @@
  181.129.96.162
  181.129.98.146
  181.13.110.44
-181.13.116.182
-181.13.116.28
  181.13.3.245
  181.130.133.135
  181.134.5.173
@@ -47961,7 +40230,6 @@
  181.137.229.1
  181.143.10.130
  181.143.101.18
-181.143.101.194
  181.143.106.162
  181.143.111.10
  181.143.157.242
@@ -47978,54 +40246,43 @@
  181.143.73.34
  181.143.79.154
  181.143.81.52
-181.143.91.190
-181.15.121.74
  181.15.154.154
  181.15.154.156
  181.16.136.1
  181.16.136.41
  181.16.17.210
-181.16.224.218
  181.16.41.215
  181.164.0.167
  181.164.132.26
  181.164.203.22
-181.164.237.201
-181.164.95.113
  181.165.107.69
  181.165.200.185
  181.165.67.138
  181.165.68.127
  181.166.106.224
-181.167.12.178
  181.167.243.89
  181.167.247.186
  181.168.206.106
-181.169.235.110
-181.169.37.247
-181.170.162.205
-181.170.38.238
  181.170.47.156
+181.171.209.241
  181.174.100.66
-181.174.102.239
+181.174.107.214
  181.174.122.26
  181.174.166.112
  181.174.166.113
  181.174.166.9
+181.174.183.25
  181.174.194.62
-181.174.55.16
-181.175.50.181
+181.176.161.137
  181.176.161.19
  181.176.164.179
+181.176.169.79
  181.176.222.68
  181.176.242.168
-181.177.111.174
+181.177.111.110
  181.177.111.47
  181.177.111.67
-181.177.111.79
-181.177.111.85
  181.177.112.106
-181.177.112.114
  181.177.112.115
  181.177.112.119
  181.177.112.122
@@ -48036,11 +40293,6 @@
  181.177.112.56
  181.177.112.7
  181.177.172.130
-181.177.192.116
-181.177.193.92
-181.177.195.245
-181.177.198.142
-181.177.199.21
  181.177.20.15
  181.177.245.165
  181.177.96.129
@@ -48053,59 +40305,49 @@
  181.177.96.99
  181.188.134.133
  181.188.149.134
-181.188.156.58
  181.188.166.74
  181.188.171.55
-181.189.143.106
  181.189.144.206
  181.189.221.245
-181.189.222.130
  181.189.224.122
  181.189.234.66
  181.189.235.134
  181.191.180.110
-181.191.205.74
+181.191.250.45
  181.191.82.196bin.sh
  181.191.85.114
  181.191.98.227
-181.193.48.228
+181.192.2.233
  181.194.114.250
  181.196.0.214
  181.196.1.1
  181.196.1.94
  181.196.145.106
  181.196.181.146
+181.196.2.139
+181.196.2.210
  181.196.2.27
  181.196.205.250
  181.196.207.202
  181.196.242.126
  181.196.244.182
  181.196.254.202
+181.196.3.129
+181.196.3.29
  181.196.57.150
  181.196.57.230
  181.197.108.171
  181.197.120.105
-181.197.99.105
  181.198.182.19
-181.198.192.179
  181.198.2.22
  181.198.203.45
  181.198.42.229
-181.198.91.203
  181.198.97.241
  181.199.109.36
-181.199.146.216
-181.199.162.111
-181.199.170.201
-181.199.170.204
  181.199.170.205
-181.199.170.208
  181.199.170.222
  181.199.170.230
-181.199.228.255
  181.206.20.11
-181.206.95.27
-181.208.213.96
  181.209.107.186
  181.209.107.188
  181.209.134.138
@@ -48117,7 +40359,6 @@
  181.209.82.154
  181.209.91.154
  181.21.242.9
-181.21.97.252
  181.210.30.243
  181.211.101.90
  181.211.11.78
@@ -48126,6 +40367,7 @@
  181.211.241.210
  181.211.245.74
  181.211.246.18
+181.211.249.178
  181.211.249.182
  181.211.250.122
  181.211.250.138
@@ -48137,13 +40379,16 @@
  181.214.209.20
  181.214.211.93
  181.214.87.25
+181.214.89.242
  181.214.89.251
-181.214.91.132
  181.214.92.100
  181.215.114.160
+181.215.14.149
  181.215.14.156
  181.215.157.149
  181.215.157.181
+181.215.157.206
+181.215.18.39
  181.215.18.50
  181.215.204.183
  181.215.4.127
@@ -48156,33 +40401,25 @@
  181.225.65.244
  181.225.99.67
  181.226.166.36
-181.226.176.227
-181.226.41.20
  181.228.140.207
  181.231.220.232
  181.231.54.156
  181.234.61.21
-181.234.70.194
  181.236.221.138
  181.236.224.4
  181.236.246.224
  181.236.247.136
  181.238.51.152
-181.239.185.129
+181.238.56.164
  181.26.66.220
  181.28.101.14
  181.28.152.133
  181.29.74.60
  181.30.101.242
  181.30.126.66
-181.30.169.222
  181.30.28.174
  181.30.28.198
-181.30.28.201
-181.30.28.219
  181.30.28.22
-181.30.28.223
-181.30.28.51
  181.30.28.73
  181.30.28.83
  181.30.30.166
@@ -48194,30 +40431,27 @@
  181.30.99.114
  181.31.151.127
  181.31.213.158
-181.31.51.181
  181.36.42.205
  181.39.135.122
  181.39.32.99
  181.40.122.102
  181.40.122.2
-181.40.66.11
  181.40.73.86
  181.40.76.162
  181.40.84.38
  181.41.241.240
+181.41.254.1
  181.44.116.72
  181.44.6.160
  181.44.71.130
  181.45.99.149
-181.46.179.140
+181.46.137.107
  181.46.68.4
-181.46.71.161
  181.47.113.213
  181.47.30.16
  181.48.105.6
-181.48.115.227
+181.48.111.246
  181.48.120.220
-181.48.130.98
  181.48.134.66
  181.48.139.118
  181.48.147.11
@@ -48227,17 +40461,12 @@
  181.48.184.162
  181.48.19.161
  181.48.225.126
-181.48.28.13
-181.48.32.134
  181.48.37.170
  181.48.46.195
-181.48.47.26
  181.48.54.202
  181.48.58.74
  181.48.7.146
  181.48.77.26
-181.48.90.61
-181.48.99.122
  181.49.106.227
  181.49.106.228
  181.49.107.180
@@ -48256,10 +40485,13 @@
  181.49.53.106
  181.49.54.250
  181.49.96.186
+181.5.194.16
  181.5.209.27
  181.5.228.7
+181.5.235.70
  181.5.237.28
  181.5.246.179
+181.50.102.158
  181.50.251.25
  181.51.253.136
  181.52.121.54
@@ -48275,20 +40507,14 @@
  181.55.95.52
  181.56.9.15
  181.57.151.214
-181.57.153.190
-181.57.167.193
  181.57.168.174
-181.57.179.198
-181.57.186.105
  181.57.97.189
  181.57.98.228
  181.58.181.9
  181.58.189.155
-181.59.56.102
  181.59.59.54
  181.6.101.250
  181.6.119.61
-181.6.12.17
  181.6.132.26
  181.6.136.169
  181.6.14.212
@@ -48324,24 +40550,22 @@
  181.6.76.90
  181.6.80.155
  181.6.82.85
+181.6.85.60
  181.6.86.202
  181.6.91.152
-181.60.78.91
  181.61.182.143
  181.61.222.32
  181.62.245.247
  181.62.250.214
  181.62.38.153
  181.63.248.149
+181.63.253.138
  181.63.253.20
  181.64.160.234
-181.64.93.135
-181.65.10.50
  181.65.138.218
  181.65.142.122
  181.65.142.125
  181.65.155.20
-181.65.157.134
  181.65.215.229
  181.65.227.194
  181.7.197.106
@@ -48352,164 +40576,134 @@
  181.7.212.24
  181.7.213.182
  181.7.215.119
-181.7.223.216
  181.7.233.81
  181.7.233.92
  181.7.234.50
-181.7.242.43
  181.7.245.123
  181.72.201.229
-181.73.4.137
  181.75.255.225
  181.78.12.115
-181.78.18.177
  181.78.18.66
  181.80.18.10
-181.81.210.128
-181.81.211.44
  181.88.176.122
-181.89.59.254
-181.91.36.154
  181.94.221.15
  181.94.226.188
  181.94.39.54
-181.94.42.45
  18141190156-xxyyzzaa.azurewebsites.net
  18190.8wix.com
  182.101.185.249
  182.101.207.11
-182.101.207.128
-182.107.159.79
-182.111.24.177
-182.112.16.164
-182.112.20.113
+182.112.18.42
  182.112.212.167
-182.112.212.70
  182.112.216.28
-182.112.27.176
-182.112.32.75
-182.112.43.25
-182.112.53.81
-182.112.54.223
-182.112.63.197
+182.112.216.37
+182.112.24.63
+182.112.26.8
+182.112.27.65
  182.112.9.196
+182.112.96.74
+182.113.102.198
  182.113.137.105
-182.113.169.191
-182.113.2.160
-182.113.21.46
  182.113.211.248
  182.113.215.240
-182.113.222.198
+182.113.219.214
  182.113.228.239
-182.113.23.130
-182.113.243.63
+182.113.230.234
  182.113.43.246
  182.113.58.37
+182.113.8.42
+182.113.9.166
  182.114.1.197
  182.114.105.74
  182.114.124.193
-182.114.125.218
-182.114.16.114
+182.114.196.193
+182.114.20.118
  182.114.20.91
-182.114.207.155
-182.114.208.219
-182.114.23.21
  182.114.23.65
  182.114.254.27
  182.114.254.79
-182.114.51.191
+182.114.3.164
  182.114.64.33
-182.114.71.185
-182.114.81.119
-182.114.85.76
+182.114.69.157
+182.114.88.145
  182.114.88.153
-182.114.92.142
+182.114.89.114
  182.114.92.204
  182.114.99.106
-182.115.146.242
-182.115.186.114
+182.115.178.47
  182.115.199.21
-182.115.86.42
-182.116.101.201
-182.116.101.242
  182.116.101.36
  182.116.102.170
  182.116.102.196
  182.116.104.54
  182.116.105.119
-182.116.106.133
+182.116.106.210
  182.116.106.86
  182.116.107.4
  182.116.108.16
  182.116.109.252
-182.116.109.47
  182.116.110.177
-182.116.115.129
+182.116.110.75
  182.116.115.46
  182.116.115.78
+182.116.117.212
+182.116.118.70
  182.116.36.174
  182.116.38.160
+182.116.64.23
  182.116.64.48
-182.116.64.93
-182.116.69.90
+182.116.68.120
  182.116.70.143
  182.116.70.149
  182.116.71.231
  182.116.74.106
-182.116.78.135
-182.116.79.48
+182.116.74.118
+182.116.77.249
  182.116.80.239
+182.116.92.17
  182.116.96.16
  182.116.96.194
  182.116.98.31
  182.116.99.66
  182.117.10.20
  182.117.100.86
-182.117.102.206
  182.117.102.58
  182.117.103.176
  182.117.108.134
  182.117.108.151
  182.117.109.104
-182.117.11.33
-182.117.110.180
  182.117.111.133
  182.117.113.240
  182.117.116.45
-182.117.129.254
-182.117.14.186
-182.117.155.114
-182.117.156.9
-182.117.2.81
  182.117.207.206
  182.117.225.137
  182.117.227.55
  182.117.230.78
-182.117.24.113
-182.117.240.27
+182.117.24.180
  182.117.26.149
  182.117.27.218
  182.117.28.104
-182.117.4.34
+182.117.29.125
+182.117.31.113
  182.117.43.196
-182.117.50.149
  182.117.64.119
-182.117.64.18
  182.117.64.26
-182.117.65.242
+182.117.65.179
  182.117.67.215
-182.117.68.130
  182.117.68.56
+182.117.69.121
  182.117.70.99
+182.117.71.114
  182.117.71.15
  182.117.71.196
  182.117.72.247
  182.117.73.120
-182.117.73.166
  182.117.73.80
  182.117.74.122
+182.117.74.221
  182.117.75.235
  182.117.75.31
+182.117.76.33
  182.117.76.68
  182.117.77.198
  182.117.77.61
@@ -48521,260 +40715,208 @@
  182.117.84.154
  182.117.85.22
  182.117.85.50
-182.117.86.126
-182.117.86.74
+182.117.86.211
  182.117.89.131
  182.117.91.214
  182.117.91.235
-182.117.94.151
  182.117.94.187
  182.117.94.81
  182.117.96.14
-182.117.98.36
-182.117.99.186
+182.117.96.46
+182.118.164.248
+182.118.172.183
+182.118.46.94
  182.119.1.56
  182.119.10.219
+182.119.10.76
  182.119.10.84
+182.119.11.36
  182.119.111.101
+182.119.119.151
  182.119.12.199
-182.119.139.110
  182.119.15.195
-182.119.15.70
-182.119.160.171
+182.119.15.236
  182.119.160.254
-182.119.163.105
-182.119.165.90
  182.119.166.162
-182.119.166.78
  182.119.167.42
  182.119.180.97
-182.119.182.74
+182.119.187.174
  182.119.189.90
  182.119.191.68
-182.119.201.197
-182.119.203.37
+182.119.202.145
  182.119.205.173
-182.119.205.19
-182.119.205.32
  182.119.207.145
-182.119.209.158
  182.119.210.90
  182.119.215.94
  182.119.219.132
-182.119.225.223
-182.119.226.158
-182.119.248.82
+182.119.225.100
  182.119.253.37
  182.119.255.88
  182.119.32.89
-182.119.47.254
+182.119.4.28
  182.119.49.220
+182.119.56.218
+182.119.57.161
  182.119.58.36
-182.119.59.154
-182.119.59.77
-182.119.62.217
+182.119.62.112
  182.119.9.51
  182.119.96.154
-182.120.122.154
  182.120.16.115
  182.120.16.8
  182.120.161.131
+182.120.163.19
+182.120.165.129
  182.120.167.250
  182.120.17.8
-182.120.185.134
  182.120.246.185
  182.120.33.50
-182.120.34.115
  182.120.36.28bin.sh
  182.120.40.42
-182.120.45.218
  182.120.45.239
  182.120.46.99
-182.120.49.136
-182.120.53.198
+182.120.53.66
+182.120.58.13
+182.120.59.124
+182.120.59.88
  182.120.63.238
+182.121.100.185
+182.121.117.130
  182.121.117.254
-182.121.127.26
+182.121.118.249
+182.121.119.209
  182.121.127.77
+182.121.133.116
  182.121.134.229
-182.121.144.139
  182.121.157.170
+182.121.158.19
+182.121.159.8
  182.121.175.167
  182.121.185.217
-182.121.19.218
-182.121.19.254
-182.121.201.236
-182.121.206.189
-182.121.212.150
-182.121.213.178
-182.121.215.193
-182.121.227.239
+182.121.203.239
+182.121.204.103
+182.121.212.17
  182.121.242.249
  182.121.25.182
+182.121.250.42
  182.121.252.193
  182.121.254.86
-182.121.67.76
-182.121.76.228
-182.121.84.244
-182.121.85.159
+182.121.26.146
+182.121.39.158
+182.121.40.30
+182.121.53.193
+182.121.55.176
+182.121.72.16
+182.121.8.208
  182.121.85.97
  182.121.86.154
-182.121.87.234
  182.121.87.66
-182.121.88.162
-182.121.89.2
+182.121.88.5
  182.121.92.16
-182.121.99.203
-182.122.135.78
+182.122.111.50
+182.122.112.10
+182.122.131.162
  182.122.160.137
-182.122.165.127
  182.122.205.202
  182.122.208.61
-182.122.228.190
  182.122.249.8
  182.122.249.87
  182.122.25.85
-182.122.250.21
  182.122.250.217
  182.122.251.231bin.sh
-182.122.255.156
  182.122.56.237
  182.122.61.172
-182.122.85.135
-182.122.86.163
-182.123.143.156
  182.123.145.147
  182.123.208.31
-182.123.209.183
-182.123.210.13
  182.123.210.25
  182.123.211.164
-182.123.240.222
+182.123.246.138
  182.123.251.182
-182.123.254.184
+182.124.1.186
+182.124.115.165
  182.124.159.26
-182.124.210.221
+182.124.177.158
  182.124.210.236
-182.124.219.7
-182.124.30.226
+182.124.234.50
+182.124.33.31
+182.124.35.32
+182.124.48.41
  182.124.5.172
-182.124.75.61
  182.124.88.60
  182.124.95.18
  182.126.101.85
  182.126.110.94
-182.126.112.152
-182.126.112.59
+182.126.114.57
+182.126.114.70
  182.126.116.141
  182.126.118.161
  182.126.119.158
-182.126.122.49
  182.126.122.88
  182.126.193.96
  182.126.194.57
  182.126.196.200
  182.126.204.94
+182.126.209.140
+182.126.211.48
+182.126.230.44
+182.126.234.11
  182.126.234.24
-182.126.234.88
-182.126.55.232
  182.126.65.75
  182.126.69.180
  182.126.69.88
  182.126.71.233
  182.126.73.51
-182.126.82.86
  182.126.85.158
+182.126.85.194
  182.126.86.214
-182.126.89.62
-182.126.91.142
+182.126.88.78
  182.126.91.235
-182.126.93.86
-182.127.107.82
-182.127.108.5
+182.127.1.55
+182.127.113.68
  182.127.119.203
+182.127.127.0
  182.127.130.133
-182.127.135.97
+182.127.131.111
  182.127.136.85
-182.127.15.24
  182.127.152.142
-182.127.155.165
  182.127.155.174
  182.127.156.246
+182.127.164.3
  182.127.171.4
-182.127.177.101
-182.127.177.206
-182.127.179.1
-182.127.186.211
+182.127.176.30
  182.127.202.189
-182.127.207.40
  182.127.214.120
  182.127.214.190
  182.127.29.87
-182.127.66.51
+182.127.75.241
+182.127.79.253
  182.127.92.126
-182.127.96.100
+182.127.96.240
  182.127.99.17
-182.129.181.11
-182.131.21.120
-182.131.5.34
  182.135.63.199
-182.135.63.227
-182.138.103.50
-182.139.1.38
  182.139.182.190
-182.140.138.55
-182.140.138.98
-182.140.233.9
-182.140.235.120
-182.140.235.143
-182.140.235.149
-182.140.235.17
-182.140.235.175
-182.140.235.246
-182.140.244.41
+182.141.234.76
  182.142.112.88
  182.142.115.84
  182.142.118.25
  182.145.110.181
  182.146.166.46
-182.148.106.131
-182.148.107.157
-182.148.107.252
  182.148.12.220
-182.148.122.18
-182.148.122.4
-182.148.122.9
+182.148.15.153
  182.148.49.16
-182.150.2.136
-182.150.2.153
-182.150.2.83
-182.150.22.22
-182.150.3.106
-182.150.3.63
-182.150.45.30
  182.150.57.34
-182.150.63.191
  182.150.63.195
  182.151.16.184
-182.151.2.98
  182.151.204.23
-182.151.214.28
-182.151.3.137
-182.151.32.144
-182.151.34.106
-182.151.37.230
-182.151.46.222
  182.151.59.205
+182.152.15.125
+182.152.15.84
+182.152.33.212
+182.152.74.172
  182.153.23.215
+182.153.232.44
  182.153.35.223
-182.155.16.34
-182.155.188.223
-182.155.60.134
-182.155.62.69
-182.155.73.42
  182.156.209.222
  182.156.213.183
-182.156.251.155
  182.16.10.90
  182.16.10.91
  182.16.10.94
@@ -48798,125 +40940,90 @@
  182.16.178.178
  182.16.179.82
  182.16.181.90
-182.16.184.3
  182.16.245.148
  182.16.245.54
  182.16.255.194
-182.16.28.134
-182.16.31.242
-182.16.4.38
  182.16.44.138
  182.16.44.139
-182.16.5.100
-182.16.5.98
-182.160.103.227
  182.160.104.213
  182.160.109.214
  182.160.110.178
-182.160.115.180
  182.160.117.130
-182.160.122.130
  182.160.124.26
-182.160.127.101
  182.160.127.53
  182.160.163.131
  182.160.96.46
  182.161.19.122
  182.162.104.239
-182.162.17.171
  182.165.90.235
-182.167.119.158
  182.172.36.95
-182.172.5.20
  182.172.94.114
-182.176.114.200
-182.176.129.75
-182.176.148.203
  182.176.203.38
-182.176.93.182
  182.177.213.78
-182.18.139.59
  182.18.144.99
  182.18.152.36
  182.18.153.206
-182.18.178.85
-182.18.180.44
-182.18.24.26
-182.18.5.201
-182.18.72.14
-182.18.72.28
-182.18.72.7
-182.180.119.180
-182.180.119.245
  182.180.122.202
  182.180.128.132
  182.180.128.134
-182.180.191.98
-182.180.5.48
-182.180.6.217
-182.180.77.114
  182.182.5.99
  182.182.80.6
  182.183.133.9
-182.184.112.215
+182.184.58.173
+182.184.76.143
  182.185.163.203
  182.185.171.73
  182.185.194.231
  182.186.15.226
+182.186.209.224
+182.186.44.183
  182.187.113.185
  182.188.194.180
+182.189.106.234
+182.189.106.60
+182.189.108.174
+182.189.232.75
  182.189.32.68
+182.189.43.74
+182.189.47.189
  182.189.49.36
  182.189.56.10
  182.189.58.23
  182.189.60.141
-182.189.60.186
-182.189.60.190
-182.189.60.92
  182.189.63.135
  182.189.67.135
-182.189.74.232
-182.189.76.162
  182.189.82.155
  182.189.94.81
-182.19.166.153
  182.19.171.85
-182.19.38.21
  182.19.41.145
  182.19.65.177
-182.19.85.20
  182.190.111.155
-182.190.207.38
-182.190.213.46
+182.190.201.87
+182.190.208.39
+182.191.114.43
  182.191.84.39
  182.200.20.181
-182.200.21.22
+182.200.20.183
  182.200.22.50
  182.200.23.59
  182.201.242.129
-182.207.219.46
-182.207.221.191
+182.205.1.87
  182.207.221.206
  182.207.222.82
  182.208.124.155
  182.208.252.91
  182.208.30.18
  182.208.98.210
-182.211.207.24
-182.212.80.68
-182.222.167.237
  182.222.195.145
  182.222.195.192
  182.222.195.217
  182.23.103.6
  182.23.104.213
  182.23.12.194
-182.23.126.68
+182.23.146.18
  182.23.2.100
  182.23.2.118
  182.23.2.98
-182.23.23.4
-182.23.23.82
  182.23.3.226
  182.23.35.242
  182.23.54.0
@@ -48925,25 +41032,10 @@
  182.23.79.162
  182.23.93.140
  182.230.208.47
-182.230.61.80
-182.233.8.171
-182.233.8.183
-182.234.62.249
-182.234.79.219
-182.235.29.125
-182.240.134.219
-182.240.98.122
-182.242.143.38
  182.242.143.78
-182.242.36.212
-182.245.122.215
+182.242.25.249
  182.245.15.219
-182.245.172.61
-182.247.166.75
-182.247.193.197
-182.252.131.200
  182.253.102.102
-182.253.104.50
  182.253.105.42
  182.253.105.44
  182.253.106.13
@@ -48955,6 +41047,7 @@
  182.253.117.99
  182.253.119.34
  182.253.119.50
+182.253.122.24
  182.253.122.61
  182.253.141.27
  182.253.141.8
@@ -48964,9 +41057,13 @@
  182.253.16.173
  182.253.16.174
  182.253.16.3
+182.253.169.130
+182.253.170.223
  182.253.172.156
  182.253.173.136
+182.253.173.93
  182.253.174.211
+182.253.174.69
  182.253.18.141
  182.253.184.20
  182.253.188.10
@@ -48978,52 +41075,39 @@
  182.253.196.221
  182.253.197.100
  182.253.197.60
-182.253.200.171
  182.253.201.214
  182.253.201.26
  182.253.201.66
  182.253.201.76
-182.253.205.29
  182.253.223.75
  182.253.224.100
  182.253.232.108
  182.253.232.228
  182.253.233.127
+182.253.233.234
  182.253.233.239
+182.253.233.40
  182.253.234.115
-182.253.235.29
  182.253.244.152
+182.253.245.148
  182.253.43.24
  182.253.6.234
  182.253.60.170
  182.253.62.194
-182.253.66.194
  182.253.66.206
-182.253.69.34
  182.253.70.228
  182.253.70.50
  182.253.78.34
  182.253.80.134
-182.253.86.118
  182.253.93.5
-182.254.129.29
-182.254.130.16
  182.254.130.92
-182.254.134.57
+182.254.134.77
  182.254.137.75
-182.254.138.153
  182.254.139.45
-182.254.141.147
-182.254.141.97
-182.254.146.170
-182.254.146.173
-182.254.146.230
-182.254.147.247
  182.254.149.130
  182.254.149.33
  182.254.151.2
  182.254.152.219
-182.254.153.53
  182.254.155.85
  182.254.158.167
  182.254.158.205
@@ -49034,71 +41118,50 @@
  182.254.166.97
  182.254.168.205
  182.254.172.63
+182.254.174.101
  182.254.178.192
  182.254.184.127
  182.254.194.38
  182.254.197.12
  182.254.201.162
  182.254.209.120
-182.254.210.199
-182.254.210.233
-182.254.211.192
  182.254.211.79
-182.254.213.32
  182.254.215.214
-182.254.215.66
-182.254.217.198
  182.254.218.176
  182.254.220.192
  182.254.220.230
  182.254.223.220
-182.254.223.249
  182.254.225.13
  182.254.240.149
  182.254.244.109
-182.254.244.238
  182.254.245.23
  182.254.247.241
  182.254.247.245
  182.255.42.152
-182.30.106.69
-182.30.143.91
-182.31.171.84
  182.34.18.169
  182.34.204.113
-182.34.242.188
-182.34.243.134
  182.34.27.27
  182.38.126.161
-182.38.156.210
-182.43.132.212
-182.43.225.166
-182.43.227.243
+182.42.61.216
  182.43.234.34
-182.43.245.54
-182.43.6.84
  182.46.158.85
-182.47.15.193
-182.47.228.174
+182.48.11.101
  182.48.213.40
-182.48.70.145
-182.48.81.222
  182.48.83.170
  182.48.87.170
  182.48.88.113
  182.48.88.205
-182.48.90.130
-182.50.117.244
-182.50.120.204
  182.50.130.1
  182.50.130.133
+182.50.130.147
  182.50.130.152
  182.50.130.173
+182.50.130.188
+182.50.130.223
+182.50.130.227
  182.50.130.228
-182.50.130.30
  182.50.130.8
  182.50.132.101
-182.50.132.44
  182.50.132.79
  182.50.132.9
  182.50.135.32
@@ -49113,9 +41176,6 @@
  182.50.151.65
  182.50.151.9
  182.50.169.65
-182.50.4.192
-182.50.65.135
-182.50.69.70
  182.52.108.104
  182.52.110.144
  182.52.110.193
@@ -49128,9 +41188,7 @@
  182.52.131.159
  182.52.131.182
  182.52.137.125
-182.52.137.137
  182.52.137.23
-182.52.21.2
  182.52.22.58
  182.52.229.57
  182.52.238.111
@@ -49142,26 +41200,22 @@
  182.52.32.26
  182.52.32.6
  182.52.32.81
-182.52.33.252
  182.52.40.170
  182.52.51.154
  182.52.51.181
  182.52.51.47
-182.52.57.87
  182.52.58.44
  182.52.63.95
  182.52.65.7
  182.52.67.122
  182.52.70.117
  182.52.74.76
-182.52.86.149
-182.52.90.117
  182.52.90.164
  182.52.90.42
-182.52.91.116
+182.52.90.43
  182.53.135.202
+182.53.135.211
  182.53.135.220
-182.53.193.171
  182.53.197.156
  182.53.197.223
  182.53.200.118
@@ -49170,7 +41224,6 @@
  182.53.201.115
  182.53.201.184
  182.53.201.96
-182.53.202.184
  182.53.206.138
  182.53.206.175
  182.53.206.198
@@ -49178,7 +41231,6 @@
  182.53.206.40
  182.53.206.44
  182.53.36.149
-182.53.96.103
  182.53.96.215
  182.53.96.56
  182.54.148.1
@@ -49186,24 +41238,16 @@
  182.54.151.2
  182.54.151.5
  182.54.151.9
-182.54.165.107
-182.54.174.165
+182.54.173.225
  182.54.207.74
  182.55.245.25
-182.57.126.111
-182.57.136.205
-182.57.79.18
-182.58.137.70
-182.58.212.95
+182.57.172.190
+182.58.233.33
  182.58.49.77
+182.59.104.218
  182.59.2.193
-182.59.202.42
-182.59.207.229
-182.59.212.117
+182.59.222.102
  182.59.3.33
-182.59.4.74
-182.59.83.47
-182.59.94.86
  182.61.10.28
  182.61.104.246
  182.61.12.12
@@ -49212,7 +41256,6 @@
  182.61.130.51
  182.61.132.205
  182.61.132.240
-182.61.133.1
  182.61.133.15
  182.61.133.172
  182.61.133.98
@@ -49227,14 +41270,12 @@
  182.61.147.176
  182.61.147.252
  182.61.149.138
-182.61.149.188
  182.61.15.79
  182.61.150.12
  182.61.150.202
  182.61.150.42
  182.61.16.73
  182.61.164.235
-182.61.165.33
  182.61.168.185
  182.61.17.16
  182.61.17.86
@@ -49243,25 +41284,22 @@
  182.61.175.219
  182.61.179.157
  182.61.18.154
-182.61.18.216
  182.61.184.155
  182.61.184.186
  182.61.19.134
-182.61.19.225
  182.61.2.135
  182.61.21.155
  182.61.21.209
  182.61.22.46
  182.61.23.171
-182.61.25.156
  182.61.26.73
  182.61.27.149
  182.61.3.13
+182.61.30.218
  182.61.30.43
  182.61.32.178
  182.61.34.119
  182.61.36.44
-182.61.36.56
  182.61.37.144
  182.61.39.159
  182.61.39.203
@@ -49279,11 +41317,9 @@
  182.61.49.107
  182.61.50.174
  182.61.50.49
-182.61.50.68
  182.61.51.32
  182.61.55.155
  182.61.55.39
-182.61.6.184
  182.61.60.191
  182.61.60.233
  182.61.61.58
@@ -49291,17 +41327,16 @@
  182.65.208.3
  182.68.251.215
  182.70.250.213
-182.71.10.18
  182.71.111.138
+182.71.126.190
  182.71.128.62
  182.71.138.178
  182.71.152.18
-182.71.163.244
  182.71.197.195
  182.71.85.94
-182.71.87.39
  182.71.90.202
  182.72.118.126
+182.72.142.62
  182.72.161.90
  182.72.162.16
  182.72.180.14
@@ -49311,20 +41346,16 @@
  182.73.143.114
  182.73.143.146
  182.73.147.154
-182.73.230.106
  182.73.39.13
  182.73.71.23
  182.73.76.154
  182.73.95.110
  182.73.95.218
  182.74.18.26
-182.74.197.50
-182.74.205.90
  182.74.215.50
  182.74.25.246
  182.74.37.226
  182.74.61.136
-182.74.86.27
  182.75.112.254
  182.75.115.59
  182.75.123.154
@@ -49333,7 +41364,6 @@
  182.75.139.222
  182.75.139.26
  182.75.165.202
-182.75.176.107
  182.75.202.174
  182.75.249.98
  182.75.90.137
@@ -49341,31 +41371,23 @@
  182.76.142.58
  182.76.169.195
  182.76.204.237
-182.76.213.139
-182.76.22.54
  182.76.237.118
  182.76.28.148
  182.76.32.70
-182.76.43.42
  182.78.194.78
  182.84.124.104
  182.84.124.112
  182.84.124.136
  182.84.124.231
-182.84.124.41
  182.84.158.96
+182.84.163.76
  182.86.190.79
-182.86.226.150
-182.87.223.76
-182.90.206.161
-182.90.62.97
  182.92.107.145
  182.92.113.148
  182.92.160.8
  182.92.242.11
  182.92.84.176
  182.93.222.39
-182.93.49.26
  182.93.77.46
  182.93.80.28
  182.93.80.3
@@ -49374,369 +41396,233 @@
  182.93.84.136
  182.93.94.80
  182.93.95.146
-182.96.242.142
  1821456.dg398993.web.hosting-test.net
  182elexusbet.com
  183.0.149.63
  183.100.208.171
-183.100.216.133
  183.100.31.47
  183.101.176.223
  183.101.185.36
-183.101.92.163
-183.102.129.78
+183.102.211.107
  183.102.227.174
  183.102.238.69
  183.103.115.2
  183.103.120.89
-183.103.35.229
  183.103.44.215
  183.103.60.238
  183.103.86.116
  183.104.218.198
  183.104.248.85
-183.105.104.25
-183.105.26.17
  183.105.60.223
  183.105.99.30
-183.106.135.170
  183.106.163.80
-183.106.201.118
  183.107.19.138
  183.107.76.55
-183.108.117.99
-183.108.23.87
-183.108.241.56
  183.109.124.137
-183.109.129.243
  183.109.79.253
  183.109.80.156
-183.11.238.29
  183.11.38.15
-183.11.39.237
  183.11.69.186
  183.11.70.250
-183.11.72.89
-183.11.75.161
  183.110.220.210
-183.110.223.149
+183.111.104.197
  183.111.125.60
-183.111.148.118
  183.111.204.148
-183.111.236.46
  183.111.96.44
  183.111.96.46
-183.12.241.194
-183.128.163.103
-183.128.164.194
-183.129.136.78
  183.129.149.190
  183.129.159.211
  183.129.159.242
  183.129.159.243
  183.129.163.142
-183.129.170.114
  183.129.174.68
-183.129.185.170
-183.129.212.251
-183.129.222.78
-183.129.224.2
-183.129.232.116
+183.129.46.232
  183.130.23.147
  183.131.180.89
-183.131.231.16
-183.131.231.4
-183.131.231.47
-183.131.231.48
-183.131.247.86
  183.131.249.58
-183.131.66.7
  183.131.74.242
-183.131.85.18
-183.131.85.219
-183.131.85.36
-183.131.86.242
-183.131.88.186
  183.132.154.32
  183.132.17.135
-183.132.21.249
+183.132.17.244
  183.133.71.189
-183.134.100.19
-183.134.101.95
  183.134.198.30
-183.134.218.178
-183.134.245.122
  183.134.65.197
-183.135.154.59
-183.136.132.14
-183.136.145.234
-183.136.148.202
-183.136.149.181
-183.136.177.123
  183.136.194.146
  183.136.223.226
-183.136.225.35
-183.136.225.45
-183.136.225.46
-183.136.225.56
-183.136.233.133
  183.136.239.178
-183.138.122.141
-183.142.18.39
-183.142.222.114
-183.142.91.243
-183.143.144.112
  183.144.52.96
-183.144.59.49
+183.144.53.118
+183.146.185.30
  183.146.189.227
  183.146.213.157
  183.146.213.198
-183.15.122.144
-183.15.122.180
+183.15.176.31
+183.15.177.139
  183.15.177.216
-183.15.207.101
+183.15.90.242
+183.15.90.53
  183.154.16.77
-183.154.25.78
-183.155.198.107
  183.155.198.201
  183.155.199.34
  183.156.2.119
-183.157.164.164
+183.156.241.29
+183.156.242.0
+183.156.242.122
+183.156.242.177
+183.156.242.80
+183.156.243.179
+183.156.244.107
+183.156.244.169
+183.156.244.209
+183.156.246.217
+183.156.246.228
+183.157.167.199
+183.157.168.101
  183.157.168.194
-183.157.168.235
-183.157.169.1
+183.157.168.24
+183.157.168.4
  183.157.169.192
-183.157.170.149
+183.157.169.234
  183.157.170.22
+183.157.170.5
  183.157.171.104
+183.157.171.120
  183.157.171.241
-183.157.171.52
-183.157.171.76
+183.157.171.31
  183.157.171.85
+183.157.172.16
+183.157.172.208
  183.157.172.3
-183.157.172.64
-183.157.172.65
  183.157.173.1
-183.157.173.20
-183.157.173.69
  183.157.173.71
-183.157.173.83
-183.157.174.169
  183.157.174.197
+183.157.174.54
  183.157.174.59
  183.157.175.0
  183.157.175.133
  183.157.175.163
  183.157.175.247
+183.157.175.99
+183.157.179.163
  183.158.55.229
  183.159.127.86
  183.162.79.39
-183.162.93.6
-183.165.40.23
+183.165.28.130
  183.165.60.50
-183.166.59.149
-183.166.98.94
-183.167.197.65
-183.167.208.66
-183.167.230.197
-183.17.125.204
-183.17.125.212
-183.17.126.105
-183.17.147.150
-183.17.224.102
-183.17.224.121
-183.171.197.47
+183.166.238.124
+183.166.239.161
+183.166.239.248
+183.17.144.28
+183.17.144.56
+183.17.145.31
  183.176.82.231
-183.177.132.29
-183.178.249.213
-183.179.137.63
-183.179.96.148
+183.18.52.16
  183.181.164.180
  183.181.168.48
  183.181.174.169
  183.181.88.119
  183.182.101.32
-183.182.107.104
-183.185.11.150
  183.186.84.54
-183.188.101.139
  183.188.103.56
  183.188.134.235
-183.188.155.199
+183.188.141.174
  183.188.172.183
+183.188.182.135
  183.188.183.18
  183.188.198.118
  183.188.204.10
  183.188.204.2
  183.188.204.90
  183.188.207.37
+183.188.22.112
  183.188.227.201
+183.188.52.10
  183.188.52.250
  183.188.55.170
  183.188.70.175
  183.188.76.228
-183.189.99.64
  183.190.148.241
  183.190.222.84
  183.191.178.215
-183.191.204.241
  183.193.44.30
  183.195.121.197
  183.196.132.209
  183.196.186.92
-183.196.213.214
  183.196.233.193
-183.196.60.137
-183.196.92.9
-183.197.56.149
  183.197.56.175
-183.197.56.186
  183.197.56.189
  183.197.56.191
  183.197.56.208
+183.197.56.214
+183.197.56.226
+183.197.56.239
  183.197.56.240
  183.197.56.243
  183.197.56.50
  183.199.223.200
-183.2.157.219
-183.2.98.151
+183.2.202.66
+183.2.96.34
  183.203.157.188
  183.203.204.186
-183.216.18.96
-183.216.18.97
+183.207.176.78
  183.219.101.110
+183.220.144.85
  183.220.144.87
-183.220.146.247
-183.220.146.248
-183.220.146.249
-183.220.146.250
-183.220.146.251
-183.220.146.252
-183.220.146.253
-183.220.146.254
  183.221.125.206
-183.221.242.60
  183.221.243.20
-183.221.39.124
-183.222.40.227
-183.223.222.190
-183.224.129.162
-183.224.146.26
-183.224.170.137
-183.224.226.21
-183.224.228.51
  183.224.38.56
-183.224.75.12
-183.224.8.133
-183.228.111.252
-183.230.166.204
-183.230.173.97
-183.230.196.153
-183.230.247.200
  183.230.255.2
  183.230.37.179
  183.230.91.108
  183.232.228.66
-183.233.151.148
  183.233.183.70
-183.233.237.73
  183.234.11.43
-183.234.160.38
-183.234.17.149
-183.234.229.242
-183.234.43.179
+183.234.167.251
  183.234.58.41
  183.234.64.2
-183.235.245.86
  183.237.175.97
  183.237.191.186
  183.238.0.242
-183.238.161.66
-183.238.198.88
  183.238.243.30
  183.238.72.82
-183.239.136.196
-183.239.182.227
+183.239.156.146
  183.239.21.44
  183.239.212.246
-183.24.72.20
-183.240.168.117
-183.245.15.19
-183.246.180.131
-183.246.185.98
-183.247.167.178
-183.247.192.169
-183.247.206.116
+183.239.62.153
+183.246.176.179
+183.247.151.247
  183.25.135.147
-183.250.129.50
-183.250.154.149
-183.250.166.175
-183.250.26.178
-183.250.89.179
-183.251.103.235
-183.251.151.28
-183.251.252.166
  183.251.87.5
-183.252.48.160
-183.253.55.188
-183.3.129.84
  183.3.149.50
-183.3.222.51
-183.3.223.86
-183.30.192.67
-183.30.195.213
  183.4.224.118
  183.4.28.24
  183.4.30.105
  183.4.30.251
-183.47.14.242
  183.47.14.74
  183.47.237.251
-183.47.30.176
-183.47.45.115
-183.54.208.71
+183.47.50.8
  183.56.167.10
-183.56.216.122
-183.57.156.10
-183.57.157.132
-183.57.248.180
-183.57.251.33
-183.57.27.10
-183.6.100.67
+183.56.197.228
  183.6.102.54
  183.6.107.20
-183.6.107.227
  183.6.107.248
  183.6.107.44
  183.6.107.68
  183.6.152.11
-183.6.17.5
+183.6.159.35
  183.6.177.234
  183.60.110.85
-183.60.161.131
-183.60.227.177
  183.60.244.37
-183.61.1.32
-183.61.1.35
-183.62.132.46
  183.62.139.167
  183.62.150.75
-183.62.175.139
-183.62.196.164
-183.62.238.34
  183.62.25.218
  183.62.29.42
  183.62.69.34
-183.63.13.214
  183.63.148.219
  183.63.172.52
  183.63.233.238
-183.63.25.194
  183.63.87.236
  183.64.239.19
-183.65.30.2
-183.66.171.253
-183.66.250.118
  183.7.172.227
  183.7.172.56
  183.7.32.245
@@ -49746,8 +41632,7 @@
  183.77.72.44
  183.78.10.31
  183.78.10.31bin.sh
-183.78.180.160
-183.78.208.206
+183.80.199.150
  183.80.199.151
  183.81.152.82
  183.81.152.85
@@ -49761,65 +41646,49 @@
  183.81.157.140
  183.81.157.217
  183.81.158.105
-183.81.52.149
  183.82.0.15
  183.82.0.21
-183.82.101.32
  183.82.102.66
-183.82.108.241
  183.82.113.143
  183.82.115.221
-183.82.121.174
  183.82.121.34
-183.82.123.14
-183.82.124.233
-183.82.175.18
  183.82.32.153
-183.82.34.162
  183.82.42.67
-183.82.42.98
-183.82.55.61
-183.82.96.110
-183.82.96.76
  183.82.97.25
-183.83.156.103
+183.82.98.118
+183.83.128.13
+183.83.154.129
+183.83.208.231
  183.83.217.190
-183.83.218.215
  183.83.36.130
  183.83.43.11
  183.83.53.64
  183.83.89.226
  183.86.194.68
  183.86.194.79
-183.87.106.126
  183.87.106.220
  183.87.110.22
  183.87.114.130
  183.87.14.250
  183.87.153.182
  183.87.153.98
-183.87.180.243
-183.87.205.249
  183.87.221.252
  183.87.221.50
+183.87.228.11
  183.87.39.174
  183.87.53.156
  183.87.68.193
  183.87.69.233
  183.87.70.210
  183.87.76.17
-183.88.101.92
  183.88.105.71
  183.88.106.133
+183.88.106.98
+183.88.107.9
  183.88.108.54
  183.88.108.75
-183.88.120.242
-183.88.121.253
  183.88.129.4
-183.88.130.150
  183.88.16.5
-183.88.16.50
-183.88.17.160
  183.88.17.76
  183.88.2.224
  183.88.212.141
@@ -49827,7 +41696,6 @@
  183.88.214.143
  183.88.214.88
  183.88.219.206
-183.88.22.201
  183.88.223.208
  183.88.224.150
  183.88.224.206
@@ -49835,11 +41703,14 @@
  183.88.240.200
  183.88.240.53
  183.88.253.14
-183.88.41.145
+183.88.3.221
  183.88.57.241
-183.88.57.29
-183.88.68.212
  183.88.77.178
+183.88.80.146
+183.88.84.129
+183.88.90.101
+183.88.97.232
+183.89.114.193
  183.89.115.1
  183.89.116.164
  183.89.119.217
@@ -49850,55 +41721,46 @@
  183.89.146.130
  183.89.146.244
  183.89.148.80
+183.89.152.225
  183.89.155.12
-183.89.157.37
  183.89.161.110
-183.89.161.59
  183.89.161.72
  183.89.162.233
  183.89.162.237
  183.89.163.194
  183.89.176.243
-183.89.176.62
  183.89.178.101
-183.89.186.104
  183.89.196.57
  183.89.197.238
-183.89.33.216
+183.89.234.105
  183.89.41.136
+183.89.59.180
+183.89.68.112
  183.89.7.218
  183.89.72.163
-183.89.83.5
-183.89.89.7
+183.89.79.18
  183.89.99.130
  183.90.250.15
  183.90.250.38
-183.91.11.198
-183.91.11.21
  183.91.11.73
-183.91.193.186
-183.91.204.27
  183.91.217.64
  183.91.3.63
  183.91.33.41
-183.91.65.42
  183.91.66.99
  183.91.68.148
+183.91.78.211
  183.92.198.102
  183.92.206.6
  183.92.214.38
-183.92.216.122
  183.93.10.57
  183.95.144.236
+183.95.147.78
  183.95.246.160
-183.95.36.75
-183.95.39.206
-183.96.40.234
  183.96.65.145
  183.96.89.113
  183.97.39.5
-183.97.59.160
-183.97.7.66
+183.98.48.163
+183.99.59.168
  1830488.synergyglobal.one
  1834.31cf4fdae.com
  183da2ac-98c9-41cf-9f59-0c377e76b19b.htmlcomponentservice.com
@@ -49924,72 +41786,23 @@
  184.105.146.50
  184.105.220.24
  184.105.242.147
-184.105.247.194
-184.105.247.195
-184.105.247.196
-184.105.247.198
-184.105.247.199
-184.105.247.200
-184.105.247.202
-184.105.247.203
-184.105.247.204
-184.105.247.206
-184.105.247.207
-184.105.247.208
-184.105.247.210
-184.105.247.211
-184.105.247.212
-184.105.247.214
-184.105.247.215
-184.105.247.216
-184.105.247.218
-184.105.247.219
-184.105.247.220
-184.105.247.222
-184.105.247.223
-184.105.247.224
-184.105.247.226
-184.105.247.227
-184.105.247.228
-184.105.247.230
-184.105.247.231
-184.105.247.232
-184.105.247.234
-184.105.247.235
-184.105.247.236
-184.105.247.238
-184.105.247.239
-184.105.247.240
-184.105.247.242
-184.105.247.243
-184.105.247.244
-184.105.247.246
-184.105.247.247
-184.105.247.248
-184.105.247.250
-184.105.247.251
-184.105.247.252
-184.105.247.254
  184.105.70.100
+184.144.20.202
  184.144.204.194
  184.145.84.193
  184.147.0.8
-184.147.20.59
  184.149.56.146
  184.152.54.228
  184.153.108.245
  184.153.135.2
  184.153.247.218
  184.153.80.179
+184.154.108.232
  184.154.109.10
  184.154.150.120
  184.154.207.42
-184.154.44.226
-184.154.44.227
-184.154.44.228
-184.154.44.229
-184.154.44.230
-184.155.0.136
+184.155.176.167
+184.155.60.198
  184.157.218.247
  184.158.11.188
  184.158.17.129
@@ -50009,50 +41822,79 @@
  184.158.66.206
  184.158.70.206
  184.158.73.218
-184.160.180.89
+184.159.130.220
  184.160.203.112
  184.162.115.11
  184.162.61.208
  184.163.72.52
  184.164.185.41
-184.164.27.153
  184.164.89.183
  184.168.146.10
+184.168.152.108
+184.168.152.111
+184.168.152.112
+184.168.152.14
  184.168.152.142
-184.168.152.154
  184.168.152.162
  184.168.152.166
-184.168.152.175
-184.168.152.7
-184.168.152.75
+184.168.152.167
+184.168.152.182
+184.168.152.187
+184.168.152.191
+184.168.152.201
+184.168.152.209
+184.168.152.66
+184.168.152.74
  184.168.152.78
-184.168.193.103
-184.168.193.106
+184.168.193.10
+184.168.193.101
+184.168.193.119
+184.168.193.128
  184.168.193.129
+184.168.193.147
  184.168.193.155
  184.168.193.159
-184.168.193.188
+184.168.193.160
+184.168.193.165
+184.168.193.178
+184.168.193.184
+184.168.193.187
  184.168.193.196
+184.168.193.200
  184.168.193.204
+184.168.193.56
+184.168.193.59
  184.168.193.60
+184.168.193.63
  184.168.193.68
  184.168.200.173
  184.168.200.205
  184.168.200.224
-184.168.224.128
+184.168.27.108
  184.168.27.144
+184.168.27.163
+184.168.27.170
+184.168.27.191
  184.168.27.60
+184.168.27.63
+184.168.27.65
  184.168.46.123
+184.168.46.143
+184.168.46.162
+184.168.46.166
  184.168.46.186
  184.168.46.187
+184.168.46.190
  184.168.46.202
-184.168.46.22
+184.168.46.206
+184.168.46.219
  184.168.46.220
-184.168.46.61
-184.168.46.82
+184.168.46.58
+184.168.46.84
  184.170.145.60
  184.170.212.94
  184.170.223.148
+184.170.249.69
  184.171.208.109
  184.171.250.187
  184.171.250.188
@@ -50063,21 +41905,25 @@
  184.174.70.105
  184.174.71.70
  184.175.21.81
+184.175.42.20
  184.175.47.179
  184.178.172.13
  184.178.172.18
+184.178.172.24
  184.178.172.25
  184.178.172.28
  184.178.172.5
+184.179.216.134
  184.179.216.135
-184.179.216.143
-184.179.216.144
+184.179.216.140
+184.179.216.146
+184.179.216.148
+184.179.216.149
  184.180.129.98
  184.180.181.202
  184.185.2.149
-184.185.2.244
+184.186.23.97
  184.187.22.44
-184.2.203.46
  184.22.234.114
  184.22.7.55
  184.3.162.169
@@ -50115,13 +41961,12 @@
  184.5.244.219
  184.5.250.79
  184.5.46.192
-184.54.140.91
  184.57.184.168
  184.57.66.197
  184.58.164.106
  184.6.214.169
-184.60.188.106
  184.66.129.200
+184.67.105.182
  184.67.123.222
  184.67.4.234
  184.68.152.178
@@ -50135,7 +41980,6 @@
  184.7.55.99
  184.70.15.166
  184.70.244.67
-184.71.214.234
  184.71.9.2
  184.72.116.54
  184.72.147.110
@@ -50152,33 +41996,30 @@
  184.74.135.242
  184.74.150.189
  184.74.240.157
-184.75.21.164
-184.75.214.210
  184.82.107.22
  184.82.107.64
  184.82.128.211
-184.82.141.204
+184.82.142.37
  184.82.143.66
  184.82.146.6
  184.82.193.128
-184.82.200.226
+184.82.200.176
  184.82.232.134
  184.82.237.123
+184.82.238.157
  184.82.239.80
  184.82.29.169
-184.82.44.21
  184.82.53.177
-184.82.67.16
+184.82.72.253
+184.82.74.222
  184.82.92.72
-184.83.147.227
-184.89.195.129
  184.91.5.61
  184.95.32.130
  184.95.32.132
  184.95.32.134
  184.95.48.13
-184.95.59.122
  184.96.133.93
+184.96.158.9
  184.98.127.94
  184249-dot-n-e-w-me-ss-age-po-rt-al.wl.r.appspot.com
  184betper.com
@@ -50193,13 +42034,12 @@
  185.10.68.175
  185.10.68.22
  185.10.68.231
-185.10.68.250
  185.10.68.254
  185.10.68.40
  185.10.68.66
  185.10.73.233
-185.10.75.12
  185.100.13.245
+185.100.13.255
  185.100.84.149
  185.100.84.85
  185.100.85.101
@@ -50208,6 +42048,7 @@
  185.100.86.154
  185.100.86.167
  185.100.86.182
+185.100.87.190
  185.100.87.206
  185.100.87.207
  185.100.87.240
@@ -50215,28 +42056,26 @@
  185.100.87.242
  185.100.87.243
  185.100.87.244
+185.100.87.246
+185.100.87.248
+185.100.87.249
  185.100.87.251
  185.100.87.41
  185.100.87.61
  185.101.105.189
  185.101.107.100
-185.101.130.29
  185.101.159.156
  185.101.238.120
  185.101.238.13
  185.101.238.34
  185.101.93.105
  185.103.110.146
-185.103.110.198
-185.103.110.199
  185.103.115.56
  185.103.181.2
-185.103.219.150
  185.103.252.12
  185.103.37.61
  185.104.120.60
  185.104.180.7
-185.104.184.114
  185.104.184.116
  185.104.184.119
  185.104.184.121
@@ -50250,8 +42089,6 @@
  185.104.187.121
  185.104.187.86
  185.104.187.87
-185.104.187.88
-185.104.187.90
  185.104.187.93
  185.104.187.94
  185.104.216.116
@@ -50263,18 +42100,12 @@
  185.104.217.201
  185.104.217.240
  185.104.217.254
-185.104.218.103
+185.104.218.108
  185.104.218.80
  185.104.219.115
  185.104.219.124
-185.104.219.224
  185.104.219.251
  185.104.29.4
-185.104.85.50
-185.105.121.70
-185.105.230.61
-185.105.238.131
-185.105.38.209
  185.106.120.109
  185.106.120.179
  185.106.120.206
@@ -50284,6 +42115,7 @@
  185.106.121.142
  185.106.121.32
  185.106.122.100
+185.106.129.123
  185.106.209.68
  185.106.92.164
  185.106.92.47
@@ -50341,7 +42173,6 @@
  185.107.94.183
  185.107.94.233
  185.107.95.215
-185.108.105.134
  185.108.106.214
  185.108.106.230
  185.108.107.31
@@ -50349,20 +42180,18 @@
  185.108.244.41
  185.109.160.94
  185.109.160.97
-185.109.75.39
  185.11.146.210
  185.11.167.190
  185.11.167.241
  185.11.180.171
  185.11.240.175
-185.110.134.20
-185.110.134.38
  185.110.187.33
  185.110.216.1
  185.110.237.34
  185.111.100.184
  185.111.157.10
  185.111.157.127
+185.111.157.159
  185.111.216.164
  185.112.144.119
  185.112.148.142
@@ -50372,19 +42201,16 @@
  185.112.249.208
  185.112.250.128
  185.112.33.46
-185.112.82.116
-185.112.82.176
  185.112.82.239
-185.112.82.34
  185.113.128.30
  185.113.129.154
-185.113.134.107
  185.113.134.111
+185.113.134.151
  185.113.140.155
-185.113.58.107
  185.113.6.254
  185.114.157.61
  185.114.23.40
+185.114.23.66
  185.114.245.100
  185.114.82.122
  185.116.194.27
@@ -50412,6 +42238,7 @@
  185.118.48.206
  185.118.65.230
  185.118.66.114
+185.12.109.207
  185.12.179.222
  185.12.222.138
  185.12.45.114
@@ -50419,11 +42246,8 @@
  185.12.45.116
  185.12.45.117
  185.12.45.118
-185.12.71.75
  185.12.94.236
-185.120.126.30
  185.120.38.103
-185.121.165.254
  185.121.2.31
  185.121.69.16
  185.121.69.40
@@ -50445,12 +42269,15 @@
  185.126.200.195
  185.126.218.17
  185.127.126.233
+185.127.164.140
+185.127.164.146
+185.127.164.254
  185.127.164.89
+185.127.165.88
+185.127.166.108
+185.127.167.157
  185.127.255.92
  185.128.126.18
-185.128.136.94
-185.128.235.174
-185.128.26.115
  185.128.37.4
  185.128.38.100
  185.128.38.146
@@ -50458,7 +42285,6 @@
  185.129.1.165
  185.129.148.167
  185.129.62.62
-185.13.106.120
  185.13.156.239
  185.13.199.162
  185.13.37.132
@@ -50490,7 +42316,6 @@
  185.132.134.154
  185.132.178.106
  185.132.178.23
-185.132.198.78
  185.132.228.118
  185.132.228.226
  185.132.228.57
@@ -50501,7 +42326,6 @@
  185.132.53.109
  185.132.53.111
  185.132.53.115
-185.132.53.118
  185.132.53.129
  185.132.53.139
  185.132.53.143
@@ -50531,8 +42355,6 @@
  185.132.53.85
  185.132.53.98
  185.133.225.26
-185.133.36.58
-185.134.98.110
  185.134.99.238
  185.135.10.154
  185.135.123.96
@@ -50549,20 +42371,15 @@
  185.136.170.15
  185.136.204.206
  185.136.204.3
-185.136.242.193
+185.136.219.74
  185.137.12.156
-185.137.233.121
-185.137.233.123
-185.137.233.125
  185.137.234.10
  185.137.234.101
  185.137.92.48
  185.138.123.78
-185.138.94.139
  185.139.239.66
  185.139.56.133
  185.139.68.79
-185.139.70.193
  185.14.149.61
  185.14.186.15
  185.14.187.101
@@ -50579,9 +42396,10 @@
  185.14.233.249
  185.14.248.98
  185.14.251.4
+185.14.29.22
  185.14.31.113
+185.14.37.196
  185.14.56.96
-185.140.100.219
  185.140.126.254
  185.140.242.82
  185.140.53.3
@@ -50591,7 +42409,6 @@
  185.140.53.8
  185.140.53.9
  185.141.10.67
-185.141.104.255
  185.141.11.202
  185.141.24.195
  185.141.24.198
@@ -50599,9 +42416,9 @@
  185.141.27.116
  185.141.33.39
  185.141.60.33
+185.141.60.36
  185.141.61.189
  185.141.62.31
-185.141.63.14
  185.142.208.160
  185.142.236.163
  185.142.236.209
@@ -50616,12 +42433,9 @@
  185.142.67.23
  185.143.145.113
  185.143.172.80
-185.143.221.7
-185.143.221.85
  185.143.223.135
-185.143.223.241
-185.143.223.250
-185.144.247.67
+185.143.230.175
+185.143.231.197
  185.144.47.215
  185.144.82.236
  185.144.83.112
@@ -50632,14 +42446,13 @@
  185.145.253.67
  185.145.26.31
  185.145.36.201
-185.145.77.31
+185.145.38.214
  185.145.98.196
  185.146.113.157
  185.146.157.196
  185.146.159.217
-185.147.213.104
-185.147.213.109
  185.147.213.121
+185.147.213.134
  185.147.213.145
  185.147.213.175
  185.147.213.19
@@ -50648,16 +42461,16 @@
  185.147.213.68
  185.147.213.73
  185.147.213.74
+185.147.213.91
+185.147.214.20
  185.147.214.43
-185.147.214.69
+185.148.100.141
  185.148.145.92
  185.148.147.47
  185.148.3.142
  185.148.3.227
-185.148.38.70
  185.148.44.65
  185.148.84.157
-185.148.84.97
  185.149.107.19
  185.149.201.137
  185.149.207.2
@@ -50665,10 +42478,12 @@
  185.15.110.106
  185.15.21.72
  185.15.21.74
-185.15.63.166
  185.15.85.88
  185.15.92.18
  185.150.117.183
+185.150.117.218
+185.150.117.220
+185.150.119.130
  185.150.190.19
  185.150.24.112
  185.150.8.157
@@ -50676,34 +42491,22 @@
  185.151.204.9
  185.151.242.196
  185.151.243.250
-185.151.31.69
  185.152.113.92
  185.152.12.49
  185.152.138.74
  185.152.166.253
  185.152.191.5
-185.153.151.12
+185.152.66.233
  185.153.151.19
  185.153.185.142
-185.153.196.126
  185.153.196.203
  185.153.196.209
  185.153.196.230
-185.153.196.38
  185.153.196.45
-185.153.196.81
-185.153.197.32
-185.153.197.52
  185.153.198.226
  185.153.198.229
  185.153.198.231
-185.153.199.132
-185.153.199.145
-185.153.199.147
-185.153.208.50
-185.153.230.59
  185.153.231.75
-185.153.45.174
  185.154.131.4
  185.154.15.87
  185.154.159.164
@@ -50711,7 +42514,6 @@
  185.154.16.157
  185.154.2.3
  185.154.21.123
-185.154.255.231
  185.154.52.140
  185.154.52.207
  185.154.53.147
@@ -50719,16 +42521,12 @@
  185.155.34.80
  185.156.172.122
  185.156.173.116
-185.156.174.178
  185.156.179.233
  185.156.214.13
  185.156.214.34
  185.156.35.156
-185.156.73.57
  185.156.73.91
  185.156.74.65
-185.157.171.71
-185.157.246.142
  185.157.79.3
  185.158.104.169
  185.158.107.131
@@ -50743,9 +42541,7 @@
  185.158.249.137
  185.158.249.171
  185.158.249.237
-185.159.146.30
  185.159.158.50
-185.159.163.54
  185.159.68.14
  185.159.80.116
  185.159.80.204
@@ -50754,7 +42550,7 @@
  185.16.204.58
  185.16.32.203
  185.16.32.66
-185.160.229.240
+185.16.52.32
  185.161.208.127
  185.161.208.97
  185.161.209.119
@@ -50769,19 +42565,15 @@
  185.161.71.44
  185.162.0.74
  185.162.128.143
-185.162.128.144
-185.162.140.149
-185.162.140.196
  185.162.141.236
  185.162.235.150
  185.162.235.157
  185.162.235.164
-185.162.235.171
  185.162.235.172
-185.162.235.193
  185.162.235.20
  185.162.235.246
  185.162.235.64
+185.162.235.66
  185.162.65.109
  185.163.1.11
  185.163.126.12
@@ -50789,6 +42581,7 @@
  185.163.44.36
  185.163.45.42
  185.163.46.148
+185.163.46.149
  185.163.46.29
  185.164.30.78
  185.164.57.46
@@ -50802,9 +42595,10 @@
  185.165.169.83
  185.165.190.104
  185.165.190.34
+185.165.221.220
  185.165.221.238
+185.165.221.252
  185.165.221.5
-185.165.221.76
  185.165.221.83
  185.165.241.137
  185.165.29.138
@@ -50813,50 +42607,46 @@
  185.165.29.84
  185.165.31.12
  185.165.88.222
-185.166.131.147
-185.166.153.237
  185.166.212.181
  185.166.239.49
  185.166.25.134
  185.166.87.198
-185.167.113.59
  185.167.116.211
  185.167.116.61
  185.167.163.103
+185.167.96.138
  185.167.97.160
+185.167.97.229
  185.167.97.31
-185.168.173.121
  185.169.17.254
  185.169.181.10
  185.169.181.12
  185.169.181.16
  185.169.181.24
  185.169.181.28
-185.169.19.17
  185.169.243.125
+185.169.54.246
  185.17.121.212
  185.17.132.15
  185.17.132.158
-185.17.132.27
  185.17.133.107
  185.17.134.149
  185.17.141.29
  185.17.18.133
-185.17.182.78
  185.17.183.22
-185.17.32.140
  185.17.38.1
  185.170.114.25
  185.170.210.47
  185.170.42.18
  185.171.10.96
  185.171.52.101
+185.171.54.26
+185.171.54.30
  185.171.54.34
  185.171.54.36
  185.171.55.218
  185.171.63.26
  185.171.63.89
-185.171.91.90
  185.172.110.175
  185.172.110.176
  185.172.110.178
@@ -50903,10 +42693,8 @@
  185.172.111.198
  185.172.111.199
  185.172.111.200
-185.172.111.201
  185.172.111.202
  185.172.111.204
-185.172.111.205
  185.172.111.206
  185.172.111.209
  185.172.111.210
@@ -50920,45 +42708,19 @@
  185.172.111.225
  185.172.111.226
  185.172.111.235
-185.172.144.12
-185.172.56.213
  185.173.104.47
-185.173.226.46
  185.173.245.127
  185.174.100.242
  185.174.100.60
  185.174.102.15
-185.174.159.16
-185.174.159.20
-185.174.195.128
-185.174.195.129
-185.174.195.130
-185.174.195.131
-185.174.195.132
-185.174.195.133
-185.174.195.134
-185.174.195.135
-185.174.195.136
+185.174.159.18
  185.174.195.137
-185.174.195.138
-185.174.195.139
-185.174.195.140
-185.174.195.141
  185.174.195.142
-185.174.195.143
-185.174.195.208
  185.174.195.239
  185.174.210.198
  185.174.63.59
  185.175.106.82
-185.175.246.105
-185.175.56.165
-185.175.81.18
-185.175.93.104
  185.175.93.14
-185.175.93.17
-185.175.93.24
-185.175.93.37
  185.175.95.46
  185.176.145.194
  185.176.220.239
@@ -50967,6 +42729,7 @@
  185.176.221.61
  185.177.124.144
  185.177.125.40
+185.177.215.118
  185.177.54.1
  185.177.54.10
  185.177.54.2
@@ -50984,30 +42747,23 @@
  185.180.196.143
  185.180.221.201
  185.180.221.7
-185.180.231.107
  185.180.231.189
-185.180.231.42
-185.180.254.235
  185.181.10.234
  185.181.102.18
  185.181.176.246
+185.181.220.102
  185.181.230.74
  185.181.246.180
  185.181.247.141
-185.181.40.136
-185.181.40.138
-185.181.40.140
-185.181.40.196
-185.181.43.100
  185.182.168.66
  185.182.56.123
+185.182.56.58
+185.182.57.201
  185.182.59.41
  185.182.59.49
  185.182.82.133
-185.183.111.148
  185.183.12.25
  185.183.16.47
-185.183.243.16
  185.183.35.65
  185.183.95.199
  185.183.96.77
@@ -51025,12 +42781,9 @@
  185.186.208.162
  185.186.240.174
  185.186.243.133
-185.186.244.228
  185.186.246.141
  185.186.246.146
  185.186.246.180
-185.186.246.209
-185.186.246.235
  185.186.246.243
  185.186.69.114
  185.186.71.56
@@ -51040,21 +42793,21 @@
  185.187.198.10
  185.187.96.253
  185.188.127.107
+185.188.182.181
  185.188.188.1
  185.188.189.1
  185.188.216.93
  185.188.218.10
  185.188.218.14
  185.188.218.9
+185.188.6.10
  185.188.7.27
  185.189.102.153
  185.189.102.169
  185.189.106.221
-185.189.112.11
  185.189.112.165
  185.189.112.228
  185.189.112.72
-185.189.114.120
  185.189.114.173
  185.189.114.98
  185.189.115.20
@@ -51062,19 +42815,13 @@
  185.189.115.30
  185.189.12.206
  185.189.12.75
-185.189.127.41
  185.189.132.178
  185.189.149.235
-185.189.15.6
  185.189.151.177
  185.189.151.180
  185.189.151.189
  185.189.151.73
  185.189.151.85
-185.189.184.180
-185.189.184.200
-185.189.187.10
-185.189.187.57
  185.189.199.75
  185.189.208.145
  185.189.208.177
@@ -51090,13 +42837,13 @@
  185.19.1.141
  185.19.176.237
  185.19.190.30
+185.19.2.109
  185.19.2.111
  185.19.24.111
  185.19.28.195
  185.19.29.110
  185.19.30.68
  185.19.31.6
-185.19.78.214
  185.190.113.130
  185.190.152.159
  185.190.165.83
@@ -51107,8 +42854,6 @@
  185.191.124.152
  185.191.124.153
  185.191.204.3
-185.191.32.155
-185.191.32.203
  185.192.111.51
  185.192.112.56
  185.192.137.82
@@ -51116,35 +42861,24 @@
  185.193.125.168
  185.193.125.190
  185.193.177.82
-185.193.210.202
  185.193.227.36
  185.193.233.248
  185.193.70.71
-185.193.88.122
-185.193.91.122
-185.193.91.166
-185.193.91.238
-185.193.91.250
  185.193.91.42
-185.193.91.62
-185.193.91.94
  185.194.25.23
  185.194.25.77
  185.194.49.132
-185.194.62.79
-185.195.201.148
-185.197.160.160
+185.195.18.110
  185.197.243.172
  185.197.33.254
-185.197.34.58
  185.198.184.14
  185.198.244.114
+185.198.244.80
  185.198.57.238
  185.198.58.146
  185.198.58.199
  185.198.58.47
  185.199.197.148
-185.199.87.243
  185.2.140.155
  185.2.154.15
  185.2.4.105
@@ -51169,41 +42903,17 @@
  185.20.90.50
  185.200.116.185
  185.200.117.168
-185.200.118.35
-185.200.118.36
-185.200.118.38
-185.200.118.39
-185.200.118.42
-185.200.118.44
-185.200.118.45
-185.200.118.51
-185.200.118.56
-185.200.118.67
-185.200.118.69
-185.200.118.70
-185.200.118.71
-185.200.118.74
-185.200.118.83
-185.200.118.86
-185.200.118.88
-185.200.176.183
-185.200.176.26
  185.200.183.204
  185.200.216.83
+185.200.36.105
  185.200.36.91
  185.200.37.181
  185.201.11.125
-185.201.11.132
  185.201.11.159
-185.201.11.194
-185.201.112.54
+185.201.11.93
  185.201.113.228
-185.201.136.80
-185.201.8.248
  185.201.89.122
  185.201.9.197
-185.202.0.107
-185.202.0.78
  185.202.1.6
  185.202.172.246
  185.202.174.84
@@ -51223,10 +42933,8 @@
  185.204.216.48
  185.204.3.36
  185.204.56.34
-185.205.108.166
-185.205.108.206
-185.205.17.17
  185.205.204.124
+185.205.204.224
  185.205.204.32
  185.205.204.42
  185.205.209.166
@@ -51243,7 +42951,6 @@
  185.206.212.12
  185.206.214.130
  185.206.214.71
-185.206.224.203
  185.206.224.206
  185.206.224.207
  185.206.224.208
@@ -51253,7 +42960,10 @@
  185.206.224.245
  185.206.224.249
  185.206.225.183
+185.206.225.229
+185.206.225.233
  185.206.93.87
+185.207.177.148
  185.207.177.16
  185.207.177.189
  185.207.177.25
@@ -51261,8 +42971,6 @@
  185.207.205.130
  185.207.205.134
  185.207.206.35
-185.207.37.104
-185.207.37.106
  185.208.100.47
  185.208.100.49
  185.208.100.72
@@ -51279,17 +42987,14 @@
  185.21.39.46
  185.21.41.49
  185.21.67.212
-185.210.144.117
-185.210.147.146
+185.210.145.53
  185.210.224.102
-185.211.138.64
+185.211.129.15
  185.211.246.135
  185.211.48.17
-185.211.57.73
  185.211.59.50
  185.211.59.7
  185.212.128.236
-185.212.129.198
  185.212.129.34
  185.212.129.54
  185.212.130.34
@@ -51301,6 +43006,8 @@
  185.212.201.26
  185.212.47.150
  185.213.155.169
+185.213.191.205
+185.213.191.229
  185.213.191.231
  185.214.14.235
  185.214.165.113
@@ -51310,24 +43017,13 @@
  185.215.227.56
  185.215.227.77
  185.216.119.235
-185.216.140.146
-185.216.140.192
-185.216.140.240
  185.216.140.249
-185.216.140.31
-185.216.140.32
-185.216.140.35
  185.216.140.41
-185.216.140.6
  185.216.215.13
  185.216.32.130
  185.216.33.122
  185.216.33.137
-185.216.33.187
  185.216.34.233
-185.217.1.243
-185.217.1.244
-185.217.1.245
  185.217.1.30
  185.217.170.159
  185.217.170.175
@@ -51336,21 +43032,18 @@
  185.217.170.92
  185.217.241.142
  185.217.90.140
-185.218.202.8
  185.218.29.222
  185.219.168.46
  185.219.168.51
  185.219.179.161
-185.219.191.160
  185.219.221.92
+185.219.43.151
  185.219.81.127
-185.22.136.214
  185.22.152.225
  185.22.172.137
  185.22.172.16
  185.22.172.177
  185.22.172.201
-185.22.172.85
  185.22.172.99
  185.22.173.142
  185.22.174.119
@@ -51358,7 +43051,6 @@
  185.22.175.133
  185.22.175.52
  185.22.31.226
-185.22.8.116
  185.22.99.20
  185.220.100.240
  185.220.100.241
@@ -51486,8 +43178,6 @@
  185.220.103.7
  185.220.103.8
  185.220.103.9
-185.220.205.106
-185.220.205.196
  185.220.205.213
  185.220.34.68
  185.220.35.86
@@ -51498,7 +43188,6 @@
  185.220.50.253
  185.220.70.168
  185.220.87.143
-185.221.169.224
  185.221.201.34
  185.222.138.229
  185.222.202.104
@@ -51506,34 +43195,25 @@
  185.222.202.133
  185.222.202.194
  185.222.210.27
-185.222.57.177
  185.222.57.183
+185.222.57.81
  185.222.57.88
-185.222.58.116
  185.222.58.123
  185.222.58.134
-185.222.58.148
-185.222.58.158
  185.222.66.113
  185.222.66.121
  185.223.28.89
  185.223.29.137
  185.224.128.41
-185.224.137.131
-185.224.137.188
  185.224.137.51
  185.224.138.102
  185.224.138.130
  185.224.138.14
  185.224.138.147
  185.224.138.176
-185.224.138.21
  185.224.138.44
-185.224.168.170
-185.224.170.218
  185.224.171.130
  185.224.80.108
-185.225.137.130
  185.225.137.170
  185.225.137.182
  185.225.137.206
@@ -51551,44 +43231,30 @@
  185.226.113.180
  185.226.113.53
  185.226.145.165
-185.226.224.144
  185.226.64.114
  185.226.64.122
  185.226.65.232
  185.226.90.141
  185.227.109.30
  185.227.111.133
-185.227.138.222
+185.227.153.228
  185.227.82.32
  185.227.82.42
  185.228.133.4
  185.228.137.238
  185.228.139.232
-185.23.128.180
-185.23.131.101
-185.23.131.102
+185.23.106.249
  185.23.131.112
-185.23.131.123
-185.23.131.124
-185.23.131.143
  185.23.131.146
  185.23.131.148
-185.23.131.191
-185.23.131.240
-185.23.131.41
-185.23.131.51
-185.23.131.73
-185.23.131.88
  185.23.151.171
  185.23.200.20
  185.230.125.36
  185.230.125.40
  185.230.4.220
-185.230.4.39
  185.230.81.96
  185.231.112.136
  185.231.112.64
-185.231.153.167
  185.231.155.153
  185.231.71.153
  185.232.182.218
@@ -51597,18 +43263,16 @@
  185.232.21.123
  185.232.21.167
  185.232.52.7
+185.232.59.131
  185.232.65.171
-185.232.65.192
-185.232.65.36
  185.233.100.23
  185.233.148.146
  185.233.186.129
  185.233.187.130
+185.233.187.149
  185.233.187.252
-185.233.187.26
  185.233.187.79
  185.234.216.198
-185.234.216.38
  185.234.216.56
  185.234.216.63
  185.234.216.64
@@ -51627,7 +43291,6 @@
  185.234.217.164
  185.234.217.184
  185.234.217.19
-185.234.217.194
  185.234.217.203
  185.234.217.204
  185.234.217.21
@@ -51659,16 +43322,13 @@
  185.234.219.12
  185.234.219.13
  185.234.219.14
-185.234.219.20
  185.234.219.227
  185.234.219.228
  185.234.219.229
  185.234.219.230
-185.234.219.28
  185.234.219.5
  185.234.72.64
  185.235.128.167
-185.235.129.245
  185.235.241.221
  185.236.202.151
  185.236.203.49
@@ -51677,7 +43337,6 @@
  185.236.77.144
  185.236.77.195
  185.236.77.62
-185.236.77.78
  185.236.77.8
  185.236.77.9
  185.236.78.112
@@ -51694,26 +43353,22 @@
  185.239.242.174
  185.239.242.178
  185.239.242.18
-185.239.242.188
  185.239.242.195
  185.239.242.197
-185.239.242.217
+185.239.242.213
  185.239.242.223
  185.239.242.225
  185.239.242.247
  185.239.242.249
  185.239.242.251
-185.239.242.45
-185.239.242.50
-185.239.242.63
  185.239.242.79
  185.239.242.8
-185.239.242.84
  185.239.242.86
  185.239.242.92
  185.239.243.138
  185.239.68.18
  185.239.70.31
+185.24.22.171
  185.24.233.209
  185.24.233.36
  185.24.233.48
@@ -51734,7 +43389,9 @@
  185.242.114.35
  185.242.114.8
  185.242.160.154
+185.242.161.49
  185.242.163.160
+185.242.217.130
  185.242.217.14
  185.242.217.186
  185.242.217.187
@@ -51742,24 +43399,25 @@
  185.242.217.243
  185.242.217.249
  185.242.217.27
+185.242.217.46
  185.242.217.8
  185.242.5.120
-185.242.5.46
  185.243.112.207
  185.243.113.110
  185.243.113.221
  185.243.113.24
  185.243.115.28
-185.243.172.168
  185.243.172.172
-185.243.172.175
-185.243.172.176
+185.243.172.177
+185.243.174.104
  185.243.174.154
  185.243.215.254
  185.243.241.144
  185.243.241.220
  185.243.241.223
+185.243.241.52
  185.243.49.46
+185.243.50.225
  185.243.57.157
  185.243.57.211
  185.244.100.106
@@ -51816,35 +43474,27 @@
  185.244.41.44
  185.244.41.45
  185.244.41.46
-185.244.41.6
  185.244.41.7
  185.244.41.9
-185.244.43.183
  185.245.2.168
  185.245.84.153
  185.245.84.30
+185.245.84.48
+185.245.84.50
  185.245.84.52
  185.245.84.54
  185.245.84.56
-185.245.84.58
  185.245.85.138
  185.245.85.139
  185.245.85.144
-185.245.85.180
  185.245.85.6
  185.245.85.61
-185.245.86.226
  185.245.96.30
-185.246.128.26
  185.246.65.34
  185.247.116.43
  185.247.143.56
-185.247.143.59
  185.247.224.14
  185.247.224.191
-185.247.228.36
-185.247.228.65
-185.247.3.250
  185.248.101.207
  185.248.103.100
  185.248.160.146
@@ -51852,7 +43502,7 @@
  185.248.160.218
  185.248.160.243
  185.248.160.65
-185.249.197.164
+185.248.238.181
  185.249.198.100
  185.249.199.106
  185.25.148.240
@@ -51877,25 +43527,26 @@
  185.250.39.154
  185.250.39.186
  185.250.39.77
-185.250.44.163
  185.250.45.13
  185.250.45.17
-185.250.45.89
  185.250.46.108
  185.250.46.34
  185.251.161.54
  185.251.39.230
-185.252.101.4
  185.252.228.158
  185.252.41.232
  185.252.77.220
+185.253.184.106
+185.253.217.145
  185.253.219.160
-185.253.224.13
  185.253.74.206
-185.253.74.99
+185.253.97.139
+185.253.97.183
  185.253.97.246
+185.253.97.247
  185.254.141.80
  185.254.44.102
+185.255.134.117
  185.255.135.33
  185.255.46.100
  185.255.46.171
@@ -51903,7 +43554,6 @@
  185.255.47.27
  185.255.47.50
  185.26.126.48
-185.26.171.236
  185.26.219.34
  185.26.28.170
  185.26.28.173
@@ -51911,6 +43561,8 @@
  185.27.252.85
  185.27.44.23
  185.27.60.83
+185.27.68.4
+185.28.196.84
  185.28.20.7
  185.29.11.145
  185.29.11.233
@@ -51924,27 +43576,27 @@
  185.29.9.171
  185.29.9.222
  185.3.133.11
-185.3.134.114
+185.3.134.134
  185.3.216.79
  185.3.95.81
  185.30.166.38
  185.30.32.183
  185.30.46.110
-185.30.46.98
  185.30.96.198
+185.31.166.143
  185.31.166.155
  185.32.120.177
-185.32.124.152
+185.32.126.134
  185.32.153.2
  185.32.165.78
+185.32.181.100
  185.32.201.122
  185.32.222.171
  185.32.222.172
  185.32.222.173
-185.32.231.84
-185.32.45.57
  185.32.63.21
  185.33.114.5
+185.33.152.138
  185.33.34.76
  185.34.17.184
  185.34.17.248
@@ -51959,17 +43611,17 @@
  185.34.88.5
  185.35.137.219
  185.35.142.70
-185.35.201.160
  185.35.202.222
  185.35.217.50
-185.35.59.249
  185.35.67.109
  185.35.78.77
  185.36.157.30
  185.36.189.6
  185.36.189.8
  185.36.191.0
+185.36.248.110
  185.36.63.212
+185.36.74.208
  185.36.81.174
  185.36.81.204
  185.36.81.23
@@ -51980,16 +43632,13 @@
  185.37.211.222
  185.37.213.76
  185.37.27.45
-185.37.56.253
  185.37.89.7
-185.38.129.19
  185.38.14.171
  185.38.14.215
  185.38.175.71
  185.38.175.72
  185.38.249.49
  185.38.3.138
-185.38.40.60
  185.39.10.73
  185.39.199.45
  185.39.64.4
@@ -52002,9 +43651,6 @@
  185.4.24.199
  185.4.66.131
  185.40.4.175
-185.40.50.131
-185.40.86.28
-185.41.154.203
  185.41.212.214
  185.41.52.94
  185.41.96.129
@@ -52019,8 +43665,6 @@
  185.43.108.6
  185.43.108.7
  185.43.108.8
-185.43.189.177
-185.43.189.226
  185.43.220.226
  185.43.249.132
  185.43.249.148
@@ -52031,6 +43675,7 @@
  185.44.231.63
  185.44.231.68
  185.44.231.70
+185.44.232.30
  185.45.12.126
  185.45.193.123
  185.45.193.173
@@ -52044,10 +43689,9 @@
  185.45.193.33
  185.45.205.169
  185.45.72.176
+185.46.122.205
  185.46.149.234
  185.46.170.253
-185.46.18.99
-185.46.222.74
  185.46.223.198
  185.46.84.181
  185.46.84.182
@@ -52055,20 +43699,18 @@
  185.47.184.253
  185.47.65.30
  185.48.113.230
+185.48.149.60
  185.48.56.34
  185.49.14.190
  185.49.15.23
  185.49.248.44
-185.49.84.133
-185.49.87.86
  185.49.93.111
  185.49.93.112
  185.49.93.121
  185.49.93.99
+185.5.104.178
  185.5.166.28
-185.5.167.33
  185.5.19.234
-185.5.197.15
  185.5.46.53
  185.5.55.219
  185.5.55.45
@@ -52077,6 +43719,7 @@
  185.50.250.94
  185.50.251.116
  185.50.251.144
+185.50.251.71
  185.51.203.132
  185.51.246.4
  185.51.76.199
@@ -52084,44 +43727,40 @@
  185.51.92.108
  185.51.92.84
  185.52.1.53
-185.52.1.71
  185.52.1.89
  185.52.11.30
  185.52.55.237
  185.52.8.81
  185.53.152.189
  185.53.155.233
-185.53.168.18
  185.53.168.96
  185.53.169.115
+185.53.169.123
+185.53.169.98
  185.53.173.64
  185.53.57.246
  185.53.88.106
  185.53.88.182
  185.53.88.6
  185.53.90.8
-185.54.154.26
  185.54.49.135
-185.55.88.230
  185.56.136.106
  185.56.153.236
  185.56.171.94
-185.56.80.55
+185.56.209.114
  185.56.80.65
-185.56.80.66
  185.56.81.8
  185.56.82.14
  185.56.82.66
  185.56.82.82
-185.58.218.82
-185.58.251.5
  185.59.101.51
  185.59.122.69
  185.59.139.99
  185.59.221.66
-185.59.245.91
  185.59.44.23
-185.6.126.174
+185.6.139.26
+185.6.153.100
+185.6.175.251
  185.60.135.103
  185.61.137.165
  185.61.148.69
@@ -52149,9 +43788,9 @@
  185.62.190.112
  185.62.190.156
  185.62.190.55
+185.62.194.253
  185.62.56.101
  185.63.191.226
-185.63.199.154
  185.63.252.55
  185.63.253.201
  185.63.253.26
@@ -52163,18 +43802,15 @@
  185.64.104.234
  185.64.116.15
  185.64.18.25
-185.64.221.13
-185.64.221.14
+185.64.221.15
  185.64.221.27
-185.64.221.39
  185.64.221.5
-185.64.221.7
  185.64.238.229
-185.64.247.43
  185.64.51.119
  185.65.132.100
  185.65.134.175
  185.65.137.208
+185.65.18.100
  185.65.186.192
  185.65.195.6
  185.65.201.27
@@ -52186,36 +43822,33 @@
  185.66.143.190
  185.66.180.33
  185.66.228.149
+185.66.233.61
  185.66.56.2
  185.66.57.100
+185.66.57.103
  185.66.57.104
-185.66.57.107
-185.66.57.109
  185.66.57.110
  185.66.57.112
  185.66.57.121
  185.66.57.124
  185.66.57.127
-185.66.57.129
  185.66.57.131
  185.66.57.137
  185.66.57.139
+185.66.57.140
  185.66.57.142
  185.66.57.146
  185.66.57.148
  185.66.57.151
  185.66.57.153
-185.66.57.158
  185.66.57.162
  185.66.57.164
-185.66.57.167
  185.66.57.168
  185.66.57.170
  185.66.57.173
  185.66.57.175
  185.66.57.176
  185.66.57.180
-185.66.57.182
  185.66.57.188
  185.66.57.196
  185.66.57.250
@@ -52227,14 +43860,15 @@
  185.66.58.113
  185.66.58.116
  185.66.58.119
-185.66.58.120
-185.66.58.125
+185.66.58.121
+185.66.58.124
  185.66.58.126
  185.66.58.130
  185.66.58.132
  185.66.58.134
  185.66.58.137
  185.66.58.140
+185.66.58.143
  185.66.58.144
  185.66.58.146
  185.66.58.148
@@ -52243,13 +43877,13 @@
  185.66.58.155
  185.66.58.161
  185.66.58.162
+185.66.58.164
  185.66.58.167
  185.66.58.169
  185.66.58.170
  185.66.58.172
  185.66.58.175
  185.66.58.182
-185.66.58.185
  185.66.58.187
  185.66.58.189
  185.66.58.192
@@ -52261,14 +43895,15 @@
  185.66.59.2
  185.66.59.204
  185.66.59.206
-185.66.59.211
+185.66.59.217
  185.66.59.224
  185.66.59.229
-185.66.59.234
+185.66.59.231
+185.66.59.251
+185.66.59.252
  185.66.59.4
  185.67.45.160
  185.67.82.114
-185.67.95.179
  185.68.247.117
  185.68.93.27
  185.69.154.252
@@ -52281,24 +43916,18 @@
  185.70.184.80
  185.70.185.34
  185.70.185.56
-185.70.189.82
-185.72.27.10
-185.72.27.14
-185.73.156.1
-185.73.168.163
+185.73.113.63
  185.74.4.17
  185.74.4.189
  185.74.4.20
  185.74.5.253
-185.74.85.184
  185.75.117.124
  185.75.181.219
+185.75.203.234
  185.75.5.158
  185.77.129.163
  185.77.129.165
  185.77.149.213
-185.77.177.112
-185.77.178.93
  185.77.225.144
  185.77.248.3
  185.77.248.4
@@ -52308,14 +43937,12 @@
  185.78.209.27
  185.78.72.204
  185.78.86.34
-185.79.156.167
  185.79.156.183
  185.79.156.83
  185.79.243.137
  185.79.243.153
  185.8.10.230
  185.8.104.152
-185.8.158.25
  185.8.202.254
  185.8.236.170
  185.8.239.148
@@ -52331,14 +43958,11 @@
  185.80.53.147
  185.81.106.52
  185.81.157.102
-185.81.157.116
  185.81.157.12
  185.81.157.121
-185.81.157.140
+185.81.157.130
  185.81.157.142
  185.81.157.167
-185.81.157.174
-185.81.157.175
  185.81.157.189
  185.81.157.208
  185.81.157.236
@@ -52347,14 +43971,9 @@
  185.81.157.58
  185.81.157.59
  185.81.157.66
-185.81.157.73
-185.81.158.101
-185.81.158.149
  185.81.166.77
  185.81.2.105
  185.81.2.81
-185.81.57.99
-185.81.96.130
  185.82.177.147
  185.82.202.109
  185.82.202.132
@@ -52377,17 +43996,19 @@
  185.82.219.12
  185.83.13.24
  185.83.145.92
-185.83.29.203
  185.85.152.241
  185.85.152.97
  185.85.189.90
  185.85.190.132
+185.85.191.196
+185.85.191.201
  185.85.219.74
  185.85.238.244
  185.85.239.110
  185.85.239.195
  185.85.3.140
  185.85.38.54
+185.86.12.246
  185.86.146.222
  185.86.148.172
  185.86.148.227
@@ -52406,44 +44027,33 @@
  185.86.164.101
  185.86.164.102
  185.86.164.103
-185.86.164.104
  185.86.164.106
  185.86.164.107
  185.86.164.108
-185.86.164.109
  185.86.164.98
  185.86.164.99
-185.86.166.174
  185.86.167.4
-185.87.122.86
  185.87.123.170
  185.87.123.34
  185.87.26.250
-185.87.45.163
  185.87.45.95
  185.87.48.123
  185.87.51.159
  185.87.70.237
-185.88.100.85
+185.88.100.152
+185.88.100.203
  185.88.158.227
-185.88.159.85
  185.88.179.172
-185.88.233.144
-185.88.37.114
  185.89.0.22
  185.89.0.237
  185.89.100.100
+185.89.100.169
  185.89.100.198
  185.89.100.20
  185.89.100.224
-185.89.124.10
-185.89.158.44
  185.89.161.157bin.sh
-185.89.244.23
-185.9.19.107
  185.9.19.90
  185.9.51.4
-185.9.62.140
  185.90.161.92
  185.90.166.56
  185.91.142.202
@@ -52451,18 +44061,14 @@
  185.91.197.253
  185.91.252.109
  185.92.220.7
+185.92.3.35
  185.92.73.100
  185.92.73.125
  185.92.73.98
  185.92.73.99
-185.92.84.25
-185.93.1.113
  185.93.182.138
-185.94.111.1
-185.94.189.182
  185.94.191.18
  185.94.191.94
-185.94.192.162
  185.94.192.214
  185.94.192.36
  185.94.192.82
@@ -52484,41 +44090,27 @@
  185.94.96.221
  185.94.97.190
  185.94.98.98
-185.95.162.84
  185.95.180.125
  185.95.2.100
  185.95.219.53
-185.95.239.229
  185.96.162.132
-185.96.166.1
-185.96.166.133
-185.96.166.228
-185.96.166.240
-185.96.166.250
-185.96.166.35
-185.96.167.10
  185.96.6.106
-185.96.71.70
-185.97.113.5
  185.97.12.130
  185.97.133.50
  185.97.134.4
+185.97.24.106
  185.97.25.96
  185.98.26.21
  185.99.184.148
+185.99.184.150
  185.99.184.151
  1851kitchen.com
  18552beguni.000webhostapp.com
  1856.31cf4fdae.com
  18577db2df4a0ba12df59e54e4f94c25-dot-dbenitonline.ey.r.appspot.com
  185betper.com
-186.0.112.175
-186.0.176.225
  186.0.239.225
-186.0.88.128
-186.0.89.194
  186.0.95.172
-186.1.181.242
  186.1.195.134
  186.1.40.105
  186.1.41.143
@@ -52526,15 +44118,10 @@
  186.1.5.35
  186.10.0.116
  186.10.125.209
-186.10.151.254
-186.10.22.250
-186.10.229.66
  186.10.231.10
-186.10.239.54
  186.10.245.152
  186.10.33.159
  186.10.35.250
-186.10.75.122
  186.10.80.122
  186.10.82.22
  186.101.16.90
@@ -52545,24 +44132,17 @@
  186.103.215.118
  186.109.88.187
  186.113.21.156
-186.114.184.195
  186.116.100.134
  186.119.116.226
  186.119.122.11
-186.12.134.65
  186.121.204.10
  186.121.206.234
  186.121.206.237
  186.121.206.241
  186.121.206.253
  186.121.228.142
-186.121.247.170
  186.122.148.216
  186.122.148.9
-186.122.149.142
-186.122.149.191
-186.122.149.68
-186.123.83.47
  186.125.171.245
  186.125.59.8
  186.126.10.18
@@ -52571,7 +44151,6 @@
  186.126.103.230
  186.126.105.189
  186.126.109.182
-186.126.109.70
  186.126.11.66
  186.126.111.205
  186.126.113.159
@@ -52621,14 +44200,13 @@
  186.126.213.94
  186.126.215.107
  186.126.218.2
-186.126.22.35
+186.126.220.186
  186.126.221.210
  186.126.224.220
  186.126.23.244
  186.126.230.20
  186.126.231.77
  186.126.238.192
-186.126.239.105
  186.126.239.205
  186.126.242.237
  186.126.27.75
@@ -52642,12 +44220,9 @@
  186.126.56.195
  186.126.57.18
  186.126.57.227
-186.126.61.140
-186.126.68.133
  186.126.71.247
  186.126.76.44
  186.126.77.185
-186.126.83.225
  186.126.85.230
  186.126.87.49
  186.126.9.115
@@ -52656,15 +44231,13 @@
  186.126.92.133
  186.126.95.126
  186.126.97.194
-186.136.187.71
  186.136.45.239
  186.137.79.39
-186.138.132.148
  186.138.186.74
-186.138.224.119
-186.139.169.241
+186.138.244.172
  186.139.227.247
  186.145.120.68
+186.145.227.100
  186.145.239.222
  186.145.254.158
  186.146.1.186
@@ -52677,17 +44250,13 @@
  186.147.160.189
  186.147.161.171
  186.147.237.152
-186.147.237.51
  186.147.245.81
  186.147.35.76
  186.148.162.100
  186.148.168.19
  186.148.172.19
  186.148.190.78
-186.148.193.55
  186.149.143.2
-186.149.199.27
-186.149.199.90
  186.149.243.229
  186.15.116.27
  186.15.156.121
@@ -52702,19 +44271,13 @@
  186.151.197.189
  186.153.124.126
  186.154.197.178
-186.154.221.154
  186.154.241.229
-186.154.40.239
-186.155.192.172
  186.155.226.43
  186.155.227.234
-186.155.253.18
  186.156.100.88
-186.156.153.5
  186.156.33.213
  186.156.79.6
-186.157.240.18
-186.158.248.235
+186.157.242.229
  186.158.74.79
  186.159.1.217
  186.159.1.58
@@ -52727,11 +44290,7 @@
  186.159.8.218
  186.16.205.157
  186.16.209.222
-186.167.0.114
  186.167.33.244
-186.167.48.45
-186.167.51.10
-186.170.28.46
  186.177.165.196
  186.178.4.190
  186.178.56.189
@@ -52739,65 +44298,75 @@
  186.178.57.101
  186.178.57.149
  186.178.57.172
-186.178.57.69
  186.178.57.70
  186.178.57.82
  186.178.57.83
  186.178.58.161
+186.178.58.21
  186.178.59.31
  186.178.59.38
-186.178.60.19
  186.178.62.160
  186.178.62.224
+186.178.62.249
+186.178.63.111
  186.178.63.242
-186.179.100.118
+186.179.100.115
+186.179.100.127
  186.179.100.128
  186.179.100.135
-186.179.100.185
-186.179.100.208
+186.179.100.14
+186.179.100.143
+186.179.100.176
+186.179.100.184
+186.179.100.196
+186.179.100.212
+186.179.100.215
  186.179.100.216
  186.179.100.229
-186.179.100.238
+186.179.100.23
+186.179.100.237
  186.179.100.241
  186.179.100.255
-186.179.100.29
-186.179.100.86
+186.179.100.33
  186.179.100.88
  186.179.100.93
  186.179.100.99
  186.179.103.118
  186.179.106.228
  186.179.111.132
+186.179.194.12
  186.179.243.77
  186.179.253.150
  186.179.40.191
-186.179.40.232
+186.179.40.221
+186.179.40.48
+186.179.42.133
+186.179.42.172
  186.179.42.174
+186.179.42.180
  186.179.42.229
+186.179.42.71
  186.179.42.81
  186.179.42.86
+186.179.43.126
  186.179.43.131
-186.179.43.151
  186.179.43.177
  186.179.43.192
  186.179.43.5
+186.179.43.68
  186.179.52.168
  186.18.180.116
  186.18.224.149
  186.18.253.51
  186.182.106.5
-186.183.151.2
-186.183.151.4
  186.183.199.203
-186.183.211.189
  186.183.251.155
  186.188.195.60
  186.188.62.9
  186.189.193.207
-186.189.235.210
  186.189.238.92
  186.189.249.2
-186.190.224.130
+186.190.224.116
  186.190.225.28
  186.192.17.242
  186.192.236.58
@@ -52821,16 +44390,12 @@
  186.193.8.116
  186.193.8.118
  186.193.8.121
-186.193.8.122
  186.200.128.78
  186.200.205.170
-186.200.65.242
  186.200.68.34
  186.201.31.186
  186.201.43.66
-186.204.143.11
  186.204.207.185
-186.204.43.53
  186.204.78.90
  186.206.129.160
  186.206.129.189
@@ -52838,9 +44403,6 @@
  186.207.131.216
  186.207.74.8
  186.208.106.62
-186.208.115.222
-186.208.121.194
-186.208.217.15
  186.208.244.121
  186.208.252.156
  186.208.5.142
@@ -52852,10 +44414,12 @@
  186.208.6.50
  186.208.6.53
  186.209.135.4
-186.210.154.26
-186.210.65.78
+186.210.12.37
+186.210.157.190
+186.210.25.252
+186.210.64.81
+186.210.88.71
  186.210.93.247
-186.210.93.25
  186.210.94.137
  186.210.95.146
  186.211.105.202
@@ -52876,12 +44440,28 @@
  186.214.248.156
  186.215.100.50
  186.215.199.65
-186.215.200.13
  186.215.202.34
-186.215.70.40
  186.216.153.23
-186.216.69.50
+186.216.68.149
+186.216.68.175
+186.216.68.186
+186.216.68.193
+186.216.68.198
+186.216.68.199
+186.216.68.215
+186.216.68.216
+186.216.68.230
+186.216.68.245
+186.216.68.249
+186.216.68.253
+186.216.69.240
+186.216.69.25
+186.216.70.11
+186.216.70.114
+186.216.70.146
+186.216.71.141
  186.216.81.21
+186.216.91.129
  186.219.210.86
  186.219.211.6
  186.219.211.9
@@ -52890,29 +44470,26 @@
  186.219.3.67
  186.219.3.68
  186.219.3.72
-186.219.3.77
  186.219.34.210
  186.219.56.1
  186.219.96.12
  186.219.96.193
  186.219.96.225
  186.219.96.47
-186.220.133.27
  186.220.212.101
  186.220.8.93
+186.221.80.226
  186.223.161.185
  186.223.165.219
+186.223.166.27
  186.223.166.82
  186.224.188.123
  186.224.225.98
-186.224.238.197
  186.224.238.32
  186.224.240.53
  186.224.247.74
-186.224.80.30
-186.225.100.74
  186.225.124.90
-186.225.133.131
+186.225.133.142
  186.225.135.54
  186.225.146.173
  186.225.151.46
@@ -52922,15 +44499,11 @@
  186.225.184.250
  186.225.186.162
  186.225.186.254
-186.225.187.128
-186.225.189.8
  186.225.194.78
-186.225.220.178
  186.225.242.165
  186.225.250.26
  186.225.252.38
  186.225.32.97
-186.225.40.1
  186.225.45.13
  186.225.52.105
  186.225.54.138
@@ -52938,29 +44511,29 @@
  186.225.61.180
  186.225.61.182
  186.225.63.134
+186.225.83.140
  186.225.98.234
  186.226.145.228
-186.226.164.169
  186.226.166.114
-186.226.166.45
+186.226.167.98
+186.226.168.66
  186.226.169.116
-186.226.169.36
-186.226.170.95
+186.226.170.141
+186.226.170.25
+186.226.170.59
+186.226.170.63
  186.226.171.129
  186.226.171.94
  186.226.172.1
  186.226.172.165
-186.226.177.250
  186.226.183.170
-186.226.188.138
  186.226.216.94
-186.226.229.3
  186.227.148.107
  186.227.150.30
-186.227.166.154
-186.227.252.53
+186.227.229.177
+186.227.55.118
+186.227.55.66
  186.228.147.58
-186.229.16.220
  186.23.211.154
  186.232.119.58
  186.232.141.17
@@ -52973,23 +44546,16 @@
  186.232.248.11
  186.232.48.98
  186.232.51.25
-186.233.169.4
+186.232.57.25
  186.233.176.26
-186.233.222.226
-186.233.226.2
-186.233.94.46
  186.233.98.146
  186.233.98.173
  186.234.249.196
  186.234.80.238
  186.234.80.89
-186.234.80.9
-186.235.43.7
  186.235.53.196
-186.235.62.161
-186.235.84.34
  186.236.111.154
-186.236.237.27
+186.236.121.229
  186.236.97.96
  186.237.131.122
  186.237.161.142
@@ -52998,14 +44564,14 @@
  186.237.223.204
  186.237.223.206
  186.237.223.42
-186.237.3.250
-186.237.78.81
  186.238.23.10
  186.239.155.106
  186.24.218.195
-186.24.5.98
  186.24.50.164
  186.24.6.36
+186.243.121.105
+186.243.122.1
+186.243.123.229
  186.248.111.102
  186.248.146.170
  186.248.166.170
@@ -53016,7 +44582,6 @@
  186.248.175.152
  186.248.175.3
  186.249.13.62
-186.249.186.16
  186.249.192.102
  186.249.217.25
  186.249.23.232
@@ -53026,7 +44591,12 @@
  186.249.231.162
  186.249.231.234
  186.249.240.146
+186.249.85.253
+186.250.193.13
+186.250.199.223
+186.250.203.126
  186.250.203.129
+186.250.203.172
  186.250.203.251
  186.250.205.147
  186.250.53.118
@@ -53034,15 +44604,12 @@
  186.250.55.5
  186.250.56.135
  186.250.89.20
-186.251.0.6
  186.251.208.121
  186.251.208.139
  186.251.208.148
-186.251.229.2
  186.251.247.58
  186.251.252.9
  186.251.253.53
-186.251.254.233
  186.251.254.253
  186.251.254.85
  186.251.255.1
@@ -53064,11 +44631,12 @@
  186.251.255.205
  186.251.255.21
  186.251.255.221
-186.251.255.225
  186.251.255.229
  186.251.255.233
+186.251.255.237
  186.251.255.241
  186.251.255.25
+186.251.255.253
  186.251.255.41
  186.251.255.45
  186.251.255.49
@@ -53080,9 +44648,9 @@
  186.251.255.97
  186.26.124.170
  186.28.125.169
+186.28.132.62
  186.28.136.135
  186.28.191.160
-186.29.133.102
  186.29.135.133
  186.29.135.64
  186.29.143.70
@@ -53091,11 +44659,8 @@
  186.29.34.136
  186.29.67.182
  186.29.70.82
-186.3.123.66
  186.3.147.10
-186.3.215.109
  186.30.148.162
-186.30.151.8
  186.30.156.1
  186.30.158.143
  186.30.158.52
@@ -53106,57 +44671,77 @@
  186.31.118.76
  186.31.36.242
  186.31.40.183
+186.33.104.104
+186.33.104.118
  186.33.104.119
-186.33.104.150
-186.33.104.174
-186.33.104.39
-186.33.104.43
-186.33.104.52
+186.33.104.12
+186.33.104.133
+186.33.104.141
+186.33.104.142
+186.33.104.163
+186.33.104.177
+186.33.104.190
+186.33.104.3
+186.33.104.46
  186.33.104.63
-186.33.104.73
-186.33.112.104
-186.33.112.110
-186.33.112.172
-186.33.112.226
-186.33.112.255
-186.33.112.35
-186.33.122.108
-186.33.122.141
-186.33.122.160
+186.33.104.96
+186.33.112.116
+186.33.112.249
+186.33.112.90
+186.33.122.101
+186.33.122.107
+186.33.122.109
+186.33.122.123
+186.33.122.152
  186.33.122.196
-186.33.122.22
-186.33.122.230
-186.33.122.232
-186.33.122.234
+186.33.122.199
+186.33.122.205
+186.33.122.209
+186.33.122.21
+186.33.122.229
  186.33.122.235
+186.33.122.24
  186.33.122.247
-186.33.122.60
+186.33.122.251
+186.33.122.254
+186.33.122.27
+186.33.122.37
+186.33.122.5
  186.33.122.75
-186.33.122.79
-186.33.122.82
+186.33.122.80
+186.33.122.84
+186.33.122.94
+186.33.123.108
  186.33.123.112
+186.33.123.113
+186.33.123.123
  186.33.123.125
-186.33.123.61
+186.33.123.17
+186.33.123.18
+186.33.123.26
+186.33.123.41
+186.33.123.47
+186.33.123.71
  186.33.123.9
+186.33.123.90
+186.33.123.91
+186.33.123.92
+186.33.211.103
  186.34.92.253
-186.35.139.37
  186.35.50.22
  186.38.26.5
  186.38.38.129
  186.38.38.2
  186.38.38.33
  186.38.38.65
-186.38.79.210
  186.4.123.139
-186.4.133.48
  186.4.172.5
  186.4.176.241
  186.4.179.78
-186.4.186.222
  186.4.192.202
  186.4.222.45
  186.4.235.4
-186.4.58.34
+186.42.102.242
  186.42.120.170
  186.42.124.130
  186.42.161.30
@@ -53171,13 +44756,12 @@
  186.46.138.194
  186.46.156.30
  186.46.184.182
-186.46.196.210
  186.46.198.122
-186.46.199.115
  186.46.222.226
  186.46.237.90
  186.46.25.210
  186.46.252.58
+186.46.40.142
  186.46.85.194
  186.47.102.166
  186.47.208.50
@@ -53193,91 +44777,74 @@
  186.5.204.2
  186.5.207.1
  186.53.148.112
-186.56.57.14
+186.58.146.96
  186.58.170.93
  186.58.28.194
+186.59.131.67
  186.59.132.129
  186.59.137.62
+186.59.148.132
  186.59.170.195
-186.59.184.47
+186.59.200.25
  186.59.213.204
-186.59.223.77
-186.60.60.63
-186.60.76.86
  186.60.98.244
  186.61.84.79
  186.64.116.45
  186.64.116.55
-186.64.117.75
  186.64.118.125
  186.64.118.210
  186.64.119.85
  186.64.199.151
+186.64.73.228
  186.65.114.130
-186.66.82.49
  186.67.13.244
  186.67.130.162
  186.67.159.100
  186.67.159.101
+186.67.164.77
  186.67.224.156
  186.67.27.174
-186.67.51.43
-186.67.60.174
  186.68.141.218
-186.68.42.228
  186.68.93.46
  186.69.213.79
-186.69.60.242
  186.7.234.150
  186.70.127.199
  186.70.56.94
-186.71.144.66
-186.71.240.100
  186.71.57.66
-186.71.70.219
  186.73.132.114
  186.73.188.132
-186.73.188.134
  186.74.169.155
  186.74.215.34
  186.74.221.210
  186.75.130.46
  186.75.241.230
+186.78.174.46
  186.80.145.145
  186.80.27.227
-186.83.133.72
-186.83.138.45
  186.83.66.200
  186.84.107.159
  186.84.172.7
  186.84.173.153
  186.84.174.33
-186.85.149.21
  186.85.159.135
  186.86.247.169
-186.88.33.21
  186.88.44.220
-186.89.10.78
  186.89.212.45
  186.9.11.188
-186.90.187.53
  186.90.29.228
  186.91.201.210
  186.91.240.234
  186.94.42.146
  186.96.102.198
-186.96.102.74
  186.96.109.181
  186.96.110.5
  186.96.121.85
  186.96.127.221
-186.96.167.82
  186.96.168.148
  186.96.175.218
+186.96.189.155
+186.96.197.18
  186.96.253.34
-186.96.36.126
-186.96.36.94
-186.97.144.202
  1860poga.co.za
  186181.com
  18655.aqq.ru
@@ -53290,10 +44857,8 @@
  187.1.166.210
  187.1.178.102
  187.1.188.158
-187.1.81.155
  187.1.81.161
  187.102.13.140
-187.102.146.222
  187.102.16.70
  187.102.71.1
  187.102.71.12
@@ -53301,31 +44866,29 @@
  187.103.15.17
  187.103.15.54
  187.103.74.137
-187.103.81.45
  187.103.82.101
  187.103.82.91
  187.104.145.56
  187.106.203.217
-187.107.186.87
  187.107.68.86
  187.108.203.53
  187.108.38.170
  187.108.46.204
-187.109.10.100
  187.109.181.77
  187.109.253.246
  187.109.36.251
+187.109.39.70
  187.109.40.9
  187.11.113.231
  187.11.126.254
  187.11.216.80
  187.11.232.71
-187.110.238.251
+187.111.153.80
  187.111.160.10
  187.111.160.23
  187.111.160.29
+187.111.160.6
  187.111.160.8
-187.111.176.193
  187.111.192.125
  187.111.192.165
  187.111.192.181
@@ -53347,29 +44910,26 @@
  187.111.193.90
  187.111.193.92
  187.111.23.14
-187.111.23.150
  187.111.28.201
+187.111.33.99
+187.111.46.199
  187.112.110.15
  187.114.164.111
+187.114.174.184
+187.114.99.46
  187.115.10.50
  187.115.67.118
  187.115.76.161
  187.116.124.25
-187.116.39.210
  187.119.191.48
-187.12.10.98
  187.12.157.82
  187.12.167.85
  187.12.181.106
-187.12.216.126
-187.120.119.167
-187.120.147.136
-187.120.147.96
-187.120.159.237
  187.120.221.165
  187.120.253.119
  187.121.100.152
  187.121.106.151
+187.121.109.85
  187.121.114.213
  187.121.126.72
  187.121.65.1
@@ -53384,29 +44944,18 @@
  187.134.229.192
  187.134.235.126
  187.135.191.160
-187.136.253.88
-187.137.28.121
  187.138.56.189
  187.141.103.107
  187.141.128.42
-187.142.7.84
  187.143.75.193
  187.144.50.63
-187.149.222.105
+187.147.141.185
+187.147.182.69
  187.149.69.121
  187.150.10.46
-187.150.38.70
  187.150.81.243
-187.151.7.126
-187.152.79.201
-187.155.131.222
-187.155.183.155
-187.155.84.186
+187.153.134.95
  187.157.32.35
-187.159.10.106
-187.159.43.131
-187.159.48.104
-187.159.60.3
  187.16.109.209
  187.16.255.199
  187.16.4.126
@@ -53418,88 +44967,62 @@
  187.162.246.198
  187.162.248.237
  187.162.250.23
-187.162.44.90
  187.162.61.184
-187.162.96.23
-187.163.122.43
-187.163.201.75
-187.168.215.87
  187.17.145.237
  187.17.148.210
  187.17.148.212
  187.17.148.214
-187.17.168.114
  187.17.172.218
  187.17.19.90
  187.17.48.86
  187.170.241.57
-187.170.247.203
-187.170.7.203
  187.172.235.182
  187.172.73.108
-187.174.215.147
  187.174.65.4
  187.177.155.123
-187.178.238.192
+187.177.85.242
  187.178.241.208
  187.18.108.73
  187.18.125.34
  187.18.47.210
-187.185.68.99
  187.188.102.9
  187.188.107.115
-187.188.116.224
-187.188.148.188
+187.188.115.81
  187.188.16.178
  187.188.166.192
-187.188.167.138
-187.188.168.69
-187.188.176.238
  187.188.181.211
  187.188.182.87
  187.188.183.5
  187.188.190.217
-187.188.195.27
  187.188.200.2
  187.188.202.78
  187.188.206.106
  187.188.213.4
  187.188.240.7
+187.188.33.146
  187.188.50.244
+187.188.67.169
  187.188.90.141
-187.189.108.139
  187.189.11.49
-187.189.11.69
-187.189.131.34
-187.189.149.224
  187.189.170.100
  187.189.178.17
-187.189.184.243
  187.189.195.208
  187.189.210.114
+187.189.222.153
  187.189.230.143
-187.189.230.226
-187.189.230.31
-187.189.231.77
-187.189.232.11
-187.189.233.242
-187.189.241.98
+187.189.237.7
  187.189.243.167
-187.189.243.22
+187.189.243.42
  187.189.27.204
  187.189.27.21
+187.189.27.30
  187.189.51.117
-187.189.52.17
-187.189.56.228
  187.189.60.10
  187.189.65.241
  187.189.7.31
  187.189.74.203
  187.189.75.245
-187.189.77.71
-187.189.82.7
-187.189.86.208
-187.189.92.38
+187.189.86.141
  187.19.114.2
  187.19.127.178
  187.19.127.180
@@ -53519,20 +45042,22 @@
  187.19.217.223
  187.19.217.230
  187.19.219.240
+187.19.8.165
  187.190.109.142
  187.190.109.201
-187.190.192.80
+187.190.154.140
  187.190.221.58
  187.190.233.6
  187.190.236.88
  187.190.237.69
  187.190.237.71
-187.190.250.138
-187.190.254.219
+187.190.255.230
  187.190.40.101
+187.190.42.115
  187.190.42.178
  187.190.48.20
  187.190.58.39
+187.190.6.26
  187.190.60.72
  187.191.20.10
  187.191.20.12
@@ -53540,23 +45065,20 @@
  187.191.4.88
  187.191.96.60
  187.192.119.193
+187.193.130.122
  187.193.221.143
  187.194.80.233
  187.195.74.33
-187.20.18.160
-187.200.119.3
  187.200.136.134
-187.200.157.242
  187.200.195.191
+187.200.199.24
  187.200.75.138
  187.200.84.217
  187.207.87.41
-187.208.147.77
-187.208.60.160
-187.210.226.214
  187.212.181.128
  187.212.3.111
  187.212.72.39
+187.214.151.204
  187.216.81.178
  187.216.81.180
  187.216.81.182
@@ -53565,16 +45087,13 @@
  187.216.81.188
  187.216.81.189
  187.216.81.190
-187.216.90.46
  187.217.199.20
  187.217.246.82
-187.22.196.43
-187.220.85.60
-187.226.113.68
+187.22.135.189
  187.227.229.200
  187.228.132.242
  187.23.135.37
-187.230.34.87
+187.232.77.155
  187.232.78.147
  187.237.103.210
  187.237.16.197
@@ -53583,24 +45102,22 @@
  187.243.240.54
  187.243.250.222
  187.243.253.182
+187.243.253.2
  187.243.255.174
-187.248.80.173
-187.254.15.41
  187.3.212.105
-187.32.153.90
  187.32.175.203
  187.32.212.208
  187.32.225.177
-187.32.48.59
  187.32.58.98
  187.32.63.186
+187.32.73.113
+187.32.76.97
  187.32.92.129
  187.33.160.252
-187.33.208.180
-187.33.245.2
  187.33.70.110
  187.33.78.226
  187.33.86.101
+187.33.87.218
  187.33.87.98
  187.33.90.18
  187.33.91.85
@@ -53610,12 +45127,11 @@
  187.33.93.197
  187.33.95.150
  187.35.147.87
-187.35.37.117
  187.36.186.3
  187.36.64.114
-187.38.150.135
  187.38.185.224
  187.38.42.137
+187.39.253.68
  187.4.114.105
  187.4.67.26
  187.40.29.86
@@ -53627,6 +45143,7 @@
  187.44.134.150
  187.44.138.152
  187.44.138.153
+187.44.138.154
  187.44.138.155
  187.44.14.19
  187.44.160.174
@@ -53634,7 +45151,6 @@
  187.44.177.134
  187.44.177.178
  187.44.184.94
-187.44.196.110
  187.44.210.246
  187.44.213.166
  187.44.225.90
@@ -53651,22 +45167,21 @@
  187.45.190.58
  187.45.193.159
  187.45.24.131
-187.45.96.8
  187.49.207.65
+187.50.136.210
  187.50.183.64
-187.50.45.130
+187.50.183.68
+187.50.183.70
  187.51.12.106
  187.52.108.202
-187.52.231.106
-187.52.70.252
  187.54.119.89
  187.54.225.76
-187.54.30.83
  187.54.74.23
  187.57.5.48
  187.58.107.81
-187.58.132.251
  187.58.65.21
+187.59.109.123
+187.59.164.79
  187.60.190.157
  187.60.34.234
  187.60.36.164
@@ -53674,29 +45189,18 @@
  187.61.17.37
  187.62.191.3
  187.62.195.145
-187.62.195.76
  187.62.220.89
-187.62.224.245
-187.62.67.1
  187.62.88.0
-187.62.88.12
+187.62.88.10
  187.62.88.14
  187.62.88.17
-187.62.88.8
-187.63.9.19
+187.62.88.2
+187.62.88.4
+187.62.88.9
  187.65.55.231
-187.67.139.209
-187.68.224.1
-187.68.35.92
-187.69.102.243
-187.69.31.249
+187.65.7.185
  187.7.156.212
-187.7.213.24
-187.71.60.11
-187.72.124.185
-187.72.139.10
-187.72.161.226
-187.72.170.97
+187.71.45.54
  187.72.177.131
  187.72.221.4
  187.72.231.193
@@ -53711,15 +45215,15 @@
  187.73.201.76
  187.73.214.155
  187.73.214.161
-187.73.26.92
+187.73.251.94
+187.73.33.43
  187.73.68.14
  187.75.209.161
+187.75.65.105
  187.75.67.84
-187.76.204.234
  187.8.171.66
  187.8.182.30
-187.84.132.20
-187.84.141.141
+187.80.240.46
  187.84.177.17
  187.84.187.33
  187.84.191.13
@@ -53734,42 +45238,37 @@
  187.84.191.41
  187.84.191.50
  187.84.191.9
-187.84.232.214
  187.85.130.98
-187.85.29.54
-187.85.80.179
+187.85.150.148
  187.85.84.202
  187.85.9.68
  187.86.129.122
  187.86.129.132
  187.86.129.134
-187.86.200.42
  187.86.201.4
  187.87.131.173
+187.87.15.155
  187.87.204.202
  187.87.204.205
  187.87.204.210
+187.87.6.124
+187.87.6.59
+187.87.7.93
+187.87.8.158
  187.9.119.44
  187.9.86.122
-187.91.1.196
-187.91.77.192
  187.93.145.83
-187.94.128.254
  187.94.16.59
  187.94.221.0
-187.94.253.222
  187.95.11.195
  187.95.114.125
  187.95.119.2
-187.95.124.103
  187.95.125.89
  187.95.162.2
-187.95.194.123
-187.95.194.125
-187.95.194.145
  187.95.236.245
+187.95.252.155
+187.95.28.135
  187.95.28.181
-187.95.49.105
  187.95.80.137
  187.95.80.141
  187.95.82.175
@@ -53779,15 +45278,9 @@
  18712030456780009000.000webhostapp.com
  1875-financeinvest.com
  187bahsegel.com
-188.0.135.108
  188.0.135.237
  188.0.151.209
  188.0.188.197
-188.0.191.81
-188.0.238.62
-188.0.238.71
-188.0.238.75
-188.0.24.190
  188.0.240.178
  188.0.240.38
  188.0.32.50
@@ -53795,35 +45288,28 @@
  188.10.210.132
  188.10.70.211
  188.100.236.114
-188.104.157.242
  188.108.202.40
-188.11.61.14
+188.109.3.246
  188.112.145.230
-188.112.171.136
  188.112.194.6
  188.113.106.183
-188.113.154.189
  188.113.166.222
-188.113.183.12
  188.113.81.17
  188.114.103.6
  188.114.140.233
  188.114.155.58
-188.114.88.183
-188.114.89.29
  188.116.40.120
  188.116.49.65
  188.117.176.56
-188.119.120.151
-188.119.24.64
  188.119.30.71
  188.119.30.72
  188.119.30.80
-188.119.30.81
  188.119.67.114
-188.120.195.50
+188.120.101.227
+188.120.116.42
+188.120.175.73
+188.120.203.161
  188.120.224.201
-188.120.225.104
  188.120.229.217
  188.120.229.66
  188.120.230.121
@@ -53838,24 +45324,26 @@
  188.120.245.247
  188.120.248.108
  188.120.253.172
+188.120.255.167
+188.120.97.41
  188.121.2.186
  188.121.252.236
-188.121.41.157
+188.121.41.158
  188.121.57.10
  188.121.57.5
-188.123.126.152
+188.122.2.55
  188.123.126.174
  188.123.126.177
  188.123.126.178
  188.124.126.69
  188.124.181.6
-188.124.37.232
  188.124.42.102
  188.124.42.103
  188.124.42.104
  188.124.42.107
  188.124.42.108
  188.124.42.119
+188.124.42.124
  188.125.107.117
  188.126.45.161
  188.126.73.10
@@ -53877,10 +45365,7 @@
  188.126.94.57
  188.127.119.38
  188.127.165.95
-188.127.167.64
  188.127.183.105
-188.127.183.132
-188.127.190.193
  188.127.224.238
  188.127.226.184
  188.127.229.105
@@ -53891,7 +45376,6 @@
  188.128.202.35.bc.googleusercontent.com
  188.128.39.127
  188.129.161.55
-188.13.55.82
  188.130.128.190
  188.130.129.138
  188.130.129.35
@@ -53899,7 +45383,6 @@
  188.130.179.11
  188.130.185.151
  188.130.187.243
-188.130.197.199
  188.130.210.243
  188.130.218.85
  188.130.219.171
@@ -53907,11 +45390,12 @@
  188.130.7.221
  188.131.129.58
  188.131.130.86
-188.131.132.83
+188.131.132.78
  188.131.133.196
-188.131.135.213
+188.131.135.227
  188.131.135.44
  188.131.140.160
+188.131.140.85
  188.131.143.134
  188.131.144.29
  188.131.144.84
@@ -53919,10 +45403,8 @@
  188.131.146.4
  188.131.148.22
  188.131.148.234
-188.131.149.116
  188.131.155.168
  188.131.156.143
-188.131.157.174
  188.131.166.222
  188.131.173.126
  188.131.173.251
@@ -53931,17 +45413,17 @@
  188.131.179.87
  188.131.183.242
  188.131.193.141
-188.131.193.68
  188.131.233.36
  188.131.235.218
  188.131.247.56
+188.133.125.175
  188.133.160.22
  188.133.165.206
  188.134.16.191
  188.134.34.43
  188.134.5.47
  188.134.6.84
-188.134.8.104
+188.134.74.188
  188.134.8.36
  188.135.15.49
  188.136.143.83
@@ -53960,10 +45442,8 @@
  188.138.84.69
  188.138.88.47
  188.14.121.243
-188.141.240.59
  188.141.34.156
  188.142.172.51
-188.142.237.253
  188.143.124.234
  188.143.145.201
  188.143.220.152
@@ -54480,35 +45960,29 @@
  188.143.233.98
  188.143.233.99
  188.143.235.21
+188.143.52.160
  188.143.57.53
  188.146.163.175
-188.146.163.227
  188.147.97.201
  188.149.149.142
+188.149.152.126
  188.15.133.158
-188.15.4.3
  188.150.7.100
-188.151.32.51
-188.151.70.46
  188.152.189.220
  188.152.33.194
-188.152.33.24
  188.152.7.140
-188.153.22.242
-188.153.7.113
  188.154.199.93
  188.154.38.35
  188.155.210.117
  188.155.219.114
+188.155.245.203
  188.155.91.186
-188.156.240.240
  188.157.101.114
-188.157.24.68
  188.158.248.126
-188.16.144.161
-188.16.145.238
+188.16.151.238
  188.16.70.72
  188.16.76.252
+188.162.199.182
  188.162.64.111
  188.162.64.41
  188.163.104.113
@@ -54517,10 +45991,10 @@
  188.163.19.0
  188.163.42.254
  188.163.74.184
+188.163.83.70
  188.165.11.196
  188.165.113.29
  188.165.119.138
-188.165.119.36
  188.165.137.96
  188.165.138.11
  188.165.140.127
@@ -54535,8 +46009,8 @@
  188.165.210.176
  188.165.211.206
  188.165.212.171
-188.165.213.155
  188.165.218.62
+188.165.220.50
  188.165.222.158
  188.165.228.188
  188.165.228.82
@@ -54559,10 +46033,8 @@
  188.165.255.8
  188.165.29.122
  188.165.34.119
-188.165.4.88
  188.165.42.223
  188.165.46.18
-188.165.50.197
  188.165.56.214
  188.165.73.28
  188.165.89.65
@@ -54574,10 +46046,9 @@
  188.166.101.23
  188.166.102.232
  188.166.102.98
-188.166.103.202
  188.166.104.152
  188.166.104.44
-188.166.105.109
+188.166.106.217
  188.166.109.87
  188.166.11.150
  188.166.111.185
@@ -54589,10 +46060,7 @@
  188.166.12.196
  188.166.120.198
  188.166.121.60
-188.166.122.217
  188.166.122.56
-188.166.123.27
-188.166.123.28
  188.166.124.106
  188.166.13.190
  188.166.144.207
@@ -54609,9 +46077,9 @@
  188.166.164.10
  188.166.164.32
  188.166.165.121
-188.166.165.223
  188.166.170.70
  188.166.172.189
+188.166.177.42
  188.166.177.99
  188.166.178.39
  188.166.18.102
@@ -54626,6 +46094,7 @@
  188.166.186.125
  188.166.186.253
  188.166.187.179
+188.166.187.225
  188.166.188.198
  188.166.188.247
  188.166.189.232
@@ -54635,14 +46104,13 @@
  188.166.190.221
  188.166.190.225
  188.166.191.195
-188.166.192.23
  188.166.193.249
  188.166.197.9
  188.166.20.136
  188.166.208.194
  188.166.208.73
+188.166.209.26
  188.166.21.143
-188.166.21.204
  188.166.21.245
  188.166.21.247
  188.166.210.143
@@ -54661,16 +46129,15 @@
  188.166.213.119
  188.166.213.97
  188.166.214.89
-188.166.215.206
  188.166.216.81
  188.166.219.160
  188.166.22.22
  188.166.220.116
  188.166.220.180
  188.166.221.186
-188.166.222.99
  188.166.223.100
  188.166.223.102
+188.166.223.13
  188.166.224.24
  188.166.224.51
  188.166.225.221
@@ -54685,16 +46152,17 @@
  188.166.229.254
  188.166.23.215
  188.166.230.130
+188.166.230.144
  188.166.232.159
  188.166.232.165
  188.166.232.65
  188.166.233.216
-188.166.234.135
  188.166.234.253
  188.166.236.56
  188.166.236.57
  188.166.237.0
  188.166.237.234
+188.166.239.7
  188.166.24.63
  188.166.240.30
  188.166.241.194
@@ -54728,7 +46196,6 @@
  188.166.255.18
  188.166.255.227
  188.166.255.49
-188.166.26.69
  188.166.27.111
  188.166.3.185
  188.166.3.215
@@ -54747,15 +46214,13 @@
  188.166.4.178
  188.166.43.209
  188.166.46.210
-188.166.47.204
  188.166.48.223
  188.166.49.115
  188.166.5.210
  188.166.5.50
  188.166.5.84
-188.166.50.163
  188.166.52.90
-188.166.56.189
+188.166.56.218
  188.166.56.221
  188.166.58.130
  188.166.58.159
@@ -54764,6 +46229,7 @@
  188.166.58.29
  188.166.58.47
  188.166.58.96
+188.166.59.73
  188.166.6.130
  188.166.60.138
  188.166.61.49
@@ -54772,55 +46238,31 @@
  188.166.69.56
  188.166.70.140
  188.166.71.170
-188.166.71.42
-188.166.72.130
  188.166.72.22
-188.166.72.62
-188.166.73.160
  188.166.73.180
-188.166.73.252
-188.166.73.49
-188.166.74.51
-188.166.76.35
-188.166.77.159
  188.166.78.120
  188.166.8.81
  188.166.8.86
  188.166.80.133
  188.166.81.188
-188.166.82.188
-188.166.82.19
  188.166.83.13
-188.166.83.209
-188.166.86.101
-188.166.86.210
  188.166.86.85
  188.166.87.110
  188.166.87.132
  188.166.87.188
  188.166.87.245
  188.166.9.210
-188.166.90.169
-188.166.90.175
  188.166.91.158
-188.166.91.52
-188.166.91.83
-188.166.92.179
-188.166.92.199
-188.166.93.41
  188.166.93.50
-188.166.93.53
-188.166.94.223
-188.166.94.8
  188.166.95.105
-188.166.95.70
  188.166.97.208
+188.166.98.233
  188.166.99.160
  188.166.99.74
  188.167.158.203
+188.167.225.155
  188.168.27.71
  188.168.27.73
-188.168.30.47
  188.168.56.31
  188.168.56.82
  188.168.75.254
@@ -54833,20 +46275,15 @@
  188.169.167.249
  188.169.167.74
  188.169.174.78
-188.169.179.127
  188.169.199.144
  188.169.199.59
  188.169.20.174
  188.169.237.144
-188.169.237.90
  188.169.30.211
  188.169.30.30
-188.169.36.114
  188.169.36.163
-188.169.36.171
  188.169.36.206
  188.169.36.214
-188.169.36.224
  188.169.45.114
  188.169.45.115
  188.169.45.140
@@ -54858,17 +46295,12 @@
  188.169.64.3
  188.169.64.67
  188.17.148.154
-188.17.152.6
-188.17.155.103
-188.17.156.113
-188.170.120.67
+188.17.152.30
  188.170.122.155
  188.170.13.225
-188.170.15.17
  188.170.183.138
  188.170.189.28
  188.170.208.210
-188.170.28.69
  188.170.33.57
  188.170.41.6
  188.170.63.9
@@ -54878,9 +46310,8 @@
  188.173.14.99
  188.173.80.134
  188.173.97.144
-188.174.11.21
  188.174.23.122
-188.177.179.8
+188.174.3.227
  188.18.54.130
  188.18.54.242
  188.18.68.230
@@ -54889,54 +46320,33 @@
  188.18.91.255
  188.181.73.110
  188.186.180.135
-188.186.182.56
  188.187.0.42
  188.187.108.131
  188.187.62.173
  188.19.123.186
-188.19.124.120
-188.19.177.132
-188.19.177.236
-188.19.183.40
-188.19.184.176
-188.19.184.181
-188.19.188.38
-188.19.189.221
-188.19.190.47
  188.19.191.178
  188.19.64.122
  188.190.101.143
  188.190.124.1
-188.190.232.175
  188.190.234.13
-188.190.245.135
  188.191.103.67
  188.191.166.23
-188.191.232.149
  188.191.232.66
-188.191.239.10
-188.191.239.44
-188.191.239.83
-188.191.239.92
  188.192.12.35
  188.192.123.62
  188.192.175.128
  188.193.117.90
  188.194.188.240
-188.195.138.20
+188.195.142.248
  188.195.169.0
  188.205.25.124
  188.208.111.62
-188.208.143.114
  188.209.49.164
  188.212.100.2
+188.212.190.165
  188.213.167.120
  188.213.170.40
-188.213.212.35
-188.213.212.47
-188.213.212.48
-188.213.212.49
-188.213.212.50
+188.213.175.168
  188.213.34.13
  188.213.34.24
  188.213.49.139
@@ -54950,26 +46360,20 @@
  188.214.132.45
  188.214.132.85
  188.214.133.114
-188.214.204.137
  188.214.30.78
-188.214.32.159
+188.215.229.26
  188.215.70.115
  188.216.254.72
-188.217.154.141
  188.217.181.18
-188.217.235.95
-188.217.242.71
  188.217.61.212
-188.218.104.96
  188.218.250.61
  188.218.47.5
  188.219.117.26
  188.219.235.35
  188.219.31.12
+188.22.30.167
  188.22.43.101
-188.221.85.5
  188.223.95.61
-188.224.14.33
  188.225.177.37
  188.225.179.86
  188.225.202.1
@@ -54993,16 +46397,12 @@
  188.226.153.173
  188.226.165.170
  188.226.167.212
-188.226.174.45
  188.226.176.113
  188.226.179.232
  188.226.180.234
  188.226.188.45
-188.226.189.117
  188.226.192.115
  188.226.233.196
-188.226.250.187
-188.227.170.139
  188.227.193.27
  188.227.193.35
  188.227.193.51
@@ -55011,39 +46411,37 @@
  188.227.195.70
  188.227.85.53
  188.23.46.85
-188.230.140.199
+188.23.90.78
+188.23.93.217
  188.230.141.9
  188.230.225.197
  188.230.241.10
-188.231.191.134
  188.234.216.99
-188.234.218.182
  188.234.218.19
  188.234.247.110
  188.234.251.138
-188.234.93.184
  188.235.0.42
  188.235.128.166
  188.235.133.102
  188.235.137.15
-188.235.141.107
  188.235.145.183
  188.235.34.146
  188.235.61.20
  188.235.61.22
  188.235.61.25
  188.235.76.27
+188.235.8.5
  188.237.119.104
  188.237.135.3
  188.237.190.44
-188.237.196.171
-188.237.50.113
-188.239.27.18
+188.237.250.100
+188.237.66.81
  188.24.24.203
  188.240.136.75
  188.240.191.163
  188.240.208.26
  188.241.121.171
+188.241.177.56
  188.241.39.65
  188.241.45.61
  188.241.45.85
@@ -55053,33 +46451,27 @@
  188.241.73.75
  188.241.82.145
  188.242.133.111
-188.242.166.123
-188.242.175.18
+188.242.27.193
  188.242.5.172
  188.242.70.154
  188.243.116.199
  188.243.190.110
  188.243.249.244
  188.243.58.75
-188.244.11.106
  188.244.20.242
  188.244.21.196
  188.246.181.50
  188.246.20.122
  188.246.224.67
-188.246.226.71
-188.246.236.122
  188.247.112.37
  188.247.144.165
  188.247.144.62
-188.247.31.26
  188.247.39.14
  188.247.86.1
  188.247.90.253
  188.25.139.117
  188.251.213.180
  188.252.14.236
-188.252.166.185
  188.252.198.250
  188.252.64.154
  188.254.0.116
@@ -55087,12 +46479,10 @@
  188.254.0.182
  188.254.159.122
  188.254.172.147
-188.254.76.69
-188.254.76.98
  188.255.118.20
-188.255.120.102
  188.255.120.9
  188.255.178.250
+188.255.184.115
  188.255.208.105
  188.255.208.17
  188.255.208.246
@@ -55111,26 +46501,16 @@
  188.255.213.49
  188.255.214.121
  188.255.214.9
+188.255.237.204
  188.255.237.206
-188.255.237.208
+188.255.237.209
  188.255.237.212
  188.255.237.213
  188.255.237.214
-188.255.237.59
-188.255.250.6
-188.26.196.155
-188.26.199.10
-188.26.226.102
  188.26.5.254
-188.26.7.21
-188.26.87.15
  188.27.137.163
-188.27.33.153
-188.28.88.161
-188.28.88.190
-188.29.87.10
-188.3.36.167
-188.32.121.140
+188.27.178.18
+188.30.22.172
  188.32.128.165
  188.32.128.29
  188.32.145.79
@@ -55139,12 +46519,10 @@
  188.34.153.196
  188.34.155.241
  188.35.167.7
-188.35.21.100
+188.35.22.131
  188.36.125.210
  188.36.194.253
  188.37.24.190
-188.38.102.54
-188.38.106.24
  188.38.154.27
  188.38.97.58
  188.40.114.21
@@ -55161,11 +46539,11 @@
  188.43.117.38
  188.43.225.109
  188.43.52.166
-188.47.10.183
  188.47.16.50
  188.50.127.101
  188.50.156.5
  188.52.48.48
+188.53.144.205
  188.53.7.172
  188.53.88.202
  188.55.47.202
@@ -55173,11 +46551,7 @@
  188.59.186.124
  188.6.164.138
  188.6.165.216
-188.61.141.169
-188.61.18.213
  188.61.31.103
-188.62.158.119
-188.63.101.156
  188.63.75.92
  188.64.132.119
  188.64.169.166
@@ -55188,13 +46562,13 @@
  188.64.171.248
  188.64.175.211
  188.64.186.224
+188.64.77.203
+188.65.132.236
  188.65.237.16
  188.65.73.110
  188.65.74.60
  188.65.85.4
-188.65.89.101
-188.65.91.223
-188.68.155.164
+188.66.6.88
  188.68.216.61
  188.68.217.63
  188.68.45.143
@@ -55202,49 +46576,46 @@
  188.68.53.44
  188.68.56.168
  188.68.56.223
+188.69.131.186
  188.69.135.214
-188.69.231.104
  188.69.251.12
  188.70.121.51
-188.72.111.33
  188.72.115.105
  188.72.115.106
  188.72.202.147
  188.72.6.98
+188.73.233.152
  188.75.138.234
  188.75.139.60
-188.75.16.163
+188.75.140.83
  188.75.173.148
  188.75.186.152
  188.76.182.249
-188.76.21.190
  188.80.27.54
-188.80.45.190
  188.81.100.83
  188.82.39.247
-188.82.65.179
-188.84.233.33
-188.85.137.146
+188.82.75.128
  188.85.143.170
-188.9.104.199
  188.9.246.107
+188.91.120.116
  188.92.190.38
+188.92.214.142
+188.92.214.154
  188.92.244.38
  188.92.73.91
-188.92.77.235
  188.93.104.2
  188.93.111.77
  188.93.208.12
  188.93.238.17
  188.93.245.172
  188.93.64.242
+188.93.78.69
  188.94.141.10
  188.94.164.178
  188.94.42.24
  188.94.66.42
-188.95.20.84
  188.95.234.6
-188.95.4.177
+188.99.173.249
  18850306919.mer.lstest.siquality.com
  18850306929.mer.lstest.siquality.com
  188elexusbet.blogspot.com
@@ -55253,10 +46624,7 @@
  189.1.123.19
  189.1.152.26
  189.1.16.61
-189.1.162.2
  189.1.163.101
-189.1.169.172
-189.1.169.174
  189.1.175.69
  189.1.26.17
  189.1.27.74
@@ -55271,56 +46639,41 @@
  189.109.236.166
  189.109.252.155
  189.11.126.17
-189.11.89.7
  189.111.216.202
-189.112.102.206
-189.112.125.131
  189.112.125.209
  189.112.125.212
  189.112.15.255
+189.112.150.193
  189.112.179.115
  189.112.196.1
  189.112.228.153
-189.112.4.168
+189.112.239.240
  189.112.46.154
-189.112.46.235
-189.112.49.220
-189.112.89.17
-189.112.94.247
-189.113.131.226
+189.112.47.181
  189.113.174.22
-189.113.185.178
-189.113.185.3
-189.113.187.156
  189.113.2.23
  189.113.217.35
-189.113.4.178
  189.114.2.235
  189.114.223.96
-189.114.67.217
+189.114.67.195
  189.114.93.191
  189.115.171.178
  189.120.76.102
  189.120.82.6
  189.121.186.147
-189.122.131.45
  189.122.185.116
-189.122.229.17
  189.123.103.233
  189.123.173.24
  189.124.17.106
  189.124.180.40
-189.124.219.226
  189.124.8.192
  189.124.94.171
  189.126.12.49
  189.126.14.210
-189.126.168.43
+189.126.173.51
  189.126.195.70
  189.126.202.121
-189.126.204.206
  189.126.28.28
-189.126.43.64
  189.126.67.230
  189.126.71.203
  189.127.106.16
@@ -55330,103 +46683,69 @@
  189.127.181.74
  189.127.25.111
  189.128.7.128
-189.130.130.241
  189.131.208.212
  189.132.112.125
-189.134.236.50
-189.134.32.244
  189.134.40.44
+189.134.56.147
  189.135.135.123
-189.135.174.168
-189.135.193.169
  189.136.141.240
  189.138.59.0
  189.138.94.69
-189.139.118.156
+189.139.127.116
  189.139.127.241
  189.139.15.186
+189.139.28.37
+189.139.65.128
  189.14.193.242
  189.14.193.94
  189.14.194.113
  189.14.233.26
-189.14.33.52
+189.14.34.150
  189.14.96.74
-189.142.141.72
-189.145.129.236
-189.146.119.195
  189.146.141.125
  189.146.149.68
-189.146.157.94
  189.146.186.156
-189.146.41.176
  189.148.103.223
-189.148.171.114
  189.15.17.127
-189.15.187.223
-189.15.204.202
-189.15.210.45
-189.15.232.64
-189.15.24.72
-189.15.249.32
+189.15.207.24
  189.15.31.238
-189.15.37.165
-189.15.51.201
-189.151.199.34
+189.15.37.41
  189.151.29.209
-189.151.88.219
  189.152.130.84
  189.152.213.9
-189.152.253.166
  189.152.61.86
  189.153.95.182
  189.154.120.111
-189.154.229.5
-189.157.12.243
  189.16.123.100
  189.162.137.237
+189.162.175.140
  189.162.178.188
  189.162.180.119
  189.166.212.235
-189.167.203.155
  189.167.6.108
-189.170.126.209
  189.171.31.166
-189.171.37.111
  189.171.65.89
-189.172.23.160
+189.172.101.28
  189.172.80.210
-189.172.95.239
-189.173.109.63
  189.174.117.246
-189.174.230.226
-189.176.62.142
  189.177.110.65
  189.177.80.175
  189.178.110.146
  189.178.119.58
  189.178.160.46
  189.178.207.48
-189.179.251.112
-189.179.254.234
  189.18.14.93
-189.18.88.168
  189.18.88.191
-189.180.114.184
-189.186.15.243
-189.186.65.69
-189.186.75.147
-189.189.221.39
+189.180.18.232
+189.180.28.15
+189.187.28.17
  189.189.236.98
  189.192.133.225
-189.194.190.56
  189.194.58.119
-189.195.143.166
  189.195.195.103
  189.195.23.210
-189.198.134.214
  189.198.135.118
  189.198.135.158
-189.198.138.114
  189.199.106.202
  189.2.127.243
  189.2.127.244
@@ -55439,49 +46758,38 @@
  189.201.191.65
  189.201.191.66
  189.201.191.69
+189.201.240.118
  189.201.242.186
  189.201.242.24
-189.201.249.189
  189.201.250.173
-189.203.130.134
  189.203.133.11
  189.203.139.37
-189.203.145.131
  189.203.162.20
  189.203.194.2
-189.203.237.120
-189.203.240.2
  189.203.26.46
+189.203.36.215
  189.203.73.102
  189.203.79.116
  189.203.91.4
  189.204.242.178
  189.204.49.40
  189.204.52.235
-189.205.111.44
  189.205.192.140
-189.206.147.226
  189.206.160.153
  189.206.165.62
  189.206.166.12
  189.206.216.18
  189.206.216.20
  189.207.242.90
-189.207.250.88
-189.207.37.70
  189.207.46.32
  189.209.110.202
  189.209.217.49
  189.209.7.168
-189.210.97.111
+189.210.52.157
  189.211.183.151
  189.212.103.237
  189.212.115.70
-189.212.90.217
-189.213.12.127
-189.213.160.219
  189.213.228.237
-189.213.85.3
  189.214.64.34
  189.218.107.128
  189.218.156.138
@@ -55490,157 +46798,125 @@
  189.219.72.148
  189.22.180.250
  189.222.175.66
-189.222.212.23
-189.223.105.172
  189.223.19.109
+189.224.10.90
  189.224.39.156
-189.225.162.157
-189.23.8.180
  189.232.97.73
  189.235.87.72
  189.236.122.23
-189.236.21.208
  189.236.212.18
-189.236.242.145
-189.236.25.43
  189.236.32.128
+189.236.58.190
  189.237.113.4
-189.237.192.210
-189.237.35.160
-189.238.58.155
  189.24.149.241
  189.24.54.53
-189.240.103.213
  189.240.117.236
  189.240.225.205
  189.240.62.227
  189.241.135.235
-189.243.115.185
  189.243.80.31
  189.244.48.69
  189.248.93.110
-189.249.223.10
-189.249.89.31
  189.250.126.76
  189.252.102.40
-189.252.188.107
  189.252.214.37
-189.253.92.225
-189.254.177.90
  189.254.255.168
  189.254.255.180
  189.26.128.138
-189.26.200.82
-189.26.251.122
  189.26.78.155
  189.27.231.123
  189.28.167.160
  189.28.186.26
  189.30.181.98
-189.31.20.254
  189.33.53.14
-189.34.104.177
+189.33.66.108
  189.34.181.88
  189.34.55.212
  189.35.124.119
  189.38.101.233
-189.38.101.234
  189.38.88.105
  189.38.90.83
  189.39.102.67
  189.39.124.90
  189.39.127.118
-189.39.130.205
-189.39.177.11
  189.4.1.12
  189.4.11.237
  189.4.128.122
  189.4.2.58
  189.4.223.50
  189.4.3.172
-189.41.242.199
  189.41.244.19
-189.41.47.68
-189.41.66.23
-189.41.78.91
+189.41.245.216
+189.41.71.72
  189.41.79.241
+189.41.90.184
  189.44.178.170
-189.45.13.209
  189.45.144.26
  189.45.199.37
-189.45.37.254
+189.46.20.42
  189.47.156.120
  189.47.255.30
-189.47.57.140
  189.50.145.18
  189.51.101.126
  189.51.101.145
  189.51.103.125
  189.51.116.5
-189.51.118.22
  189.51.127.1
  189.51.143.10
  189.51.97.126
  189.51.97.35
  189.51.98.182
-189.52.154.213
  189.52.165.134
  189.52.165.84
  189.54.62.128
  189.55.194.94
+189.56.184.27
  189.57.121.10
  189.57.62.34
  189.57.73.18
-189.59.13.202
-189.59.69.3
+189.59.128.229
  189.6.28.187
+189.6.32.101
  189.6.78.34
-189.61.174.184
-189.61.25.110
  189.62.220.195
+189.63.17.191
  189.63.219.250
-189.63.81.219
+189.63.80.5
+189.63.87.20
  189.65.53.168
  189.68.140.123
  189.69.105.240
  189.7.129.60
-189.7.146.169
  189.7.217.23
-189.7.25.246
  189.7.81.29
-189.70.115.128
  189.71.187.84
  189.71.240.56
  189.75.115.204
-189.78.155.37
  189.78.156.8
  189.78.251.165
-189.79.114.190
  189.79.142.55
  189.79.170.194
  189.79.193.173
  189.79.74.43
  189.79.76.236
+189.79.99.149
  189.8.108.50
  189.80.111.66
+189.80.143.222
  189.80.219.58
  189.80.219.60
  189.80.219.62
  189.80.3.187
-189.81.221.118
  189.82.99.137
  189.84.112.217
  189.84.112.218
  189.84.112.220
  189.84.112.222
  189.84.121.178
-189.84.121.58
  189.84.21.44
  189.84.236.1
  189.84.242.14
  189.85.100.1
-189.85.40.2
-189.85.85.10
  189.88.240.103
  189.89.135.78
  189.89.168.131
@@ -55648,10 +46924,11 @@
  189.89.170.234
  189.89.18.86
  189.89.187.162
+189.89.214.180
+189.89.222.168
  189.89.242.122
  189.89.27.17
  189.89.66.210
-189.89.66.211
  189.9.25.66
  189.9.25.69
  189.9.25.89
@@ -55659,6 +46936,8 @@
  189.9.25.92
  189.9.25.94
  189.90.114.37
+189.90.210.144
+189.90.210.20
  189.90.244.46
  189.90.244.82
  189.90.254.193
@@ -55667,8 +46946,13 @@
  189.91.101.54
  189.91.115.6
  189.91.239.194
+189.91.4.147
+189.91.4.153
  189.91.5.167
  189.91.84.25
+189.93.94.198
+189.94.193.65
+189.95.119.245
  189.95.186.43
  189cj.cn
  189zx.com
@@ -55696,21 +46980,17 @@
  18whatsapp.zzux.com
  18whatsappgroupbokep.tk
  190-365.net
-190.0.121.205
  190.0.159.74
  190.0.159.86
  190.0.242.217
  190.0.246.9
-190.0.51.2
  190.0.53.213
  190.0.61.18
  190.0.8.134
-190.10.122.160
-190.10.159.34
-190.10.177.60
+190.1.203.180
  190.10.8.67
  190.100.170.253
-190.101.40.205
+190.101.168.19
  190.102.147.3
  190.102.147.6
  190.102.147.8
@@ -55723,15 +47003,12 @@
  190.103.29.236
  190.104.10.164
  190.104.149.194
-190.104.157.142
  190.104.17.3
  190.104.175.34
  190.104.2.46
-190.104.213.73
  190.104.233.95
  190.104.235.8
  190.104.237.148
-190.104.245.164
  190.104.245.28
  190.104.245.41
  190.104.247.220
@@ -55741,18 +47018,13 @@
  190.104.254.198
  190.104.26.227
  190.104.64.242
+190.104.66.223
  190.104.68.246
  190.104.69.241
  190.105.213.165
-190.105.217.217
  190.106.103.250
  190.106.104.2
  190.106.97.230
-190.107.17.131
-190.107.177.38
-190.107.21.4
-190.107.240.237
-190.107.63.68
  190.108.217.6
  190.108.228.27
  190.108.228.48
@@ -55760,7 +47032,6 @@
  190.108.67.138
  190.108.84.166
  190.109.160.73
-190.109.164.58
  190.109.167.9
  190.109.167.98
  190.109.168.241
@@ -55768,9 +47039,10 @@
  190.109.170.105
  190.109.170.245
  190.109.178.180
+190.109.194.46
  190.109.196.41
  190.109.196.44
-190.109.217.114
+190.109.43.185
  190.109.43.253
  190.109.72.10
  190.109.72.21
@@ -55778,24 +47050,19 @@
  190.109.72.33
  190.109.72.41
  190.109.74.1
+190.109.75.109
  190.109.75.253
  190.11.15.14
-190.11.156.207
-190.11.168.226
-190.11.195.102
+190.11.158.152
  190.11.198.89
  190.11.53.13
-190.110.179.106
  190.110.182.230
  190.110.197.18
  190.110.86.134
  190.111.119.69
-190.111.184.1
  190.111.211.52
  190.111.231.8
-190.111.232.247
  190.111.245.154
-190.111.246.85
  190.112.136.125
  190.112.136.177
  190.112.136.181
@@ -55803,24 +47070,17 @@
  190.112.193.110
  190.112.193.254
  190.112.196.12
-190.112.224.132
  190.113.162.53
  190.113.165.223
+190.113.211.245
  190.113.236.48
  190.113.238.240
  190.113.239.244
-190.114.138.228
  190.114.255.23
-190.114.70.247
-190.114.71.125
-190.114.81.233
-190.114.94.161
-190.115.10.45
  190.115.18.139
  190.115.218.2
  190.115.219.249
  190.115.4.2
-190.117.108.106
  190.117.126.169
  190.117.145.221
  190.117.147.185
@@ -55829,6 +47089,7 @@
  190.117.206.153
  190.117.214.61
  190.117.250.61
+190.119.131.29
  190.119.199.18
  190.119.242.38
  190.12.102.205
@@ -55837,16 +47098,15 @@
  190.12.22.166
  190.12.39.194
  190.12.47.246
-190.12.49.90
  190.12.66.27
  190.12.8.146
  190.12.8.206
  190.12.86.98
  190.12.88.133
  190.12.95.170
+190.12.95.56
  190.120.123.2
  190.120.123.4
-190.120.225.11
  190.120.23.157
  190.120.253.66
  190.120.254.17
@@ -55857,10 +47117,7 @@
  190.121.157.90
  190.121.16.250
  190.121.5.210
-190.121.6.65
-190.122.112.160
  190.122.112.32
-190.122.112.41
  190.123.23.22
  190.123.35.138
  190.123.35.139
@@ -55880,16 +47137,13 @@
  190.123.90.242
  190.123.90.246
  190.124.164.78
-190.124.247.250
  190.124.250.10
  190.124.34.221
-190.124.60.10
  190.128.129.18
  190.128.135.130
  190.128.137.90
  190.128.142.218
  190.128.148.198
-190.128.154.222
  190.128.169.222
  190.128.171.250
  190.128.226.122
@@ -55902,31 +47156,20 @@
  190.129.12.90
  190.129.49.62
  190.129.69.101
-190.129.72.242
-190.129.99.102
-190.13.136.53
  190.13.138.50
  190.13.173.67
-190.13.178.65
+190.13.221.197
  190.13.63.218
  190.13.82.242
-190.13.83.125
-190.13.84.2
  190.13.84.221
  190.131.167.50
  190.131.206.106
-190.131.208.146
-190.131.230.147
  190.133.192.231
  190.134.168.53
  190.134.172.66
  190.134.217.71
  190.134.25.155
-190.135.245.199
-190.135.43.147
-190.135.84.212
  190.136.178.52
-190.136.183.199
  190.137.230.166
  190.138.206.15
  190.138.206.16
@@ -55934,9 +47177,12 @@
  190.14.170.109
  190.14.231.211
  190.14.39.239
-190.14.41.58
+190.140.20.59
+190.140.70.246
+190.140.92.234
  190.141.231.0
  190.142.137.9
+190.142.142.14
  190.143.117.178
  190.143.137.114
  190.143.39.211
@@ -55947,23 +47193,17 @@
  190.144.187.188
  190.144.224.182
  190.144.250.167
-190.144.33.65
  190.144.44.36
  190.144.57.186
  190.144.60.138
  190.144.70.74
-190.144.79.102
  190.144.79.157
-190.144.92.114
  190.144.99.11
-190.145.102.78
-190.145.118.122
  190.145.12.233
  190.145.123.26
  190.145.128.22
  190.145.132.250
  190.145.148.34
-190.145.151.68
  190.145.156.58
  190.145.157.206
  190.145.159.26
@@ -55978,19 +47218,14 @@
  190.145.60.229
  190.145.69.123
  190.145.77.219
-190.145.81.37
  190.145.92.18
  190.146.13.180
  190.146.131.105
-190.146.131.138
-190.146.133.251
  190.146.155.105
  190.146.87.202
  190.147.137.66
-190.147.158.196
  190.147.19.117
  190.147.215.53
-190.147.3.2
  190.147.33.171
  190.147.81.16
  190.148.39.222
@@ -55998,19 +47233,14 @@
  190.149.165.162
  190.149.165.214
  190.149.216.74
-190.149.59.82
  190.15.221.21
  190.15.221.4
  190.15.222.101
-190.15.226.115
  190.151.100.10
-190.151.123.26
-190.151.50.214
  190.151.94.2
-190.152.0.130
-190.152.10.198
  190.152.12.54
  190.152.15.194
+190.152.17.62
  190.152.180.90
  190.152.181.106
  190.152.181.74
@@ -56024,7 +47254,6 @@
  190.152.221.82
  190.152.39.78
  190.152.44.55
-190.152.5.126
  190.152.5.130
  190.152.5.134
  190.152.5.86
@@ -56035,21 +47264,14 @@
  190.152.88.114
  190.153.209.146
  190.153.222.250
-190.153.228.250
  190.153.249.99
-190.154.14.239
-190.154.170.8
-190.154.25.210
  190.155.106.74
-190.155.204.86
  190.156.227.27
  190.156.229.215
  190.156.231.182
  190.156.231.245
  190.156.238.155
  190.159.240.215
-190.159.72.55
-190.16.124.195
  190.16.241.145
  190.160.43.137
  190.160.53.126
@@ -56062,42 +47284,31 @@
  190.164.104.62
  190.165.166.138
  190.166.28.179
-190.166.78.248
  190.166.90.2
  190.167.135.54
+190.167.170.244
  190.167.215.170
  190.167.220.7
  190.17.44.48
  190.17.51.132
  190.171.133.10
  190.171.153.139
-190.171.180.162
-190.171.185.53
-190.171.202.7
  190.171.218.40
  190.171.219.220
-190.171.221.225
-190.171.233.75
  190.171.240.51
-190.171.90.147
  190.177.83.80
  190.18.10.68
-190.18.145.210
  190.18.184.113
  190.18.207.58
  190.18.3.250
  190.18.63.166
-190.180.53.98
  190.180.53.99
-190.180.65.14
  190.181.122.225
  190.181.122.233
  190.181.190.30
-190.181.60.196
  190.182.232.250
  190.182.88.214
  190.182.88.226
-190.183.129.18
  190.183.239.249
  190.183.60.210
  190.183.61.156
@@ -56106,45 +47317,29 @@
  190.184.201.146
  190.184.201.154
  190.184.213.203
-190.185.118.58
  190.185.119.44
  190.185.150.4
  190.186.1.46
-190.186.124.209
-190.186.124.54
  190.186.144.99
  190.186.170.82
-190.186.186.3
-190.186.19.42
-190.186.198.18
-190.186.198.68
-190.186.243.67
-190.186.253.86
-190.186.26.175
-190.186.36.148
-190.186.50.73
  190.186.76.19
  190.186.89.150
  190.187.100.17
  190.187.112.66
  190.187.240.84
-190.187.58.50
-190.188.156.33
  190.188.245.242
  190.188.252.82
+190.189.170.52
  190.189.188.120
-190.189.42.121
+190.189.21.5
  190.19.27.186
  190.190.219.184
-190.191.118.158
  190.191.163.147
  190.191.171.72
+190.192.110.126
  190.192.39.136
  190.193.8.28
  190.194.12.132
-190.194.127.201
-190.194.130.180
-190.194.182.140
  190.195.129.227
  190.195.148.163
  190.195.235.56
@@ -56179,68 +47374,51 @@
  190.2.16.178
  190.2.209.46
  190.2.21.153
-190.2.211.18
  190.2.31.172
  190.20.97.244
  190.200.120.251
-190.200.87.171
-190.201.153.174
-190.202.0.82
  190.202.109.244
  190.202.124.93
  190.202.147.253
-190.202.217.59
  190.202.22.129
+190.202.238.156
  190.202.24.66
  190.202.32.2
-190.203.182.137
+190.202.44.194
  190.205.111.140
  190.205.156.139
  190.205.34.227
  190.206.113.156
  190.206.250.72
-190.206.61.61
-190.207.79.153
-190.207.79.88
  190.208.17.136
-190.208.22.227
-190.21.234.43
-190.21.32.3
  190.21.43.26
+190.210.104.157
  190.210.15.194
-190.210.151.152
-190.210.161.210
  190.210.164.141
  190.210.182.179
  190.210.184.138
-190.210.214.54
  190.210.231.34
  190.210.236.139
  190.210.238.77
-190.210.47.73
  190.210.72.84
  190.210.8.65
  190.210.8.69
  190.210.93.9
  190.211.154.255
  190.211.160.114
-190.211.2.151
  190.211.204.68
  190.211.254.191
  190.211.254.193
  190.211.254.196
  190.211.5.210
  190.212.140.6
-190.213.153.68
  190.213.161.17
  190.213.180.98
  190.213.4.130
  190.213.71.109
-190.214.1.190
  190.214.12.34
  190.214.13.2
  190.214.13.90
-190.214.15.46
  190.214.18.70
  190.214.20.10
  190.214.27.26
@@ -56250,22 +47428,17 @@
  190.214.44.230
  190.214.50.158
  190.214.51.166
+190.214.79.95
  190.214.9.10
-190.215.117.149
+190.215.113.98
  190.215.117.69
-190.215.144.220
  190.215.18.121
  190.215.220.34
  190.215.220.36
  190.215.220.38
-190.215.27.182
-190.215.76.30
-190.215.88.61
  190.216.166.200
-190.216.175.158
  190.216.2.136
  190.216.244.132
-190.216.250.11
  190.217.1.101
  190.217.1.121
  190.217.1.129
@@ -56276,18 +47449,14 @@
  190.217.1.57
  190.217.1.89
  190.217.1.9
-190.217.223.104
  190.217.4.102
-190.217.4.66
-190.217.63.6
  190.217.68.210
  190.217.68.211
  190.217.68.212
  190.217.68.221
  190.218.150.141
+190.218.185.75
  190.219.149.236
-190.219.160.91
-190.219.176.79
  190.220.17.34
  190.221.152.130
  190.221.46.78
@@ -56298,7 +47467,6 @@
  190.226.33.211
  190.226.46.114
  190.226.46.116
-190.228.147.172
  190.228.171.10
  190.228.171.126
  190.228.171.17
@@ -56306,22 +47474,16 @@
  190.228.171.5
  190.228.171.6
  190.228.29.70
-190.229.14.252
  190.230.60.129
  190.232.112.115
  190.232.223.60
  190.233.187.198
-190.234.148.76
+190.236.203.178
  190.236.225.222
  190.236.28.112
-190.236.58.65
-190.238.35.27
  190.239.1.225
-190.24.116.28
-190.24.119.19
  190.24.131.38
  190.24.243.186
-190.24.45.109
  190.24.50.205
  190.24.50.238
  190.24.6.162
@@ -56331,42 +47493,29 @@
  190.242.47.102
  190.242.47.126
  190.242.98.61
-190.244.138.46
-190.244.145.63
-190.244.76.27
  190.244.96.69
  190.245.117.162
-190.245.118.206
-190.245.187.164
  190.245.22.47
+190.246.152.117
  190.246.155.119
  190.246.155.29
-190.246.33.57
-190.247.114.229
-190.247.16.37
  190.248.133.62
  190.248.134.106
  190.248.153.162
  190.248.68.18
-190.248.68.78
  190.249.150.97
+190.249.155.222
  190.25.168.216
  190.25.189.178
-190.25.232.106
  190.25.235.106
-190.25.242.139
-190.25.242.37
  190.25.49.114
  190.25.76.224
-190.25.79.167
  190.251.216.100
  190.252.108.146
-190.252.16.109
  190.253.19.101
  190.253.240.110
  190.254.58.196
  190.255.222.2
-190.255.4.26
  190.255.49.83
  190.26.164.111
  190.26.168.203
@@ -56381,10 +47530,9 @@
  190.27.162.35
  190.27.21.108
  190.27.63.71
-190.27.94.208
-190.28.131.206
-190.28.240.185
-190.28.89.194
+190.28.101.64
+190.28.104.254
+190.28.246.237
  190.28.92.91
  190.28.97.148
  190.29.111.9
@@ -56393,69 +47541,48 @@
  190.29.96.187
  190.3.117.18
  190.3.194.209
-190.3.206.146
  190.3.23.35
  190.32.21.250
  190.34.149.226
  190.34.204.10
-190.37.101.214
  190.38.14.52
  190.4.0.246
-190.4.202.123
  190.4.204.163
  190.4.205.226
-190.4.31.25
  190.4.56.17
-190.40.108.41
  190.40.85.200
  190.41.129.181
-190.41.94.94
  190.42.250.85
-190.44.137.65
  190.44.157.81
-190.44.188.179
  190.44.66.190
  190.45.24.210
-190.45.48.92
  190.46.119.249
-190.47.211.205
-190.48.245.19
  190.5.118.42
  190.5.122.174
  190.5.162.204
  190.5.228.74
  190.5.242.114
-190.5.243.179
-190.5.70.102
  190.5.85.242
  190.52.131.234
  190.52.168.20
  190.52.187.226
-190.52.191.49
  190.52.193.102
  190.52.193.90
  190.52.193.91
  190.52.193.97
  190.52.199.200
-190.52.200.25
  190.52.34.43
-190.53.161.193
  190.53.34.118
  190.53.38.98
  190.53.46.14
  190.53.46.2
-190.54.97.154
-190.55.137.36
  190.55.181.54
  190.55.186.229
  190.55.198.25
-190.55.217.76
-190.55.5.142
  190.56.142.198
  190.56.229.41
  190.56.255.118
  190.56.75.198
-190.57.139.106
  190.57.150.110
  190.57.173.122
  190.57.176.22
@@ -56463,16 +47590,15 @@
  190.57.236.124
  190.57.30.139
  190.57.30.141
-190.58.4.185
+190.58.104.24
+190.6.141.29
  190.6.193.152
  190.6.204.99
  190.60.110.240
-190.61.80.227
  190.63.144.26
  190.63.144.29
  190.63.160.62
  190.63.7.166
-190.64.131.130
  190.64.137.172
  190.64.141.18
  190.64.142.122
@@ -56482,10 +47608,8 @@
  190.64.68.106
  190.64.68.178
  190.64.88.186
-190.64.90.154
  190.65.220.94
  190.66.10.152
-190.69.27.137
  190.7.141.66
  190.7.141.90
  190.7.155.42
@@ -56500,45 +47624,32 @@
  190.7.180.254
  190.7.181.46
  190.7.231.210
-190.7.35.37
  190.7.49.205
  190.7.66.110
  190.73.12.20
  190.75.160.174
-190.77.133.164
-190.77.142.1
-190.77.5.174
-190.79.113.224
  190.79.131.206
-190.79.174.166
  190.79.227.81
+190.8.112.234
  190.8.117.5
  190.8.149.146
-190.8.168.145
  190.8.169.206
-190.8.82.58
+190.8.184.171
  190.80.159.182
+190.80.159.210
  190.80.243.251
  190.80.61.113
-190.82.111.22
-190.82.83.106
-190.83.180.220
+190.81.117.218
  190.83.84.211
-190.84.225.4
  190.84.232.82
  190.85.10.147
+190.85.102.124
  190.85.115.78
  190.85.12.42
-190.85.129.117
  190.85.130.174
  190.85.131.57
  190.85.136.220
-190.85.149.107
-190.85.169.4
-190.85.183.250
  190.85.186.254
-190.85.201.36
-190.85.235.84
  190.85.239.59
  190.85.34.142
  190.85.46.52
@@ -56546,11 +47657,11 @@
  190.85.65.50
  190.85.67.171
  190.86.139.122
+190.86.139.170
  190.86.203.60
  190.86.37.170
  190.89.101.83
  190.89.144.18
-190.89.245.152
  190.89.28.10
  190.89.28.103
  190.89.28.107
@@ -56589,53 +47700,34 @@
  190.89.28.8
  190.89.29.10
  190.89.29.102
-190.89.4.19
  190.9.128.96
  190.9.249.221
  190.90.140.55
-190.90.190.19
  190.90.20.229
  190.90.20.230
-190.90.251.229
  190.90.252.204
-190.90.46.127
  190.90.95.12
  190.92.122.226
  190.92.46.114
-190.92.48.212
-190.92.81.42
  190.93.176.70
-190.93.200.144
-190.93.203.14
  190.94.144.157
  190.94.148.130
  190.94.18.2
-190.95.210.227
  190.95.231.98
-190.95.36.108
  190.96.117.106
  190.96.118.15
  190.96.15.50
-190.96.192.69
  190.96.214.59
-190.96.24.89
-190.96.47.2
-190.96.7.34
-190.97.11.35
  190.97.167.214
  190.97.219.241
  190.97.219.4
  190.97.240.82
  190.97.30.167
-190.98.46.7
  190.99.76.98
  191-365.net
  191.0.68.142
-191.10.112.196
  191.100.24.5
  191.100.25.73
-191.100.26.20
-191.100.27.229
  191.100.28.217
  191.101.109.187
  191.101.109.195
@@ -56655,35 +47747,44 @@
  191.101.166.81
  191.101.171.70
  191.101.180.74
+191.101.200.203
  191.101.230.216
  191.101.243.42
  191.101.250.13
  191.101.250.170
  191.101.250.245
  191.101.251.160
+191.101.39.118
  191.101.39.2
  191.101.39.29
+191.101.39.54
  191.101.64.125
  191.101.66.57
-191.101.66.60
+191.101.66.59
+191.101.66.80
+191.101.67.1
  191.101.67.15
-191.101.77.167
  191.101.81.137
  191.101.82.183
+191.101.87.146
  191.101.89.76
+191.101.91.63
+191.101.92.116
  191.101.96.127
  191.101.98.31
  191.101.99.154
  191.102.106.1
  191.102.113.107
-191.102.120.103
  191.102.120.112
+191.102.120.114
  191.102.120.13
  191.102.120.148
  191.102.120.160
-191.102.120.181
-191.102.120.215
+191.102.120.171
+191.102.120.175
  191.102.120.38
+191.102.122.180
+191.102.122.227
  191.102.130.124
  191.102.130.187
  191.102.148.105
@@ -56696,44 +47797,35 @@
  191.102.151.125
  191.102.151.131
  191.102.151.135
-191.102.151.154
  191.102.151.185
  191.102.151.197
  191.102.151.216
  191.102.151.218
  191.102.151.222
  191.102.151.29
-191.102.151.46
-191.102.151.60
  191.102.151.68
  191.102.151.71
  191.102.151.72
-191.102.151.79
-191.102.153.165
  191.102.153.179
  191.102.153.182
  191.102.153.196
  191.102.153.225
  191.102.153.28
-191.102.153.65
+191.102.153.48
+191.102.154.183
  191.102.154.198
  191.102.154.213
  191.102.154.68
-191.102.156.121
  191.102.156.122
-191.102.156.144
  191.102.156.151
  191.102.156.159
  191.102.156.16
+191.102.156.174
  191.102.156.196
  191.102.156.224
-191.102.156.238
  191.102.156.3
-191.102.156.33
-191.102.156.7
-191.102.156.99
+191.102.156.41
  191.102.164.134
-191.102.164.41
  191.102.165.216
  191.102.166.244
  191.102.188.166
@@ -56741,33 +47833,35 @@
  191.102.189.148
  191.102.189.170
  191.102.189.90
-191.102.72.200
+191.102.78.229
  191.102.78.235
  191.102.88.218
  191.102.95.171
+191.102.96.5
  191.103.219.225
  191.103.254.125
  191.103.254.145
  191.113.244.94
  191.114.236.236
-191.12.29.228
-191.13.220.2
-191.14.85.32
+191.12.14.153
+191.14.99.63
+191.162.197.157
  191.162.202.67
+191.162.206.220
  191.162.211.107
-191.177.143.114
-191.18.18.186
+191.162.220.104
+191.162.222.153
  191.182.6.118
  191.183.21.190
-191.184.184.219
  191.185.42.248
+191.186.143.99
  191.189.31.176
-191.189.74.161
  191.19.226.180
  191.191.105.95
  191.191.176.167
+191.193.44.7
  191.195.186.167
-191.208.14.247
+191.207.15.58
  191.209.114.90
  191.209.21.188
  191.209.21.39
@@ -56777,9 +47871,9 @@
  191.211.185.126
  191.217.170.33
  191.217.84.226
-191.220.231.200
+191.22.186.206
+191.220.6.151
  191.223.36.170
-191.223.66.127
  191.23.80.220
  191.232.136.43
  191.232.136.87
@@ -56790,12 +47884,10 @@
  191.232.176.226
  191.232.181.145
  191.232.187.69
-191.232.193.231
  191.232.211.168
  191.232.211.83
  191.232.213.108
  191.232.233.191
-191.232.238.25
  191.232.244.135
  191.232.247.35
  191.232.247.86
@@ -56807,15 +47899,12 @@
  191.233.198.107
  191.233.232.243
  191.234.160.112
-191.234.163.70
  191.234.168.151
  191.234.169.163
  191.234.169.50
  191.234.175.191
  191.234.175.56
-191.234.176.158
  191.234.178.160
-191.234.188.83
  191.234.189.215
  191.235.103.154
  191.235.103.166
@@ -56831,29 +47920,27 @@
  191.235.89.181
  191.235.89.204
  191.235.91.109
-191.235.93.150
  191.236.119.223
  191.237.253.183
  191.237.42.132
  191.239.118.89
+191.239.240.25
  191.239.245.8
  191.239.246.164
  191.239.246.39
-191.239.247.246
  191.239.249.178
  191.239.250.168
  191.239.255.175
-191.240.113.139
-191.240.113.219
+191.240.113.233
+191.240.113.65
  191.240.152.129
  191.240.152.132
  191.240.152.134
  191.240.154.122
  191.240.157.186
  191.240.28.25
-191.240.71.216
  191.240.99.142
-191.241.174.233
+191.241.160.38
  191.241.2.195
  191.241.226.173
  191.241.226.230
@@ -56861,60 +47948,45 @@
  191.241.255.162
  191.241.32.23
  191.241.33.51
-191.241.34.186
  191.241.34.210
  191.241.67.10
-191.241.68.154
  191.241.72.246
  191.242.112.221
  191.242.178.209
  191.242.182.132
+191.242.184.129
  191.242.232.10
  191.242.232.33
  191.243.221.6
-191.243.224.2
  191.243.3.172
-191.243.31.12
  191.243.54.245
  191.243.72.2
  191.243.72.34
-191.246.106.92
-191.247.46.175
  191.248.197.126
+191.249.196.89
  191.25.127.242
  191.252.1.235
  191.252.1.78
  191.252.113.123
  191.252.205.120
-191.252.220.54
  191.252.56.65
  191.252.67.131
  191.252.95.213
-191.253.14.73
-191.253.152.198
-191.253.47.44
  191.253.80.114
  191.253.89.73
-191.254.63.126
  191.255.210.82
  191.255.221.168
  191.255.232.53
-191.27.107.107
  191.28.70.36
-191.30.181.214
+191.30.191.70
  191.31.1.116
  191.31.104.17
-191.32.132.196
-191.32.67.244
  191.33.20.66
  191.33.22.202
  191.33.228.162
-191.33.8.208
  191.33.81.18
-191.34.165.146
-191.35.212.15
-191.35.5.229
-191.36.142.49
+191.35.191.242
+191.35.28.3
  191.36.173.34
  191.37.0.214
  191.37.150.221
@@ -56922,120 +47994,153 @@
  191.37.165.84
  191.37.183.209
  191.37.220.93
-191.37.241.2
+191.37.23.146
  191.37.79.238
  191.43.35.67
-191.5.100.156
-191.5.100.171
+191.5.100.104
+191.5.100.165
+191.5.100.167
+191.5.100.181
  191.5.100.184
  191.5.100.188
+191.5.100.197
  191.5.100.219
  191.5.100.22
-191.5.100.23
-191.5.100.255
+191.5.100.59
  191.5.100.80
-191.5.100.82
  191.5.100.86
  191.5.100.87
  191.5.100.9
-191.5.100.92
-191.5.101.101
-191.5.101.102
+191.5.101.105
+191.5.101.109
  191.5.101.112
-191.5.101.113
  191.5.101.114
+191.5.101.116
+191.5.101.125
+191.5.101.126
+191.5.101.130
+191.5.101.132
+191.5.101.138
  191.5.101.139
  191.5.101.19
-191.5.101.67
+191.5.101.28
+191.5.101.4
  191.5.101.68
-191.5.102.111
-191.5.102.119
+191.5.101.80
+191.5.102.104
  191.5.102.124
+191.5.102.143
  191.5.102.3
  191.5.102.44
-191.5.102.47
  191.5.102.53
-191.5.102.59
+191.5.102.67
  191.5.102.72
  191.5.102.75
+191.5.102.76
+191.5.102.78
  191.5.102.8
+191.5.102.94
+191.5.102.95
  191.5.102.98
  191.5.55.7
  191.5.97.0
  191.5.97.100
-191.5.97.108
  191.5.97.110
  191.5.97.120
+191.5.97.124
+191.5.97.130
+191.5.97.132
+191.5.97.135
  191.5.97.14
  191.5.97.145
-191.5.97.159
  191.5.97.16
  191.5.97.160
-191.5.97.162
  191.5.97.165
+191.5.97.182
+191.5.97.183
  191.5.97.184
-191.5.97.185
-191.5.97.189
+191.5.97.187
+191.5.97.194
  191.5.97.196
-191.5.97.203
  191.5.97.207
  191.5.97.209
-191.5.97.221
  191.5.97.227
+191.5.97.232
  191.5.97.233
-191.5.97.25
-191.5.97.39
+191.5.97.234
+191.5.97.235
+191.5.97.242
+191.5.97.248
+191.5.97.250
+191.5.97.28
  191.5.97.47
  191.5.97.49
-191.5.97.51
  191.5.97.56
-191.5.97.59
-191.5.97.65
  191.5.97.67
+191.5.97.75
+191.5.97.78
+191.5.97.95
+191.5.97.98
  191.5.98.192
+191.5.98.204
  191.5.98.207
-191.5.98.222
  191.5.98.231
+191.5.98.234
+191.5.99.0
  191.5.99.106
-191.5.99.133
-191.5.99.143
+191.5.99.108
+191.5.99.115
+191.5.99.13
+191.5.99.131
+191.5.99.134
+191.5.99.139
+191.5.99.150
  191.5.99.161
-191.5.99.162
-191.5.99.176
-191.5.99.178
  191.5.99.180
  191.5.99.183
+191.5.99.191
+191.5.99.195
  191.5.99.196
  191.5.99.198
+191.5.99.205
  191.5.99.208
-191.5.99.212
  191.5.99.214
  191.5.99.216
  191.5.99.217
-191.5.99.233
-191.5.99.245
  191.5.99.26
-191.5.99.3
-191.5.99.30
-191.5.99.32
+191.5.99.27
  191.5.99.50
+191.5.99.54
+191.5.99.81
  191.5.99.82
  191.53.112.170
+191.53.193.193
  191.53.193.249
  191.53.194.103
  191.53.194.114
  191.53.194.133
  191.53.194.140
+191.53.194.160
+191.53.194.161
+191.53.194.220
+191.53.196.241
  191.53.198.190
  191.53.221.13
+191.53.223.111
+191.53.52.143
  191.53.52.61
  191.53.82.135
  191.54.110.31
+191.54.113.129
  191.54.131.127
-191.55.135.104
+191.54.171.221
+191.54.208.20
+191.54.84.86
+191.54.86.240
+191.55.14.126
  191.55.141.41
-191.55.216.90
  191.55.242.226
+191.55.44.30
  191.6.132.104
  191.6.132.105
  191.6.132.126
@@ -57047,6 +48152,7 @@
  191.6.134.20
  191.6.135.90
  191.6.135.93
+191.6.164.44
  191.6.88.176
  191.6.89.200
  191.6.91.84
@@ -57069,9 +48175,9 @@
  191.7.209.74
  191.7.211.234
  191.7.215.236
-191.8.83.229
-191.8.85.166
+191.7.96.58
  191.80.162.6
+191.82.177.43
  191.82.39.123
  191.96.123.31
  191.96.135.30
@@ -57086,13 +48192,13 @@
  191.96.25.226
  191.96.252.159
  191.96.43.183
+191.96.63.169
  191.97.10.25
-191.97.12.212
-191.97.189.157
  191.97.3.195
  191.97.4.238
  191.97.53.43
  191.97.7.165
+191.97.84.27
  191.98.144.217
  191.98.181.218
  191.98.184.122
@@ -57110,25 +48216,19 @@
  191.98.195.246
  191.98.195.250
  191.98.195.254
-191.99.141.52
  191gm.com
  192-168-1-45.000webhostapp.com
-192.0.103.4
-192.0.197.123
  192.0.82.48
  192.0.85.132
+192.0.91.201
  192.100.213.83
-192.101.136.84
  192.109.165.108
  192.111.129.150
-192.111.138.29
+192.111.135.21
  192.111.139.165
  192.111.146.37
-192.112.0.32
-192.112.0.66
  192.116.142.153
  192.117.146.110
-192.117.6.125
  192.119.106.9
  192.119.110.222
  192.119.110.44
@@ -57159,7 +48259,9 @@
  192.12.112.102
  192.12.112.66
  192.12.112.68
-192.12.114.184
+192.121.158.100
+192.121.159.230
+192.124.249.4
  192.126.156.1
  192.126.156.108
  192.126.156.42
@@ -57168,7 +48270,9 @@
  192.126.160.218
  192.126.160.255
  192.126.160.89
-192.126.226.51
+192.126.204.218
+192.126.204.56
+192.126.226.225
  192.129.186.62
  192.129.188.98
  192.129.189.115
@@ -57177,7 +48281,6 @@
  192.129.223.98
  192.129.227.26
  192.129.245.69
-192.135.91.254
  192.140.42.28
  192.140.42.81
  192.140.42.83
@@ -57186,11 +48289,10 @@
  192.141.12.70
  192.141.205.241
  192.141.208.1
-192.141.244.188
-192.141.84.67
  192.144.104.1
  192.144.104.33
  192.144.129.98
+192.144.130.54
  192.144.137.82
  192.144.138.102
  192.144.140.20
@@ -57198,17 +48300,10 @@
  192.144.142.62
  192.144.143.101
  192.144.144.178
-192.144.148.220
-192.144.154.209
  192.144.157.134
-192.144.157.33
  192.144.160.53
-192.144.171.165
  192.144.172.241
-192.144.175.42
-192.144.185.74
  192.144.186.22
-192.144.187.80
  192.144.188.237
  192.144.189.51
  192.144.190.178
@@ -57219,20 +48314,16 @@
  192.144.205.87
  192.144.210.27
  192.144.215.146
-192.144.216.70
  192.144.217.101
  192.144.217.87
  192.144.218.101
  192.144.218.21
-192.144.218.38
  192.144.218.46
  192.144.219.28
  192.144.219.75
  192.144.227.166
-192.144.227.36
  192.144.227.85
  192.144.228.40
-192.144.230.221
  192.144.230.43
  192.144.233.41
  192.144.234.119
@@ -57241,10 +48332,10 @@
  192.144.239.108
  192.144.253.167
  192.144.254.245
+192.144.31.178
  192.144.31.201
  192.144.31.240
  192.144.31.91
-192.145.127.42
  192.145.205.74
  192.145.232.221
  192.145.239.17
@@ -57263,9 +48354,7 @@
  192.151.147.62
  192.151.155.242
  192.151.158.26
-192.151.202.10
  192.154.105.21
-192.154.150.38
  192.154.227.193
  192.154.228.190
  192.154.244.227
@@ -57273,15 +48362,13 @@
  192.154.246.158
  192.154.246.248
  192.154.246.57
-192.154.47.140
-192.155.93.187
  192.155.93.237
  192.155.94.15
-192.156.110.196
  192.157.201.202
  192.158.15.201
  192.158.228.223
  192.158.30.73
+192.159.104.245
  192.160.102.164
  192.160.102.165
  192.160.102.166
@@ -57290,13 +48377,11 @@
  192.160.102.170
  192.161.172.215
  192.161.190.171
-192.161.190.91
  192.161.48.61
  192.162.101.35
  192.162.102.44
  192.162.132.51
-192.162.143.109
-192.162.192.148
+192.162.145.6
  192.162.193.243
  192.162.27.108
  192.162.27.155
@@ -57306,11 +48391,10 @@
  192.163.192.224
  192.163.199.254
  192.163.221.191
-192.163.249.45
-192.165.228.133
-192.165.228.139
  192.166.128.1
  192.166.134.173
+192.166.153.140
+192.166.153.222
  192.166.223.155
  192.166.245.138
  192.166.47.32
@@ -57319,7 +48403,9 @@
  192.169.176.66
  192.169.189.120
  192.169.201.143
+192.169.201.24
  192.169.227.134
+192.169.249.168
  192.169.6.101
  192.169.6.144
  192.169.6.178
@@ -57327,9 +48413,7 @@
  192.169.7.120
  192.169.7.152
  192.169.7.80
-192.169.87.22
  192.175.111.212
-192.176.223.112
  192.182.157.119
  192.185.129.96
  192.185.130.170
@@ -57339,11 +48423,9 @@
  192.186.130.133
  192.186.130.143
  192.186.130.155
-192.186.134.122
  192.186.134.130
  192.186.134.158
  192.186.134.56
-192.186.134.61
  192.186.134.67
  192.186.134.70
  192.186.134.92
@@ -57357,6 +48439,8 @@
  192.186.151.81
  192.186.153.185
  192.186.153.232
+192.186.153.237
+192.186.161.141
  192.186.161.194
  192.186.161.205
  192.186.161.238
@@ -57364,12 +48448,9 @@
  192.186.168.218
  192.186.169.63
  192.186.169.75
-192.186.171.230
  192.186.171.235
  192.186.171.236
  192.186.171.237
-192.186.174.60
-192.186.177.16
  192.186.177.30
  192.186.180.146
  192.186.180.154
@@ -57390,7 +48471,6 @@
  192.186.190.41
  192.186.190.44
  192.187.110.198
-192.187.120.50
  192.187.121.46
  192.187.123.242
  192.187.125.75
@@ -57418,7 +48498,6 @@
  192.198.119.70
  192.198.122.247
  192.198.124.164
-192.198.124.172
  192.198.125.200
  192.198.125.201
  192.198.125.202
@@ -57457,17 +48536,16 @@
  192.198.98.35
  192.198.99.77
  192.198.99.79
-192.199.247.104
  192.199.249.41
  192.199.249.95
  192.199.53.131
  192.200.102.246
  192.200.122.226
+192.200.158.22
  192.200.158.246
  192.200.192.2
  192.200.215.162
  192.200.215.90
-192.200.215.91
  192.204.197.190
  192.210.133.252
  192.210.140.199
@@ -57475,11 +48553,10 @@
  192.210.144.66
  192.210.149.16
  192.210.150.182
-192.210.151.245
  192.210.167.173
  192.210.167.247
  192.210.168.241
-192.210.170.111
+192.210.177.4
  192.210.181.32
  192.210.185.109
  192.210.185.110
@@ -57494,14 +48571,12 @@
  192.210.185.96
  192.210.186.149
  192.210.186.150
-192.210.186.158
-192.210.189.120
-192.210.194.140
  192.210.195.23
  192.210.198.34
  192.210.200.194
  192.210.200.200
  192.210.200.220
+192.210.203.167
  192.210.214.146
  192.210.214.51
  192.210.215.246
@@ -57512,13 +48587,9 @@
  192.210.223.114
  192.210.226.106
  192.210.226.125
-192.210.226.158
  192.210.229.115
-192.210.230.137
  192.210.230.153
  192.210.231.101
-192.210.236.212
-192.210.236.218
  192.210.236.38
  192.210.239.115
  192.210.240.152
@@ -57526,7 +48597,6 @@
  192.216.61.102
  192.220.118.1
  192.222.208.26
-192.223.68.218
  192.225.214.132
  192.225.226.15
  192.225.226.39
@@ -57550,7 +48620,7 @@
  192.227.138.112
  192.227.138.113
  192.227.138.114
-192.227.138.119
+192.227.138.116
  192.227.138.123
  192.227.138.124
  192.227.138.175
@@ -57591,10 +48661,11 @@
  192.227.180.94
  192.227.180.98
  192.227.191.172
-192.227.206.113
  192.227.207.115
+192.227.207.56
  192.227.209.212
  192.227.209.219
+192.227.211.39
  192.227.212.251
  192.227.214.146
  192.227.215.147
@@ -57611,9 +48682,7 @@
  192.227.249.182
  192.227.252.99
  192.227.69.80
-192.227.78.175
  192.227.80.83
-192.227.93.123
  192.228.100.200
  192.228.100.222
  192.228.100.250
@@ -57655,8 +48724,8 @@
  192.236.236.74
  192.240.150.133
  192.241.111.3
-192.241.113.198
  192.241.113.204
+192.241.113.207
  192.241.130.220
  192.241.130.65
  192.241.131.150
@@ -57716,7 +48785,6 @@
  192.241.184.220
  192.241.185.120
  192.241.185.214
-192.241.194.61
  192.241.195.30
  192.241.195.43
  192.241.196.148
@@ -57733,673 +48801,61 @@
  192.241.201.79
  192.241.202.169
  192.241.203.105
-192.241.204.192
-192.241.204.61
-192.241.205.222
-192.241.206.15
  192.241.206.246
  192.241.206.48
-192.241.206.62
-192.241.207.112
-192.241.207.116
-192.241.207.146
-192.241.208.132
-192.241.208.139
-192.241.208.151
-192.241.208.163
-192.241.208.169
-192.241.208.203
-192.241.208.9
-192.241.209.111
-192.241.209.122
-192.241.209.134
-192.241.209.169
-192.241.209.73
-192.241.210.125
-192.241.210.136
  192.241.210.14
-192.241.210.222
-192.241.210.224
-192.241.210.24
-192.241.210.61
-192.241.210.65
-192.241.210.93
-192.241.211.132
-192.241.211.138
-192.241.211.140
-192.241.211.186
-192.241.211.215
-192.241.211.249
-192.241.211.83
  192.241.211.94
-192.241.211.97
-192.241.212.158
-192.241.212.178
-192.241.212.191
-192.241.212.44
-192.241.212.56
-192.241.212.58
-192.241.212.72
-192.241.212.79
-192.241.213.134
-192.241.213.152
-192.241.213.212
  192.241.213.239
-192.241.213.243
  192.241.213.38
-192.241.213.51
-192.241.213.98
-192.241.214.101
  192.241.214.122
-192.241.214.142
-192.241.214.158
-192.241.214.165
  192.241.214.170
-192.241.214.172
-192.241.214.180
-192.241.214.181
  192.241.214.195
-192.241.214.20
-192.241.214.210
-192.241.214.218
-192.241.214.228
-192.241.214.252
-192.241.214.46
-192.241.214.48
-192.241.214.52
-192.241.214.65
-192.241.214.87
-192.241.215.103
  192.241.215.116
  192.241.215.124
-192.241.215.127
-192.241.215.153
  192.241.215.189
-192.241.215.206
-192.241.215.210
-192.241.215.216
-192.241.215.27
-192.241.215.45
-192.241.215.51
-192.241.215.65
-192.241.215.97
-192.241.216.111
-192.241.216.130
-192.241.216.156
-192.241.216.169
-192.241.216.214
-192.241.216.216
-192.241.216.242
-192.241.216.26
-192.241.216.32
-192.241.216.68
-192.241.217.10
-192.241.217.104
-192.241.217.112
-192.241.217.115
-192.241.217.125
-192.241.217.136
-192.241.217.137
-192.241.217.150
-192.241.217.152
-192.241.217.154
  192.241.217.161
-192.241.217.189
-192.241.217.192
-192.241.217.23
-192.241.217.38
-192.241.217.42
-192.241.217.52
  192.241.217.60
-192.241.217.64
-192.241.217.78
  192.241.217.80
  192.241.217.83
-192.241.218.123
-192.241.218.14
  192.241.218.151
-192.241.218.158
-192.241.218.169
-192.241.218.197
  192.241.218.199
-192.241.218.206
-192.241.218.213
-192.241.218.22
-192.241.218.44
  192.241.218.53
  192.241.218.69
-192.241.218.81
-192.241.218.84
-192.241.218.89
  192.241.218.91
-192.241.219.117
-192.241.219.133
-192.241.219.165
-192.241.219.194
-192.241.219.20
-192.241.219.22
-192.241.219.226
-192.241.219.32
-192.241.219.35
-192.241.219.38
-192.241.219.52
-192.241.219.56
-192.241.219.58
-192.241.219.61
-192.241.219.64
-192.241.219.80
-192.241.219.95
-192.241.220.133
-192.241.220.144
-192.241.220.153
  192.241.220.155
-192.241.220.166
  192.241.220.183
-192.241.220.21
-192.241.220.218
-192.241.220.224
  192.241.220.227
-192.241.220.233
-192.241.220.234
-192.241.220.248
-192.241.220.251
-192.241.220.30
-192.241.220.31
-192.241.221.114
  192.241.221.158
-192.241.221.159
-192.241.221.22
-192.241.221.242
-192.241.221.28
-192.241.221.43
-192.241.221.46
-192.241.221.64
-192.241.221.66
-192.241.221.78
-192.241.222.11
-192.241.222.113
-192.241.222.123
-192.241.222.143
-192.241.222.180
-192.241.222.58
-192.241.222.59
-192.241.222.62
-192.241.222.72
-192.241.222.79
  192.241.222.89
-192.241.223.12
-192.241.223.186
-192.241.223.219
-192.241.223.72
-192.241.224.183
-192.241.224.227
-192.241.225.115
-192.241.225.192
  192.241.225.203
  192.241.225.53
-192.241.226.135
-192.241.226.28
  192.241.226.82
-192.241.226.83
-192.241.227.129
-192.241.227.207
-192.241.227.237
-192.241.227.240
  192.241.227.59
-192.241.228.138
-192.241.229.140
-192.241.229.204
-192.241.229.228
  192.241.229.67
-192.241.230.159
-192.241.230.182
-192.241.230.24
  192.241.230.86
-192.241.231.103
-192.241.231.139
  192.241.231.146
-192.241.231.17
-192.241.231.199
-192.241.231.213
-192.241.231.227
-192.241.231.232
-192.241.231.234
-192.241.231.237
-192.241.231.240
-192.241.231.241
-192.241.231.242
-192.241.231.35
-192.241.231.7
-192.241.232.109
-192.241.232.13
-192.241.232.136
-192.241.232.146
-192.241.232.150
-192.241.232.157
-192.241.232.162
-192.241.232.167
-192.241.232.168
-192.241.232.192
-192.241.232.202
-192.241.232.213
-192.241.232.227
-192.241.232.231
-192.241.232.233
-192.241.232.250
-192.241.232.38
-192.241.232.7
-192.241.232.99
  192.241.233.101
  192.241.233.115
-192.241.233.118
-192.241.233.119
-192.241.233.121
-192.241.233.143
-192.241.233.16
-192.241.233.163
-192.241.233.165
-192.241.233.166
-192.241.233.169
  192.241.233.171
-192.241.233.176
-192.241.233.180
-192.241.233.186
-192.241.233.213
-192.241.233.220
-192.241.233.233
-192.241.233.235
  192.241.233.240
-192.241.233.246
-192.241.233.247
-192.241.233.249
-192.241.233.252
-192.241.233.29
-192.241.233.39
-192.241.233.40
-192.241.233.55
  192.241.233.59
-192.241.233.64
-192.241.233.68
  192.241.233.72
-192.241.233.82
-192.241.233.83
  192.241.233.87
-192.241.233.89
-192.241.233.93
-192.241.234.100
-192.241.234.101
-192.241.234.103
-192.241.234.107
-192.241.234.109
-192.241.234.114
-192.241.234.115
-192.241.234.116
-192.241.234.123
-192.241.234.126
-192.241.234.13
-192.241.234.137
-192.241.234.140
-192.241.234.141
-192.241.234.142
-192.241.234.145
-192.241.234.155
-192.241.234.16
-192.241.234.161
-192.241.234.166
-192.241.234.173
-192.241.234.185
-192.241.234.189
-192.241.234.196
-192.241.234.202
-192.241.234.205
-192.241.234.207
-192.241.234.212
-192.241.234.214
-192.241.234.215
-192.241.234.218
-192.241.234.235
-192.241.234.238
  192.241.234.242
-192.241.234.246
-192.241.234.251
-192.241.234.29
-192.241.234.31
-192.241.234.35
-192.241.234.4
-192.241.234.43
-192.241.234.5
-192.241.234.53
-192.241.234.57
-192.241.234.58
-192.241.234.59
-192.241.234.60
-192.241.234.66
-192.241.234.68
-192.241.234.7
-192.241.234.70
-192.241.234.77
-192.241.234.8
  192.241.234.83
-192.241.234.86
-192.241.234.94
-192.241.234.95
-192.241.234.96
-192.241.235.10
-192.241.235.104
-192.241.235.108
-192.241.235.112
-192.241.235.115
-192.241.235.121
-192.241.235.124
-192.241.235.126
-192.241.235.129
-192.241.235.137
-192.241.235.138
-192.241.235.149
-192.241.235.153
-192.241.235.158
-192.241.235.159
-192.241.235.163
-192.241.235.168
-192.241.235.172
-192.241.235.173
-192.241.235.176
-192.241.235.179
-192.241.235.181
-192.241.235.184
-192.241.235.185
-192.241.235.189
-192.241.235.191
-192.241.235.192
  192.241.235.195
-192.241.235.196
-192.241.235.197
-192.241.235.198
-192.241.235.20
-192.241.235.203
-192.241.235.214
-192.241.235.216
-192.241.235.219
-192.241.235.22
-192.241.235.220
-192.241.235.228
-192.241.235.231
-192.241.235.234
-192.241.235.244
-192.241.235.25
-192.241.235.26
-192.241.235.28
-192.241.235.30
-192.241.235.36
-192.241.235.42
-192.241.235.45
-192.241.235.46
-192.241.235.5
-192.241.235.51
-192.241.235.57
-192.241.235.60
-192.241.235.63
-192.241.235.68
-192.241.235.69
-192.241.235.70
+192.241.235.210
  192.241.235.72
-192.241.235.74
-192.241.235.76
-192.241.235.77
-192.241.235.85
-192.241.235.86
-192.241.235.91
-192.241.235.98
-192.241.236.103
-192.241.236.106
-192.241.236.123
-192.241.236.125
-192.241.236.126
-192.241.236.131
-192.241.236.133
-192.241.236.138
-192.241.236.143
-192.241.236.146
-192.241.236.149
-192.241.236.156
-192.241.236.161
-192.241.236.167
-192.241.236.169
-192.241.236.171
-192.241.236.197
-192.241.236.20
-192.241.236.232
-192.241.236.239
  192.241.236.246
-192.241.236.248
-192.241.236.32
-192.241.236.40
-192.241.236.53
-192.241.236.61
-192.241.236.62
-192.241.236.64
-192.241.236.71
-192.241.236.80
-192.241.236.86
-192.241.236.89
-192.241.236.94
-192.241.237.108
-192.241.237.109
-192.241.237.115
-192.241.237.125
-192.241.237.127
-192.241.237.128
-192.241.237.130
-192.241.237.131
-192.241.237.135
  192.241.237.136
-192.241.237.137
-192.241.237.143
-192.241.237.144
-192.241.237.148
-192.241.237.149
-192.241.237.154
-192.241.237.155
-192.241.237.157
-192.241.237.158
  192.241.237.159
-192.241.237.160
-192.241.237.167
-192.241.237.168
-192.241.237.17
-192.241.237.170
-192.241.237.171
-192.241.237.172
-192.241.237.173
-192.241.237.175
-192.241.237.178
-192.241.237.183
-192.241.237.188
-192.241.237.19
-192.241.237.191
-192.241.237.192
-192.241.237.193
-192.241.237.194
-192.241.237.195
-192.241.237.197
-192.241.237.198
-192.241.237.202
-192.241.237.203
-192.241.237.209
-192.241.237.210
-192.241.237.214
-192.241.237.216
-192.241.237.220
-192.241.237.224
-192.241.237.227
-192.241.237.229
-192.241.237.233
-192.241.237.237
-192.241.237.238
-192.241.237.240
-192.241.237.249
-192.241.237.250
-192.241.237.28
-192.241.237.29
-192.241.237.30
-192.241.237.31
-192.241.237.32
-192.241.237.37
-192.241.237.41
-192.241.237.44
-192.241.237.45
-192.241.237.49
-192.241.237.51
-192.241.237.52
-192.241.237.53
-192.241.237.57
-192.241.237.6
-192.241.237.60
-192.241.237.61
-192.241.237.65
-192.241.237.68
-192.241.237.71
-192.241.237.74
-192.241.237.77
-192.241.237.8
-192.241.237.80
-192.241.237.81
-192.241.237.84
-192.241.237.88
-192.241.237.91
-192.241.237.93
  192.241.237.98
-192.241.238.10
-192.241.238.100
-192.241.238.101
-192.241.238.102
-192.241.238.11
-192.241.238.111
  192.241.238.116
  192.241.238.12
-192.241.238.134
-192.241.238.14
-192.241.238.146
-192.241.238.16
-192.241.238.161
-192.241.238.163
-192.241.238.17
  192.241.238.174
-192.241.238.18
-192.241.238.180
-192.241.238.19
-192.241.238.197
-192.241.238.206
-192.241.238.207
-192.241.238.208
-192.241.238.21
-192.241.238.210
-192.241.238.214
-192.241.238.215
-192.241.238.218
-192.241.238.220
-192.241.238.222
-192.241.238.224
-192.241.238.225
-192.241.238.229
-192.241.238.23
-192.241.238.240
-192.241.238.241
-192.241.238.245
-192.241.238.248
-192.241.238.252
-192.241.238.37
-192.241.238.38
-192.241.238.4
  192.241.238.43
-192.241.238.48
-192.241.238.5
-192.241.238.51
-192.241.238.53
-192.241.238.54
-192.241.238.57
-192.241.238.60
-192.241.238.67
-192.241.238.75
-192.241.238.80
-192.241.238.83
-192.241.238.86
-192.241.238.9
-192.241.238.90
-192.241.238.92
-192.241.238.94
-192.241.238.97
-192.241.238.98
-192.241.239.10
-192.241.239.103
-192.241.239.104
-192.241.239.108
-192.241.239.112
-192.241.239.114
-192.241.239.116
-192.241.239.117
-192.241.239.119
-192.241.239.122
-192.241.239.123
-192.241.239.124
-192.241.239.125
-192.241.239.126
-192.241.239.128
  192.241.239.135
-192.241.239.140
-192.241.239.143
-192.241.239.145
-192.241.239.146
-192.241.239.15
-192.241.239.152
-192.241.239.155
-192.241.239.175
-192.241.239.177
-192.241.239.179
-192.241.239.181
-192.241.239.182
-192.241.239.183
-192.241.239.189
-192.241.239.19
-192.241.239.192
-192.241.239.195
-192.241.239.201
-192.241.239.202
-192.241.239.21
-192.241.239.215
-192.241.239.216
-192.241.239.218
-192.241.239.219
-192.241.239.222
-192.241.239.229
-192.241.239.234
-192.241.239.247
-192.241.239.25
-192.241.239.251
-192.241.239.29
-192.241.239.30
-192.241.239.32
-192.241.239.36
-192.241.239.39
-192.241.239.43
-192.241.239.46
-192.241.239.48
-192.241.239.5
-192.241.239.50
-192.241.239.55
-192.241.239.56
  192.241.239.57
-192.241.239.59
-192.241.239.62
-192.241.239.63
-192.241.239.68
-192.241.239.78
-192.241.239.81
-192.241.239.84
-192.241.239.88
-192.241.239.9
-192.241.239.92
-192.241.239.94
  192.241.241.222
  192.241.244.232
  192.241.246.167
@@ -58411,6 +48867,7 @@
  192.241.255.77
  192.241.64.114
  192.241.64.227
+192.241.64.234
  192.241.64.248
  192.241.64.87
  192.241.64.89
@@ -58431,7 +48888,6 @@
  192.241.80.247
  192.241.80.248
  192.241.80.252
-192.241.80.31
  192.241.84.109
  192.241.84.117
  192.241.84.122
@@ -58464,8 +48920,6 @@
  192.249.53.158
  192.249.53.67
  192.249.73.222
-192.250.196.242
-192.250.197.98
  192.251.226.0
  192.251.226.1
  192.251.226.10
@@ -58733,8 +49187,9 @@
  192.254.193.145
  192.254.210.74
  192.254.250.165
+192.254.75.166
  192.254.75.254
-192.255.235.84
+192.254.97.105
  192.3.105.80
  192.3.105.95
  192.3.105.99
@@ -58746,11 +49201,8 @@
  192.3.111.183
  192.3.12.113
  192.3.122.100
-192.3.122.27
  192.3.124.227
  192.3.124.40
-192.3.126.145
-192.3.126.146
  192.3.126.42
  192.3.126.52
  192.3.136.72
@@ -58786,9 +49238,9 @@
  192.3.180.230
  192.3.180.239
  192.3.180.247
-192.3.182.91
  192.3.185.210
  192.3.185.29
+192.3.188.115
  192.3.188.204
  192.3.188.251
  192.3.193.251
@@ -58797,7 +49249,6 @@
  192.3.2.77
  192.3.2.86
  192.3.2.87
-192.3.202.210
  192.3.203.140
  192.3.203.155
  192.3.203.158
@@ -58807,7 +49258,6 @@
  192.3.203.177
  192.3.203.182
  192.3.203.188
-192.3.203.39
  192.3.203.62
  192.3.207.170
  192.3.208.115
@@ -58826,7 +49276,6 @@
  192.3.208.98
  192.3.209.168
  192.3.211.251
-192.3.213.17
  192.3.214.12
  192.3.214.13
  192.3.214.16
@@ -58836,14 +49285,14 @@
  192.3.214.6
  192.3.214.8
  192.3.215.204
-192.3.224.229
-192.3.224.230
  192.3.23.41
  192.3.233.234
+192.3.240.105
+192.3.240.185
  192.3.240.191
  192.3.240.229
  192.3.240.29
-192.3.245.103
+192.3.240.66
  192.3.245.22
  192.3.246.20
  192.3.247.112
@@ -58878,10 +49327,10 @@
  192.3.7.118
  192.3.7.90
  192.3.8.178
-192.3.9.201
  192.3.9.207
  192.3.93.247
  192.3.99.28
+192.31.242.196
  192.34.56.82
  192.34.57.210
  192.34.57.220
@@ -58892,153 +49341,10 @@
  192.34.62.208
  192.34.62.252
  192.34.80.176
-192.35.168.112
-192.35.168.113
-192.35.168.114
-192.35.168.115
-192.35.168.116
-192.35.168.117
-192.35.168.118
-192.35.168.119
-192.35.168.120
-192.35.168.121
-192.35.168.122
-192.35.168.123
-192.35.168.124
-192.35.168.125
-192.35.168.126
-192.35.168.127
-192.35.168.128
-192.35.168.129
-192.35.168.130
-192.35.168.131
-192.35.168.132
-192.35.168.133
-192.35.168.134
-192.35.168.135
-192.35.168.136
-192.35.168.137
-192.35.168.138
-192.35.168.139
-192.35.168.140
-192.35.168.141
-192.35.168.142
-192.35.168.143
-192.35.168.144
-192.35.168.145
-192.35.168.146
-192.35.168.147
-192.35.168.148
-192.35.168.149
-192.35.168.150
-192.35.168.151
-192.35.168.152
-192.35.168.153
-192.35.168.154
-192.35.168.155
-192.35.168.156
-192.35.168.157
-192.35.168.158
-192.35.168.159
  192.35.168.16
-192.35.168.160
-192.35.168.161
-192.35.168.162
-192.35.168.163
-192.35.168.164
-192.35.168.165
-192.35.168.166
-192.35.168.167
-192.35.168.168
-192.35.168.169
-192.35.168.17
-192.35.168.170
-192.35.168.171
-192.35.168.172
-192.35.168.173
-192.35.168.174
-192.35.168.175
-192.35.168.18
-192.35.168.19
-192.35.168.20
-192.35.168.21
-192.35.168.22
-192.35.168.224
-192.35.168.225
-192.35.168.226
-192.35.168.227
-192.35.168.228
-192.35.168.229
-192.35.168.23
-192.35.168.230
-192.35.168.231
-192.35.168.232
-192.35.168.233
-192.35.168.234
-192.35.168.235
-192.35.168.236
-192.35.168.237
-192.35.168.238
-192.35.168.239
-192.35.168.24
  192.35.168.240
-192.35.168.25
-192.35.168.26
-192.35.168.27
-192.35.168.28
-192.35.168.29
-192.35.168.30
-192.35.168.31
-192.35.168.32
-192.35.168.33
-192.35.168.34
-192.35.168.35
-192.35.168.36
-192.35.168.37
-192.35.168.38
-192.35.168.39
-192.35.168.40
-192.35.168.41
-192.35.168.42
-192.35.168.43
-192.35.168.44
-192.35.168.45
-192.35.168.46
-192.35.168.47
-192.35.168.64
-192.35.168.65
-192.35.168.66
-192.35.168.67
-192.35.168.68
-192.35.168.69
-192.35.168.70
-192.35.168.71
-192.35.168.72
-192.35.168.73
-192.35.168.74
-192.35.168.75
-192.35.168.76
-192.35.168.77
-192.35.168.78
-192.35.168.79
  192.35.168.80
-192.35.168.81
-192.35.168.82
-192.35.168.83
-192.35.168.84
-192.35.168.85
-192.35.168.86
-192.35.168.87
-192.35.168.88
-192.35.168.89
-192.35.168.90
-192.35.168.91
-192.35.168.92
-192.35.168.93
-192.35.168.94
-192.35.168.95
  192.35.169.48
-192.36.155.56
  192.36.27.4
  192.40.57.57
  192.40.95.147
@@ -59050,7 +49356,6 @@
  192.40.95.38
  192.40.95.6
  192.41.136.217
-192.41.45.19
  192.42.116.13
  192.42.116.14
  192.42.116.15
@@ -59069,13 +49374,13 @@
  192.42.116.41
  192.43.209.197
  192.44.77.205
-192.5.110.86
  192.52.166.9
  192.52.167.130
  192.52.167.145
  192.52.167.219
  192.52.167.228
  192.52.242.27
+192.64.112.100
  192.64.113.144
  192.64.114.145
  192.64.114.214
@@ -59083,11 +49388,13 @@
  192.64.114.84
  192.64.118.132
  192.64.52.124
+192.64.86.34
  192.65.170.15
  192.65.170.50
  192.69.235.189
  192.71.166.25
-192.73.237.8
+192.71.18.246
+192.71.86.158
  192.74.235.226
  192.81.129.60
  192.81.129.82
@@ -59106,16 +49413,12 @@
  192.81.215.138
  192.81.217.100
  192.81.217.138
-192.81.218.93
  192.81.219.123
  192.81.220.148
  192.81.221.84
-192.81.223.158
  192.81.223.236
  192.81.38.31
-192.92.97.231
  192.95.12.175
-192.95.16.165
  192.95.18.190
  192.95.2.165
  192.95.24.39
@@ -59124,20 +49427,16 @@
  192.95.30.137
  192.95.30.185
  192.95.30.59
-192.95.30.65
  192.95.31.71
  192.95.31.9
  192.95.37.160
  192.95.49.93
-192.95.53.14
  192.95.6.110
  192.96.206.186
  192.96.206.197
  192.96.24.1
-192.99.0.56
  192.99.0.98
  192.99.1.38
-192.99.10.122
  192.99.10.26
  192.99.101.152
  192.99.109.30
@@ -59167,28 +49466,11 @@
  192.99.166.42
  192.99.168.9
  192.99.169.223
-192.99.175.176
-192.99.175.177
-192.99.175.178
-192.99.175.179
-192.99.175.180
-192.99.175.181
-192.99.175.182
-192.99.175.183
-192.99.175.184
-192.99.175.185
-192.99.175.186
-192.99.175.187
-192.99.175.188
-192.99.175.189
-192.99.175.190
-192.99.175.191
+192.99.172.138
  192.99.175.86
  192.99.19.154
-192.99.190.183
  192.99.2.41
  192.99.200.213
-192.99.208.205
  192.99.245.135
  192.99.247.102
  192.99.252.90
@@ -59198,10 +49480,10 @@
  192.99.35.135
  192.99.35.149
  192.99.36.177
+192.99.39.157
  192.99.4.179
  192.99.4.59
  192.99.4.63
-192.99.41.83
  192.99.42.246
  192.99.47.10
  192.99.47.125
@@ -59209,9 +49491,9 @@
  192.99.5.14
  192.99.5.94
  192.99.7.106
-192.99.7.16
  192.99.70.54
  192.99.70.67
+192.99.71.52
  192.99.8.102
  192.99.8.157
  192.99.83.47
@@ -59219,12 +49501,11 @@
  1929128.servicesbpd.club
  192mobility0040.info
  192yuanma.com
-193.0.178.127
  193.0.88.1
  193.1.101.222
  193.10.203.23
  193.104.41.59
-193.105.112.22
+193.105.134.45
  193.105.154.146
  193.105.206.253
  193.105.62.11
@@ -59233,7 +49514,6 @@
  193.105.83.6
  193.106.130.249
  193.106.175.103
-193.106.203.125
  193.106.231.145
  193.106.242.218
  193.106.26.133
@@ -59242,12 +49522,9 @@
  193.106.29.98
  193.106.30.90
  193.106.30.99
-193.106.31.106
  193.106.31.138
  193.106.31.146
  193.106.31.42
-193.106.57.177
-193.106.57.239
  193.106.58.51
  193.106.60.145
  193.106.95.186
@@ -59260,14 +49537,10 @@
  193.107.221.176
  193.107.236.167
  193.107.48.3
-193.107.74.36
  193.107.75.42
  193.107.85.56
  193.107.89.41
-193.107.96.32
-193.108.171.167
  193.109.217.15
-193.109.217.232
  193.109.79.233
  193.110.115.220
  193.110.201.100
@@ -59277,7 +49550,6 @@
  193.111.152.64
  193.111.152.71
  193.111.156.2
-193.111.2.141
  193.111.38.178
  193.111.4.131
  193.111.4.163
@@ -59285,27 +49557,26 @@
  193.111.5.195
  193.111.5.214
  193.111.5.221
+193.111.5.222
  193.112.1.26
+193.112.100.26
  193.112.102.236
  193.112.102.52
-193.112.104.178
  193.112.107.200
  193.112.108.11
  193.112.108.135
-193.112.108.148
  193.112.109.108
-193.112.111.119
  193.112.111.207
  193.112.118.128
  193.112.118.135
  193.112.123.100
  193.112.126.64
  193.112.127.245
-193.112.138.148
  193.112.139.159
  193.112.140.108
  193.112.157.231
  193.112.16.245
+193.112.160.70
  193.112.162.113
  193.112.162.48
  193.112.163.159
@@ -59328,7 +49599,6 @@
  193.112.213.227
  193.112.213.248
  193.112.23.105
-193.112.24.94
  193.112.247.98
  193.112.248.85
  193.112.250.77
@@ -59339,46 +49609,31 @@
  193.112.39.179
  193.112.39.2
  193.112.4.12
-193.112.42.13
  193.112.43.115
-193.112.49.125
  193.112.5.66
  193.112.58.246
-193.112.60.122
  193.112.61.82
  193.112.66.187
  193.112.70.95
  193.112.72.251
-193.112.72.37
  193.112.73.244
-193.112.74.230
  193.112.79.20
-193.112.8.113
-193.112.82.160
  193.112.85.35
  193.112.86.231
  193.112.9.233
-193.112.93.2
  193.112.93.94
+193.112.94.225
  193.112.96.42
  193.112.98.79
-193.112.99.188
-193.113.42.113
-193.118.53.139
-193.118.53.140
-193.118.53.142
-193.118.55.147
-193.118.55.148
-193.118.55.149
  193.12.104.83
  193.122.134.181
-193.122.141.173
-193.122.143.65
+193.122.144.192
  193.122.145.189
-193.122.153.182
  193.122.158.53
  193.122.163.242
  193.122.166.29
+193.122.61.112
+193.123.224.161
  193.124.183.187
  193.135.153.242
  193.137.208.199
@@ -59386,6 +49641,7 @@
  193.138.218.162
  193.138.218.72
  193.138.50.36
+193.140.135.230
  193.140.245.7
  193.142.146.202
  193.142.146.232
@@ -59396,10 +49652,10 @@
  193.142.30.73
  193.142.58.38
  193.142.59.11
+193.142.59.142
  193.142.59.169
  193.142.59.173
  193.142.59.18
-193.142.59.182
  193.142.59.78
  193.148.18.100
  193.148.70.150
@@ -59407,13 +49663,13 @@
  193.148.71.10
  193.148.71.149
  193.148.71.169
-193.148.73.10
+193.149.225.224
  193.15.16.4
  193.150.116.185
  193.150.121.66
  193.150.153.32
  193.150.233.115
-193.150.244.131
+193.150.252.38
  193.150.92.116
  193.151.118.207
  193.151.12.117
@@ -59424,14 +49680,13 @@
  193.152.253.185
  193.160.10.242
  193.160.224.139
+193.160.226.158
  193.160.64.180
-193.160.96.11
  193.164.131.14
  193.164.131.223
  193.164.133.75
  193.164.140.88
  193.164.216.238
-193.164.254.214
  193.168.147.25
  193.169.117.115
  193.169.145.194
@@ -59450,43 +49705,41 @@
  193.169.245.78
  193.169.245.81
  193.169.245.87
+193.169.252.15
  193.169.252.19
  193.169.252.205
  193.169.252.206
  193.169.252.208
-193.169.252.31
  193.169.252.59
  193.169.252.60
-193.169.252.64
  193.169.252.81
  193.169.252.82
  193.169.252.83
+193.169.253.114
  193.169.253.118
+193.169.253.122
  193.169.253.128
  193.169.253.136
  193.169.253.137
-193.169.253.139
  193.169.253.153
  193.169.253.173
-193.169.253.192
+193.169.253.175
  193.169.253.35
+193.169.253.45
  193.169.253.48
  193.169.253.49
  193.169.253.52
  193.169.253.56
-193.169.253.63
  193.169.253.66
  193.169.253.68
-193.169.253.71
  193.169.254.105
  193.169.254.107
  193.169.254.109
  193.169.254.116
-193.169.254.27
  193.169.5.14
  193.169.61.162
-193.17.73.18
  193.173.196.50
+193.176.186.5
  193.176.240.30
  193.176.242.137
  193.176.84.121
@@ -59501,20 +49754,12 @@
  193.176.85.82
  193.176.85.89
  193.176.85.90
-193.177.162.226
-193.178.118.10
-193.178.118.12
-193.178.118.4
-193.178.118.5
  193.178.169.252
  193.178.50.49
-193.179.240.18
-193.181.51.163
-193.183.246.194
-193.186.9.226
+193.183.217.67
+193.183.67.55
  193.187.119.203
  193.187.175.213
-193.187.91.18
  193.188.254.67
  193.189.117.189
  193.189.117.243
@@ -59528,8 +49773,6 @@
  193.19.165.222
  193.19.167.21
  193.19.243.246
-193.19.97.10
-193.192.122.65
  193.193.194.194
  193.193.240.34
  193.193.240.36
@@ -59539,7 +49782,6 @@
  193.194.69.36
  193.194.77.194
  193.194.80.6
-193.194.91.130
  193.194.92.198
  193.196.37.62
  193.196.39.103
@@ -59549,9 +49791,8 @@
  193.198.34.24
  193.200.151.69
  193.200.241.132
-193.200.50.167
-193.200.50.241
-193.200.50.246
+193.200.241.195
+193.200.74.97
  193.201.224.177
  193.201.224.213
  193.201.224.220
@@ -59561,17 +49802,14 @@
  193.202.8.118
  193.202.80.142
  193.202.80.22
-193.202.80.74
  193.202.81.153
-193.202.81.72
  193.202.82.188
  193.202.83.177
+193.203.11.116
  193.203.11.45
  193.203.8.218
  193.203.8.60
-193.203.9.60
  193.210.229.87
-193.213.8.6
  193.213.89.72
  193.216.178.70
  193.218.118.100
@@ -59595,26 +49833,28 @@
  193.218.118.30
  193.218.118.90
  193.218.118.95
+193.22.97.151
  193.222.130.14
+193.223.106.15
+193.223.106.17
+193.223.106.31
+193.223.106.5
+193.223.106.52
+193.223.106.59
+193.223.106.6
  193.223.106.60
  193.224.96.3
  193.225.126.2
-193.227.11.123
-193.227.11.126
  193.227.111.34
  193.227.16.160
-193.227.248.248
  193.227.49.81
  193.228.108.122
  193.228.53.78
  193.228.58.125
-193.228.58.131
-193.228.58.74
  193.228.59.112
  193.228.59.129
  193.228.59.13
  193.228.59.130
-193.228.59.157
  193.228.59.190
  193.228.59.191
  193.228.59.80
@@ -59630,29 +49870,28 @@
  193.233.14.18
  193.233.155.219
  193.233.6.156
+193.233.74.53
  193.233.9.167
  193.234.224.132
  193.234.224.213
  193.234.50.227
+193.235.238.234
  193.238.152.198
  193.238.152.67
-193.238.37.63
  193.239.101.6
  193.239.101.99
  193.239.102.12
-193.239.127.25
  193.239.147.100
  193.239.147.102
  193.239.147.125
+193.239.147.19
  193.239.147.211
-193.239.147.214
  193.239.147.217
  193.239.147.229
  193.239.147.3
  193.239.147.52
  193.239.147.66
  193.239.147.76
-193.239.147.77
  193.239.147.84
  193.239.147.90
  193.239.186.138
@@ -59667,6 +49906,8 @@
  193.246.121.239
  193.247.213.196
  193.248.247.215
+193.248.249.253
+193.248.48.130
  193.25.197.129
  193.250.107.205
  193.251.6.236
@@ -59676,35 +49917,19 @@
  193.252.54.240
  193.252.8.76
  193.253.113.78
+193.253.98.44
  193.254.184.188
  193.254.245.10
  193.27.13.180
-193.27.228.100
-193.27.228.130
-193.27.228.167
-193.27.228.173
-193.27.228.174
-193.27.228.187
-193.27.228.188
-193.27.228.217
-193.27.228.224
-193.27.228.32
-193.27.228.98
-193.27.229.183
-193.27.229.184
  193.27.229.207
  193.27.229.226
  193.27.229.227
+193.27.229.228
+193.27.229.229
+193.27.229.230
+193.27.229.231
  193.27.229.47
-193.27.229.86
-193.27.229.93
-193.27.229.94
-193.27.229.97
  193.28.7.234
-193.29.13.154
-193.29.13.157
-193.29.13.27
-193.29.15.169
  193.29.187.214
  193.29.187.218
  193.29.187.226
@@ -59714,44 +49939,18 @@
  193.29.56.172
  193.30.121.100
  193.30.123.70
-193.30.244.7
  193.31.24.154
  193.31.24.160
  193.32.126.161
  193.32.161.77
  193.32.188.211
-193.32.188.44
-193.32.68.34
-193.32.8.11
  193.32.8.112
  193.32.8.123
-193.32.8.128
-193.32.8.14
-193.32.8.18
-193.32.8.3
-193.32.8.32
-193.32.8.41
-193.32.8.44
-193.32.8.45
-193.32.8.49
-193.32.8.5
-193.32.8.50
-193.32.8.51
-193.32.8.59
-193.32.8.6
+193.32.8.124
+193.32.8.130
  193.32.8.63
-193.32.8.64
-193.32.8.67
-193.32.8.68
-193.32.8.69
-193.32.8.7
-193.32.8.70
-193.32.8.71
-193.32.8.73
-193.32.8.76
-193.32.8.78
-193.32.8.79
  193.34.144.138
+193.34.144.211
  193.34.161.137
  193.34.166.216
  193.34.166.96
@@ -59778,11 +49977,9 @@
  193.37.32.166
  193.38.51.25
  193.39.185.214
-193.39.220.13
  193.40.10.82
  193.41.114.13
  193.41.114.34
-193.41.114.50
  193.41.114.62
  193.41.115.103
  193.41.115.2
@@ -59795,7 +49992,6 @@
  193.41.123.102
  193.41.123.103
  193.41.123.121
-193.41.123.50
  193.41.123.76
  193.41.123.80
  193.41.123.87
@@ -59811,12 +50007,10 @@
  193.41.87.223
  193.41.87.235
  193.42.110.30
+193.42.159.234
  193.42.96.108
  193.43.118.68
  193.43.118.76
-193.43.13.122
-193.43.252.210
-193.43.72.250
  193.46.198.216
  193.46.199.225
  193.46.202.3
@@ -59825,35 +50019,33 @@
  193.56.107.31
  193.56.255.133
  193.56.28.103
-193.56.28.107
-193.56.28.109
+193.56.28.116
  193.56.28.119
  193.56.28.122
-193.56.28.130
-193.56.28.158
+193.56.28.147
  193.56.28.160
  193.56.28.17
  193.56.28.177
+193.56.28.180
+193.56.28.189
  193.56.28.204
  193.56.28.205
  193.56.28.225
  193.56.28.239
-193.56.28.241
+193.56.28.248
  193.56.28.249
  193.56.28.30
  193.56.28.33
  193.56.28.37
+193.56.28.63
  193.56.28.82
-193.56.28.87
  193.56.28.95
  193.56.28.97
  193.56.29.19
  193.56.29.251
+193.56.64.188
+193.56.64.237
  193.56.73.166
-193.57.40.15
-193.57.40.20
-193.57.40.31
-193.57.40.68
  193.58.168.177
  193.58.169.27
  193.58.196.212
@@ -59863,6 +50055,7 @@
  193.59.26.248
  193.59.26.46
  193.59.27.83
+193.63.77.2
  193.68.19.34
  193.68.200.227
  193.68.41.17
@@ -59879,16 +50072,13 @@
  193.70.38.187
  193.70.39.203
  193.70.39.41
-193.70.47.137
  193.70.7.73
  193.70.72.249
  193.70.77.132
  193.70.84.104
  193.70.84.113
  193.70.88.213
-193.70.91.148
  193.70.91.79
-193.71.141.104
  193.71.191.134
  193.75.54.35
  193.77.155.50
@@ -59896,8 +50086,6 @@
  193.77.242.110
  193.77.35.9
  193.77.51.6
-193.8.222.228
-193.8.83.28
  193.84.116.22
  193.85.145.251
  193.85.228.178
@@ -59906,24 +50094,22 @@
  193.87.81.18
  193.87.81.20
  193.87.99.18
+193.89.60.68
  193.9.114.232
  193.9.158.114
+193.9.158.119
  193.9.158.140
  193.9.158.182
  193.9.158.191
+193.9.158.25
  193.9.21.34
-193.9.28.34
  193.90.12.86
  193.90.12.87
  193.90.146.39
-193.90.178.142
-193.92.166.180
  193.93.192.151
  193.93.192.16
  193.93.192.168
-193.93.192.170
  193.93.192.181
-193.93.192.23
  193.93.192.231
  193.93.192.45
  193.93.192.73
@@ -59931,12 +50117,10 @@
  193.93.193.143
  193.93.194.186
  193.93.194.219
+193.93.194.82
  193.93.195.232
  193.93.195.252
-193.93.195.61
  193.93.219.102
-193.93.62.58
-193.93.62.61
  193.95.228.13
  193.95.24.114
  193.95.247.90
@@ -59944,12 +50128,12 @@
  1933611911.findprofile.net.pl
  194-58-108-245.ovz.vps.regruhosting.ru
  194.0.157.1
+194.0.157.102
  194.0.163.116
  194.1.247.250
  194.1.249.27
  194.102.40.134
  194.104.10.165
-194.105.136.16
  194.105.205.42
  194.105.25.25
  194.106.192.6
@@ -59959,18 +50143,11 @@
  194.110.113.40
  194.113.107.233
  194.113.235.67
-194.114.128.149
  194.117.252.30
+194.118.226.118
  194.118.227.218
  194.118.245.236
  194.12.121.100
-194.12.66.56
-194.12.73.223
-194.12.80.47
-194.12.81.20
-194.12.87.154
-194.12.87.231
-194.12.87.80
  194.124.213.78
  194.124.251.18
  194.126.110.134
@@ -59979,7 +50156,6 @@
  194.13.83.71
  194.135.135.69
  194.135.15.6
-194.135.60.198
  194.135.75.74
  194.135.80.231
  194.135.92.96
@@ -59992,20 +50168,19 @@
  194.14.246.8
  194.14.246.85
  194.14.246.86
+194.14.85.18
  194.141.86.251
-194.143.136.122
  194.143.151.96
  194.143.194.107
  194.143.248.179
  194.143.248.185
  194.143.248.246
-194.143.248.49
+194.143.249.181
  194.143.249.191
+194.143.249.229
  194.143.249.62
-194.143.249.70
  194.143.250.195
  194.143.250.225
-194.143.250.239
  194.143.250.26
  194.143.250.31
  194.143.250.57
@@ -60015,16 +50190,16 @@
  194.143.251.5
  194.145.175.76
  194.145.199.26
-194.145.246.67
  194.145.63.105
  194.145.63.107
  194.146.225.214
+194.146.239.70
+194.146.44.93
  194.147.115.117
-194.147.203.20
  194.147.34.119
  194.147.34.62
+194.147.34.64
  194.147.34.67
-194.147.78.217
  194.15.36.10
  194.15.36.102
  194.15.36.104
@@ -60038,7 +50213,6 @@
  194.15.36.18
  194.15.36.183
  194.15.36.19
-194.15.36.207
  194.15.36.212
  194.15.36.240
  194.15.36.242
@@ -60059,35 +50233,27 @@
  194.15.36.97
  194.150.167.104
  194.150.214.114
-194.150.214.120
-194.150.214.121
-194.150.214.123
-194.150.214.124
-194.150.214.126
-194.150.214.130
  194.150.214.132
-194.150.214.137
-194.150.215.133
+194.150.215.101
+194.150.215.122
  194.150.215.137
+194.150.215.138
  194.150.215.142
  194.150.215.143
+194.150.215.149
  194.150.215.153
  194.150.215.168
  194.150.215.198
  194.150.215.221
-194.150.215.23
  194.150.235.18
  194.150.235.182
  194.150.235.184
-194.150.235.188
  194.150.235.19
  194.150.235.190
-194.150.235.191
-194.150.235.198
  194.150.235.57
-194.150.235.82
-194.150.235.85
+194.150.235.77
  194.150.253.204
+194.150.255.17
  194.150.255.200
  194.152.206.103
  194.152.206.17
@@ -60102,26 +50268,20 @@
  194.156.123.56
  194.156.124.236
  194.156.125.110
-194.156.125.128
  194.156.125.163
  194.156.125.240
+194.156.175.197
+194.156.175.92
  194.156.175.95
  194.156.184.28
  194.156.95.214
  194.156.96.206
  194.156.97.183
  194.156.97.221
-194.158.192.17
-194.158.201.245
  194.158.210.79
  194.158.216.104
-194.158.223.22
-194.158.70.235
  194.160.76.5
-194.165.16.10
  194.170.156.9
-194.170.189.196
-194.170.189.226
  194.176.118.175
  194.180.110.10
  194.180.224.10
@@ -60143,14 +50303,12 @@
  194.181.82.190
  194.182.160.70
  194.182.72.214
-194.182.86.11
  194.183.15.230
  194.183.167.185
  194.183.170.59
  194.183.244.147
  194.186.168.50
  194.186.17.14
-194.186.172.10
  194.186.234.162
  194.186.249.22
  194.186.48.44
@@ -60180,7 +50338,6 @@
  194.187.170.209
  194.187.170.217
  194.187.249.179
-194.187.249.28
  194.187.249.34
  194.187.249.52
  194.187.249.56
@@ -60189,23 +50346,14 @@
  194.190.83.68
  194.190.93.136
  194.190.96.114
-194.193.183.140
-194.193.58.138
  194.201.253.190
  194.201.253.5
-194.204.123.123
  194.204.194.11
-194.207.64.187
-194.209.60.30
  194.213.43.166
-194.218.209.135
  194.219.107.15
  194.219.62.23
-194.219.7.29
  194.220.190.189
-194.220.218.94
  194.223.4.167
-194.223.49.69
  194.226.61.18
  194.228.129.189
  194.228.84.10
@@ -60213,6 +50361,7 @@
  194.242.101.10
  194.244.16.53
  194.244.16.58
+194.244.242.115
  194.246.105.27
  194.247.1.210
  194.247.22.2
@@ -60220,53 +50369,28 @@
  194.250.91.157
  194.254.163.71
  194.26.180.142
-194.26.25.101
  194.26.25.102
  194.26.25.108
-194.26.25.109
-194.26.25.110
  194.26.25.116
-194.26.25.119
-194.26.25.120
-194.26.25.121
-194.26.25.122
-194.26.25.123
-194.26.25.124
-194.26.25.125
-194.26.25.126
-194.26.25.127
-194.26.25.128
-194.26.25.13
  194.26.25.146
  194.26.25.147
-194.26.25.40
  194.26.25.46
  194.26.25.8
-194.26.27.100
-194.26.27.101
-194.26.27.103
  194.26.27.106
  194.26.27.108
  194.26.27.109
-194.26.29.31
-194.26.29.33
+194.26.29.22
+194.26.29.44
  194.27.68.207
  194.28.112.12
  194.28.222.1
  194.28.223.154
  194.28.223.242
-194.31.212.214
-194.31.53.23
+194.31.252.136
  194.32.237.152
  194.32.76.204
  194.32.76.210
  194.32.79.210
-194.34.132.148
-194.34.132.149
-194.34.132.150
-194.34.132.8
-194.34.132.91
-194.34.248.103
  194.34.248.120
  194.35.113.73
  194.35.116.127
@@ -60311,9 +50435,7 @@
  194.35.116.188
  194.35.12.125
  194.35.248.23
-194.36.102.29
  194.36.108.68
-194.36.174.154
  194.36.174.168
  194.36.188.112
  194.36.188.12
@@ -60325,14 +50447,11 @@
  194.36.88.150
  194.36.91.253
  194.36.96.135
-194.36.96.155
  194.36.96.57
  194.36.96.93
-194.36.99.218
-194.36.99.236
+194.36.99.140
  194.36.99.237
  194.36.99.41
-194.36.99.58
  194.37.81.239
  194.38.123.211
  194.38.146.73
@@ -60351,18 +50470,19 @@
  194.44.243.186
  194.44.244.187
  194.44.244.200
-194.44.38.51
  194.44.61.82
+194.44.77.226
  194.44.78.198
  194.44.86.243
  194.44.94.103
-194.44.99.45
-194.48.150.105
+194.44.97.39
+194.44.97.45
  194.48.152.60
  194.48.168.101
  194.48.218.52
  194.49.106.63
  194.49.60.74
+194.5.156.139
  194.5.159.197
  194.5.176.112
  194.5.176.39
@@ -60371,55 +50491,51 @@
  194.5.53.57
  194.5.79.166
  194.5.96.60
-194.50.85.117
  194.54.160.248
-194.56.118.9
  194.58.182.73
-194.59.164.32
+194.59.164.163
+194.59.165.208
  194.59.204.187
  194.59.250.167
  194.59.250.180
-194.6.231.122
  194.60.237.49
+194.60.238.118
  194.61.1.73
  194.61.24.102
  194.61.24.177
  194.61.24.253
  194.61.24.29
  194.61.54.115
-194.61.70.197
  194.62.1.123
-194.62.6.248
  194.62.6.66
  194.62.96.34
  194.63.143.79
  194.63.197.166
  194.63.235.156
-194.65.71.247
-194.67.110.172
  194.67.111.225
  194.67.203.67
  194.67.215.180
-194.67.78.25
  194.67.90.236
  194.67.93.197
  194.68.225.68
  194.68.27.32
  194.68.44.127
  194.68.44.160
-194.69.42.58
  194.71.126.76
+194.71.211.80
+194.71.217.77
  194.72.112.130
+194.73.218.62
+194.73.225.250
  194.76.114.144
  194.76.114.157
  194.76.114.226
  194.76.114.58
-194.78.242.245
  194.78.46.36
  194.79.157.171
+194.79.62.217
  194.8.136.62
  194.8.146.167
-194.8.146.220
  194.84.0.85
  194.87.138.0
  194.87.138.10
@@ -60439,39 +50555,31 @@
  194.87.138.2
  194.87.138.204
  194.87.138.214
-194.87.138.219
  194.87.138.225
  194.87.138.23
  194.87.138.51
  194.87.138.52
  194.87.138.67
-194.87.138.70
  194.87.138.71
  194.87.138.78
  194.87.138.8
  194.87.138.86
  194.87.139.108
  194.87.139.113
-194.87.139.169
-194.87.139.172
-194.87.139.188
-194.87.139.198
-194.87.139.200
-194.87.139.201
  194.87.139.207
-194.87.139.248
  194.87.139.34
  194.87.139.82
  194.87.147.137
  194.87.18.147
  194.87.190.89
  194.87.238.60
+194.87.34.193
  194.87.52.226
  194.87.52.61
  194.87.72.129
  194.88.107.222
  194.88.107.53
-194.88.143.48
+194.88.143.38
  194.9.177.10
  194.9.177.13
  194.9.178.16
@@ -60485,18 +50593,15 @@
  195.103.51.22
  195.110.147.194
  195.110.35.115
-195.110.54.19
  195.112.197.19
-195.112.227.180
  195.112.252.180
  195.112.64.53
  195.112.99.102
  195.113.147.69
  195.114.8.202
-195.117.107.150
+195.116.100.104
  195.117.107.182
  195.117.107.190
-195.117.162.191
  195.117.193.1
  195.12.49.210
  195.122.226.164
@@ -60513,6 +50618,7 @@
  195.123.234.33
  195.123.237.110
  195.123.240.104
+195.123.240.2
  195.123.240.236
  195.123.242.97
  195.123.245.175
@@ -60520,43 +50626,35 @@
  195.128.118.44
  195.128.119.233
  195.128.119.244
-195.128.157.124
  195.128.174.132
  195.13.201.98
+195.13.39.130
  195.130.152.71
  195.130.73.229
  195.132.54.179
  195.133.220.18
-195.133.56.144
  195.135.194.8
  195.135.24.63
-195.135.51.246
  195.136.66.4
  195.137.140.179
  195.137.74.2
  195.138.73.54
-195.138.74.25
  195.138.76.69
  195.138.82.198
-195.138.87.163
  195.138.90.121
  195.138.91.220
  195.138.92.152
  195.138.95.113
  195.139.152.20
  195.14.0.12
-195.14.170.50
  195.140.232.216
-195.141.82.250
-195.142.112.244
  195.144.205.25
  195.144.21.161
  195.144.21.219
  195.144.21.56
  195.144.219.155
-195.144.255.4
+195.146.117.56
  195.146.133.84
-195.146.242.238
  195.146.37.19
  195.146.50.22
  195.146.81.144
@@ -60580,13 +50678,10 @@
  195.154.168.82
  195.154.169.14
  195.154.17.225
-195.154.171.235
-195.154.172.21
  195.154.172.217
  195.154.176.37
  195.154.177.139
  195.154.177.15
-195.154.177.173
  195.154.178.122
  195.154.179.3
  195.154.181.15
@@ -60598,7 +50693,6 @@
  195.154.185.118
  195.154.185.170
  195.154.185.20
-195.154.185.239
  195.154.187.115
  195.154.187.6
  195.154.188.9
@@ -60623,25 +50717,17 @@
  195.154.214.162
  195.154.216.72
  195.154.217.119
-195.154.220.2
-195.154.221.174
  195.154.222.113
  195.154.222.29
  195.154.222.31
  195.154.223.131
  195.154.225.16
-195.154.225.56
-195.154.225.74
-195.154.226.126
-195.154.231.8
  195.154.233.102
-195.154.233.88
  195.154.237.166
  195.154.240.184
  195.154.242.189
  195.154.242.89
  195.154.243.19
-195.154.250.111
  195.154.250.133
  195.154.251.131
  195.154.251.86
@@ -60655,7 +50741,6 @@
  195.154.45.133
  195.154.50.29
  195.154.54.229
-195.154.56.73
  195.154.60.148
  195.154.87.159
  195.155.171.185
@@ -60664,16 +50749,12 @@
  195.158.103.157
  195.158.109.248
  195.158.199.36
-195.158.2.197
  195.158.26.102
  195.158.26.238
-195.158.26.70
  195.158.28.62
  195.158.3.198
-195.158.31.153
  195.158.6.55
  195.158.8.206
-195.158.8.210
  195.159.180.19
  195.159.28.229
  195.159.28.66
@@ -60681,7 +50762,6 @@
  195.161.114.14
  195.161.114.175
  195.161.114.23
-195.161.162.250
  195.161.162.46
  195.161.2.66
  195.162.24.32
@@ -60690,13 +50770,12 @@
  195.170.15.66
  195.170.38.230
  195.175.209.194
-195.175.53.70
  195.176.3.19
  195.176.3.20
  195.176.3.23
  195.176.3.24
  195.178.106.145
-195.178.201.105
+195.178.203.145
  195.178.39.98
  195.18.224.6
  195.18.33.130
@@ -60706,7 +50785,6 @@
  195.181.172.77
  195.181.215.65
  195.182.131.101
-195.182.139.145
  195.182.152.238
  195.186.64.163
  195.186.81.204
@@ -60714,15 +50792,9 @@
  195.19.102.173
  195.19.96.236
  195.190.166.35
-195.190.23.49
-195.191.132.161
-195.191.148.23
  195.191.214.118
  195.191.32.134
-195.192.246.28
-195.198.195.206
  195.2.78.123
-195.2.79.183
  195.2.92.155
  195.2.93.50
  195.20.133.161
@@ -60765,10 +50837,8 @@
  195.207.15.79
  195.208.103.30
  195.208.130.85
-195.208.160.137
  195.209.131.19
  195.209.236.77
-195.209.96.42
  195.210.172.43
  195.210.172.46
  195.211.1.114
@@ -60779,20 +50849,12 @@
  195.211.156.193
  195.211.160.88
  195.211.161.124
-195.211.163.22
  195.211.173.143
  195.211.219.47
  195.211.239.254
-195.211.240.171
-195.211.252.197
-195.211.253.86
  195.211.30.115
  195.211.84.104
-195.211.87.133
-195.213.47.61
-195.213.49.37
  195.214.157.34
-195.214.196.234
  195.214.214.253
  195.214.223.84
  195.214.252.110
@@ -60802,7 +50864,6 @@
  195.218.174.50
  195.22.101.58
  195.22.117.1
-195.22.153.170
  195.22.153.199
  195.22.157.111
  195.22.239.150
@@ -60818,12 +50879,9 @@
  195.222.163.54
  195.222.44.54
  195.222.55.232
-195.222.67.107
-195.223.176.47
  195.223.211.242
  195.223.215.190
  195.224.138.61
-195.224.39.199
  195.225.168.186
  195.225.48.113
  195.225.48.177
@@ -60838,12 +50896,9 @@
  195.228.65.108
  195.228.75.149
  195.228.75.150
-195.228.76.246
-195.228.76.248
  195.228.76.41
  195.228.8.8
  195.228.80.166
-195.23.10.74
  195.230.141.2
  195.230.141.68
  195.230.154.2
@@ -60858,31 +50913,25 @@
  195.234.171.80
  195.234.215.26
  195.234.215.81
-195.234.239.20
  195.234.87.211
-195.238.109.226
  195.238.71.50
  195.238.71.52
  195.239.115.106
  195.239.178.110
  195.239.185.251
  195.239.243.84
-195.239.249.172
  195.239.26.38
  195.239.48.166
-195.239.63.166
  195.239.7.18
  195.24.129.234
  195.24.207.199
-195.24.207.221
-195.24.207.222
-195.24.207.224
-195.24.207.250
+195.24.207.223
  195.24.49.142
  195.24.61.7
  195.241.146.206
  195.242.93.88
  195.244.209.70
+195.244.215.150
  195.245.112.235
  195.246.120.147
  195.246.120.148
@@ -60899,18 +50948,12 @@
  195.246.120.176
  195.246.120.177
  195.246.120.179
-195.246.39.17
-195.246.57.116
-195.248.241.135
  195.248.242.249
  195.25.101.25
  195.25.19.4
-195.25.24.43
  195.250.143.182
-195.250.253.134
  195.251.143.108
  195.251.200.71
-195.252.88.109
  195.254.134.10
  195.254.134.194
  195.254.135.76
@@ -60918,7 +50961,7 @@
  195.29.102.42
  195.29.106.2
  195.29.155.98
-195.29.201.112
+195.29.161.70
  195.29.51.133
  195.29.51.134
  195.29.51.135
@@ -60929,29 +50972,28 @@
  195.3.144.84
  195.3.144.88
  195.3.144.92
+195.3.147.47
  195.3.154.253
  195.3.195.8
+195.30.85.70
  195.32.106.250
+195.32.14.110
  195.32.14.88
-195.32.44.245
  195.32.74.149
  195.32.74.170
  195.32.74.92
  195.32.75.115
  195.32.75.13
+195.32.75.205
  195.33.206.195
  195.33.246.1
  195.34.242.131
  195.34.78.110
-195.35.245.30
  195.36.136.59
  195.37.209.9
-195.38.18.104
  195.38.35.58
  195.38.98.224
  195.39.114.210
-195.39.148.97
-195.40.181.55
  195.42.149.78
  195.46.105.233
  195.46.109.249
@@ -60959,25 +51001,16 @@
  195.46.189.178
  195.46.20.146
  195.47.243.254
-195.48.56.4
  195.5.163.212
  195.5.246.162
  195.53.165.150
  195.53.237.122
-195.53.49.11
-195.54.160.155
  195.54.160.20
-195.54.160.228
-195.54.160.85
  195.54.161.122
-195.54.161.225
  195.54.162.38
  195.54.163.83
-195.54.167.124
-195.54.167.220
  195.54.201.163
  195.55.236.20
-195.55.3.90
  195.56.165.14
  195.56.55.217
  195.56.63.10
@@ -60988,15 +51021,11 @@
  195.58.39.193
  195.58.39.217
  195.58.39.228
-195.60.174.112
+195.60.138.10
  195.60.174.123
-195.60.175.143
  195.60.190.235
-195.60.191.83
-195.62.46.21
+195.62.62.248
  195.64.154.191
-195.65.1.148
-195.66.179.90
  195.67.139.54
  195.68.129.146
  195.68.186.51
@@ -61004,16 +51033,12 @@
  195.69.135.78
  195.69.140.147
  195.69.187.6
+195.69.218.198
  195.69.221.198
-195.69.76.159
  195.70.32.203
  195.70.59.121
-195.74.91.118
-195.74.91.68
-195.74.91.78
-195.77.202.12
+195.74.138.9
  195.78.112.235
-195.78.66.28
  195.78.94.193
  195.8.105.201
  195.8.51.55
@@ -61033,53 +51058,49 @@
  195.86.221.44
  195.86.221.45
  195.86.221.46
-195.88.121.113
-195.88.126.86
+195.88.184.186
  195.88.208.35
  195.88.4.18
-195.9.113.150
  195.9.114.222
  195.9.131.130
  195.9.192.52
  195.9.209.10
  195.9.225.238
-195.9.33.162
-195.9.33.186
-195.9.49.26
  195.9.61.22
  195.9.80.22
  195.9.89.66
  195.9.89.68
  195.9.89.70
  195.90.200.184
+195.91.148.184
  195.91.186.78
  195.91.239.8
-195.94.232.102
  195.95.131.211
  195.95.131.214
  195.95.131.215
-195.95.171.6
  195.95.228.30
  195.95.229.230
-195.97.19.2
  195.97.75.174
-195.97.83.206
  195.98.176.62
+195.98.232.90
  195.98.246.112
  19536.psdzy.com
  195479-dot-n-e-w-me-ss-age-po-rt-al.wl.r.appspot.com
  196.0.111.186
  196.0.111.194
  196.0.113.10
+196.0.117.110
  196.0.34.142
  196.0.58.214
+196.1.238.130
+196.1.238.2
  196.1.238.58
  196.1.97.206
  196.1.97.216
  196.10.94.244
  196.11.80.154
+196.12.151.70
  196.12.186.34
-196.121.149.118
  196.13.111.127
  196.132.1.4
  196.14.130.164
@@ -61089,16 +51110,14 @@
  196.15.211.91
  196.15.211.92
  196.15.249.151
-196.159.137.226
  196.16.121.147
-196.16.160.98
-196.16.180.114
+196.16.160.214
  196.16.223.109
  196.16.223.30
  196.16.223.6
  196.16.223.72
  196.16.241.53
-196.16.77.13
+196.17.161.116
  196.17.162.116
  196.17.162.230
  196.17.162.61
@@ -61108,28 +51127,27 @@
  196.170.62.66
  196.175.251.17
  196.179.227.47
+196.18.0.35
  196.18.146.98
-196.18.209.31
+196.18.209.215
+196.18.225.83
  196.180.54.59
  196.181.184.191
  196.183.230.199
  196.184.35.117
  196.187.83.101
-196.188.0.172
-196.188.192.242
+196.188.12.175
  196.188.30.27
-196.188.51.241
-196.188.92.51
  196.189.91.162
  196.189.91.196
  196.192.185.189
-196.196.112.37
  196.196.116.71
  196.196.160.109
  196.196.160.196
  196.196.160.223
  196.196.160.88
  196.196.194.222
+196.196.195.243
  196.196.198.142
  196.196.198.98
  196.196.216.146
@@ -61139,45 +51157,34 @@
  196.196.224.127
  196.196.224.171
  196.196.255.205
-196.196.255.60
-196.196.34.136
+196.196.31.231
  196.196.34.137
-196.196.47.128
+196.196.47.209
  196.196.47.226
  196.196.50.108
  196.196.50.13
  196.196.50.159
+196.196.50.67
  196.199.122.123
-196.199.122.198
-196.199.122.213
+196.199.122.137
  196.199.122.233
  196.199.122.236
  196.199.122.62
  196.199.122.71
  196.199.122.76
  196.2.13.12
-196.2.14.137
-196.2.14.184
  196.2.14.250
-196.2.15.20
-196.2.9.178
+196.20.238.196
  196.200.138.20
-196.200.156.122
  196.200.37.201
+196.200.39.101
+196.200.39.204
  196.200.39.80
  196.200.39.82
-196.200.45.235
  196.200.45.244
-196.202.117.85
-196.202.127.211
-196.202.168.130
  196.202.202.197
  196.202.209.77
  196.202.220.95
-196.202.5.21
-196.202.71.90
-196.202.9.3
-196.202.92.132
  196.203.182.166
  196.203.219.138
  196.203.31.154
@@ -61185,34 +51192,19 @@
  196.204.25.92
  196.204.28.100
  196.204.28.109
-196.206.227.153
  196.206.83.31
  196.206.87.210
-196.207.176.12
-196.207.176.175
-196.207.176.185
+196.207.177.24
  196.207.177.246
  196.207.184.14
  196.213.65.166
  196.215.192.62
-196.216.10.15
  196.216.220.196
  196.216.220.204
  196.216.73.90
-196.217.240.243
-196.218.101.245
-196.218.107.29
-196.218.110.31
-196.218.174.83
  196.218.180.49
-196.218.19.221
  196.218.23.67
-196.218.37.194
-196.218.89.46
-196.219.163.197
-196.219.85.159
-196.219.89.214
-196.219.93.130
+196.218.88.76
  196.22.215.233
  196.22.215.250
  196.22.215.6
@@ -61221,20 +51213,22 @@
  196.22.221.2
  196.22.221.97
  196.22.224.98
-196.22.227.186
-196.220.34.80
  196.220.42.100
  196.221.145.196
-196.221.165.143
-196.221.165.32
-196.221.39.2
-196.223.154.139
+196.223.160.214
  196.223.162.38
+196.224.212.37
  196.23.22.27
  196.235.232.102
  196.240.104.179
-196.240.104.219
+196.240.104.245
+196.240.104.250
+196.240.104.5
+196.240.104.86
+196.240.105.26
+196.240.109.103
  196.240.109.121
+196.240.109.128
  196.240.109.149
  196.240.109.203
  196.240.109.224
@@ -61253,8 +51247,9 @@
  196.240.173.192
  196.240.173.206
  196.240.173.219
-196.240.237.20
  196.240.237.201
+196.240.237.240
+196.240.237.253
  196.240.250.114
  196.240.250.174
  196.240.250.176
@@ -61266,21 +51261,22 @@
  196.240.250.37
  196.240.250.39
  196.240.250.49
+196.240.250.52
  196.240.254.147
  196.240.254.3
  196.240.254.37
-196.240.254.39
  196.240.254.51
-196.240.254.55
  196.240.58.127
  196.240.58.138
+196.240.58.148
+196.240.58.34
  196.240.58.73
  196.242.178.10
  196.242.178.122
  196.242.178.135
+196.242.178.219
  196.242.178.223
  196.242.178.229
-196.242.178.43
  196.242.178.49
  196.242.195.145
  196.242.195.230
@@ -61290,8 +51286,8 @@
  196.242.195.56
  196.242.195.92
  196.242.20.100
-196.242.20.101
  196.242.20.104
+196.242.20.137
  196.242.20.145
  196.242.20.16
  196.242.20.163
@@ -61302,30 +51298,29 @@
  196.242.20.30
  196.242.20.67
  196.242.20.78
+196.242.200.99
  196.242.244.238
  196.242.244.241
-196.242.3.10
-196.242.3.11
-196.242.3.144
-196.242.3.160
  196.242.3.163
  196.242.3.187
-196.242.47.131
  196.242.47.230
  196.242.47.3
+196.242.84.182
  196.244.192.62
  196.244.4.14
  196.244.4.27
  196.244.4.93
  196.245.148.101
+196.245.148.123
  196.245.148.187
  196.245.148.245
  196.245.148.37
+196.245.148.64
+196.245.149.210
  196.245.149.226
  196.245.159.35
  196.245.159.36
  196.245.163.130
-196.245.164.142
  196.245.184.124
  196.245.184.144
  196.245.184.225
@@ -61355,12 +51350,9 @@
  196.245.250.161
  196.245.250.222
  196.245.250.225
-196.245.254.103
  196.245.254.126
  196.245.254.138
-196.245.254.152
  196.245.254.208
-196.245.254.224
  196.245.254.242
  196.245.254.83
  196.245.255.66
@@ -61378,7 +51370,6 @@
  196.247.163.252
  196.247.163.62
  196.247.18.152
-196.247.192.45
  196.247.192.59
  196.247.224.183
  196.247.224.190
@@ -61396,62 +51387,41 @@
  196.25.94.134
  196.250.176.17
  196.250.176.77
-196.250.209.32
  196.250.39.65
  196.251.55.196
  196.27.106.112
  196.27.107.231
  196.27.115.50
  196.27.127.170
-196.27.127.58
  196.27.127.61
-196.27.73.219
-196.28.101.116
-196.28.101.117
  196.28.226.33
  196.28.234.66
  196.3.100.45
  196.3.171.138
  196.3.171.145
  196.3.192.229
-196.3.193.145
+196.3.193.177
  196.3.193.70
-196.3.195.146
  196.3.96.158
  196.3.97.34
  196.3.97.70
  196.3.99.197
  196.3.99.210
+196.32.105.142
  196.32.105.209
-196.33.226.72
-196.34.217.228
-196.35.193.107
  196.35.41.109
-196.36.152.50
-196.37.111.104
-196.37.111.106
-196.37.111.170
-196.37.111.171
  196.37.111.217
-196.38.150.104
  196.38.70.24
-196.40.83.18
  196.40.97.14
  196.41.102.130
  196.41.122.94
  196.41.130.159
  196.41.17.62
  196.41.2.166
-196.41.48.84
-196.41.51.22
-196.43.171.28
  196.44.10.207
-196.44.111.169
  196.44.176.55
  196.44.182.183
-196.44.202.122
-196.44.236.202
-196.45.141.38
+196.46.202.80
  196.46.39.53
  196.47.67.180
  196.49.1.16
@@ -61465,121 +51435,38 @@
  196.52.10.7
  196.52.38.11
  196.52.38.14
-196.52.43.100
-196.52.43.101
-196.52.43.102
-196.52.43.103
-196.52.43.104
-196.52.43.105
-196.52.43.106
-196.52.43.108
-196.52.43.109
-196.52.43.110
-196.52.43.111
-196.52.43.112
-196.52.43.113
-196.52.43.114
-196.52.43.115
-196.52.43.116
-196.52.43.118
-196.52.43.119
-196.52.43.120
-196.52.43.121
-196.52.43.122
-196.52.43.123
-196.52.43.124
-196.52.43.125
-196.52.43.126
-196.52.43.127
-196.52.43.128
-196.52.43.129
-196.52.43.130
-196.52.43.131
-196.52.43.51
  196.52.43.52
-196.52.43.53
-196.52.43.54
-196.52.43.55
-196.52.43.56
-196.52.43.57
-196.52.43.58
-196.52.43.59
-196.52.43.60
-196.52.43.61
-196.52.43.62
-196.52.43.63
-196.52.43.64
-196.52.43.65
-196.52.43.66
-196.52.43.67
-196.52.43.68
-196.52.43.69
-196.52.43.71
-196.52.43.72
-196.52.43.73
-196.52.43.74
-196.52.43.75
-196.52.43.76
-196.52.43.77
-196.52.43.78
-196.52.43.79
-196.52.43.80
-196.52.43.81
-196.52.43.82
-196.52.43.84
-196.52.43.85
-196.52.43.86
-196.52.43.87
-196.52.43.88
-196.52.43.89
-196.52.43.90
-196.52.43.91
-196.52.43.92
-196.52.43.93
-196.52.43.94
-196.52.43.95
-196.52.43.96
-196.52.43.97
-196.52.43.98
-196.52.43.99
  196.52.60.21
  196.52.84.80
  196.53.0.119
-196.53.224.150
  196.55.233.39
  196.6.112.70
  196.6.232.32
  196.61.32.34
  196.61.32.43
+196.70.200.81
+196.70.212.216
  196.70.252.2
-196.73.33.181
-196.74.96.152
-196.77.119.116
  196.77.45.147
  196.92.5.195
  19618-dot-n-e-w-me-ss-age-po-rt-al.wl.r.appspot.com
+197.0.123.120
  197.0.35.209
  197.1.100.46
  197.1.142.52
  197.1.6.184
  197.1.94.79
-197.112.0.40
-197.128.28.251
  197.13.2.215
-197.132.49.61
-197.135.239.104
  197.136.142.5
  197.14.199.24
  197.14.216.207
  197.14.82.93
  197.148.21.121
-197.148.91.218
  197.149.128.25
  197.149.148.110
  197.149.195.108
-197.153.143.222
-197.153.92.233
-197.155.158.22
+197.15.22.89
+197.153.4.211
  197.155.193.115
  197.155.194.194
  197.155.200.6
@@ -61589,7 +51476,6 @@
  197.157.21.82
  197.157.21.90
  197.157.219.169
-197.157.22.166
  197.157.228.121
  197.157.228.125
  197.157.228.129
@@ -61619,19 +51505,12 @@
  197.157.255.38
  197.159.0.214
  197.159.12.167
-197.159.195.159
-197.159.217.33
-197.159.217.34
-197.159.218.209
  197.159.23.174
  197.159.3.35
-197.159.9.29
-197.161.154.18
-197.162.252.152
-197.164.97.71
-197.185.98.237
+197.185.111.198
+197.188.144.91
  197.188.147.238
-197.188.148.78
+197.188.148.160
  197.188.163.146
  197.188.165.5
  197.188.166.234
@@ -61641,12 +51520,10 @@
  197.2.148.6
  197.2.194.74
  197.206.139.101
-197.210.109.44
  197.210.114.50
  197.210.114.58
  197.210.124.186
  197.210.130.46
-197.210.131.94
  197.210.135.139
  197.210.150.57
  197.210.153.234
@@ -61655,38 +51532,32 @@
  197.210.191.131
  197.210.217.66
  197.210.246.30
-197.210.91.138
-197.211.1.234
  197.211.209.236
-197.211.215.170
  197.211.238.220
  197.211.3.238
-197.211.35.163
  197.211.38.187
  197.211.39.16
  197.211.45.4
  197.211.57.62
-197.211.62.202
-197.214.114.90
-197.214.119.60
-197.217.71.234
-197.220.163.230
+197.217.71.183
  197.220.169.143
-197.220.68.74
  197.221.158.186
  197.221.28.59
+197.221.52.216
  197.221.90.54
+197.229.1.102
+197.229.1.20
+197.229.1.25
+197.229.1.97
  197.230.17.94
-197.230.221.148
+197.230.188.214
  197.230.26.130
  197.231.186.148
  197.231.198.172
  197.231.202.106
-197.231.202.157
  197.231.221.211
-197.232.106.107
-197.232.20.75
  197.232.21.22
+197.232.23.143
  197.232.245.251
  197.232.36.108
  197.232.41.216
@@ -61698,6 +51569,9 @@
  197.234.13.12
  197.234.13.16
  197.234.13.2
+197.234.13.20
+197.234.13.22
+197.234.13.24
  197.234.13.32
  197.234.13.34
  197.234.13.36
@@ -61716,9 +51590,8 @@
  197.234.13.8
  197.234.13.82
  197.234.13.84
+197.234.13.86
  197.234.13.88
-197.234.13.91
-197.234.13.92
  197.234.13.96
  197.234.179.102
  197.234.221.176
@@ -61726,123 +51599,83 @@
  197.234.221.250
  197.234.35.82
  197.234.48.242
-197.234.83.186
  197.235.10.121
  197.237.12.31
-197.237.137.151
+197.237.150.189
+197.237.150.231
  197.237.151.253
  197.237.161.55
-197.237.161.58
-197.237.161.64
-197.237.174.107
  197.237.174.150
-197.237.174.26
-197.237.175.99
-197.237.243.89
+197.237.175.30
+197.237.243.237
+197.237.243.68
  197.237.90.67
  197.240.209.56
  197.240.76.29
-197.242.125.206
+197.242.102.148
+197.242.112.94
  197.242.144.229
  197.242.147.47
  197.242.203.180
  197.242.203.246
  197.242.205.65
  197.242.206.64
-197.243.0.238
-197.243.108.20
-197.243.20.92
-197.243.22.27
-197.245.15.194
  197.245.151.249
-197.245.175.45
  197.245.230.122
  197.245.234.197
  197.245.25.228
+197.246.40.147
  197.248.114.226
  197.248.136.250
+197.248.184.157
  197.248.190.170
  197.248.2.229
  197.248.20.69
-197.248.230.67
-197.248.29.234
-197.249.11.20
-197.249.20.247
  197.249.46.152
  197.250.230.246
  197.250.8.162
  197.251.147.252
  197.251.150.153
-197.251.152.248
-197.251.188.49
+197.251.150.225
+197.251.150.8
+197.251.151.69
  197.251.189.252
-197.251.192.86
  197.251.194.228
-197.251.224.215
  197.253.224.21
  197.254.115.162
-197.254.118.122
-197.254.12.202
-197.254.193.118
  197.254.29.22
  197.254.38.250
  197.254.64.186
  197.254.7.178
-197.254.7.34
  197.254.7.86
  197.254.84.170
  197.255.0.98
  197.255.160.226
  197.255.162.162
  197.255.176.29
-197.255.207.98
-197.255.213.78
-197.255.223.138
  197.255.253.210
  197.255.255.101
  197.255.255.113
  197.27.105.191
  197.3.10.10
-197.3.254.237
-197.3.7.162
  197.32.144.247
-197.32.164.82
-197.32.17.84
-197.32.226.136
-197.32.24.30
-197.34.88.84
  197.35.46.71
  197.37.102.120
  197.37.114.148
+197.37.219.248
  197.39.210.11
  197.40.158.14
  197.40.196.212
-197.42.54.110
-197.42.55.191
  197.44.124.205
-197.44.153.250
-197.44.170.83
-197.44.22.99
  197.44.52.58
-197.44.72.58
-197.44.74.18
-197.44.80.122
-197.44.94.33
-197.45.138.52
-197.45.155.10
  197.45.163.117
-197.45.181.206
-197.45.181.244
  197.45.47.140
  197.46.77.192
+197.47.11.8
  197.47.141.255
-197.48.127.229
  197.48.161.231
-197.48.199.168
-197.48.20.22
+197.48.55.4
  197.48.60.42
-197.48.90.23
-197.49.234.64
  197.5.145.102
  197.5.145.106
  197.5.145.112
@@ -61855,52 +51688,33 @@
  197.5.145.75
  197.5.145.88
  197.5.145.93
-197.50.179.254
-197.50.187.225
-197.50.250.124
-197.50.251.53
-197.50.251.56
-197.50.44.19
-197.50.45.114
-197.50.5.252
-197.50.71.53
-197.51.216.156
  197.51.225.43
-197.51.236.207
-197.51.243.118
-197.51.78.122
-197.52.238.5
  197.52.30.33
-197.52.49.188
  197.52.93.117
  197.53.100.215
-197.53.132.246
+197.53.149.209
  197.53.218.213
  197.53.219.141
-197.55.209.188
-197.56.127.109
-197.58.159.92
+197.55.206.84
+197.57.88.57
  197.60.198.104
-197.61.141.196
+197.61.146.180
  197.61.49.24
-197.62.174.35
  197.81.132.193
  197.85.185.156
-197.86.217.241
  197.88.32.60
  197.89.103.103
+197.89.150.85
  197.89.2.174
  197.89.252.215
  197.89.35.107
  197.89.69.208
  197.89.73.184
  197.89.73.215
-197.91.169.179
-197.94.221.17
-197.95.149.190
  19725.psdzy.com
  1975365.com
  198.0.198.132
+198.1.119.72
  198.1.231.6
  198.1.67.59
  198.1.73.228
@@ -61912,7 +51726,6 @@
  198.100.146.67
  198.100.146.76
  198.100.147.36
-198.100.148.52
  198.100.148.81
  198.100.149.153
  198.100.150.77
@@ -61922,12 +51735,11 @@
  198.100.159.54
  198.100.45.215
  198.105.117.140
-198.105.117.210
  198.105.117.219
+198.105.117.253
  198.105.117.51
  198.105.117.82
  198.106.189.76
-198.12.105.83
  198.12.108.109
  198.12.108.110
  198.12.108.111
@@ -61952,13 +51764,12 @@
  198.12.125.116
  198.12.125.248
  198.12.125.254
+198.12.223.86
  198.12.224.76
  198.12.230.116
  198.12.249.249
  198.12.250.116
-198.12.252.163
  198.12.64.117
-198.12.64.120
  198.12.66.104
  198.12.66.106
  198.12.66.107
@@ -61974,19 +51785,19 @@
  198.12.80.151
  198.12.80.164
  198.12.80.171
+198.12.80.177
  198.12.81.233
  198.12.83.181
  198.12.84.18
  198.12.84.221
-198.12.85.110
+198.12.85.114
+198.12.85.97
+198.12.86.252
  198.12.87.153
-198.12.88.149
-198.12.93.117
  198.12.97.66
  198.13.33.52
  198.13.33.97
  198.13.34.137
-198.13.43.55
  198.13.49.8
  198.13.53.217
  198.13.57.8
@@ -61995,30 +51806,7 @@
  198.137.202.175
  198.143.115.198
  198.143.129.162
-198.143.129.163
-198.143.129.164
-198.143.129.165
-198.143.129.166
-198.143.147.114
-198.143.147.115
-198.143.147.116
-198.143.147.117
-198.143.147.118
-198.143.175.42
-198.143.175.43
-198.143.175.44
-198.143.175.45
-198.143.175.46
  198.143.175.82
-198.143.175.83
-198.143.175.84
-198.143.175.85
-198.143.175.86
-198.143.185.10
-198.143.185.11
-198.143.185.12
-198.143.185.13
-198.143.185.14
  198.143.185.202
  198.143.190.68
  198.143.4.54
@@ -62032,9 +51820,7 @@
  198.144.158.120
  198.144.176.137
  198.144.176.147
-198.144.176.85
  198.144.180.170
-198.144.190.164
  198.144.191.135
  198.148.153.20
  198.15.105.10
@@ -62068,27 +51854,22 @@
  198.154.92.252
  198.167.136.150
  198.167.140.237
-198.167.195.10
-198.17.119.229
-198.175.126.119
+198.167.211.209
  198.178.120.5
-198.181.163.251
+198.181.163.145
  198.181.43.204
-198.186.236.66
  198.187.28.137
  198.187.30.116
  198.199.100.215
  198.199.103.79
  198.199.105.147
  198.199.105.174
-198.199.106.251
  198.199.106.91
  198.199.107.36
  198.199.108.133
  198.199.108.36
  198.199.109.234
  198.199.112.63
-198.199.113.231
  198.199.113.36
  198.199.114.69
  198.199.115.23
@@ -62100,6 +51881,7 @@
  198.199.122.245
  198.199.122.67
  198.199.123.206
+198.199.124.117
  198.199.125.32
  198.199.125.87
  198.199.126.199
@@ -62108,7 +51890,6 @@
  198.199.64.84
  198.199.65.166
  198.199.65.87
-198.199.66.10
  198.199.66.196
  198.199.67.168
  198.199.68.76
@@ -62116,7 +51897,6 @@
  198.199.70.131
  198.199.70.39
  198.199.72.10
-198.199.72.47
  198.199.73.239
  198.199.75.246
  198.199.76.168
@@ -62126,7 +51906,6 @@
  198.199.80.244
  198.199.81.198
  198.199.82.190
-198.199.83.174
  198.199.83.58
  198.199.85.178
  198.199.89.152
@@ -62135,12 +51914,9 @@
  198.199.91.213
  198.199.91.215
  198.199.91.6
-198.199.92.246
  198.199.94.189
  198.199.94.96
  198.199.95.124
-198.199.95.17
-198.199.95.69
  198.199.96.229
  198.199.97.218
  198.199.97.78
@@ -62150,29 +51926,21 @@
  198.2.196.162
  198.2.198.161
  198.2.198.98
-198.2.200.228
  198.2.200.97
  198.2.203.193
  198.2.203.194
  198.2.203.195
-198.2.208.1
-198.2.208.10
+198.2.208.11
  198.2.208.12
-198.2.208.17
  198.2.208.18
  198.2.208.22
-198.2.208.25
  198.2.208.26
-198.2.208.6
  198.2.209.221
  198.2.217.129
-198.2.89.195
-198.20.127.197
  198.20.163.226
  198.20.164.43
  198.20.167.253
  198.20.168.83
-198.20.168.87
  198.20.172.158
  198.20.172.159
  198.20.172.161
@@ -62182,6 +51950,7 @@
  198.20.172.77
  198.20.173.169
  198.20.174.164
+198.20.174.168
  198.20.175.146
  198.20.176.178
  198.20.176.188
@@ -62195,15 +51964,10 @@
  198.20.182.203
  198.20.231.157
  198.20.235.1
+198.20.248.178
  198.20.69.98
  198.20.70.114
  198.20.70.58
-198.20.70.59
-198.20.70.60
-198.20.70.61
-198.20.70.62
-198.20.87.98
-198.20.99.130
  198.200.51.1
  198.202.171.12
  198.202.171.154
@@ -62241,7 +52005,6 @@
  198.211.102.227
  198.211.104.28
  198.211.105.114
-198.211.105.59
  198.211.107.194
  198.211.107.224
  198.211.109.242
@@ -62258,6 +52021,7 @@
  198.211.120.93
  198.211.121.126
  198.211.122.221
+198.211.122.238
  198.211.123.28
  198.211.125.152
  198.211.125.219
@@ -62267,22 +52031,19 @@
  198.211.29.68
  198.211.33.205
  198.211.33.231
-198.211.49.176
  198.211.60.243
  198.211.96.133
  198.211.98.165
-198.211.99.153
+198.211.98.90
  198.211.99.227
  198.211.99.24
  198.211.99.79
  198.23.137.142
-198.23.140.218
  198.23.145.197
  198.23.145.200
  198.23.145.208
  198.23.145.82
  198.23.148.137
-198.23.156.170
  198.23.167.28
  198.23.170.77
  198.23.170.81
@@ -62292,6 +52053,7 @@
  198.23.172.169
  198.23.173.157
  198.23.173.254
+198.23.174.135
  198.23.174.137
  198.23.174.138
  198.23.174.151
@@ -62312,11 +52074,12 @@
  198.23.206.131
  198.23.206.134
  198.23.206.135
+198.23.211.42
  198.23.212.138
+198.23.212.86
  198.23.212.90
  198.23.213.30
  198.23.213.57
-198.23.214.20
  198.23.216.244
  198.23.217.200
  198.23.217.205
@@ -62329,13 +52092,12 @@
  198.23.235.218
  198.23.236.144
  198.23.238.15
+198.23.238.16
  198.23.238.179
  198.23.238.182
  198.23.238.186
  198.23.238.38
  198.23.238.39
-198.23.239.102
-198.23.242.210
  198.23.247.171
  198.23.57.226
  198.23.60.180
@@ -62343,7 +52105,6 @@
  198.23.71.118
  198.24.131.83
  198.24.149.162
-198.245.175.19
  198.245.49.14
  198.245.49.215
  198.245.49.22
@@ -62356,7 +52117,6 @@
  198.245.61.119
  198.245.62.147
  198.245.62.228
-198.245.63.184
  198.245.67.57
  198.245.67.58
  198.245.67.59
@@ -62371,22 +52131,22 @@
  198.245.72.87
  198.245.75.78
  198.251.81.249
-198.251.82.109
  198.251.83.193
  198.251.83.248
  198.251.84.216
  198.251.89.198
  198.251.89.80
  198.252.110.55
+198.254.168.139
  198.255.92.170
  198.27.108.198
-198.27.108.202
  198.27.118.5
  198.27.123.127
  198.27.235.185
  198.27.64.100
  198.27.66.144
  198.27.66.37
+198.27.67.87
  198.27.68.223
  198.27.68.80
  198.27.70.45
@@ -62400,47 +52160,39 @@
  198.27.83.13
  198.27.83.210
  198.27.83.216
-198.27.89.7
  198.27.90.106
  198.27.96.183
  198.35.47.13
  198.36.28.88
-198.36.31.124
-198.36.31.135
  198.37.153.204
  198.38.82.127
-198.38.85.88
  198.38.92.65
-198.40.56.50
  198.41.85.5
  198.44.0.158
+198.44.163.64
  198.44.188.154
-198.44.191.149
  198.44.66.59
-198.46.131.179
-198.46.132.213
  198.46.138.98
  198.46.149.165
  198.46.158.43
  198.46.159.20
  198.46.168.25
-198.46.173.13
+198.46.176.16
+198.46.184.8
  198.46.185.88
  198.46.189.157
  198.46.193.232
  198.46.194.140
  198.46.198.115
  198.46.199.73
-198.46.201.190
-198.46.201.198
  198.46.202.121
  198.46.203.162
  198.46.203.254
  198.46.203.37
-198.46.203.54
  198.46.205.78
  198.46.205.89
  198.46.209.159
+198.46.222.30
  198.46.223.23
  198.46.226.110
  198.46.226.112
@@ -62452,17 +52204,13 @@
  198.46.226.98
  198.46.226.99
  198.46.232.249
-198.46.234.185
  198.46.235.119
-198.46.236.180
  198.46.249.206
  198.46.81.12
  198.46.81.34
  198.46.82.25
  198.48.138.149
-198.48.171.211
  198.48.204.250
-198.48.223.179
  198.48.225.88
  198.48.246.47
  198.49.68.101
@@ -62491,13 +52239,11 @@
  198.50.186.212
  198.50.189.124
  198.50.192.36
-198.50.195.42
  198.50.196.140
  198.50.212.177
  198.50.212.208
  198.50.212.209
  198.50.222.102
-198.50.223.185
  198.50.234.102
  198.50.234.106
  198.50.234.107
@@ -62508,7 +52254,6 @@
  198.52.119.103
  198.52.122.180
  198.52.128.195
-198.53.66.67
  198.54.112.110
  198.54.112.38
  198.54.112.86
@@ -62549,6 +52294,7 @@
  198.71.226.21
  198.71.226.24
  198.71.226.54
+198.71.227.14
  198.71.227.45
  198.71.227.47
  198.71.227.55
@@ -62556,20 +52302,21 @@
  198.71.228.14
  198.71.228.28
  198.71.228.33
-198.71.228.40
  198.71.228.43
  198.71.228.63
  198.71.230.15
+198.71.230.19
  198.71.230.47
  198.71.230.52
  198.71.230.65
+198.71.231.21
+198.71.231.29
  198.71.231.31
  198.71.231.35
  198.71.231.4
  198.71.231.76
  198.71.234.33
  198.71.235.21
-198.71.235.66
  198.71.235.70
  198.71.235.71
  198.71.236.12
@@ -62578,17 +52325,20 @@
  198.71.236.32
  198.71.236.46
  198.71.236.76
+198.71.236.82
+198.71.236.86
  198.71.237.10
  198.71.237.24
  198.71.237.9
-198.71.238.11
  198.71.238.14
+198.71.238.16
  198.71.238.17
  198.71.238.18
  198.71.238.19
-198.71.238.20
+198.71.238.2
  198.71.238.21
  198.71.238.22
+198.71.238.23
  198.71.238.3
  198.71.238.4
  198.71.238.6
@@ -62598,17 +52348,23 @@
  198.71.239.13
  198.71.239.14
  198.71.239.15
+198.71.239.17
  198.71.239.20
+198.71.239.25
  198.71.239.26
+198.71.239.30
+198.71.239.31
  198.71.239.33
+198.71.239.34
+198.71.239.35
  198.71.239.36
  198.71.239.39
  198.71.239.40
  198.71.239.41
-198.71.239.42
  198.71.239.44
  198.71.239.46
-198.71.239.49
+198.71.239.50
+198.71.239.51
  198.71.239.7
  198.71.240.2
  198.71.240.42
@@ -62629,33 +52385,23 @@
  198.74.53.87
  198.74.58.104
  198.74.59.21
-198.74.62.68
  198.8.85.230
-198.8.94.170
  198.84.175.4
-198.84.181.176
  198.89.92.162
  198.89.97.193
  198.89.97.196
-198.91.176.181
  198.96.155.3
  198.96.95.143
  198.96.95.145
  198.96.95.65
+198.98.208.64
  198.98.48.123
  198.98.48.175
-198.98.48.228
-198.98.48.7
  198.98.49.178
-198.98.49.180
  198.98.49.187
-198.98.49.198
  198.98.50.112
-198.98.51.138
  198.98.51.151
  198.98.51.16
-198.98.51.196
-198.98.51.197
  198.98.51.240
  198.98.52.119
  198.98.52.155
@@ -62666,7 +52412,6 @@
  198.98.54.170
  198.98.54.215
  198.98.54.241
-198.98.54.48
  198.98.55.164
  198.98.55.168
  198.98.55.95
@@ -62675,16 +52420,11 @@
  198.98.57.177
  198.98.57.217
  198.98.57.234
-198.98.57.49
  198.98.58.178
  198.98.58.66
-198.98.58.69
-198.98.58.84
  198.98.59.197
-198.98.59.50
  198.98.60.90
  198.98.61.131
-198.98.61.236
  198.98.61.32
  198.98.61.36
  198.98.61.43
@@ -62697,10 +52437,12 @@
  198663092739365.cf
  199.101.103.20
  199.101.127.168
+199.102.105.241
  199.102.224.190
  199.115.101.178
  199.115.117.118
  199.115.117.70
+199.115.161.180
  199.115.202.1
  199.115.203.1
  199.115.205.83
@@ -62743,7 +52485,6 @@
  199.180.134.167
  199.182.184.204
  199.187.124.83
-199.187.141.203
  199.187.211.100
  199.187.211.101
  199.187.211.104
@@ -62751,6 +52492,7 @@
  199.187.211.106
  199.187.211.107
  199.187.211.99
+199.187.249.211
  199.187.28.190
  199.187.28.193
  199.187.28.197
@@ -62765,6 +52507,7 @@
  199.188.103.69
  199.188.103.74
  199.188.103.75
+199.188.201.227
  199.188.204.174
  199.188.204.25
  199.188.204.4
@@ -62790,6 +52533,7 @@
  199.19.225.212
  199.192.121.53
  199.192.16.206
+199.192.16.253
  199.192.18.162
  199.192.20.201
  199.192.211.30
@@ -62797,13 +52541,10 @@
  199.192.27.170
  199.192.28.11
  199.192.31.96
-199.193.183.180
  199.193.6.182
  199.195.144.111
  199.195.192.248
-199.195.248.138
  199.195.248.174
-199.195.249.137
  199.195.249.82
  199.195.250.148
  199.195.250.170
@@ -62811,14 +52552,8 @@
  199.195.251.110
  199.195.251.207
  199.195.251.227
-199.195.251.55
-199.195.251.74
  199.195.251.84
-199.195.252.105
  199.195.252.137
-199.195.252.198
-199.195.252.200
-199.195.254.13
  199.195.254.209
  199.195.254.254
  199.195.254.81
@@ -62833,13 +52568,13 @@
  199.204.45.6
  199.21.113.251
  199.21.99.200
+199.217.104.237
  199.217.104.240
  199.217.115.189
  199.217.117.134
  199.217.117.211
  199.217.119.221
  199.223.236.90
-199.229.238.69
  199.229.250.50
  199.229.250.94
  199.231.166.210
@@ -62847,15 +52582,10 @@
  199.231.189.99
  199.231.240.25
  199.233.246.195
-199.241.139.179
-199.241.139.9
  199.241.145.219
-199.242.29.88
-199.243.205.47
  199.247.15.234
  199.247.18.42
  199.247.24.116
-199.247.247.174
  199.247.26.75
  199.247.29.89
  199.247.3.79
@@ -62875,13 +52605,11 @@
  199.249.230.100
  199.249.230.101
  199.249.230.102
-199.249.230.103
  199.249.230.104
  199.249.230.106
  199.249.230.108
  199.249.230.110
  199.249.230.112
-199.249.230.113
  199.249.230.114
  199.249.230.115
  199.249.230.116
@@ -62917,13 +52645,10 @@
  199.249.230.162
  199.249.230.163
  199.249.230.164
-199.249.230.165
  199.249.230.166
  199.249.230.168
-199.249.230.169
  199.249.230.170
  199.249.230.172
-199.249.230.173
  199.249.230.174
  199.249.230.175
  199.249.230.177
@@ -62963,13 +52688,12 @@
  199.249.230.87
  199.249.230.88
  199.249.230.89
+199.250.188.204
  199.250.194.83
-199.255.119.11
  199.255.96.233
-199.30.185.127
  199.34.16.230
  199.34.78.210
-199.38.243.111
+199.36.213.39
  199.4.18.206
  199.48.147.141
  199.48.92.184
@@ -62977,10 +52701,8 @@
  199.58.86.206
  199.58.86.209
  199.58.86.211
-199.60.103.31
+199.66.112.78
  199.66.68.144
-199.66.88.28
-199.66.92.227
  199.68.196.66
  199.76.13.106
  199.76.38.123
@@ -63016,8 +52738,8 @@
  199.83.207.95
  199.87.154.255
  199.89.54.108
-199.91.228.178
  199.96.83.117
+199.96.83.27
  1990.duckdns.org
  1991ford-mustang-rover-ebay-item235464554423432.nominatedayending.xyz
  199231184302.us-south.cf.appdomain.cloud
@@ -63209,6 +52931,7 @@
  1tbuortfa1t.bankofamericaslpemr.com
  1tdcanada.com
  1team.es
+1teename.com
  1tinhlachiem.000webhostapp.com
  1ubofau1.banouter.com
  1ubuofa1u.bankofamericaslpemr.com
@@ -63248,14 +52971,12 @@
  2.104.14.161
  2.104.72.24
  2.112.240.141
-2.115.195.178
  2.117.184.131
  2.123.156.227
+2.124.184.117
  2.132.102.224
-2.132.249.34
  2.132.91.60
  2.133.61.161
-2.134.90.156
  2.136.179.77
  2.136.95.251
  2.137.162.255
@@ -63265,9 +52986,9 @@
  2.138.140.65
  2.138.62.79
  2.138.80.54
+2.138.83.41
  2.138.85.131
-2.138.87.177
-2.139.155.90
+2.139.1.139
  2.139.162.80
  2.139.172.148
  2.139.189.242
@@ -63277,135 +52998,93 @@
  2.139.252.47
  2.139.69.101
  2.144.230.229
-2.144.242.210
  2.144.243.102
-2.144.244.212
  2.144.245.78
-2.153.129.64
+2.152.82.127
  2.154.144.228
-2.176.243.11
+2.155.115.251
+2.176.232.204
  2.177.190.191
  2.177.94.33
  2.178.255.157
  2.179.164.112
  2.179.247.236
-2.180.11.55
  2.180.29.55
-2.181.179.55
  2.182.99.72
+2.183.8.145
  2.184.4.3
  2.184.52.194
  2.184.52.204
-2.186.126.36
-2.187.100.151
  2.187.101.1
  2.187.107.15
-2.187.112.1
  2.187.18.194
-2.187.210.55
-2.189.216.212
+2.187.237.182
  2.190.29.104
+2.191.195.198
+2.191.90.195
+2.192.1.32
  2.192.66.216
-2.195.234.4
-2.196.138.234
  2.200.199.171
  2.200.83.70
+2.201.149.143
  2.201.149.223
-2.201.149.96
  2.202.112.81
  2.203.180.208
-2.205.48.20
  2.217.44.77
  2.217.45.18
-2.218.115.113
  2.218.193.131
-2.220.235.50
  2.224.246.80
-2.225.249.9
-2.226.135.239
-2.226.179.79
-2.228.163.157
  2.228.87.194
  2.228.87.82
  2.229.122.100
-2.229.123.30
-2.229.16.100
  2.229.214.152
  2.229.239.77
+2.229.94.237
  2.230.178.184
  2.230.19.211
-2.230.196.171
-2.231.31.70
  2.232.248.6
-2.232.248.99
  2.232.250.91
-2.232.252.73
  2.233.125.227
-2.233.126.24
  2.233.236.201
  2.234.122.191
-2.234.154.2
-2.235.159.160
-2.236.140.22
-2.237.29.22
  2.237.76.249
  2.238.115.47
  2.238.147.10
  2.238.18.160
  2.238.192.200
-2.243.46.190
+2.24.212.96
+2.243.122.144
  2.244.132.99
  2.244.184.48
  2.244.44.209
  2.247.245.251
-2.247.246.32
-2.249.168.27
-2.249.177.101
-2.3.11.104
-2.30.116.253
+2.3.229.42
  2.31.165.246
-2.35.150.233
-2.35.178.187
-2.35.240.145
  2.37.111.40
  2.37.187.249
  2.38.152.84
  2.38.2.58
-2.38.214.35
  2.38.99.79
-2.39.121.54
  2.39.173.126
-2.39.33.240
  2.42.173.240
-2.42.185.164
-2.42.196.30
  2.44.166.148
  2.44.200.81
  2.44.245.127
-2.45.100.120
  2.45.179.5
  2.45.185.2
-2.47.127.229
  2.47.139.162
-2.47.198.217
-2.47.54.201
  2.49.59.161
  2.4buyuklergazete.com
-2.50.153.133
  2.50.159.186
-2.50.16.117
-2.50.170.143
  2.50.54.193
-2.50.8.199
  2.51.114.149
  2.51.26.64
-2.56.121.154
+2.55.92.107
+2.56.101.149
  2.56.139.208
-2.56.168.201
-2.56.168.213
  2.56.8.123
  2.56.8.13
-2.56.98.125
+2.56.8.156
  2.56.99.239
  2.57.121.109
  2.57.121.111
@@ -63413,12 +53092,12 @@
  2.57.122.109
  2.57.122.167
  2.57.122.186
-2.57.122.190
  2.57.122.195
  2.57.122.196
-2.57.122.201
  2.57.122.210
  2.57.122.214
+2.57.122.215
+2.57.122.216
  2.57.122.219
  2.57.122.223
  2.57.122.241
@@ -63426,47 +53105,38 @@
  2.57.122.247
  2.57.122.248
  2.57.122.249
+2.57.122.250
  2.57.19.154
-2.57.87.220
-2.57.91.143
+2.57.91.110
  2.58.12.170
  2.58.12.175
+2.58.12.193
  2.58.12.43
  2.58.12.44
  2.58.16.86
  2.58.16.89
-2.58.228.117
-2.59.119.42
-2.59.151.109
  2.6.185.246
  2.61.143.10
  2.61.151.166
  2.61.185.5
  2.61.209.37
-2.62.227.16
-2.64.23.213
+2.62.224.77
  2.7.248.51
-2.80.144.219
  2.80.239.168
-2.81.219.150
+2.80.46.35
  2.81.90.43
  2.82.170.124
  2.82.175.119
+2.82.198.38
  2.82.75.215
-2.83.106.233
  2.84.232.100
-2.84.9.192
-2.85.32.15
-2.87.156.101
-2.88.9.32
+2.88.55.70
  2.89.37.143
  2.89.82.192
-2.92.210.73
+2.90.219.196
  2.92.39.39
  2.92.51.124
  2.95.11.42
-2.95.232.205
-2.95.59.113
  2.96.36.182
  2.99.127.248
  2.gabung-grup-whatsapp.getsviip7.com
@@ -63478,32 +53148,26 @@
  20-186-64-56.cprapid.com
  20-31-102-75.com
  20-groups.cf
-20.140.186.125
  20.151.19.163
  20.151.2.8
-20.151.20.29
  20.184.15.116
+20.185.150.144
  20.185.247.149
  20.185.39.51
  20.186.110.157
  20.186.32.122
-20.186.65.192
  20.186.72.33
  20.188.107.54
  20.188.108.164
-20.188.212.179
  20.188.44.31
-20.188.45.91
  20.188.60.188
  20.194.200.87
  20.194.24.86
  20.194.41.206
  20.194.47.201
  20.194.50.237
-20.195.184.56
  20.195.56.104
  20.195.56.55
-20.195.9.179
  20.36.46.115
  20.37.252.115
  20.37.50.97
@@ -63528,49 +53192,39 @@
  20.49.186.22
  20.4buyuklergazete.com
  20.50.114.95
-20.51.214.254
-20.51.221.172
  20.51.228.76
  20.52.133.134
  20.52.155.148
-20.52.156.100
-20.52.157.219
-20.52.233.214
+20.52.40.32
  20.52.55.4
-20.55.25.62
  20.55.26.138
  20.55.56.114
-20.57.136.162
-20.57.33.82
+20.57.10.194
  20.58.48.57
  20.62.40.13
  20.63.72.46
  20.64.137.33
  20.64.157.95
  20.67.82.14
+20.70.136.105
  20.71.103.224
  20.71.181.237
  20.71.218.196
  20.71.224.189
  20.71.31.218
-20.71.63.126
  20.72.208.156
  20.73.52.5
-20.73.56.138
-20.75.72.160
  20.80.72.80
  20.80.80.9
  200-365.net
  200.0.118.29
-200.0.226.124
  200.0.40.166
  200.0.46.50
-200.10.132.117
  200.10.37.10
+200.10.37.107
+200.10.37.12
  200.10.37.122
-200.10.37.209
  200.10.37.210
-200.10.37.211
  200.10.37.223
  200.10.37.5
  200.10.37.59
@@ -63580,16 +53234,15 @@
  200.101.9.195
  200.103.16.43
  200.103.39.110
+200.104.147.51
  200.105.144.202
  200.105.157.218
-200.105.169.181
  200.105.174.20
  200.105.179.250
  200.105.183.118
  200.105.201.198
  200.105.209.170
  200.105.212.205
-200.105.215.18
  200.105.242.58
  200.105.74.140
  200.106.147.35
@@ -63603,27 +53256,22 @@
  200.108.143.6
  200.108.196.108
  200.108.196.110
-200.109.112.50
  200.109.58.183
  200.11.136.198
-200.11.241.44
  200.110.176.121
  200.111.101.242
-200.111.110.218
  200.111.120.180
-200.111.133.69
  200.111.167.170
  200.111.182.6
  200.111.197.34
  200.112.228.211
  200.113.106.18
-200.113.62.243
  200.114.116.178
  200.114.142.40
-200.114.175.90
  200.115.157.211
  200.115.48.82
  200.115.53.225
+200.115.56.139
  200.116.145.225
  200.116.175.40
  200.116.188.62
@@ -63632,19 +53280,15 @@
  200.116.198.140
  200.116.198.160
  200.116.198.177
-200.116.211.138
  200.116.3.133
  200.116.47.247
-200.117.144.248
-200.117.185.116
+200.118.122.6
  200.118.57.190
  200.118.57.238
  200.119.112.204
  200.119.125.194
  200.119.204.19
  200.119.40.13
-200.119.46.228
-200.119.55.71
  200.119.85.93
  200.121.128.64
  200.121.169.156
@@ -63652,13 +53296,10 @@
  200.122.181.2
  200.122.225.34
  200.122.249.203
-200.122.70.33
+200.122.77.221
  200.123.101.90
-200.123.142.244
-200.123.150.39
  200.123.150.89
  200.123.2.171
-200.123.208.29
  200.123.232.185bin.sh
  200.123.232.219bin.sh
  200.123.232.93
@@ -63667,23 +53308,20 @@
  200.123.233.10bin.sh
  200.123.233.170bin.sh
  200.123.233.33bin.sh
+200.123.50.44
  200.124.191.230
  200.124.243.62
  200.125.44.242
-200.126.160.225
-200.126.84.105
+200.126.197.211
  200.127.1.233
  200.127.14.97
-200.127.223.47
  200.128.62.2
  200.13.160.125
  200.13.253.154
-200.132.39.29
-200.133.12.61
+200.133.3.253
  200.133.38.233
  200.133.39.84
  200.135.228.230
-200.136.225.9
  200.137.5.195
  200.140.44.243
  200.140.44.244
@@ -63694,8 +53332,6 @@
  200.142.120.90
  200.142.98.115
  200.143.183.141
-200.144.254.191
-200.146.221.97
  200.146.227.146
  200.146.229.129
  200.146.236.217
@@ -63705,22 +53341,23 @@
  200.146.46.198
  200.146.75.58
  200.147.153.131
+200.147.166.24
  200.148.25.132
-200.149.1.106
  200.149.130.18
  200.149.214.6
  200.149.232.242
  200.149.244.202
  200.150.114.227
  200.150.121.212
-200.150.122.27
+200.150.122.46
  200.150.162.136
  200.150.77.238
  200.150.77.93
  200.150.86.130
  200.150.86.138
+200.152.100.173
+200.152.104.81
  200.152.49.163
-200.152.70.103
  200.152.78.48
  200.155.181.198
  200.155.188.173
@@ -63732,14 +53369,12 @@
  200.159.105.20
  200.159.131.50
  200.159.156.26
-200.159.224.122
  200.159.250.2
  200.159.91.130
  200.160.152.202
  200.162.128.211
  200.162.171.247
  200.163.38.163
-200.164.85.245
  200.165.142.90
  200.165.165.6
  200.165.79.34
@@ -63747,8 +53382,6 @@
  200.169.218.172
  200.17.13.3
  200.17.171.1
-200.170.127.34
-200.170.250.162
  200.171.241.71
  200.174.158.26
  200.175.104.103
@@ -63756,33 +53389,25 @@
  200.175.180.116
  200.175.185.54
  200.175.239.226
-200.178.119.18
  200.178.251.146
  200.182.18.82
  200.186.127.210
  200.187.127.8
-200.187.154.162
  200.187.164.149
  200.187.169.12
  200.188.154.9
  200.188.157.3
-200.188.19.31
-200.188.19.33
-200.188.6.177
  200.19.254.179
  200.192.131.74
  200.192.212.131
-200.193.101.106
  200.193.152.216
  200.194.41.208
  200.195.136.12
  200.195.148.18
  200.195.156.242
-200.195.157.170
  200.195.55.186
  200.195.85.142
  200.196.249.170
-200.198.185.229
  200.198.220.158
  200.198.46.15
  200.199.114.226
@@ -63790,41 +53415,34 @@
  200.199.8.113
  200.199.8.114
  200.199.8.118
-200.2.127.154
-200.2.182.114
-200.2.182.185
-200.2.197.2
+200.20.186.254
  200.201.180.130
  200.203.104.18
  200.203.123.32
  200.203.123.34
-200.203.125.170
  200.203.126.15
  200.203.239.188
  200.204.150.216
-200.204.166.143
  200.204.174.163
-200.205.174.66
+200.206.16.105
  200.206.63.34
  200.206.81.154
-200.207.148.135
  200.207.169.7
-200.208.104.114
  200.21.51.38
  200.212.2.125
  200.212.2.70
  200.212.2.80
  200.212.2.88
  200.212.2.94
+200.216.159.230
  200.216.193.138
  200.216.239.231
  200.216.31.148
  200.216.77.154
+200.217.153.246
  200.217.168.98
  200.217.191.130
  200.219.207.42
-200.219.77.150
-200.219.94.56
  200.220.202.1
  200.222.137.202
  200.222.29.10
@@ -63836,10 +53454,9 @@
  200.229.147.1
  200.229.147.112
  200.229.227.201
+200.229.252.82
  200.229.90.210
-200.232.134.224
  200.232.72.50
-200.232.95.33
  200.233.136.249
  200.233.147.38
  200.233.163.65
@@ -63871,8 +53488,8 @@
  200.24.84.78
  200.240.244.7
  200.240.250.92
+200.241.39.37
  200.243.153.66
-200.243.21.50
  200.248.72.99
  200.252.208.2
  200.252.208.35
@@ -63884,33 +53501,26 @@
  200.27.18.138
  200.27.18.242
  200.27.212.22
-200.27.71.123
  200.29.10.15
  200.29.105.12
  200.29.109.112
  200.29.109.193
-200.29.111.182
  200.29.120.94
-200.29.132.211
  200.29.139.11
-200.29.143.125
  200.29.176.174
  200.29.191.151
  200.29.248.57
  200.29.254.1
  200.29.90.110
-200.30.73.141
  200.31.122.174
  200.31.16.164
  200.31.164.82
  200.31.19.206
-200.31.22.170
  200.31.81.25
  200.31.99.35
  200.33.152.207
  200.34.227.204
  200.35.145.133
-200.35.43.57
  200.35.49.50
  200.35.49.57
  200.35.49.89
@@ -63919,21 +53529,19 @@
  200.37.108.195
  200.37.176.156
  200.37.200.178
-200.37.202.19
+200.37.231.66
  200.37.241.185
  200.37.3.10
  200.38.232.248
  200.38.79.134
  200.39.22.86
-200.39.241.64
  200.40.86.142
  200.41.121.69
  200.41.182.243
  200.41.79.230
  200.41.86.59
-200.42.153.216
  200.42.174.109
-200.42.176.45
+200.42.24.98
  200.44.158.226
  200.44.50.155
  200.45.147.129
@@ -63941,9 +53549,6 @@
  200.46.22.187
  200.46.235.146
  200.46.252.35
-200.46.29.26
-200.46.45.114
-200.48.108.211
  200.48.129.124
  200.48.210.5
  200.48.37.66
@@ -63953,51 +53558,44 @@
  200.5.251.4
  200.5.251.6
  200.5.32.217
+200.50.193.211
  200.51.94.251
  200.52.140.145
  200.52.140.148
  200.52.144.170
  200.52.221.17
-200.52.221.18
-200.52.228.26
  200.52.80.34
  200.53.216.153
  200.53.217.25
  200.54.108.54
-200.54.167.253
  200.54.170.198
-200.54.171.218
  200.54.183.234
-200.54.218.188
  200.54.221.202
  200.54.247.98
  200.54.51.124
  200.54.56.107
  200.54.56.108
-200.54.66.75
  200.54.72.148
  200.54.78.178
-200.54.78.218
  200.55.140.181
-200.55.198.66
  200.55.208.196
  200.55.237.117
  200.55.243.138
  200.55.25.75
  200.56.17.5
  200.56.60.157
-200.56.96.167
  200.57.102.71
  200.57.8.74
-200.58.160.242
+200.58.118.226
+200.58.118.51
+200.58.118.89
+200.58.119.34
  200.58.171.51
-200.58.77.48
  200.58.83.144
  200.58.83.179
  200.58.86.27
  200.58.98.49
  200.59.6.174
-200.59.82.251
  200.6.122.228
  200.6.168.67
  200.6.168.86
@@ -64007,103 +53605,80 @@
  200.6.170.82
  200.6.175.10
  200.6.250.235
-200.6.48.253
  200.60.132.181
  200.60.146.5
-200.60.71.10
-200.60.71.14
-200.60.78.174
  200.60.79.11
+200.60.89.129
  200.60.97.194
  200.60.97.196
-200.61.181.65
  200.61.185.200
-200.62.99.4
+200.62.146.174
+200.66.116.3
+200.66.122.62
+200.66.124.153
  200.66.77.178
  200.68.13.26
  200.68.230.193
  200.68.230.197
-200.68.38.30
-200.68.49.184
  200.68.74.178
  200.68.8.77
  200.68.87.164
-200.69.102.223
-200.69.146.234
+200.69.141.210
  200.69.224.73
-200.69.236.172
  200.69.77.172
-200.69.77.34
  200.69.81.10
  200.69.81.198
  200.69.83.54
  200.69.87.109
-200.69.95.74
  200.7.102.76
  200.7.118.10
  200.7.149.112
+200.7.193.229
  200.7.197.65
  200.7.197.66
  200.7.197.68
  200.7.198.66
-200.7.219.137
  200.7.252.118
-200.7.88.52
  200.7.98.102
  200.70.22.77
  200.70.56.204
  200.71.122.54
-200.71.190.205
-200.71.237.250
  200.71.72.14
  200.71.72.201
  200.71.72.234
  200.71.72.245
  200.71.73.222
  200.71.73.242
-200.72.158.6
  200.73.128.100
  200.73.128.114
  200.73.128.116
-200.73.128.130
  200.73.128.148
  200.73.128.173
  200.73.128.175
-200.73.128.181
  200.73.128.183
  200.73.128.252
  200.73.128.45
  200.73.128.64
  200.73.129.102
-200.73.129.163
-200.73.129.195
  200.73.129.33
-200.73.129.34
  200.73.129.37
-200.73.129.44
  200.73.130.156
-200.73.130.160
  200.73.130.226
  200.73.131.100
  200.73.131.176
-200.73.131.186
  200.73.131.239
  200.73.131.6
-200.73.131.94
  200.73.132.115
-200.73.132.127
  200.73.132.67
  200.73.157.138
  200.73.35.195
+200.74.194.83
  200.74.243.12
  200.75.222.198
  200.75.241.206
-200.75.249.38
-200.75.253.218
  200.75.45.67
  200.75.48.85
  200.76.189.213
-200.77.160.107
  200.77.186.161
  200.77.186.170
  200.77.186.177
@@ -64121,8 +53696,6 @@
  200.77.186.218
  200.77.186.219
  200.8.127.73
-200.8.139.107
-200.8.178.74
  200.8.18.62
  200.80.163.218
  200.80.22.47
@@ -64137,7 +53710,6 @@
  200.81.147.1
  200.82.170.231
  200.83.118.26
-200.83.133.77
  200.83.166.136
  200.83.178.229
  200.83.202.237
@@ -64151,15 +53723,13 @@
  200.85.137.44
  200.85.139.9
  200.85.169.18
-200.85.63.46
  200.85.95.234
  200.87.116.14
  200.87.116.213
  200.87.180.226
-200.87.202.162
  200.87.233.68
  200.87.28.114
-200.87.43.178
+200.88.117.22
  200.88.162.196
  200.88.172.229
  200.88.48.99
@@ -64171,25 +53741,23 @@
  200.89.159.240
  200.89.174.105
  200.89.174.209
-200.89.174.243
  200.89.178.19
  200.89.178.208
  200.89.178.212
  200.89.178.217
+200.89.178.79
  200.89.99.226
-200.9.155.198
+200.90.11.98
  200.90.8.86
  200.90.8.90
  200.91.160.238
-200.91.27.230
  200.92.226.50
+200.93.14.43
  200.93.147.154
  200.93.148.14
  200.93.162.51
  200.93.248.10
  200.94.140.50
-200.94.147.244
-200.95.184.2
  200.96.49.76
  200.97.148.167
  200.97.64.90
@@ -64199,15 +53767,11 @@
  200.98.1.212
  200.98.1.236
  200.98.1.90
-200.98.136.44
-200.98.138.102
  200.98.163.13
-200.98.200.218
  200.98.200.78
  200.98.4.116
  200.98.4.119
  200.98.4.207
-200.98.64.68
  2000526.com
  2000kumdo.com
  2000tours.com
@@ -64219,38 +53783,24 @@
  2009sanchezsupplicate.com
  201.103.144.79
  201.103.208.126
-201.103.50.210
-201.103.85.230
-201.105.155.35
  201.106.32.171
-201.108.118.5
-201.108.168.114
+201.108.206.0
  201.108.245.51
-201.11.70.28
-201.110.190.124
-201.110.34.191
-201.110.8.37
-201.111.53.137
  201.116.184.243
  201.116.194.210
  201.116.227.194
  201.116.52.104
-201.117.138.69
  201.122.102.21
-201.122.180.91
  201.122.212.15
-201.122.212.30
  201.123.180.9
-201.123.98.203
  201.128.204.26
  201.130.79.47
  201.131.126.17
+201.131.180.195
  201.131.180.59
-201.131.185.2
  201.131.244.44
  201.131.38.208
  201.134.205.138
-201.137.143.43
  201.139.126.118
  201.139.127.6
  201.139.75.6
@@ -64259,34 +53809,34 @@
  201.14.128.223
  201.140.103.33
  201.140.105.182
-201.140.108.146
  201.140.110.78
  201.140.176.114
  201.141.53.87
+201.143.177.214
  201.143.240.82
  201.143.32.82
-201.143.57.24
-201.143.98.29
  201.144.122.243
-201.144.20.130
  201.144.206.244
  201.144.234.22
-201.144.235.49
  201.144.51.200
  201.145.155.26
-201.145.235.54
  201.146.3.72
  201.147.144.89
  201.148.126.202
  201.148.126.38
  201.148.127.57
-201.148.246.202
+201.148.246.109
+201.148.246.204
+201.148.246.251
+201.148.246.41
+201.148.247.17
+201.148.247.243
+201.148.247.82
  201.148.71.65
  201.149.119.133
  201.149.20.161
  201.149.26.51
  201.149.3.102
-201.149.34.177
  201.149.44.237
  201.149.49.146
  201.149.49.162
@@ -64298,11 +53848,10 @@
  201.155.182.49
  201.155.192.248
  201.157.194.106
-201.157.255.163
  201.158.106.71
-201.158.48.14
  201.159.112.70
  201.159.179.164
+201.159.74.147
  201.159.95.101
  201.159.95.105
  201.159.95.113
@@ -64312,7 +53861,6 @@
  201.159.95.94
  201.16.179.121
  201.16.203.147
-201.16.206.100
  201.16.228.170
  201.161.223.150
  201.161.37.93
@@ -64325,7 +53873,6 @@
  201.163.74.203
  201.163.98.162
  201.164.220.56
-201.165.213.51
  201.165.215.183
  201.165.52.129
  201.166.149.154
@@ -64333,14 +53880,15 @@
  201.166.154.228
  201.166.199.205
  201.167.56.18
+201.168.210.118
  201.17.130.156
  201.17.210.49
-201.170.1.88
-201.170.246.227
+201.17.211.242
  201.171.150.41
  201.171.227.59
  201.171.244.130
  201.172.77.247
+201.172.86.223
  201.172.89.164
  201.172.92.101
  201.172.92.141
@@ -64351,41 +53899,27 @@
  201.173.64.98
  201.173.74.158
  201.173.92.212
-201.174.109.130
-201.174.12.134
-201.174.12.186
  201.174.122.29
  201.174.123.242
-201.174.127.62
-201.174.134.196
  201.174.182.158
-201.174.185.26
-201.174.28.235
-201.174.53.130
  201.175.113.237
  201.175.17.129
  201.175.73.218
-201.176.119.141
-201.176.203.43
-201.179.139.211
+201.176.234.57
+201.176.30.3
  201.179.99.174
-201.18.16.214
-201.18.237.254
  201.18.88.150
  201.182.120.230
  201.182.150.45
  201.182.180.28
  201.182.214.166
  201.182.66.18
-201.182.69.85
  201.182.88.10
  201.182.88.13
  201.182.88.2
  201.182.88.93
  201.182.91.15
  201.183.224.39
-201.183.225.114
-201.183.225.59
  201.183.239.5
  201.184.105.242
  201.184.128.134
@@ -64397,23 +53931,18 @@
  201.184.162.58
  201.184.175.90
  201.184.188.122
+201.184.241.243
  201.184.244.186
  201.184.250.170
-201.184.43.206
  201.184.75.210
-201.186.13.184
  201.187.103.18
-201.187.106.222
-201.187.40.102
+201.189.202.46
  201.189.52.10
  201.190.184.22
  201.191.42.39
  201.192.136.240
-201.192.138.219
-201.192.141.95
  201.193.180.14
  201.196.15.79
-201.196.17.50
  201.196.89.88
  201.199.93.54
  201.2.149.172
@@ -64436,56 +53965,43 @@
  201.204.46.10
  201.207.53.62
  201.208.29.217
-201.21.221.80
+201.209.78.118
  201.211.136.12
  201.211.227.208
  201.211.230.145
  201.211.31.45
-201.212.134.94
-201.212.216.79
-201.212.245.215
+201.212.120.187
  201.212.29.93
  201.213.177.139
  201.213.231.77
  201.213.32.59
  201.214.92.26
  201.215.208.78
-201.216.110.186
-201.216.110.67
  201.216.197.229
-201.216.217.25
  201.216.222.155
-201.216.26.18
  201.217.143.51
  201.217.159.155
-201.217.220.26
  201.217.245.229
  201.217.4.101
  201.217.51.246
  201.217.51.9
  201.217.55.97
  201.217.71.122
+201.218.108.46
  201.218.125.149
-201.218.202.198
-201.218.207.58
  201.218.228.226
  201.218.237.98
-201.218.85.233
  201.219.197.138
  201.219.197.50
  201.219.208.42
  201.219.216.132
  201.219.217.70
-201.219.220.205
-201.22.231.42
  201.22.94.210
  201.22.95.52
  201.220.138.42
  201.220.140.6
  201.221.133.86
  201.221.134.74
-201.221.158.193
-201.221.187.134
  201.222.48.115
  201.222.48.42
  201.222.55.238
@@ -64496,14 +54012,12 @@
  201.229.250.74
  201.23.89.66
  201.230.169.75
-201.230.244.16
  201.230.29.84
-201.231.111.53
  201.232.54.48
-201.234.119.98
  201.234.204.140
  201.234.224.223
  201.234.227.221
+201.234.237.156
  201.234.238.10
  201.234.253.3
  201.234.66.133
@@ -64512,12 +54026,8 @@
  201.235.19.122
  201.236.1.51
  201.236.134.154
-201.236.134.230
-201.236.139.242
  201.236.143.243
-201.236.160.142
  201.236.200.242
-201.237.231.196
  201.238.174.182
  201.238.181.231
  201.238.181.7
@@ -64526,22 +54036,17 @@
  201.238.239.51
  201.24.199.23
  201.241.127.190
-201.241.208.64
-201.242.240.50
  201.243.233.85
-201.243.65.147
-201.244.0.47
-201.244.0.78
  201.244.141.167
-201.244.155.6
  201.244.213.9
  201.244.214.162
-201.245.163.176
+201.246.234.230
  201.247.41.158
-201.248.243.133
+201.247.47.246
+201.247.72.6
+201.248.139.180
  201.249.0.131
  201.249.146.101
-201.249.176.74
  201.249.229.107
  201.249.50.74
  201.249.57.132
@@ -64549,23 +54054,21 @@
  201.249.61.60
  201.249.75.13
  201.249.88.38
+201.250.14.94
  201.251.63.208
-201.254.161.168
  201.255.112.125
-201.255.15.186
-201.255.59.89
-201.255.83.90
+201.255.77.179
  201.255.88.68
  201.26.113.204
  201.26.174.39
  201.26.179.96
  201.26.58.209
+201.28.105.213
  201.28.135.246
  201.28.87.42
  201.28.87.43
  201.30.132.19
  201.31.167.50
-201.32.158.208
  201.32.178.190
  201.33.161.234
  201.33.161.236
@@ -64574,29 +54077,26 @@
  201.33.17.229
  201.33.170.25
  201.33.228.154
-201.33.23.186
  201.35.168.225
  201.35.168.227
  201.35.168.253
  201.35.84.213
  201.36.173.93
  201.39.92.13
-201.40.38.160
  201.40.41.12
-201.41.121.230
  201.41.81.130
+201.42.106.229
  201.43.25.242
  201.43.83.50
  201.46.28.100
  201.46.28.222
  201.46.29.184
-201.46.39.6
  201.46.65.125
  201.46.85.22
  201.48.115.235
-201.48.183.70
  201.48.184.157
  201.48.192.60
+201.48.220.135
  201.48.25.161
  201.48.28.2
  201.48.34.200
@@ -64609,19 +54109,16 @@
  201.49.58.234
  201.49.89.221
  201.50.47.169
-201.51.176.147
  201.54.113.170
  201.54.232.42
  201.55.103.34
-201.55.91.6
+201.55.141.34
+201.55.142.243
+201.55.142.36
  201.57.40.70
  201.59.201.92
  201.59.214.82
  201.6.101.122
-201.6.156.181
-201.6.156.253
-201.6.240.10
-201.6.247.90
  201.6.99.188
  201.62.54.168
  201.62.56.49
@@ -64629,37 +54126,29 @@
  201.65.121.66
  201.66.199.247
  201.67.77.216
-201.68.91.123
-201.69.151.122
  201.7.66.177
  201.71.225.18
  201.71.228.86
  201.71.45.32
  201.72.190.98
  201.72.59.162
-201.73.143.60
  201.75.53.118
-201.75.56.205
  201.76.162.174
  201.76.9.56
  201.78.38.79
  201.79.70.172
-201.80.108.222
  201.80.45.116
-201.82.62.34
-201.82.96.76
  201.86.99.130
  201.87.154.127
  201.87.154.128
-201.87.233.60
  201.87.243.22
  201.87.32.244
  201.90.101.165
  201.90.148.195
  201.91.194.218
-201.91.207.114
  201.91.210.130
  201.91.43.186
+201.91.82.155
  201.91.86.28
  201.93.159.234
  201.93.177.206
@@ -64667,7 +54156,6 @@
  201.93.86.188
  201.93.94.50
  201.94.226.69
-201.95.92.49
  201.99.106.67
  2010-honda-civic-gx-autof12c76f7-dae5-486a-812e-e303461184c1.site
  2012-presidentielles.com
@@ -64683,102 +54171,53 @@
  20191021t124955-dot-we-secure-file-sh4455.appspot.com
  20191027t231510-dot-wetransfer-auth-file-343.appspot.com
  20191113t071621-dot-wetransfer-auth-file334.appspot.com
-202.1.114.202
  202.10.33.102
  202.10.33.98
-202.10.79.168
-202.100.168.67
-202.100.185.138
  202.100.188.108
-202.100.214.108
-202.100.223.42
-202.101.102.194
-202.101.102.202
  202.101.186.218
  202.101.58.115
+202.101.87.61
  202.102.126.37
-202.102.67.181
-202.102.67.184
  202.102.90.21
-202.103.222.10
-202.103.241.234
-202.103.242.166
  202.104.101.27
  202.104.112.217
  202.104.113.226
-202.104.184.19
+202.104.139.133
  202.104.188.147
  202.104.69.204
-202.105.190.225
  202.105.98.210
-202.106.151.201
-202.106.151.247
-202.106.54.122
  202.107.11.68
-202.107.190.246
-202.107.226.4
-202.107.226.5
-202.107.227.42
-202.107.251.28
-202.108.140.114
  202.108.211.135
-202.108.219.98
  202.109.158.139
-202.109.193.202
-202.109.197.45
-202.110.75.154
-202.110.83.126
  202.110.9.197
-202.110.9.212
-202.111.13.98
  202.111.131.236
-202.111.173.59
-202.111.174.150
-202.111.185.3
-202.112.30.85
-202.112.42.158
  202.112.51.45
-202.113.65.13
-202.113.80.58
-202.115.254.100
-202.117.194.151
-202.119.114.64
  202.12.103.153
  202.12.74.243
-202.12.80.74
  202.120.13.51
  202.120.38.51
  202.121.138.74
-202.121.174.96
  202.122.8.50
-202.124.204.5
  202.124.242.10
-202.124.248.254
  202.124.46.196
-202.125.138.234
  202.125.152.246
  202.125.45.45
  202.125.46.31
  202.126.123.54
  202.126.98.42
  202.129.0.27
-202.129.16.39
-202.129.164.186
  202.129.184.10
  202.129.185.184
  202.129.189.58
  202.129.191.170
-202.129.206.226
-202.129.207.4
  202.129.239.193
-202.129.28.14
  202.129.38.3
+202.129.41.94
+202.129.58.130
  202.130.32.19
  202.131.152.2
-202.131.176.233
  202.131.226.102
  202.131.226.52
-202.131.227.134
  202.131.233.202
  202.131.234.142
  202.131.254.118
@@ -64787,14 +54226,14 @@
  202.133.4.53
  202.133.4.57
  202.133.63.9
-202.134.0.9
+202.134.106.67
  202.134.160.168
  202.134.166.1
  202.134.180.50
  202.134.4.211
  202.134.4.216
-202.134.61.41
  202.134.81.249
+202.134.81.254
  202.136.120.62
  202.136.123.254
  202.136.124.38
@@ -64813,18 +54252,19 @@
  202.137.154.62
  202.137.155.148
  202.137.155.168
-202.137.155.193
-202.137.155.234
+202.137.155.171
+202.137.155.212
  202.137.155.68
+202.137.155.94
+202.137.155.95
  202.137.159.130
  202.137.159.132
+202.137.20.53
  202.137.26.10
  202.137.26.12
  202.137.26.5
  202.137.26.6
  202.137.26.8
-202.137.5.98
-202.137.7.58
  202.138.233.162
  202.138.234.18
  202.138.239.102
@@ -64834,19 +54274,11 @@
  202.138.242.8
  202.138.248.85
  202.138.254.154
-202.139.192.136
-202.14.4.165
-202.14.5.153
-202.141.225.174
  202.141.226.124
  202.141.226.125
  202.141.242.3
-202.141.243.14
  202.141.243.254
-202.141.246.254
-202.142.112.54
  202.142.120.210
-202.142.127.26
  202.142.151.30
  202.142.153.181
  202.142.155.146
@@ -64855,15 +54287,10 @@
  202.142.159.26
  202.142.178.114
  202.142.184.166
-202.142.189.138
  202.142.193.72
  202.142.215.25
-202.142.82.78
  202.143.111.42
-202.143.120.57
  202.143.121.245
-202.143.127.163
-202.143.97.57
  202.144.201.129
  202.144.201.130
  202.144.201.132
@@ -64872,14 +54299,13 @@
  202.144.201.34
  202.144.201.36
  202.144.201.38
-202.146.217.253
  202.146.222.249
+202.146.231.106
  202.146.245.156
  202.147.192.134
  202.147.192.242
  202.147.198.115
  202.147.206.210
-202.147.207.253
  202.148.12.90
  202.148.2.254
  202.148.28.18
@@ -64892,47 +54318,38 @@
  202.150.151.85
  202.150.176.100
  202.150.181.58
-202.150.182.142
  202.150.216.211
  202.151.14.14
  202.151.163.10
-202.152.1.89
  202.152.149.26
-202.152.15.12
-202.152.30.73
  202.152.33.132
  202.152.38.74
  202.152.38.76
-202.152.39.13
+202.152.40.186
  202.152.40.28
  202.152.48.210
  202.152.55.67
  202.152.56.170
-202.152.57.114
  202.152.60.50
  202.153.103.135
  202.153.37.194
  202.153.37.205
  202.154.180.51
  202.154.180.53
-202.154.182.234
  202.154.186.25
  202.154.191.106
  202.154.191.58
+202.155.200.118
  202.155.208.243
  202.155.211.226
  202.155.228.207
  202.155.248.196
-202.157.176.152
  202.157.176.154
-202.157.185.117
  202.158.11.92
-202.158.43.131
  202.158.49.138
  202.158.49.140
  202.158.49.141
  202.158.49.142
-202.158.62.240
  202.159.107.1
  202.159.107.137
  202.159.107.209
@@ -64945,6 +54362,7 @@
  202.159.30.1
  202.159.30.129
  202.159.30.153
+202.159.30.65
  202.159.30.81
  202.159.30.9
  202.159.35.105
@@ -64973,17 +54391,12 @@
  202.159.60.145
  202.159.60.17
  202.159.60.65
-202.160.132.115
-202.160.132.67
-202.160.132.82
-202.160.135.149
-202.160.135.16
-202.160.15.85
  202.160.160.161
  202.160.161.206
  202.160.166.193
  202.160.170.225
  202.160.173.9
+202.161.81.102
  202.162.188.147
  202.162.195.77
  202.162.196.170
@@ -64996,34 +54409,39 @@
  202.162.219.10
  202.162.219.12
  202.162.29.193
-202.162.79.202
-202.163.101.11
-202.164.131.74
-202.164.210.147
+202.164.138.179
+202.164.138.19
+202.164.138.250
+202.164.138.67
+202.164.139.211
+202.164.139.219
+202.164.139.236
+202.164.139.249
+202.164.139.29
+202.164.139.5
+202.164.139.85
  202.164.211.51
  202.164.212.244
  202.164.222.41
-202.164.41.2
-202.165.120.162
  202.165.22.170
  202.165.22.177
  202.165.22.203
  202.165.22.219
+202.165.22.227
  202.165.22.247
  202.165.22.28
  202.165.228.161
  202.165.228.225
  202.165.232.92
  202.165.233.130
+202.165.233.8
  202.165.234.193
  202.165.234.202
-202.165.236.136
-202.165.236.50
+202.165.234.42
  202.166.170.43
  202.166.174.218
  202.166.196.34
  202.166.196.6
-202.166.198.206
  202.166.202.29
  202.166.203.23
  202.166.204.62
@@ -65038,7 +54456,6 @@
  202.166.212.249
  202.166.213.156
  202.166.217.117
-202.166.69.193
  202.168.146.100
  202.168.146.102
  202.168.146.108
@@ -65052,7 +54469,6 @@
  202.168.146.98
  202.168.151.102
  202.168.159.54
-202.168.186.98
  202.168.225.141
  202.169.240.54
  202.169.32.138
@@ -65061,27 +54477,20 @@
  202.169.38.82
  202.169.44.140
  202.169.45.20
-202.169.53.11
  202.169.59.118
-202.169.63.62
  202.170.57.253
  202.170.69.12
  202.171.253.105
  202.171.253.74
  202.172.32.247
  202.174.46.174
-202.175.105.186
  202.176.4.231
-202.177.244.68
  202.178.113.221
+202.178.118.110
  202.178.123.122
-202.179.184.37
  202.179.21.58
  202.179.76.187
-202.181.209.102
-202.181.234.12
-202.181.237.142
-202.181.239.56
+202.180.109.109
  202.182.100.165
  202.182.101.14
  202.182.109.112
@@ -65096,22 +54505,17 @@
  202.183.155.242
  202.183.164.143
  202.183.164.32
-202.183.198.16
  202.183.247.200
  202.183.32.173
  202.183.32.181
  202.183.32.182
  202.183.32.185
  202.184.0.102
+202.184.103.168
  202.184.196.111
-202.184.56.181
  202.186.172.191
-202.186.200.146
  202.186.48.181
  202.187.164.196
-202.187.183.169
-202.187.186.23
-202.187.195.37
  202.187.252.250
  202.188.101.106
  202.188.101.4
@@ -65119,34 +54523,27 @@
  202.188.20.123
  202.188.20.126
  202.188.217.68
-202.189.3.195
-202.189.3.253
+202.188.26.115
+202.188.46.179
+202.189.252.224
  202.191.104.97
  202.191.120.12
  202.191.121.12
  202.191.122.62
  202.191.126.100
  202.191.126.60
-202.191.132.211
  202.191.15.253
  202.191.56.154
  202.191.8.225
  202.192.34.106
-202.195.100.158
-202.196.65.124
-202.200.144.150
  202.200.236.214
-202.201.0.144
-202.201.12.133
-202.202.217.76
-202.204.179.181
  202.205.160.242
  202.208.223.251
+202.21.108.143
  202.21.115.94
  202.21.123.124
  202.21.123.185
  202.21.123.194
-202.21.123.6
  202.21.124.226
  202.21.184.194
  202.21.32.158
@@ -65154,28 +54551,19 @@
  202.212.79.128
  202.22.141.45
  202.22.199.145
-202.22.228.246
-202.220.176.48
  202.228.204.204
  202.228.204.224
-202.239.26.221
  202.239.42.192
  202.28.10.20
-202.28.217.30
  202.28.221.106
  202.28.247.202
  202.28.77.46
-202.29.105.30
  202.29.18.25
  202.29.211.11
-202.29.212.60
-202.29.213.219
  202.29.215.114
-202.29.216.171
  202.29.220.202
  202.29.226.134
  202.29.226.54
-202.29.228.241
  202.29.231.46
  202.29.232.90
  202.29.237.113
@@ -65183,32 +54571,27 @@
  202.29.243.253
  202.29.243.254
  202.29.245.46
+202.29.39.234
  202.29.4.97
  202.29.57.22
+202.29.70.46
  202.29.80.133
  202.29.86.7
  202.29.95.12
  202.3.72.104
  202.3.72.17
  202.3.72.50
-202.30.130.199
  202.30.198.28
  202.38.181.171
-202.38.224.23
  202.38.69.166
  202.38.75.219
  202.39.237.188
-202.39.249.114
  202.4.173.49
-202.4.186.6
  202.40.139.165
  202.40.177.94
-202.40.178.201
  202.40.185.67
  202.40.186.157
  202.40.186.26
-202.40.187.138
-202.40.187.22
  202.40.188.201
  202.40.188.90
  202.40.188.94
@@ -65222,6 +54605,7 @@
  202.43.117.134
  202.43.160.142
  202.43.183.158
+202.43.184.206
  202.43.190.11
  202.43.191.10
  202.43.191.14
@@ -65233,13 +54617,14 @@
  202.44.9.1
  202.45.146.210
  202.46.121.195
-202.46.122.227
  202.46.29.76
  202.46.3.22
  202.46.3.26
  202.47.116.107
  202.47.116.121
  202.47.40.89
+202.47.42.112
+202.47.43.208
  202.49.183.168
  202.5.16.47
  202.5.17.28
@@ -65253,7 +54638,6 @@
  202.5.54.76
  202.5.56.33
  202.5.56.71
-202.5.60.106
  202.51.100.33
  202.51.102.17
  202.51.106.161
@@ -65267,6 +54651,7 @@
  202.51.116.133
  202.51.116.170
  202.51.116.34
+202.51.118.34
  202.51.118.42
  202.51.120.22
  202.51.178.126
@@ -65274,23 +54659,16 @@
  202.51.188.170
  202.51.189.134
  202.51.190.36
-202.51.69.72
  202.51.96.49
  202.52.146.71
  202.52.234.236
+202.52.240.17
  202.52.244.150
  202.52.248.254
  202.52.4.151
-202.52.58.37
-202.53.138.233
-202.53.160.50
-202.53.169.17
  202.53.174.136
  202.53.175.190
  202.53.8.82
-202.55.167.171
-202.55.167.228
-202.55.168.252
  202.55.175.236
  202.55.176.12
  202.55.87.45
@@ -65305,12 +54683,10 @@
  202.57.36.110
  202.57.37.197
  202.57.39.2
-202.57.40.227
  202.57.40.228
  202.57.43.26
  202.57.46.140
  202.57.46.97
-202.57.49.250
  202.57.52.18
  202.58.108.1
  202.58.108.100
@@ -65327,14 +54703,12 @@
  202.58.108.77
  202.58.108.81
  202.58.108.86
-202.58.204.150
  202.59.166.146
  202.59.173.204
  202.6.224.50
  202.6.224.52
  202.60.225.49
  202.60.227.65
-202.60.56.157
  202.60.72.107
  202.60.94.104
  202.61.120.90
@@ -65346,14 +54720,9 @@
  202.61.133.32
  202.61.133.80
  202.61.49.52
-202.61.87.57
  202.62.10.250
-202.62.107.135
  202.62.11.106
-202.62.120.5
  202.62.13.72
-202.62.224.24
-202.62.226.26
  202.62.227.168
  202.62.227.41
  202.62.227.45
@@ -65362,7 +54731,6 @@
  202.62.39.111
  202.62.45.17
  202.62.45.53
-202.62.48.112
  202.62.50.81
  202.62.57.130
  202.62.57.50
@@ -65373,10 +54741,8 @@
  202.62.92.225
  202.62.99.170
  202.63.104.89
-202.63.218.19
  202.63.242.135
  202.63.242.20
-202.64.117.55
  202.65.141.228
  202.65.170.174
  202.65.171.67
@@ -65388,50 +54754,33 @@
  202.69.38.237
  202.69.45.22
  202.69.48.126
-202.69.59.170
  202.69.59.69
  202.70.136.160
  202.70.34.82
  202.70.44.195
  202.70.65.229
  202.70.72.217
-202.70.72.233
  202.70.84.201
  202.71.108.26
-202.71.131.8
  202.72.209.3
-202.72.211.213
  202.72.225.17
  202.72.233.18
  202.72.242.242
  202.73.51.102
-202.73.58.54
-202.74.238.202
  202.74.243.112
  202.74.243.38
-202.75.177.41
+202.74.40.27
  202.75.211.206
-202.75.221.119
-202.75.223.184
  202.75.53.115
  202.75.97.82
  202.77.105.100
-202.77.105.50
-202.77.105.51
-202.77.115.125
-202.77.120.42
-202.77.61.103
-202.77.61.112
+202.77.6.10
  202.78.200.205
-202.78.201.165
-202.78.202.37
  202.78.232.134
  202.78.232.138
  202.78.94.70
  202.79.164.35
  202.79.167.65
-202.79.169.57
-202.79.174.139
  202.79.24.136
  202.79.34.167
  202.79.34.178
@@ -65440,52 +54789,33 @@
  202.79.40.97
  202.79.56.90
  202.79.58.89
-202.79.60.121
  202.8.102.18
  202.8.113.141
  202.8.113.237
  202.8.113.56
  202.80.118.90
+202.80.139.52
  202.80.213.188
  202.80.216.126
-202.82.218.169
-202.82.59.237
-202.83.168.97
  202.83.172.218
-202.83.172.43
  202.83.25.83
-202.83.39.66
  202.83.54.167
  202.83.56.209
-202.84.32.140
-202.84.42.69
-202.85.208.217
-202.85.219.61
-202.85.223.74
-202.85.3.138
  202.86.217.90
  202.87.248.134
  202.87.248.50
  202.87.249.45
-202.88.154.70
  202.88.239.11
  202.88.241.107
-202.88.241.118
  202.9.123.40
  202.9.38.20
  202.9.39.139
+202.90.86.159
  202.91.10.123
-202.91.232.39
-202.91.242.198
-202.91.242.199
-202.91.244.247
-202.91.244.249
  202.91.35.253
  202.91.82.81
  202.91.89.129
-202.91.89.163
  202.91.89.67
-202.91.90.39
  202.91.93.5
  202.92.128.181
  202.92.199.86
@@ -65497,31 +54827,14 @@
  202.93.229.99
  202.93.254.137
  202.94.175.118
+202.94.175.167
  202.94.175.33
  202.94.175.7
  202.94.175.87
  202.95.11.253
-202.95.11.5
  202.95.8.227
  202.95.9.254
-202.96.123.99
-202.96.63.70
-202.96.99.82
-202.96.99.83
-202.97.174.3
-202.98.203.20
-202.98.203.21
-202.98.203.23
-202.98.203.27
-202.98.203.29
-202.98.213.26
  202.98.216.29
-202.98.252.213
-202.98.38.185
-202.98.38.187
-202.98.80.187
-202.99.135.93
-202.99.149.54
  202.99.48.168
  2020-attupgrade.weebly.com
  2020-giveaway.com
@@ -65767,32 +55080,19 @@
  2023devlet-iadeleri.org
  2023talep-iadelerim.org
  202983268654sbcglobal.weebly.com
-203.0.108.2
  203.10.58.4
  203.100.165.2
-203.101.174.175
-203.101.178.179
-203.101.178.68
+203.100.73.86
+203.101.178.13
  203.106.141.229
-203.106.158.94
-203.106.86.114
-203.106.97.13
-203.109.106.165
  203.109.113.155
-203.109.45.52
  203.11.71.1
  203.110.164.139
-203.110.86.82
-203.110.86.94
-203.110.87.139
-203.110.94.131
-203.110.95.84
-203.111.208.99
  203.111.254.243
  203.112.212.114
  203.112.218.83
  203.113.10.153
-203.113.135.199
+203.113.102.178
  203.113.174.47
  203.114.102.157
  203.114.108.46
@@ -65806,23 +55106,19 @@
  203.114.75.50
  203.114.75.59
  203.115.101.106
-203.115.119.109
  203.115.131.17
+203.115.73.114
  203.115.73.205
-203.116.184.242
-203.117.96.166
  203.122.19.101
  203.122.225.70
  203.122.226.250
  203.122.26.98
  203.122.34.206
+203.122.37.106
  203.122.48.58
  203.123.125.210
  203.123.99.149
-203.124.46.72
-203.125.16.18
  203.128.17.34
-203.128.170.18
  203.128.18.225
  203.128.242.166
  203.128.67.130
@@ -65831,12 +55127,10 @@
  203.128.72.62
  203.128.74.122
  203.128.79.18
-203.128.81.98
  203.128.83.115
  203.129.113.142
  203.129.197.98
  203.129.220.182
-203.129.220.82
  203.130.0.69
  203.130.130.40
  203.130.215.147
@@ -65845,7 +55139,6 @@
  203.130.242.178
  203.130.242.68
  203.130.255.2
-203.130.70.105
  203.131.229.187
  203.131.252.210
  203.132.92.216
@@ -65862,36 +55155,26 @@
  203.142.76.171
  203.143.119.196
  203.144.133.5
-203.144.233.115
  203.146.127.133
-203.146.129.235
  203.146.208.208
-203.146.21.248
  203.146.255.101
  203.147.62.92
  203.147.78.171
  203.148.20.162
-203.148.250.144
-203.148.87.154
-203.150.103.40
  203.150.107.77
  203.150.113.117
  203.150.113.66
  203.150.137.94
  203.150.156.152
  203.150.225.2
-203.150.36.61
  203.150.53.209
-203.150.53.222
-203.150.54.178
-203.150.54.87
-203.150.91.123
  203.151.146.216
+203.151.155.167
  203.151.166.123
  203.151.166.124
  203.151.20.19
  203.151.215.130
-203.152.167.41
+203.151.4.130
  203.152.210.122
  203.153.106.109
  203.153.108.219
@@ -65901,24 +55184,13 @@
  203.153.216.189
  203.153.25.126
  203.153.28.2
+203.153.39.77
  203.153.99.174
-203.154.232.182
  203.154.243.50
-203.154.56.219
-203.154.78.176
-203.156.205.55
-203.156.221.250
-203.156.221.251
-203.156.221.253
-203.156.221.254
-203.158.136.31
-203.158.167.25
  203.158.177.71
  203.159.172.13
  203.159.249.215
  203.160.1.76
-203.160.165.18
-203.160.189.202
  203.160.55.126
  203.160.57.193
  203.160.57.39
@@ -65931,7 +55203,6 @@
  203.160.59.153
  203.160.59.185
  203.160.59.2
-203.160.59.209
  203.160.59.249
  203.160.59.73
  203.160.61.101
@@ -65942,28 +55213,18 @@
  203.160.62.180
  203.160.63.113
  203.160.63.117
-203.160.63.125
  203.160.63.17
  203.160.63.49
  203.160.63.81
  203.162.123.109
  203.162.130.73
  203.162.230.150
-203.162.76.32
  203.163.236.249bin.sh
  203.163.245.14
  203.163.252.102
  203.165.255.200
-203.166.210.226
-203.166.211.129
-203.166.212.81
-203.166.214.108
  203.167.34.213
  203.169.225.68
-203.170.100.108
-203.170.121.115
-203.170.58.241
-203.170.59.244
  203.170.66.1
  203.170.66.129
  203.170.66.161
@@ -65978,11 +55239,9 @@
  203.170.66.57
  203.170.67.109
  203.170.67.125
-203.170.67.145
  203.170.67.157
  203.170.67.169
  203.170.67.17
-203.170.67.193
  203.170.67.205
  203.170.67.209
  203.170.67.217
@@ -66000,25 +55259,20 @@
  203.170.68.185
  203.170.68.205
  203.170.68.21
-203.170.68.249
  203.170.68.57
  203.170.68.97
  203.171.21.225
  203.171.226.93
-203.171.239.10
  203.171.31.156
  203.172.162.163
-203.172.41.129
+203.172.64.145
  203.172.76.4
  203.173.157.57
  203.173.92.229
-203.173.92.250
  203.173.92.254
-203.173.93.174
  203.173.94.2
  203.173.94.94
  203.174.13.158
-203.174.56.230
  203.175.162.60
  203.176.135.102
  203.176.135.98
@@ -66027,12 +55281,7 @@
  203.176.180.194
  203.177.135.133
  203.177.156.249
-203.177.159.170
-203.177.237.46
-203.177.71.203
-203.177.71.253
  203.177.71.254
-203.177.76.173
  203.180.218.175
  203.183.68.135
  203.184.132.189
@@ -66040,27 +55289,19 @@
  203.184.132.191
  203.184.55.57
  203.185.129.36
-203.186.128.148
  203.186.54.237
  203.187.186.204
  203.188.242.222
  203.188.245.98
  203.188.246.194
  203.188.248.252
-203.188.255.179
-203.189.117.38
  203.189.135.187
  203.189.141.214
  203.189.141.56
  203.189.142.33
-203.189.143.204
  203.189.146.230
-203.189.150.120
-203.189.153.225
-203.189.154.243
-203.189.200.118
+203.189.156.47
  203.189.235.205
-203.189.237.212
  203.189.253.170
  203.189.88.233
  203.189.89.134
@@ -66073,42 +55314,34 @@
  203.190.148.180
  203.190.34.28
  203.190.37.133
+203.190.50.140
  203.190.53.45
  203.190.53.6
  203.190.55.213
-203.191.150.32
  203.191.188.164
  203.192.204.168
  203.192.206.254
-203.192.212.165
  203.192.219.7
-203.192.226.26
  203.192.25.1
-203.193.160.51
-203.193.191.122
+203.193.191.132
  203.194.104.47
  203.194.21.241
  203.195.130.233
  203.195.132.128
-203.195.134.30
  203.195.138.190
  203.195.141.177
  203.195.141.18
  203.195.144.114
  203.195.148.210
  203.195.150.131
-203.195.152.113
-203.195.154.146
  203.195.157.137
  203.195.163.239
-203.195.164.81
  203.195.169.75
  203.195.171.47
  203.195.174.122
  203.195.184.33
  203.195.200.192
  203.195.202.128
-203.195.204.122
  203.195.204.47
  203.195.205.202
  203.195.214.173
@@ -66118,28 +55351,18 @@
  203.195.245.241
  203.197.88.53
  203.198.131.47
-203.198.142.142
-203.198.41.73
-203.198.94.228
  203.199.238.249
-203.2.162.41
-203.2.64.146
  203.200.95.142
  203.202.243.198
  203.202.243.199
  203.202.245.211
-203.202.249.70
  203.202.253.186
-203.203.8.154
  203.204.232.18
-203.205.0.80
  203.205.137.101
  203.205.137.182
  203.205.137.186
  203.205.137.72
  203.205.21.159
-203.205.21.36
-203.205.21.54
  203.205.35.201
  203.205.37.233
  203.206.167.242
@@ -66150,65 +55373,45 @@
  203.209.190.154
  203.209.190.202
  203.210.149.193
-203.210.232.243
  203.210.84.171
  203.210.84.83
-203.212.114.254
-203.212.119.92
-203.212.220.51
-203.212.244.11
-203.212.98.24
+203.212.27.109
  203.213.119.246
  203.213.249.66
+203.213.55.19
  203.213.66.170
-203.214.47.109
  203.215.181.218
  203.215.181.220
  203.215.181.222
-203.217.1.13
-203.217.105.57
-203.217.110.201
-203.217.112.214
  203.217.140.77
  203.217.145.4
  203.217.169.217
  203.217.169.89
  203.217.173.206
  203.217.176.244
-203.217.56.212
  203.217.56.33
-203.218.132.12
-203.218.85.159
  203.219.101.156
  203.219.151.169
-203.219.245.104
  203.219.251.142
  203.219.254.97
  203.22.204.107
-203.220.59.222
  203.221.135.128
  203.221.14.215
-203.222.14.23
-203.222.16.66
-203.222.26.26
+203.223.171.129
  203.223.171.161
  203.223.171.185
  203.223.171.189
  203.223.191.66
  203.223.41.34
  203.223.44.102
+203.227.115.112
  203.227.203.31
  203.227.217.27
-203.227.217.42
-203.227.217.57
  203.227.222.112
-203.228.97.38
  203.229.21.56
  203.230.220.19
  203.230.6.175
-203.234.135.222
  203.234.139.138
-203.234.243.178
  203.234.248.190
  203.234.62.129
  203.236.100.30
@@ -66220,21 +55423,8 @@
  203.238.191.9
  203.24.188.242
  203.24.188.59
-203.240.227.189
-203.243.10.132
-203.243.10.150
-203.243.10.151
-203.243.10.156
-203.243.10.161
-203.243.10.192
-203.243.10.198
-203.243.10.241
-203.243.10.249
-203.243.142.149
-203.243.142.242
  203.243.142.45
  203.243.142.70
-203.243.190.82
  203.245.29.148
  203.245.29.159
  203.245.41.96
@@ -66244,17 +55434,12 @@
  203.249.76.225
  203.25.159.3
  203.25.217.155
-203.250.68.51
  203.251.11.118
-203.251.188.245
  203.251.225.101
-203.251.73.188
-203.251.73.253
  203.252.161.42
  203.252.90.80
  203.253.25.15
  203.255.228.8
-203.3.84.204
  203.30.90.82
  203.30.95.15
  203.31.110.92
@@ -66263,42 +55448,28 @@
  203.45.171.181
  203.46.223.176
  203.51.27.108
-203.55.117.211
  203.56.191.129
-203.56.228.178
-203.56.4.47
-203.57.200.58
-203.57.229.254
  203.58.26.70
  203.59.228.28
  203.6.149.115
+203.6.230.96
  203.62.185.131
-203.63.218.28
  203.64.20.2
-203.66.13.176
  203.66.14.161
  203.66.168.81
-203.69.187.175
  203.69.229.118
-203.69.234.235
-203.69.59.2
+203.69.229.81
+203.69.229.95
  203.69.91.190
  203.71.2.73
  203.71.220.140
  203.73.150.177
-203.73.168.4
-203.74.120.11
  203.74.190.196
  203.76.109.178
  203.76.110.186
-203.76.110.190
  203.76.115.246
  203.76.116.14
-203.76.121.210
  203.76.148.2
-203.76.240.103
-203.76.240.104
-203.76.240.114
  203.76.251.66
  203.77.210.161
  203.77.214.49
@@ -66306,7 +55477,6 @@
  203.77.229.124
  203.77.230.114
  203.77.240.76
-203.77.68.124
  203.77.76.152
  203.80.170.130
  203.80.170.68
@@ -66314,8 +55484,9 @@
  203.80.190.162
  203.80.190.242
  203.80.191.18
+203.80.52.48
+203.81.242.153
  203.81.75.37
-203.81.76.214
  203.81.78.180
  203.81.87.186
  203.81.95.70
@@ -66325,17 +55496,12 @@
  203.83.182.86
  203.83.184.54
  203.83.189.126
-203.83.234.158
  203.86.7.110
-203.88.129.74
-203.89.96.50
  203.90.61.133
-203.91.113.39
  203.91.118.71
  203.91.121.70
  203.91.121.71
  203.92.47.40
-203.92.91.194
  203.93.19.36
  203.93.209.7
  203.93.6.28
@@ -66347,15 +55513,10 @@
  203.95.7.164
  203.97.30.12
  203.98.76.172
-203.98.96.180
-203.98.96.66
  203.99.110.214
  203.99.123.25
  203.99.131.218
  203.99.131.241
-203.99.177.175
-203.99.184.4
-203.99.187.63
  203.99.60.219
  203.99.62.158
  203102102682672-dot-vui-egd-lhs.appspot.com
@@ -66366,18 +55527,16 @@
  2038277.weebly.com
  20387638.cf
  20394884884.z13.web.core.windows.net
+204.10.162.137
  204.10.162.203
-204.10.89.39
  204.101.4.42
  204.101.61.82
  204.107.27.43
  204.11.17.16
  204.11.50.131
  204.11.58.151
-204.11.58.87
  204.11.59.175
  204.111.241.195
-204.112.101.66
  204.12.124.138
  204.12.206.90
  204.12.207.91
@@ -66393,11 +55552,10 @@
  204.13.201.161
  204.13.201.162
  204.13.201.163
-204.13.65.221
  204.132.129.234
+204.137.141.1
  204.137.157.184
  204.14.245.176
-204.141.232.112
  204.145.94.123
  204.145.94.154
  204.15.11.4
@@ -66406,7 +55564,6 @@
  204.15.145.35
  204.15.145.39
  204.15.151.118
-204.15.177.144
  204.15.192.194
  204.15.230.189
  204.152.199.34
@@ -66426,12 +55583,9 @@
  204.155.30.121
  204.155.30.77
  204.155.31.153
-204.16.0.32
-204.16.247.116
  204.16.247.19
  204.16.247.28
  204.17.56.42
-204.186.24.49
  204.188.213.73
  204.188.221.82
  204.194.29.4
@@ -66440,15 +55594,14 @@
  204.195.19.126
  204.195.62.198
  204.197.146.48
-204.197.155.166
  204.225.249.100
  204.232.192.66
  204.232.208.15
  204.236.129.29
  204.236.201.180
+204.236.65.123
  204.237.122.45
  204.27.60.147
-204.42.253.132
  204.44.101.146
  204.44.112.135
  204.44.112.46
@@ -66460,7 +55613,6 @@
  204.44.75.55
  204.44.83.216
  204.44.85.152
-204.44.85.61
  204.44.85.63
  204.44.87.4
  204.44.92.154
@@ -66478,20 +55630,15 @@
  204.52.167.22
  204.60.23.203
  204.61.221.178
-204.8.167.172
-204.83.108.242
  204.85.191.30
  204.85.191.31
  204.85.191.8
  204.85.191.9
  204.86.22.251
-204.9.180.112
  204.9.243.81
  204.93.113.108
-204.93.154.215
-204.93.160.85
-204.93.165.110
  204.93.180.3
+204.93.180.4
  204.93.197.85
  204.98.164.243
  204.99.118.10
@@ -66503,10 +55650,9 @@
  205.134.172.6
  205.134.182.106
  205.134.255.225
-205.144.171.163
+205.144.171.155
  205.157.156.10
  205.164.3.143
-205.164.7.242
  205.166.231.208
  205.172.134.229
  205.173.105.205
@@ -66514,78 +55660,63 @@
  205.178.9.104
  205.185.113.140
  205.185.113.151
+205.185.113.76
  205.185.114.215
  205.185.114.231
  205.185.114.29
-205.185.114.70
  205.185.115.100
  205.185.115.183
-205.185.115.3
  205.185.115.93
  205.185.116.126
  205.185.116.163
  205.185.116.78
-205.185.116.87
  205.185.117.149
  205.185.117.28
-205.185.117.4
  205.185.118.156
  205.185.118.62
  205.185.119.102
-205.185.119.177
-205.185.119.194
  205.185.122.246
  205.185.123.173
-205.185.123.78
  205.185.124.200
-205.185.124.203
  205.185.125.104
-205.185.125.171
  205.185.125.216
  205.185.126.171
  205.185.126.184
  205.185.126.93
-205.185.127.135
  205.185.127.217
-205.185.127.249
  205.185.127.35
-205.185.127.69
  205.185.127.74
-205.185.209.118
-205.185.209.130
-205.185.209.147
+205.185.209.106
  205.185.209.227
  205.185.214.128
  205.185.214.139
-205.185.222.25
+205.185.214.71
+205.185.222.177
  205.185.222.26
-205.185.222.47
  205.185.223.153
-205.185.223.98
  205.186.131.199
  205.186.132.245
  205.186.152.130
  205.186.166.172
  205.186.176.33
-205.197.221.112
-205.197.221.114
-205.201.49.132
-205.206.81.86
+205.201.49.208
  205.209.160.130
  205.209.173.8
  205.209.183.209
  205.209.97.120
-205.215.7.23
-205.220.219.85
-205.233.7.250
  205.234.159.168
  205.234.184.42
  205.234.198.191
  205.234.198.247
+205.234.203.28
  205.234.238.90
  205.234.252.183
  205.234.55.26
  205.236.80.15
+205.237.251.72
+205.240.77.111
+205.240.77.21
+205.240.77.231
  205.244.148.43
  205.247.175.71
  205.247.175.77
@@ -66600,10 +55731,10 @@
  205539.cc
  205630.cc
  206.108.48.242
-206.116.156.240
  206.123.139.131
  206.123.139.183
  206.123.139.226
+206.123.139.229
  206.123.139.230
  206.123.139.233
  206.123.139.235
@@ -66615,7 +55746,6 @@
  206.123.153.8
  206.123.95.6
  206.124.149.66
-206.125.147.98
  206.125.169.164
  206.126.81.103
  206.126.81.105
@@ -66626,15 +55756,10 @@
  206.126.81.49
  206.126.81.82
  206.126.81.92
-206.132.57.240
+206.130.141.124
  206.173.219.10
  206.174.214.90
-206.174.236.147
-206.174.236.57
-206.174.243.131
-206.180.160.119
  206.183.31.221
-206.186.170.243
  206.188.207.19
  206.189.1.246
  206.189.101.68
@@ -66642,7 +55767,6 @@
  206.189.110.64
  206.189.110.77
  206.189.112.173
-206.189.113.102
  206.189.113.118
  206.189.113.210
  206.189.114.102
@@ -66651,7 +55775,6 @@
  206.189.118.168
  206.189.119.230
  206.189.121.234
-206.189.121.29
  206.189.122.104
  206.189.122.115
  206.189.124.254
@@ -66666,22 +55789,17 @@
  206.189.132.108
  206.189.132.204
  206.189.132.8
-206.189.134.111
  206.189.135.186
  206.189.136.160
  206.189.136.185
-206.189.136.239
  206.189.136.246
  206.189.137.124
  206.189.138.144
+206.189.138.27
  206.189.139.21
-206.189.139.211
  206.189.140.139
  206.189.141.156
-206.189.142.144
  206.189.142.61
-206.189.143.230
-206.189.143.61
  206.189.143.91
  206.189.144.129
  206.189.145.21
@@ -66691,10 +55809,8 @@
  206.189.147.87
  206.189.151.151
  206.189.151.16
-206.189.151.254
  206.189.151.26
  206.189.153.222
-206.189.153.226
  206.189.154.19
  206.189.155.250
  206.189.157.50
@@ -66707,36 +55823,19 @@
  206.189.160.233
  206.189.162.136
  206.189.162.99
-206.189.163.103
-206.189.163.44
-206.189.163.5
-206.189.163.93
-206.189.164.178
-206.189.164.200
-206.189.164.208
-206.189.165.171
  206.189.165.77
-206.189.166.172
  206.189.166.210
  206.189.167.164
-206.189.168.251
-206.189.169.223
  206.189.169.6
  206.189.17.179
-206.189.170.67
  206.189.171.111
  206.189.171.114
  206.189.171.204
-206.189.171.222
  206.189.171.239
  206.189.171.241
-206.189.171.33
-206.189.171.88
  206.189.172.126
-206.189.172.22
  206.189.173.15
  206.189.173.185
-206.189.174.104
  206.189.174.127
  206.189.176.239
  206.189.178.121
@@ -66750,7 +55849,7 @@
  206.189.183.0
  206.189.183.229
  206.189.183.71
-206.189.188.218
+206.189.184.16
  206.189.188.223
  206.189.189.192
  206.189.190.18
@@ -66764,6 +55863,7 @@
  206.189.199.185
  206.189.199.23
  206.189.199.48
+206.189.20.169
  206.189.200.15
  206.189.200.8
  206.189.201.17
@@ -66776,7 +55876,6 @@
  206.189.208.7
  206.189.208.80
  206.189.209.253
-206.189.212.237
  206.189.213.113
  206.189.213.126
  206.189.213.201
@@ -66789,28 +55888,17 @@
  206.189.221.52
  206.189.221.73
  206.189.222.161
-206.189.223.159
-206.189.223.163
  206.189.223.181
-206.189.223.31
-206.189.223.53
-206.189.223.63
-206.189.223.66
  206.189.223.88
-206.189.223.89
  206.189.225.85
-206.189.228.120
  206.189.23.189
  206.189.23.60
  206.189.231.196
  206.189.232.10
  206.189.232.31
  206.189.232.51
-206.189.234.238
-206.189.236.228
  206.189.238.171
-206.189.239.168
-206.189.24.200
+206.189.24.121
  206.189.24.87
  206.189.25.102
  206.189.26.219
@@ -66825,11 +55913,8 @@
  206.189.33.197
  206.189.35.67
  206.189.36.195
-206.189.36.223
-206.189.37.1
  206.189.38.237
  206.189.38.75
-206.189.43.143
  206.189.45.137
  206.189.45.138
  206.189.45.170
@@ -66840,10 +55925,10 @@
  206.189.47.179
  206.189.49.175
  206.189.49.58
+206.189.51.172
  206.189.51.209
  206.189.52.142
  206.189.54.172
-206.189.54.19
  206.189.54.247
  206.189.56.106
  206.189.57.210
@@ -66853,7 +55938,9 @@
  206.189.59.60
  206.189.60.170
  206.189.60.173
+206.189.61.171
  206.189.61.185
+206.189.61.198
  206.189.62.14
  206.189.62.200
  206.189.62.8
@@ -66863,28 +55950,16 @@
  206.189.63.216
  206.189.63.80
  206.189.64.158
-206.189.65.136
-206.189.66.224
-206.189.67.1
  206.189.67.149
-206.189.67.236
-206.189.68.96
-206.189.69.235
  206.189.69.35
  206.189.70.38
  206.189.70.79
-206.189.72.161
  206.189.72.229
-206.189.73.146
  206.189.74.10
-206.189.75.101
-206.189.77.79
+206.189.77.230
  206.189.77.91
  206.189.79.71
-206.189.80.84
-206.189.81.224
  206.189.81.71
-206.189.83.111
  206.189.83.155
  206.189.83.36
  206.189.84.194
@@ -66917,42 +55992,36 @@
  206.217.132.194
  206.217.132.195
  206.217.132.201
+206.217.132.202
  206.217.134.189
  206.217.135.166
  206.217.137.205
  206.217.137.208
+206.217.138.205
  206.217.138.210
  206.217.138.213
  206.217.138.216
  206.217.141.250
  206.217.141.252
-206.219.100.100
-206.219.100.104
-206.219.100.12
-206.219.100.215
-206.219.100.216
-206.219.100.220
-206.219.100.43
-206.219.100.50
  206.221.176.149
  206.221.176.87
  206.221.191.237
-206.221.81.97
  206.225.23.4
  206.225.95.33
  206.248.174.129
  206.248.184.127
  206.251.209.88
-206.251.211.198
+206.251.210.47
  206.251.217.51
+206.251.220.29
  206.252.192.5
  206.252.192.6
  206.253.224.74
  206.253.226.7
-206.255.142.44
+206.255.51.10
  206.29.180.76
  206.31.242.26
-206.41.169.101
+206.41.169.65
  206.41.172.111
  206.41.172.124
  206.41.172.207
@@ -66960,9 +56029,9 @@
  206.41.172.69
  206.41.172.76
  206.41.176.151
-206.41.176.211
  206.41.176.246
  206.41.176.7
+206.41.176.98
  206.41.177.3
  206.41.178.119
  206.41.178.183
@@ -66970,30 +56039,27 @@
  206.41.179.27
  206.41.184.140
  206.41.184.57
+206.41.185.91
  206.41.186.104
  206.41.186.46
  206.41.187.149
  206.41.187.204
-206.47.38.14
-206.53.23.129
+206.45.88.226
  206.54.165.103
  206.54.209.61
  206.71.228.129
  206.71.228.193
  206.72.193.153
  206.72.196.30
-206.72.197.235
  206.72.204.221
  206.72.206.4
  206.75.193.67
-206.75.196.20
  206.80.42.35
  206.81.1.137
  206.81.1.200
  206.81.1.222
  206.81.10.215
  206.81.11.129
-206.81.11.149
  206.81.12.141
  206.81.13.144
  206.81.13.189
@@ -67010,20 +56076,17 @@
  206.81.21.179
  206.81.22.113
  206.81.23.190
-206.81.23.204
  206.81.23.234
  206.81.23.8
  206.81.26.249
  206.81.27.110
  206.81.27.211
-206.81.27.235
  206.81.28.167
  206.81.29.131
  206.81.29.232
  206.81.29.249
  206.81.29.252
  206.81.29.61
-206.81.29.88
  206.81.30.176
  206.81.4.87
  206.81.6.142
@@ -67033,9 +56096,8 @@
  2063696-dot-n-e-w-me-ss-age-po-rt-al.wl.r.appspot.com
  206betasus.com
  207-365.net
-207.102.103.20
-207.102.21.5
  207.106.93.174
+207.107.229.2
  207.115.102.98
  207.118.103.209
  207.118.104.63
@@ -67055,7 +56117,6 @@
  207.118.169.77
  207.118.70.96
  207.119.133.206
-207.121.152.20
  207.126.164.52
  207.134.179.108
  207.134.8.242
@@ -67067,6 +56128,7 @@
  207.148.101.96
  207.148.102.135
  207.148.103.207
+207.148.104.208
  207.148.109.58
  207.148.114.86
  207.148.118.133
@@ -67079,6 +56141,7 @@
  207.148.19.136
  207.148.23.160
  207.148.26.182
+207.148.27.41
  207.148.30.112
  207.148.7.245
  207.148.72.181
@@ -67109,9 +56172,7 @@
  207.154.204.20
  207.154.204.59
  207.154.205.86
-207.154.205.92
  207.154.206.22
-207.154.206.66
  207.154.207.214
  207.154.207.48
  207.154.208.77
@@ -67128,13 +56189,12 @@
  207.154.224.149
  207.154.224.26
  207.154.225.14
-207.154.227.53
+207.154.226.17
  207.154.228.141
  207.154.229.50
  207.154.230.131
  207.154.230.25
  207.154.230.59
-207.154.232.0
  207.154.232.106
  207.154.232.218
  207.154.232.99
@@ -67143,11 +56203,9 @@
  207.154.235.2
  207.154.235.230
  207.154.235.64
-207.154.237.194
  207.154.238.18
  207.154.239.128
  207.154.240.23
-207.154.241.101
  207.154.241.112
  207.154.242.155
  207.154.243.194
@@ -67165,16 +56223,14 @@
  207.158.22.128
  207.162.219.29
  207.164.119.31
-207.166.131.238
-207.166.131.243
-207.166.136.252
  207.174.213.181
  207.177.157.5
  207.180.192.225
  207.180.195.154
+207.180.196.191
  207.180.206.148
  207.180.207.205
-207.180.210.41
+207.180.211.159
  207.180.217.251
  207.180.217.42
  207.180.223.239
@@ -67183,7 +56239,6 @@
  207.180.227.177
  207.180.227.204
  207.180.234.123
-207.180.234.176
  207.180.244.165
  207.180.247.20
  207.180.250.131
@@ -67194,6 +56249,7 @@
  207.182.137.218
  207.182.154.178
  207.182.25.33
+207.183.174.166
  207.188.41.2
  207.191.165.8
  207.191.186.10
@@ -67201,10 +56257,6 @@
  207.191.38.230
  207.194.255.18
  207.194.255.74
-207.199.250.108
-207.199.250.82
-207.200.146.161
-207.204.107.202
  207.210.125.155
  207.210.254.157
  207.210.254.158
@@ -67221,7 +56273,6 @@
  207.229.46.30
  207.231.235.145
  207.235.124.166
-207.237.36.228
  207.241.227.38
  207.241.229.212
  207.241.237.209
@@ -67233,7 +56284,6 @@
  207.242.216.3
  207.242.7.91
  207.244.109.182
-207.244.117.173
  207.244.117.228
  207.244.117.87
  207.244.119.191
@@ -67247,12 +56297,12 @@
  207.244.149.82
  207.244.157.138
  207.244.157.139
-207.244.228.239
+207.244.224.121
  207.244.234.203
-207.244.234.226
  207.244.240.155
  207.244.240.40
-207.244.248.194
+207.244.240.67
+207.244.247.57
  207.244.249.131
  207.244.250.95
  207.244.253.177
@@ -67266,6 +56316,7 @@
  207.246.119.222
  207.246.120.203
  207.246.124.223
+207.246.240.113
  207.246.240.116
  207.246.240.122
  207.246.249.193
@@ -67284,19 +56335,15 @@
  207.246.95.196
  207.246.95.21
  207.246.95.32
-207.248.113.225
  207.248.113.236
  207.248.230.178
-207.249.133.182
  207.251.84.210
-207.253.227.226
-207.254.247.210
  207.255.193.47
  207.255.89.183
  207.30.28.244
  207.30.28.246
+207.38.83.164
  207.38.90.177
-207.44.62.36
  207.46.13.0
  207.46.13.103
  207.46.13.104
@@ -67397,6 +56444,7 @@
  207.46.132.127
  207.46.145.19
  207.5.112.195
+207.5.30.10
  207.55.247.240
  207.57.93.88
  207.58.138.166
@@ -67405,18 +56453,16 @@
  207.59.160.181
  207.7.108.203
  207.74.82.103
-207.87.244.218
  207.89.22.102
  207.96.90.42
  207.97.174.134
-207.99.102.202
+207.99.121.125
  207.99.28.140
  2072.ch
  20759379-1808-4ca1-8f3a-3923cb555671.htmlcomponentservice.com
  20760220.snapchatprime.com
  208.100.13.56
  208.100.170.91
-208.100.177.17
  208.100.26.233
  208.100.26.235
  208.100.26.236
@@ -67425,17 +56471,14 @@
  208.101.5.28
  208.102.205.3
  208.102.51.6
-208.103.228.79
  208.105.137.2
  208.106.250.221
-208.108.212.164
  208.109.100.40
  208.109.11.147
  208.109.11.34
  208.109.12.104
  208.109.12.211
  208.109.12.26
-208.109.13.144
  208.109.13.208
  208.109.14.122
  208.109.14.218
@@ -67445,30 +56488,25 @@
  208.109.209.94
  208.109.248.165
  208.109.8.153
-208.109.8.97
  208.109.9.14
+208.109.9.37
  208.110.66.130
  208.110.71.26
  208.110.85.188
-208.110.85.242
  208.110.93.52
  208.110.99.105
-208.111.31.6
  208.112.122.108
  208.113.130.13
  208.113.130.87
  208.113.131.116
  208.113.131.75
-208.113.132.249
  208.113.133.35
  208.113.135.145
  208.113.153.203
  208.113.153.222
-208.113.153.233
  208.113.153.236
  208.113.153.238
  208.113.155.2
-208.113.157.50
  208.113.162.98
  208.113.164.202
  208.113.181.161
@@ -67508,6 +56546,7 @@
  208.113.221.222
  208.113.221.229
  208.113.221.241
+208.113.221.245
  208.113.221.41
  208.113.221.51
  208.113.221.54
@@ -67569,16 +56608,17 @@
  208.113.223.187
  208.113.223.202
  208.113.249.139
+208.114.33.101
  208.114.42.234
  208.115.113.88
  208.115.113.94
  208.115.196.18
+208.115.199.82
  208.115.234.20
-208.115.240.30
  208.116.25.29
  208.116.44.162
  208.116.50.118
-208.117.85.152
+208.117.87.74
  208.118.245.141
  208.123.119.107
  208.123.119.114
@@ -67592,9 +56632,7 @@
  208.176.53.58
  208.180.145.73
  208.180.145.93
-208.180.16.17
  208.180.16.38
-208.180.181.185
  208.180.202.147
  208.180.207.205
  208.180.33.94
@@ -67602,7 +56640,6 @@
  208.191.153.193
  208.25.206.130
  208.255.161.107
-208.28.34.10
  208.29.185.38
  208.30.17.74
  208.31.49.51
@@ -67613,8 +56650,8 @@
  208.43.225.84
  208.43.225.85
  208.43.71.114
-208.46.77.203
  208.47.101.73
+208.47.176.252
  208.48.252.70
  208.51.62.51
  208.52.154.240
@@ -67623,18 +56660,14 @@
  208.52.161.99
  208.53.34.202
  208.59.170.5
-208.59.50.23
  208.6.49.2
  208.64.68.228
  208.65.181.179
-208.66.188.229
-208.66.193.76
  208.66.208.153
  208.67.1.113
  208.67.1.194
  208.67.248.254
  208.67.250.157
-208.67.251.253
  208.67.29.49
  208.67.97.229
  208.68.37.37
@@ -67654,7 +56687,6 @@
  208.74.77.246
  208.76.252.198
  208.77.130.238
-208.78.228.35
  208.78.245.218
  208.78.55.144
  208.79.50.48
@@ -67663,8 +56695,6 @@
  208.81.126.169
  208.82.115.230
  208.82.116.179
-208.82.160.69
-208.82.160.81
  208.83.1.168
  208.83.204.215
  208.84.155.68
@@ -67678,15 +56708,13 @@
  208.87.241.91
  208.87.97.100
  208.88.6.140
-208.89.176.104
  208.89.214.167
  208.90.15.84
-208.91.109.146
-208.91.111.138
  208.91.198.102
  208.91.198.110
  208.91.198.220
  208.91.198.30
+208.91.198.51
  208.91.198.85
  208.91.199.159
  208.91.199.85
@@ -67703,7 +56731,6 @@
  209.10.104.120
  209.10.104.40
  209.10.105.174
-209.10.246.154
  209.103.178.10
  209.103.178.101
  209.103.178.102
@@ -67716,10 +56743,10 @@
  209.103.178.126
  209.103.178.129
  209.103.178.130
-209.103.178.132
+209.103.178.133
  209.103.178.135
  209.103.178.136
-209.103.178.138
+209.103.178.139
  209.103.178.140
  209.103.178.144
  209.103.178.147
@@ -67727,7 +56754,6 @@
  209.103.178.151
  209.103.178.152
  209.103.178.156
-209.103.178.159
  209.103.178.16
  209.103.178.160
  209.103.178.162
@@ -67751,7 +56777,7 @@
  209.103.178.204
  209.103.178.206
  209.103.178.208
-209.103.178.210
+209.103.178.211
  209.103.178.212
  209.103.178.214
  209.103.178.217
@@ -67778,6 +56804,8 @@
  209.103.178.38
  209.103.178.4
  209.103.178.40
+209.103.178.44
+209.103.178.46
  209.103.178.48
  209.103.178.50
  209.103.178.52
@@ -67800,13 +56828,12 @@
  209.103.178.93
  209.103.178.94
  209.103.178.97
-209.103.178.98
  209.105.239.88
  209.105.243.145
  209.105.243.164
+209.107.196.213
  209.107.196.231
  209.107.196.46
-209.107.204.182
  209.107.204.48
  209.107.210.147
  209.107.214.195
@@ -67824,7 +56851,6 @@
  209.126.11.54
  209.126.110.113
  209.126.114.72
-209.126.116.205
  209.126.127.49
  209.126.13.138
  209.126.131.10
@@ -67835,13 +56861,10 @@
  209.126.76.205
  209.126.8.170
  209.126.9.243
-209.127.120.125
-209.127.18.148
+209.127.178.46
  209.127.20.106
-209.127.28.164
  209.127.28.234
  209.127.28.244
-209.128.84.137
  209.128.84.141
  209.13.96.163
  209.13.96.164
@@ -67850,7 +56873,6 @@
  209.13.96.172
  209.131.236.105
  209.140.29.226
-209.141.186.35
  209.141.33.226
  209.141.33.53
  209.141.34.47
@@ -67858,20 +56880,15 @@
  209.141.35.155
  209.141.35.27
  209.141.36.139
-209.141.36.191
-209.141.36.72
  209.141.37.101
  209.141.38.163
  209.141.40.180
  209.141.40.46
  209.141.41.103
  209.141.41.134
-209.141.41.230
  209.141.42.155
  209.141.42.182
  209.141.43.187
-209.141.43.226
-209.141.44.136
  209.141.45.173
  209.141.45.179
  209.141.45.183
@@ -67886,59 +56903,43 @@
  209.141.47.92
  209.141.48.242
  209.141.48.243
-209.141.48.68
  209.141.50.178
  209.141.50.5
-209.141.51.154
-209.141.51.211
  209.141.51.251
  209.141.51.32
  209.141.52.28
  209.141.53.10
  209.141.53.20
-209.141.53.77
-209.141.54.106
  209.141.54.122
  209.141.54.153
  209.141.54.161
  209.141.54.195
+209.141.54.196
  209.141.54.197
  209.141.54.221
  209.141.54.239
  209.141.54.72
-209.141.55.105
-209.141.55.107
-209.141.56.78
  209.141.57.57
-209.141.58.115
  209.141.58.50
  209.141.59.157
  209.141.59.18
  209.141.59.224
  209.141.59.245
  209.141.60.65
-209.141.61.111
  209.141.61.129
  209.141.61.233
  209.141.62.139
  209.145.87.30bin.sh
  209.146.23.182
-209.15.140.66
  209.15.236.190
-209.150.146.112
-209.150.150.66
-209.150.241.64
  209.150.60.107
  209.151.224.239
  209.151.224.247
  209.151.235.177
  209.151.70.1
  209.159.149.91
-209.159.152.124
  209.159.158.234
  209.16.78.27
-209.160.123.32
-209.160.40.13
  209.160.54.26
  209.160.64.61
  209.163.116.127
@@ -67947,69 +56948,23 @@
  209.163.160.253
  209.164.189.107
  209.165.163.187
-209.169.160.7
-209.169.161.146
  209.169.166.148
-209.169.181.138
-209.17.96.10
-209.17.96.106
-209.17.96.114
-209.17.96.122
  209.17.96.130
-209.17.96.138
  209.17.96.146
-209.17.96.154
-209.17.96.162
-209.17.96.170
-209.17.96.178
-209.17.96.18
  209.17.96.186
-209.17.96.194
-209.17.96.2
  209.17.96.202
-209.17.96.210
-209.17.96.218
-209.17.96.226
-209.17.96.234
-209.17.96.242
-209.17.96.250
-209.17.96.26
-209.17.96.34
-209.17.96.42
-209.17.96.50
-209.17.96.58
-209.17.96.66
-209.17.96.74
-209.17.96.82
-209.17.96.90
-209.17.96.98
-209.17.97.10
-209.17.97.106
-209.17.97.122
-209.17.97.18
-209.17.97.2
-209.17.97.26
-209.17.97.34
-209.17.97.42
-209.17.97.50
-209.17.97.58
-209.17.97.66
-209.17.97.74
-209.17.97.82
-209.17.97.90
-209.17.97.98
  209.172.0.85
  209.172.40.10
  209.172.50.172
  209.172.57.205
  209.177.86.18
  209.177.86.21
+209.177.86.22
  209.181.137.169
  209.182.202.96
  209.182.219.176
  209.182.219.37
  209.182.219.68
-209.182.238.87
  209.188.18.44
  209.188.18.45
  209.188.91.112
@@ -68022,26 +56977,23 @@
  209.190.46.193
  209.190.5.26
  209.194.236.25
+209.197.16.155
  209.197.16.172
  209.197.26.104
  209.198.180.142
  209.20.64.41
-209.200.15.168
-209.200.15.177
  209.200.23.116
  209.200.231.134
  209.200.237.152
  209.200.244.39
  209.200.44.215
-209.200.5.4
  209.203.130.25
+209.203.130.59
  209.203.22.217
  209.205.112.34
  209.205.200.13
  209.208.72.217
  209.212.194.75
-209.212.208.255
-209.212.216.17
  209.212.33.99
  209.213.199.16
  209.213.199.17
@@ -68077,13 +57029,10 @@
  209.236.117.207
  209.236.133.201
  209.236.228.26
-209.236.42.18
  209.236.75.4
-209.237.150.168
  209.237.87.177
  209.239.112.201
  209.240.35.141
-209.242.223.215
  209.244.77.241
  209.249.134.2
  209.25.170.22
@@ -68095,7 +57044,6 @@
  209.250.235.234
  209.250.236.206
  209.250.240.2
-209.250.240.6
  209.250.241.254
  209.250.243.233
  209.250.244.240
@@ -68106,16 +57054,15 @@
  209.250.251.72
  209.250.253.49
  209.250.255.60
+209.27.61.166
  209.31.182.178
  209.41.180.93
  209.41.67.169
  209.44.101.82
  209.44.113.34
  209.44.99.194
-209.45.100.108
  209.45.48.28
  209.45.61.108
-209.45.63.254
  209.45.91.79
  209.50.48.105
  209.50.48.123
@@ -68125,8 +57072,9 @@
  209.51.188.190
  209.54.34.231
  209.54.34.249
+209.54.43.203
+209.54.47.203
  209.54.60.159
-209.58.129.98
  209.58.142.157
  209.58.149.116
  209.58.152.105
@@ -68137,16 +57085,11 @@
  209.58.157.137
  209.58.157.23
  209.58.157.87
-209.58.163.232
-209.58.173.179
-209.58.173.182
  209.58.183.70
  209.58.190.4
-209.59.110.48
  209.59.137.142
  209.59.138.182
  209.59.141.149
-209.59.154.141
  209.59.166.114
  209.59.186.242
  209.59.228.221
@@ -68166,10 +57109,10 @@
  209.66.128.10
  209.66.203.43
  209.73.137.141
-209.73.145.226
  209.81.103.132
  209.81.9.223
  209.85.100.3
+209.85.219.199
  209.89.86.148
  209.90.225.194
  209.90.225.195
@@ -68184,11 +57127,9 @@
  209.90.225.242
  209.90.225.243
  209.90.225.82
-209.90.227.24
  209.90.232.167
  209.90.77.24
  209.90.77.43
-209.91.178.224
  209.92.156.53
  209.92.176.24
  209.92.176.48
@@ -68196,14 +57137,12 @@
  209.95.143.254
  209.97.129.2
  209.97.129.244
-209.97.131.176
  209.97.132.66
  209.97.133.56
  209.97.137.55
  209.97.138.179
  209.97.138.189
  209.97.140.9
-209.97.141.112
  209.97.142.132
  209.97.143.230
  209.97.143.9
@@ -68219,7 +57158,6 @@
  209.97.160.56
  209.97.161.222
  209.97.165.196
-209.97.165.231
  209.97.166.234
  209.97.167.137
  209.97.167.229
@@ -68240,11 +57178,8 @@
  209.97.183.120
  209.97.183.188
  209.97.183.252
-209.97.183.28
-209.97.185.75
  209.97.186.179
  209.97.186.48
-209.97.187.124
  209.97.187.226
  209.97.188.25
  209.97.189.249
@@ -68254,6 +57189,7 @@
  209.97.191.78
  209.97.199.149
  209.97.212.185
+209.99.129.214
  209.99.129.229
  209.99.129.37
  209.99.129.82
@@ -68275,7 +57211,6 @@
  209.99.134.127
  209.99.134.157
  209.99.134.161
-209.99.134.208
  209.99.134.235
  209.99.134.27
  209.99.134.33
@@ -68283,47 +57218,42 @@
  209.99.135.117
  209.99.135.121
  209.99.135.235
-209.99.135.40
+209.99.135.59
  209.99.136.237
  209.99.136.47
  209.99.16.16
  209.99.164.68
-209.99.168.113
-209.99.168.150
-209.99.168.155
-209.99.168.157
+209.99.168.107
  209.99.168.163
-209.99.168.166
  209.99.168.195
  209.99.168.196
-209.99.168.200
  209.99.168.221
  209.99.168.239
+209.99.168.240
  209.99.168.25
  209.99.168.3
-209.99.168.4
  209.99.168.40
  209.99.168.42
  209.99.168.43
  209.99.168.72
+209.99.168.89
  209.99.170.125
  209.99.170.239
  209.99.170.245
-209.99.171.18
+209.99.171.171
+209.99.171.6
  209.99.171.66
  209.99.172.123
+209.99.172.229
  209.99.172.253
  209.99.172.80
  209.99.172.87
  209.99.173.197
  209.99.173.87
-209.99.173.88
-209.99.173.94
  209.99.175.165
-209.99.175.167
-209.99.175.183
  209.99.175.229
  209.99.175.28
+209.99.175.32
  209.99.175.49
  2091465280215.org
  2095169429.jclecardinal.com
@@ -68348,17 +57278,13 @@
  21-123-2.vasdasdvvvv.repl.co
  21.4buyuklergazete.com
  210-365.net
-210.0.158.192
-210.1.225.5
  210.1.225.79
  210.1.226.124
  210.1.82.194
  210.10.205.158
  210.10.208.238
-210.100.142.172
-210.100.235.112
+210.100.133.38
  210.101.91.152
-210.101.91.153
  210.101.91.155
  210.104.112.207
  210.105.193.15
@@ -68367,71 +57293,53 @@
  210.106.218.191bin.sh
  210.109.108.186
  210.11.178.95
-210.111.169.113
-210.111.184.50
  210.112.121.14
  210.112.121.225
+210.112.21.108
  210.112.232.6
-210.113.198.187
+210.112.25.192
  210.113.90.139
  210.114.1.172
  210.114.17.198
-210.114.17.205
-210.114.19.7
  210.114.9.199
-210.117.228.44
+210.117.182.80
  210.118.170.11
-210.118.193.90
  210.12.127.66
-210.12.130.161
  210.12.168.79
-210.12.24.134
  210.12.27.226
  210.12.42.211
-210.12.45.130
-210.12.52.26
  210.12.71.170
+210.12.78.16
  210.121.223.61
-210.123.77.249
-210.124.127.220
+210.124.127.73
  210.124.149.19
-210.126.110.182
-210.126.15.26
  210.127.209.27
  210.127.209.30
  210.127.249.145
  210.127.253.179
  210.127.253.247
+210.13.110.60
  210.13.110.61
-210.13.56.51
-210.13.93.59
  210.14.105.23
-210.14.130.9
+210.14.105.9
  210.14.142.85
-210.14.146.80
-210.14.17.241
  210.14.69.76
  210.14.77.39
  210.140.10.26
  210.140.10.35
  210.140.172.181
-210.140.40.57
  210.143.109.157
  210.143.35.13
-210.146.152.179
  210.146.36.62
  210.149.29.182
+210.149.70.82
  210.153.106.106
-210.153.161.138
+210.157.255.130
  210.16.100.8
  210.16.101.36
  210.16.102.68
-210.16.115.8
  210.16.187.206
-210.16.187.29
  210.16.188.124
-210.16.189.4
-210.16.189.87
  210.16.81.253
  210.16.81.67
  210.16.84.102
@@ -68439,68 +57347,42 @@
  210.16.85.134
  210.16.85.142
  210.16.85.98
+210.16.88.145
  210.165.117.45
  210.166.214.192
-210.166.230.64
-210.170.21.190
-210.171.150.205
-210.172.87.226
  210.177.164.45
  210.177.243.102
-210.178.36.10
-210.178.36.55
  210.178.88.171bin.sh
  210.178.94.227
-210.179.118.20
  210.179.174.113
  210.179.174.114
  210.179.177.167
-210.179.249.148
  210.179.249.45
  210.18.133.185
-210.18.133.240
+210.180.237.212
  210.182.148.126
  210.182.169.25
  210.183.102.85
  210.183.21.48
-210.183.22.225
  210.183.46.232
-210.185.123.107
  210.185.123.37
  210.185.171.83
-210.186.147.107
+210.187.148.178
  210.187.189.107
-210.187.189.19
  210.188.218.41
-210.19.105.138
  210.19.212.234
  210.190.64.68
-210.192.94.12
-210.192.94.2
-210.192.94.7
  210.194.194.253
-210.195.156.88
  210.195.187.128
  210.195.190.88
  210.2.157.130
-210.2.172.202
-210.2.64.3
  210.2.86.96
-210.201.111.51
-210.201.118.103
  210.201.139.189
  210.205.6.107
  210.205.6.171
  210.205.6.233
  210.205.8.250
-210.206.166.3
  210.206.92.137
-210.209.125.26
-210.209.154.156
-210.209.193.235
-210.209.203.37
-210.209.204.147
-210.209.221.173
  210.209.72.232
  210.209.89.74
  210.209.93.90
@@ -68508,28 +57390,21 @@
  210.21.221.156
  210.21.226.2
  210.21.30.126
-210.210.110.124
  210.210.130.139
  210.210.136.147
+210.210.184.20
  210.210.255.7
-210.211.101.194
  210.211.107.3
  210.211.111.85
  210.211.116.204
  210.211.116.80
  210.211.124.15
  210.211.126.19
-210.211.68.196
  210.211.96.155
-210.212.104.26
  210.212.227.70
  210.212.233.34
  210.212.237.67
-210.212.253.150
  210.212.68.213
-210.213.127.197
-210.213.127.198
-210.213.127.206
  210.213.146.195
  210.216.152.122
  210.216.153.142
@@ -68539,22 +57414,19 @@
  210.22.5.117
  210.22.77.70
  210.220.150.170
+210.221.124.147
  210.221.154.117
-210.222.183.192
-210.222.200.72
+210.222.25.166
  210.222.48.13
  210.222.86.19
  210.223.141.74
  210.223.165.195
  210.223.186.182
  210.224.74.142
-210.24.102.117
  210.240.163.95
-210.242.65.96
  210.245.110.9
  210.245.119.111
  210.245.17.235
-210.245.32.137
  210.245.51.1
  210.245.51.14
  210.245.51.17
@@ -68572,7 +57444,6 @@
  210.245.51.76
  210.245.52.62
  210.245.54.97
-210.245.89.247
  210.245.92.136
  210.245.92.204
  210.245.92.228
@@ -68580,45 +57451,24 @@
  210.246.240.42
  210.246.243.70
  210.246.40.22
+210.246.63.55
  210.251.213.165
  210.251.214.133
  210.255.240.125
-210.27.177.110
-210.3.11.134
-210.3.151.147
+210.26.49.89
  210.3.176.42
  210.3.176.43
  210.3.176.44
  210.3.176.45
-210.3.217.150
-210.4.114.122
  210.4.96.73
  210.4.97.107
-210.42.225.131
-210.44.14.43
-210.44.14.45
-210.44.14.59
-210.44.14.72
-210.44.169.103
-210.44.8.51
-210.45.169.238
-210.45.172.12
-210.45.174.4
-210.45.175.7
-210.45.175.70
-210.46.216.12
  210.48.139.228
  210.48.204.118
  210.48.204.134
  210.48.4.48
-210.5.110.122
-210.5.116.180
-210.5.116.181
-210.5.116.182
  210.5.151.232
  210.5.172.6
  210.5.85.150
-210.50.8.102
  210.51.13.174
  210.51.174.189
  210.54.37.190
@@ -68633,9 +57483,6 @@
  210.56.244.46
  210.56.245.10
  210.56.245.94
-210.56.27.174
-210.56.29.131
-210.56.8.83
  210.57.209.134
  210.57.210.150
  210.57.214.70
@@ -68643,96 +57490,61 @@
  210.57.219.131
  210.57.219.135
  210.57.228.128
-210.57.235.233
  210.57.237.70
  210.59.98.106
  210.6.150.39
-210.6.192.20
-210.6.5.5
  210.61.216.66
  210.61.26.38
  210.61.47.79
-210.62.186.212
-210.64.103.139
  210.64.214.91
-210.65.138.196
  210.65.47.133
  210.66.100.173
-210.66.115.238
-210.66.133.119
-210.68.242.104
-210.68.95.115
  210.71.232.236
-210.72.25.225
-210.72.88.165
-210.72.88.87
  210.72.91.6
  210.73.220.186
  210.74.11.97
  210.74.12.169
-210.74.15.139
  210.74.8.66
  210.76.64.46
-210.76.9.1
  210.89.176.166
  210.89.46.130
  210.9.47.154
-210.90.187.51
-210.91.251.168
  210.92.18.171
  210.92.18.179
  210.92.18.25
  210.94.133.243
-210.94.185.235
  210.97.192.120
-210.99.231.62
  2101movies.online
  210676-dot-n-e-w-me-ss-age-po-rt-al.wl.r.appspot.com
  2109f.com
  210sadivorce.com
  211.101.18.158
  211.101.61.231
-211.103.110.137
-211.103.121.185
-211.103.158.189
  211.103.172.114
-211.103.208.76
  211.103.213.125
-211.103.213.45
  211.103.222.34
-211.103.237.82
-211.103.4.100
-211.103.4.5
  211.104.146.238
  211.104.160.202
  211.104.217.42
  211.104.242.52
-211.105.214.127
  211.105.40.71
-211.106.241.42
-211.107.14.12
  211.108.51.122
  211.108.69.103
  211.109.11.227
  211.110.125.62
  211.110.229.161
-211.112.103.38
  211.112.18.37
  211.112.187.197
-211.112.205.57
-211.112.69.34
  211.114.178.168
  211.115.110.64
  211.115.212.166
  211.115.213.103
  211.115.213.42
-211.115.254.51
  211.115.32.22
  211.115.89.97
  211.116.217.52
  211.116.220.205
  211.117.60.11
-211.118.226.133
  211.119.131.234
  211.121.191.53
  211.136.100.154
@@ -68756,65 +57568,31 @@
  211.137.225.59
  211.137.225.83
  211.137.225.96
-211.137.234.86
-211.137.5.43
-211.139.125.115
  211.140.118.18
  211.140.196.90
-211.141.115.70
-211.141.200.137
-211.141.200.175
-211.141.234.16
-211.141.41.210
-211.142.118.34
-211.142.138.108
-211.142.169.226
-211.142.215.250
-211.142.228.174
-211.143.142.139
+211.143.253.166
  211.144.114.31
-211.144.149.190
-211.144.154.70
  211.144.221.226
  211.144.69.249
-211.144.96.41
+211.145.38.94
+211.145.38.96
+211.145.38.97
  211.147.150.245
  211.151.130.24
  211.152.33.24
-211.152.51.106
  211.152.55.174
-211.155.128.203
  211.155.225.104
-211.155.230.46
-211.155.88.36
-211.157.101.163
-211.157.153.194
-211.157.166.195
-211.157.179.168
  211.157.179.38
-211.157.183.78
-211.157.186.110
  211.159.148.181
  211.159.153.62
  211.159.160.173
  211.159.165.137
-211.159.166.12
  211.159.169.96
-211.159.170.194
  211.159.171.238
  211.159.183.117
  211.159.183.238
  211.159.186.152
-211.159.194.18
-211.160.244.77
  211.161.60.21
-211.162.122.249
-211.162.122.250
-211.162.123.157
-211.162.125.93
-211.167.240.253
-211.167.96.88
-211.168.108.124
  211.170.28.251
  211.170.28.252
  211.170.61.184
@@ -68826,77 +57604,53 @@
  211.174.59.120
  211.174.63.235
  211.177.113.84
+211.178.68.164
  211.180.175.198
  211.184.131.136
  211.184.131.136bin.sh
  211.184.187.129
-211.184.2.252
-211.187.9.234
  211.189.18.242
  211.189.18.73
  211.19.31.123
  211.19.36.87
  211.191.178.139
+211.192.157.218
+211.192.157.63
  211.193.184.102
  211.193.31.52
  211.193.4.108
  211.193.60.137
  211.194.183.51
  211.194.20.45
-211.194.25.40
-211.195.135.231
-211.195.159.19
-211.195.187.17
-211.195.250.186
  211.196.195.46
+211.196.56.18
  211.197.117.73
  211.197.168.102
-211.197.19.253
-211.197.19.254
-211.197.96.125
  211.198.174.72
  211.198.180.137
  211.198.184.230
-211.198.212.193
-211.198.212.196
-211.198.212.227
  211.198.240.52
  211.198.31.204
  211.198.90.77bin.sh
-211.199.147.75
  211.199.153.194
  211.199.233.146
-211.199.65.180
-211.2.181.197
-211.20.102.253
-211.20.123.130
  211.20.145.202
  211.20.145.204
-211.20.151.172
  211.20.154.167
  211.20.176.82
  211.20.181.113
-211.20.222.157
-211.20.226.61
  211.20.238.33
-211.20.254.167
  211.200.178.178
-211.201.146.31
  211.202.2.220
-211.202.48.120
  211.203.180.144
  211.204.215.157
  211.204.215.157bin.sh
  211.204.50.10
-211.205.224.177
-211.205.237.53
  211.206.120.187
  211.206.124.179
-211.206.189.122
-211.206.189.69
+211.207.205.124
  211.21.104.173
  211.21.120.163
-211.21.182.18
  211.21.92.211
  211.210.154.32
  211.210.161.162
@@ -68904,58 +57658,45 @@
  211.210.3.214
  211.211.184.191
  211.214.161.205
+211.216.71.22
  211.218.105.101
  211.218.109.221
  211.218.126.236
  211.218.192.149
  211.218.245.66
  211.219.18.186
-211.219.233.94
-211.219.246.119
-211.22.107.150
-211.22.135.32
+211.219.71.38
  211.22.143.178
-211.22.149.217
  211.22.154.223
-211.22.176.39
-211.22.209.93
  211.22.236.44
-211.22.244.205
  211.220.195.71
  211.220.214.50
  211.220.27.191
  211.220.63.148
-211.221.1.29
+211.221.107.75
  211.221.155.6
  211.221.59.241
-211.222.168.47
+211.222.244.136
  211.222.69.222
  211.223.201.177
  211.223.205.250
-211.223.95.214
-211.224.24.171
-211.225.150.129
-211.225.2.66
-211.227.123.243
-211.227.139.97
  211.229.107.60
  211.229.139.87
  211.229.19.45
  211.229.236.149
  211.229.30.62
-211.23.156.28
+211.23.105.226
+211.23.128.57
+211.23.45.46
+211.230.136.96
  211.230.156.161
-211.230.87.97
  211.231.72.94
-211.231.76.198
-211.232.235.250
  211.233.11.27
  211.233.16.217
  211.233.38.165
  211.233.50.192
  211.233.56.228
  211.233.58.19
-211.233.68.2
  211.233.69.41
  211.234.106.119
  211.234.119.189
@@ -68965,8 +57706,6 @@
  211.236.192.230
  211.236.43.200
  211.237.120.13
-211.237.27.5
-211.238.11.7
  211.238.147.196
  211.238.83.238bin.sh
  211.239.124.233
@@ -68977,19 +57716,18 @@
  211.24.28.202
  211.24.73.223
  211.24.8.49
-211.24.85.234
  211.24.95.49
-211.240.98.140
  211.241.175.50
  211.241.177.69
  211.241.183.16
  211.242.110.197
+211.243.171.182
  211.244.168.32
  211.245.106.41
  211.246.253.30
  211.248.241.236
  211.25.101.131
-211.250.233.150
+211.250.42.101
  211.250.72.142
  211.251.235.65
  211.251.239.72
@@ -69011,10 +57749,12 @@
  211.255.32.134
  211.255.32.19
  211.26.10.49
-211.26.11.53
  211.26.187.128
  211.27.147.67
+211.27.2.248
+211.32.122.110
  211.32.50.110
+211.34.127.193
  211.35.66.57
  211.35.66.61
  211.35.67.133
@@ -69036,82 +57776,51 @@
  211.38.98.67
  211.39.130.176
  211.40.128.112
-211.40.48.105
  211.40.53.149
  211.40.68.132
-211.41.212.37
  211.43.174.165
  211.43.196.32
  211.43.206.220
  211.43.8.168
  211.45.247.122
-211.45.78.196
  211.47.102.51
-211.47.107.22
  211.47.118.102
  211.47.237.17
  211.47.69.153
+211.47.96.39
  211.47.97.64
  211.47.99.228
  211.48.121.149
  211.48.20.244
-211.48.84.171
  211.48.90.28
  211.48.90.28bin.sh
  211.49.225.146
  211.49.225.208
  211.5.245.2
  211.50.170.252
-211.50.3.78
-211.52.107.132
+211.54.253.11
  211.55.116.245
  211.55.116.245bin.sh
-211.55.251.81
  211.56.15.42
  211.56.15.44
  211.56.15.46
  211.57.153.250
-211.57.28.181
-211.57.31.133
  211.58.220.37
-211.59.104.104
  211.63.170.219
  211.63.176.88
-211.63.252.34
  211.63.60.50
  211.63.71.72
-211.65.107.179
  211.70.159.13
-211.70.159.30
  211.70.51.6
  211.72.111.146
-211.72.111.91
-211.72.136.110
-211.72.136.111
-211.72.168.179
-211.75.102.247
-211.75.132.61
-211.75.14.26
-211.75.157.61
-211.75.163.219
-211.75.195.61
  211.75.215.176
-211.75.217.242
-211.75.227.44
-211.75.55.8
-211.75.76.138
-211.84.226.2
-211.90.246.115
-211.90.37.212
-211.91.254.220
-211.93.68.203
+211.93.11.178
  211.95.47.166
  211.95.84.146
-211.95.96.14
-211.99.227.4
  211.99.229.3
  21112.com
  211740640418593-dot-wetransfer-auth-file-341.appspot.com
+212.0.125.5
  212.1.210.170
  212.1.71.129
  212.1.71.130
@@ -69124,10 +57833,11 @@
  212.102.35.102
  212.102.36.166
  212.102.49.251
+212.102.49.72
+212.102.52.232
  212.102.53.129
  212.103.61.157
  212.103.61.160
-212.103.61.50
  212.107.237.28
  212.107.238.101
  212.108.216.5
@@ -69146,7 +57856,6 @@
  212.112.113.235
  212.112.124.123
  212.112.97.27
-212.113.233.0
  212.113.35.162
  212.114.49.242
  212.114.52.21
@@ -69155,19 +57864,20 @@
  212.115.108.181
  212.115.232.79
  212.115.239.147
+212.115.49.203
  212.115.49.229
  212.115.51.101
  212.115.51.154
  212.115.51.210
  212.115.51.84
-212.116.109.70
  212.117.165.14
  212.117.170.192
  212.117.19.215
-212.118.24.10
+212.118.28.210
  212.119.190.162
  212.119.226.86
  212.119.241.46
+212.119.41.92
  212.119.44.125
  212.119.45.113
  212.119.46.135
@@ -69180,7 +57890,7 @@
  212.122.187.209
  212.124.114.242
  212.124.160.4
-212.124.21.41
+212.124.182.166
  212.125.128.12
  212.125.15.254
  212.126.102.142
@@ -69189,51 +57899,37 @@
  212.126.119.6
  212.126.97.83
  212.129.1.25
-212.129.144.231
  212.129.152.27
  212.129.154.221
  212.129.16.22
-212.129.17.73
  212.129.239.224
+212.129.24.108
  212.129.24.72
  212.129.24.79
  212.129.242.171
  212.129.245.90
  212.129.246.52
-212.129.249.216
-212.129.249.33
  212.129.27.74
-212.129.27.80
  212.129.33.185
-212.129.36.238
-212.129.40.43
-212.129.41.230
-212.129.41.9
-212.129.45.220
+212.129.34.163
  212.129.46.40
  212.129.47.122
  212.129.47.201
  212.129.47.208
  212.129.48.175
  212.129.49.38
-212.129.5.154
  212.129.50.181
-212.129.52.185
  212.129.52.198
  212.129.53.188
  212.129.54.164
  212.129.55.0
  212.129.9.233
-212.13.128.229
  212.13.49.186
-212.130.102.221
  212.14.163.206
  212.142.104.138
-212.142.121.168
+212.142.134.150
  212.142.155.17
-212.142.226.124
  212.142.226.93
-212.143.172.198
  212.143.230.27
  212.143.28.43
  212.144.253.67
@@ -69242,8 +57938,6 @@
  212.146.44.91
  212.149.202.12
  212.15.184.190
-212.152.181.201
-212.154.169.88
  212.154.23.121
  212.154.250.21
  212.154.58.100
@@ -69265,24 +57959,17 @@
  212.154.83.119
  212.154.83.124
  212.156.115.58
-212.156.136.114
-212.156.17.218
-212.156.174.60
-212.156.221.69
-212.156.44.42
  212.156.55.34
  212.156.59.70
  212.156.86.130
  212.156.86.226
  212.156.87.194
  212.156.94.118
-212.158.160.217
  212.158.163.67
  212.158.167.98
-212.159.115.125
  212.159.61.155
  212.16.104.33
-212.16.142.92
+212.16.186.196
  212.160.230.70
  212.160.230.96
  212.160.230.97
@@ -69291,10 +57978,11 @@
  212.162.14.222
  212.162.151.144
  212.166.68.146
+212.168.31.17
  212.17.102.75
  212.170.18.65
  212.170.207.29
-212.170.92.253
+212.171.89.234
  212.172.38.61
  212.172.74.14
  212.174.201.38
@@ -69302,13 +57990,10 @@
  212.175.113.250
  212.175.153.158
  212.175.167.137
-212.175.180.89
  212.175.189.83
-212.175.81.220
  212.175.87.57
  212.175.87.9
-212.178.135.62
-212.178.154.174
+212.182.124.88
  212.183.162.103
  212.185.62.33
  212.186.170.226
@@ -69316,12 +58001,10 @@
  212.186.191.177
  212.186.222.236
  212.186.251.2
-212.187.22.18
  212.187.48.150
  212.187.98.26
  212.188.192.20
  212.188.66.218
-212.19.14.26
  212.19.20.115
  212.19.20.87
  212.191.132.210
@@ -69333,33 +58016,31 @@
  212.200.101.173
  212.200.118.98
  212.200.146.50
-212.200.210.66
  212.200.212.50
  212.200.217.80
  212.200.236.42
+212.200.32.91
  212.200.89.254
  212.203.55.32
  212.205.112.162
  212.205.185.170
  212.205.214.216
-212.205.224.44
  212.205.236.80
  212.205.76.250
  212.21.10.127
-212.21.136.93
  212.21.66.6
-212.217.118.100
-212.217.118.99
  212.22.70.65
  212.22.72.254
  212.22.85.104
+212.220.0.17
  212.220.0.176
  212.220.115.246
  212.220.204.238
-212.220.30.109
+212.220.206.155
  212.220.99.211
  212.224.98.221
  212.225.225.142
+212.225.225.219
  212.227.114.114
  212.227.119.183
  212.227.141.53
@@ -69372,29 +58053,21 @@
  212.227.39.1
  212.227.54.144
  212.230.136.235
-212.231.184.214
-212.231.185.82
+212.230.157.190
  212.231.186.51
  212.231.216.2
  212.233.130.198
  212.233.132.178
-212.233.154.29
-212.233.164.252
-212.233.175.118
-212.233.200.143
-212.233.207.202
  212.233.213.29
  212.233.216.133
  212.233.218.5
  212.234.12.71
  212.235.111.111
-212.235.114.141
  212.235.5.188
  212.235.53.129
  212.237.0.244
  212.237.10.57
  212.237.100.181
-212.237.112.63
  212.237.15.70
  212.237.23.60
  212.237.24.117
@@ -69425,21 +58098,14 @@
  212.250.127.100
  212.250.127.111
  212.251.11.211
-212.251.130.72
-212.251.230.102
+212.251.132.10
  212.251.232.254
  212.252.134.107
  212.252.63.243
  212.252.63.247
  212.253.125.253
-212.253.86.249
-212.253.94.254
  212.26.132.213
-212.26.136.212
-212.26.248.156
  212.28.71.86
-212.28.77.192
-212.28.77.194
  212.28.84.105
  212.3.109.7
  212.3.146.80
@@ -69447,12 +58113,10 @@
  212.3.193.17
  212.3.205.85
  212.3.209.158
-212.30.203.42
  212.31cf4fdae.com
  212.32.229.173
  212.32.231.161
  212.32.233.237
-212.32.242.111
  212.33.199.47
  212.33.206.226
  212.33.240.140
@@ -69461,13 +58125,9 @@
  212.33.250.241
  212.33.255.82
  212.33.28.50
-212.34.11.3
  212.34.144.12
  212.34.225.118
-212.34.238.164
  212.34.239.253
-212.34.30.3
-212.35.69.38
  212.36.95.182
  212.37.27.58
  212.38.168.19
@@ -69475,15 +58135,11 @@
  212.4.57.179
  212.4.57.180
  212.41.210.78
-212.42.104.101
  212.42.116.29
  212.42.117.207
-212.42.196.98
  212.42.199.112
-212.42.203.154
  212.42.99.22
  212.42.99.32
-212.43.123.18
  212.46.255.78
  212.47.220.165
  212.47.229.189
@@ -69500,26 +58156,21 @@
  212.47.238.207
  212.47.241.15
  212.47.243.54
-212.47.244.195
+212.47.246.177
  212.47.247.105
  212.47.247.88
  212.47.251.127
  212.47.251.79
-212.48.159.7
  212.48.251.21
  212.48.66.92
  212.48.68.133
-212.48.70.90
  212.48.72.62
  212.48.87.19
-212.49.115.70
  212.49.69.67
  212.49.70.12
  212.49.81.113
-212.5.158.205
+212.5.200.188
  212.50.227.91
-212.50.64.56
-212.50.86.172
  212.51.132.226
  212.51.136.133
  212.51.138.2
@@ -69533,12 +58184,10 @@
  212.51.156.131
  212.51.159.132
  212.52.131.9
-212.55.181.78
  212.56.194.238
  212.56.202.198
  212.56.203.114
  212.56.211.138
-212.56.214.61
  212.57.42.225
  212.58.103.36
  212.58.120.155
@@ -69548,15 +58197,12 @@
  212.59.30.110
  212.59.6.16
  212.60.161.111
-212.60.20.189
  212.60.20.49
  212.60.5.220
  212.60.64.220
-212.62.49.110
  212.63.206.39
  212.64.0.75
  212.64.1.170
-212.64.100.96
  212.64.101.163
  212.64.102.106
  212.64.111.18
@@ -69565,24 +58211,23 @@
  212.64.14.185
  212.64.198.41
  212.64.23.30
+212.64.25.106
  212.64.27.53
  212.64.29.136
  212.64.32.64
  212.64.33.244
+212.64.34.124
  212.64.36.88
  212.64.4.186
  212.64.4.3
  212.64.40.200
  212.64.43.52
  212.64.47.123
-212.64.48.45
  212.64.49.70
  212.64.5.128
  212.64.5.28
-212.64.53.252
  212.64.55.229
  212.64.60.50
-212.64.61.70
  212.64.65.2
  212.64.66.135
  212.64.66.208
@@ -69590,9 +58235,9 @@
  212.64.68.71
  212.64.69.175
  212.64.7.134
-212.64.7.167
+212.64.71.101
  212.64.71.225
-212.64.72.184
+212.64.71.254
  212.64.76.91
  212.64.77.154
  212.64.77.173
@@ -69601,6 +58246,7 @@
  212.64.79.154
  212.64.8.10
  212.64.80.169
+212.64.83.74
  212.64.86.16
  212.64.91.105
  212.64.91.114
@@ -69610,22 +58256,19 @@
  212.67.0.150
  212.67.205.246
  212.68.168.178
+212.68.249.25
  212.69.10.210
  212.69.10.75
  212.69.139.173
  212.69.166.122
  212.69.19.223
-212.69.19.250
  212.69.218.47
-212.69.24.37
-212.69.24.42
  212.7.20.104
  212.70.149.21
  212.70.149.5
  212.70.149.53
  212.70.149.69
  212.70.149.84
-212.70.156.137
  212.71.233.31
  212.71.237.140
  212.71.238.147
@@ -69635,19 +58278,14 @@
  212.71.254.10
  212.72.142.214
  212.72.149.234
-212.72.214.149
  212.72.47.218
  212.73.128.194
  212.73.131.30
-212.73.143.101
  212.73.150.21
-212.73.68.142
-212.73.68.162
  212.73.69.6
-212.77.138.155
+212.75.232.147
  212.77.43.160
  212.79.169.50
-212.8.105.57
  212.8.189.20
  212.8.189.28
  212.8.244.242
@@ -69657,9 +58295,9 @@
  212.8.250.141
  212.8.253.49
  212.80.219.11
-212.81.208.102
  212.83.129.80
  212.83.130.61
+212.83.131.65
  212.83.133.41
  212.83.133.63
  212.83.135.58
@@ -69672,9 +58310,7 @@
  212.83.152.183
  212.83.157.81
  212.83.158.105
-212.83.162.123
  212.83.166.62
-212.83.167.190
  212.83.169.24
  212.83.169.45
  212.83.169.60
@@ -69685,9 +58321,7 @@
  212.83.178.35
  212.83.182.10
  212.83.188.161
-212.83.188.222
  212.83.189.95
-212.83.191.184
  212.83.35.11
  212.83.35.173
  212.83.58.207
@@ -69696,25 +58330,14 @@
  212.83.58.216
  212.83.58.219
  212.83.58.231
-212.83.8.75
-212.83.8.76
-212.83.8.77
-212.83.8.79
-212.83.8.80
-212.83.8.81
  212.85.69.14
-212.85.83.91
  212.86.114.74
  212.86.32.106
-212.87.169.49
-212.87.172.113
-212.87.172.76
  212.89.173.216
  212.9.185.194
  212.90.166.34
  212.90.167.90
  212.90.168.150
-212.90.170.166
  212.91.188.166
  212.91.85.1
  212.91.91.242
@@ -69730,15 +58353,8 @@
  212.94.111.13
  212.95.110.30
  212.95.137.19
-212.95.146.3
  212.95.146.32
  212.95.146.65
-212.95.150.46
-212.95.152.141
-212.95.152.161
-212.95.152.251
-212.95.175.140
-212.95.175.226
  212.95.41.41
  212.96.34.143
  212.97.48.5
@@ -69756,51 +58372,47 @@
  213.100.212.187
  213.101.151.4
  213.102.68.48
-213.102.74.187
-213.103.153.104
  213.105.29.14
+213.108.1.164
  213.108.134.182
-213.108.162.200
+213.108.160.152
+213.108.162.108
  213.108.162.237
  213.108.18.34
-213.108.196.20
-213.108.199.168
+213.108.199.105
+213.108.2.163
  213.108.200.11
  213.108.248.127
  213.108.249.127
-213.109.12.126
+213.108.5.226
  213.109.160.48
  213.109.162.199
  213.109.162.82
  213.109.163.216
  213.109.235.231
+213.109.238.156
  213.109.6.85
  213.111.123.68
  213.111.197.180
  213.111.197.81
  213.111.65.125
-213.113.125.117
  213.113.250.106
  213.114.231.129
  213.115.254.197
  213.118.237.146
-213.119.79.248
-213.123.191.179
+213.123.141.104
  213.123.237.152
  213.123.60.59
  213.124.126.26
  213.125.144.146
  213.125.67.108
-213.127.125.184
  213.129.99.10
-213.131.45.75
  213.133.100.200
  213.133.81.2
  213.134.192.13
  213.135.4.164
  213.135.42.100
  213.135.67.42
-213.135.86.10
  213.136.40.37
  213.136.68.62
  213.136.71.124
@@ -69810,63 +58422,44 @@
  213.136.78.113
  213.136.79.123
  213.136.80.134
-213.136.83.223
  213.136.85.17
  213.136.87.165
  213.136.89.190
-213.136.90.123
  213.136.90.194
  213.136.94.142
  213.137.179.203
-213.137.63.239
  213.138.77.238
-213.138.78.150
-213.139.206.50
-213.139.212.154
-213.14.112.92
-213.14.153.159
-213.14.165.254
+213.138.88.165
  213.14.31.122
  213.14.6.17
  213.14.6.2
  213.14.6.5
  213.141.131.22
-213.141.141.150
-213.141.153.218
  213.141.157.220
-213.141.33.240
  213.141.41.178
  213.141.47.155
-213.141.68.49
  213.142.185.1
  213.142.206.146
  213.142.218.226
  213.144.147.149
  213.144.147.16
  213.144.157.36
-213.144.66.249
  213.145.110.75
  213.145.137.102
-213.145.5.146
  213.147.107.58
-213.147.97.225
  213.148.199.23
  213.149.103.132
  213.149.171.218
-213.149.174.251
-213.149.182.113
  213.149.190.193
+213.149.239.148
  213.149.31.47
-213.149.61.105
+213.149.61.131
  213.150.206.88
  213.152.161.101
  213.152.161.249
  213.152.161.40
  213.152.176.162
-213.152.186.132
-213.152.186.173
  213.154.0.120
-213.154.13.11
  213.154.2.42
  213.154.229.27
  213.154.3.102
@@ -69875,7 +58468,10 @@
  213.155.3.216
  213.157.191.123
  213.158.29.179
+213.159.204.3
+213.159.208.129
  213.159.38.90
+213.16.52.249
  213.16.81.182
  213.16.99.180
  213.16.99.24
@@ -69883,11 +58479,9 @@
  213.160.150.239
  213.160.156.181
  213.160.175.212
-213.160.190.239
  213.160.91.138
  213.162.112.80
  213.162.22.190
-213.162.73.214
  213.163.153.237
  213.163.181.33
  213.163.73.106
@@ -69911,18 +58505,14 @@
  213.168.187.27
  213.168.190.59
  213.168.210.76
-213.171.163.29
  213.171.196.14
  213.171.196.79
  213.171.225.234
  213.171.37.206
-213.171.37.45
  213.171.50.48
-213.171.58.162
  213.172.49.129
  213.172.91.53
  213.173.80.3
-213.173.93.228
  213.174.0.72
  213.174.123.194
  213.174.156.71
@@ -69930,10 +58520,10 @@
  213.175.197.156
  213.175.215.160
  213.175.221.110
+213.176.35.212
  213.176.35.40
  213.176.36.147
  213.176.36.42
-213.176.48.151
  213.177.107.170
  213.177.199.228
  213.178.155.74
@@ -69941,15 +58531,13 @@
  213.178.252.30
  213.178.28.118
  213.178.38.246
-213.178.54.106
-213.18.150.131
+213.178.60.162
  213.180.31.149
  213.180.70.138
  213.180.89.75
-213.181.195.28
  213.181.195.31
  213.182.138.224
-213.183.107.6
+213.182.90.251
  213.183.53.250
  213.183.56.121
  213.183.62.154
@@ -69957,17 +58545,14 @@
  213.183.75.84
  213.184.100.132
  213.184.227.188
-213.184.254.128
  213.185.128.150
  213.185.128.152
-213.185.21.133
  213.186.126.89
  213.186.127.3
  213.186.153.75
  213.186.162.164
  213.186.46.93
  213.186.48.20
-213.187.77.253
  213.188.179.243
  213.188.179.245
  213.189.178.163
@@ -69976,25 +58561,19 @@
  213.189.4.139
  213.190.100.135
  213.190.50.166
+213.190.6.6
  213.191.105.236
  213.191.135.189
-213.192.13.15
  213.193.42.1
  213.193.83.251
-213.194.140.151
  213.194.149.28
  213.194.173.90
-213.194.99.235
  213.195.127.45
-213.196.89.232
  213.197.182.158
  213.197.72.201
  213.198.67.46
-213.200.174.159
  213.200.221.94
-213.200.236.95
  213.202.212.78
-213.202.222.90
  213.202.252.50
  213.202.255.4
  213.203.138.236
@@ -70002,19 +58581,14 @@
  213.206.91.61
  213.207.37.214
  213.207.92.40
+213.209.238.226
  213.21.15.22
-213.21.86.130
  213.210.67.186
-213.211.111.206
-213.212.201.228
-213.212.63.61
-213.215.244.18
  213.216.48.21
  213.216.48.9
-213.217.178.37
-213.217.34.75
  213.218.137.112
  213.218.154.210
+213.219.144.79
  213.219.210.178
  213.219.210.180
  213.219.210.182
@@ -70025,12 +58599,12 @@
  213.222.56.130
  213.226.11.149
  213.226.114.189
+213.226.141.39
  213.227.154.145
  213.227.155.145
  213.227.205.178
  213.227.57.58
  213.227.93.117
-213.228.81.141
  213.229.125.87
  213.229.60.50
  213.229.86.240
@@ -70039,24 +58613,19 @@
  213.230.107.9
  213.230.110.100
  213.230.127.141
-213.230.6.17
  213.230.67.32
  213.230.69.33
  213.230.71.0
  213.230.77.13
  213.230.96.243
  213.231.21.109
-213.232.211.253
  213.233.110.14
-213.233.179.197
  213.233.57.134
  213.234.0.242
  213.234.119.4
  213.234.197.54
  213.234.238.52
-213.234.252.110
  213.234.31.22
-213.238.239.78
  213.238.8.11
  213.239.194.252
  213.239.196.9
@@ -70077,11 +58646,8 @@
  213.239.220.183
  213.239.232.113
  213.24.125.168
-213.241.94.66
  213.243.242.9
-213.244.115.130
  213.244.123.182
-213.244.240.85
  213.244.8.59
  213.245.241.3
  213.248.112.35
@@ -70089,8 +58655,6 @@
  213.248.39.163
  213.249.156.189
  213.249.203.14
-213.25.135.27
-213.25.46.110
  213.250.21.112
  213.250.247.146
  213.251.132.198
@@ -70109,22 +58673,19 @@
  213.252.247.233
  213.252.247.69
  213.253.214.229
-213.254.157.3
  213.254.212.186
  213.254.6.99
  213.27.152.15
+213.27.189.252
  213.3.24.104
  213.3.25.204
  213.3.26.176
-213.30.51.82
  213.31.57.117
-213.32.10.80
-213.32.10.81
+213.32.101.187
  213.32.103.143
  213.32.108.123
  213.32.111.52
  213.32.111.53
-213.32.113.159
  213.32.126.47
  213.32.22.189
  213.32.23.54
@@ -70142,6 +58703,7 @@
  213.32.6.132
  213.32.63.123
  213.32.63.93
+213.32.71.196
  213.32.77.242
  213.32.78.219
  213.32.83.233
@@ -70150,16 +58712,11 @@
  213.32.91.71
  213.32.92.57
  213.32.95.79
-213.33.147.213
  213.33.157.204
-213.33.164.114
  213.33.179.242
  213.33.179.243
  213.33.179.244
-213.33.179.39
  213.34.115.158
-213.34.163.254
-213.34.171.254
  213.35.152.193
  213.35.152.198
  213.35.191.39
@@ -70170,35 +58727,24 @@
  213.4.38.162
  213.42.28.185
  213.42.95.134
-213.45.9.225
  213.46.192.213
  213.46.85.185
-213.47.111.35
  213.47.114.114
  213.47.148.252
  213.47.252.190
  213.47.26.58
  213.47.64.105
  213.48.232.9
-213.48.6.125
  213.49.242.106
  213.5.17.18
-213.5.17.190
  213.5.19.108
  213.5.67.223
-213.50.195.125
  213.52.129.250
  213.52.74.198
-213.55.77.131
-213.55.90.51
  213.57.63.10
  213.58.202.70
-213.59.118.118
  213.59.135.87
-213.59.249.19
-213.6.10.148
  213.6.101.174
-213.6.110.194
  213.6.116.222
  213.6.118.170
  213.6.122.225
@@ -70206,9 +58752,8 @@
  213.6.141.114
  213.6.141.146
  213.6.147.138
-213.6.149.30
-213.6.16.218
  213.6.162.6
+213.6.199.94
  213.6.210.50
  213.6.227.38
  213.6.244.178
@@ -70220,26 +58765,19 @@
  213.6.66.242
  213.6.66.66
  213.6.68.210
-213.6.82.74
  213.60.152.7
  213.60.19.18
  213.60.210.202
-213.60.3.44
  213.61.149.100
  213.61.215.54
  213.61.220.144
  213.61.89.51
-213.64.219.153
-213.65.244.86
  213.7.96.25
  213.76.181.70
  213.79.101.98
-213.79.122.233
  213.8.115.147
-213.8.160.20
  213.80.166.5
  213.80.225.40
-213.81.147.251
  213.81.155.129
  213.81.161.155
  213.81.178.129
@@ -70266,12 +58804,10 @@
  213.81.178.248
  213.81.178.253
  213.81.182.29
-213.81.196.31
-213.81.196.32
  213.81.203.66
+213.81.209.81
  213.81.209.89
  213.82.174.226
-213.85.235.35
  213.86.150.242
  213.86.23.219
  213.86.4.51
@@ -70288,8 +58824,10 @@
  213.92.191.122
  213.92.200.135
  213.92.254.112
+213.92.254.200
  213.92.254.28
  213.93.145.183
+213.94.60.253
  213.95.149.22
  213.96.16.193
  213.96.240.156
@@ -70316,16 +58854,12 @@
  216.107.149.82
  216.107.238.165
  216.108.227.39
-216.108.236.61
-216.110.231.197
+216.108.228.75
+216.115.152.109
  216.115.153.201
-216.115.206.2
  216.115.225.91
-216.117.133.138
  216.117.136.95
-216.117.227.198
  216.118.251.2
-216.119.164.156
  216.120.237.30
  216.121.123.115
  216.121.63.153
@@ -70336,15 +58870,10 @@
  216.126.82.39
  216.127.171.242
  216.13.56.89
-216.130.158.134
-216.130.246.244
-216.136.103.252
  216.138.32.4
  216.138.34.116
  216.139.123.119
-216.14.72.228
  216.143.116.8
-216.143.135.241
  216.144.120.16
  216.144.243.34
  216.144.248.186
@@ -70355,7 +58884,6 @@
  216.145.89.198
  216.146.196.16
  216.146.251.8
-216.146.33.123
  216.151.130.0
  216.151.130.1
  216.151.130.10
@@ -71128,12 +59656,16 @@
  216.151.180.129
  216.151.180.136
  216.151.180.184
-216.151.180.39
+216.151.180.195
+216.151.180.196
  216.151.180.81
  216.151.183.112
+216.151.183.220
+216.151.183.45
  216.151.183.57
  216.151.183.87
  216.151.184.73
+216.151.191.92
  216.151.27.241
  216.152.249.0
  216.152.249.1
@@ -71655,15 +60187,13 @@
  216.157.27.59
  216.158.192.15
  216.158.192.32
-216.158.194.60
+216.158.194.49
  216.158.208.40
  216.158.208.7
  216.158.217.2
  216.158.232.133
  216.158.93.104
  216.158.93.106
-216.158.97.113
-216.161.214.11
  216.164.16.190
  216.164.192.25
  216.167.162.37
@@ -71686,6 +60216,7 @@
  216.170.126.102
  216.171.167.38
  216.172.109.152
+216.172.109.153
  216.172.109.155
  216.172.129.137
  216.172.129.232
@@ -71712,9 +60243,8 @@
  216.180.117.37
  216.180.117.68
  216.180.117.96
-216.181.255.13
-216.182.106.179
  216.183.177.131
+216.183.222.135
  216.183.32.98
  216.183.40.209
  216.183.40.225
@@ -71724,13 +60254,12 @@
  216.185.114.222
  216.185.44.230
  216.186.133.172
+216.186.223.67
  216.186.250.53
  216.187.92.10
-216.189.116.247
  216.189.145.11
  216.189.153.207
  216.189.153.64
-216.189.177.22
  216.189.52.48
  216.191.204.114
  216.191.44.114
@@ -71738,16 +60267,15 @@
  216.193.128.54
  216.194.161.135
  216.194.165.98
+216.195.33.230
  216.196.140.205
-216.196.223.82
  216.199.232.112
  216.20.131.111
  216.200.166.188
-216.201.242.153
  216.207.207.150
  216.208.127.101
-216.208.226.25
  216.211.180.40
+216.211.38.25
  216.212.243.150
  216.213.170.114
  216.213.29.76
@@ -71755,21 +60283,22 @@
  216.215.72.82
  216.218.134.12
  216.218.15.48
-216.218.152.145
+216.218.152.144
  216.218.190.50
  216.218.190.54
-216.218.217.190
  216.218.222.12
  216.218.222.14
+216.218.224.238
  216.218.240.46
-216.218.243.162
  216.218.25.224
-216.218.254.165
  216.218.63.13
  216.221.152.148
+216.221.54.66
+216.222.194.40
  216.222.194.94
  216.223.26.101
  216.224.117.2
+216.224.126.49
  216.226.128.189
  216.226.129.20
  216.226.131.197
@@ -71780,10 +60309,9 @@
  216.232.223.30
  216.235.244.68
  216.236.164.82
-216.238.234.28
  216.238.244.19
  216.238.247.140
-216.238.248.145
+216.239.78.167
  216.239.90.19
  216.24.179.112
  216.24.193.163
@@ -71791,8 +60319,8 @@
  216.24.85.65
  216.24.85.65bin.sh
  216.24.85.75
-216.241.14.226
  216.241.50.74
+216.244.221.235
  216.244.65.10
  216.244.65.11
  216.244.65.12
@@ -71805,7 +60333,6 @@
  216.244.65.59
  216.244.76.80
  216.244.85.106
-216.244.85.155
  216.244.86.114
  216.244.87.179
  216.244.93.52
@@ -71814,7 +60341,6 @@
  216.245.206.226
  216.245.212.218
  216.245.220.19
-216.245.221.230
  216.246.109.114
  216.246.109.132
  216.246.109.138
@@ -71843,27 +60369,21 @@
  216.40.218.210
  216.41.233.253
  216.41.234.16
-216.41.243.126
  216.45.59.90
-216.45.85.239
-216.46.0.102
  216.47.196.104
  216.47.216.113
  216.47.235.66
  216.47.42.18
  216.49.37.157
+216.49.40.184
  216.49.54.211
-216.53.254.86
  216.55.141.92
  216.55.146.49
  216.56.31.99
  216.56.48.245
  216.56.63.247
-216.59.172.47
-216.59.200.218
  216.6.201.3
  216.6.230.16
-216.61.218.163
  216.65.1.208
  216.66.0.103
  216.66.0.119
@@ -71872,7 +60392,6 @@
  216.67.154.126
  216.67.165.13
  216.67.172.238
-216.67.21.170
  216.69.191.97
  216.69.191.98
  216.69.224.11
@@ -71883,17 +60402,10 @@
  216.74.32.109
  216.74.83.116
  216.75.37.196
-216.8.56.127
  216.82.243.88
  216.82.251.237
  216.83.198.99
-216.83.44.130
  216.83.55.154
-216.83.57.26
-216.83.57.27
-216.83.57.28
-216.83.57.36
-216.83.8.66
  216.85.161.204
  216.85.161.220
  216.85.161.222
@@ -71922,12 +60434,9 @@
  2162e66b18eb.ngrok.io
  21649-dot-proud-voice-296522.appspot.com
  217.10.103.163
-217.10.103.170
  217.10.103.227
  217.10.144.19
  217.100.104.237
-217.100.148.210
-217.100.185.246
  217.100.97.156
  217.103.94.158
  217.104.75.11
@@ -71938,22 +60447,18 @@
  217.107.71.14
  217.11.225.189
  217.11.48.184
-217.111.146.157
  217.111.197.123
  217.111.239.37
  217.111.245.138
  217.112.92.251
  217.113.114.80
  217.113.118.170
-217.113.123.144
-217.113.18.67
  217.113.232.70
-217.113.25.232
-217.113.3.93
  217.114.151.255
  217.114.178.78
  217.114.212.26
  217.115.11.163
+217.115.114.91
  217.115.213.186
  217.117.216.105
  217.12.201.34
@@ -71964,7 +60469,6 @@
  217.12.218.240
  217.12.218.95
  217.12.221.131
-217.12.223.247
  217.12.223.51
  217.12.57.89
  217.12.66.26
@@ -71972,30 +60476,30 @@
  217.120.103.59
  217.122.250.142
  217.123.170.239
+217.123.190.54
  217.123.207.149
+217.125.122.151
  217.125.152.126
  217.126.115.60
  217.126.50.212
  217.128.135.23
-217.128.221.161
+217.128.250.252
  217.128.47.29
  217.128.8.98
+217.128.99.185
  217.13.107.26
  217.13.201.233
  217.13.201.234
  217.13.201.235
  217.13.201.236
  217.13.201.237
-217.13.211.146
  217.131.182.240
  217.131.2.232
  217.133.12.80
  217.133.138.66
-217.133.234.65
  217.133.40.144
  217.133.58.148
  217.133.95.209
-217.136.113.229
  217.136.13.236
  217.138.193.184
  217.138.193.188
@@ -72006,8 +60510,6 @@
  217.138.205.162
  217.138.211.245
  217.138.219.180
-217.138.221.91
-217.138.222.108
  217.138.252.189
  217.14.7.228
  217.14.7.228bin.sh
@@ -72017,14 +60519,12 @@
  217.145.199.112
  217.145.199.45
  217.145.94.94
-217.146.255.247
  217.146.27.52
  217.146.27.53
  217.146.76.212
  217.146.88.133
  217.146.88.153
  217.147.1.128
-217.147.162.201
  217.147.165.79
  217.147.169.244
  217.147.173.159
@@ -72032,12 +60532,10 @@
  217.148.223.170
  217.148.51.164
  217.148.89.86
-217.149.122.70
-217.149.188.102
  217.149.58.106
  217.149.7.232
+217.149.7.234
  217.15.117.26
-217.15.139.219
  217.15.178.7
  217.15.195.141
  217.150.77.31
@@ -72068,20 +60566,15 @@
  217.160.65.177
  217.163.11.111
  217.163.28.231
-217.164.19.56
-217.164.255.35
-217.164.37.155
-217.165.118.22
  217.165.124.23
  217.165.125.14
  217.168.76.230
  217.168.76.77
-217.169.16.126
  217.169.210.130
+217.169.210.250
  217.169.216.130
  217.169.46.98
  217.17.108.35
-217.17.17.74
  217.17.237.197
  217.170.197.89
  217.170.204.126
@@ -72092,20 +60585,19 @@
  217.171.147.164
  217.171.147.200
  217.171.66.171
-217.172.122.12
+217.172.122.14
  217.172.122.16
-217.172.122.19
  217.172.122.4
  217.172.179.138
  217.172.179.75
  217.172.186.250
-217.172.190.198
  217.172.244.9
  217.173.202.37
  217.174.177.139
  217.174.248.162
  217.175.0.203
  217.182.103.201
+217.182.120.32
  217.182.131.4
  217.182.136.154
  217.182.138.24
@@ -72115,20 +60607,17 @@
  217.182.140.117
  217.182.141.253
  217.182.142.251
-217.182.16.9
  217.182.170.138
  217.182.172.114
  217.182.172.117
  217.182.173.156
  217.182.174.139
+217.182.175.112
  217.182.192.217
-217.182.196.227
  217.182.197.93
  217.182.198.228
-217.182.199.5
  217.182.201.204
  217.182.204.110
-217.182.204.25
  217.182.205.27
  217.182.206.215
  217.182.217.24
@@ -72136,7 +60625,6 @@
  217.182.23.55
  217.182.230.5
  217.182.252.30
-217.182.253.217
  217.182.253.249
  217.182.27.217
  217.182.37.121
@@ -72145,7 +60633,6 @@
  217.182.54.204
  217.182.54.205
  217.182.54.210
-217.182.63.9
  217.182.66.235
  217.182.67.242
  217.182.68.147
@@ -72155,6 +60642,7 @@
  217.182.78.180
  217.182.78.195
  217.182.81.8
+217.182.95.21
  217.182.95.74
  217.19.154.218
  217.19.20.25
@@ -72162,18 +60650,19 @@
  217.19.216.210
  217.19.221.137
  217.194.6.58
+217.195.155.42
  217.195.164.4
  217.195.202.34
  217.195.206.229
  217.196.212.150
-217.196.25.120
  217.196.64.12
  217.196.67.61
+217.197.116.11
  217.197.160.186
-217.197.241.85
  217.197.244.62
  217.199.160.224
  217.199.168.23
+217.199.187.72
  217.199.217.196
  217.20.114.233
  217.20.130.72
@@ -72181,35 +60670,26 @@
  217.20.169.129
  217.20.183.149
  217.208.223.204
-217.209.74.154
  217.209.85.167
  217.21.124.194
  217.21.125.179
  217.21.125.180
-217.21.147.112
  217.21.54.173
  217.21.54.221
-217.21.6.18
-217.21.60.36
-217.213.104.90
-217.218.222.34
+217.217.192.4
  217.218.233.164
-217.219.116.116
-217.219.136.129
-217.219.217.81
  217.219.235.55
+217.219.247.208
  217.219.31.210
-217.219.61.27
  217.219.61.6
  217.22.141.61
  217.22.60.25
  217.225.110.56
+217.225.116.224
  217.225.194.131
  217.229.49.235
  217.23.12.100
  217.23.12.47
-217.23.143.169
-217.23.200.32
  217.23.3.251
  217.23.3.96
  217.23.4.32
@@ -72217,43 +60697,38 @@
  217.23.69.146
  217.23.79.14
  217.23.8.80
-217.230.215.4
+217.230.222.92
  217.230.223.57
+217.230.56.219
+217.230.83.234
  217.232.150.236
-217.233.45.133
  217.233.46.138
  217.236.129.146
  217.236.168.39
  217.237.112.101
  217.24.18.226
  217.24.240.68
-217.24.6.8
  217.24.72.52
  217.244.141.210
  217.248.124.114
  217.25.113.79
  217.25.198.133
  217.25.221.60
-217.25.225.192
  217.25.25.246
  217.25.31.20
  217.250.113.216
  217.250.123.111
+217.251.138.183
  217.251.65.29
  217.254.201.86
  217.26.163.82
  217.26.47.10
  217.27.117.136
-217.27.124.81
  217.27.131.208
-217.27.175.249
  217.27.193.106
  217.27.219.14
-217.27.226.117
  217.29.126.136
  217.29.18.206
-217.30.175.101
-217.31.183.42
  217.31.48.13
  217.31.48.30
  217.31.58.188
@@ -72265,7 +60740,6 @@
  217.56.71.58
  217.57.140.58
  217.57.32.210
-217.57.74.118
  217.58.17.173
  217.60.184.227
  217.61.0.54
@@ -72281,7 +60755,6 @@
  217.64.42.157
  217.64.42.35
  217.64.47.138
-217.64.98.169
  217.65.6.12
  217.67.182.170
  217.69.13.100
@@ -72294,9 +60767,7 @@
  217.69.5.132
  217.69.5.25
  217.69.9.142
-217.7.238.247
  217.70.191.85
-217.70.23.114
  217.71.106.18
  217.72.1.254
  217.72.207.191
@@ -72305,11 +60776,9 @@
  217.73.143.168
  217.73.143.80
  217.77.104.10
-217.77.219.21
  217.77.221.209
  217.77.46.38
  217.77.62.21
-217.78.1.59
  217.78.248.167
  217.78.61.143
  217.79.178.53
@@ -72334,226 +60803,96 @@
  217.8.117.77
  217.8.117.79
  217.8.117.89
-217.8.44.38
  217.81.21.173
  217.86.103.212
-217.86.210.82
-217.87.133.71
-217.88.124.173
  217.91.38.70
  217.91.5.66
-217.92.113.18
  217.92.128.231
  217.92.55.246
  217.95.160.149
+217.97.218.42
  217538-dot-n-e-w-me-ss-age-po-rt-al.wl.r.appspot.com
-218.0.56.209
  218.1.106.82
  218.1.179.138
-218.1.18.154
-218.10.139.55
-218.10.28.58
-218.10.97.44
  218.101.202.186
  218.101.230.26
-218.102.106.31
  218.102.202.137
-218.103.179.247
-218.103.234.213
-218.103.37.97
  218.104.225.140
  218.106.167.102
  218.106.92.66
-218.107.195.117
-218.107.38.70
-218.108.109.90
  218.108.152.218
-218.108.188.226
-218.108.19.250
  218.108.31.28
-218.108.32.210
  218.108.39.210
-218.108.39.211
  218.108.52.58
  218.109.145.152
  218.109.146.170
  218.111.88.185
-218.12.33.155
-218.13.174.238
  218.14.109.42
-218.14.12.255
-218.14.122.4
-218.14.180.70
  218.14.208.90
  218.144.113.26
  218.144.62.85
  218.145.29.142
  218.146.11.227
-218.146.121.30
  218.146.20.61
-218.147.229.218
-218.148.146.236
+218.146.21.148
  218.149.128.186
-218.149.179.55
  218.149.80.105
-218.15.119.188
-218.15.128.59
-218.15.226.250
-218.150.11.37
+218.150.216.229
  218.150.243.158
-218.150.255.81
-218.150.67.35
  218.150.85.170
  218.152.150.177
  218.152.150.177bin.sh
-218.152.254.145
-218.153.157.39
-218.153.243.136
-218.154.181.253
-218.154.205.101
-218.154.21.22
-218.155.19.29
-218.155.199.58
-218.155.199.69
+218.153.122.227
+218.153.212.73
+218.155.146.99
  218.155.48.210
  218.155.48.210bin.sh
  218.155.48.219
  218.156.226.141
  218.156.26.85
-218.156.38.158
-218.156.38.65
-218.156.38.68
-218.157.116.189
+218.156.44.15
  218.157.166.40
-218.157.202.244
-218.157.37.144
  218.158.113.142
  218.158.113.142bin.sh
-218.158.160.84
  218.158.186.8
  218.158.57.21
+218.159.228.106
  218.16.204.227
  218.16.218.109
-218.16.245.188
-218.161.100.202
-218.161.106.134
-218.161.106.185
-218.161.109.240
-218.161.114.108
-218.161.119.93
-218.161.12.85
-218.161.120.116
-218.161.120.142
-218.161.122.187
-218.161.123.232
-218.161.14.23
-218.161.15.234
-218.161.15.9
-218.161.16.121
-218.161.20.72
-218.161.21.164
-218.161.21.192
-218.161.21.79
-218.161.22.150
-218.161.22.153
-218.161.25.221
-218.161.26.123
-218.161.28.22
-218.161.3.26
-218.161.31.153
  218.161.36.89
-218.161.37.47
  218.161.39.151
  218.161.39.79
-218.161.4.120
  218.161.42.248
-218.161.53.173
-218.161.53.7
-218.161.58.88
-218.161.60.227
-218.161.61.185
-218.161.61.63
-218.161.63.168
-218.161.64.147
-218.161.66.234
-218.161.68.132
-218.161.73.109
-218.161.73.90
-218.161.75.146
-218.161.79.179
-218.161.85.210
-218.161.87.216
-218.161.90.86
-218.161.92.233
-218.161.96.178
-218.161.96.52
-218.161.98.109
-218.161.98.241
-218.161.99.113
-218.161.99.69
-218.166.17.95
  218.166.36.57
+218.166.67.253
  218.17.162.119
  218.17.185.223
  218.17.228.102
-218.17.37.90
  218.17.45.98
-218.17.70.178
  218.18.101.84
-218.18.152.89
  218.18.232.29
  218.185.20.88
-218.186.151.204
-218.186.152.117
-218.186.159.160
-218.186.161.78
  218.188.39.33
  218.188.39.51
  218.188.39.59
-218.189.18.158
  218.189.19.30
  218.19.164.115
-218.193.192.193
-218.193.192.22
-218.195.112.98
-218.195.117.34
-218.195.119.200
-218.195.119.201
-218.195.119.237
-218.195.119.72
  218.2.106.125
-218.2.113.234
  218.2.53.161
-218.2.55.154
  218.20.32.230
-218.200.3.26
-218.200.68.199
+218.20.32.94
+218.200.61.170
  218.201.104.165
  218.201.104.183
  218.201.104.205
  218.201.104.209
  218.201.104.210
  218.201.104.226
-218.201.104.243
  218.201.114.34
  218.201.133.86
-218.201.151.41
-218.201.78.103
-218.201.81.162
-218.203.175.70
  218.203.206.137
-218.203.250.14
-218.204.130.238
-218.204.132.211
-218.204.166.179
  218.204.17.44
  218.204.70.179
-218.206.140.38
-218.206.168.34
-218.206.25.11
-218.207.116.27
-218.207.116.29
-218.207.116.32
  218.207.116.34
  218.207.126.155
  218.208.209.217
@@ -72578,191 +60917,89 @@
  218.21.171.51
  218.21.171.55
  218.21.171.57
-218.21.196.234
-218.21.240.200
-218.21.240.201
  218.21.240.24
-218.21.250.162
  218.21.254.3
-218.21.70.248
  218.21.78.35
  218.210.122.195
-218.210.36.142
-218.212.114.209
-218.212.135.110
-218.212.135.212
-218.212.140.92
-218.212.201.119
-218.212.23.3
-218.212.52.164
-218.212.7.141
-218.212.7.80
-218.212.77.252
-218.212.78.98
-218.212.95.56
  218.213.137.21
+218.214.91.77
  218.216.73.138
  218.217.114.239
  218.219.238.62
  218.219.99.184
  218.22.127.176
  218.22.190.174
-218.22.223.201
  218.22.27.14
  218.22.36.135
  218.227.171.11
  218.23.161.2
-218.23.227.52
-218.23.236.22
-218.23.236.23
-218.23.57.244
  218.232.109.160
+218.232.118.235
  218.232.135.95
-218.233.105.38
  218.234.17.96
  218.234.19.79
  218.234.21.178
-218.234.65.226
  218.235.113.249
  218.236.113.49
-218.237.120.251
-218.237.120.252
  218.237.156.34
-218.237.219.12
  218.237.253.167
  218.237.65.52
  218.238.2.226
  218.238.246.3
  218.239.235.29
-218.239.6.144
  218.24.16.198
-218.24.172.158
-218.24.173.120
-218.24.88.122
-218.241.157.29
-218.241.161.190
-218.241.191.1
  218.241.202.58
-218.241.208.171
-218.241.215.37
  218.241.234.48
-218.242.123.46
-218.242.159.100
-218.242.33.29
-218.242.47.98
-218.244.131.108
-218.244.148.142
  218.245.1.169
  218.246.20.221
  218.246.22.202
  218.248.0.1
  218.248.116.142
-218.248.16.252
  218.248.232.24
-218.248.240.108
-218.248.29.19
  218.248.64.239
-218.248.80.62
-218.249.104.50
  218.249.45.162
-218.249.59.12
-218.249.69.210
-218.25.101.189
  218.25.130.220
  218.25.140.72
  218.25.161.226
-218.25.224.23
-218.25.31.150
  218.25.89.99
-218.250.136.236
-218.250.137.96
-218.250.145.132
-218.250.156.35
-218.250.166.49
  218.250.167.151
-218.250.189.183
-218.250.21.79
-218.250.233.210
-218.251.58.151
-218.252.129.203
-218.253.240.16
-218.253.254.100
-218.253.69.134
  218.255.136.110
-218.255.163.212
  218.255.228.158
  218.255.242.114
  218.255.245.10
+218.255.9.242
  218.26.101.226
  218.26.163.125
-218.26.20.247
-218.26.204.42
  218.26.243.138
-218.26.30.58
-218.26.79.93
-218.26.98.199
  218.27.202.183
  218.27.203.107
-218.27.204.249
-218.27.6.190
  218.28.108.237
-218.28.11.162
-218.28.110.154
-218.28.13.36
-218.28.131.14
  218.28.133.53
-218.28.169.62
-218.28.191.102
-218.28.198.143
-218.28.198.163
-218.28.20.18
-218.28.200.67
-218.28.21.210
+218.28.160.174
  218.28.238.162
-218.28.244.83
-218.28.78.243
  218.28.83.106
-218.28.99.248
  218.29.102.142
-218.29.107.94
-218.29.120.11
-218.29.120.70
  218.29.128.195
  218.29.188.139
  218.29.188.169
  218.29.196.186
-218.29.219.20
-218.29.219.36
-218.29.231.4
-218.29.35.62
  218.29.54.107
  218.29.54.108
  218.29.54.87
-218.29.67.194
  218.29.68.154
  218.29.85.98
  218.3.190.75
  218.3.194.137
  218.3.222.230
  218.3.223.134
-218.30.21.112
  218.30.21.209
-218.30.21.46
  218.30.5.19
  218.31.0.109
  218.31.18.187
  218.31.2.125
  218.31.3.83
-218.31.3.90
-218.32.121.17
-218.32.150.6
-218.35.219.79
  218.35.45.116
-218.35.56.191
-218.35.77.247
-218.35.82.232
  218.36.86.40
-218.37.112.143
  218.38.12.110
  218.38.12.29
  218.38.136.125
@@ -72771,27 +61008,16 @@
  218.38.16.103
  218.38.16.181
  218.38.16.26
-218.38.254.71
  218.38.34.19
  218.38.56.83
-218.39.132.22
  218.39.226.115
  218.39.91.20
-218.4.148.44
  218.4.164.86
-218.4.202.186
  218.4.239.146
-218.4.240.194
-218.4.86.194
-218.4.90.211
-218.4.92.194
  218.48.135.50
-218.5.20.178
-218.5.28.113
  218.5.74.92
  218.5.80.210
  218.50.52.241
-218.51.127.13
  218.51.205.132
  218.54.123.239
  218.54.149.67
@@ -72800,28 +61026,15 @@
  218.56.11.181
  218.56.11.236
  218.56.155.106
-218.56.158.75
-218.56.158.76
-218.56.158.81
-218.56.158.83
-218.56.160.82
-218.56.161.69
  218.56.226.68
-218.56.41.228
-218.56.59.170
-218.56.65.232
  218.56.71.164
-218.57.11.72
  218.57.118.56
-218.57.204.114
  218.57.213.9
  218.57.51.87
  218.57.51.87bin.sh
  218.57.55.87
-218.57.8.92
  218.57.81.236
  218.58.194.162
-218.58.198.154
  218.58.83.60
  218.58.84.58
  218.58.96.189
@@ -72831,104 +61044,55 @@
  218.59.139.12
  218.59.14.132
  218.59.175.218
-218.59.27.35
+218.59.233.34
  218.59.46.158
  218.59.98.138bin.sh
  218.59.98.44
-218.6.224.50
  218.60.131.234
+218.60.22.20
  218.60.41.136
  218.60.8.99
-218.60.95.42
-218.61.108.114
  218.61.194.13
-218.61.30.20
-218.61.58.118
-218.61.58.206
-218.62.64.153
-218.62.64.66
-218.62.83.66
-218.62.91.252
-218.64.53.20
+218.64.218.43
  218.64.57.12
  218.64.69.79
-218.64.84.147
-218.65.131.48
-218.65.220.48
  218.65.221.24
-218.66.16.249
-218.66.246.240
  218.66.253.144
+218.66.59.238
  218.66.67.233
-218.67.28.150
-218.67.65.194
-218.68.204.130
-218.69.1.90
-218.69.139.82
-218.69.181.106
+218.67.101.207
+218.69.223.100
  218.69.31.132
-218.69.33.116
  218.69.91.84
  218.7.171.91
-218.7.208.250
-218.7.36.82
  218.70.148.133
-218.70.19.74
-218.70.28.190
  218.70.66.187
  218.71.141.62
  218.72.209.44
-218.73.38.86
  218.73.60.118
  218.75.110.41
  218.75.110.51
  218.75.121.74
  218.75.156.247
-218.75.164.63
  218.75.190.215
  218.75.210.46
  218.75.211.14
  218.75.216.21
-218.75.219.76
  218.75.223.72
-218.75.230.4
-218.75.27.198
  218.75.33.180
-218.75.47.242
-218.75.60.55
-218.75.62.90
  218.75.72.82
  218.75.77.92
-218.75.78.214
  218.75.78.42
-218.75.98.230
  218.76.101.25
-218.76.2.55
  218.76.215.4
-218.76.46.172
-218.76.49.100
+218.76.223.50
  218.76.52.120
-218.76.60.162
-218.76.88.2
-218.77.104.75
-218.77.128.200
-218.77.129.81
-218.77.50.45
-218.78.0.73
-218.78.103.91
  218.78.209.1
  218.78.209.241
-218.78.21.74
-218.78.50.164
-218.78.54.80
-218.79.132.63
  218.79.231.145
  218.79.231.8
  218.8.101.247
-218.8.232.91
  218.8.251.187
-218.8.64.202
-218.80.245.54
  218.81.164.154
  218.81.186.184
  218.81.193.171
@@ -72937,53 +61101,27 @@
  218.81.240.69
  218.81.245.38
  218.81.48.153
-218.82.184.229
  218.84.125.8
-218.84.130.96
-218.84.70.60
  218.85.119.92
  218.85.22.110
  218.86.155.143
  218.86.31.67
  218.86.87.171
-218.87.107.134
-218.87.149.136
-218.87.74.9
  218.88.215.49
  218.88.24.115
  218.88.24.117
-218.88.250.6
  218.88.26.212
  218.88.28.73
  218.88.29.67
  218.88.31.15
-218.89.136.104
-218.89.146.66
  218.89.196.116
-218.89.222.125
  218.89.222.16
-218.89.222.178
-218.89.238.62
-218.89.241.68
-218.89.50.90
-218.89.77.122
-218.89.77.21
-218.89.77.27
-218.89.77.28
-218.89.77.30
-218.89.77.4
-218.89.77.55
-218.89.77.78
  218.89.77.79
-218.89.77.86
  218.89.81.109
-218.9.248.75
  218.90.138.98
  218.90.171.214
-218.90.186.140
-218.91.204.226
  218.91.206.250
-218.91.83.18
+218.91.90.186
  218.91.95.180
  218.91.95.87
  218.92.0.133
@@ -72997,6 +61135,7 @@
  218.92.0.175
  218.92.0.184
  218.92.0.185
+218.92.0.195
  218.92.0.198
  218.92.0.199
  218.92.0.200
@@ -73004,8 +61143,8 @@
  218.92.0.203
  218.92.0.204
  218.92.0.205
+218.92.0.206
  218.92.0.208
-218.92.0.210
  218.92.0.211
  218.92.0.212
  218.92.0.223
@@ -73015,22 +61154,10 @@
  218.92.0.249
  218.92.0.250
  218.92.0.251
-218.92.115.130
  218.92.150.130
  218.92.150.134
-218.92.204.214
-218.92.206.150
-218.92.239.38
-218.92.244.196
-218.92.26.86
  218.92.77.242
-218.93.116.4
  218.93.119.90
-218.93.126.135
-218.93.129.208
-218.93.13.217
-218.93.150.222
-218.93.17.156
  218.93.172.55
  218.93.207.40
  218.93.207.84
@@ -73038,338 +61165,193 @@
  218.93.207.94
  218.93.208.28
  218.93.208.43
+218.93.220.102
  218.93.225.150
  218.93.232.166
-218.93.44.222
-218.93.66.165
-218.94.119.66
-218.94.129.162
-218.94.13.94
-218.94.132.114
-218.94.136.174
  218.94.136.90
  218.94.148.222
-218.94.179.198
  218.94.2.162
-218.94.33.166
-218.94.57.147
  218.94.57.157
-218.94.59.55
-218.94.60.99
  218.94.71.198
-218.95.182.149
  218.95.182.38
-218.95.253.98
  218.95.37.66
-218.98.18.19
  218270aa6e0294fb7a7a4f77229e10301cd5aec3.info
  218711.com
  218847280326116-dot-wetransfer-auth-file334.appspot.com
  21897secured.info
  218betasus.com
-219.100.37.242
  219.101.192.141
  219.111.105.182
  219.111.2.38
  219.117.196.250
  219.117.223.106
  219.121.0.60
-219.124.144.179
-219.126.241.251
-219.128.10.58
-219.128.38.115
-219.129.60.39
  219.129.60.6
-219.130.55.201
  219.131.193.180
-219.131.60.198
-219.133.158.120
-219.133.167.225
-219.133.168.209
  219.133.179.100
-219.134.137.234
-219.134.161.166
-219.135.172.202
  219.135.209.164
-219.135.61.86
  219.136.243.47
  219.136.249.151
-219.138.150.220
-219.138.158.131
-219.138.158.220
-219.138.226.132
-219.138.59.240
-219.138.66.239
-219.139.128.2
-219.139.44.135
-219.139.83.165
+219.138.184.228
  219.140.105.134
  219.140.113.180
-219.140.126.11
-219.140.20.67
-219.140.21.173
  219.140.224.239
-219.140.69.44
-219.141.167.120
-219.141.211.66
  219.141.231.161
-219.142.106.204
-219.142.133.116
  219.142.135.82
  219.142.19.70
-219.143.144.130
  219.143.38.232
-219.144.196.98
-219.144.196.99
-219.144.245.34
-219.144.67.60
  219.144.82.202
-219.145.169.4
-219.145.189.125
+219.145.1.232
  219.145.19.32
-219.145.195.109
-219.145.221.106
+219.145.20.192
  219.146.127.6
-219.146.196.114
-219.146.242.110
-219.146.247.94
-219.146.85.226
+219.147.10.126
  219.147.112.150
  219.147.74.48
-219.147.76.9
-219.147.89.150
  219.147.90.16
-219.147.99.190
  219.148.157.86
  219.148.172.250
  219.148.36.105
-219.148.52.18
-219.148.83.88
  219.149.173.4
-219.150.218.243
-219.150.39.246
-219.150.39.99
-219.150.85.232
-219.150.85.237
  219.150.85.238
  219.150.93.157
-219.151.11.109
  219.151.133.140
-219.151.147.148
  219.151.149.33
-219.151.22.209
  219.151.248.79
  219.151.249.31
-219.151.35.119
-219.151.41.253
-219.151.43.115
-219.151.45.15
  219.151.9.139
-219.152.168.133
  219.152.17.36
-219.152.170.58
-219.153.13.70
  219.153.20.224
  219.153.33.234
-219.153.72.78
-219.153.74.70
+219.154.100.200
  219.154.102.109
  219.154.109.161
-219.154.112.114
-219.154.119.15
+219.154.113.157
+219.154.123.151
+219.154.123.182
+219.154.151.6
  219.154.160.74
+219.155.117.127
+219.155.117.97
+219.155.134.144
  219.155.161.58
  219.155.17.114
-219.155.20.189
  219.155.210.213
-219.155.210.226
  219.155.215.80
  219.155.23.198
-219.155.27.129
-219.155.27.86
-219.155.29.195
-219.155.30.112
-219.155.30.192
-219.155.30.212
+219.155.27.49
+219.155.35.143
  219.155.69.108
  219.155.70.203
-219.155.74.36
-219.155.86.67
  219.155.96.191
-219.155.96.249
-219.155.96.45
  219.155.98.235
  219.156.107.98
-219.156.126.191
  219.156.13.111
  219.156.152.149
-219.156.168.44
  219.156.188.241
-219.156.20.111
-219.156.56.35
+219.156.19.86
+219.156.22.58
+219.156.60.250
  219.156.67.181
  219.156.77.236
-219.156.9.153
-219.156.99.173
+219.156.8.43
+219.156.8.46
+219.156.96.91
  219.157.132.75
  219.157.133.32
  219.157.135.166
-219.157.136.219
  219.157.139.165
  219.157.144.147
  219.157.144.205
  219.157.145.150
  219.157.151.114
-219.157.155.86
-219.157.162.48
  219.157.168.233
  219.157.168.98
+219.157.170.195
  219.157.177.59
-219.157.177.90
  219.157.179.101
+219.157.180.182
  219.157.181.141
-219.157.181.156
  219.157.181.187
  219.157.20.45
-219.157.205.119
+219.157.201.242
  219.157.207.134
  219.157.212.72
  219.157.214.143
+219.157.214.151
  219.157.214.236
-219.157.215.182
  219.157.215.235
  219.157.216.229
  219.157.217.121
  219.157.220.44
  219.157.221.183
  219.157.235.93
-219.157.238.16
-219.157.24.230
  219.157.244.216
  219.157.250.57
  219.157.32.53
  219.157.36.105
+219.157.36.143
  219.157.37.140
+219.157.50.15
  219.157.54.231
-219.157.58.59
  219.157.59.196
-219.157.62.172
-219.157.75.62
-219.159.170.38
+219.157.67.160
  219.159.202.141
-219.159.245.20
-219.165.253.2
-219.216.120.119
-219.228.100.200
-219.230.159.55
  219.232.124.237
  219.233.217.123
-219.233.217.18
  219.234.88.34
  219.235.119.109
  219.235.3.182
-219.235.94.34
  219.237.78.2
-219.237.9.201
-219.237.97.222
  219.238.180.114
-219.239.31.10
+219.239.21.79
  219.239.47.66
  219.239.93.61
-219.240.139.111
  219.240.36.36
  219.240.39.223
  219.240.39.230
  219.240.99.120
-219.241.243.165
  219.241.6.180
-219.244.16.225
-219.244.16.226
-219.244.16.227
-219.246.67.82
  219.248.137.7
  219.250.174.170
-219.251.24.53
  219.255.134.109
  219.255.28.241
  219.255.59.153
  219.59.165.54
-219.68.100.60
-219.68.171.7
+219.65.67.114
  219.68.2.48
-219.68.244.245
-219.68.5.83
  219.69.110.49
-219.73.42.54
-219.73.94.238
-219.74.121.62
-219.74.129.43
-219.74.130.202
-219.74.40.227
-219.74.87.163
-219.74.87.45
-219.75.38.170
-219.75.42.82
-219.75.75.96
+219.70.205.168
+219.74.162.21
+219.74.195.86
+219.74.237.196
  219.75.79.61
-219.76.165.12
  219.76.178.193
  219.76.192.202
-219.76.194.185
  219.76.200.27
-219.76.26.40
-219.77.42.29
-219.77.67.174
-219.78.24.102
-219.78.37.158
-219.78.53.220
-219.79.112.34
-219.79.154.19
-219.79.202.40
-219.79.223.69
  219.80.133.57
-219.80.144.143
-219.80.217.104
  219.83.125.35
-219.83.162.37
-219.84.106.189
-219.84.213.145
+219.83.160.162
  219.84.234.73
  219.84.236.108
  219.84.28.244
-219.85.144.12
  219.85.145.194
  219.85.145.194bin.sh
  219.85.156.111
  219.85.169.224
  219.85.186.75
-219.85.201.133
-219.85.220.101
  219.85.47.121
-219.85.55.106
  219.85.56.111
-219.85.61.101
  219.85.63.226
-219.85.68.50
  219.85.82.160
  219.85.82.211
-219.87.82.112
-219.87.82.115
-219.87.82.116
-219.87.82.122
-219.89.123.232
  219.89.196.131
-219.90.112.44
  219.91.110.131
  219.91.153.198
  219.91.168.167
-219.91.186.122
  219.91.255.179
-219.91.31.143
  219.92.13.25
  219.92.228.222
-219.92.23.236
-219.92.4.201
  219.92.50.41
  219.92.54.249
  219.92.54.250
@@ -73377,15 +61359,12 @@
  219.92.59.93
  219.92.6.185
  219.93.110.60
-219.93.110.97
-219.93.111.93
  219.93.177.171
  219.94.128.174
  219.94.194.248
  219.94.198.80
  219.94.242.134
  219.94.95.83
-219.96.49.211
  219.99.0.196
  21906.8wix.com
  219236-dot-n-e-w-me-ss-age-po-rt-al.wl.r.appspot.com
@@ -73401,581 +61380,108 @@
  220.102.43.235
  220.110.145.21
  220.112.1.78
-220.112.206.33
-220.112.207.212
-220.113.1.226
+220.116.19.222
  220.116.55.86
  220.116.55.86bin.sh
  220.117.141.40
  220.117.160.182
+220.117.208.226
  220.118.111.189
  220.118.168.155
+220.118.18.32
  220.118.44.251
-220.119.120.146
-220.119.52.46
  220.120.106.254
  220.120.15.27
  220.121.112.170
-220.121.112.224
  220.121.37.66
  220.121.58.55
  220.122.253.188
  220.123.122.250bin.sh
-220.123.211.60
  220.123.235.22
  220.123.239.163
  220.123.241.30
-220.124.184.174
+220.124.130.66
  220.124.192.178
-220.124.246.99
  220.125.223.105
-220.125.230.193
-220.125.230.194
  220.125.237.35
-220.126.208.81
-220.126.255.210
-220.127.118.117
-220.127.135.103
-220.128.125.59
-220.128.142.245
+220.127.132.220
  220.128.159.121
-220.128.220.153
  220.129.192.206
  220.130.10.13
-220.130.105.55
-220.130.148.192
-220.130.174.113
-220.130.184.5
-220.130.226.1
-220.130.226.2
-220.130.227.165
-220.130.239.185
-220.130.239.186
-220.130.252.247
-220.130.40.37
  220.130.9.117
-220.132.102.2
-220.132.106.146
-220.132.106.6
-220.132.108.203
-220.132.110.63
-220.132.114.252
-220.132.114.51
-220.132.115.7
-220.132.120.207
-220.132.125.40
-220.132.126.132
-220.132.127.203
-220.132.128.169
-220.132.13.184
-220.132.131.219
-220.132.133.76
-220.132.134.1
  220.132.135.54
-220.132.136.166
-220.132.136.23
-220.132.141.26
-220.132.147.163
-220.132.148.15
-220.132.149.37
-220.132.149.94
-220.132.158.155
-220.132.158.215
-220.132.162.101
-220.132.162.110
-220.132.164.130
-220.132.165.241
-220.132.166.96
-220.132.167.212
-220.132.168.182
-220.132.168.28
-220.132.170.142
-220.132.170.222
-220.132.170.62
-220.132.181.99
-220.132.185.13
-220.132.185.23
-220.132.189.173
-220.132.189.251
  220.132.19.136
-220.132.191.143
-220.132.191.38
-220.132.192.169
-220.132.192.49
-220.132.193.17
-220.132.195.14
-220.132.195.97
-220.132.196.36
-220.132.198.134
-220.132.200.166
-220.132.200.9
-220.132.203.189
-220.132.206.250
-220.132.207.155
-220.132.210.223
-220.132.210.91
-220.132.214.120
-220.132.214.196
-220.132.214.43
-220.132.223.184
-220.132.223.198
-220.132.223.243
-220.132.224.22
-220.132.224.252
-220.132.227.246
-220.132.24.220
-220.132.24.68
-220.132.243.213
-220.132.244.143
-220.132.245.137
+220.132.231.89
  220.132.247.7
-220.132.250.56
-220.132.252.135
-220.132.26.42
  220.132.27.154
-220.132.29.151
-220.132.29.77
-220.132.33.203
-220.132.38.17
-220.132.39.221
-220.132.42.82
-220.132.43.19
-220.132.43.72
-220.132.49.58
-220.132.50.251
-220.132.51.165
-220.132.52.13
-220.132.54.41
-220.132.56.115
  220.132.57.245
-220.132.68.51
  220.132.75.140
-220.132.77.15
-220.132.79.130
-220.132.84.135
-220.132.84.234
-220.132.84.78
  220.132.86.14
  220.132.86.21
-220.132.9.125
-220.132.94.72
-220.132.95.27
-220.132.95.77
-220.132.97.13
-220.132.97.193
-220.133.100.15
-220.133.101.142
-220.133.103.201
-220.133.103.223
-220.133.103.251
-220.133.104.228
-220.133.105.188
-220.133.105.223
-220.133.105.92
-220.133.107.201
-220.133.108.29
-220.133.110.105
-220.133.113.195
-220.133.115.222
-220.133.118.97
-220.133.119.149
-220.133.119.172
-220.133.119.226
-220.133.12.155
-220.133.122.21
-220.133.126.148
-220.133.126.30
-220.133.134.38
-220.133.135.77
-220.133.137.15
-220.133.137.85
-220.133.138.154
-220.133.139.11
-220.133.146.119
-220.133.15.213
-220.133.150.251
-220.133.150.71
-220.133.153.107
-220.133.153.18
-220.133.156.203
-220.133.156.228
-220.133.158.245
-220.133.159.248
-220.133.162.8
-220.133.163.230
-220.133.168.156
-220.133.175.150
-220.133.178.189
-220.133.179.111
-220.133.186.124
-220.133.190.58
-220.133.191.215
-220.133.196.147
-220.133.196.221
-220.133.196.32
-220.133.197.128
-220.133.20.102
-220.133.202.184
-220.133.202.72
-220.133.203.90
-220.133.209.119
+220.133.108.83
  220.133.209.253
-220.133.21.85
-220.133.214.162
-220.133.215.185
-220.133.218.211
-220.133.218.29
-220.133.218.91
-220.133.219.201
-220.133.22.128
-220.133.22.56
-220.133.222.198
-220.133.227.76
-220.133.228.55
-220.133.229.56
-220.133.23.205
  220.133.230.106
-220.133.231.198
-220.133.231.208
-220.133.231.81
-220.133.234.91
-220.133.235.21
-220.133.235.221
-220.133.235.23
-220.133.236.166
-220.133.237.166
-220.133.237.211
-220.133.237.94
-220.133.239.41
-220.133.24.220
-220.133.241.54
-220.133.242.250
-220.133.247.125
-220.133.247.39
-220.133.249.116
-220.133.249.221
-220.133.252.49
-220.133.26.212
-220.133.35.114
-220.133.38.234
  220.133.39.61
-220.133.4.97
-220.133.41.182
-220.133.43.151
-220.133.46.40
-220.133.48.99
-220.133.50.74
  220.133.51.28
-220.133.53.34
-220.133.56.242
-220.133.56.93
-220.133.63.32
-220.133.66.216
-220.133.67.93
-220.133.72.137
-220.133.72.6
-220.133.72.76
-220.133.72.91
-220.133.78.253
-220.133.79.1
-220.133.90.70
-220.133.92.107
-220.133.93.131
-220.133.95.181
  220.133.95.68
-220.134.103.150
-220.134.104.125
-220.134.110.191
-220.134.116.161
-220.134.117.57
-220.134.118.11
-220.134.121.97
-220.134.122.15
-220.134.122.81
-220.134.124.225
-220.134.127.212
-220.134.128.169
-220.134.128.186
-220.134.128.225
-220.134.128.43
-220.134.128.97
-220.134.13.92
-220.134.131.176
-220.134.132.169
-220.134.132.44
-220.134.138.237
-220.134.141.202
-220.134.142.116
-220.134.142.9
-220.134.143.153
-220.134.143.232
-220.134.146.27
-220.134.148.125
-220.134.148.16
-220.134.150.4
-220.134.152.142
-220.134.153.138
-220.134.154.196
-220.134.154.205
-220.134.154.7
-220.134.156.216
-220.134.156.56
-220.134.165.117
-220.134.165.59
-220.134.166.209
-220.134.167.184
-220.134.168.152
-220.134.168.208
-220.134.169.222
-220.134.178.99
-220.134.181.110
-220.134.186.240
-220.134.186.40
-220.134.196.19
-220.134.199.145
-220.134.201.8
-220.134.206.27
-220.134.209.196
-220.134.21.19
-220.134.210.96
-220.134.218.161
-220.134.218.77
-220.134.219.199
  220.134.22.157
-220.134.220.129
-220.134.222.210
-220.134.225.204
-220.134.226.121
-220.134.229.182
-220.134.231.7
-220.134.234.50
-220.134.24.109
-220.134.24.14
-220.134.241.90
-220.134.244.147
-220.134.245.215
-220.134.246.250
-220.134.246.253
-220.134.250.230
-220.134.251.139
-220.134.252.136
-220.134.3.89
  220.134.38.32
-220.134.40.122
-220.134.46.83
-220.134.52.193
-220.134.54.79
-220.134.55.209
-220.134.58.141
-220.134.59.130
-220.134.62.92
-220.134.67.222
-220.134.72.9
-220.134.74.111
-220.134.75.151
-220.134.76.225
-220.134.76.28
-220.134.77.13
-220.134.79.106
-220.134.80.79
-220.134.81.172
-220.134.81.249
-220.134.88.124
-220.134.88.29
-220.134.9.13
-220.134.99.218
-220.135.0.48
-220.135.1.163
-220.135.10.172
-220.135.103.129
-220.135.106.189
-220.135.111.70
-220.135.12.122
-220.135.12.155
-220.135.12.39
-220.135.121.67
-220.135.128.252
-220.135.129.182
-220.135.13.28
-220.135.130.154
-220.135.130.235
-220.135.131.127
-220.135.135.248
-220.135.138.30
-220.135.141.182
-220.135.143.198
-220.135.144.223
-220.135.144.38
-220.135.144.9
-220.135.145.178
-220.135.151.127
-220.135.151.17
-220.135.154.163
-220.135.154.75
-220.135.157.30
-220.135.160.52
  220.135.162.68
-220.135.165.218
-220.135.170.72
-220.135.173.211
-220.135.173.233
-220.135.174.68
-220.135.175.33
-220.135.180.209
-220.135.180.41
-220.135.184.107
  220.135.189.192
-220.135.192.214
-220.135.193.117
-220.135.193.171
-220.135.195.154
-220.135.195.223
  220.135.2.247
-220.135.203.117
-220.135.211.172
-220.135.218.128
-220.135.22.1
-220.135.221.10
-220.135.223.145
-220.135.223.157
-220.135.223.163
-220.135.225.189
-220.135.232.172
-220.135.232.193
-220.135.236.29
-220.135.237.138
-220.135.237.252
-220.135.243.47
-220.135.244.12
-220.135.246.50
-220.135.247.151
-220.135.249.6
-220.135.250.221
-220.135.252.189
-220.135.252.221
-220.135.26.176
-220.135.26.181
-220.135.27.194
-220.135.3.161
-220.135.32.30
-220.135.32.35
-220.135.50.222
-220.135.53.143
-220.135.53.17
-220.135.6.184
-220.135.60.73
-220.135.62.115
-220.135.63.209
-220.135.67.214
-220.135.67.222
-220.135.74.41
-220.135.77.82
-220.135.78.16
  220.135.81.163
-220.135.81.69
-220.135.86.1
-220.135.87.5
-220.135.87.96
-220.135.88.118
-220.135.91.77
-220.135.93.60
-220.135.95.1
+220.136.88.184
  220.136.94.210
+220.136.97.246
+220.141.111.151
  220.142.17.72
  220.143.161.233
  220.143.192.220
-220.143.53.200
  220.143.70.100
-220.148.152.162
  220.149.25.33
-220.156.236.162
+220.150.76.193
  220.158.216.101
  220.158.216.107
  220.158.216.121
  220.158.216.123
  220.158.216.139
  220.158.216.15
-220.161.15.189
-220.161.77.42
-220.161.81.162
-220.162.164.102
-220.162.204.6
-220.162.237.167
-220.162.244.136
-220.163.125.148
-220.163.133.24
-220.164.105.157
  220.164.161.201
-220.164.161.25
-220.164.175.26
-220.164.192.25
  220.164.2.110
-220.164.2.131
-220.164.2.61
-220.164.2.65
-220.164.226.212
-220.165.147.62
-220.165.15.150
+220.164.2.62
+220.165.149.168
  220.165.15.228
-220.165.15.250
-220.167.105.122
-220.167.106.151
-220.167.147.11
-220.167.147.7
-220.167.234.26
+220.166.42.139
+220.167.140.138
  220.168.183.132
  220.168.238.82bin.sh
  220.168.239.80
  220.168.240.227
-220.169.101.4
  220.169.127.172
-220.169.253.204
-220.169.63.94
-220.171.45.37
-220.171.67.14
  220.171.93.62
-220.173.140.142
-220.173.140.245
+220.172.193.180
  220.173.160.221
  220.173.160.221bin.sh
-220.173.20.140
-220.173.210.113
-220.173.45.79
-220.174.101.31
  220.176.168.176
-220.176.172.64
-220.176.183.42
-220.176.212.86
+220.176.169.91
+220.177.78.47
  220.177.92.227
  220.178.171.184
  220.178.221.74
-220.178.254.54
-220.178.65.122
-220.178.67.242
-220.178.67.247
-220.178.67.250
-220.178.71.156
  220.179.231.155
-220.179.231.173
  220.179.231.203
-220.179.231.250
-220.179.255.54
-220.179.83.46
+220.179.87.204
  220.180.107.235
  220.180.112.208
  220.180.119.192
-220.180.171.199
  220.180.192.152
  220.180.192.77
+220.180.239.88
  220.181.187.187
  220.181.77.162
-220.182.47.116
-220.184.119.238
  220.185.195.156
  220.185.198.208
  220.185.215.165
-220.186.128.241
-220.186.130.5
  220.186.131.57
  220.186.134.51
  220.186.135.159
@@ -73996,42 +61502,29 @@
  220.186.164.142
  220.186.164.200
  220.186.165.164
-220.186.167.11
+220.186.167.135
  220.186.168.225
  220.186.169.198
  220.186.170.208
  220.186.171.80
  220.186.174.12
  220.186.177.82
-220.186.183.35
  220.186.184.123
  220.186.184.137
  220.186.185.34
  220.186.187.174
  220.186.187.63
  220.186.188.61
-220.186.191.54
-220.189.209.182
-220.189.211.75
-220.189.216.132
-220.189.68.209
-220.190.96.76
-220.191.107.80
-220.191.185.245
-220.191.210.132
-220.191.220.65
  220.191.237.75
  220.192.222.215
-220.192.236.91
  220.194.248.144
-220.194.41.250
  220.194.59.89
-220.195.65.240
-220.196.1.142
  220.196.248.130
-220.197.200.250
-220.201.153.37
-220.202.61.142
+220.197.219.70
+220.202.12.149
+220.202.73.52
+220.202.74.56
+220.211.122.237
  220.225.126.55
  220.225.7.81
  220.225.87.129
@@ -74040,23 +61533,14 @@
  220.230.121.57
  220.231.134.2
  220.233.116.117
-220.235.116.185
-220.235.150.36
-220.238.111.25
-220.239.78.104
+220.235.152.58
  220.240.137.71
-220.242.158.72
-220.242.158.87
  220.243.137.9
  220.244.58.58
  220.245.124.14
  220.245.198.194
-220.245.3.34
-220.246.136.249
  220.246.163.22
-220.246.38.178
  220.246.65.99
-220.246.67.191
  220.247.166.135
  220.247.174.12
  220.247.174.202
@@ -74064,49 +61548,30 @@
  220.247.174.234
  220.247.174.236
  220.247.174.238
-220.247.224.58
  220.247.244.206
-220.248.113.26
-220.248.18.146
  220.248.188.75
-220.248.238.130
-220.248.36.50
-220.249.100.3
-220.249.11.34
-220.249.11.38
-220.249.112.170
+220.248.20.74
  220.249.114.237
-220.249.136.5
-220.249.16.114
-220.249.19.94
-220.249.9.90
-220.249.90.197
-220.250.25.125
  220.250.50.148
  220.250.50.192
  220.253.106.214
  220.255.1.162
-220.255.112.41
-220.255.186.184
-220.255.249.8
-220.255.31.95
-220.255.54.237
-220.255.71.82
+220.66.155.2
  220.70.43.145bin.sh
-220.70.70.39
-220.71.104.17
  220.71.140.168
  220.71.140.168bin.sh
-220.73.134.140
+220.72.128.86
  220.73.144.196
  220.73.162.48
-220.74.104.184
+220.74.17.13
  220.74.76.130
  220.74.98.214
-220.75.233.205
+220.75.222.216
  220.76.107.107
  220.76.192.95
  220.76.205.178
+220.76.55.120
+220.76.55.181
  220.76.77.20
  220.76.91.27
  220.77.117.160
@@ -74120,116 +61585,72 @@
  220.78.36.41
  220.78.36.77
  220.78.36.91
-220.78.37.228
  220.79.128.186
  220.79.154.37
  220.79.180.243
+220.79.24.203
  220.79.34.109
-220.79.90.98
+220.79.52.107
  220.80.108.150
-220.80.127.210
-220.80.127.22
-220.80.127.44
-220.80.139.203
+220.80.116.118
  220.81.113.77
  220.81.13.97
  220.81.200.65
  220.82.197.3
  220.83.122.156
-220.83.207.33
-220.84.150.236
-220.84.162.232
-220.84.217.186
+220.84.179.125
  220.85.104.202
  220.85.233.146
-220.86.1.147
  220.86.227.220
  220.86.29.35
-220.86.74.75
-220.87.50.221
  220.87.94.21
  220.87.94.21bin.sh
  220.88.1.208
-220.88.103.27
-220.88.103.30
  220.88.67.211
  220.89.71.36
-220.89.95.213
-220.90.79.110
  220.92.137.31
  220.92.187.72
  220.92.208.5
-220.93.162.10
+220.93.115.163
  220.93.216.119
-220.93.35.204
+220.93.6.105
  220.94.66.153bin.sh
  220.94.87.179
  220.95.36.90
-220.95.8.227
-220.95.8.253
  220.96.225.2
  220betasus.com
  220market.net
  221-365.net
  221.0.125.22
  221.0.152.13
-221.0.183.82
  221.0.190.91
  221.0.207.243
  221.0.214.50
  221.0.94.20
-221.1.104.98
  221.1.171.25
  221.1.174.251
  221.1.220.185
-221.1.83.21
-221.1.96.46
-221.10.110.118
  221.10.141.8
-221.10.22.164
-221.11.20.103
-221.11.20.107
  221.11.30.226
  221.12.100.170
-221.12.101.123
-221.12.117.144
-221.12.117.171
  221.12.137.6
-221.12.22.202
  221.120.189.209
  221.120.199.35
-221.120.207.68
-221.120.218.74
-221.120.40.132
  221.120.98.49
  221.120.99.241
  221.121.12.238
  221.121.145.137
  221.121.145.159
-221.122.100.25
-221.122.108.203
  221.122.113.98
  221.122.119.50
-221.122.120.249
-221.122.121.122
-221.122.121.137
  221.122.73.130
  221.122.73.89
-221.122.75.22
  221.122.78.202
-221.122.78.206
-221.122.93.178
-221.122.93.197
-221.125.253.110
-221.125.90.114
-221.125.99.247
-221.126.242.254
  221.127.24.156
-221.127.41.194
  221.13.144.87
  221.13.244.204
-221.13.96.114
-221.130.126.164
+221.13.251.37
+221.13.7.50
  221.130.59.248
  221.131.165.119
  221.131.165.124
@@ -74239,31 +61660,27 @@
  221.131.165.85
  221.131.165.86
  221.131.165.87
-221.131.172.233
-221.131.179.233
-221.131.85.19
  221.132.101.247
  221.132.27.148
  221.133.2.26
  221.133.54.254
  221.133.60.167
  221.133.7.121
-221.133.9.96
  221.138.17.156
  221.138.17.241
  221.139.0.56
  221.139.0.75
  221.139.3.168
  221.139.50.13
-221.14.10.187
  221.14.122.28
  221.14.152.158
-221.14.163.17
  221.14.164.147
+221.14.205.184
  221.14.236.220
+221.14.239.168
  221.14.7.241
  221.141.1.113
-221.141.130.183
+221.141.220.4
  221.141.253.171
  221.141.3.104
  221.141.86.121
@@ -74272,78 +61689,45 @@
  221.143.40.39
  221.143.48.143
  221.143.48.34
-221.144.161.172
  221.144.178.231
-221.144.73.100
-221.144.73.4
-221.144.84.172
-221.146.181.25
-221.147.113.195
-221.147.217.115
  221.147.217.184
  221.148.107.154
  221.148.123.67
  221.148.45.168
  221.15.11.116
-221.15.126.29
-221.15.127.179
  221.15.144.115
+221.15.144.46
  221.15.145.158
-221.15.145.233
-221.15.146.70
-221.15.158.3
+221.15.173.43
  221.15.175.10
-221.15.176.22
  221.15.176.96
-221.15.180.254
  221.15.183.135
-221.15.194.47
  221.15.196.210
-221.15.216.221
  221.15.217.250
  221.15.218.80
  221.15.22.0
  221.15.22.137
  221.15.22.26
-221.15.224.120
  221.15.224.195
-221.15.224.254
-221.15.227.251
+221.15.227.65
  221.15.237.109
-221.15.238.245
  221.15.238.49
-221.15.252.131
-221.15.253.144
-221.15.4.11
+221.15.255.97
  221.15.4.174
+221.15.53.119
  221.15.54.162
  221.15.6.110
-221.150.112.229
  221.150.116.43
-221.150.175.212
-221.150.22.201
-221.150.68.246
+221.150.121.168
  221.151.207.173
-221.151.78.82
-221.153.164.69
-221.153.164.8
-221.153.164.9
-221.153.195.124
-221.153.195.240
-221.153.198.250
  221.153.211.94
-221.153.254.190
-221.154.222.86
  221.154.72.249
-221.155.157.89
-221.156.114.167
  221.156.126.1
  221.156.35.214
  221.157.162.127
-221.157.164.194
  221.157.214.220
+221.157.35.51
  221.157.75.124
-221.157.75.252
  221.158.139.154
  221.158.33.13
  221.159.180.253
@@ -74354,41 +61738,30 @@
  221.160.177.153
  221.160.177.197
  221.160.177.224
-221.160.177.30
  221.160.177.39
  221.160.177.66
-221.160.206.90
  221.161.195.249
  221.161.31.8
  221.161.82.113
-221.162.122.173
  221.162.6.190
-221.163.252.227
  221.164.122.198
  221.164.211.139bin.sh
-221.164.31.44
  221.165.13.155
  221.165.252.143
  221.166.237.100
  221.166.250.205
  221.166.250.205bin.sh
  221.167.247.35
-221.176.156.203
-221.176.177.46
-221.176.179.205
-221.176.179.213
-221.176.223.194
  221.178.190.8
-221.179.126.194
-221.179.173.90
  221.179.216.81
  221.180.170.104
-221.180.18.4
-221.180.206.13
-221.180.240.166
+221.181.181.163
  221.181.185.135
  221.181.185.136
  221.181.185.141
+221.181.185.143
+221.181.185.148
+221.181.185.149
  221.181.185.18
  221.181.185.19
  221.181.185.198
@@ -74401,92 +61774,47 @@
  221.181.185.29
  221.181.185.36
  221.181.185.68
-221.182.0.8
-221.182.20.248
  221.182.204.114
-221.182.236.34
-221.182.236.66
  221.182.31.54
-221.182.98.152
-221.188.201.104
  221.192.138.58
-221.192.139.251
  221.192.199.35
  221.192.244.242
-221.193.195.51
-221.193.216.20
  221.193.218.37
-221.193.240.217
-221.193.53.117
  221.194.102.131
-221.194.153.133
  221.195.1.201
  221.195.189.144
  221.195.189.154
  221.195.27.119
-221.195.36.69
  221.195.73.68
  221.195.73.86
  221.195.80.203
+221.196.121.149
  221.196.121.64
-221.196.124.74
-221.196.137.72
-221.196.199.56
  221.196.221.161
+221.196.232.67
  221.197.248.73
  221.197.251.25
  221.198.190.214
-221.198.197.25
  221.198.77.235
  221.198.96.42
  221.2.121.122
  221.2.144.41
-221.2.153.74
  221.2.155.35
  221.2.176.211
  221.2.224.212
-221.2.228.110
  221.2.35.78
  221.2.71.178
-221.2.79.166
  221.2.82.230
  221.200.110.249
  221.200.120.93
  221.202.168.254
-221.202.219.99
-221.202.72.128
-221.203.122.10
-221.203.13.137
-221.203.162.6
  221.203.169.50
-221.203.21.194
-221.203.21.195
  221.203.210.230
-221.203.22.243
-221.203.22.244
-221.203.22.245
  221.203.23.107
-221.203.6.138
-221.203.63.54
-221.203.78.131
-221.203.9.162
-221.204.177.15
-221.204.177.167
-221.204.213.84
-221.204.224.49
-221.204.232.43
-221.204.234.37
-221.204.249.104
-221.207.201.111
+221.207.247.76
  221.207.8.254
-221.208.13.6
-221.208.196.152
-221.208.196.62
-221.208.250.76
-221.209.10.202
+221.208.81.217
  221.209.17.222
-221.209.224.157
-221.210.133.64
  221.210.211.102
  221.210.211.11
  221.210.211.12
@@ -74508,43 +61836,33 @@
  221.210.211.50
  221.210.211.60
  221.210.211.8
-221.210.225.107
-221.210.5.218
-221.211.55.16
-221.212.210.246
-221.213.115.48
+221.210.80.136
+221.212.49.149
  221.213.221.130
  221.213.221.232
  221.213.26.61
  221.214.110.130
-221.214.120.249
  221.214.130.215
  221.214.147.153
  221.214.149.36
+221.214.152.179
  221.214.154.68
  221.214.156.252
  221.214.158.137
  221.214.160.207
  221.214.167.3
-221.214.181.196
  221.214.192.216
-221.214.206.8
  221.214.212.149
  221.214.221.27
  221.214.225.157
  221.214.229.168
-221.214.54.122
  221.214.60.2
  221.214.74.10
-221.214.92.187
  221.215.109.185
-221.215.12.30
-221.215.142.228
  221.215.149.34
  221.215.154.73
  221.215.167.86
  221.215.199.46
-221.215.202.168
  221.215.231.152
  221.215.233.153
  221.215.234.14
@@ -74555,95 +61873,62 @@
  221.215.8.64
  221.215.82.167
  221.215.82.87
+221.216.139.239
  221.216.205.26
  221.216.38.254
  221.216.95.120
-221.217.59.118
-221.218.247.202
  221.218.6.146
-221.218.97.205
-221.220.128.242
  221.220.133.201
  221.220.15.114
-221.221.137.118
+221.221.148.109
+221.221.159.165
+221.221.163.234
  221.221.164.125
-221.223.35.118
-221.224.122.162
+221.221.167.7
  221.224.213.156
-221.224.43.179
-221.224.45.194
-221.224.61.218
-221.224.9.154
  221.225.126.249
-221.225.226.79
-221.225.68.246
-221.225.70.148
+221.225.126.95
  221.225.71.163
-221.225.81.86
-221.225.82.74
+221.225.71.32
+221.225.71.66
  221.225.83.45
  221.225.89.202
-221.226.102.85
-221.226.121.106
-221.226.140.189
-221.226.142.2
-221.226.159.19
  221.226.184.178
-221.226.28.34
-221.226.29.194
+221.226.23.174
  221.226.39.202
-221.226.65.226
-221.226.70.186
  221.226.94.218
-221.227.12.168
  221.227.125.75
  221.227.162.143
  221.228.109.146
  221.228.240.130
-221.228.72.134
  221.229.144.191
-221.229.179.236
  221.229.190.64
  221.229.199.103
-221.229.218.12
-221.229.221.244
  221.229.223.2
  221.229.229.174
  221.229.252.98
  221.229.47.154
-221.231.113.90
+221.230.1.113
  221.231.125.146
-221.231.126.2
  221.231.72.66
  221.232.1.133
-221.232.130.26
  221.232.176.79
  221.232.181.185
  221.232.57.161
-221.232.57.38
-221.232.69.100
-221.233.164.34
-221.233.60.11
-221.234.19.109
  221.234.216.12
  221.234.9.207
  221.235.139.4
-221.235.143.34
-221.235.53.173
  221.235.72.170
-221.236.35.38
-221.237.179.82
+221.235.85.145
  221.237.182.153
  221.237.189.26
-221.237.200.39
+221.237.30.194
  221.237.37.55
-221.238.47.98
+221.239.223.50
  221.3.105.164
  221.3.109.187
  221.3.125.140
-221.3.132.30
  221.3.21.3
-221.3.212.228
  221.3.27.182
  221.3.32.216
  221.3.66.153
@@ -74651,28 +61936,21 @@
  221.3.83.163
  221.3.87.204
  221.3.89.189
-221.4.201.51
-221.5.213.189
-221.5.225.158
+221.5.11.110
  221.5.31.159
-221.5.80.102
  221.5.80.66
  221.6.114.149
-221.6.198.254
  221.6.206.14
  221.6.32.34
  221.6.45.147
-221.7.175.12
  221.7.213.133
  221.7.255.168
  221.7.49.218
  221.7.59.167
  221.7.61.34
-221.8.12.152
  221.8.31.27
  221.8.52.73
  221.9.146.237
-221.9.51.174
  221102.us-south.cf.appdomain.cloud
  2214756-39975-dot-bles05.wn.r.appspot.com
  221496844.embeddedsw.org
@@ -74680,59 +61958,32 @@
  221995a.com
  221betasus.com
  222.101.11.238
-222.101.142.78
-222.101.187.112
  222.101.206.56
  222.101.46.147
-222.102.166.115
-222.102.166.170
-222.102.166.62
-222.102.185.66
-222.102.5.253
-222.102.96.131
-222.102.96.57
-222.102.96.8
-222.103.134.193
+222.102.125.183
  222.104.137.106
+222.104.177.185
  222.104.247.109
  222.104.247.109bin.sh
-222.104.9.180
-222.105.122.199
-222.105.217.221
  222.105.26.35
-222.106.177.244
  222.106.22.71
  222.107.145.100
  222.107.156.227
  222.108.213.43
  222.108.43.23
-222.109.234.67
  222.109.26.50
  222.110.147.61
  222.110.159.235
-222.111.129.6
  222.111.161.189
  222.112.2.21
  222.112.220.12
  222.113.184.193
-222.113.252.68
-222.114.137.250
-222.114.144.209
-222.114.19.52
-222.114.215.49
-222.114.43.115
  222.114.70.188
-222.116.188.116
-222.116.35.154
-222.117.103.132
  222.117.124.136
  222.117.13.84
+222.117.14.197
  222.117.176.100
-222.117.83.236
-222.117.83.84
-222.118.135.43
-222.118.140.188
-222.121.3.205
+222.120.62.20
  222.122.141.47
  222.122.157.111
  222.122.161.125
@@ -74749,74 +62000,60 @@
  222.122.60.175
  222.124.1.226
  222.124.11.139
-222.124.144.42
  222.124.155.106
  222.124.17.227
  222.124.170.66
  222.124.175.100
  222.124.200.250
  222.124.30.138
-222.124.56.92
  222.125.152.27
  222.126.154.49
  222.127.105.27
  222.127.133.58
  222.127.151.230
  222.127.97.91
-222.128.11.75
-222.128.126.51
  222.128.14.106
-222.128.46.27
-222.128.51.106
+222.128.172.171
  222.128.6.99
  222.128.60.162
  222.128.9.235
-222.129.146.50
-222.129.187.3
-222.129.23.83
-222.129.39.31
  222.129.49.177
  222.132.129.26
-222.132.156.2
  222.132.180.139
  222.132.240.7
-222.132.77.14
-222.132.82.62
-222.132.85.202
  222.133.102.125
  222.133.66.210
  222.133.66.222
-222.134.214.229
-222.134.70.166
-222.134.75.6
+222.134.22.74
  222.134.91.170
  222.135.135.94
  222.135.201.91
  222.135.217.143
-222.135.223.117
  222.135.34.11
  222.135.62.55
+222.136.145.124
  222.136.146.41
+222.136.149.126
+222.136.152.104
+222.136.157.120
  222.136.212.112
+222.136.30.187
  222.137.0.44
-222.137.1.124
+222.137.106.206
+222.137.107.0
  222.137.115.121
  222.137.120.141
  222.137.120.37
-222.137.121.100
-222.137.122.104
  222.137.122.142
-222.137.122.203
+222.137.122.21
+222.137.122.243
  222.137.122.251
  222.137.122.90
  222.137.123.198
-222.137.130.49
  222.137.136.102
  222.137.136.116
-222.137.136.131
-222.137.136.143
-222.137.136.222
  222.137.136.232
+222.137.136.255
  222.137.136.26
  222.137.136.35
  222.137.136.37
@@ -74826,110 +62063,83 @@
  222.137.138.5
  222.137.138.51
  222.137.138.58
-222.137.139.179
  222.137.139.188
  222.137.139.4
  222.137.139.41
-222.137.139.62
-222.137.144.161
-222.137.147.154
  222.137.153.251
-222.137.161.207
-222.137.162.103
-222.137.162.40
-222.137.165.111
+222.137.166.142
+222.137.169.113
  222.137.173.85
-222.137.189.206
-222.137.192.252
-222.137.214.183
-222.137.215.185
+222.137.174.119
+222.137.183.192
+222.137.188.28
+222.137.198.45
+222.137.199.20
+222.137.211.61
  222.137.215.58
  222.137.215.83
  222.137.221.248
  222.137.232.89
-222.137.237.44
  222.137.25.25
-222.137.33.91
-222.137.34.196
-222.137.35.32
  222.137.5.44
  222.137.6.220
  222.137.7.103
  222.137.71.161
  222.137.76.204
-222.137.78.95
-222.137.85.83
-222.138.116.177
-222.138.119.59
-222.138.146.227
+222.138.118.117
+222.138.119.230
  222.138.174.120
  222.138.174.182
  222.138.180.34
  222.138.181.119
-222.138.181.12
  222.138.190.135
  222.138.201.98
+222.138.207.28
  222.138.23.163
  222.138.237.199
-222.138.246.247
+222.138.52.108
  222.138.55.212
-222.138.76.91
  222.138.96.58
  222.138.96.76
-222.139.122.152
-222.139.15.33
+222.139.114.32
+222.139.16.143
+222.139.199.129
  222.139.209.19
  222.139.224.153
  222.139.245.70
  222.139.28.84
-222.139.76.188
+222.139.62.110
  222.140.170.140
-222.140.183.183
  222.140.19.172
  222.140.208.45
-222.140.214.200
-222.140.218.255
+222.140.214.230
  222.140.32.87
+222.140.34.246
  222.140.72.174
-222.140.9.110
-222.141.11.83
-222.141.117.235
-222.141.12.69
-222.141.122.174
-222.141.124.42
-222.141.13.158
-222.141.13.185
-222.141.160.124
+222.141.115.226
+222.141.117.241
+222.141.132.123
+222.141.173.156
  222.141.22.72
-222.141.253.93
+222.141.43.123
  222.141.44.201
  222.141.45.106
-222.141.45.228
+222.141.63.153
  222.141.8.2
  222.141.8.76
  222.142.113.51
-222.142.180.42
+222.142.135.85
  222.142.209.8
-222.142.210.106
  222.142.211.131
  222.142.211.190
  222.142.223.3
-222.142.234.144
-222.142.255.99
-222.142.63.226
+222.142.68.53
  222.142.97.107
  222.153.237.227
  222.159.216.246
-222.160.226.14
-222.160.65.50
-222.160.78.94
-222.161.15.174
-222.161.17.58
-222.161.206.66
-222.161.223.54
-222.163.131.97
-222.163.236.232
-222.164.102.195
+222.162.101.40
+222.162.74.55
+222.163.47.226
  222.165.194.67
  222.165.194.68
  222.165.221.12
@@ -74938,53 +62148,26 @@
  222.165.223.138
  222.165.223.140
  222.165.234.147
-222.166.216.104
  222.168.18.227
-222.169.117.250
  222.169.185.226
  222.169.185.242
-222.170.37.76
-222.170.61.66
-222.170.86.42
-222.171.105.242
-222.171.225.185
  222.171.243.27
-222.173.12.58
  222.173.242.30
-222.173.38.41
+222.173.69.54
  222.173.82.126
-222.173.87.34
-222.173.98.114
  222.173.98.158
  222.173.98.230
-222.174.148.178
  222.174.213.178
  222.174.213.180
-222.174.243.198
-222.175.139.188
-222.175.186.110
-222.177.17.107
-222.178.213.224
-222.178.216.126
-222.178.233.158
-222.179.125.77
-222.179.152.126
+222.175.5.114
  222.179.205.14
-222.179.89.46
-222.180.150.130
-222.180.151.86
  222.180.208.14
+222.180.250.42
  222.182.189.117
  222.184.14.90
-222.184.208.82
  222.184.254.170
-222.184.35.115
-222.184.35.137
-222.184.35.139
  222.184.7.26
-222.184.76.162
  222.184.86.186
-222.184.97.8
  222.185.151.16
  222.185.16.234
  222.185.161.165
@@ -74998,20 +62181,17 @@
  222.185.231.246
  222.185.235.186
  222.185.241.130
-222.185.244.178
+222.185.39.166
  222.185.42.110
  222.185.73.210
+222.185.77.236
  222.185.77.42
+222.185.77.73
  222.185.77.86
  222.185.85.228
  222.186.10.154
-222.186.118.241
  222.186.13.91
-222.186.136.150
-222.186.139.94
  222.186.160.114
-222.186.169.102
-222.186.20.57
  222.186.21.147
  222.186.24.192
  222.186.24.66
@@ -75020,12 +62200,7 @@
  222.186.26.88
  222.186.34.200
  222.186.38.44
-222.186.39.22
-222.186.48.245
-222.186.59.247
-222.186.94.9
  222.187.1.163
-222.187.119.210
  222.187.157.54
  222.187.159.166
  222.187.159.223
@@ -75044,6 +62219,8 @@
  222.187.222.55
  222.187.224.132
  222.187.224.30
+222.187.227.177
+222.187.227.224
  222.187.232.73
  222.187.232.77
  222.187.238.39
@@ -75052,120 +62229,54 @@
  222.187.238.93
  222.187.238.97
  222.187.239.42
-222.187.45.234
  222.188.131.220
  222.188.136.120
-222.188.136.200
  222.188.136.246
+222.188.136.26
  222.188.136.85
-222.188.136.95
  222.188.190.206
-222.188.211.234
  222.188.221.118
-222.188.231.30
  222.188.238.225
  222.188.243.137
  222.188.243.195
  222.188.243.225
  222.188.255.95
-222.188.81.114
-222.188.84.101
-222.188.96.71
-222.189.155.242
  222.189.163.82
-222.189.186.44
  222.189.207.226
  222.189.21.90
-222.189.217.172
-222.19.137.19
-222.19.137.25
-222.19.137.26
-222.190.125.8
  222.190.143.206
  222.190.145.130
-222.190.236.106
-222.191.143.11
+222.190.254.130
  222.191.234.30
-222.191.243.187
-222.192.176.93
-222.192.176.98
-222.192.88.101
-222.192.88.60
-222.192.88.62
-222.192.88.68
-222.192.88.79
-222.192.88.87
-222.192.88.99
-222.195.93.60
  222.199.52.3
-222.205.127.251
  222.208.0.197
-222.208.119.107
  222.208.183.195
  222.208.183.218
-222.208.233.76
  222.208.3.115
-222.208.42.11
  222.209.207.10
-222.209.216.163
-222.209.233.158
-222.209.54.193
-222.209.77.105
-222.209.78.30
+222.209.208.234
  222.209.85.197
-222.212.141.178
+222.211.2.254
  222.212.154.8
-222.212.65.240
-222.212.81.137
-222.214.116.232
-222.215.214.10
  222.215.50.156
-222.215.70.166
-222.216.206.143
-222.217.126.32
  222.217.65.112
-222.217.65.32
-222.217.69.247
  222.218.130.213
-222.218.17.199
-222.218.176.73
-222.218.210.223
-222.218.39.35
+222.219.179.10
  222.219.182.45
-222.219.183.190
-222.219.73.113
-222.220.162.172
-222.220.234.178
-222.220.98.69
  222.221.36.120
-222.221.36.63
-222.221.91.153
-222.221.94.136
-222.222.141.113
-222.222.158.23
-222.222.181.214
-222.222.209.149
  222.222.31.70
  222.222.71.101
-222.222.76.131
-222.223.116.46
+222.223.122.204
  222.223.162.77
-222.223.183.15
  222.223.203.3
  222.223.212.78
-222.223.232.4
-222.223.29.110
  222.223.32.228
  222.223.56.116
-222.223.93.194
-222.23.86.45
  222.231.1.69
  222.231.3.128
-222.231.59.218
  222.231.60.131
  222.232.29.235
-222.233.105.170
-222.233.38.252
+222.233.2.138
  222.234.103.90
  222.234.2.152
  222.235.67.132
@@ -75175,127 +62286,94 @@
  222.236.47.188
  222.236.47.23
  222.237.76.118
-222.237.78.213
-222.238.173.135
+222.238.230.7
  222.239.124.19
  222.239.223.75
  222.239.227.209
  222.239.249.166
  222.239.255.101
  222.239.28.177
-222.240.152.132
  222.240.184.126
-222.240.202.162
  222.240.205.13
-222.240.205.178
  222.240.228.67
  222.240.228.75
  222.240.228.76
-222.240.234.58
-222.240.234.61
-222.242.155.5
+222.240.233.210
  222.242.158.161
  222.242.182.166
-222.242.226.117
  222.243.14.67
-222.243.200.139
-222.244.133.203
  222.244.139.132
  222.244.146.232
-222.244.147.183
-222.245.76.42
-222.246.111.24
-222.246.40.98
-222.246.64.83
+222.246.41.250
  222.246.67.49
-222.249.129.31
+222.248.161.31
  222.249.171.246
  222.249.173.170
-222.249.228.37
-222.249.232.90
-222.252.11.236
-222.252.118.75
+222.252.0.73
  222.252.148.134
  222.252.16.201
  222.252.2.9
-222.252.20.185
-222.252.20.20
  222.252.22.193
-222.252.224.130
  222.252.25.168
  222.252.25.186
+222.252.30.153
  222.252.30.29
+222.252.33.230
+222.252.35.6
+222.252.40.177
  222.252.57.216
  222.252.6.68
+222.252.94.29
  222.252.95.115
  222.253.144.250
-222.254.228.182
+222.253.79.26
+222.254.17.11
  222.254.34.129
-222.254.5.62
  222.255.115.237
-222.255.135.243
-222.255.175.217
-222.32.70.174
-222.34.19.112
-222.44.176.113
-222.52.5.5
  222.58.151.67
-222.64.209.104
  222.64.226.66
-222.65.114.193
  222.65.43.72
  222.65.99.235
-222.66.50.184
+222.66.144.162
+222.66.154.106
  222.66.64.250
-222.67.230.166
+222.67.113.123
  222.70.181.55
-222.70.79.9
+222.70.234.190
+222.72.141.62
  222.72.38.22
  222.73.114.78
  222.73.129.15
-222.73.134.185
-222.73.136.163
-222.73.136.63
  222.73.17.7
  222.73.204.203
-222.73.215.81
-222.73.44.37
-222.73.44.71
-222.73.48.151
  222.73.62.184
-222.73.7.22
-222.73.85.107
-222.73.85.76
+222.74.13.26
  222.74.186.134
  222.74.186.136
  222.74.186.174
  222.74.186.176
  222.74.186.186
-222.74.23.247
+222.74.207.34
  222.74.50.141
-222.74.73.194
  222.74.73.202
  222.75.1.197
  222.75.1.42
  222.75.12.150
+222.75.12.78
  222.75.16.58
-222.76.126.213
-222.76.66.110
+222.75.179.106
  222.77.100.144
  222.77.212.28
-222.78.216.18
+222.78.2.35
  222.79.10.25
  222.79.10.252
-222.80.110.191
+222.79.61.253
  222.80.132.148
  222.80.148.4
  222.80.170.172
-222.80.229.99
-222.80.29.29
  222.80.56.3
  222.80.61.181
  222.80.62.200
-222.81.119.245
  222.81.149.25
  222.81.15.33
  222.81.153.248
@@ -75308,119 +62386,65 @@
  222.82.252.238
  222.82.253.106
  222.83.110.68
-222.83.237.69
+222.83.150.97
  222.83.49.68
  222.83.53.212
  222.83.68.37
  222.83.71.235
-222.84.116.77
  222.84.117.30
-222.85.110.26
-222.85.134.62
-222.86.192.246
  222.87.139.44
  222.87.177.3
-222.87.198.114
  222.87.198.38
-222.87.198.63
-222.87.54.4
-222.88.152.96
-222.88.210.11
+222.87.54.164
  222.88.236.236
-222.88.238.129
  222.88.64.94
-222.89.166.120
-222.89.70.73
  222.90.28.99
-222.90.79.50
  222.91.180.5
  222.91.97.134
  222.92.139.158
-222.92.206.154
-222.92.40.26
+222.93.140.102
  222.93.142.252
-222.93.183.41
-222.94.100.190
-222.94.92.227
-222.95.250.131
+222.93.174.203
+222.95.60.13
  222.96.116.190
  222.96.155.188
  222.96.156.84
  222.96.237.2
-222.96.50.40
  222.96.93.147
-222.96.94.72
-222.97.126.167
  222.97.15.30
-222.98.171.132
  222.98.173.216
-222.98.34.101
-222.98.34.109
-222.98.34.65
-222.98.34.75
  222.98.34.86
  222.98.34.87
-222.99.127.59
  222.99.52.216
  222v333.com
  223.10.0.117
  223.10.174.92
  223.10.181.67
  223.10.35.57
-223.100.111.77
-223.100.12.53
  223.100.123.165
  223.100.140.10
  223.100.166.3
  223.100.167.105
  223.100.17.190
-223.100.206.115
-223.100.22.69
-223.100.224.216
-223.100.83.248
-223.11.10.222
  223.11.60.53
-223.111.161.73
-223.111.161.74
-223.111.201.42
-223.112.117.110
-223.112.70.109
-223.113.103.167
  223.113.4.109
-223.113.50.86
-223.115.228.209
-223.13.71.52
-223.130.228.151
-223.130.29.58
+223.115.237.199
  223.130.29.82
-223.131.83.54
  223.145.145.196
  223.145.148.92
  223.15.14.29
-223.15.163.144
-223.150.127.65
-223.150.132.95
-223.150.211.134
-223.150.223.107
-223.150.225.239
-223.154.43.119
+223.150.114.180
+223.150.137.11
+223.151.191.45
  223.154.80.169
  223.154.80.173
  223.154.81.219
  223.154.81.58
  223.157.248.26
-223.159.29.116
-223.16.106.101
-223.16.120.242
+223.159.30.253
  223.16.128.199
-223.16.14.88
-223.16.17.129
-223.16.187.84
-223.16.202.90
-223.16.206.169
  223.16.229.241
  223.16.59.112
-223.16.76.39
  223.165.129.23
  223.165.148.24
  223.165.149.25
@@ -75431,82 +62455,53 @@
  223.165.243.161
  223.165.243.209
  223.165.243.81
-223.166.96.114
  223.166.97.79
  223.167.110.183
-223.167.116.9
-223.167.224.123
-223.167.225.223
  223.167.5.210
+223.17.107.33
  223.17.120.140
  223.17.215.76
-223.17.33.68
-223.17.72.33
  223.171.32.55
  223.171.46.146
-223.18.128.210
-223.18.40.195
+223.175.199.122
  223.18.5.147
-223.181.219.65
-223.19.141.177
+223.182.203.3
  223.19.191.30
-223.19.24.226
-223.19.42.194
-223.19.73.184
-223.19.82.81
  223.191.34.173
  223.196.67.195
-223.197.136.59
-223.197.143.41
  223.197.151.55
  223.197.175.171
+223.197.175.35
  223.197.175.91
  223.197.185.60
  223.197.186.7
  223.197.188.206
  223.197.193.131
-223.197.236.110
  223.197.242.160
  223.197.56.102
  223.197.89.48
  223.199.21.89
-223.199.25.54
+223.199.24.76
  223.204.236.221
  223.204.54.197
-223.204.88.218
-223.205.124.237
-223.205.185.82
  223.205.56.44
-223.206.149.14
  223.206.243.39
-223.206.247.208
-223.212.211.103
+223.207.100.202
  223.212.234.84
  223.212.5.29
  223.212.57.118
  223.212.57.118bin.sh
-223.212.78.164
-223.213.112.44
-223.213.133.38
-223.213.144.4
-223.215.160.131
+223.214.156.70
  223.218.32.230
  223.22.243.180
-223.220.168.22
  223.220.248.6
  223.220.251.232
+223.223.130.68
  223.223.142.16
  223.223.156.5
  223.223.176.184
  223.223.183.244
-223.223.187.2
  223.223.194.101
-223.223.194.58
-223.223.199.60
-223.223.204.221
-223.223.205.114
-223.223.205.117
-223.223.205.229
  223.223.25.39
  223.226.132.248
  223.227.122.197
@@ -75515,61 +62510,31 @@
  223.229.179.238
  223.235.14.248
  223.235.201.33
-223.240.103.61
-223.240.104.222
  223.240.208.69
-223.240.70.4
  223.240.83.191
  223.240.93.176
-223.241.116.75
  223.241.247.214
+223.241.55.196
  223.241.55.247
-223.241.78.113
-223.241.78.210
-223.241.78.235
  223.242.220.225
-223.244.126.184
-223.244.128.132
-223.244.128.160
-223.244.233.104
-223.244.237.75
-223.244.96.246
-223.247.0.63
-223.247.130.195
-223.247.153.244
-223.247.156.49
+223.245.213.215
+223.245.213.229
  223.247.185.150
-223.247.194.119
-223.247.194.43
-223.247.199.243
-223.247.218.112
-223.247.219.87
+223.247.226.92
  223.25.111.8
  223.25.14.66
-223.25.64.225
  223.25.67.117
  223.25.97.250
  223.25.99.163
  223.25.99.37
  223.252.6.16
-223.252.75.173
  223.255.28.203
  223.26.31.69
-223.27.111.134
-223.27.131.18
  223.27.194.66
-223.27.255.162
-223.27.255.190
-223.28.148.209
  223.29.204.245
  223.29.204.246
  223.31.191.50
-223.4.66.84
-223.65.203.130
-223.65.206.170
-223.68.10.114
  223.68.169.180
-223.68.188.242
  223.68.190.130
  223.70.137.2
  223.70.163.118
@@ -75577,52 +62542,20 @@
  223.70.163.86
  223.70.163.90
  223.70.163.94
-223.70.176.202
-223.70.176.75
-223.70.181.102
-223.70.190.146
-223.70.217.2
-223.71.167.171
-223.71.232.246
-223.71.26.138
-223.71.26.146
-223.71.26.154
-223.71.63.130
+223.71.108.34
  223.71.97.214
-223.72.152.57
  223.72.244.42
  223.72.39.203
-223.73.84.123
  223.73.84.198
-223.75.116.49
-223.75.13.131
-223.75.13.132
  223.75.148.49
-223.75.162.26
-223.75.162.79
-223.75.167.161
  223.75.175.52
  223.75.237.42
-223.75.68.18
-223.78.104.111
-223.78.122.102
-223.80.102.181
-223.82.0.51
-223.82.0.57
-223.82.0.59
+223.80.100.87
  223.82.106.253
-223.82.204.146
-223.82.40.8
-223.82.99.148
  223.83.134.195
-223.83.140.194
-223.83.169.41
  223.83.203.67
-223.84.216.86
-223.84.61.232
+223.83.254.249
  223.85.112.162
-223.85.205.58
-223.85.66.157
  223.88.64.29
  223.9.149.141
  223.93.157.236
@@ -75630,21 +62563,13 @@
  223.93.171.204
  223.93.171.210
  223.93.188.234
-223.93.66.135
-223.94.142.237
  223.94.44.161
  223.95.112.107
-223.95.98.93
-223.96.91.105
-223.99.15.231
+223.95.86.157
  223.99.170.130
-223.99.18.171
-223.99.198.227
-223.99.207.60
  223.99.22.139
  223.99.22.141
  223.99.22.149
-223.99.220.203
  22334444.com
  224001.selcdn.ru
  224268.com
@@ -75671,12 +62596,9 @@
  23-1-23.vasdasd.repl.co
  23-227-206-171.static.hvvc.us
  23-227-206-177.static.hvvc.us
-23.100.41.141
  23.100.56.88
  23.100.68.66
-23.101.112.231
  23.101.133.123
-23.101.154.243
  23.101.156.218
  23.101.164.210
  23.101.187.252
@@ -75688,8 +62610,6 @@
  23.102.153.172
  23.102.155.128
  23.102.68.69
-23.102.8.15
-23.104.161.111
  23.104.161.139
  23.104.161.187
  23.104.184.10
@@ -75704,7 +62624,6 @@
  23.105.143.232
  23.105.143.4
  23.105.143.90
-23.105.157.123
  23.105.159.123
  23.105.159.146
  23.105.159.31
@@ -75720,7 +62639,6 @@
  23.105.231.117
  23.105.231.120
  23.105.7.70
-23.106.122.108
  23.106.124.196
  23.106.150.15
  23.106.159.187
@@ -75730,8 +62648,8 @@
  23.106.223.127
  23.106.248.103
  23.106.27.121
-23.106.27.206
  23.107.13.123
+23.108.2.140
  23.108.2.65
  23.108.252.139
  23.108.252.178
@@ -75739,12 +62657,14 @@
  23.108.4.219
  23.108.4.242
  23.108.4.99
+23.108.45.99
  23.108.48.3
  23.108.50.180
+23.108.50.182
  23.108.86.172
  23.108.93.110
  23.108.93.112
-23.108.93.139
+23.108.93.161
  23.108.93.214
  23.108.93.227
  23.108.93.241
@@ -75752,7 +62672,6 @@
  23.110.166.95
  23.111.136.190
  23.111.173.98
-23.111.188.213
  23.112.250.126
  23.115.77.25
  23.116.217.13
@@ -75762,7 +62681,6 @@
  23.120.182.124
  23.120.182.125
  23.122.142.209
-23.123.181.116
  23.126.222.27
  23.129.64.100
  23.129.64.102
@@ -75822,9 +62740,11 @@
  23.152.0.207
  23.152.0.210
  23.152.0.96
-23.152.32.242
+23.154.160.224
+23.154.160.229
  23.16.24.244
  23.160.192.115
+23.160.193.162
  23.160.208.245
  23.160.208.247
  23.160.208.248
@@ -75834,7 +62754,6 @@
  23.163.0.146
  23.163.0.36
  23.163.0.62
-23.166.32.229
  23.17.225.26
  23.17.9.24
  23.175.0.200
@@ -75850,7 +62769,6 @@
  23.20.169.83
  23.20.221.87
  23.20.240.200
-23.20.248.52
  23.20.85.16
  23.21.103.74
  23.21.185.95
@@ -75863,6 +62781,7 @@
  23.22.178.111
  23.22.22.111
  23.22.241.231
+23.224.151.10
  23.225.169.106
  23.225.200.200
  23.225.207.179
@@ -75877,11 +62796,7 @@
  23.227.201.165
  23.227.207.140
  23.228.113.185
-23.228.114.244
  23.228.114.34
-23.228.117.130
-23.228.118.237
-23.228.118.238
  23.228.120.17
  23.228.125.180
  23.228.192.206
@@ -75889,7 +62804,6 @@
  23.228.232.67
  23.228.245.166
  23.228.81.10
-23.228.89.34
  23.228.90.98
  23.228.90.99
  23.228.96.82
@@ -75906,6 +62820,7 @@
  23.229.25.76
  23.229.25.92
  23.229.27.235
+23.229.31.168
  23.229.34.238
  23.229.34.84
  23.229.35.100
@@ -75930,9 +62845,8 @@
  23.229.45.173
  23.229.45.174
  23.229.52.1
-23.229.55.133
-23.229.55.163
  23.229.57.146
+23.229.57.147
  23.229.57.151
  23.229.57.153
  23.229.57.236
@@ -75952,6 +62866,7 @@
  23.229.73.184
  23.229.73.187
  23.229.73.196
+23.229.73.204
  23.229.73.65
  23.229.73.66
  23.229.73.75
@@ -75962,7 +62877,6 @@
  23.229.73.86
  23.229.73.87
  23.229.73.88
-23.229.74.77
  23.229.75.1
  23.229.75.17
  23.229.75.27
@@ -75989,14 +62903,12 @@
  23.23.230.174
  23.23.31.250
  23.23.32.163
-23.230.98.234
-23.231.13.132
+23.231.13.61
  23.231.32.12
-23.231.34.114
-23.231.34.211
  23.231.37.27
  23.233.107.21
-23.233.13.226
+23.233.246.75
+23.233.55.92
  23.235.199.28
  23.235.221.57
  23.235.227.124
@@ -76027,11 +62939,11 @@
  23.236.152.28
  23.236.152.29
  23.236.152.56
-23.236.154.210
  23.236.156.111
  23.236.156.115
  23.236.156.121
  23.236.156.217
+23.236.156.219
  23.236.162.239
  23.236.168.227
  23.236.181.34
@@ -76048,7 +62960,6 @@
  23.236.210.196
  23.236.210.198
  23.236.210.199
-23.236.210.219
  23.236.221.146
  23.236.221.177
  23.236.221.219
@@ -76063,7 +62974,6 @@
  23.236.223.17
  23.236.223.187
  23.236.223.189
-23.236.223.19
  23.236.223.192
  23.236.223.198
  23.236.223.20
@@ -76095,9 +63005,9 @@
  23.236.229.240
  23.236.229.243
  23.236.229.250
+23.236.229.251
  23.236.229.51
  23.236.229.77
-23.236.232.102
  23.236.232.196
  23.236.232.203
  23.236.232.204
@@ -76108,6 +63018,7 @@
  23.236.232.90
  23.236.232.95
  23.236.238.107
+23.236.242.131
  23.236.249.13
  23.236.254.130
  23.236.49.71
@@ -76135,33 +63046,23 @@
  23.239.67.41
  23.239.7.183
  23.239.9.69
-23.24.9.57
-23.240.206.247
-23.240.211.247
-23.240.89.98
+23.240.136.91
  23.241.250.252
-23.242.132.94
  23.242.138.46
  23.242.56.125
  23.243.149.13
-23.243.149.241
  23.246.247.42
  23.247.102.10
-23.247.102.106
  23.247.102.120
  23.247.102.125
  23.247.102.18
  23.247.102.23
  23.247.129.202
  23.247.33.61
-23.247.36.46
  23.247.42.128
  23.247.42.45
  23.247.5.46
-23.247.55.23
  23.247.97.117
-23.248.101.200
-23.249.127.57
  23.249.162.26
  23.249.163.7
  23.249.164.26
@@ -76172,6 +63073,7 @@
  23.25.85.219
  23.25.85.221
  23.25.97.177
+23.250.1.144
  23.250.1.146
  23.250.1.147
  23.250.105.98
@@ -76181,29 +63083,26 @@
  23.250.108.139
  23.250.108.163
  23.250.108.174
-23.250.109.1
  23.250.11.242
  23.250.11.251
  23.250.11.253
  23.250.110.56
  23.250.110.59
-23.250.118.11
  23.250.16.111
  23.250.16.233
  23.250.16.65
  23.250.16.68
  23.250.16.70
-23.250.17.172
+23.250.16.86
  23.250.17.58
  23.250.24.59
-23.250.26.117
  23.250.26.198
+23.250.26.200
  23.250.26.206
  23.250.26.36
  23.250.26.44
  23.250.26.47
  23.250.36.246
-23.250.39.62
  23.250.42.202
  23.250.42.203
  23.250.42.210
@@ -76212,6 +63111,7 @@
  23.250.43.217
  23.250.44.131
  23.250.44.156
+23.250.44.212
  23.250.44.213
  23.250.44.247
  23.250.49.178
@@ -76225,7 +63125,6 @@
  23.250.53.77
  23.250.55.190
  23.250.56.224
-23.250.60.110
  23.250.60.50
  23.250.70.56
  23.250.85.79
@@ -76235,12 +63134,12 @@
  23.250.94.203
  23.250.94.211
  23.250.94.237
+23.250.94.246
  23.251.149.109
  23.251.32.80
  23.251.55.234
  23.251.86.72
  23.252.107.194
-23.252.134.241
  23.252.170.124
  23.252.75.254
  23.253.119.33
@@ -76288,6 +63187,7 @@
  23.254.17.92
  23.254.17.93
  23.254.17.95
+23.254.18.13
  23.254.20.170
  23.254.20.171
  23.254.201.58
@@ -76297,10 +63197,10 @@
  23.254.204.253
  23.254.209.188
  23.254.209.220
+23.254.21.148
  23.254.211.179
  23.254.211.250
  23.254.215.109
-23.254.215.19
  23.254.215.229
  23.254.217.35
  23.254.224.102
@@ -76312,6 +63212,7 @@
  23.254.226.60
  23.254.227.105
  23.254.227.92
+23.254.228.102
  23.254.228.35
  23.254.228.86
  23.254.229.222
@@ -76338,9 +63239,9 @@
  23.254.47.96
  23.254.5.46
  23.254.5.64
-23.254.55.115
  23.254.56.114
  23.254.56.53
+23.254.56.65
  23.254.56.73
  23.254.6.55
  23.254.6.61
@@ -76371,10 +63272,10 @@
  23.28.102.158
  23.28.50.172
  23.29.80.56
-23.30.221.181
  23.4.43.27
  23.4buyuklergazete.com
  23.80.147.25
+23.80.149.10
  23.80.149.104
  23.80.149.133
  23.80.149.173
@@ -76398,12 +63299,12 @@
  23.81.246.166
  23.81.246.83
  23.81.27.114
-23.81.63.198
  23.82.110.145
  23.82.110.174
  23.82.110.191
  23.82.110.206
  23.82.110.244
+23.82.110.49
  23.82.110.70
  23.82.28.74
  23.82.29.51
@@ -76411,7 +63312,6 @@
  23.83.133.250
  23.83.134.109
  23.83.179.27
-23.83.179.33
  23.83.225.179
  23.83.231.153
  23.83.239.130
@@ -76421,10 +63321,7 @@
  23.83.247.171
  23.83.249.80
  23.83.252.134
-23.83.89.197
  23.89.29.66
-23.90.145.58
-23.90.145.59
  23.90.28.102
  23.90.28.113
  23.90.28.122
@@ -76444,7 +63341,6 @@
  23.90.29.86
  23.90.30.195
  23.90.31.10
-23.90.31.106
  23.90.31.127
  23.90.31.130
  23.90.31.139
@@ -76458,6 +63354,7 @@
  23.90.31.72
  23.90.31.75
  23.90.31.88
+23.90.31.93
  23.90.40.105
  23.90.40.106
  23.90.40.120
@@ -76467,10 +63364,9 @@
  23.90.40.154
  23.90.40.170
  23.90.40.171
-23.90.40.189
  23.90.40.190
+23.90.40.194
  23.90.40.201
-23.90.40.224
  23.90.40.230
  23.90.40.7
  23.90.40.89
@@ -76478,7 +63374,6 @@
  23.90.43.129
  23.90.43.9
  23.91.66.183
-23.91.70.51
  23.92.127.10
  23.92.127.132
  23.92.127.34
@@ -76494,22 +63389,20 @@
  23.94.104.126
  23.94.104.26
  23.94.123.242
-23.94.136.12
+23.94.146.221
  23.94.150.186
  23.94.151.108
  23.94.151.211
-23.94.151.253
  23.94.151.43
  23.94.154.241
+23.94.154.245
  23.94.154.254
-23.94.156.8
  23.94.158.76
  23.94.158.77
  23.94.158.78
  23.94.158.79
  23.94.158.80
-23.94.162.214
-23.94.175.14
+23.94.175.42
  23.94.175.58
  23.94.176.162
  23.94.176.166
@@ -76521,8 +63414,8 @@
  23.94.178.223
  23.94.179.44
  23.94.182.197
-23.94.182.210
  23.94.182.222
+23.94.184.164
  23.94.184.188
  23.94.185.202
  23.94.185.220
@@ -76538,6 +63431,7 @@
  23.94.19.213
  23.94.190.119
  23.94.191.130
+23.94.191.226
  23.94.191.234
  23.94.2.243
  23.94.20.156
@@ -76551,16 +63445,14 @@
  23.94.21.254
  23.94.221.128
  23.94.24.171
-23.94.24.60
  23.94.27.6
+23.94.28.11
  23.94.28.9
  23.94.29.137
  23.94.29.34
  23.94.30.118
  23.94.30.126
-23.94.37.47
  23.94.4.113
-23.94.4.224
  23.94.4.225
  23.94.4.38
  23.94.43.186
@@ -76570,7 +63462,6 @@
  23.94.47.114
  23.94.47.116
  23.94.47.117
-23.94.47.124
  23.94.6.104
  23.94.6.79
  23.94.62.134
@@ -76580,12 +63471,10 @@
  23.94.81.167
  23.94.81.184
  23.94.93.183
-23.94.96.119
  23.95.0.119
  23.95.102.190
  23.95.103.49
  23.95.103.52
-23.95.107.109
  23.95.109.209
  23.95.109.243
  23.95.11.48
@@ -76595,7 +63484,6 @@
  23.95.117.72
  23.95.12.210
  23.95.13.131
-23.95.132.44
  23.95.182.158
  23.95.182.161
  23.95.182.163
@@ -76608,20 +63496,19 @@
  23.95.188.186
  23.95.188.189
  23.95.188.191
-23.95.197.202
  23.95.197.221
+23.95.204.125
  23.95.204.216
  23.95.207.214
  23.95.215.12
  23.95.219.131
  23.95.219.164
-23.95.219.167
  23.95.219.183
  23.95.219.5
  23.95.219.55
  23.95.219.6
-23.95.220.148
  23.95.224.31
+23.95.224.69
  23.95.226.107
  23.95.226.153
  23.95.230.119
@@ -76631,19 +63518,14 @@
  23.95.242.14
  23.95.5.31
  23.95.7.98
-23.95.81.204
-23.95.81.232
-23.95.85.74
  23.95.89.71
  23.95.89.78
  23.95.89.93
  23.95.9.10
-23.95.9.117
  23.95.9.135
  23.95.9.144
  23.95.97.195
  23.96.11.64
-23.96.202.234
  23.96.25.249
  23.96.33.112
  23.96.38.43
@@ -76658,6 +63540,7 @@
  23.98.191.127
  23.98.216.241
  23.98.43.84
+23.98.66.136
  23.99.10.223
  23.99.134.224
  23.99.196.41
@@ -76712,20 +63595,17 @@
  24-7-supporting-link.world
  24-rw-in-ak-llc.net
  24.0.114.228
+24.0.138.246
+24.0.2.196
  24.103.137.222
  24.103.166.34
  24.105.202.216
  24.106.168.70
-24.106.221.230
  24.106.226.216
-24.108.89.129
  24.109.248.25
  24.11.124.75
-24.111.247.22
-24.111.30.225
  24.111.31.96
  24.111.39.66
-24.111.79.11
  24.113.10.158
  24.113.13.233
  24.113.133.84
@@ -76743,23 +63623,22 @@
  24.113.238.213
  24.113.44.144
  24.113.92.37
-24.115.131.155
  24.115.199.23
  24.116.202.31
  24.116.246.9
  24.118.12.41
  24.118.165.35
+24.119.66.159
  24.12.184.19
+24.12.204.206
  24.121.219.54
  24.122.28.67
  24.123.196.28
  24.123.37.67
-24.125.253.239
  24.125.254.207
  24.125.46.75
  24.126.152.6
  24.126.7.19
-24.129.235.125
  24.13.245.57
  24.132.182.110
  24.133.168.232
@@ -76775,7 +63654,6 @@
  24.14.211.163
  24.141.166.152
  24.142.165.126
-24.142.31.30
  24.143.75.66
  24.143.76.121
  24.146.180.191
@@ -76783,28 +63661,21 @@
  24.148.52.186
  24.148.98.177
  24.151.140.205
-24.151.6.190
-24.152.30.57
  24.152.37.102
  24.153.190.114
-24.153.54.253
  24.154.144.221
  24.155.196.246
  24.156.1.90
  24.157.130.222
-24.158.135.49
+24.16.235.138
  24.160.150.173
  24.161.18.241
  24.162.33.181
  24.164.79.147
-24.165.208.33
  24.167.210.124
  24.167.248.109
  24.167.96.213
  24.17.248.42
-24.170.241.241
-24.172.15.26
-24.172.15.58
  24.172.34.114
  24.172.79.6
  24.173.166.166
@@ -76815,59 +63686,49 @@
  24.176.64.180
  24.177.106.85
  24.177.185.132
+24.177.215.194
  24.178.90.49
  24.179.112.4
  24.179.13.119
  24.18.194.109
  24.18.235.43
+24.18.50.224
  24.180.55.125
-24.181.205.130
  24.181.205.134
-24.181.67.58
  24.184.0.146
  24.184.1.41
-24.184.221.184
-24.184.236.145
  24.185.157.190
  24.185.159.118
  24.185.159.69
+24.186.128.14
  24.188.176.255
  24.188.214.137
-24.188.228.243
  24.189.48.184
  24.191.220.176
-24.192.185.142
  24.192.191.109
-24.193.65.105
  24.193.76.156
  24.196.138.163
  24.196.49.98
  24.196.88.234
  24.2.154.151
  24.2.160.242
-24.200.121.125
-24.201.16.147
-24.201.161.132
  24.201.165.190
  24.201.219.233
-24.201.31.10
  24.202.108.135
  24.202.48.101
  24.205.144.72
  24.205.215.192
+24.206.168.83
  24.207.219.234
-24.208.55.62
+24.208.21.112
  24.21.176.186
  24.21.229.157
+24.21.31.148
  24.211.7.38
-24.212.126.173
  24.212.51.61
  24.212.64.36
-24.213.8.101
  24.214.210.83
  24.214.72.152
-24.215.82.23
-24.216.217.209
  24.217.140.142
  24.217.25.147
  24.217.251.48
@@ -76877,33 +63738,25 @@
  24.22.122.39
  24.220.176.108
  24.220.5.235
-24.220.85.125
+24.221.19.31
  24.221.19.57
  24.221.197.241
  24.222.131.233
-24.222.200.71
-24.222.43.214
  24.222.43.8
-24.226.148.214
-24.227.222.61
  24.227.47.162
  24.23.133.203
-24.23.37.86
-24.231.36.167
  24.231.68.53
  24.231.70.85
-24.232.177.8
  24.232.227.50
  24.232.228.233
  24.233.245.188
-24.234.106.161
  24.234.119.227
+24.234.169.237
  24.234.197.4
  24.234.50.44
  24.234.59.162
  24.234.75.185
  24.234.75.185bin.sh
-24.235.62.14
  24.237.101.250
  24.237.70.53
  24.239.232.136
@@ -76911,38 +63764,26 @@
  24.241.102.26
  24.241.123.145
  24.243.11.175
-24.243.111.6
-24.243.87.27
  24.244.157.205
-24.244.157.21
  24.244.161.36
  24.245.100.212
  24.245.121.47
  24.245.126.32
-24.245.85.51
-24.246.23.168
  24.246.31.205
-24.247.73.160
-24.248.207.7
  24.248.44.90
  24.249.125.168
  24.249.136.254
  24.249.17.108
-24.249.199.12
  24.249.199.14
  24.249.199.4
  24.25.222.126
-24.251.172.3
  24.251.77.254
  24.252.1.231
  24.252.140.29
  24.253.114.10
  24.253.146.50
-24.253.151.30
-24.253.89.71
  24.254.38.127
  24.255.192.211
-24.255.96.250
  24.26.156.42
  24.30.124.181
  24.31.15.232
@@ -76959,8 +63800,6 @@
  24.37.80.177
  24.37.80.178
  24.37.80.190
-24.37.85.238
-24.39.150.166
  24.39.154.236
  24.39.162.98
  24.39.181.18
@@ -76975,47 +63814,31 @@
  24.45.4.1
  24.47.90.156
  24.48.209.211
-24.49.129.113
  24.4buyuklergazete.com
-24.5.232.17
  24.5.246.58
-24.51.114.39
  24.51.32.49
-24.52.248.148
  24.53.245.34
  24.54.106.17
  24.54.211.91
-24.54.22.88
  24.55.19.82
  24.56.242.244
-24.57.192.80
  24.57.227.242
  24.6.59.102
  24.6.92.181
  24.60.104.154
  24.63.194.252
  24.63.46.3
+24.64.72.174
  24.64.86.246
-24.66.204.57
  24.66.35.226
-24.67.168.170
  24.68.94.168
  24.69.138.178
-24.69.65.8
-24.7.35.18
  24.70.96.78
-24.76.213.10
  24.78.40.54
-24.8.136.37
-24.80.24.93
-24.80.54.131
+24.8.209.61
  24.84.207.249
  24.86.184.66
  24.87.71.106
-24.89.162.12
-24.89.71.20
-24.90.234.200
-24.90.240.65
  24.92.157.192
  24.92.187.245
  24.93.234.75
@@ -77025,10 +63848,7 @@
  24.96.173.47
  24.96.226.22
  24.97.165.106
-24.97.43.195
  24.98.109.144
-24.98.168.148
-24.99.3.63
  24.ogloszeniateraz97.club
  24073.xc.08an.com
  2415460e44bce092512caa5c73e4a5a6430da2f1.info
@@ -77039,6 +63859,7 @@
  2439088-dot-n-e-w-me-ss-age-po-rt-al.wl.r.appspot.com
  24399.url.snwxn.com
  244423.simplecloud.ru
+246.89.8.6
  246039141.snapchatprime.com
  24621.url.xrzzk.com
  24621.xc.liaochuo.com
@@ -77141,18 +63962,14 @@
  26buofa26.bankofamericaslpemr.com
  26coder.net
  26v.cn
-27.1.225.116
  27.1.245.12
  27.1.245.16
  27.1.245.16bin.sh
  27.1.245.33
  27.1.253.142
-27.10.48.132
  27.102.102.139
-27.102.114.116
  27.102.127.39
  27.102.128.36
-27.102.128.76
  27.102.66.168
  27.102.66.169
  27.102.66.170
@@ -77165,38 +63982,26 @@
  27.102.70.194
  27.102.70.210
  27.102.70.211
-27.104.157.167
  27.104.221.179
  27.104.223.236
  27.104.252.37
-27.104.254.41
-27.104.255.19
-27.105.152.218
-27.105.152.96
  27.105.198.65
  27.106.12.218
-27.106.82.193
-27.106.84.162
+27.106.82.217
  27.106.84.186
  27.109.115.136
  27.109.115.153
  27.109.115.154
-27.109.116.119
  27.109.116.171
  27.109.153.99
  27.11.118.138
-27.11.210.129
  27.11.212.90
  27.111.29.180
  27.111.35.13
-27.111.44.196
  27.111.47.232
  27.112.70.42
-27.113.114.246
-27.113.52.156
-27.114.151.187
  27.114.9.93
-27.115.124.10
+27.115.124.36
  27.115.124.74
  27.115.124.75
  27.115.124.9
@@ -77212,16 +64017,14 @@
  27.116.51.186
  27.116.51.85
  27.116.51.92
-27.116.84.57
  27.117.105.125
  27.117.105.125bin.sh
-27.117.111.130
-27.118.108.203
-27.118.96.112
  27.120.109.165
  27.120.124.43
+27.122.14.38
+27.122.14.40
+27.122.14.42
  27.122.56.147
-27.122.58.101
  27.122.59.10
  27.122.59.100
  27.122.59.86
@@ -77229,15 +64032,11 @@
  27.123.171.65
  27.123.213.170
  27.123.213.172
-27.123.240.250
  27.123.255.82
  27.123.3.138
  27.123.3.140
-27.124.142.200
-27.124.39.75
  27.124.4.35
-27.124.85.149
-27.125.136.116
+27.125.136.147
  27.125.188.123
  27.125.242.176
  27.125.242.224
@@ -77245,132 +64044,106 @@
  27.126.179.46
  27.126.188.205
  27.128.161.18
-27.128.165.131
  27.128.168.13
  27.128.168.225
  27.128.173.81
-27.128.176.144
-27.128.180.42
-27.128.183.162
-27.128.193.90
-27.128.199.247
+27.128.196.70
  27.128.201.88
  27.128.236.189
-27.128.243.112
  27.128.244.13
-27.13.185.36
  27.131.106.230
-27.131.178.119
  27.131.187.222
  27.133.239.100
-27.14.39.202
  27.14.81.28
-27.14.83.60
  27.142.132.247
  27.145.130.154
  27.147.140.83
  27.147.142.177
-27.147.142.50
-27.147.142.53
  27.147.155.66
  27.147.155.70
  27.147.179.232
-27.147.18.9
  27.147.183.49
  27.147.190.202
+27.147.201.156
  27.147.209.215
  27.147.210.35
  27.147.217.194
  27.147.217.3
  27.147.217.86
-27.147.222.212
  27.147.225.202
-27.147.228.11
  27.147.40.128
  27.148.190.100
-27.148.211.247
  27.15.24.204
-27.15.27.198
-27.150.170.26
-27.150.175.150
+27.15.46.151
  27.150.175.28
  27.150.182.230
  27.150.187.208
  27.150.22.155
-27.150.31.167
-27.151.0.160
-27.151.30.189
  27.151.4.29
-27.153.132.8
+27.153.180.110
+27.153.185.189
+27.153.186.144
  27.153.186.208
  27.153.254.70
+27.154.164.126
  27.154.225.186
-27.154.233.226
  27.154.242.142
  27.154.32.202
  27.154.34.146
  27.154.59.202
-27.154.66.176
+27.154.66.208
+27.154.66.228
  27.154.67.29
-27.155.101.173
  27.155.101.197
  27.155.101.232
-27.155.54.174
+27.155.193.166
  27.155.97.12
-27.156.199.164
  27.156.4.179
  27.156.6.147
-27.156.72.117
  27.156.72.228
  27.157.19.36
  27.158.161.91
-27.158.214.245
-27.159.82.254
+27.158.23.19
+27.158.48.82
+27.159.187.253
  27.17.28.132
-27.184.133.88
+27.17.3.90
  27.184.217.107
+27.184.62.28
  27.185.12.20
-27.187.248.223
+27.187.248.208
  27.187.249.35
-27.187.250.146
-27.188.56.26
-27.188.61.75
  27.188.62.55
  27.189.251.86
-27.19.126.67
  27.19.127.43
-27.19.194.5
  27.19.211.168
  27.19.54.67
-27.191.208.157
-27.191.210.15
+27.19.55.206
  27.191.234.69
  27.192.137.78
  27.193.105.154
  27.193.106.189
  27.193.106.206bin.sh
  27.193.107.227
-27.193.138.162
  27.193.138.177
  27.193.158.32
-27.193.159.91
  27.193.175.206
  27.193.189.201
  27.193.20.76
  27.193.201.33
+27.193.21.173
  27.193.21.217bin.sh
  27.193.215.70
  27.193.250.240bin.sh
  27.193.253.146
  27.193.79.25
+27.193.82.104
  27.193.86.150
  27.193.89.119
  27.193.92.147
-27.194.11.76
  27.194.129.92
  27.194.134.4
  27.194.143.157
-27.194.151.94
  27.194.155.27
  27.194.157.123
  27.194.157.226
@@ -77379,16 +64152,11 @@
  27.194.164.63
  27.194.192.227
  27.194.192.37
-27.194.193.236
-27.194.21.85
  27.194.252.247
  27.194.26.98
  27.194.36.216
-27.194.89.49
-27.196.109.177
-27.196.204.124
-27.196.226.143
-27.196.31.95
+27.194.95.201
+27.197.19.52
  27.197.39.53
  27.197.56.140
  27.197.83.147
@@ -77396,42 +64164,34 @@
  27.197.95.74
  27.198.115.85
  27.198.119.251
-27.198.133.131
-27.198.136.166
  27.198.173.54
+27.198.187.232
  27.198.225.29
  27.198.33.255
  27.198.51.21
-27.198.7.48
-27.199.131.151
+27.198.74.8
  27.199.192.250
  27.199.198.206
-27.2.191.152
-27.2.64.36
+27.199.83.249
  27.2.7.59
  27.200.1.139
  27.200.105.117
-27.200.108.208
  27.200.168.78
-27.200.224.3
-27.200.248.92
+27.200.68.27
  27.201.110.238
  27.201.118.119
  27.201.118.95
  27.201.187.70
  27.201.191.126
-27.201.196.32
  27.201.205.12
  27.201.244.14
  27.201.59.218
  27.201.72.189
-27.201.88.4
  27.202.101.6
  27.202.112.190
  27.202.120.42
  27.202.137.28
  27.202.138.128
-27.202.141.121
  27.202.142.222
  27.202.190.53
  27.202.191.77
@@ -77446,7 +64206,6 @@
  27.202.29.116
  27.202.34.3
  27.202.35.65
-27.202.4.106
  27.202.44.3
  27.202.52.95
  27.203.101.100
@@ -77458,7 +64217,6 @@
  27.203.161.174
  27.203.167.160
  27.203.168.90
-27.203.2.99
  27.203.210.255
  27.203.225.92
  27.203.231.17
@@ -77468,7 +64226,6 @@
  27.203.40.110
  27.203.42.58
  27.203.5.143
-27.203.7.117
  27.203.70.108
  27.203.83.24
  27.203.87.75
@@ -77478,13 +64235,11 @@
  27.204.242.5
  27.204.254.155
  27.204.75.109
-27.205.121.150
-27.205.18.36
+27.206.10.169
  27.206.108.54
  27.206.114.196
  27.206.162.191
  27.206.186.251
-27.206.186.252
  27.206.187.146
  27.206.188.109
  27.206.190.107
@@ -77498,9 +64253,7 @@
  27.207.172.194
  27.207.180.93
  27.207.182.227
-27.207.192.130
  27.207.192.7
-27.207.197.232
  27.207.197.49bin.sh
  27.207.202.222
  27.207.24.78
@@ -77515,26 +64268,20 @@
  27.208.145.149
  27.208.148.93
  27.208.163.180
-27.208.190.146
  27.208.199.103
  27.208.200.128
  27.208.202.25
  27.208.205.154
  27.208.21.167
-27.208.22.49
  27.208.37.210
  27.208.43.59
-27.208.45.77
  27.208.79.57
  27.209.126.200
-27.209.147.175
  27.209.153.137
  27.209.159.64
-27.209.205.175
  27.209.6.39
  27.209.64.138
  27.210.101.26
-27.210.105.74
  27.210.110.103
  27.210.114.170bin.sh
  27.210.131.117
@@ -77550,20 +64297,19 @@
  27.210.35.107bin.sh
  27.210.40.255
  27.210.42.130
-27.210.42.246
  27.210.55.84
  27.210.6.157
+27.210.63.153
+27.210.8.50
  27.210.82.136
-27.210.92.32
  27.211.104.44
-27.211.129.193
+27.211.209.55
  27.211.216.126
  27.211.251.2
  27.211.62.203
  27.213.109.62
  27.213.137.14
  27.213.148.166
-27.213.159.205
  27.213.170.203bin.sh
  27.213.172.173
  27.213.208.35
@@ -77576,26 +64322,19 @@
  27.213.34.49
  27.213.35.55
  27.213.38.45
-27.213.50.231
  27.213.6.59
  27.213.64.218
-27.213.66.16
  27.213.66.238
-27.213.66.248
-27.213.69.164
  27.213.84.41
-27.213.9.229
  27.213.95.75
  27.213.99.44
  27.215.100.145
  27.215.122.212
-27.215.138.169
  27.215.140.240
  27.215.146.216
  27.215.148.27
  27.215.168.30
  27.215.176.224
-27.215.199.172
  27.215.20.250
  27.215.224.48
  27.215.228.253
@@ -77606,15 +64345,14 @@
  27.215.61.73
  27.215.68.28
  27.215.68.87
-27.215.81.136
  27.215.83.51
  27.215.83.51bin.sh
-27.216.102.222
  27.216.107.88
  27.216.123.241
  27.216.129.117
-27.216.164.200
  27.216.174.156
+27.216.183.76
+27.216.184.21
  27.216.186.136
  27.216.214.166
  27.216.214.38
@@ -77623,32 +64361,24 @@
  27.216.254.180
  27.216.46.101
  27.216.48.72
-27.216.6.83
-27.216.65.12
-27.216.77.180
  27.216.82.57
-27.217.103.59
  27.217.113.90
  27.217.136.68bin.sh
  27.217.138.46
  27.217.139.169
  27.217.154.84
-27.217.19.69
  27.217.213.201
-27.217.214.175
  27.217.242.231bin.sh
  27.217.4.105
  27.217.46.206
  27.217.49.27
  27.217.54.35
+27.217.67.19
  27.217.71.122
  27.218.178.146
  27.218.187.213
-27.218.190.190
-27.219.109.50
  27.219.124.153
  27.219.126.249
-27.219.137.38
  27.219.137.38bin.sh
  27.219.138.234
  27.219.146.237
@@ -77667,62 +64397,51 @@
  27.220.158.71
  27.220.38.82
  27.220.61.85
-27.220.82.88
  27.220.88.199
-27.220.89.110
  27.220.89.65
  27.220.94.247
  27.221.109.116
-27.221.232.226
-27.221.240.42
+27.221.232.180
  27.221.241.61
-27.221.25.235
+27.221.251.95
  27.222.142.26
  27.222.143.116
  27.222.150.57
-27.222.151.99
  27.222.174.239
  27.222.206.184
  27.222.242.112
  27.222.54.39
-27.222.60.210
-27.222.69.5
  27.222.76.194
  27.223.147.180bin.sh
  27.223.153.198
  27.223.161.155
-27.223.174.233
  27.223.196.71
-27.223.2.182
  27.223.203.99
  27.223.213.68
  27.223.221.186
  27.223.230.215
  27.223.244.246
  27.223.254.218
-27.223.78.164
+27.223.44.61
  27.223.89.238
  27.223.99.130
-27.24.159.28
  27.24.28.41
  27.24.29.111bin.sh
  27.24.29.251bin.sh
  27.24.85.22
  27.254.130.67
  27.254.137.144
+27.254.172.54
  27.254.206.238
  27.254.34.177
-27.254.34.181
-27.254.38.122
  27.254.46.67
  27.254.60.60
  27.254.95.199
-27.255.166.107
  27.255.191.204
-27.255.198.58
-27.255.245.93
+27.255.43.242
  27.255.65.107
-27.255.75.146
+27.255.75.10
+27.255.75.153
  27.255.75.18
  27.255.75.3
  27.255.75.5
@@ -77730,33 +64449,25 @@
  27.255.75.7
  27.255.75.8
  27.255.75.9
-27.255.77.10
  27.255.77.182
-27.255.77.22
-27.255.77.33
  27.255.79.116
  27.255.79.37
-27.255.80.163
  27.255.80.203
  27.255.81.140
  27.255.81.163
  27.255.94.166
  27.255.94.55
-27.29.184.141
-27.3.235.252
-27.3.44.31
  27.30.4.215
-27.32.77.98
  27.33.160.196
  27.33.170.219
+27.33.55.112
+27.34.0.72
  27.34.13.17
  27.34.13.52
  27.34.161.42
+27.34.20.121
  27.34.20.87
  27.34.251.60
-27.34.35.111
-27.34.8.62
-27.34.88.177
  27.35.100.245
  27.35.104.17
  27.35.105.206
@@ -77767,53 +64478,40 @@
  27.35.144.79
  27.35.154.13
  27.35.160.16
-27.35.172.14
  27.35.197.103
  27.35.211.40
-27.35.211.93
  27.35.217.36
-27.35.217.62
  27.35.217.95
  27.35.228.134
-27.35.231.84
  27.35.236.49
  27.35.32.138
  27.35.34.141
  27.35.50.238
-27.35.50.53
  27.35.50.93
  27.35.58.5
  27.37.179.56
-27.38.124.117
-27.41.137.76
-27.41.139.37
-27.41.149.189
+27.38.8.195
+27.41.156.239
  27.41.157.5
  27.41.158.204
-27.41.175.21
  27.41.179.202
  27.41.181.181
+27.41.181.98
  27.41.182.169
  27.41.187.171
  27.41.204.88
  27.41.206.175
-27.41.213.68
  27.41.214.127
+27.41.216.192
+27.41.217.142
  27.41.218.40
-27.41.228.17
  27.41.87.94
  27.42.168.46
-27.44.195.200
-27.46.44.235
-27.48.138.8
-27.49.160.7
-27.49.160.9
-27.49.232.9
+27.46.6.247
  27.5.248.205
  27.5.32.191
-27.5.41.191
+27.5.41.83
  27.5.45.52
-27.50.169.196
  27.50.175.63
  27.50.18.42
  27.50.22.30
@@ -77821,9 +64519,7 @@
  27.54.118.235
  27.54.163.132
  27.54.166.212
-27.54.228.71
-27.54.248.35
-27.57.191.153
+27.55.68.204
  27.59.96.163
  27.6.104.60bin.sh
  27.6.159.214
@@ -77837,23 +64533,21 @@
  27.64.13.18
  27.64.13.187
  27.64.14.232
+27.64.14.89
  27.64.15.243
-27.64.16.204
  27.64.229.157
  27.64.9.139
  27.64.9.160
  27.64.9.87
-27.65.58.89
-27.66.89.122
+27.66.73.101
  27.69.10.118
  27.69.181.55
  27.69.245.10
  27.7.143.136
-27.7.83.127
+27.71.2.208
  27.71.228.25
  27.71.231.25
  27.71.231.81
-27.71.6.113
  27.72.109.15
  27.72.113.239
  27.72.122.228
@@ -77866,32 +64560,13 @@
  27.72.72.228
  27.72.72.48
  27.72.75.227
-27.73.177.45
-27.73.61.126
-27.73.61.220
+27.73.236.137
  27.74.247.135
  27.74.247.140
-27.74.251.18
-27.74.80.196
-27.75.82.237
-27.76.8.68
-27.77.255.113
-27.77.53.140
-27.77.61.241
-27.77.70.33
-27.78.27.110
-27.78.36.99
-27.79.158.146
-27.79.214.96
+27.76.74.60
  27.8.108.4
-27.8.110.109
-27.8.119.46
-27.8.119.88
  27.8.228.156
  27.8.235.240
-27.9.96.63
-27.96.229.21
-27.96.68.117
  272101.com
  27353.join78.ga
  2746.31cf4fdae.com
@@ -77963,6 +64638,7 @@
  2b7ccbe0e12725004.temporary.link
  2b87a39fe5ef08875af9edab331f7589.accesscam.org
  2b87gf5ac1o2l99ea.com
+2ba547df7ef92c01ec4ac9311b006fbb-dot-extra-nexus.uk.r.appspot.com
  2babaworriors.com
  2bc41e514f72.ngrok.io
  2bill-wireless.com
@@ -78091,6 +64767,7 @@
  2stm.uno
  2tbofat2.banouter.com
  2tbuofa2t.bankofamericaslpemr.com
+2teename.com
  2tem5sb.merlontean.com
  2themoonwidget.info
  2thpubgm.com
@@ -78158,7 +64835,6 @@
  3.0.172.253
  3.0.178.55
  3.0.22.9
-3.0.44.32
  3.1.101.22
  3.1.201.76
  3.1.213.80
@@ -78167,13 +64843,11 @@
  3.10.70.38
  3.101.12.202
  3.101.125.70
-3.101.139.90
  3.101.147.13
  3.101.67.35
  3.104.224.253
  3.104.224.80
  3.104.54.134
-3.105.67.56
  3.11.152.239
  3.11.235.44
  3.112.107.63
@@ -78193,7 +64867,6 @@
  3.115.164.24
  3.115.245.111
  3.120.112.0
-3.120.129.178
  3.120.151.83
  3.120.158.102
  3.120.172.249
@@ -78206,14 +64879,14 @@
  3.121.203.211
  3.121.94.224
  3.122.247.28
+3.122.248.153
  3.122.59.101
  3.123.19.130
  3.123.222.19
  3.123.254.92
  3.123.26.194
  3.123.28.195
-3.124.212.17
-3.124.220.121
+3.123.30.145
  3.124.38.47
  3.124.5.37
  3.124.63.44
@@ -78224,7 +64897,6 @@
  3.126.209.33
  3.126.249.36
  3.127.236.227
-3.127.45.228
  3.128.106.107
  3.128.205.10
  3.128.212.89
@@ -78237,14 +64909,12 @@
  3.131.13.61
  3.131.202.18
  3.131.207.170
-3.131.236.110
  3.132.39.66
  3.133.119.53
-3.133.142.248
-3.133.154.216
  3.133.86.139
  3.134.125.175
  3.134.245.141
+3.134.39.220
  3.134.91.16
  3.135.154.33
  3.135.201.40
@@ -78253,7 +64923,7 @@
  3.137.163.92
  3.138.122.100
  3.138.137.1
-3.139.101.224
+3.138.192.154
  3.139.64.97
  3.14.168.201
  3.14.81.8
@@ -78265,16 +64935,16 @@
  3.16.128.12
  3.16.129.75
  3.16.165.53
+3.16.46.54
  3.16.53.75
  3.17.10.247
+3.17.104.2
  3.17.109.77
  3.17.142.163
-3.17.151.111
  3.17.165.85
  3.17.174.43
  3.17.176.216
  3.17.213.129
-3.17.24.6
  3.17.27.175
  3.17.57.130
  3.17.61.84
@@ -78284,8 +64954,6 @@
  3.19.227.221
  3.19.30.176
  3.19.56.156
-3.20.206.26
-3.208.0.6
  3.208.228.221
  3.208.33.179
  3.208.33.180
@@ -78298,25 +64966,24 @@
  3.210.177.194
  3.211.17.212
  3.211.51.136
-3.214.190.124
  3.219.41.205
  3.219.58.63
+3.22.148.89
  3.22.198.63
  3.22.25.171
  3.22.30.40
-3.22.51.2
  3.22.98.50
  3.220.203.233
  3.220.231.94
  3.221.155.232
  3.222.213.197
+3.222.53.110
  3.224.147.129
  3.226.90.197
  3.227.11.183
-3.227.15.164
-3.227.195.104
  3.227.40.135
  3.228.87.114
+3.229.23.232
  3.23.111.204
  3.23.227.175
  3.23.87.72
@@ -78327,7 +64994,6 @@
  3.232.243.7
  3.233.220.90
  3.234.139.193
-3.234.236.62
  3.234.251.85
  3.235.183.241
  3.235.183.74
@@ -78337,13 +65003,16 @@
  3.236.45.242
  3.236.45.91
  3.236.57.164
+3.236.70.144
  3.237.205.105
  3.237.21.100
  3.237.31.105
  3.237.32.184
  3.237.45.200
  3.237.65.243
+3.238.157.137
  3.238.8.21
+3.239.3.233
  3.239.48.250
  3.24.135.75
  3.24.40.204
@@ -78355,12 +65024,9 @@
  3.250.35.22
  3.26.49.147
  3.34.133.144
-3.34.141.64
  3.34.180.213
  3.34.189.221
-3.34.208.174
  3.34.252.168
-3.34.42.230
  3.35.138.214
  3.35.166.20
  3.35.168.137
@@ -78368,9 +65034,9 @@
  3.35.40.175
  3.35.43.188
  3.6.206.209
-3.6.40.26
  3.6.62.165
  3.6.71.62
+3.6.73.88
  3.7.171.70
  3.7.190.231
  3.7.66.53
@@ -78387,44 +65053,29 @@
  3.8.38.104
  3.8.52.65
  3.8.9.247
-3.80.166.95
  3.81.144.22
  3.81.208.241
-3.81.27.225
-3.81.6.97
  3.81.67.195
-3.81.69.127
-3.81.9.188
-3.81.90.20
  3.81.94.209
+3.82.213.88
  3.82.58.104
  3.83.190.102
  3.83.217.230
  3.83.239.210
  3.83.8.0
  3.84.141.230
-3.84.215.5
  3.84.255.159
  3.84.27.209
-3.85.100.29
  3.87.133.20
-3.87.139.249
  3.87.158.26
  3.87.177.152
  3.87.216.155
-3.87.38.110
  3.88.242.52
  3.89.143.143
-3.89.7.95
-3.90.112.217
  3.90.83.73
  3.91.209.129
-3.91.236.72
-3.91.73.60
  3.92.233.209
  3.93.244.52
-3.93.38.220
-3.94.197.195
  3.94.249.60
  3.94.59.124
  3.94.96.136
@@ -78432,7 +65083,6 @@
  3.96.170.113
  3.96.190.111
  3.96.218.124
-3.96.60.219
  3.change-my-billing-details.com
  3.empirecores.com
  3.gucac.com
@@ -78490,65 +65140,55 @@
  30yearsred.com
  30ywc.codesandbox.io
  31-31-199-49.ovz.vps.regruhosting.ru
-31.0.194.24
-31.0.210.36
-31.0.221.234
+31.0.34.223
+31.0.65.15
  31.0.98.131
-31.0.99.6
+31.1.134.62
  31.10.110.132
  31.10.15.182
  31.11.51.57
  31.12.67.62
-31.124.19.165
+31.124.248.248
  31.125.91.61
  31.128.90.180
-31.129.11.38
-31.129.127.19
  31.129.166.236
-31.129.173.162
+31.129.246.248
  31.129.253.30
-31.129.68.164
  31.13.115.23
  31.13.137.65
-31.13.176.209
  31.13.218.167
  31.130.203.168
  31.131.20.185
  31.131.21.132
  31.131.22.48
  31.131.249.220
+31.131.67.14
  31.131.69.14
+31.132.1.41
  31.132.135.237
-31.132.152.49
  31.132.17.56
  31.132.171.99
  31.132.208.24
  31.132.220.2
  31.132.69.165
-31.132.94.8
  31.133.57.134
-31.133.65.89
  31.134.121.223
  31.134.125.80
  31.134.143.197
  31.134.16.13
  31.134.16.39
-31.135.177.195
  31.135.205.221
  31.135.77.117
  31.135.91.9
  31.14.136.210
-31.14.140.241
  31.14.201.156
  31.14.40.154
  31.14.40.19
-31.14.57.239
  31.145.144.162
  31.145.166.27
  31.145.166.28
  31.145.74.138
  31.146.102.119
-31.146.115.147
  31.146.124.122
  31.146.124.20
  31.146.124.203
@@ -78564,16 +65204,9 @@
  31.146.229.254
  31.146.229.26
  31.146.243.12
-31.146.243.208
-31.146.243.215
-31.146.243.254
  31.146.243.52
  31.147.253.49
-31.148.107.67
-31.148.126.30
-31.148.127.91
  31.148.138.245
-31.148.140.42
  31.148.219.131
  31.148.219.206
  31.148.219.227
@@ -78586,67 +65219,34 @@
  31.15.89.51
  31.151.28.39
  31.153.101.140
-31.154.74.110
-31.156.118.156
-31.156.138.197
-31.156.165.147
-31.156.78.210
  31.16.176.69
  31.16.217.18
-31.16.252.176
+31.162.1.152
  31.162.152.3
  31.162.164.104
  31.162.234.145
  31.162.28.191
  31.162.49.58
  31.162.7.0
-31.163.130.208
-31.163.134.103
-31.163.136.147
-31.163.137.76
-31.163.138.228
+31.163.136.207
  31.163.143.19
-31.163.149.48
-31.163.150.235
-31.163.150.42
-31.163.151.211
-31.163.156.242
-31.163.158.160
  31.163.158.203
-31.163.158.220
  31.163.160.48
-31.163.160.66
-31.163.167.154
-31.163.167.70
  31.163.168.177
  31.163.168.62
-31.163.169.240
-31.163.171.163
-31.163.171.73
-31.163.173.177
-31.163.182.71
-31.163.182.80
-31.163.183.251
-31.163.184.247
+31.163.177.16
  31.163.185.27
-31.163.186.151
-31.163.191.111
+31.163.189.145
  31.163.198.162
  31.163.200.63
  31.163.202.55
  31.163.240.184
  31.163.251.135
-31.166.125.7
  31.167.104.130
-31.167.134.193
-31.167.18.162
-31.167.43.110
  31.167.60.26
-31.168.137.245
  31.168.168.167
  31.168.177.37
  31.168.184.59
-31.168.24.115
  31.168.249.37
  31.168.60.234
  31.168.69.220
@@ -78656,34 +65256,34 @@
  31.17.70.80
  31.170.123.8
  31.170.160.90
+31.170.161.39
+31.170.161.57
  31.170.161.84
  31.170.166.149
-31.170.166.154
  31.170.166.18
  31.170.173.73
+31.170.60.116
  31.170.61.191
-31.171.108.141
-31.171.114.85
+31.170.61.47
+31.170.62.13
+31.171.139.10
  31.171.152.100
  31.171.152.103
  31.171.152.105
  31.171.152.106
  31.171.152.108
+31.171.152.110
  31.171.195.124
-31.171.197.12
-31.171.198.145
-31.171.198.84
  31.171.251.35
  31.171.71.74
  31.172.248.10
  31.173.0.249
+31.173.123.11
  31.173.13.190
  31.173.135.156
  31.173.138.204
-31.173.162.191
-31.173.246.95
  31.173.48.61
-31.173.75.21
+31.173.87.218
  31.173.94.93
  31.176.182.220
  31.176.185.30
@@ -78691,36 +65291,32 @@
  31.177.78.239
  31.178.150.200
  31.178.171.177
-31.179.106.30
  31.179.131.246
-31.179.155.194
  31.179.204.142
  31.179.224.42
  31.179.235.105
  31.179.247.161
+31.18.250.195
  31.18.73.104
+31.180.220.226
  31.181.183.203
-31.181.96.248
+31.181.205.85
+31.181.229.164
  31.182.12.3
  31.182.13.17
-31.182.57.86
  31.183.130.58
  31.184.177.6
  31.184.194.180
  31.184.195.114
  31.184.198.75
  31.184.199.114
-31.184.215.57
  31.184.218.3
  31.184.224.90
  31.184.234.145
  31.185.104.19
  31.185.104.21
-31.185.111.112
  31.185.167.195
  31.186.26.130
-31.186.48.172
-31.186.53.122
  31.186.8.86
  31.19.63.107
  31.192.105.16
@@ -78734,13 +65330,11 @@
  31.2.110.221
  31.20.193.52
  31.201.13.250
-31.201.222.51
  31.201.236.49
  31.201.238.250
  31.201.50.78
  31.202.101.40
-31.202.184.11
-31.202.195.221
+31.202.191.131
  31.202.30.118
  31.202.35.72
  31.203.201.228
@@ -78748,13 +65342,12 @@
  31.204.128.20
  31.204.155.160
  31.204.180.44
-31.204.20.13
  31.206.38.40
  31.206.38.46
  31.206.38.48
  31.206.38.50
  31.206.38.55
-31.207.134.83
+31.206.63.226
  31.207.172.78
  31.207.33.100
  31.207.33.153
@@ -78762,18 +65355,12 @@
  31.207.44.34
  31.207.47.33
  31.207.47.34
-31.208.136.2
-31.208.16.80
  31.208.173.175
-31.208.201.207
-31.208.225.175
-31.208.236.235
-31.208.236.25
+31.208.246.36
  31.208.27.177
  31.208.27.85
  31.208.30.55
  31.208.34.198
-31.208.43.188
  31.209.104.231
  31.209.21.17
  31.209.223.149
@@ -78792,8 +65379,10 @@
  31.214.157.247
  31.214.157.73
  31.214.245.178
-31.216.38.22
+31.214.245.85
  31.217.222.192
+31.217.24.224
+31.217.33.51
  31.220.0.186
  31.220.0.202
  31.220.0.203
@@ -78801,6 +65390,10 @@
  31.220.1.169
  31.220.1.170
  31.220.1.233
+31.220.104.186
+31.220.110.168
+31.220.110.62
+31.220.110.63
  31.220.183.217
  31.220.2.100
  31.220.2.107
@@ -78833,30 +65426,25 @@
  31.220.43.160
  31.220.45.151
  31.220.48.188
-31.220.52.245
  31.220.53.200
  31.220.53.6
  31.220.53.84
  31.220.55.120
-31.220.56.156
  31.220.60.222
  31.220.63.23
  31.220.84.214
  31.221.95.5
  31.222.129.14
-31.222.6.25
-31.222.6.30
-31.222.6.42
+31.222.6.48
+31.222.6.61
  31.222.6.65
-31.222.7.51
  31.222.7.56
  31.222.7.79
  31.223.135.126
-31.223.135.188
  31.223.135.222
-31.223.16.149
  31.223.165.146
  31.23.54.45
+31.24.128.41
  31.24.176.249
  31.24.200.23
  31.24.205.70
@@ -78868,74 +65456,54 @@
  31.25.246.206
  31.27.105.102
  31.27.129.57
-31.27.21.13
-31.28.0.203
  31.28.10.74
+31.28.123.144
  31.28.163.45
+31.28.228.252
  31.28.241.117
  31.28.5.212
  31.28.99.25
-31.29.212.240
  31.29.34.188
  31.29.99.227
  31.29.99.230
-31.3.124.69
  31.3.135.181
-31.3.152.162
  31.3.232.109
  31.3.242.140
  31.30.126.217
-31.30.169.157
  31.31.14.134
-31.31.198.78
  31.31.6.21
  31.31.72.24
  31.31.74.47
  31.31.76.95
  31.31.77.107
-31.32.208.250
-31.36.100.205
  31.36.157.129
  31.36.181.181
  31.39.234.242
-31.4.242.89
  31.40.135.67
  31.40.136.83
-31.40.209.34
-31.40.253.59
  31.40.48.112
-31.41.104.59
  31.41.11.10
  31.41.15.19
  31.41.154.125
  31.41.225.205
-31.41.227.72
  31.41.255.34
  31.41.30.225
-31.41.63.12
  31.41.8.139
  31.41.89.237
  31.41.92.154
  31.41.93.230
-31.42.184.136
-31.42.184.239
-31.42.186.147
+31.42.11.180
  31.42.188.74
  31.42.254.24
  31.42.254.25
  31.43.1.189
-31.43.127.71
  31.43.14.252
  31.43.140.190
  31.43.181.189
-31.43.255.124
-31.43.255.86
  31.43.63.70
-31.43.99.137
  31.44.12.233
  31.44.161.205
  31.44.184.50
-31.44.60.29
  31.45.113.95
  31.45.150.164
  31.45.150.196
@@ -78944,25 +65512,18 @@
  31.45.240.114
  31.45.240.154
  31.46.16.91
-31.46.242.252
+31.46.165.237
+31.46.250.52
  31.46.32.20
-31.46.95.254
-31.47.105.136
-31.47.154.249
  31.47.189.14
  31.47.202.73
  31.47.240.130
  31.47.252.50
-31.47.43.139
-31.47.54.180
  31.47.55.138
  31.48.9.90
-31.5.172.135
  31.5.19.51
  31.50.81.226
-31.52.156.157
  31.53.222.118
-31.54.8.212
  31.56.42.112
  31.6.4.245
  31.6.71.218
@@ -78996,7 +65557,7 @@
  31qqww.com
  32.140.225.186
  32.214.183.114
-32.216.140.235
+32.218.180.9
  32.64.34.139
  32.97.152.254
  3201170-dot-n-e-w-me-ss-age-po-rt-al.wl.r.appspot.com
@@ -79056,7 +65617,6 @@
  33c59f73d1.nxcli.net
  33cow.com
  33duoduo.icu
-33edb76650e6edb7f82f32c02d896cf4-dot-lunar-prism-298307.oa.r.appspot.com
  33lzmm.com
  33smbzj2p5b1.us-south.cf.appdomain.cloud
  33tang.com
@@ -79085,7 +65645,6 @@
  34.105.19.97
  34.105.204.108
  34.105.209.243
-34.105.235.111
  34.105.247.173
  34.106.105.122
  34.106.108.150
@@ -79108,18 +65667,17 @@
  34.107.111.11
  34.107.118.237
  34.107.124.150
-34.107.127.177
  34.107.22.190
  34.107.22.206
  34.107.23.120
  34.107.38.0
  34.107.51.85
  34.107.54.119
+34.107.55.184
  34.107.96.176
  34.121.191.59
  34.121.220.45
  34.121.56.218
-34.122.133.6
  34.122.17.53
  34.122.32.203
  34.123.129.183
@@ -79129,7 +65687,6 @@
  34.123.178.160
  34.123.213.165
  34.123.239.209
-34.123.69.19
  34.123.84.183
  34.125.112.156
  34.125.126.33
@@ -79152,6 +65709,7 @@
  34.126.107.179
  34.126.115.35
  34.126.120.20
+34.126.124.61
  34.126.67.135
  34.192.156.39
  34.192.191.140
@@ -79177,14 +65735,15 @@
  34.201.101.33
  34.201.115.218
  34.201.120.185
-34.201.153.104
  34.201.209.180
+34.201.223.145
  34.201.229.41
  34.201.38.1
  34.201.67.195
  34.201.76.115
  34.201.76.73
  34.202.20.169
+34.203.101.105
  34.203.196.115
  34.203.197.252
  34.203.198.206
@@ -79228,7 +65787,6 @@
  34.208.172.122
  34.208.179.121
  34.208.233.24
-34.208.243.244
  34.208.5.11
  34.208.97.244
  34.209.12.26
@@ -79259,7 +65817,6 @@
  34.210.179.19
  34.210.194.169
  34.210.198.230
-34.210.214.185
  34.210.230.117
  34.210.240.100
  34.210.26.53
@@ -79281,7 +65838,6 @@
  34.212.191.195
  34.212.192.189
  34.212.202.231
-34.212.25.21
  34.212.255.95
  34.212.29.94
  34.212.83.125
@@ -79343,7 +65899,6 @@
  34.219.21.171
  34.219.211.208
  34.219.240.62
-34.219.42.179
  34.219.51.19
  34.220.136.119
  34.220.144.124
@@ -79364,6 +65919,7 @@
  34.221.48.44
  34.221.99.7
  34.222.116.184
+34.222.125.116
  34.222.125.43
  34.222.193.26
  34.222.228.252
@@ -79397,24 +65953,20 @@
  34.227.72.151
  34.227.72.236
  34.227.77.146
-34.227.96.133
  34.227.96.252
  34.227.98.5
  34.228.142.87
  34.228.155.214
  34.228.158.237
-34.228.183.107
  34.228.186.31
  34.228.217.49
  34.228.228.12
-34.228.229.227
  34.228.241.245
  34.228.31.206
  34.228.43.110
  34.228.44.213
  34.228.7.21
  34.229.105.200
-34.229.113.79
  34.229.116.12
  34.229.144.168
  34.229.150.92
@@ -79438,7 +65990,6 @@
  34.230.197.237
  34.230.42.105
  34.230.42.255
-34.230.64.203
  34.230.72.241
  34.230.85.188
  34.230.89.247
@@ -79447,7 +65998,6 @@
  34.231.21.96
  34.231.234.150
  34.232.106.159
-34.232.120.177
  34.232.63.88
  34.234.149.96
  34.234.208.165
@@ -79471,6 +66021,7 @@
  34.236.44.64
  34.236.86.59
  34.237.15.134
+34.237.241.18
  34.237.243.198
  34.238.124.208
  34.238.127.130
@@ -79488,10 +66039,10 @@
  34.239.137.1
  34.239.142.43
  34.239.143.202
+34.239.202.197
  34.239.251.172
  34.239.255.90
  34.239.97.88
-34.239.99.68
  34.240.10.66
  34.240.146.14
  34.240.187.228
@@ -79514,7 +66065,6 @@
  34.242.64.157
  34.243.139.60
  34.243.145.140
-34.243.211.235
  34.243.236.188
  34.243.42.57
  34.243.52.146
@@ -79524,6 +66074,7 @@
  34.244.164.104
  34.244.167.154
  34.244.168.170
+34.244.191.106
  34.244.207.181
  34.244.210.243
  34.244.233.188
@@ -79601,6 +66152,7 @@
  34.64.149.89
  34.64.150.100
  34.64.151.153
+34.64.169.221
  34.64.199.161
  34.64.209.210
  34.64.211.116
@@ -79641,7 +66193,6 @@
  34.68.243.140
  34.69.106.155
  34.69.117.110
-34.69.250.177
  34.69.253.72
  34.69.69.205
  34.70.109.189
@@ -79649,28 +66200,19 @@
  34.70.196.248
  34.70.217.179
  34.70.49.158
-34.71.174.184
-34.71.19.169
  34.71.206.168
  34.71.210.159
-34.71.232.139
  34.71.250.100
-34.71.41.157
-34.72.127.29
  34.72.156.130
  34.72.163.246
  34.72.214.182
  34.72.78.90
  34.72.85.73
-34.72.90.199
  34.73.10.30
  34.73.101.96
-34.73.136.216
  34.73.71.43
-34.74.178.229
  34.74.178.245
  34.74.24.33
-34.74.252.206
  34.74.26.21
  34.74.46.5
  34.75.113.198
@@ -79680,9 +66222,8 @@
  34.75.54.59
  34.76.14.99
  34.76.203.45
+34.76.33.242
  34.76.95.40
-34.77.55.50
-34.77.93.233
  34.78.103.223
  34.78.14.25
  34.78.159.8
@@ -79726,12 +66267,9 @@
  34.85.35.125
  34.85.94.221
  34.85.99.179
-34.86.124.63
-34.86.133.159
  34.86.135.216
  34.86.138.106
  34.86.185.91
-34.86.202.53
  34.86.205.89
  34.86.209.19
  34.86.217.40
@@ -79748,19 +66286,17 @@
  34.87.141.181
  34.87.160.10
  34.87.160.111
+34.87.161.9
  34.87.164.59
  34.87.168.12
  34.87.188.136
-34.87.200.87
  34.87.205.187
  34.87.226.183
  34.87.232.92
-34.87.242.193
  34.87.251.211
  34.87.251.72
  34.87.252.166
  34.87.53.100
-34.87.60.128
  34.87.61.90
  34.87.69.221
  34.87.70.59
@@ -79785,6 +66321,7 @@
  34.90.103.131
  34.90.104.47
  34.90.113.143
+34.90.13.176
  34.90.157.209
  34.90.160.87
  34.90.25.58
@@ -79794,7 +66331,6 @@
  34.91.140.191
  34.91.188.86
  34.91.195.229
-34.91.252.56
  34.91.41.138
  34.91.86.7
  34.92.115.205
@@ -79813,6 +66349,7 @@
  34.92.27.145
  34.92.29.25
  34.92.40.26
+34.92.62.114
  34.92.87.60
  34.92.95.72
  34.93.0.165
@@ -79824,7 +66361,6 @@
  34.93.204.215
  34.93.206.77
  34.93.21.82
-34.93.211.102
  34.93.222.205
  34.93.237.166
  34.93.249.82
@@ -79845,13 +66381,11 @@
  34.94.90.206
  34.94.93.161
  34.95.0.69
-34.95.136.147
  34.95.148.137
  34.95.164.161
  34.95.165.1
  34.95.17.184
  34.95.223.61
-34.95.254.204
  34.95.29.216
  34.95.29.237
  34.95.38.162
@@ -79924,22 +66458,21 @@
  35-23-4532-34.com
  35-40konkatsu.net
  35.0.127.52
+35.129.216.86
  35.130.112.58
-35.131.161.166
  35.133.115.62
  35.137.236.32
  35.142.195.99
  35.143.99.174
  35.152.37.200
  35.153.133.181
-35.153.167.247
  35.153.168.135
-35.153.182.233
  35.153.203.202
  35.153.54.53
  35.153.87.161
  35.154.183.151
  35.154.255.215
+35.154.47.206
  35.154.62.240
  35.154.66.71
  35.154.83.174
@@ -79976,6 +66509,7 @@
  35.158.169.39
  35.158.185.217
  35.158.226.16
+35.158.227.216
  35.158.237.165
  35.158.249.148
  35.158.42.168
@@ -80026,6 +66560,7 @@
  35.163.36.246
  35.163.48.30
  35.163.8.39
+35.164.127.120
  35.164.128.161
  35.164.151.193
  35.164.16.145
@@ -80098,15 +66633,12 @@
  35.172.186.20
  35.172.201.19
  35.172.33.199
-35.173.138.120
-35.173.184.123
  35.173.221.11
  35.174.188.175
-35.174.9.142
  35.175.179.11
  35.175.184.240
+35.175.211.235
  35.175.223.226
-35.175.224.31
  35.175.55.104
  35.176.1.31
  35.176.114.144
@@ -80207,6 +66739,7 @@
  35.180.209.30
  35.180.215.26
  35.180.226.15
+35.180.238.5
  35.180.30.122
  35.180.41.213
  35.180.61.40
@@ -80257,7 +66790,6 @@
  35.183.60.98
  35.183.61.192
  35.184.116.118
-35.184.122.221
  35.184.128.99
  35.184.139.145
  35.184.144.99
@@ -80297,7 +66829,6 @@
  35.186.228.86
  35.187.108.126
  35.187.177.230
-35.187.2.55
  35.187.223.176
  35.187.242.8
  35.187.46.198
@@ -80340,7 +66871,6 @@
  35.192.131.204
  35.192.132.255
  35.192.133.155
-35.192.140.254
  35.192.16.224
  35.192.178.18
  35.192.219.160
@@ -80354,7 +66884,6 @@
  35.192.88.64
  35.193.10.18
  35.193.104.24
-35.193.202.138
  35.193.206.253
  35.193.216.14
  35.193.226.32
@@ -80368,7 +66897,6 @@
  35.194.136.34
  35.194.150.24
  35.194.161.52
-35.194.164.99
  35.194.25.179
  35.194.251.225
  35.194.253.204
@@ -80389,7 +66917,6 @@
  35.195.238.142
  35.195.25.89
  35.195.30.252
-35.195.64.67
  35.195.64.76
  35.196.133.89
  35.196.153.175
@@ -80412,7 +66939,6 @@
  35.197.147.209
  35.197.151.149
  35.197.172.49
-35.197.227.71
  35.197.3.12
  35.197.32.194
  35.197.41.227
@@ -80425,12 +66951,9 @@
  35.198.155.181
  35.198.162.31
  35.198.179.51
-35.198.181.71
  35.198.182.228
-35.198.195.1
  35.198.203.184
  35.198.228.240
-35.198.42.138
  35.198.48.176
  35.198.49.11
  35.199.10.191
@@ -80452,7 +66975,6 @@
  35.199.86.139
  35.199.88.255
  35.200.114.187
-35.200.15.166
  35.200.161.138
  35.200.167.38
  35.200.168.65
@@ -80467,7 +66989,6 @@
  35.200.237.93
  35.200.241.227
  35.200.252.133
-35.200.60.134
  35.200.71.247
  35.200.75.228
  35.200.77.30
@@ -80486,7 +67007,6 @@
  35.202.188.178
  35.202.198.13
  35.202.200.129
-35.202.25.83
  35.202.253.241
  35.202.72.149
  35.202.74.190
@@ -80503,7 +67023,6 @@
  35.203.7.188
  35.203.70.175
  35.203.9.43
-35.203.90.175
  35.203.92.223
  35.204.114.205
  35.204.137.151
@@ -80514,25 +67033,18 @@
  35.204.2.48
  35.204.253.254
  35.204.31.217
-35.204.32.209
  35.205.117.63
  35.205.22.29
  35.205.83.203
-35.207.1.8
  35.207.65.42
-35.207.8.221
-35.207.9.24
+35.208.134.190
  35.208.14.82
-35.208.192.227
  35.208.209.158
  35.208.232.147
  35.208.250.102
-35.208.72.203
  35.208.83.16
  35.209.158.181
  35.209.209.15
-35.209.236.138
-35.209.4.62
  35.209.43.93
  35.209.51.212
  35.209.9.189
@@ -80541,17 +67053,13 @@
  35.213.156.250
  35.213.157.114
  35.213.159.186
-35.213.164.184
  35.213.164.234
  35.213.165.60
-35.213.168.22
  35.213.18.190
  35.213.181.224
-35.213.185.252
  35.213.188.188
  35.214.150.199
  35.214.151.47
-35.214.165.70
  35.220.138.138
  35.220.147.109
  35.220.155.26
@@ -80567,7 +67075,6 @@
  35.221.158.174
  35.221.193.56
  35.221.196.29
-35.221.196.33
  35.221.214.98
  35.221.223.15
  35.221.223.61
@@ -80578,9 +67085,7 @@
  35.223.104.113
  35.223.16.227
  35.223.167.122
-35.223.191.160
  35.223.255.227
-35.223.255.24
  35.224.1.26
  35.224.107.234
  35.224.124.158
@@ -80598,7 +67103,6 @@
  35.225.107.161
  35.225.122.10
  35.225.15.12
-35.225.173.185
  35.225.181.213
  35.225.191.140
  35.225.192.27
@@ -80606,14 +67110,17 @@
  35.225.94.95
  35.226.120.32
  35.226.132.241
+35.226.135.24
  35.226.14.224
  35.226.172.128
+35.226.188.44
  35.226.204.126
  35.226.232.224
  35.226.50.174
  35.226.53.239
  35.226.8.173
  35.226.81.181
+35.227.156.200
  35.227.169.40
  35.227.169.57
  35.227.181.98
@@ -80624,7 +67131,6 @@
  35.227.64.238
  35.227.77.27
  35.228.132.48
-35.228.135.238
  35.228.150.47
  35.228.169.211
  35.228.171.144
@@ -80639,21 +67145,15 @@
  35.228.236.15
  35.228.238.236
  35.228.239.128
-35.228.24.69
  35.228.240.175
-35.228.243.135
-35.228.246.186
  35.228.251.146
-35.228.38.108
  35.228.71.136
-35.228.8.120
  35.228.85.207
  35.228.95.22
  35.229.108.202
  35.229.113.53
  35.229.123.111
  35.229.126.239
-35.229.133.115
  35.229.139.80
  35.229.148.33
  35.229.169.213
@@ -80674,7 +67174,6 @@
  35.230.88.52
  35.230.95.205
  35.231.100.231
-35.231.106.59
  35.231.113.167
  35.231.154.254
  35.231.190.134
@@ -80686,7 +67185,6 @@
  35.231.89.204
  35.232.112.59
  35.232.138.65
-35.232.183.107
  35.232.213.202
  35.232.228.59
  35.232.5.209
@@ -80694,34 +67192,30 @@
  35.233.226.183
  35.233.235.80
  35.234.100.118
-35.234.17.69
  35.234.19.151
  35.234.52.44
  35.234.57.250
  35.234.64.242
  35.234.7.71
  35.234.78.228
+35.234.9.72
  35.235.107.110
  35.235.115.241
-35.235.127.27
  35.235.89.230
  35.235.96.109
  35.236.118.211
  35.236.12.131
  35.236.125.18
  35.236.139.60
-35.236.145.244
  35.236.147.169
  35.236.147.87
  35.236.160.131
  35.236.164.193
-35.236.169.30
  35.236.182.209
  35.236.186.225
  35.236.199.75
  35.236.203.52
  35.236.207.14
-35.236.27.30
  35.236.39.99
  35.236.40.20
  35.236.57.66
@@ -80739,9 +67233,9 @@
  35.237.55.25
  35.237.92.187
  35.238.144.91
-35.238.210.82
  35.238.235.88
  35.238.252.69
+35.238.62.159
  35.238.78.110
  35.238.86.248
  35.239.105.105
@@ -80775,14 +67269,11 @@
  35.244.103.242
  35.244.108.75
  35.244.120.134
-35.244.120.253
  35.244.234.195
  35.244.25.124
  35.244.33.53
  35.244.67.121
  35.244.9.182
-35.245.105.248
-35.245.128.50
  35.245.143.50
  35.245.148.20
  35.245.173.118
@@ -80791,11 +67282,9 @@
  35.245.230.216
  35.245.33.180
  35.245.48.156
-35.245.5.75
  35.245.67.98
  35.246.105.196
  35.246.116.88
-35.246.132.82
  35.246.144.163
  35.246.175.1
  35.246.206.89
@@ -80809,12 +67298,11 @@
  35.246.97.170
  35.247.128.200
  35.247.175.47
+35.247.183.82
  35.247.228.106
  35.247.235.180
  35.247.237.194
-35.247.238.82
  35.247.241.173
-35.247.248.136
  35.247.39.60
  350450-dot-n-e-w-me-ss-age-po-rt-al.wl.r.appspot.com
  352773.com
@@ -80835,14 +67323,8 @@
  36.102.218.76
  36.102.232.2
  36.102.7.118
-36.103.229.76
-36.103.231.0
-36.103.241.148
-36.104.144.251
-36.104.145.203
  36.105.119.10
  36.105.15.120
-36.105.205.140
  36.105.56.188
  36.105.57.50
  36.107.137.193
@@ -80851,140 +67333,65 @@
  36.107.235.83
  36.107.236.145
  36.107.26.26
-36.109.132.16
+36.108.150.37
  36.109.133.37
  36.109.134.42
-36.110.105.51
-36.110.105.52
  36.110.110.34
  36.110.111.51
  36.110.142.239
  36.110.174.236
-36.110.182.30
-36.110.197.215
-36.110.197.52
  36.110.202.226
-36.110.218.194
  36.110.231.213
  36.110.239.4
-36.110.26.43
  36.110.27.122
-36.110.29.74
-36.110.3.52
-36.110.41.66
-36.110.59.242
  36.110.85.86
-36.111.145.226
-36.111.150.124
-36.111.150.54
-36.111.152.132
-36.111.160.189
-36.111.175.239
-36.111.181.248
-36.111.182.126
-36.111.182.133
-36.111.182.36
-36.111.182.37
-36.111.182.49
-36.111.195.5
-36.111.202.147
-36.111.33.70
-36.112.101.130
  36.112.104.194
-36.112.118.154
-36.112.118.158
-36.112.118.182
-36.112.128.193
-36.112.128.203
-36.112.131.191
-36.112.144.50
-36.112.150.84
  36.112.172.125
-36.112.26.35
-36.112.41.194
-36.112.74.3
-36.129.8.224
-36.130.74.34
  36.133.109.2
  36.133.119.199
-36.133.13.122
  36.133.131.165
  36.133.135.128
  36.133.166.205
+36.133.35.228
  36.133.44.246
  36.133.62.154
  36.133.97.82
  36.134.74.5
  36.134.75.7
  36.134.79.96
-36.148.1.36
  36.152.142.45
-36.152.214.226
  36.152.26.250
-36.152.32.87
  36.152.38.149
-36.152.65.134
-36.153.138.98
  36.153.164.122
-36.153.205.142
-36.153.231.18
  36.154.110.46
-36.154.117.210
-36.154.142.242
-36.154.171.130
-36.154.210.165
-36.154.210.166
-36.154.210.167
-36.154.210.171
-36.154.210.172
-36.154.8.103
-36.154.8.46
-36.155.113.199
-36.155.115.72
  36.155.117.5
  36.155.9.133
-36.156.138.107
-36.156.139.75
  36.156.154.154
  36.156.155.134
-36.156.157.177
-36.156.66.147
  36.158.206.230
-36.159.106.69
  36.189.253.226
-36.189.255.162
  36.22.178.114
  36.22.187.34
  36.22.223.138
+36.22.223.192
+36.226.37.52
  36.227.171.220
-36.228.48.7
-36.229.163.21
  36.229.7.108
-36.230.163.27
  36.230.232.24
  36.231.201.150
  36.231.69.25
  36.231.95.42
-36.232.172.66
-36.232.199.8
-36.233.57.188
  36.234.180.56
  36.236.156.204
  36.236.204.134
-36.236.229.43
-36.237.214.109
-36.238.106.39
-36.238.115.97
-36.238.52.231
  36.239.145.176
+36.239.210.121
  36.248.152.127
  36.248.153.3
  36.248.169.146
  36.248.170.140
+36.248.211.71
  36.248.93.13
-36.25.122.166
-36.25.122.42
-36.25.122.81
  36.25.228.115
  36.25.230.184
  36.25.243.251
@@ -81003,10 +67410,8 @@
  36.250.229.115
  36.250.229.97
  36.250.5.117
-36.250.75.44
  36.251.157.225
  36.251.19.27
-36.251.51.244
  36.251.52.129
  36.251.66.253
  36.251.68.194
@@ -81016,7 +67421,6 @@
  36.255.156.126
  36.255.156.78
  36.255.211.1
-36.255.248.218
  36.255.40.41
  36.255.61.190
  36.255.85.227
@@ -81038,16 +67442,8 @@
  36.26.194.61
  36.26.194.83
  36.26.210.57
-36.26.48.234
-36.26.68.112
-36.26.68.41
-36.26.87.107
-36.27.111.229
  36.27.208.157
  36.32.110.7
-36.32.139.253
-36.32.193.213
-36.32.236.76
  36.32.45.198
  36.32.69.140
  36.32.71.33
@@ -81056,9 +67452,7 @@
  36.33.138.140
  36.33.140.232
  36.33.140.248
-36.33.162.231
  36.34.150.235
-36.35.151.150
  36.35.160.188
  36.35.160.240
  36.35.161.107
@@ -81066,12 +67460,10 @@
  36.35.161.156
  36.35.161.7
  36.35.164.52
-36.35.93.34
  36.36.243.67
  36.37.104.98
  36.37.112.210
  36.37.113.4
-36.37.115.106
  36.37.122.118
  36.37.122.179
  36.37.122.43
@@ -81089,24 +67481,23 @@
  36.37.242.67
  36.37.73.245
  36.37.81.135
-36.37.98.82
-36.38.113.111
  36.39.18.226
+36.40.224.244
  36.43.65.41
-36.46.135.38
  36.48.145.151
  36.48.145.224
-36.48.159.58
-36.48.166.77
-36.48.175.161
+36.48.145.62
  36.49.158.18
  36.49.92.152
-36.5.177.96
  36.5.178.209
-36.5.93.18
-36.5.94.205
  36.55.230.146
-36.57.37.12
+36.57.37.143
+36.57.37.152
+36.57.37.164
+36.57.37.27
+36.57.37.71
+36.6.57.3
+36.62.8.2
  36.65.189.137
  36.65.42.59
  36.65.84.183
@@ -81118,7 +67509,6 @@
  36.66.133.19
  36.66.137.249
  36.66.140.15
-36.66.140.3
  36.66.149.211
  36.66.151.17
  36.66.155.23
@@ -81138,7 +67528,6 @@
  36.66.213.167
  36.66.231.113
  36.66.235.70
-36.66.239.105
  36.66.242.146
  36.66.242.148
  36.66.243.115
@@ -81162,6 +67551,7 @@
  36.67.109.165
  36.67.11.41
  36.67.112.11
+36.67.120.34
  36.67.123.239
  36.67.128.145
  36.67.153.58
@@ -81178,7 +67568,6 @@
  36.67.20.163
  36.67.20.251
  36.67.204.214
-36.67.206.55
  36.67.217.149
  36.67.220.55
  36.67.223.243
@@ -81203,7 +67592,6 @@
  36.67.63.239
  36.67.63.29
  36.67.66.100
-36.67.66.202
  36.67.68.21
  36.67.7.33
  36.67.70.186
@@ -81216,90 +67604,77 @@
  36.67.89.179
  36.67.93.209
  36.67.93.210
+36.67.96.217
  36.68.100.181
  36.68.107.171
  36.68.155.158
  36.68.17.215
  36.68.22.13
-36.68.220.117
+36.68.221.90
  36.68.63.166
  36.69.50.95
  36.69.71.27
-36.7.111.4
-36.7.111.8
-36.7.138.214
  36.7.159.60
-36.7.159.62
-36.7.168.201
-36.7.168.22
-36.7.168.25
-36.7.168.92
  36.7.64.144
  36.7.69.56
  36.7.72.133
-36.7.80.168
-36.7.87.6
-36.70.126.182
-36.70.44.143
  36.71.137.21
-36.71.142.63
+36.71.171.10
  36.71.235.183
-36.72.114.134
  36.72.124.249
  36.72.14.69
+36.72.213.178
  36.72.217.227
-36.72.218.190
  36.72.236.35
  36.72.57.115
-36.72.83.151
+36.72.59.235
  36.72.84.87
-36.72.86.117
-36.73.19.73
+36.73.15.186
  36.73.22.199
  36.73.30.43
-36.73.34.109
  36.74.101.96
-36.74.128.67
  36.74.144.83
  36.74.148.66
  36.74.27.23
  36.74.43.246
  36.75.110.226
-36.75.151.143
+36.75.15.0
  36.75.212.60
+36.75.25.103
+36.76.237.205
  36.76.247.42
  36.76.89.130
-36.77.113.80
  36.77.32.46
  36.77.33.59
  36.77.45.165
  36.77.61.234
  36.78.1.5
+36.78.204.102
  36.78.210.176
  36.79.20.187
  36.79.214.0
  36.79.215.72
  36.79.248.111
-36.79.72.49
  36.80.116.162
  36.80.34.225
  36.81.203.211
  36.81.255.22
-36.82.106.238
  36.82.144.35
  36.82.32.8
+36.82.85.70
  36.83.237.106
  36.83.68.209
  36.84.100.165
  36.84.100.210
+36.84.102.54
  36.84.59.53
-36.85.187.65
  36.85.221.137
-36.85.222.233
+36.85.223.62
  36.85.52.100
  36.85.91.95
  36.89.10.51
  36.89.105.61
+36.89.116.102
  36.89.119.149
  36.89.122.240
  36.89.129.183
@@ -81324,6 +67699,7 @@
  36.89.183.209
  36.89.183.243
  36.89.183.77
+36.89.185.129
  36.89.187.193
  36.89.188.123
  36.89.188.57
@@ -81367,15 +67743,14 @@
  36.89.93.28
  36.89.94.139
  36.89.99.98
-36.90.0.58
  36.90.12.144
  36.90.12.39
  36.90.122.168
+36.90.122.41
  36.90.123.171
  36.90.123.173
  36.90.13.197
  36.90.15.163
-36.90.16.174
  36.90.16.52
  36.90.16.60
  36.90.163.228
@@ -81384,9 +67759,10 @@
  36.90.172.115
  36.90.172.68
  36.90.173.137
+36.90.173.250
  36.90.179.147
+36.90.180.189
  36.90.180.197
-36.90.19.198
  36.90.19.26
  36.90.236.105
  36.90.245.53
@@ -81398,21 +67774,16 @@
  36.90.42.132
  36.90.42.161
  36.90.42.35
-36.90.43.247
  36.90.48.243
  36.90.49.211
-36.90.53.247
  36.90.55.11
  36.90.57.236
  36.90.60.108
-36.90.60.148
-36.90.60.41
  36.90.61.9
  36.90.62.10
  36.90.62.105
  36.90.62.240
  36.90.62.30
-36.91.115.21
  36.91.119.243
  36.91.128.66
  36.91.143.58
@@ -81429,7 +67800,7 @@
  36.91.45.10
  36.91.48.186
  36.91.54.25
-36.92.1.97
+36.92.1.31
  36.92.10.95
  36.92.109.147
  36.92.111.143
@@ -81438,49 +67809,35 @@
  36.92.18.179
  36.92.180.240
  36.92.185.49
+36.92.188.246
  36.92.190.107
  36.92.211.43
  36.92.222.105
  36.92.33.194
  36.92.35.73
-36.92.67.165
  36.92.68.141
  36.92.68.145
  36.92.70.209
+36.92.76.170
  36.92.83.178
+36.92.85.66
  36.92.9.75
  36.92.93.139
  36.92.93.61
  36.94.110.17
  36.94.12.210
  36.94.130.176
-36.94.142.140
-36.94.145.21
-36.94.161.159
-36.94.176.171
-36.94.20.2
-36.94.200.135
+36.94.20.190
  36.94.203.202
  36.94.23.91
-36.94.37.66
  36.94.43.124
  36.94.43.131
  36.94.43.132
  36.94.8.19
  36.94.82.147
-36.94.90.170
-36.94.90.99
  36.96.12.49
-36.96.13.219
  36.96.184.215
-36.97.143.123
-36.99.113.60
-36.99.161.193
-36.99.168.93
-36.99.169.141
  36.99.175.246
-36.99.44.70
-36.99.46.128
  360.lcy2zzx.pw
  360925443516409-dot-wetransfer-auth-file333.appspot.com
  360autodisplayusa.com
@@ -81554,7 +67911,6 @@
  36522.url.xrzzk.com
  3652223.com
  36529.url.xrzzk.com
-3653133.com
  365359046409-dot-vhj-opi-mkl.pendingmessagesalert.com
  36536.url.nszmz.com
  365365-348.com
@@ -81754,20 +68110,19 @@
  37-72-175-173.static.hvvc.us
  37-72-175-233.static.hvvc.us
  37.1.200.82
-37.1.216.172
+37.1.215.39
  37.10.86.247
-37.105.88.120
  37.107.67.177
-37.109.0.34
  37.109.8.114
-37.11.232.225
+37.110.11.219
  37.110.66.21
+37.110.83.186
  37.111.42.210
  37.113.174.140
  37.113.187.152
+37.113.24.141
  37.113.47.145
  37.114.149.20
-37.114.56.27
  37.114.56.85
  37.114.61.73
  37.115.112.150
@@ -81779,55 +68134,49 @@
  37.115.212.44
  37.115.213.47
  37.115.219.122
-37.115.23.196
-37.116.4.177
-37.117.151.200
-37.117.194.81
  37.117.218.28
-37.120.135.94
  37.120.136.171
  37.120.140.134
  37.120.142.27
  37.120.143.168
-37.120.145.163
+37.120.144.83
  37.120.146.26
  37.120.148.182
-37.120.148.78
  37.120.171.27
  37.120.176.61
  37.120.192.154
-37.120.201.196
  37.120.203.131
  37.120.203.72
  37.120.205.186
  37.120.205.188
  37.120.217.11
+37.120.222.134
  37.120.222.241
-37.122.151.234
-37.123.142.19
  37.123.174.99
  37.128.107.98
  37.128.174.35
+37.13.54.119
  37.130.0.132
  37.130.15.21
-37.130.176.186
  37.130.202.92
  37.130.227.133
  37.130.38.21
-37.130.91.125
  37.131.107.39
+37.131.130.162
  37.131.164.102
-37.131.164.124
  37.131.164.48
  37.131.164.94
  37.131.165.19
  37.131.166.251
  37.131.196.63
-37.134.200.239
  37.134.238.244
+37.135.137.166
  37.135.50.58
+37.138.209.171
+37.138.54.245
  37.139.0.44
  37.139.1.197
+37.139.11.239
  37.139.112.2
  37.139.15.140
  37.139.15.205
@@ -81866,24 +68215,23 @@
  37.139.85.66
  37.139.9.23
  37.14.20.153
-37.142.120.186
+37.140.63.238
  37.142.89.38
  37.143.116.43
  37.143.130.183
  37.143.9.107
-37.144.204.95
  37.144.247.87
-37.144.41.232
+37.145.103.224
  37.145.110.32
  37.145.18.129
  37.145.54.246
  37.145.74.29
-37.146.177.172
  37.146.188.143
-37.146.72.75
+37.146.194.165
+37.147.118.119
+37.147.234.238
+37.147.238.118
  37.148.209.107
-37.15.17.180
-37.15.178.243
  37.15.208.112
  37.15.209.208
  37.152.163.35
@@ -81893,26 +68241,22 @@
  37.153.138.206
  37.153.174.190
  37.153.32.237
-37.153.91.218
  37.156.104.124
-37.156.146.132
  37.156.147.250
-37.156.147.69
  37.156.18.214
  37.156.220.20
  37.156.28.170
  37.157.184.9
  37.157.187.206
  37.157.193.84
-37.157.40.4
-37.158.249.119
  37.159.208.218
  37.159.7.178
-37.159.80.182
  37.159.84.145
  37.160.161.180
+37.162.176.138
  37.17.12.32
  37.17.12.33
+37.17.14.59
  37.17.16.61
  37.17.168.163
  37.17.169.80
@@ -81920,18 +68264,16 @@
  37.17.182.22
  37.17.182.24
  37.17.237.30
+37.17.38.196
  37.17.56.44
  37.17.9.140
  37.17.9.28
  37.176.19.75
-37.176.46.155
  37.179.145.105
  37.179.164.177
  37.179.204.33
  37.18.141.142
-37.182.160.87
  37.183.188.131
-37.183.198.98
  37.186.101.240
  37.186.249.90
  37.187.0.20
@@ -81961,7 +68303,6 @@
  37.187.122.82
  37.187.124.209
  37.187.124.25
-37.187.125.87
  37.187.127.114
  37.187.129.166
  37.187.129.227
@@ -81987,8 +68328,8 @@
  37.187.181.155
  37.187.181.182
  37.187.19.207
-37.187.19.70
  37.187.190.181
+37.187.190.2
  37.187.196.218
  37.187.196.226
  37.187.2.199
@@ -82016,8 +68357,6 @@
  37.187.7.95
  37.187.72.193
  37.187.74.109
-37.187.74.146
-37.187.74.197
  37.187.75.16
  37.187.78.196
  37.187.79.227
@@ -82028,87 +68367,66 @@
  37.187.95.218
  37.187.96.95
  37.187.97.80
-37.187.99.140
-37.189.244.143
-37.19.86.225
-37.191.157.81
-37.191.179.253
-37.191.182.129
-37.191.184.203
-37.191.189.43
-37.191.193.230
+37.189.164.159
  37.191.201.165
  37.191.243.119
  37.191.7.71
  37.191.74.106
  37.192.194.50
+37.192.42.3
+37.193.121.19
  37.193.125.103
-37.193.175.55
  37.193.227.16
+37.193.25.103
  37.193.60.160
-37.193.65.172
-37.193.86.120
  37.194.10.30
-37.194.220.30
  37.195.209.169
  37.196.26.48
-37.2.86.201
  37.20.197.128
-37.20.71.205
+37.20.204.143
  37.200.77.123
  37.201.116.60
  37.201.139.174
  37.201.186.77
+37.201.192.41
  37.201.196.26
  37.201.197.79
-37.202.119.180
-37.202.125.216
-37.202.19.74
  37.203.236.29
-37.204.11.167
+37.204.108.240
  37.205.14.137
  37.205.8.78
  37.205.81.41
-37.206.130.116
  37.208.162.224
-37.208.30.143
-37.208.41.214
+37.208.167.40
  37.208.67.207
  37.209.12.197
  37.21.107.194
  37.210.247.181
-37.210.250.60
-37.211.186.233
  37.211.19.161
-37.211.50.203
-37.211.87.239
  37.212.138.205
-37.212.181.193
  37.212.182.90
  37.212.186.113
+37.212.187.250
  37.212.189.13
-37.212.189.23
+37.212.218.118
  37.212.224.179
-37.212.246.138
  37.212.252.97
  37.212.41.233
  37.212.8.236
-37.213.163.167
-37.213.209.147
  37.213.229.124
-37.213.229.46
  37.214.127.102
+37.214.151.209
  37.214.181.208
  37.214.213.25
+37.214.233.84
+37.214.32.97
  37.214.67.130
-37.215.241.214
  37.215.247.93
+37.215.77.68
  37.215.9.127
  37.218.191.190
  37.218.245.25
-37.22.251.200
  37.220.109.238
-37.220.195.14
  37.220.22.106
  37.220.22.131
  37.220.31.119
@@ -82121,42 +68439,35 @@
  37.220.31.93
  37.220.34.61
  37.220.35.202
-37.220.70.133
  37.221.163.218
-37.221.183.109
+37.221.183.110
  37.221.204.206
  37.221.209.222
-37.221.214.24
+37.221.245.106
  37.221.249.202
  37.221.250.240
  37.221.253.27
-37.224.115.7
+37.221.253.36
  37.224.81.137
  37.228.129.2
  37.228.129.5
  37.228.129.95
-37.228.138.150
-37.228.139.68
  37.228.241.125
+37.228.241.177
  37.228.65.107
  37.228.68.27
  37.228.70.151
-37.23.139.172
+37.229.82.37
  37.23.239.181
  37.230.131.120
-37.230.138.148
  37.230.163.30
-37.230.206.15
+37.230.94.131
  37.230.99.119
  37.232.34.201
  37.232.4.12
  37.232.98.103
-37.233.12.58
  37.233.17.225
-37.233.55.0
-37.233.77.228
  37.234.242.87
-37.235.106.242
  37.235.153.214
  37.235.155.2
  37.235.178.123
@@ -82164,21 +68475,18 @@
  37.235.206.211
  37.235.220.140
  37.235.221.243
-37.235.248.82
  37.235.252.223
  37.235.55.45
  37.236.146.218
  37.236.167.250
-37.236.88.77
+37.236.88.35
  37.236.89.50
  37.236.92.120
  37.236.93.226
  37.237.65.43
  37.238.130.50
-37.238.136.74
  37.239.46.2
  37.239.46.26
-37.24.128.100
  37.24.199.68
  37.24.240.15
  37.247.111.141
@@ -82191,10 +68499,9 @@
  37.252.64.48
  37.252.67.169
  37.252.67.184
-37.252.69.104
+37.252.68.170
  37.252.69.70
  37.252.70.69
-37.252.71.149
  37.252.72.189
  37.252.73.252
  37.252.77.193
@@ -82203,6 +68510,7 @@
  37.252.77.200
  37.252.8.185
  37.255.183.3
+37.255.195.152
  37.255.209.94
  37.255.210.111
  37.26.136.181
@@ -82213,29 +68521,25 @@
  37.26.86.206
  37.28.185.215
  37.29.100.54
+37.29.106.178
  37.29.116.46
  37.29.35.190
-37.30.19.85
  37.32.44.1
-37.33.0.63
-37.33.27.46
  37.34.57.179
  37.38.27.96
  37.4.227.227
+37.4.233.58
+37.41.110.37
  37.41.117.116
-37.41.120.153
  37.41.147.249
  37.41.162.9
  37.41.35.57
-37.41.45.233
  37.41.48.87
-37.44.103.230
-37.44.116.181
  37.44.137.205
  37.44.196.93
  37.44.252.190
+37.44.252.224
  37.44.253.180
-37.44.253.186
  37.44.253.220
  37.44.253.243
  37.44.253.67
@@ -82245,27 +68549,21 @@
  37.44.41.50
  37.44.69.149
  37.44.71.146
-37.45.121.99
  37.45.125.60
  37.45.19.4
-37.45.217.18
-37.45.6.215
-37.45.68.172
  37.45.76.45
  37.45.81.80
  37.45.83.77
-37.45.94.3
+37.45.95.34
+37.45.97.77
  37.46.118.107
  37.46.129.215
  37.46.150.13
  37.46.150.134
  37.46.150.14
  37.46.150.150
-37.46.150.160
  37.46.150.166
-37.46.150.171
-37.46.150.199
-37.46.150.207
+37.46.150.187
  37.46.150.212
  37.46.150.230
  37.46.150.235
@@ -82274,6 +68572,7 @@
  37.46.150.27
  37.46.150.39
  37.46.150.40
+37.46.150.5
  37.46.150.72
  37.46.150.79
  37.46.73.5
@@ -82328,17 +68627,20 @@
  37.49.224.98
  37.49.225.0
  37.49.225.110
+37.49.225.116
  37.49.225.122
  37.49.225.123
+37.49.225.124
  37.49.225.128
+37.49.225.138
  37.49.225.140
  37.49.225.145
  37.49.225.146
  37.49.225.15
  37.49.225.151
  37.49.225.157
+37.49.225.159
  37.49.225.161
-37.49.225.162
  37.49.225.169
  37.49.225.194
  37.49.225.196
@@ -82396,12 +68698,9 @@
  37.49.226.8
  37.49.226.88
  37.49.226.99
-37.49.227.202
-37.49.229.140
-37.49.229.52
+37.49.229.182
  37.49.230.102
  37.49.230.103
-37.49.230.114
  37.49.230.128
  37.49.230.131
  37.49.230.133
@@ -82422,7 +68721,6 @@
  37.49.230.204
  37.49.230.22
  37.49.230.227
-37.49.230.232
  37.49.230.234
  37.49.230.241
  37.49.230.244
@@ -82441,9 +68739,10 @@
  37.49.231.190
  37.49.231.37
  37.49.231.62
+37.53.123.215
+37.53.176.11
  37.53.80.248
  37.53.93.198
-37.54.118.94
  37.54.71.79
  37.55.18.244
  37.57.0.198
@@ -82454,7 +68753,6 @@
  37.57.15.43
  37.57.169.85
  37.57.18.229
-37.57.184.94
  37.57.216.4
  37.57.231.110
  37.57.231.111
@@ -82471,7 +68769,6 @@
  37.57.89.52
  37.58.122.114
  37.58.150.203
-37.58.183.24
  37.58.75.46
  37.59.106.38
  37.59.109.58
@@ -82479,7 +68776,6 @@
  37.59.138.199
  37.59.141.40
  37.59.151.188
-37.59.17.24
  37.59.179.5
  37.59.192.122
  37.59.200.29
@@ -82488,6 +68784,7 @@
  37.59.215.22
  37.59.223.107
  37.59.224.39
+37.59.225.232
  37.59.31.135
  37.59.36.210
  37.59.37.74
@@ -82514,7 +68811,6 @@
  37.59.58.142
  37.59.58.8
  37.59.60.115
-37.59.60.12
  37.59.61.212
  37.59.62.38
  37.59.64.255
@@ -82523,11 +68819,9 @@
  37.59.9.55
  37.59.90.90
  37.59.98.31
-37.60.190.98
  37.61.202.71
  37.61.219.34
  37.61.219.53
-37.61.220.63
  37.70.131.107
  37.72.175.160
  37.72.175.206
@@ -82544,9 +68838,8 @@
  37.76.146.163
  37.76.155.227
  37.76.234.230
-37.77.101.17
+37.77.128.162
  37.77.48.7
-37.78.25.121
  37.79.131.229
  37.79.133.185
  37.79.134.12
@@ -82554,29 +68847,23 @@
  37.79.254.152
  37.79.255.195
  37.79.3.196
-37.9.13.118
-37.9.13.119
-37.9.13.120
-37.9.13.83
-37.9.13.85
-37.9.13.92
-37.9.13.98
  37.9.134.133
-37.9.134.97
  37.9.168.167
  37.9.169.4
  37.9.169.5
  37.9.192.204
  37.9.40.150
+37.9.40.159
  37.9.40.169
  37.9.40.200
  37.9.40.36
  37.9.41.188
  37.9.41.42
-37.9.46.125
  37.9.46.173
  37.9.46.89
  37.9.47.121
+37.9.47.125
+37.9.47.142
  37.97.136.206
  37.97.139.116
  37.97.173.245
@@ -82585,49 +68872,54 @@
  37.97.229.26
  37.97.249.17
  37.98.231.2
-37.99.132.138
  37.99.214.45
  37.99.250.103
  37.99.250.124
  37.99.250.181
-37.99.250.194
  37.99.250.203
-37.99.250.213
  37.99.250.37
  37.99.251.104
-37.99.251.138
+37.99.251.163
+37.99.251.190
  37.99.251.225
+37.99.251.61
  37.99.251.9
  37.99.252.0
  37.99.252.137
+37.99.252.140
  37.99.252.145
  37.99.252.163
-37.99.252.164
+37.99.252.178
  37.99.252.18
+37.99.252.182
  37.99.252.186
  37.99.252.190
-37.99.252.221
-37.99.252.227
-37.99.252.228
  37.99.252.231
+37.99.252.44
+37.99.252.64
  37.99.252.72
  37.99.252.74
  37.99.252.82
  37.99.252.9
-37.99.253.179
+37.99.252.90
+37.99.253.142
+37.99.253.240
+37.99.253.245
  37.99.253.251
-37.99.253.36
+37.99.253.29
  37.99.254.113
  37.99.254.187
  37.99.254.197
-37.99.254.215
+37.99.254.232
+37.99.254.70
  37.99.254.75
+37.99.254.76
  37.99.255.145
  37.99.255.200
  37.99.255.233
+37.99.255.235
  37.99.255.242
-37.99.255.245
-37.99.255.78
+37.99.255.66
  37.99.33.183
  37015.url.hen360.com
  370155612367591-dot-wetransfer-auth-file-341.appspot.com
@@ -82749,10 +69041,9 @@
  38.100.21.78
  38.102.254.23
  38.102.69.70
-38.104.215.130
  38.109.195.42
+38.114.83.77
  38.117.123.2
-38.121.43.221
  38.122.16.146
  38.123.64.242
  38.124.1.228
@@ -82769,16 +69060,18 @@
  38.140.230.210
  38.140.231.10
  38.142.63.146
-38.143.11.21
  38.145.201.162
  38.145.201.41
  38.145.221.36
  38.145.221.57
  38.145.221.59
+38.145.221.63
  38.145.221.75
+38.145.221.77
+38.145.222.75
+38.145.222.94
  38.146.5.58
  38.146.5.61
-38.146.86.136
  38.242.12.100
  38.242.21.27
  38.29.147.15
@@ -82797,8 +69090,6 @@
  38.72.132.201
  38.72.132.202
  38.73.238.138
-38.75.38.144
-38.77.16.239
  38.80.148.37
  38.87.234.241
  38.87.234.242
@@ -82806,7 +69097,6 @@
  38.87.54.164
  38.88.126.202
  38.89.136.117
-38.89.143.31
  38.91.100.230
  38.91.100.28
  38.91.101.30
@@ -82830,15 +69120,14 @@
  38f1d44f1a954bd72362716c792b3cf7-dot-dbenitonline.ey.r.appspot.com
  38seventeen.com
  39.100.149.197
-39.100.153.223
+39.100.157.192
  39.100.18.213
+39.100.196.32
  39.100.36.150
-39.100.65.211
+39.100.90.147
  39.101.136.226
  39.101.194.214
  39.101.206.20
-39.101.207.41
-39.101.209.57
  39.103.139.6
  39.104.118.116
  39.104.77.51
@@ -82848,47 +69137,36 @@
  39.105.123.103
  39.105.129.219
  39.105.136.217
-39.105.181.131
-39.105.186.125
-39.105.188.38
+39.105.156.71
+39.105.169.186
  39.105.192.77
  39.105.200.55
-39.105.30.93
  39.105.46.101
-39.105.51.43
  39.105.55.56
  39.105.82.171
  39.105.85.40
  39.106.118.147
  39.106.126.152
  39.106.13.134
-39.106.135.59
  39.106.150.224
-39.106.160.255
-39.106.171.1
+39.106.172.162
  39.106.189.253
-39.106.19.133
  39.106.220.238
  39.106.223.134
  39.106.223.207
  39.106.229.113
-39.106.4.135
  39.106.7.117
-39.106.71.150
  39.106.9.88
-39.107.106.105
+39.107.107.120
  39.107.141.80
-39.107.158.80
-39.107.181.240
  39.107.234.140
  39.107.236.42
-39.107.238.138
-39.107.246.103
-39.107.53.246
+39.107.65.141
  39.107.69.172
  39.108.104.226
  39.108.123.4
  39.108.141.158
+39.108.165.16
  39.108.167.47
  39.108.3.76
  39.108.64.20
@@ -82896,12 +69174,10 @@
  39.109.112.98
  39.109.122.127
  39.109.127.81
-39.109.161.157
+39.109.13.92
  39.109.17.201
  39.109.18.157
  39.109.18.17
-39.109.188.204
-39.109.191.221
  39.109.3.237
  39.109.4.26
  39.109.4.89
@@ -82917,68 +69193,43 @@
  39.115.133.87
  39.115.75.148
  39.116.190.2
-39.118.52.101
-39.122.186.3
-39.122.57.85
-39.129.209.95
+39.121.2.76
  39.129.23.23
-39.129.27.80
  39.129.55.85
  39.130.146.252
  39.137.107.98
  39.137.69.10
  39.137.69.7
  39.145.126.90
-39.152.112.110
-39.152.133.197
-39.152.133.8
-39.152.177.33
-39.152.20.153
  39.152.207.148
-39.152.207.86
-39.152.34.50
-39.152.67.245
-39.153.135.16
-39.153.252.196
-39.155.195.1
  39.155.212.90
  39.155.214.66
  39.155.215.199
  39.155.215.50
-39.155.215.54
-39.155.215.58
  39.155.215.62
-39.155.244.81
-39.164.205.16
-39.164.32.145
-39.164.33.142
-39.164.97.22
-39.165.101.235
-39.165.66.10
+39.164.34.146
  39.170.36.149
-39.175.68.187
-39.175.87.9
-39.175.92.86
-39.181.224.219
  39.181.230.248
  39.183.132.49
-39.184.147.57
-39.184.152.56
-39.184.153.196
+39.32.40.16
  39.32.40.207
  39.32.80.18
  39.33.31.204
  39.33.63.96
-39.34.207.22
-39.37.232.91
  39.44.43.237
-39.45.34.31
-39.46.250.57
  39.48.21.67
+39.49.68.131
+39.50.1.29
+39.50.123.123
+39.50.89.122
+39.50.94.227
  39.50.97.132
-39.52.133.36
  39.53.72.130
  39.53.96.83
+39.60.1.241
+39.64.162.135
+39.64.163.25
+39.64.165.219
  39.64.36.1
  39.65.102.212
  39.65.165.65
@@ -82991,53 +69242,41 @@
  39.65.213.74
  39.65.233.243
  39.65.239.92
-39.65.240.59
  39.65.3.194
-39.65.42.119
  39.66.108.79
  39.66.113.55
+39.66.123.64
+39.66.155.192
  39.66.179.245
  39.66.242.10
  39.66.33.156
-39.66.74.61
  39.66.85.78
  39.66.97.214
  39.66.97.215
  39.67.199.5
  39.68.11.133
-39.68.134.193
  39.68.154.55
  39.68.22.18
  39.68.37.250
  39.68.40.255
  39.69.115.100
-39.69.56.252
-39.69.59.233
-39.70.202.131
-39.71.116.248
+39.71.80.196
  39.72.13.11
-39.72.238.116
  39.73.1.187
-39.73.121.42
  39.73.122.199
-39.73.123.130
-39.73.123.173
  39.73.123.45
-39.73.127.2
-39.73.128.102
-39.73.160.13
  39.73.160.208
+39.73.167.16
  39.73.169.24
  39.73.17.175
-39.73.189.224
  39.73.217.43
-39.73.235.116
  39.73.243.234
  39.73.29.216
-39.73.45.169
  39.73.46.26
  39.73.61.233
-39.73.93.93
+39.73.62.100
+39.73.63.174
+39.74.10.57
  39.74.135.235
  39.74.139.172
  39.74.15.99
@@ -83045,14 +69284,12 @@
  39.74.153.25
  39.74.175.57
  39.74.175.57bin.sh
-39.74.180.220
  39.74.182.189
  39.74.189.152
  39.74.189.177
  39.74.198.19
  39.74.198.239
  39.74.20.114
-39.74.229.170
  39.74.233.188
  39.74.238.137
  39.74.240.204
@@ -83063,9 +69300,7 @@
  39.74.54.102
  39.74.60.166
  39.74.94.60
-39.76.1.75
  39.76.215.248
-39.76.76.197
  39.77.106.17
  39.77.110.170
  39.77.115.171
@@ -83073,14 +69308,7 @@
  39.77.166.66
  39.77.188.114
  39.77.229.131
-39.77.86.63
-39.77.95.50
-39.78.173.234
-39.78.75.59
-39.79.104.73
-39.79.118.149
  39.79.146.109
-39.79.147.101
  39.79.147.75
  39.79.149.166
  39.79.156.154
@@ -83109,24 +69337,22 @@
  39.80.54.190
  39.80.59.111
  39.80.67.142
-39.80.67.196
  39.80.83.114
  39.81.137.64
  39.81.139.3
+39.81.151.244
  39.81.189.207
  39.81.238.18
-39.81.25.105
  39.81.25.141
+39.81.30.28
+39.81.81.15
  39.82.44.201
  39.82.8.36
  39.83.185.237
  39.83.186.54
-39.83.49.24
  39.83.56.21
-39.83.75.231
  39.83.80.5
  39.84.128.192
-39.84.220.245
  39.84.39.52
  39.84.43.241
  39.84.83.126
@@ -83141,34 +69367,28 @@
  39.85.92.197
  39.86.1.81
  39.86.114.166
-39.86.2.64
  39.86.235.120
  39.86.239.185
  39.86.249.146
+39.86.254.172
+39.86.255.139
  39.86.39.219
  39.86.62.244
  39.86.63.244
-39.86.64.110
-39.86.64.154
-39.86.65.118
  39.86.65.119
  39.86.66.16
  39.86.76.213
  39.86.77.178
-39.86.77.45
  39.86.82.189
  39.86.83.12
  39.86.83.30
  39.86.92.120
-39.86.95.135
  39.87.190.74
  39.87.220.92
  39.87.237.122
  39.87.237.182
  39.87.60.188
  39.88.109.128
-39.88.119.249
-39.88.119.76
  39.88.131.215
  39.88.133.23
  39.88.144.114
@@ -83177,14 +69397,14 @@
  39.88.193.81
  39.88.206.41bin.sh
  39.88.228.48
-39.88.230.51
  39.88.35.181
+39.88.41.73
+39.88.55.171
  39.88.67.184
  39.88.67.92
  39.88.92.58
  39.89.103.52
  39.89.115.200
-39.89.118.48
  39.89.120.174bin.sh
  39.89.131.223
  39.89.140.197
@@ -83193,8 +69413,8 @@
  39.89.154.226
  39.89.157.227
  39.89.160.232
-39.89.162.207
  39.89.174.67
+39.89.181.186
  39.89.194.231
  39.89.204.42
  39.89.209.81
@@ -83202,34 +69422,33 @@
  39.89.211.37
  39.89.23.22
  39.89.237.220
+39.89.25.169
+39.89.29.139
  39.89.30.218
  39.89.40.208
  39.90.152.43
  39.90.154.220
  39.90.159.54bin.sh
-39.90.55.2
-39.91.57.247
  39.96.175.55
  39.96.19.171
  39.96.202.234
-39.96.71.218
+39.96.72.204
  39.96.82.174
  39.96.82.217
  39.97.105.18
-39.97.107.254
-39.97.107.42
  39.97.169.112
-39.97.171.164
-39.97.182.75
  39.97.227.7
  39.97.231.198
  39.97.244.212
-39.98.196.213
+39.98.210.84
  39.98.228.208
+39.98.245.32
+39.98.250.239
+39.98.57.48
+39.99.174.195
  39.99.188.111
  39.99.198.78
  39.99.232.25
-39.99.235.141
  39.99.237.209
  39006.xc.05cg.com
  39009.xc.05cg.com
@@ -83267,6 +69486,7 @@
  3alert-verify.co
  3alert.co.uk
  3alerts-billing.com
+3alerts-billinginfo.com
  3alerts-restrictions.com
  3alerts.2fa-support.mobi
  3alerts.link
@@ -83449,9 +69669,6 @@
  4.16.101.222
  4.17.231.194
  4.17.231.196
-4.17.231.207
-4.17.231.208
-4.17.85.253
  4.30.179.102
  4.34.52.202
  4.4buyuklergazete.com
@@ -83459,12 +69676,12 @@
  4.7.94.244
  4.71.37.45
  4.71.37.46
+4.78.191.187
  4.79.109.106
  4.ogloszeniateraz97.club
  4.program-iq.com
  4.top4top.io
  4.uni-webs.com
-40.112.132.196
  40.112.143.216
  40.112.144.167
  40.112.169.64
@@ -83484,11 +69701,8 @@
  40.114.66.171
  40.114.68.30
  40.114.89.172
-40.115.112.87
-40.115.122.111
  40.115.137.28
  40.115.187.98
-40.115.24.141
  40.115.6.17
  40.115.79.44
  40.115.97.162
@@ -83502,15 +69716,12 @@
  40.117.252.39
  40.117.46.166
  40.117.75.152
-40.117.99.2
  40.118.133.199
  40.118.168.204
  40.118.172.113
  40.118.205.218
  40.118.226.96
  40.118.236.59
-40.118.236.80
-40.120.58.173
  40.120.62.167
  40.121.12.127
  40.121.142.168
@@ -83519,6 +69730,7 @@
  40.121.17.49
  40.121.183.0
  40.121.196.179
+40.121.5.217
  40.121.58.255
  40.121.70.33
  40.121.86.78
@@ -83534,7 +69746,6 @@
  40.122.27.80
  40.122.30.84
  40.122.49.211
-40.122.53.162
  40.122.68.214
  40.122.70.73
  40.123.250.83
@@ -83553,12 +69764,15 @@
  40.127.139.82
  40.127.160.75
  40.127.177.193
+40.127.182.92
+40.130.19.178
  40.131.87.38
  40.132.242.226
+40.65.113.26
  40.65.159.0
-40.65.184.21
  40.66.47.169
  40.66.48.164
+40.68.103.75
  40.68.255.214
  40.68.77.27
  40.69.155.91
@@ -83569,8 +69783,6 @@
  40.70.12.248
  40.70.16.38
  40.70.189.4
-40.70.22.253
-40.70.240.229
  40.70.56.35
  40.70.72.10
  40.70.74.171
@@ -83580,38 +69792,31 @@
  40.71.250.6
  40.71.251.58
  40.71.41.208
+40.71.56.185
  40.71.92.214
  40.72.105.23
  40.73.0.147
-40.73.0.168
  40.73.103.188
-40.73.103.7
  40.73.112.132
-40.73.114.247
  40.73.120.132
-40.73.24.131
  40.73.35.39
  40.73.66.97
  40.73.67.85
  40.73.77.193
  40.73.79.203
  40.74.112.227
-40.74.229.12
  40.74.231.133
  40.74.235.156
  40.74.78.199
  40.74.80.66
-40.75.117.244
  40.76.0.90
  40.76.136.194
-40.76.149.42
  40.76.192.3
  40.76.201.251
  40.76.21.137
  40.76.222.119
  40.76.229.145
  40.76.24.2
-40.76.25.179
  40.76.44.230
  40.76.82.187
  40.76.92.194
@@ -83688,6 +69893,7 @@
  40.77.26.187
  40.78.110.37
  40.78.126.29
+40.78.19.149
  40.78.70.107
  40.78.83.99
  40.79.248.65
@@ -83726,23 +69932,15 @@
  40.87.105.177
  40.87.121.159
  40.87.136.160
-40.87.145.212
  40.87.17.154
-40.87.50.62
  40.87.54.154
  40.87.87.198
-40.87.93.216
-40.88.124.42
-40.88.146.140
-40.88.148.192
-40.89.134.4
  40.89.135.229
  40.89.137.145
  40.89.137.181
  40.89.159.38
  40.89.168.246
  40.90.23.208
-40.90.238.52
  4000095599.com
  400517034274668-dot-charming-sky-2700.appspot.com
  4006261166.com
@@ -83764,46 +69962,46 @@
  40buortfa40.bankofamericaslpemr.com
  40hops.com
  41.0.82.166
+41.100.180.254
  41.100.35.162
+41.101.251.78
  41.101.40.77
+41.102.165.82
  41.102.217.22
  41.102.59.247
  41.102.97.25
  41.103.208.28
  41.103.47.67
+41.105.197.53
  41.105.60.148
  41.107.69.41
-41.110.24.21
-41.110.65.59
  41.111.123.99
  41.111.133.103
-41.111.135.193
-41.111.137.222
  41.111.242.6
-41.128.168.39
-41.129.47.37
+41.111.242.7
+41.128.191.136
  41.129.49.49
-41.129.50.200
  41.130.62.64
  41.131.119.107
  41.138.241.106
  41.138.54.13
  41.138.56.3
  41.138.90.69
+41.139.131.177
  41.139.160.55
  41.139.223.242
  41.139.9.47
-41.140.253.4
+41.140.151.0
  41.140.31.106
-41.141.219.24
  41.141.220.3
  41.142.248.91
+41.142.43.78
  41.143.149.21
  41.143.249.57
  41.143.249.60
  41.143.250.78
-41.143.254.58
  41.146.8.38
+41.155.247.124
  41.160.100.202
  41.160.100.204
  41.160.114.37
@@ -83814,16 +70012,15 @@
  41.160.48.202
  41.160.6.186
  41.160.62.74
-41.160.99.145
  41.162.107.130
  41.162.125.226
  41.162.186.2
  41.162.57.94
  41.162.94.52
  41.162.95.10
+41.164.143.195
  41.164.24.243
  41.164.247.186
-41.165.88.132
  41.169.123.37
  41.169.139.2
  41.169.143.211
@@ -83834,7 +70031,6 @@
  41.169.78.42
  41.169.79.166
  41.170.12.92
-41.175.155.78
  41.180.4.117
  41.180.64.254
  41.180.65.27
@@ -83843,8 +70039,10 @@
  41.180.80.28
  41.180.82.158
  41.180.98.70
+41.182.130.122
  41.182.144.14
  41.182.150.137
+41.182.151.23
  41.185.28.84
  41.185.29.128
  41.185.8.170
@@ -83855,7 +70053,6 @@
  41.189.211.154
  41.190.136.202
  41.190.147.158
-41.190.226.190
  41.190.232.139
  41.190.232.36
  41.190.232.52
@@ -83863,27 +70060,27 @@
  41.190.233.61
  41.190.33.162
  41.190.92.84
+41.190.95.20
  41.190.95.92
  41.191.205.121
  41.191.222.26
  41.191.71.250
  41.193.12.50
-41.193.159.11
  41.193.22.146
  41.193.22.153
  41.193.5.52
  41.193.55.190
  41.194.37.106
  41.200.138.131
+41.200.228.254
+41.202.169.116
+41.202.233.10
+41.203.145.20
+41.203.18.35
  41.203.93.115
-41.204.53.81
  41.204.87.90
-41.204.93.114
-41.204.93.22
  41.205.13.126
-41.205.14.108
-41.205.59.241
-41.205.83.6
+41.205.18.51
  41.206.11.44
  41.206.35.222
  41.206.48.90
@@ -83891,49 +70088,33 @@
  41.207.248.188
  41.207.251.194
  41.208.150.114
-41.208.161.203
-41.208.70.39
-41.208.71.226
-41.21.233.230
-41.210.13.97
  41.210.140.35
  41.210.161.114
-41.210.171.146
-41.210.173.242
-41.210.19.21
+41.210.17.5
+41.210.19.198
  41.210.25.171
-41.210.25.88
+41.210.28.121
+41.210.3.126
  41.210.32.159
  41.210.5.105
  41.210.6.141
-41.210.6.255
  41.210.7.30
-41.210.8.73
  41.210.9.57
  41.211.122.81
-41.212.110.177
  41.212.121.138
-41.212.26.246
+41.212.26.163
  41.212.26.92
  41.212.30.171
-41.212.30.248
+41.212.30.52
  41.212.30.84
  41.212.41.107
  41.212.41.141
  41.212.41.144
-41.212.66.236
-41.212.67.229
-41.212.75.5
  41.212.75.63
-41.212.75.85
  41.213.13.146
  41.213.13.154
-41.213.138.16
  41.215.10.6
-41.215.116.221
-41.215.117.230
  41.215.119.31
-41.215.128.91
  41.215.33.186
  41.215.37.230
  41.215.39.25
@@ -83945,14 +70126,13 @@
  41.215.62.18
  41.215.77.54
  41.215.79.182
-41.215.84.170
  41.215.95.113
  41.216.102.178
  41.216.148.55
-41.216.155.171
+41.216.155.130
+41.216.155.143
  41.216.173.222
  41.216.177.120
-41.216.180.47
  41.216.184.209
  41.216.225.250
  41.217.216.17
@@ -83962,42 +70142,38 @@
  41.217.219.165
  41.217.219.49
  41.217.219.53
+41.217.74.79
  41.218.116.38
  41.218.193.158
+41.218.193.216
+41.218.195.216
  41.218.196.132
  41.218.196.248
-41.218.196.65
  41.218.198.155
  41.218.199.35
  41.218.199.66
-41.218.200.166
-41.218.201.181
-41.218.202.36
+41.218.204.17
  41.218.204.89
-41.218.205.99
-41.218.210.7
+41.218.210.19
  41.218.211.24
-41.218.213.78
-41.218.214.136
+41.218.214.131
  41.218.215.24
-41.218.217.166
-41.218.218.137
  41.218.218.141
+41.218.220.118
+41.218.221.39
  41.218.224.104
+41.218.225.173
  41.218.253.127
+41.219.17.115
  41.220.115.83
  41.220.119.246
  41.220.128.3
-41.220.162.71
+41.220.131.55
  41.221.158.186
  41.221.168.167
  41.221.236.62
  41.221.238.5
-41.221.251.19
  41.222.0.194
-41.222.172.57
-41.222.173.246
-41.222.32.12
  41.222.57.63
  41.222.58.37
  41.223.108.13
@@ -84005,15 +70181,12 @@
  41.223.142.211
  41.223.213.175
  41.223.234.116
-41.223.28.76
  41.223.4.155
  41.225.101.247
-41.225.16.155
  41.225.17.53
  41.225.186.80
  41.225.99.33
  41.226.11.252
-41.226.18.215
  41.226.25.65
  41.226.27.133
  41.226.27.210
@@ -84021,22 +70194,16 @@
  41.226.60.115
  41.226.60.138
  41.227.119.223
-41.227.39.92
-41.228.163.109
-41.228.239.198
  41.230.104.255
-41.230.14.134
-41.230.17.220
  41.230.230.113
  41.230.30.215
  41.230.31.58
  41.231.53.25
-41.231.87.69
  41.233.184.127
-41.235.102.17
+41.234.5.210
+41.235.197.97
  41.235.198.219
  41.238.200.222
-41.239.116.22
  41.242.117.242
  41.242.141.134
  41.242.57.34
@@ -84044,145 +70211,87 @@
  41.242.80.29
  41.243.13.70
  41.248.133.186
+41.248.164.134
  41.248.62.160
  41.249.212.74
  41.249.250.209
-41.250.189.200
  41.250.96.149
  41.251.106.8
-41.251.195.164
  41.251.195.2
-41.251.252.222
  41.254.41.230
  41.254.44.241
  41.254.44.62
  41.32.104.230
-41.32.112.34
-41.32.124.68
-41.32.133.153
  41.32.187.149
-41.32.201.202
  41.32.213.239
-41.32.217.57
-41.32.217.62
-41.32.42.5
-41.33.146.1
-41.33.152.123
  41.33.212.68
-41.33.240.117
  41.33.66.226
  41.33.66.228
  41.33.66.230
-41.34.2.142
+41.34.112.55
  41.34.63.171
  41.35.108.212
-41.35.82.50
  41.37.2.203
  41.38.119.243
-41.38.128.22
-41.38.144.114
-41.38.165.34
-41.38.50.50
  41.38.80.108
-41.39.105.69
-41.39.119.209
-41.39.134.174
  41.39.134.88
  41.39.155.50
-41.39.173.218
-41.39.183.34
-41.39.23.73
-41.39.43.36
-41.39.53.198
-41.39.65.104
-41.39.70.201
-41.39.71.179
-41.39.77.92
  41.39.79.101
  41.39.79.194
  41.40.175.149
  41.40.252.81
-41.40.69.104
-41.41.225.78
-41.41.232.50
-41.41.239.190
+41.41.15.49
  41.41.25.227
-41.41.37.219
  41.41.70.190
-41.41.77.196
-41.42.173.201
-41.42.174.118
+41.42.234.160
  41.42.79.98
-41.42.95.206
-41.43.103.81
  41.43.140.210
  41.44.166.1
-41.44.67.35
  41.45.200.26
-41.45.49.6
  41.46.133.136
-41.47.223.22
-41.47.69.146
-41.47.8.84
+41.46.17.158
+41.47.230.75
  41.50.101.73
  41.57.109.74
  41.57.42.174
  41.58.159.55
  41.59.200.33
-41.59.202.12
-41.59.82.183
  41.59.89.98
  41.60.113.38
+41.60.122.131
  41.60.216.148
  41.60.216.153
-41.60.216.245
  41.60.218.10
  41.60.220.84
-41.60.232.70
  41.60.234.108
  41.60.234.155
  41.60.236.145
-41.60.236.58
-41.60.67.55
  41.60.74.62
  41.60.93.163
-41.62.202.57
  41.62.85.248
  41.63.0.133
  41.63.0.41
-41.63.10.12
-41.63.10.5
-41.63.15.2
-41.64.18.117
  41.65.111.226
-41.65.112.186
  41.65.146.38
  41.65.174.66
-41.65.201.172
-41.65.218.72
+41.65.201.174
+41.65.242.44
  41.65.255.210
-41.65.68.70
-41.66.229.4
-41.66.234.135
+41.65.99.66
+41.66.232.85
  41.67.48.101
  41.67.48.110
  41.67.48.71
-41.68.181.244
  41.71.119.195
  41.71.24.136
  41.71.24.138
-41.71.24.156
  41.71.24.160
  41.72.13.239
  41.72.198.40
  41.72.203.182
  41.72.203.66
  41.72.21.125
-41.72.216.14
  41.72.219.102
-41.72.61.50
-41.72.61.67
-41.73.132.4
  41.73.15.130
  41.73.15.134
  41.73.15.246
@@ -84198,8 +70307,6 @@
  41.75.126.50
  41.75.152.3
  41.75.220.181
-41.75.92.98
-41.75.93.254
  41.76.108.100
  41.76.117.194
  41.76.157.202
@@ -84210,22 +70317,14 @@
  41.76.245.154
  41.76.246.254
  41.76.248.17
-41.76.251.205
-41.76.42.75
-41.76.8.12
  41.77.100.129
  41.77.137.114
  41.77.146.98
-41.77.245.240
-41.78.103.8
-41.78.108.226
-41.78.118.2
  41.78.247.252
  41.78.26.155
  41.78.73.144
  41.78.75.45
  41.78.82.180
-41.79.151.175
  41.79.16.154
  41.79.170.111
  41.79.170.125
@@ -84234,7 +70333,6 @@
  41.79.170.76
  41.79.170.88
  41.79.219.197
-41.79.219.221
  41.79.221.97
  41.79.226.86
  41.79.236.164
@@ -84243,20 +70341,17 @@
  41.79.35.1
  41.79.49.23
  41.79.66.106
-41.79.67.149
  41.79.78.59
  41.79.82.46
+41.80.239.232
+41.80.251.57
  41.82.131.151
-41.82.180.229
  41.82.208.182
-41.82.213.42
  41.82.83.76
  41.83.109.15
  41.84.228.86
  41.85.189.66
  41.85.191.6
-41.86.153.187
-41.86.155.5
  41.86.18.10
  41.86.18.150
  41.86.18.152
@@ -84269,48 +70364,38 @@
  41.86.18.207
  41.86.18.22
  41.86.18.89
-41.86.19.146
  41.86.19.200
  41.86.19.205
  41.86.19.206
-41.86.19.80
-41.86.21.22
  41.86.21.27
  41.86.21.28
  41.86.21.44
  41.86.21.59
  41.86.21.62
  41.86.21.9
-41.86.34.45
  41.86.48.178
  41.86.5.103
-41.86.5.140
-41.86.5.142
+41.86.5.176
  41.86.5.197
-41.86.5.233
  41.86.5.237
  41.86.56.224
  41.87.10.81
  41.87.13.44
  41.87.29.130
-41.87.7.22
  41.89.162.8
  41.89.171.220
  41.89.211.5
  41.89.94.30
-41.90.106.78
  41.90.126.158
  41.90.30.47
-41.92.133.214
  41.93.155.17
  41.93.32.132
-41.93.45.139
  41.93.82.7
  41.94.10.23
  41.94.218.3
-41.94.22.6
-41.94.47.41
-41.97.210.160
+41.95.246.18
+41.97.219.208
+41.97.49.139
  41.98.84.239
  4117570-dot-n-e-w-me-ss-age-po-rt-al.wl.r.appspot.com
  413bd12fe0.nxcli.net
@@ -84322,6 +70407,8 @@
  41fde.codesandbox.io
  41r73tlc.gmz.cc
  42.104.109.194
+42.106.211.148
+42.106.211.220
  42.107.80.65
  42.110.128.244
  42.110.147.144
@@ -84330,14 +70417,7 @@
  42.112.209.164
  42.112.211.52
  42.112.26.30
-42.112.36.20
-42.112.74.40
-42.112.94.82
-42.113.150.6
-42.113.229.199
-42.113.3.169
-42.114.124.81
-42.114.239.164
+42.114.121.166
  42.115.10.67
  42.115.25.55
  42.115.33.152
@@ -84348,21 +70428,12 @@
  42.115.88.12
  42.115.91.82
  42.116.115.189
-42.116.136.132
  42.116.18.180
-42.117.20.229
-42.117.20.28
-42.117.20.76
-42.117.242.28
-42.117.89.166
  42.118.242.189
  42.119.102.255
-42.119.24.68
  42.119.249.191
-42.119.252.180
  42.119.252.185
-42.119.46.59
-42.123.99.67
+42.144.70.13
  42.159.10.142
  42.159.142.14
  42.159.155.8
@@ -84372,28 +70443,14 @@
  42.159.80.91
  42.159.83.169
  42.159.86.108
-42.176.141.225
  42.176.225.109
-42.176.243.56
-42.176.248.128
-42.176.248.25
-42.177.39.56
-42.178.123.14
  42.178.205.97
-42.178.228.93
-42.179.182.90
-42.179.201.9
-42.179.228.13
-42.179.237.113
-42.179.238.168
-42.179.80.193
  42.180.206.145
-42.180.254.49
  42.180.4.139
  42.184.161.20
-42.187.121.88
+42.191.128.134
  42.191.179.108
-42.191.179.61
+42.192.118.103
  42.192.12.208
  42.192.121.40
  42.192.123.202
@@ -84404,13 +70461,11 @@
  42.192.128.191
  42.192.130.153
  42.192.131.204
-42.192.131.231
  42.192.133.81
  42.192.134.244
  42.192.135.112
  42.192.136.151
  42.192.136.164
-42.192.137.134
  42.192.138.146
  42.192.138.24
  42.192.138.52
@@ -84422,39 +70477,27 @@
  42.192.147.231
  42.192.152.72
  42.192.154.179
-42.192.155.135
-42.192.159.98
  42.192.16.24
-42.192.164.109
-42.192.183.243
  42.192.187.220
+42.192.189.223
  42.192.20.162
-42.192.20.240
-42.192.20.37
+42.192.205.33
  42.192.21.127
-42.192.21.132
  42.192.219.123
+42.192.233.89
  42.192.238.34
  42.192.3.193
  42.192.3.9
+42.192.36.88
  42.192.37.232
-42.192.37.236
  42.192.38.253
-42.192.39.29
-42.192.40.225
-42.192.40.242
-42.192.41.97
+42.192.42.126
  42.192.43.62
  42.192.46.203
  42.192.47.140
  42.192.47.27
  42.192.47.60
-42.192.47.94
-42.192.49.46
  42.192.51.16
-42.192.51.168
-42.192.51.27
-42.192.51.93
  42.192.52.136
  42.192.54.145
  42.192.54.8
@@ -84464,8 +70507,6 @@
  42.192.56.194
  42.192.57.166
  42.192.60.130
-42.192.60.154
-42.192.65.23
  42.192.66.61
  42.192.69.114
  42.192.7.200
@@ -84484,19 +70525,15 @@
  42.192.83.49
  42.192.84.124
  42.192.84.237
-42.192.84.32
  42.192.85.186
  42.192.86.190
  42.192.86.191
-42.192.88.60
  42.192.89.106
  42.192.89.20
-42.192.89.219
  42.192.91.114
  42.192.94.144
  42.192.94.8
  42.192.95.68
-42.192.96.152
  42.194.128.158
  42.194.132.178
  42.194.135.105
@@ -84511,21 +70548,16 @@
  42.194.148.212
  42.194.148.24
  42.194.151.226
-42.194.151.25
  42.194.158.19
  42.194.162.228
  42.194.168.209
  42.194.168.89
  42.194.173.211
-42.194.176.168
  42.194.179.186
  42.194.181.115
  42.194.184.92
-42.194.187.114
-42.194.187.94
  42.194.197.106
  42.194.198.187
-42.194.199.11
  42.194.199.125
  42.194.201.156
  42.194.203.206
@@ -84539,24 +70571,18 @@
  42.194.217.169
  42.194.217.197
  42.194.218.25
-42.194.225.106
-42.2.217.236
-42.2.38.77
-42.200.102.93
+42.2.158.152
  42.200.109.74
-42.200.115.104
  42.200.141.242
  42.200.142.209
-42.200.143.145
  42.200.143.29
  42.200.149.223
-42.200.150.157
-42.200.153.190
  42.200.155.72
  42.200.196.30
  42.200.198.161
  42.200.200.146
  42.200.206.225
+42.200.219.231
  42.200.226.58
  42.200.35.174
  42.200.35.239
@@ -84566,285 +70592,207 @@
  42.200.81.149
  42.200.96.63
  42.202.101.2
-42.224.101.239
+42.224.102.197
+42.224.120.178
  42.224.122.152
  42.224.124.241
-42.224.125.167
-42.224.138.103
-42.224.141.148
+42.224.125.157
+42.224.125.88
+42.224.126.144
+42.224.126.246
+42.224.154.133
  42.224.159.178
  42.224.168.111
  42.224.169.188
-42.224.172.1
-42.224.175.8
+42.224.172.122
+42.224.174.38
  42.224.177.237
  42.224.180.248
  42.224.183.237
-42.224.217.138
+42.224.211.161
  42.224.235.221
  42.224.238.221
-42.224.241.79
-42.224.249.217
-42.224.25.205
+42.224.242.174
+42.224.249.93
+42.224.250.83
  42.224.254.207
+42.224.255.40
  42.224.27.97
-42.224.34.203
-42.224.37.103
-42.224.42.102
-42.224.44.29
-42.224.63.221
+42.224.28.63
+42.224.29.222
+42.224.29.247
+42.224.30.48
+42.224.39.152
  42.224.65.175
-42.224.65.20
-42.224.66.42
  42.224.7.197
  42.224.70.21
  42.224.75.150
-42.224.75.3
-42.224.77.8
-42.224.78.188
  42.224.78.99
-42.224.97.157
+42.224.8.188
  42.224.98.101
  42.224.99.158
-42.225.102.5
-42.225.202.90
+42.225.20.199
  42.225.203.187
-42.225.53.141
-42.226.88.81
-42.227.116.252
+42.225.24.40
+42.226.66.21
+42.226.68.7
+42.226.72.35
+42.226.94.96
  42.227.121.217
-42.227.164.241
+42.227.155.95
+42.227.164.29
  42.227.164.88
+42.227.165.197
  42.227.167.89
  42.227.172.211
+42.227.175.206
  42.227.184.249
  42.227.184.46
-42.227.185.176
  42.227.25.126
-42.227.52.216
-42.227.56.138
+42.227.25.169
  42.227.57.226
  42.228.124.84
  42.228.126.164
-42.228.164.22
-42.228.164.23
-42.228.199.176
  42.228.237.138
-42.228.237.166
-42.228.32.95
-42.228.34.226
-42.228.38.118
-42.228.38.179
+42.228.33.170
+42.228.35.86
+42.228.43.167
  42.228.43.26
-42.228.44.68
  42.228.47.6
-42.228.60.114
  42.228.64.61
  42.228.68.252
-42.228.69.177
-42.228.75.126
+42.228.72.196
  42.228.79.60
  42.228.80.137
-42.228.9.96
+42.228.80.66
+42.229.148.184
+42.229.152.54
  42.229.165.192
-42.229.226.233
-42.230.11.39
-42.230.147.161
-42.230.174.7
-42.230.192.34
-42.230.217.213
+42.229.181.170
+42.229.238.178
+42.229.247.115
+42.230.102.1
+42.230.175.143
+42.230.193.74
+42.230.216.155
+42.230.216.95
+42.230.218.193
  42.230.27.134
-42.230.32.230
+42.230.36.227
  42.230.41.206
  42.230.43.23
+42.230.44.11
  42.230.50.192
+42.230.52.181
  42.230.52.232
+42.230.54.2
+42.230.59.227
  42.230.62.207
-42.230.67.57
  42.230.86.194
  42.230.88.68
+42.230.93.215
  42.230.95.232
  42.231.103.90
  42.231.111.173
+42.231.125.22
  42.231.161.220
  42.231.236.95
  42.231.42.217
-42.231.68.25
+42.231.90.47
  42.232.100.48
  42.232.101.226
-42.232.168.222
-42.232.170.168
+42.232.116.49
  42.232.18.254
-42.232.2.189
  42.232.239.137
-42.232.41.107
-42.232.90.19
-42.233.106.165
+42.232.79.113
+42.233.102.155
  42.233.118.245
+42.233.123.62
  42.233.124.131
-42.233.127.201
  42.233.150.109
  42.233.232.93
-42.233.254.208
  42.233.254.41
  42.233.32.16
-42.233.77.124
-42.234.105.252
+42.233.71.132
+42.233.75.167
+42.234.129.110
  42.234.150.121
  42.234.186.167
+42.234.235.232
  42.234.236.206
-42.234.242.7
  42.234.244.174
+42.234.251.238
  42.234.253.65
  42.234.84.107
-42.235.149.150
+42.235.117.145
+42.235.122.2
  42.235.156.137
+42.235.158.213
  42.235.160.71
-42.235.166.137
+42.235.164.46
  42.235.175.95
-42.235.181.1
-42.235.182.200
+42.235.189.125
  42.235.20.211
  42.235.57.48
-42.235.68.78
-42.235.71.5
-42.235.82.34
  42.235.88.20
-42.235.89.105
  42.235.89.211
+42.235.93.73
  42.235.93.96
-42.236.10.117
-42.236.10.78
-42.236.137.43
-42.236.148.240
+42.235.95.77
  42.236.150.4
  42.236.160.189
  42.236.161.183
  42.236.161.240
  42.236.161.43
-42.236.212.63
  42.236.213.81
  42.236.214.109
  42.236.215.249
  42.236.221.16
  42.236.221.189
-42.236.223.173
  42.236.223.79
-42.236.74.70
-42.237.112.52
-42.237.127.182
+42.237.123.245
  42.237.197.58
  42.237.40.112
-42.238.163.122
-42.238.231.142
+42.238.165.178
  42.238.231.157
-42.238.244.118
-42.238.244.32
+42.238.246.43
  42.238.5.149
-42.239.12.111
+42.238.67.78
+42.239.14.39
  42.239.145.30
  42.239.181.224
  42.239.193.119
-42.239.230.103
+42.239.235.158
+42.239.236.126
  42.239.239.71
-42.239.245.10
  42.239.246.63
-42.239.253.102
  42.239.253.249
-42.239.79.204
-42.240.129.58
  42.243.172.85
-42.243.218.137
  42.243.218.57
-42.243.35.234
-42.247.5.67
-42.247.5.68
-42.247.5.69
-42.247.5.70
-42.247.5.71
-42.247.5.72
-42.247.5.74
-42.247.5.75
-42.247.5.76
-42.247.5.79
-42.247.5.80
-42.247.5.81
-42.247.5.84
-42.247.5.85
-42.247.5.86
-42.247.5.87
-42.247.5.89
-42.247.5.90
-42.247.5.91
-42.247.5.92
-42.247.5.93
-42.247.5.95
  42.248.78.142
  42.248.78.144
  42.248.78.56
-42.3.18.20
+42.3.145.94
  42.3.231.163
-42.3.97.69
-42.3.98.85
  42.4.181.0
-42.48.104.96
-42.48.118.179
-42.48.136.44
-42.48.16.242
-42.48.185.91
-42.48.185.94
  42.48.29.11
-42.48.60.89
-42.5.101.145
-42.5.224.214
-42.5.225.156
-42.51.12.36
-42.51.129.156
+42.51.173.18
  42.51.19.75
-42.51.191.178
  42.51.201.86
-42.51.222.246
-42.51.225.175
  42.51.26.79
  42.51.34.169
-42.51.64.23
-42.52.106.181
-42.52.202.24
-42.52.41.8
+42.52.188.31
  42.52.57.181
-42.53.165.158
-42.55.204.221
-42.58.5.206
-42.59.187.25
+42.59.120.168
  42.59.204.103
-42.60.49.240
-42.60.83.228
-42.61.156.157
-42.61.189.137
+42.60.36.61
  42.61.234.251
-42.62.107.209
-42.62.96.34
-42.63.14.194
-42.63.158.14
  42.63.23.133
-42.63.41.94
  42.63.9.198
-42.7.19.24
-42.81.123.232
-42.82.224.71
-42.82.224.72
-42.82.224.83
-42.84.220.139
-42.85.248.241
-42.86.170.92
-42.87.227.166
  42.87.76.172
-42.87.89.187
-42.98.208.127
-42.98.254.246
-42.98.71.10
  42.98.8.73
  42.99.116.139
+42.99.180.135
  420365365.com
  420extracts.ca
  420marijuanalist.com
@@ -84874,9 +70822,9 @@
  43.224.118.222
  43.224.118.46
  43.224.128.110
+43.224.129.70
  43.224.130.146
-43.224.152.192
-43.224.180.215
+43.224.182.85
  43.224.234.88
  43.224.248.159
  43.224.248.183
@@ -84886,12 +70834,10 @@
  43.224.249.53
  43.224.8.116
  43.224.8.124
-43.224.8.125
  43.224.8.14
  43.225.151.198
  43.225.161.91
  43.225.163.209
-43.225.187.13
  43.225.187.186
  43.225.187.210
  43.225.192.225
@@ -84920,70 +70866,60 @@
  43.226.147.162
  43.226.147.229
  43.226.147.62
-43.226.148.152
  43.226.148.193
  43.226.148.42
  43.226.148.89
-43.226.150.131
  43.226.152.191
+43.226.152.45
  43.226.16.20
+43.226.20.245
  43.226.22.105
  43.226.238.12
-43.226.26.159
-43.226.51.148
+43.226.38.94
+43.226.40.197
+43.226.64.185
  43.226.69.100
  43.226.69.103
  43.226.69.146
-43.227.113.81
  43.227.128.6
-43.227.132.8
  43.227.135.214
-43.227.66.5
  43.228.117.242
  43.228.126.114
  43.228.131.115
  43.228.222.114
  43.228.222.2
-43.228.38.174
-43.228.84.23
-43.229.11.20
  43.229.149.83
  43.229.151.135
  43.229.152.207
  43.229.153.13
  43.229.153.76
  43.229.225.236
-43.229.54.48
+43.229.227.162
  43.229.55.61
  43.229.62.133
  43.229.72.220
+43.229.73.206
  43.229.73.223
  43.229.73.229
  43.229.73.230
  43.229.73.233
+43.229.73.235
  43.229.73.239
  43.229.73.240
  43.229.73.242
-43.229.73.244
  43.229.88.100
  43.229.88.76
  43.229.88.86
  43.229.89.183
+43.230.157.134
  43.230.168.149
  43.230.196.98
-43.230.207.104
  43.230.62.157
  43.230.89.50
  43.230.89.54
-43.231.0.5
-43.231.114.20
  43.231.129.193
-43.231.150.78
-43.231.185.67
  43.231.240.23
-43.231.54.138
  43.231.56.113
-43.231.56.142
  43.231.56.249
  43.231.62.98
  43.231.76.1
@@ -84995,10 +70931,12 @@
  43.231.76.145
  43.231.76.149
  43.231.76.153
+43.231.76.157
  43.231.76.161
  43.231.76.169
  43.231.76.173
  43.231.76.185
+43.231.76.193
  43.231.76.209
  43.231.76.213
  43.231.76.225
@@ -85039,9 +70977,11 @@
  43.231.78.41
  43.231.78.45
  43.231.78.49
+43.231.78.5
  43.231.78.53
  43.231.78.57
  43.231.78.61
+43.231.78.69
  43.231.78.73
  43.231.78.81
  43.231.78.85
@@ -85051,9 +70991,6 @@
  43.231.79.129
  43.231.79.13
  43.231.79.9
-43.231.96.108
-43.239.203.232
-43.239.223.228
  43.239.67.110
  43.239.75.102
  43.239.75.145
@@ -85064,42 +71001,29 @@
  43.240.103.179
  43.240.12.190
  43.240.13.4
-43.240.137.16
  43.240.14.222
  43.240.226.28
  43.240.31.188
  43.240.31.52
  43.240.66.46
+43.240.74.145
  43.241.106.183
-43.241.106.185
-43.241.106.201
-43.241.108.122
-43.241.108.5
-43.241.110.15
-43.241.110.246
-43.241.111.110
-43.241.111.154
+43.241.108.134
  43.241.128.193
  43.241.196.78
-43.241.25.66
+43.241.57.18
  43.241.63.96
  43.242.112.133
  43.242.112.254
  43.242.128.32
  43.242.174.69
  43.242.174.70
-43.242.208.135
-43.242.210.142
-43.242.214.183
  43.242.38.146
-43.243.168.98
  43.243.171.24
  43.243.204.106
  43.243.204.134
  43.243.207.242
-43.243.39.122
  43.243.87.144
-43.245.130.88
  43.245.184.150
  43.245.184.30
  43.245.185.66
@@ -85112,21 +71036,11 @@
  43.245.86.99
  43.245.94.226
  43.246.139.33
-43.246.141.67
-43.246.240.243
-43.246.242.2
-43.247.102.81
  43.247.102.83
-43.247.102.84
-43.247.102.85
  43.247.12.110
  43.247.14.122
-43.247.184.225
-43.247.185.98
-43.247.70.234
  43.247.70.61
  43.248.191.89
-43.248.202.152
  43.248.24.122
  43.248.24.157
  43.248.24.158
@@ -85135,29 +71049,26 @@
  43.248.25.6
  43.248.26.18
  43.248.9.100
+43.249.113.219
  43.249.113.220
  43.249.113.235
+43.249.113.236
+43.249.113.243
  43.249.113.246
  43.249.114.36
-43.249.193.25
  43.249.205.169
-43.249.218.125
  43.249.36.69
  43.249.52.100
-43.249.55.146
+43.249.55.54
  43.249.65.56
-43.249.83.16
  43.250.126.1
  43.250.127.98
+43.250.140.33
  43.250.164.113
  43.250.164.92
-43.250.187.130
-43.250.187.166
-43.250.187.22
-43.250.241.175
  43.250.249.5
+43.250.255.21
  43.250.80.117
-43.250.81.59
  43.251.104.46
  43.251.159.144
  43.251.16.143
@@ -85180,15 +71091,11 @@
  43.252.229.93
  43.252.230.100
  43.252.230.164
-43.252.236.198
  43.252.238.50
  43.252.239.37
-43.252.60.50
  43.252.73.99
-43.254.151.94
  43.254.153.79
  43.254.156.213
-43.254.156.214
  43.254.156.218
  43.254.156.237
  43.254.156.48
@@ -85199,14 +71106,10 @@
  43.254.217.158
  43.254.219.183
  43.254.219.3
-43.254.240.34
-43.254.241.20
  43.254.43.122
  43.254.54.96
  43.254.59.210
-43.255.118.109
  43.255.152.16
-43.255.166.192
  43.255.217.186
  43.255.228.150
  430lodsposlok.site
@@ -85235,8 +71138,6 @@
  43essentialsfood.com
  43sd.org
  44.227.166.167
-44.231.140.69
-44.234.86.108
  440440688980429-dot-wetransfer-auth-file-344.appspot.com
  440grandbetting.com
  441-365.net
@@ -85259,18 +71160,14 @@
  44unit.duckdns.org
  45-76-47-204.plesk.page
  45.10.166.222
-45.10.175.20
  45.10.175.38
  45.10.232.123
-45.10.232.134
-45.10.232.14
-45.10.232.141
  45.10.232.147
  45.10.232.15
  45.10.232.20
  45.10.232.32
  45.10.232.45
-45.10.232.51
+45.10.232.57
  45.10.232.68
  45.10.232.87
  45.10.236.131
@@ -85278,19 +71175,19 @@
  45.10.236.155
  45.10.236.186
  45.10.236.203
-45.10.236.7
+45.10.236.245
+45.10.236.69
+45.10.236.95
  45.10.237.201
  45.10.237.229
  45.10.237.49
  45.10.237.9
-45.10.238.120
  45.10.238.142
  45.10.238.75
-45.10.239.107
  45.10.239.131
  45.10.239.146
+45.10.239.170
  45.10.239.175
-45.10.239.188
  45.10.239.206
  45.10.239.236
  45.10.24.161
@@ -85298,59 +71195,33 @@
  45.10.24.218
  45.10.55.243
  45.10.88.108
-45.10.88.111
  45.10.88.124
  45.10.88.252
  45.11.183.191
-45.11.27.108
-45.11.27.111
+45.11.21.58
  45.11.27.114
  45.11.79.19
  45.112.0.34
  45.112.0.43
  45.112.1.161
  45.112.11.25
-45.112.117.150
-45.112.117.163
  45.112.127.23
-45.112.140.25
-45.112.160.110
  45.112.203.124
-45.112.204.203
  45.112.242.188
  45.112.242.54
  45.112.56.142
  45.112.57.230
  45.113.1.94
-45.113.105.6
  45.113.109.108
-45.113.201.226
  45.113.238.30
  45.113.32.180
  45.113.67.66
-45.113.68.179
-45.113.69.175
-45.113.70.144
-45.113.70.146
-45.113.70.213
-45.113.70.223
-45.113.70.231
-45.113.70.37
-45.113.71.101
-45.113.71.103
-45.113.71.200
-45.113.71.209
-45.113.71.219
-45.113.71.23
-45.113.71.236
-45.113.71.49
  45.113.80.188
  45.113.80.44
  45.114.117.137
  45.114.117.156
  45.114.117.98
  45.114.130.4
-45.114.146.11
  45.114.147.111
  45.114.147.248
  45.114.147.45
@@ -85362,16 +71233,14 @@
  45.115.173.205
  45.115.174.29
  45.115.176.18
-45.115.218.74
+45.115.176.35
  45.115.60.197
  45.115.62.131
  45.115.63.78
  45.116.112.22
  45.116.14.20
  45.116.157.236
-45.116.160.31
  45.116.162.37
-45.116.173.125
  45.116.179.183
  45.116.2.17
  45.116.233.32
@@ -85392,12 +71261,9 @@
  45.117.102.194
  45.117.102.201
  45.117.102.238
-45.117.207.26
-45.117.228.153
-45.117.228.85
+45.117.168.152
  45.117.228.89
  45.117.228.97
-45.117.28.253
  45.117.28.65
  45.117.30.153
  45.117.30.177
@@ -85406,7 +71272,6 @@
  45.117.31.137
  45.117.31.25
  45.117.31.41
-45.117.42.106
  45.117.61.34
  45.117.74.89
  45.117.77.41
@@ -85419,19 +71284,13 @@
  45.118.144.77
  45.118.145.223
  45.118.151.85
-45.118.217.57
-45.118.35.169
-45.118.35.182
+45.118.32.91
  45.119.125.167
-45.119.125.62
-45.119.125.86
  45.119.126.114
-45.119.126.247
  45.119.126.99
  45.119.203.170
  45.119.212.14
  45.119.212.150
-45.119.212.222
  45.119.212.93
  45.119.213.240
  45.119.215.73
@@ -85440,25 +71299,21 @@
  45.119.80.168
  45.119.80.98
  45.119.82.132
-45.119.83.164
  45.119.83.68
  45.119.84.149
  45.119.84.18
-45.12.177.112
-45.12.177.116
+45.12.110.202
  45.12.177.18
  45.12.177.24
  45.12.177.25
-45.12.177.252
  45.12.177.31
  45.12.215.167
  45.12.215.204
  45.12.215.243
  45.120.119.55
-45.120.16.195
+45.120.16.105
  45.120.162.120
  45.120.49.17
-45.120.49.200
  45.120.49.248
  45.120.49.62
  45.120.49.74
@@ -85469,19 +71324,12 @@
  45.120.50.197
  45.120.51.94
  45.121.111.1
-45.121.144.114
-45.121.236.140
-45.121.237.210
  45.121.38.189
  45.122.138.123
  45.122.138.124
  45.122.138.125
  45.122.221.30
-45.122.246.145
  45.122.255.205
-45.123.110.122
-45.123.110.235
-45.123.110.70
  45.123.197.146
  45.123.197.38
  45.123.197.92
@@ -85497,13 +71345,12 @@
  45.123.43.138
  45.123.8.165
  45.124.113.6
+45.124.142.59
  45.124.144.116
  45.124.145.186
-45.124.146.5
-45.124.147.239
-45.124.147.252
  45.124.169.26
  45.124.171.145
+45.124.171.148
  45.124.202.153
  45.124.24.148
  45.124.24.215
@@ -85511,14 +71358,12 @@
  45.124.25.237
  45.124.53.112
  45.124.85.35
+45.124.86.155
  45.125.12.170
  45.125.14.78
  45.125.222.97
  45.125.239.34
-45.125.239.54
-45.125.239.87
  45.125.245.152
-45.125.245.162
  45.125.245.21
  45.125.245.215
  45.125.245.57
@@ -85526,15 +71371,12 @@
  45.125.63.46
  45.125.65.105
  45.125.65.112
-45.125.65.118
  45.125.65.31
  45.125.65.39
  45.125.65.45
-45.125.65.52
  45.125.65.87
  45.125.66.22
  45.126.124.242
-45.126.161.226
  45.126.168.69
  45.126.169.137
  45.126.169.185
@@ -85543,11 +71385,8 @@
  45.126.183.71
  45.126.20.14
  45.126.22.162
-45.127.101.217
  45.127.133.61
-45.127.186.21
  45.127.97.67
-45.128.133.158
  45.128.133.231
  45.128.133.242
  45.128.152.74
@@ -85555,97 +71394,24 @@
  45.129.166.40
  45.129.180.214
  45.129.186.28
-45.129.33.10
-45.129.33.101
-45.129.33.12
-45.129.33.120
-45.129.33.121
-45.129.33.122
  45.129.33.128
-45.129.33.129
-45.129.33.13
-45.129.33.14
-45.129.33.141
-45.129.33.142
-45.129.33.143
-45.129.33.147
-45.129.33.148
-45.129.33.149
-45.129.33.15
  45.129.33.151
  45.129.33.152
-45.129.33.153
  45.129.33.154
-45.129.33.155
-45.129.33.156
-45.129.33.160
-45.129.33.161
-45.129.33.162
-45.129.33.163
-45.129.33.164
-45.129.33.165
-45.129.33.166
-45.129.33.167
-45.129.33.168
-45.129.33.169
-45.129.33.170
-45.129.33.171
-45.129.33.172
-45.129.33.174
-45.129.33.175
-45.129.33.176
-45.129.33.177
-45.129.33.178
-45.129.33.179
-45.129.33.180
-45.129.33.181
-45.129.33.182
-45.129.33.183
-45.129.33.184
-45.129.33.185
-45.129.33.186
-45.129.33.187
-45.129.33.188
-45.129.33.189
-45.129.33.2
-45.129.33.24
-45.129.33.3
-45.129.33.4
  45.129.33.40
-45.129.33.41
-45.129.33.43
-45.129.33.44
-45.129.33.45
-45.129.33.47
-45.129.33.48
-45.129.33.49
-45.129.33.5
-45.129.33.51
-45.129.33.57
-45.129.33.59
-45.129.33.6
-45.129.33.60
-45.129.33.8
-45.129.33.82
-45.129.33.84
-45.129.33.9
+45.129.33.53
  45.129.56.200
  45.129.96.49
-45.13.10.255
-45.13.161.115
  45.13.228.179
  45.13.228.209
  45.13.58.149
  45.13.58.4
  45.13.59.114
-45.130.147.27
-45.130.228.19
  45.130.228.191
  45.130.255.23
  45.130.255.90
  45.130.60.97
  45.131.108.113
-45.131.24.51
  45.131.47.61
  45.132.105.43
  45.132.137.16
@@ -85655,11 +71421,8 @@
  45.132.184.155
  45.132.184.172
  45.132.184.204
-45.132.241.226
-45.132.241.99
  45.132.242.49
  45.132.38.210
-45.132.91.172
  45.133.107.130
  45.133.107.161
  45.133.119.138
@@ -85680,15 +71443,12 @@
  45.134.183.210
  45.134.22.2
  45.134.252.237
+45.134.252.92
+45.134.253.180
  45.134.253.57
  45.135.118.144
  45.135.187.47
-45.135.232.21
-45.135.232.22
-45.135.232.23
-45.135.232.24
  45.135.33.227
-45.135.36.75
  45.135.4.143
  45.135.4.215
  45.136.12.45
@@ -85702,19 +71462,28 @@
  45.137.22.156
  45.137.22.84
  45.137.53.103
+45.137.53.119
  45.137.53.137
-45.137.53.154
  45.137.53.178
+45.137.53.20
  45.137.53.201
  45.137.53.208
+45.137.53.232
+45.137.53.242
  45.137.53.252
+45.137.53.26
+45.137.53.36
+45.137.53.55
  45.137.53.64
+45.137.53.77
+45.137.53.83
  45.137.65.84
  45.138.100.174
  45.138.100.28
-45.138.100.84
+45.138.96.180
  45.138.97.46
  45.138.99.4
+45.139.126.58
  45.139.176.170
  45.139.176.78
  45.139.186.123
@@ -85723,7 +71492,6 @@
  45.139.236.5
  45.14.13.72
  45.14.148.105
-45.14.148.177
  45.14.148.96
  45.14.149.205
  45.14.149.46
@@ -85737,11 +71505,8 @@
  45.14.224.110
  45.14.224.112
  45.14.224.124
-45.14.224.144
  45.14.224.148
  45.14.224.152
-45.14.224.153
-45.14.224.162
  45.14.224.164
  45.14.224.166
  45.14.224.170
@@ -85757,10 +71522,9 @@
  45.14.224.48
  45.14.224.52
  45.14.224.66
-45.14.224.68
  45.14.224.69
  45.14.224.77
-45.14.250.76
+45.14.251.175
  45.14.28.67
  45.14.29.133
  45.14.49.56
@@ -85777,12 +71541,13 @@
  45.140.53.62
  45.140.54.67
  45.140.54.83
+45.140.54.89
  45.141.101.168
  45.141.156.17
  45.141.156.18
  45.141.156.19
-45.141.156.196
  45.141.156.20
+45.141.156.24
  45.141.156.25
  45.141.156.27
  45.141.156.28
@@ -85799,18 +71564,17 @@
  45.141.159.63
  45.141.176.230
  45.141.197.3
-45.141.247.17
  45.141.58.107
  45.141.58.166
+45.141.58.178
+45.141.58.179
  45.141.58.192
  45.141.58.200
-45.141.59.138
  45.141.59.178
  45.141.59.212
  45.141.84.10
  45.141.84.126
  45.141.84.184
-45.141.84.57
  45.142.120.11
  45.142.120.121
  45.142.120.133
@@ -85857,38 +71621,22 @@
  45.142.120.93
  45.142.120.99
  45.142.124.155
-45.142.124.18
-45.142.124.76
  45.142.176.172
-45.142.214.153
-45.142.253.225
  45.142.253.6
-45.143.141.127
-45.143.141.152
-45.143.141.190
-45.143.141.195
-45.143.141.210
-45.143.141.225
-45.143.141.231
-45.143.141.236
-45.143.141.240
-45.143.141.248
-45.143.141.30
+45.142.253.82
  45.143.144.180
  45.143.145.84
  45.143.220.125
  45.143.220.246
  45.143.220.55
  45.143.220.79
-45.143.221.110
  45.143.221.128
+45.143.221.169
  45.143.221.22
-45.143.221.3
-45.143.221.50
  45.143.221.54
-45.143.221.68
  45.143.222.126
  45.143.222.162
+45.143.222.245
  45.143.222.30
  45.143.222.41
  45.143.223.111
@@ -85900,15 +71648,10 @@
  45.143.223.42
  45.143.223.7
  45.143.229.5
-45.143.97.24
  45.144.207.133
  45.144.30.41
-45.144.36.246
  45.144.36.95
-45.144.65.27
  45.144.65.49
-45.144.65.71
-45.145.116.24
  45.145.117.73
  45.145.119.38
  45.145.121.208
@@ -85928,47 +71671,22 @@
  45.145.185.3
  45.145.185.31
  45.145.185.36
-45.145.185.43
  45.145.185.56
  45.145.185.74
  45.145.185.75
  45.145.185.94
-45.145.67.74
  45.146.15.24
-45.146.164.157
  45.146.164.166
  45.146.164.169
-45.146.164.211
-45.146.164.64
-45.146.164.69
-45.146.164.97
-45.146.165.160
-45.146.165.161
-45.146.165.179
-45.146.165.205
-45.146.165.207
-45.146.165.208
-45.146.165.209
-45.146.165.21
-45.146.165.210
-45.146.165.216
-45.146.165.24
-45.146.165.25
-45.146.165.42
-45.146.165.43
-45.146.165.44
-45.146.165.45
-45.146.165.84
  45.146.255.15
-45.146.36.115
  45.147.1.212
+45.147.192.110
  45.147.192.52
  45.147.192.87
  45.147.198.233
  45.147.198.62
  45.147.228.245
  45.147.229.234
-45.147.230.178
  45.148.10.159
  45.148.10.160
  45.148.10.163
@@ -85986,7 +71704,6 @@
  45.148.10.54
  45.148.10.83
  45.148.10.86
-45.148.10.88
  45.148.10.89
  45.148.10.92
  45.148.10.94
@@ -85996,8 +71713,9 @@
  45.148.120.193
  45.148.122.113
  45.148.122.142
+45.148.124.212
  45.148.124.230
-45.148.125.92
+45.148.124.56
  45.148.233.133
  45.148.233.224
  45.148.233.249
@@ -86006,11 +71724,10 @@
  45.148.235.117
  45.148.235.123
  45.148.235.246
+45.148.8.160
  45.148.9.198
-45.148.9.20
  45.149.128.45
  45.149.165.146
-45.149.165.16
  45.149.165.27
  45.149.165.67
  45.149.40.240
@@ -86018,20 +71735,16 @@
  45.15.143.129
  45.15.143.140
  45.15.143.142
-45.15.143.158
  45.15.143.161
-45.15.143.171
-45.15.143.172
+45.15.143.170
  45.15.143.175
  45.15.143.186
  45.15.143.195
  45.15.16.72
-45.15.236.120
  45.15.237.137
  45.15.237.65
  45.15.237.68
  45.15.24.48
-45.15.25.76
  45.15.27.162
  45.15.61.233
  45.150.187.9
@@ -86050,15 +71763,14 @@
  45.151.167.10
  45.151.28.36
  45.151.88.220
-45.151.88.224
  45.151.88.44
  45.152.182.136
  45.152.198.10
  45.152.198.129
  45.152.198.171
+45.152.198.183
  45.152.198.190
  45.152.198.194
-45.152.198.199
  45.152.198.213
  45.152.198.228
  45.152.198.247
@@ -86068,24 +71780,23 @@
  45.153.157.107
  45.153.157.114
  45.153.157.117
-45.153.157.137
-45.153.157.147
  45.153.157.16
-45.153.157.198
  45.153.157.242
  45.153.157.30
  45.153.157.4
-45.153.157.51
  45.153.157.56
  45.153.157.73
  45.153.157.94
  45.153.158.110
  45.153.158.124
-45.153.158.164
+45.153.158.128
+45.153.158.167
  45.153.158.227
  45.153.158.229
+45.153.158.252
  45.153.158.3
  45.153.158.31
+45.153.158.36
  45.153.158.66
  45.153.158.72
  45.153.158.76
@@ -86108,22 +71819,21 @@
  45.153.203.136
  45.153.203.137
  45.153.203.141
-45.153.203.153
  45.153.203.172
  45.153.203.181
  45.153.203.192
-45.153.203.215
  45.153.203.218
  45.153.203.33
  45.153.203.52
  45.153.240.17
+45.153.35.216
+45.153.35.235
  45.154.1.68
  45.154.1.71
  45.154.168.147
  45.154.168.201
  45.154.244.109
  45.154.245.129
-45.154.245.252
  45.154.255.147
  45.154.255.46
  45.154.255.66
@@ -86154,26 +71864,18 @@
  45.155.125.116
  45.155.126.3
  45.155.156.96
+45.155.157.21
  45.155.157.239
  45.155.205.22
  45.155.205.23
  45.155.205.24
  45.155.205.25
-45.155.205.31
-45.155.205.32
-45.155.205.33
-45.155.205.34
-45.155.205.36
  45.155.205.78
  45.155.205.86
  45.155.205.87
  45.155.42.133
  45.155.89.122
  45.156.22.152
-45.156.23.124
-45.156.23.216
-45.156.24.88
-45.156.26.143
  45.156.26.153
  45.156.84.236
  45.157.120.218
@@ -86184,20 +71886,25 @@
  45.158.199.10
  45.158.199.156
  45.158.23.143
-45.159.179.132
-45.159.18.139
  45.16.103.141
  45.16.226.117
+45.160.138.118
+45.160.138.151
+45.160.138.192
+45.160.138.211
  45.160.179.169
  45.160.179.6
-45.160.191.6
+45.160.235.130
  45.160.75.11
-45.161.112.142
  45.161.242.102
  45.161.255.21
  45.161.255.62
  45.162.123.9
+45.162.20.139
+45.162.20.150
+45.162.20.61
  45.162.20.62
+45.162.20.87
  45.162.203.138
  45.162.225.82
  45.162.228.51
@@ -86209,60 +71916,50 @@
  45.163.117.6
  45.163.117.8
  45.163.144.2
-45.163.161.128
  45.163.189.10
  45.163.200.2
  45.163.200.9
  45.163.203.1
-45.163.207.5
-45.163.8.1
-45.163.8.120
-45.163.8.81
  45.164.140.130
  45.164.141.101
-45.164.141.106
-45.164.173.6
+45.164.201.151
  45.164.244.165
-45.164.37.170
  45.164.8.244
  45.165.152.26
-45.165.168.220
-45.165.186.1
  45.165.199.219
+45.165.214.216
+45.165.214.64
  45.165.68.2
  45.165.68.5
-45.165.90.215
-45.166.119.74
  45.166.186.239
-45.166.22.79
-45.166.33.141
  45.166.35.0
  45.166.35.17
  45.166.35.22
  45.166.35.4
  45.166.35.7
  45.166.35.8
-45.167.10.252
  45.167.140.166
-45.167.144.11
  45.167.220.135
  45.167.36.35
  45.167.36.41
-45.167.76.7
+45.167.36.48
  45.167.8.134
-45.167.9.170
+45.167.9.50
+45.167.9.52
+45.168.15.126
  45.168.15.135
  45.168.15.143
  45.168.15.145
-45.168.15.148
  45.168.15.170
  45.168.15.193
-45.168.15.21
+45.168.15.212
  45.168.15.218
+45.168.15.225
  45.168.15.239
  45.168.15.39
  45.168.15.47
  45.168.15.75
+45.168.15.94
  45.168.15.99
  45.168.168.9
  45.168.34.134
@@ -86282,99 +71979,85 @@
  45.170.14.11
  45.170.14.111
  45.170.14.133
-45.170.14.138
+45.170.14.193
  45.170.14.195
-45.170.14.227
  45.170.14.243
  45.170.14.46
  45.170.14.5
  45.170.14.56
+45.170.14.69
+45.170.14.79
  45.170.174.128
-45.171.124.30
  45.171.144.37
  45.171.144.39
  45.171.246.64
  45.171.33.190
-45.171.59.81
  45.172.108.60
-45.172.108.64
  45.172.108.65
  45.172.108.67
  45.172.108.73
  45.172.108.76
+45.172.108.79
  45.172.108.80
+45.172.108.81
  45.172.108.84
-45.172.108.85
-45.172.108.89
-45.172.108.90
+45.172.108.86
  45.172.133.0
  45.172.133.218
-45.172.172.119
-45.172.172.17
-45.172.173.39
-45.172.173.4
-45.172.173.81
-45.172.174.134
  45.172.212.246
-45.173.18.241
+45.172.232.226
+45.172.232.253
+45.172.234.16
+45.172.34.80
+45.172.99.37
  45.173.28.1
  45.173.72.9
  45.173.88.33
-45.175.169.180
  45.175.173.210
  45.175.176.222
  45.175.179.182
  45.175.179.229
  45.175.179.230
  45.175.64.170
-45.176.108.206
-45.176.108.247
+45.176.108.46
  45.176.109.132
-45.176.109.161
-45.176.109.163
  45.176.109.169
+45.176.109.193
  45.176.109.218
  45.176.109.28bin.sh
-45.176.109.34
-45.176.110.204
+45.176.110.163
  45.176.110.213
  45.176.110.97
  45.176.111.12
  45.176.111.126
-45.176.111.246
  45.176.111.37
  45.176.111.43
  45.176.111.46
  45.176.111.53
+45.176.111.63
  45.176.111.78
  45.176.111.95
  45.176.208.50
-45.176.244.78
-45.176.40.169
+45.176.215.43
  45.177.109.244
-45.177.207.4
  45.177.223.2
  45.177.233.106
  45.178.141.20
-45.178.144.234
  45.179.24.234
  45.179.245.177
-45.181.197.135
+45.181.223.44
  45.181.228.208
  45.181.228.211
  45.181.228.212
  45.181.228.216
+45.181.228.218
  45.181.228.220
  45.181.228.223
  45.181.229.209
  45.181.229.23
-45.181.30.158
-45.181.48.2
-45.181.84.19
-45.181.84.20
-45.181.84.21
+45.181.30.117
+45.181.31.123
  45.181.84.23
-45.181.84.25
  45.181.84.26
  45.181.84.28
  45.181.84.29
@@ -86384,20 +72067,13 @@
  45.183.193.1
  45.184.24.5
  45.184.68.32
-45.184.74.67
-45.185.132.18
-45.185.133.252
  45.185.181.31
-45.185.195.51
  45.185.40.33
  45.185.40.6
  45.185.41.65
  45.186.132.130
-45.186.201.22
-45.187.16.108
  45.187.192.1
-45.188.198.42
-45.188.198.92
+45.188.155.174
  45.188.82.131
  45.189.12.186
  45.189.184.40
@@ -86405,8 +72081,6 @@
  45.189.184.47
  45.189.187.1
  45.189.56.18
-45.189.57.198
-45.189.89.75
  45.190.151.250
  45.190.178.1
  45.190.178.13
@@ -86416,49 +72090,41 @@
  45.190.178.5
  45.190.179.2
  45.190.179.5
-45.190.228.2
  45.190.253.134
  45.190.253.218
-45.191.101.43
-45.191.174.20
-45.191.60.238
-45.191.60.240
  45.195.177.32
-45.195.202.193
  45.199.13.17
  45.20.67.1
  45.201.175.222
  45.201.209.44
+45.202.25.50
  45.207.58.113
  45.22.209.58
-45.220.13.31
-45.221.47.133
  45.221.56.41
  45.221.77.82
-45.222.27.182
-45.222.5.51
  45.224.130.220
  45.224.161.63
+45.224.162.171
  45.224.169.140
  45.224.173.254
  45.224.197.137
  45.225.106.4
-45.225.13.95
-45.225.184.82
+45.225.49.221
  45.225.90.118
  45.225.92.93
-45.226.122.59
  45.226.48.38
  45.226.48.54
  45.226.48.57
  45.226.48.61
+45.227.108.180
  45.227.156.66
  45.227.159.7
  45.227.254.241
  45.227.254.245
-45.227.254.30
-45.227.255.60
-45.228.137.6
+45.227.97.144
+45.227.97.57
+45.227.98.195
+45.227.98.216
  45.228.138.18
  45.228.16.1
  45.228.189.240
@@ -86474,7 +72140,6 @@
  45.228.48.4
  45.228.6.248
  45.228.96.34
-45.229.138.6
  45.229.173.234
  45.229.174.34
  45.229.174.36
@@ -86482,28 +72147,23 @@
  45.229.174.42
  45.229.174.44
  45.229.174.46
-45.229.185.1
-45.229.53.118
  45.229.53.132
  45.229.53.26
-45.229.53.86
+45.229.54.152
+45.229.55.160
  45.229.56.67
  45.230.100.238
  45.230.169.14
-45.230.176.146
+45.230.230.210
+45.230.230.253
  45.230.237.31
-45.230.240.107
-45.230.69.230
  45.230.69.82
  45.230.8.20
  45.231.12.37
  45.231.132.171
-45.231.139.231
  45.231.207.22
  45.231.213.110
-45.231.61.115
  45.232.18.173
-45.232.18.2
  45.232.226.102
  45.232.226.137
  45.232.226.158
@@ -86516,10 +72176,7 @@
  45.232.73.46bin.sh
  45.232.73.83
  45.232.75.253
-45.233.106.72
-45.233.116.200
  45.233.169.14
-45.233.188.157
  45.233.58.133
  45.233.76.160
  45.233.78.128
@@ -86527,68 +72184,57 @@
  45.233.79.42
  45.234.116.34
  45.234.148.1
-45.234.200.18
  45.234.69.150
  45.234.69.178
  45.235.110.153
  45.235.110.66
  45.235.120.65
-45.235.16.88
-45.235.37.37
-45.235.37.90
-45.235.37.98
  45.235.93.14
-45.236.116.13
  45.236.120.241
  45.236.128.213
  45.236.129.243
+45.236.139.113
  45.236.170.6
  45.236.170.9
  45.236.171.122
-45.237.116.161
  45.237.140.13
-45.237.168.129
  45.237.168.247
-45.237.179.8
+45.237.168.78
  45.237.182.98
  45.238.121.129
  45.238.121.134
  45.238.121.139
+45.238.121.150
+45.238.121.156
  45.238.121.207
+45.238.121.225
  45.238.121.232
  45.238.121.243
  45.238.121.250
  45.238.121.251
  45.238.121.255
-45.238.122.107
-45.238.122.124
-45.238.122.85
  45.238.122.88
-45.238.122.90
  45.238.123.221
  45.238.123.223
  45.238.208.6
  45.238.23.82
  45.238.252.74
-45.239.106.32
+45.238.37.177
  45.239.138.251
-45.239.180.6
  45.239.204.100
  45.239.204.83
  45.239.84.133
-45.240.103.44
-45.240.167.142
-45.240.241.159
  45.240.88.16
  45.240.88.20
-45.240.88.25
  45.240.88.35
  45.240.88.36
+45.243.150.6
  45.247.150.190
  45.247.252.155
  45.248.138.210
  45.248.139.140
  45.248.150.129
+45.248.192.48
  45.248.195.170
  45.248.195.94
  45.248.43.33
@@ -86597,41 +72243,30 @@
  45.248.86.69
  45.248.86.88
  45.248.87.180
-45.248.94.195
  45.248.94.60
  45.248.95.28
-45.249.100.40
  45.249.101.1
  45.249.122.6
-45.249.171.36
  45.249.245.101
  45.249.245.148
  45.249.245.50
  45.249.246.175
  45.249.247.162
-45.249.50.250
  45.249.79.105
  45.249.79.185
  45.249.79.190
  45.249.88.41
-45.249.91.246
  45.249.95.49
-45.250.199.90
  45.250.226.136
  45.250.226.56
  45.250.37.162
  45.250.37.174
  45.250.37.180
-45.251.21.82
  45.251.228.117
  45.251.240.125
  45.251.240.197
-45.251.35.254
-45.252.248.177
  45.252.248.18
  45.252.249.73
-45.252.71.198
-45.252.80.2
  45.253.64.48
  45.32.10.111
  45.32.103.230
@@ -86652,7 +72287,6 @@
  45.32.127.64
  45.32.13.11
  45.32.13.224
-45.32.139.49
  45.32.147.97
  45.32.151.23
  45.32.154.52
@@ -86772,7 +72406,6 @@
  45.33.63.141
  45.33.66.178
  45.33.69.239
-45.33.7.49
  45.33.76.249
  45.33.77.42
  45.33.78.170
@@ -86786,56 +72419,56 @@
  45.35.251.20
  45.35.86.118
  45.36.184.6
+45.36.40.39
  45.4.158.22
+45.4.168.175
+45.4.169.236
+45.4.171.231
+45.4.171.39
  45.4.187.43
  45.4.202.109
-45.4.216.54
  45.4.237.72
-45.4.252.4
  45.4.254.82
  45.4.5.221
  45.4.51.68
  45.4.55.10
-45.4.8.66
  45.4.85.152
-45.4.85.76
  45.40.130.40
-45.40.156.37
+45.40.156.36
  45.40.164.164
  45.40.165.142
+45.40.166.139
  45.40.166.142
  45.40.166.144
-45.40.166.162
+45.40.166.151
+45.40.166.161
+45.40.166.167
+45.40.166.172
+45.40.167.4
+45.40.167.5
  45.40.192.155
  45.40.193.40
-45.40.194.129
+45.40.196.167
  45.40.199.6
  45.40.199.82
  45.40.203.112
-45.40.228.204
  45.40.234.156
  45.40.253.179
-45.42.103.67
-45.42.99.241
  45.43.18.171
  45.43.18.215
-45.43.21.31
  45.43.27.71
-45.43.45.250
  45.43.54.31
  45.45.81.243
  45.46.162.85
  45.48.168.16
+45.49.216.146
  45.5.119.86
-45.5.146.136
-45.5.152.78
-45.5.203.2
+45.5.131.146
  45.5.208.13
  45.5.208.33
  45.5.208.6
  45.5.208.70
  45.5.208.72
-45.50.145.59
  45.50.46.221
  45.51.104.59
  45.55.1.145
@@ -86859,7 +72492,6 @@
  45.55.151.121
  45.55.155.31
  45.55.156.19
-45.55.157.1
  45.55.157.126
  45.55.159.57
  45.55.16.175
@@ -86878,7 +72510,6 @@
  45.55.175.193
  45.55.176.173
  45.55.178.16
-45.55.179.132
  45.55.179.219
  45.55.179.243
  45.55.180.7
@@ -86942,7 +72573,6 @@
  45.55.27.246
  45.55.28.53
  45.55.31.74
-45.55.32.34
  45.55.36.216
  45.55.36.51
  45.55.38.140
@@ -86969,7 +72599,6 @@
  45.55.61.52
  45.55.63.118
  45.55.65.221
-45.55.65.92
  45.55.67.45
  45.55.70.15
  45.55.72.19
@@ -86999,18 +72628,17 @@
  45.56.137.66
  45.56.148.101
  45.56.154.141
+45.56.161.25
  45.56.162.8
  45.56.77.104
  45.56.77.80
  45.56.78.153
  45.56.79.249
  45.56.80.116
-45.56.81.30
  45.56.83.234
  45.56.84.79
  45.56.87.243
  45.56.90.98
-45.56.91.118
  45.56.93.199
  45.57.138.206
  45.57.138.216
@@ -87030,7 +72658,6 @@
  45.57.216.12
  45.57.216.120
  45.57.216.121
-45.57.216.13
  45.57.216.99
  45.57.218.203
  45.57.220.224
@@ -87038,6 +72665,7 @@
  45.57.220.236
  45.57.220.238
  45.57.220.239
+45.57.220.253
  45.57.230.153
  45.57.247.164
  45.58.52.17
@@ -87051,32 +72679,35 @@
  45.6.15.15
  45.6.18.13
  45.6.195.247bin.sh
+45.6.201.117
+45.6.201.207
  45.6.201.6
+45.6.202.106
  45.6.228.178
  45.6.229.224
  45.6.231.106
-45.6.24.24
  45.6.37.241
-45.6.63.64
  45.6.72.20
  45.6.92.131
  45.61.136.31
  45.61.139.48
-45.61.160.87
  45.61.161.13
-45.61.161.217
-45.61.161.60
  45.61.162.195
  45.61.163.15
+45.61.163.52
  45.61.163.61
  45.61.165.20
+45.61.165.25
+45.61.165.3
  45.61.166.100
  45.61.166.27
  45.61.166.33
  45.61.166.51
  45.61.166.59
-45.61.167.115
+45.61.166.99
+45.61.167.146
  45.61.167.151
+45.61.167.177
  45.61.167.80
  45.61.167.96
  45.61.168.154
@@ -87085,6 +72716,7 @@
  45.61.169.111
  45.61.169.116
  45.61.169.119
+45.61.169.203
  45.61.170.153
  45.61.170.181
  45.61.171.2
@@ -87095,8 +72727,6 @@
  45.62.102.27
  45.62.106.139
  45.62.112.135
-45.62.200.29
-45.62.234.226
  45.62.246.12
  45.62.250.179
  45.62.99.6
@@ -87126,6 +72756,7 @@
  45.63.54.13
  45.63.55.253
  45.63.58.187
+45.63.59.8
  45.63.64.18
  45.63.65.113
  45.63.67.174
@@ -87145,39 +72776,29 @@
  45.64.112.184
  45.64.112.78
  45.64.122.210
-45.64.128.160
  45.64.134.198
  45.64.139.126
-45.64.153.155
-45.64.153.170
-45.64.153.62
-45.64.160.148
  45.64.160.53
-45.64.179.124
+45.64.179.210
  45.64.179.26
  45.64.184.140
  45.64.186.122
  45.64.213.46
-45.64.214.86
  45.64.237.125
  45.64.75.111
-45.64.85.242
  45.64.9.126
  45.64.99.13
  45.65.128.216
  45.65.128.218
  45.65.129.38
-45.65.131.131
  45.65.131.133
  45.65.131.140
  45.65.131.142
  45.65.196.7
  45.65.229.242
-45.65.233.73
  45.65.242.162
  45.65.242.185
  45.65.242.38
-45.65.247.121
  45.65.251.186
  45.65.65.18
  45.66.150.249
@@ -87190,24 +72811,22 @@
  45.66.158.158
  45.66.166.180
  45.66.208.143
-45.66.208.198
  45.66.208.239
-45.66.208.29
  45.66.209.139
  45.66.209.74
  45.66.221.235
  45.66.35.35
-45.66.45.115
  45.66.9.110
  45.66.9.200
-45.67.113.140
  45.67.14.154
  45.67.14.61
  45.67.15.69
+45.67.213.98
  45.67.214.172
  45.67.228.196
  45.67.230.130
  45.67.230.58
+45.67.235.193
  45.7.116.162
  45.7.176.126
  45.7.176.169
@@ -87245,9 +72864,7 @@
  45.7.196.77
  45.7.205.103
  45.7.228.50
-45.7.230.123
  45.7.231.15
-45.7.238.58
  45.70.0.137
  45.70.0.17
  45.70.0.250
@@ -87257,14 +72874,13 @@
  45.70.204.21
  45.70.204.233
  45.70.204.238
-45.70.204.245
  45.70.204.254
  45.70.206.29
  45.70.206.33
  45.70.207.253
  45.70.208.42
+45.70.215.42
  45.70.215.51
-45.70.222.50
  45.70.3.30
  45.70.56.2
  45.70.7.238
@@ -87272,26 +72888,23 @@
  45.71.113.187
  45.71.160.114
  45.71.195.150
-45.71.230.28
  45.71.244.2
  45.71.58.25
  45.71.80.1
-45.71.80.129
  45.71.80.17
  45.71.80.2
  45.71.80.5
-45.71.80.9
+45.72.0.203
  45.72.0.247
  45.72.109.125
  45.72.129.231
+45.72.137.93
  45.72.219.86
  45.72.250.123
-45.72.26.14
  45.72.26.34
  45.72.26.47
  45.72.26.55
  45.72.3.143
-45.72.65.67
  45.72.67.10
  45.72.67.15
  45.72.67.5
@@ -87307,12 +72920,7 @@
  45.72.71.220
  45.72.73.17
  45.72.74.62
-45.73.13.205
  45.73.41.194
-45.74.150.167
-45.74.151.146
-45.74.161.54
-45.74.205.29
  45.74.22.154
  45.74.22.17
  45.76.100.103
@@ -87328,6 +72936,7 @@
  45.76.132.156
  45.76.132.197
  45.76.135.239
+45.76.142.82
  45.76.145.89
  45.76.146.75
  45.76.147.15
@@ -87354,7 +72963,6 @@
  45.76.179.26
  45.76.179.89
  45.76.18.117
-45.76.184.228
  45.76.186.19
  45.76.187.236
  45.76.188.166
@@ -87386,7 +72994,6 @@
  45.76.228.115
  45.76.230.176
  45.76.230.186
-45.76.230.97
  45.76.234.128
  45.76.237.80
  45.76.24.49
@@ -87425,7 +73032,6 @@
  45.76.88.131
  45.76.89.63
  45.76.9.113
-45.76.95.130
  45.77.101.17
  45.77.101.204
  45.77.101.248
@@ -87441,7 +73047,6 @@
  45.77.139.58
  45.77.139.91
  45.77.142.47
-45.77.16.184
  45.77.162.21
  45.77.168.153
  45.77.17.72
@@ -87454,7 +73059,6 @@
  45.77.181.137
  45.77.182.189
  45.77.186.176
-45.77.189.98
  45.77.193.121
  45.77.193.123
  45.77.200.185
@@ -87518,14 +73122,13 @@
  45.78.7.222
  45.78.77.44
  45.79.0.178
-45.79.106.170
+45.79.10.244
  45.79.107.110
  45.79.108.171
  45.79.109.180
  45.79.11.176
  45.79.110.196
  45.79.110.203
-45.79.110.218
  45.79.115.27
  45.79.120.141
  45.79.120.252
@@ -87533,17 +73136,12 @@
  45.79.121.82
  45.79.122.134
  45.79.123.5
-45.79.123.85
-45.79.124.190
  45.79.124.58
  45.79.124.60
  45.79.124.96
  45.79.125.42
  45.79.126.240
  45.79.133.137
-45.79.135.24
-45.79.136.161
-45.79.139.190
  45.79.142.52
  45.79.142.60
  45.79.143.154
@@ -87552,19 +73150,14 @@
  45.79.145.107
  45.79.145.254
  45.79.146.48
-45.79.151.240
  45.79.151.241
-45.79.153.64
  45.79.157.103
-45.79.16.21
  45.79.164.28
  45.79.165.189
  45.79.165.44
-45.79.171.101
  45.79.172.142
  45.79.173.220
  45.79.175.163
-45.79.177.117
  45.79.179.13
  45.79.179.161
  45.79.179.9
@@ -87573,9 +73166,7 @@
  45.79.184.159
  45.79.184.171
  45.79.185.218
-45.79.185.61
  45.79.185.82
-45.79.189.15
  45.79.189.154
  45.79.190.141
  45.79.192.108
@@ -87606,7 +73197,6 @@
  45.79.72.132
  45.79.73.22
  45.79.73.97
-45.79.76.236
  45.79.77.44
  45.79.78.5
  45.79.80.173
@@ -87620,15 +73210,18 @@
  45.79.95.107
  45.79.95.154
  45.79.99.208
+45.8.116.127
  45.8.124.63
  45.8.154.105
  45.80.104.112
  45.80.104.77
-45.80.105.194
+45.80.105.148
+45.80.106.236
  45.80.148.33
  45.80.149.68
  45.80.153.177
  45.80.153.178
+45.80.154.11
  45.80.210.210
  45.80.210.92
  45.80.64.230
@@ -87638,50 +73231,20 @@
  45.81.226.57
  45.81.233.112
  45.81.235.31
-45.81.7.40
  45.81.7.68
  45.82.120.55
  45.82.137.35
  45.82.139.34
-45.82.144.59
  45.82.196.246
  45.82.196.55
  45.82.197.123
  45.82.197.132
  45.82.197.190
-45.82.198.220
  45.82.223.114
  45.82.72.92
  45.83.106.30
-45.83.220.178
-45.83.220.181
-45.83.220.183
-45.83.231.19
-45.83.27.152
  45.83.27.154
-45.83.64.104
-45.83.64.119
-45.83.64.152
-45.83.64.176
-45.83.64.192
-45.83.64.230
-45.83.64.231
-45.83.65.127
-45.83.65.131
-45.83.65.141
-45.83.65.169
-45.83.65.217
-45.83.65.229
-45.83.65.6
-45.83.65.87
-45.83.65.91
-45.83.91.42
-45.84.172.14
-45.84.172.32
-45.84.172.59
-45.84.172.9
-45.84.185.164
-45.84.185.64
+45.84.0.100
  45.84.196.100
  45.84.196.110
  45.84.196.113
@@ -87727,74 +73290,62 @@
  45.84.196.95
  45.84.196.99
  45.84.204.109
-45.84.204.44
  45.84.42.80
  45.85.0.98
  45.85.219.74
-45.85.3.238
  45.85.85.8
  45.86.1.131
-45.86.1.230
  45.86.201.148
  45.86.65.210
  45.87.186.76
  45.87.186.77
-45.87.213.162
-45.87.228.50
  45.87.252.125
  45.87.253.71
-45.87.43.10
-45.87.83.100
-45.87.83.245
+45.87.80.133
  45.87.89.89
  45.88.105.198
  45.88.106.132
  45.88.106.31
+45.88.106.72
+45.88.106.90
  45.88.106.96
  45.88.110.171
-45.88.110.202
  45.88.3.145
-45.88.40.229
  45.89.124.41
  45.89.140.83
  45.89.16.45
  45.89.233.98
-45.89.67.49
  45.9.148.102
  45.9.148.134
  45.9.148.37
  45.9.188.239
-45.9.189.98
+45.9.189.134
  45.9.229.28
  45.9.61.196
-45.90.109.12
+45.90.110.67
  45.90.141.44
  45.90.188.142
  45.90.222.161
  45.90.57.101
+45.90.58.251
  45.91.101.18
  45.91.202.155
  45.91.203.3
  45.91.239.131
-45.91.94.134
  45.92.247.100
+45.92.28.54
  45.92.33.4
  45.93.101.100
-45.93.101.63
  45.93.103.28
  45.93.127.2
-45.93.201.121
-45.93.201.131
-45.93.201.233
-45.93.201.62
+45.93.95.0
+45.93.95.26
  45.94.232.109
-45.94.232.155
  45.94.232.199
  45.94.232.243
  45.94.234.133
  45.94.234.179
  45.94.235.128
-45.94.235.131
  45.95.116.120
  45.95.116.40
  45.95.168.102
@@ -87904,6 +73455,7 @@
  45.95.168.97
  45.95.169.171
  45.95.169.2
+45.95.169.220
  45.95.169.232
  45.95.169.233
  45.95.169.234
@@ -87916,10 +73468,7 @@
  45.95.235.45
  45.95.28.247
  45.95.31.141
-45.95.39.142
-45.95.39.212
  45.95.39.235
-45.95.39.79
  45.95.55.110
  45.95.55.58
  45.95.55.69
@@ -87956,25 +73505,21 @@
  45reasonswhy.com
  45tges3.icu
  45tuyr.site
-46.0.122.238
+46.0.203.186
  46.0.203.99
-46.0.205.102
-46.1.214.160
  46.10.199.90
  46.10.221.163
-46.100.249.100
  46.100.250.21
-46.100.5.132
-46.100.57.26
-46.100.63.54
+46.100.74.74
+46.100.97.238
  46.101.0.138
  46.101.1.193
  46.101.100.227
  46.101.101.183
  46.101.101.253
+46.101.101.41
  46.101.102.11
  46.101.103.207
-46.101.103.221
  46.101.104.158
  46.101.105.227
  46.101.108.49
@@ -87994,9 +73539,7 @@
  46.101.126.196
  46.101.127.55
  46.101.128.55
-46.101.129.22
  46.101.13.178
-46.101.130.183
  46.101.130.218
  46.101.131.239
  46.101.132.88
@@ -88013,7 +73556,6 @@
  46.101.143.214
  46.101.144.52
  46.101.145.90
-46.101.146.208
  46.101.146.6
  46.101.149.23
  46.101.150.9
@@ -88021,7 +73563,6 @@
  46.101.152.58
  46.101.154.242
  46.101.155.74
-46.101.156.213
  46.101.158.114
  46.101.164.33
  46.101.164.46
@@ -88033,7 +73574,7 @@
  46.101.168.62
  46.101.169.56
  46.101.17.224
-46.101.172.5
+46.101.171.116
  46.101.173.231
  46.101.173.66
  46.101.173.84
@@ -88049,16 +73590,15 @@
  46.101.180.51
  46.101.180.52
  46.101.182.128
+46.101.182.213
  46.101.184.178
  46.101.185.141
  46.101.185.65
  46.101.188.144
-46.101.188.246
  46.101.189.20
  46.101.189.37
  46.101.19.133
  46.101.191.77
-46.101.192.47
  46.101.193.50
  46.101.193.54
  46.101.193.68
@@ -88069,12 +73609,10 @@
  46.101.194.57
  46.101.195.156
  46.101.196.146
-46.101.196.16
  46.101.196.49
  46.101.197.228
  46.101.197.40
  46.101.199.178
-46.101.2.135
  46.101.200.149
  46.101.201.158
  46.101.201.4
@@ -88086,11 +73624,11 @@
  46.101.206.8
  46.101.207.203
  46.101.207.7
+46.101.209.166
  46.101.209.178
  46.101.209.251
  46.101.211.105
  46.101.211.196
-46.101.213.139
  46.101.214.166
  46.101.215.222
  46.101.217.186
@@ -88144,7 +73682,6 @@
  46.101.38.84
  46.101.4.101
  46.101.4.230
-46.101.4.237
  46.101.40.21
  46.101.42.36
  46.101.43.129
@@ -88153,17 +73690,15 @@
  46.101.53.154
  46.101.53.190
  46.101.55.40
+46.101.57.241
  46.101.58.37
-46.101.6.43
  46.101.61.207
  46.101.61.36
  46.101.66.194
-46.101.7.170
  46.101.72.51
  46.101.73.232
  46.101.77.53
  46.101.79.212
-46.101.8.59
  46.101.80.211
  46.101.80.241
  46.101.80.43
@@ -88173,7 +73708,6 @@
  46.101.84.227
  46.101.87.133
  46.101.88.10
-46.101.9.64
  46.101.95.65
  46.101.96.228
  46.101.97.5
@@ -88193,6 +73727,7 @@
  46.105.103.59
  46.105.103.9
  46.105.107.98
+46.105.108.111
  46.105.110.43
  46.105.114.137
  46.105.116.137
@@ -88204,17 +73739,16 @@
  46.105.131.69
  46.105.131.79
  46.105.131.87
-46.105.132.32
  46.105.148.221
  46.105.149.168
  46.105.160.91
  46.105.161.65
-46.105.163.8
  46.105.17.34
  46.105.18.17
  46.105.226.77
  46.105.227.206
  46.105.243.22
+46.105.244.17
  46.105.250.196
  46.105.251.236
  46.105.252.253
@@ -88222,7 +73756,6 @@
  46.105.31.249
  46.105.32.34
  46.105.40.255
-46.105.45.118
  46.105.46.162
  46.105.49.88
  46.105.56.193
@@ -88233,22 +73766,22 @@
  46.105.97.40
  46.105.98.166
  46.105.99.163
-46.107.172.49
-46.107.226.18
-46.107.228.254
  46.107.230.122
  46.107.230.156
  46.107.238.24
  46.107.238.30
  46.108.136.27
  46.114.104.64
-46.114.109.99
+46.114.111.103
+46.114.2.216
  46.114.3.232
+46.114.34.221
  46.114.39.10
  46.114.57.73
  46.114.7.5
  46.116.160.110
  46.116.252.64
+46.117.164.72
  46.118.112.135
  46.118.114.118
  46.118.118.233
@@ -88264,6 +73797,7 @@
  46.119.115.106
  46.119.121.84
  46.119.127.129
+46.119.150.38
  46.119.160.60
  46.119.172.173
  46.119.174.102
@@ -88277,25 +73811,19 @@
  46.126.205.128
  46.126.217.197
  46.126.236.2
-46.126.62.54
  46.127.220.56
  46.128.107.11
  46.128.140.193
  46.128.41.9
  46.128.8.46
  46.128.92.113
-46.130.119.42
-46.130.168.225
  46.132.191.6
  46.137.102.36
  46.137.138.142
  46.138.90.240
  46.139.105.181
-46.141.13.239
-46.141.92.60
-46.142.125.103
+46.142.124.76
  46.142.125.57
-46.142.13.223
  46.142.5.61
  46.143.184.209
  46.146.136.8
@@ -88305,21 +73833,16 @@
  46.146.214.244
  46.146.218.79
  46.146.222.134
-46.146.229.170
  46.146.239.105
  46.146.240.185
-46.146.240.199
+46.146.244.97
  46.146.248.89
-46.146.69.170
  46.147.132.50
  46.148.18.122
  46.148.20.25
  46.148.206.226
  46.148.227.6
-46.148.79.10
  46.149.113.2
-46.149.152.145
-46.149.176.223
  46.149.86.51
  46.150.170.10
  46.150.173.75
@@ -88331,24 +73854,18 @@
  46.151.145.4
  46.151.150.11
  46.151.157.115
-46.151.215.107
  46.151.250.178
  46.151.60.99
-46.152.110.9
+46.151.72.113
  46.152.78.103
  46.158.94.207
  46.16.226.6
  46.16.228.6
-46.160.179.117
  46.160.202.162
-46.161.14.13
-46.161.27.111
-46.161.27.28
-46.161.27.39
-46.161.27.48
  46.161.27.75
  46.161.40.104
  46.161.60.134
+46.161.60.163
  46.161.60.224
  46.161.60.230
  46.161.60.68
@@ -88358,6 +73875,7 @@
  46.161.61.250
  46.161.61.89
  46.161.62.114
+46.161.62.115
  46.161.62.168
  46.161.62.194
  46.161.62.205
@@ -88370,7 +73888,6 @@
  46.161.62.225
  46.161.62.227
  46.161.62.231
-46.161.62.236
  46.161.62.239
  46.161.62.246
  46.161.62.248
@@ -88432,6 +73949,7 @@
  46.161.63.253
  46.161.63.32
  46.161.63.35
+46.161.63.49
  46.161.63.54
  46.161.63.56
  46.161.63.57
@@ -88440,7 +73958,6 @@
  46.161.63.70
  46.161.63.74
  46.161.63.75
-46.161.63.78
  46.161.63.79
  46.161.63.82
  46.161.63.88
@@ -88452,6 +73969,7 @@
  46.161.9.6
  46.161.9.8
  46.163.144.228
+46.163.177.216
  46.163.76.40
  46.164.143.82
  46.164.251.129
@@ -88472,13 +73990,9 @@
  46.165.251.153
  46.165.254.129
  46.165.254.247
-46.165.48.57
  46.166.128.226
-46.166.128.239
  46.166.129.155
  46.166.129.156
-46.166.129.174
-46.166.129.200
  46.166.139.111
  46.166.139.20
  46.166.139.35
@@ -88520,36 +74034,22 @@
  46.167.233.32
  46.167.244.56
  46.167.244.59
-46.17.121.19
-46.17.121.195
  46.17.42.156
+46.17.46.168
+46.17.46.211
  46.17.47.195
  46.17.99.143
  46.171.110.250
  46.171.163.10
-46.171.210.65
  46.171.236.4
  46.171.28.162
  46.172.223.250
-46.172.63.49
  46.172.69.163
  46.172.69.76
-46.173.105.151
-46.173.165.236
  46.173.191.94
-46.173.208.2
-46.173.210.29
-46.173.210.30
-46.173.210.31
-46.173.211.218
  46.173.214.18
  46.173.35.229
  46.173.72.156
-46.174.191.28
-46.174.191.29
-46.174.191.30
-46.174.191.31
-46.174.191.32
  46.174.238.91
  46.174.37.53
  46.175.130.113
@@ -88563,11 +74063,13 @@
  46.181.102.77
  46.182.106.190
  46.182.111.80
+46.182.173.244
  46.182.19.219
  46.182.19.49
  46.182.21.248
  46.182.5.30
  46.182.5.40
+46.183.135.234
  46.183.216.142
  46.183.217.69
  46.183.218.195
@@ -88596,28 +74098,22 @@
  46.185.115.163
  46.185.129.185
  46.185.138.163
-46.185.163.167
-46.185.212.34
-46.185.227.68
-46.185.236.142
  46.185.50.104
  46.185.50.12
  46.185.50.128
  46.185.50.242
  46.185.50.31
  46.185.50.64
-46.185.51.112
  46.185.51.192
+46.185.51.200
  46.185.51.217
  46.185.51.219
-46.185.51.223
  46.185.6.126
  46.187.174.231
  46.188.109.21
  46.188.15.6
  46.188.18.71
  46.188.30.118
-46.188.45.11
  46.188.6.229
  46.188.82.11
  46.188.82.63
@@ -88628,13 +74124,12 @@
  46.19.141.85
  46.19.141.86
  46.19.143.133
-46.19.190.30
-46.19.225.236
  46.19.35.176
  46.19.98.42
  46.190.43.220
  46.194.34.176
-46.195.187.253
+46.198.141.82
+46.2.108.168
  46.20.152.56
  46.20.2.220
  46.20.2.222
@@ -88642,10 +74137,8 @@
  46.20.59.11
  46.20.93.83
  46.200.73.236
-46.200.74.213
  46.201.228.220
  46.201.5.174
-46.209.209.74
  46.209.4.194
  46.21.111.219
  46.21.145.91
@@ -88655,10 +74148,6 @@
  46.21.250.205
  46.21.252.98
  46.21.55.3
-46.21.97.90
-46.210.124.130
-46.214.123.55
-46.214.125.132
  46.214.183.35
  46.216.11.214
  46.216.54.244
@@ -88669,26 +74158,22 @@
  46.218.85.122
  46.218.85.69
  46.219.112.33
-46.219.113.164
  46.219.120.59
  46.219.231.196
  46.219.231.219
  46.219.80.142
-46.22.120.82
  46.22.173.131
-46.22.254.254
-46.22.48.26
  46.22.49.41
  46.221.19.138
  46.221.40.25
  46.221.46.101
  46.221.46.81
-46.223.105.131
+46.221.50.190
+46.223.162.19
  46.223.162.44
  46.223.8.233
  46.224.2.69
  46.225.119.60
-46.225.126.139
  46.225.234.222
  46.225.240.122
  46.225.241.19
@@ -88698,7 +74183,7 @@
  46.226.109.113
  46.226.111.23
  46.226.18.135
-46.227.143.127
+46.227.133.42
  46.227.162.98
  46.228.93.242
  46.229.165.141
@@ -88744,7 +74229,6 @@
  46.229.238.187
  46.229.67.198
  46.23.157.132
-46.23.184.111
  46.23.42.113
  46.23.74.181
  46.23.87.218
@@ -88753,20 +74237,13 @@
  46.232.249.138
  46.232.251.191
  46.233.234.136
-46.233.28.137
-46.233.9.28
  46.234.155.92
-46.235.14.11
-46.235.219.130
  46.235.53.26
-46.235.91.97
  46.236.194.34
  46.237.253.139
  46.238.164.110
-46.238.228.50
-46.24.14.169
+46.238.42.250
  46.24.148.191
-46.24.59.39
  46.240.151.166
  46.241.120.230
  46.241.254.167
@@ -88780,20 +74257,17 @@
  46.243.147.131
  46.243.149.130
  46.243.150.35
-46.243.160.126
  46.243.179.115
  46.243.189.99
  46.243.220.146
  46.243.220.226
  46.243.220.229
  46.243.220.232
+46.243.221.45
  46.243.68.16
-46.244.233.90
+46.244.224.213
  46.244.244.92
-46.244.51.135
-46.245.134.110
  46.245.167.226
-46.245.222.203
  46.246.123.133
  46.246.123.151
  46.246.26.8
@@ -88804,6 +74278,7 @@
  46.246.94.204
  46.249.114.178
  46.249.199.7
+46.249.32.129
  46.249.38.194
  46.249.59.113
  46.249.59.91
@@ -88812,15 +74287,11 @@
  46.25.50.194
  46.250.171.31
  46.250.221.18
+46.250.97.214
  46.252.205.166
-46.252.21.137
-46.252.21.207
-46.252.21.236
-46.252.24.168
-46.252.25.146
  46.252.26.215
  46.252.27.87
-46.252.63.68
+46.252.49.40
  46.253.234.231
  46.253.39.142
  46.254.11.194
@@ -88830,13 +74301,12 @@
  46.254.247.53
  46.254.247.60
  46.254.25.251
+46.255.172.148
  46.255.211.20
  46.26.158.20
  46.26.228.157
  46.26.241.196
  46.27.131.40
-46.27.181.85
-46.27.33.188
  46.28.109.24
  46.28.111.142
  46.28.132.34
@@ -88849,27 +74319,26 @@
  46.29.11.254
  46.29.116.3
  46.29.116.6
+46.29.160.113
  46.29.160.26
  46.29.161.214
-46.29.161.84
  46.29.164.15
  46.29.164.31
  46.29.165.170
  46.29.166.105
-46.29.167.235
  46.29.167.77
-46.29.2.167
  46.29.248.238
  46.29.250.186
  46.29.251.236
  46.29.251.238
  46.29.251.45
+46.29.252.70
+46.29.252.98
  46.29.254.246
  46.29.79.57
  46.29.9.46
  46.30.189.218
-46.31.177.209
-46.32.100.55
+46.31.33.36
  46.32.229.152
  46.32.234.8
  46.32.239.84
@@ -88877,6 +74346,7 @@
  46.32.50.98
  46.32.53.120
  46.32.78.150
+46.33.103.69
  46.33.253.29
  46.33.33.114
  46.33.33.124
@@ -88892,20 +74362,17 @@
  46.37.188.139
  46.37.31.195
  46.37.5.150
+46.37.6.66
  46.38.142.142
  46.38.233.161
  46.38.235.14
  46.38.235.236
  46.38.237.108
  46.38.237.77
-46.38.48.224
+46.38.251.90
  46.38.51.183
  46.39.129.114
  46.39.129.82
-46.39.135.159
-46.39.138.34
-46.39.139.189
-46.39.197.9
  46.39.41.21
  46.4.100.141
  46.4.103.105
@@ -88924,10 +74391,8 @@
  46.4.136.69
  46.4.152.178
  46.4.156.35
-46.4.156.44
  46.4.157.125
  46.4.157.37
-46.4.162.29
  46.4.178.187
  46.4.18.160
  46.4.20.137
@@ -88959,20 +74424,20 @@
  46.4.92.21
  46.4.94.175
  46.41.138.43
-46.42.18.28
+46.41.148.252
  46.43.1.22
  46.43.2.95
-46.43.204.88
-46.44.0.198
-46.44.0.239
  46.44.166.125
+46.45.144.67
+46.45.210.229
  46.45.229.159
  46.47.255.194
  46.47.80.188bin.sh
-46.48.142.45
+46.48.93.16
  46.5.192.152
-46.50.12.31
  46.50.198.180
+46.50.61.79
+46.50.66.246
  46.52.131.207
  46.52.156.58
  46.52.213.194
@@ -88981,38 +74446,31 @@
  46.53.183.136
  46.53.195.177
  46.53.241.182
+46.53.249.253
  46.55.25.191
  46.59.12.86
  46.59.137.103
  46.59.243.225
-46.59.25.81
  46.59.65.88
  46.59.67.69
-46.59.87.87
  46.6.11.103
  46.6.14.198
  46.6.15.129
+46.61.1.93
  46.61.101.46
-46.61.219.38
  46.61.247.131
  46.61.36.70
  46.61.88.215
  46.62.144.80
+46.62.159.238
  46.63.0.17
-46.63.22.16
-46.63.57.50
  46.63.71.13
  46.63.81.195
-46.64.253.236
-46.64.62.196
-46.69.203.67
  46.69.28.187
-46.72.147.143
-46.72.196.159
  46.73.33.253
-46.77.64.29
  46.77.76.158
  46.8.107.5
+46.8.11.31
  46.8.111.10
  46.8.111.220
  46.8.111.38
@@ -89020,20 +74478,15 @@
  46.8.14.23
  46.8.154.123
  46.8.159.147
-46.8.171.170
-46.8.178.107
-46.8.178.109
-46.8.178.79
-46.8.178.81
-46.8.178.83
  46.8.179.104
  46.8.198.222
  46.8.213.173
  46.8.213.219
-46.8.222.44
+46.8.22.191
  46.8.223.84
  46.8.243.235
  46.8.247.3
+46.8.31.181
  46.8.33.101
  46.8.33.121
  46.8.33.186
@@ -89048,15 +74501,14 @@
  46.8.33.245
  46.8.33.250
  46.8.33.254
-46.8.48.124
  46.8.48.73
  46.8.48.82
-46.8.48.92
+46.8.48.89
  46.8.48.98
-46.8.5.8
  46.8.56.21
  46.8.57.211
  46.8.57.3
+46.80.197.42
  46.83.64.222
  46.83.64.63
  46.83.66.63
@@ -89069,30 +74521,26 @@
  46.85.164.9
  46.85.208.40
  46.88.223.66
+46.88.232.95
  46.9.94.78
-46.90.93.18
+46.90.91.139
  46.91.120.206
-46.91.245.104
+46.92.113.194
+46.92.126.191
  46.92.28.202
-46.93.85.191
  46.93.99.39
-46.97.10.222
  46.97.44.18
-46.97.76.154
  46.98.127.20
  46.98.212.103
-46.99.10.5
+46.98.213.108
+46.99.126.55
  46.99.131.27
  46.99.133.169
  46.99.135.154
  46.99.151.44
-46.99.158.235
-46.99.183.154
-46.99.184.111
  46.99.19.131
  46.99.195.53
  46.99.195.78
-46.99.251.244
  46.99.252.42
  46.99.255.235
  46.99.26.117
@@ -89120,8 +74568,8 @@
  46buofa46.bankofamericaslpemr.com
  46buortfa46.bankofamericaslpemr.com
  46w46.com
-47.100.103.115
  47.100.106.114
+47.100.107.125
  47.100.120.52
  47.100.137.252
  47.100.139.94
@@ -89131,56 +74579,54 @@
  47.100.203.120
  47.100.21.5
  47.100.212.103
-47.100.226.196
-47.100.228.93
  47.100.244.200
  47.100.244.87
-47.100.3.181
  47.100.34.177
  47.100.4.249
  47.100.45.121
-47.100.7.39
+47.100.85.212
  47.100.88.65
  47.101.138.183
  47.101.151.15
  47.101.187.9
  47.101.190.190
-47.101.216.133
+47.101.206.180
  47.101.36.129
+47.102.102.46
+47.102.139.58
  47.102.193.203
  47.102.196.154
  47.102.215.91
  47.102.216.176
-47.102.98.167
  47.103.1.49
-47.103.107.225
  47.103.148.115
-47.103.157.56
  47.103.192.47
  47.103.195.117
  47.103.24.120
-47.104.153.246
+47.103.71.49
+47.104.110.129
+47.104.128.186
  47.104.176.209
  47.104.191.32
  47.104.211.226
  47.104.242.42
  47.104.252.203
+47.104.254.190
+47.104.5.43
  47.104.68.172
  47.104.79.149
-47.104.85.183
+47.104.90.58
  47.105.100.191
-47.105.137.74
+47.105.132.8
  47.105.164.105
+47.105.194.62
  47.105.206.192
  47.105.220.149
-47.105.222.98
  47.105.223.120
-47.105.25.175
  47.105.32.200
-47.105.44.134
  47.105.53.157
  47.105.64.53
-47.106.113.245
+47.105.91.160
  47.106.124.179
  47.106.161.111
  47.106.161.182
@@ -89191,11 +74637,13 @@
  47.106.59.75
  47.106.82.115
  47.106.84.72
+47.106.91.124
  47.107.133.109
  47.107.134.197
  47.107.140.142
  47.107.140.220
  47.107.141.34
+47.107.144.13
  47.107.147.168
  47.107.150.206
  47.107.152.220
@@ -89210,7 +74658,6 @@
  47.107.70.252
  47.108.140.54
  47.108.156.129
-47.108.163.111
  47.108.165.147
  47.108.21.116
  47.108.24.191
@@ -89223,71 +74670,63 @@
  47.108.56.153
  47.108.56.230
  47.108.56.231
+47.108.59.119
  47.108.63.50
  47.108.65.144
  47.108.78.200
  47.108.81.144
-47.110.150.226
  47.110.225.78
  47.110.236.96
+47.110.238.171
  47.110.49.177
  47.110.92.146
+47.111.113.87
  47.111.14.20
-47.111.253.166
-47.111.88.91
-47.111.93.51
+47.111.153.111
  47.112.116.126
  47.112.122.216
  47.112.127.188
  47.112.144.63
-47.112.193.247
  47.112.231.143
  47.113.108.107
-47.113.197.246
-47.113.204.215
  47.113.95.224
  47.113.97.212
-47.114.120.83
+47.114.164.221
  47.114.47.245
  47.114.57.226
-47.114.91.95
  47.114.96.237
  47.115.146.83
-47.115.166.149
-47.115.40.219
+47.115.41.112
  47.115.52.118
  47.115.53.163
+47.116.130.70
  47.12.21.242
-47.12.55.24
-47.134.33.109
+47.12.43.130
  47.136.93.142
+47.14.116.35
+47.144.21.37
  47.144.81.151
  47.145.152.26
  47.146.117.214
  47.148.11.100
-47.148.133.237
-47.148.176.14
  47.149.0.75
-47.149.82.178
  47.149.9.231
  47.15.67.253
  47.152.159.183
-47.152.199.79
  47.153.183.211
-47.156.31.183
+47.156.153.122
  47.156.70.145
  47.16.126.209
  47.17.177.110
-47.17.187.4
  47.176.104.74
-47.176.20.59
  47.176.38.242
  47.176.38.253
  47.180.114.229
  47.180.15.184
+47.180.162.65
  47.180.212.134
  47.180.63.37
-47.180.88.49
+47.180.83.91
  47.180.96.157
  47.184.198.212
  47.184.48.254
@@ -89299,61 +74738,45 @@
  47.187.7.210
  47.188.43.153
  47.189.240.211
-47.19.54.70
-47.19.86.253
  47.190.132.213
  47.190.19.75
  47.192.118.43
  47.196.131.158
-47.196.148.157
  47.196.156.194
  47.198.209.213
  47.20.185.84
  47.201.203.44
-47.203.152.125
  47.203.62.194
  47.203.92.216
  47.203.93.167
-47.204.214.212
-47.204.225.168
  47.204.239.244
-47.208.144.121
  47.208.246.213
-47.21.15.202
  47.21.41.254
+47.21.62.54
  47.215.219.151
-47.217.122.253
+47.219.91.123
  47.22.138.10
-47.22.43.40
  47.222.103.234
-47.224.53.179
  47.225.11.69
-47.227.118.130
  47.227.226.242
-47.227.68.203
  47.227.83.56
  47.232.211.197
  47.232.68.226
-47.234.210.235
-47.234.210.77
  47.234.241.121
  47.240.230.87
+47.240.250.136
  47.240.33.132
-47.241.109.98
+47.241.0.210
+47.241.10.157
  47.241.128.140
  47.241.15.209
  47.241.15.42
-47.241.21.95
  47.241.26.71
  47.241.28.63
-47.241.29.56
  47.241.34.42
  47.241.5.69
  47.241.61.131
-47.241.62.238
  47.241.62.245
-47.241.63.146
-47.241.63.196
  47.241.7.56
  47.241.76.21
  47.242.128.121
@@ -89362,37 +74785,29 @@
  47.242.157.245
  47.242.158.241
  47.242.170.47
-47.242.174.113
  47.242.220.246
  47.242.223.170
-47.242.28.74
  47.242.30.91
  47.242.36.172
  47.242.63.115
-47.242.85.197
  47.244.1.172
  47.244.106.48
  47.244.107.89
  47.244.119.155
  47.244.120.6
  47.244.137.178
-47.244.166.23
-47.244.172.73
-47.244.177.113
+47.244.151.211
+47.244.175.167
  47.244.184.204
  47.244.185.132
  47.244.186.177
  47.244.19.14
  47.244.191.212
  47.244.20.191
-47.244.213.73
  47.244.214.69
-47.244.220.143
  47.244.221.47
-47.244.229.23
  47.244.26.70
  47.244.27.17
-47.244.34.79
  47.244.44.239
  47.244.45.12
  47.244.45.245
@@ -89402,10 +74817,10 @@
  47.244.57.253
  47.244.9.128
  47.245.0.78
+47.245.32.64
  47.245.35.63
  47.245.59.9
  47.247.175.74
-47.250.40.25
  47.252.73.221
  47.252.80.192
  47.252.80.85
@@ -89420,13 +74835,13 @@
  47.253.5.99
  47.253.6.9
  47.254.129.46
-47.254.131.234
+47.254.133.216
  47.254.134.244
  47.254.145.104
  47.254.155.40
  47.254.170.214
  47.254.172.215
-47.254.173.225
+47.254.173.103
  47.254.173.87
  47.254.174.194
  47.254.174.39
@@ -89434,33 +74849,31 @@
  47.254.177.13
  47.254.178.15
  47.254.196.230
+47.254.197.130
  47.254.20.82
  47.254.203.24
  47.254.214.208
  47.254.215.132
  47.254.237.199
  47.254.238.111
-47.254.238.45
  47.254.238.50
  47.254.243.29
  47.254.251.250
+47.254.28.96
  47.254.29.128
-47.254.29.135
+47.254.47.38
  47.254.73.32
+47.254.76.32
  47.254.77.228
  47.254.93.177
  47.254.94.183
  47.254.95.196
  47.26.94.181
-47.29.116.101
-47.32.255.120
-47.34.128.25
+47.27.234.75
  47.34.145.147
-47.36.118.107
  47.36.140.164
  47.37.4.48
  47.39.207.183
-47.44.26.10
  47.46.220.20
  47.46.34.39
  47.47.50.147
@@ -89475,7 +74888,9 @@
  47.52.128.231
  47.52.131.159
  47.52.134.197
+47.52.135.0
  47.52.152.69
+47.52.173.66
  47.52.193.158
  47.52.201.10
  47.52.204.241
@@ -89491,69 +74906,55 @@
  47.52.39.76
  47.52.59.139
  47.52.61.250
-47.52.62.174
-47.52.64.165
  47.52.68.110
  47.52.68.55
-47.53.170.22
  47.53.91.198
  47.54.211.232
  47.54.214.102
  47.56.106.198
  47.56.136.253
  47.56.141.204
-47.56.148.140
-47.56.148.150
-47.56.151.78
+47.56.154.60
  47.56.183.121
+47.56.192.209
  47.56.192.224
-47.56.226.219
  47.56.231.218
  47.56.251.168
  47.56.255.231
  47.57.121.81
-47.57.125.18
+47.57.124.95
  47.57.152.25
  47.57.162.76
  47.57.19.153
  47.57.19.95
-47.57.27.68
-47.57.74.239
  47.57.88.124
  47.6.104.214
  47.6.15.79
  47.6.163.146
-47.6.45.8
  47.6.64.179
  47.60.69.99
-47.61.184.131
  47.61.89.133
  47.62.108.222
-47.62.187.6
+47.62.90.216
  47.63.46.83
-47.72.185.213
+47.72.128.205
  47.72.244.50
  47.74.10.225
-47.74.16.114
  47.74.17.225
  47.74.175.100
  47.74.185.172
+47.74.190.56
  47.74.190.93
-47.74.209.175
  47.74.216.206
  47.74.220.148
-47.74.221.216
-47.74.223.226
  47.74.228.168
  47.74.231.192
  47.74.234.121
  47.74.240.108
-47.74.241.65
  47.74.242.64
-47.74.3.113
-47.74.32.13
  47.74.32.199
  47.74.35.128
+47.74.35.143
  47.74.44.224
  47.74.44.83
  47.74.48.82
@@ -89561,12 +74962,10 @@
  47.74.70.0
  47.74.70.72
  47.74.84.213
-47.74.87.65
+47.74.87.245
  47.74.9.23
-47.75.1.243
  47.75.100.63
  47.75.107.1
-47.75.11.36
  47.75.11.94
  47.75.116.211
  47.75.130.202
@@ -89574,47 +74973,40 @@
  47.75.15.2
  47.75.151.154
  47.75.154.176
-47.75.167.17
  47.75.168.219
  47.75.175.59
  47.75.176.144
-47.75.177.195
  47.75.178.149
  47.75.184.180
  47.75.199.52
  47.75.2.225
  47.75.201.50
  47.75.202.172
+47.75.204.149
  47.75.204.212
-47.75.214.234
-47.75.216.136
+47.75.221.20
  47.75.253.127
  47.75.37.35
-47.75.42.203
-47.75.42.226
+47.75.47.75
  47.75.48.133
-47.75.52.4
  47.75.55.181
  47.75.7.170
  47.75.70.153
  47.75.90.57
  47.8.249.171
  47.88.100.201
-47.88.137.99
  47.88.153.61
-47.88.154.236
-47.88.157.51
  47.88.159.100
  47.88.168.99
  47.88.17.25
  47.88.17.253
  47.88.220.246
-47.88.228.246
  47.88.241.49
  47.88.245.100
  47.88.28.221
  47.88.5.227
  47.88.76.141
+47.88.76.80
  47.88.79.207
  47.88.84.125
  47.88.84.126
@@ -89629,9 +75021,9 @@
  47.89.46.67
  47.89.49.161
  47.89.8.91
+47.9.92.68
  47.90.0.38
  47.90.1.193
-47.90.105.174
  47.90.120.25
  47.90.4.203
  47.90.43.18
@@ -89639,9 +75031,11 @@
  47.90.72.227
  47.90.87.225
  47.90.9.211
+47.90.95.192
  47.91.106.208
  47.91.108.18
  47.91.114.197
+47.91.124.172
  47.91.156.40
  47.91.17.45
  47.91.178.158
@@ -89649,7 +75043,8 @@
  47.91.19.156
  47.91.196.15
  47.91.206.207
-47.91.223.116
+47.91.215.113
+47.91.222.124
  47.91.228.50
  47.91.231.107
  47.91.239.118
@@ -89665,38 +75060,32 @@
  47.91.92.101
  47.91.92.228
  47.92.152.148
+47.92.166.137
  47.92.198.58
  47.92.204.240
  47.92.212.252
-47.92.220.143
+47.92.228.155
  47.92.245.97
+47.92.28.129
  47.92.35.210
+47.92.35.37
  47.92.54.132
+47.92.69.155
  47.92.78.176
+47.92.84.235
  47.92.94.125
-47.92.98.123
  47.93.112.4
-47.93.124.219
-47.93.129.209
  47.93.14.61
+47.93.149.252
  47.93.173.17
  47.93.198.131
-47.93.207.58
-47.93.228.217
  47.93.230.171
  47.93.24.207
  47.93.244.101
  47.93.247.22
-47.93.29.255
  47.93.4.61
-47.93.85.85
  47.93.96.145
-47.93.97.47
-47.93.98.150
  47.94.111.103
-47.94.147.176
-47.94.148.130
-47.94.156.0
  47.94.158.75
  47.94.159.168
  47.94.161.180
@@ -89709,51 +75098,47 @@
  47.94.233.182
  47.94.242.18
  47.94.243.77
-47.94.41.69
  47.94.89.87
-47.95.0.135
  47.95.1.229
  47.95.145.199
+47.95.15.131
  47.95.2.17
  47.95.211.213
  47.95.213.15
  47.95.215.4
+47.95.253.206
  47.95.32.92
  47.96.119.168
  47.96.123.190
  47.96.140.92
  47.96.148.67
  47.96.17.60
+47.96.224.211
  47.96.5.37
-47.96.83.173
  47.96.84.84
  47.97.109.82
-47.97.154.202
+47.97.153.92
  47.97.159.26
-47.97.63.166
+47.97.230.92
  47.97.90.220
  47.98.114.56
-47.98.116.160
  47.98.121.240
  47.98.129.215
+47.98.132.161
  47.98.138.84
+47.98.143.82
  47.98.162.88
  47.98.166.130
  47.98.169.16
  47.98.170.47
-47.98.179.39
  47.98.190.243
  47.98.192.141
  47.98.210.217
-47.98.41.124
-47.99.129.135
-47.99.134.42
-47.99.149.110
  47.99.158.238
  47.99.206.133
  47.99.207.56
  47.99.65.77
-47.99.86.90
+47.99.82.168
  470365365.com
  4715.3190cfdae.com
  471511113115611.002.sh.cn
@@ -89801,7 +75186,6 @@
  48blv.weblium.site
  48rro.weblium.site
  49.0.39.186
-49.0.64.223
  49.0.82.190
  49.0.82.5
  49.1.244.139
@@ -89809,23 +75193,24 @@
  49.112.197.0
  49.112.198.186
  49.112.95.249
-49.114.173.112
  49.115.100.143
  49.115.128.63
  49.115.195.47
  49.115.198.166
  49.115.203.30
-49.115.68.182
  49.115.97.206
  49.115.98.124
  49.116.182.64
  49.116.183.36
  49.116.197.233
  49.116.205.198
+49.116.212.38
  49.116.212.39
+49.116.213.52
  49.116.214.38
  49.116.71.58
  49.117.188.163
+49.117.188.170
  49.117.188.251
  49.117.189.177
  49.117.189.79
@@ -89836,7 +75221,6 @@
  49.119.61.14
  49.119.63.134
  49.119.78.23
-49.119.97.74
  49.12.0.103
  49.12.100.57
  49.12.11.16
@@ -89847,66 +75231,37 @@
  49.12.4.194
  49.12.47.176
  49.12.64.114
-49.12.78.106
  49.12.83.44
  49.12.85.232
  49.12.98.122
-49.128.174.248
  49.128.178.22
  49.128.181.229
-49.128.184.131
-49.128.60.248
-49.130.107.101
  49.130.107.88
-49.130.15.255
-49.130.17.76
-49.130.29.180
  49.130.36.148
  49.130.57.167
  49.130.79.42
  49.130.80.162
-49.130.93.75
  49.130.95.252
-49.135.33.90
  49.135.43.110
-49.142.41.204
-49.142.82.60
  49.142.87.36
  49.143.0.215
-49.143.0.81
-49.143.180.69
-49.143.181.248
-49.143.182.85
-49.143.182.96
-49.143.183.35
-49.143.185.105
-49.143.186.14
-49.143.186.15
-49.143.186.60
-49.143.186.62
-49.143.186.63
-49.143.187.103
-49.143.187.209
  49.143.32.36
  49.143.32.59
  49.143.32.6
  49.143.32.92
-49.143.43.93
-49.143.93.171
  49.144.7.160
  49.145.105.98
+49.145.169.220
  49.145.195.104
+49.145.196.52
  49.145.226.213
  49.145.44.247
  49.145.98.131
  49.146.85.76
-49.147.200.192
-49.149.133.144
  49.149.45.236
  49.149.53.251
  49.150.228.59
  49.151.49.196
-49.156.149.190
  49.156.151.242
  49.156.152.113
  49.156.152.193
@@ -89915,26 +75270,11 @@
  49.156.44.138
  49.156.45.181
  49.156.47.61
-49.158.0.99
-49.158.1.165
-49.158.202.10
-49.158.205.178
-49.158.24.51
-49.158.44.4
-49.158.54.2
-49.158.97.22
  49.159.160.71
-49.159.39.46
-49.159.95.129
  49.161.112.155
  49.161.66.17
-49.164.46.64
  49.168.38.170
  49.174.185.233
-49.174.212.110
-49.174.68.246
-49.175.177.45
-49.176.146.35
  49.176.168.68
  49.192.177.66
  49.192.221.251
@@ -89945,52 +75285,22 @@
  49.206.228.138
  49.206.229.219
  49.206.244.236
-49.206.29.108
-49.206.36.131
+49.206.53.122
+49.207.135.144
+49.207.138.44
  49.207.140.81
  49.207.206.225
-49.209.124.32
-49.212.128.149
  49.212.151.222
  49.212.179.58
  49.212.209.19
-49.213.161.239
-49.213.163.106
-49.213.163.34
-49.213.164.114
-49.213.164.21
-49.213.164.23
-49.213.171.161
-49.213.172.161
-49.213.172.4
-49.213.178.207
-49.213.188.198
-49.213.188.217
-49.213.194.118
-49.213.195.151
-49.213.195.154
-49.213.199.151
-49.213.202.39
-49.213.212.21
-49.213.217.33
-49.213.226.106
-49.213.226.13
-49.213.232.97
+49.228.153.160
  49.228.195.67
-49.228.65.207
-49.229.25.242
-49.229.29.50
  49.229.69.4
-49.229.73.214
  49.231.0.178
-49.231.146.68
  49.231.166.197
-49.231.182.30
-49.231.66.20
  49.232.100.132
  49.232.100.177
  49.232.101.33
-49.232.102.161
  49.232.104.219
  49.232.105.118
  49.232.106.184
@@ -90008,48 +75318,34 @@
  49.232.136.90
  49.232.139.175
  49.232.139.183
-49.232.14.144
  49.232.143.159
-49.232.145.83
-49.232.147.37
  49.232.148.100
-49.232.150.106
  49.232.151.155
  49.232.152.94
-49.232.154.122
-49.232.155.136
-49.232.155.183
  49.232.155.98
  49.232.157.17
  49.232.158.185
  49.232.16.221
-49.232.16.241
-49.232.16.47
  49.232.160.106
  49.232.161.124
  49.232.161.221
-49.232.162.53
  49.232.163.163
  49.232.164.190
  49.232.165.50
  49.232.167.126
  49.232.167.99
  49.232.168.102
-49.232.170.83
  49.232.171.88
  49.232.172.154
  49.232.172.20
-49.232.172.85
  49.232.173.147
  49.232.174.142
  49.232.174.20
  49.232.175.137
  49.232.191.178
-49.232.191.244
  49.232.191.67
  49.232.192.91
  49.232.194.141
-49.232.194.80
  49.232.195.225
  49.232.196.185
  49.232.197.54
@@ -90064,22 +75360,16 @@
  49.232.205.249
  49.232.208.242
  49.232.208.26
-49.232.209.9
  49.232.210.195
  49.232.216.220
  49.232.218.129
  49.232.219.61
-49.232.222.20
  49.232.223.38
-49.232.227.52
-49.232.23.38
  49.232.247.107
  49.232.25.14
  49.232.26.148
  49.232.28.79
  49.232.29.120
-49.232.31.210
-49.232.34.247
  49.232.39.21
  49.232.41.237
  49.232.43.192
@@ -90089,8 +75379,6 @@
  49.232.55.26
  49.232.56.88
  49.232.58.114
-49.232.63.9
-49.232.7.169
  49.232.71.199
  49.232.72.13
  49.232.74.201
@@ -90100,7 +75388,6 @@
  49.232.82.76
  49.232.83.75
  49.232.86.158
-49.232.87.218
  49.232.89.242
  49.232.90.224
  49.232.90.82
@@ -90112,14 +75399,11 @@
  49.233.105.63
  49.233.11.112
  49.233.11.118
-49.233.111.193
  49.233.117.138
  49.233.117.199
  49.233.119.93
-49.233.12.186
  49.233.122.40
  49.233.13.194
-49.233.137.3
  49.233.14.115
  49.233.14.36
  49.233.15.54
@@ -90135,13 +75419,11 @@
  49.233.177.173
  49.233.177.99
  49.233.18.9
-49.233.180.38
  49.233.183.15
-49.233.185.244
-49.233.186.174
  49.233.186.66
  49.233.189.200
  49.233.189.73
+49.233.190.13
  49.233.195.198
  49.233.196.120
  49.233.196.165
@@ -90149,19 +75431,18 @@
  49.233.199.228
  49.233.200.37
  49.233.201.186
+49.233.203.30
  49.233.204.226
  49.233.204.30
-49.233.204.37
  49.233.212.154
  49.233.213.214
  49.233.214.16
  49.233.216.158
  49.233.218.70
+49.233.22.224
  49.233.220.148
  49.233.221.231
  49.233.250.147
-49.233.254.253
-49.233.28.77
  49.233.29.44
  49.233.3.177
  49.233.30.125
@@ -90171,19 +75452,19 @@
  49.233.33.66
  49.233.34.5
  49.233.34.9
+49.233.34.92
  49.233.37.15
  49.233.37.62
  49.233.4.143
  49.233.4.31
-49.233.42.217
  49.233.47.104
  49.233.47.41
-49.233.49.153
  49.233.51.48
  49.233.53.111
  49.233.54.212
  49.233.54.236
  49.233.56.9
+49.233.58.73
  49.233.60.69
  49.233.64.168
  49.233.68.90
@@ -90198,25 +75479,18 @@
  49.233.85.167
  49.233.90.200
  49.233.91.148
-49.233.92.134
  49.234.100.123
  49.234.100.133
  49.234.100.201
  49.234.100.95
-49.234.101.19
-49.234.101.196
-49.234.104.94
  49.234.105.96
-49.234.106.231
  49.234.107.24
-49.234.11.240
  49.234.110.240
  49.234.111.57
  49.234.114.62
  49.234.116.74
  49.234.117.66
  49.234.119.42
-49.234.12.79
  49.234.12.93
  49.234.123.171
  49.234.124.196
@@ -90224,6 +75498,7 @@
  49.234.125.24
  49.234.127.168
  49.234.131.75
+49.234.137.177
  49.234.138.20
  49.234.138.26
  49.234.14.175
@@ -90234,19 +75509,14 @@
  49.234.149.92
  49.234.150.126
  49.234.150.129
-49.234.155.82
  49.234.158.131
  49.234.158.16
-49.234.159.71
  49.234.163.189
  49.234.17.252
  49.234.18.158
  49.234.181.60
-49.234.182.99
-49.234.183.237
  49.234.190.140
  49.234.201.237
-49.234.205.32
  49.234.208.46
  49.234.209.124
  49.234.21.219
@@ -90263,15 +75533,9 @@
  49.234.224.134
  49.234.224.88
  49.234.225.74
-49.234.226.196
  49.234.227.17
-49.234.227.202
  49.234.230.31
-49.234.230.86
-49.234.231.164
  49.234.235.127
-49.234.236.123
-49.234.239.243
  49.234.239.91
  49.234.24.193
  49.234.24.246
@@ -90283,37 +75547,30 @@
  49.234.41.108
  49.234.41.15
  49.234.41.154
-49.234.42.108
  49.234.43.127
  49.234.43.224
  49.234.43.39
  49.234.45.241
  49.234.47.124
-49.234.50.203
  49.234.50.235
  49.234.50.247
  49.234.51.251
-49.234.51.76
  49.234.52.166
  49.234.58.191
  49.234.60.118
-49.234.61.37
-49.234.61.76
  49.234.62.183
+49.234.67.23
  49.234.68.42
  49.234.69.205
  49.234.69.78
-49.234.70.78
  49.234.72.49
  49.234.72.59
-49.234.72.85
  49.234.77.13
  49.234.78.175
  49.234.78.216
  49.234.79.129
  49.234.79.204
  49.234.79.81
-49.234.81.14
  49.234.87.24
  49.234.88.101
  49.234.91.78
@@ -90323,7 +75580,6 @@
  49.234.95.189
  49.234.96.166
  49.234.96.173
-49.234.96.58
  49.234.97.214
  49.234.99.208
  49.234.99.246
@@ -90331,8 +75587,6 @@
  49.235.100.147
  49.235.103.191
  49.235.104.204
-49.235.105.75
-49.235.106.130
  49.235.107.186
  49.235.109.216
  49.235.11.137
@@ -90346,18 +75600,11 @@
  49.235.124.111
  49.235.125.17
  49.235.128.105
-49.235.13.33
-49.235.130.109
  49.235.132.88
-49.235.135.230
  49.235.136.49
  49.235.136.89
-49.235.141.203
-49.235.143.244
  49.235.144.143
  49.235.146.95
-49.235.147.85
-49.235.151.50
  49.235.153.54
  49.235.154.66
  49.235.159.133
@@ -90380,23 +75627,15 @@
  49.235.206.172
  49.235.207.127
  49.235.213.170
-49.235.216.54
  49.235.221.172
  49.235.221.66
-49.235.226.135
  49.235.226.192
  49.235.227.17
-49.235.232.228
  49.235.233.189
-49.235.234.186
  49.235.239.92
-49.235.240.125
  49.235.241.211
-49.235.243.205
-49.235.245.239
  49.235.25.117
  49.235.250.156
-49.235.250.94
  49.235.251.162
  49.235.251.43
  49.235.252.236
@@ -90405,13 +75644,9 @@
  49.235.253.61
  49.235.253.75
  49.235.254.16
-49.235.255.186
-49.235.26.232
  49.235.26.37
-49.235.27.102
  49.235.28.55
  49.235.28.96
-49.235.34.147
  49.235.35.65
  49.235.35.79
  49.235.38.46
@@ -90419,7 +75654,6 @@
  49.235.48.191
  49.235.54.129
  49.235.61.225
-49.235.62.91
  49.235.66.14
  49.235.7.60
  49.235.70.92
@@ -90430,38 +75664,27 @@
  49.235.74.192
  49.235.74.226
  49.235.74.32
-49.235.74.82
-49.235.74.86
  49.235.75.158
  49.235.75.232
+49.235.75.93
+49.235.76.18
  49.235.78.110
-49.235.78.54
  49.235.80.143
  49.235.83.136
  49.235.84.120
-49.235.86.34
-49.235.9.47
  49.235.90.102
-49.235.90.166
  49.235.90.244
-49.235.91.35
  49.235.93.192
  49.235.93.87
  49.235.96.146
+49.235.96.74
  49.235.98.68
-49.236.192.13
-49.236.192.136
-49.236.193.70
  49.236.195.150
  49.236.214.144
  49.238.142.12
  49.243.9.118
-49.245.112.250
-49.245.17.152
-49.245.42.168
  49.245.44.222
  49.245.52.243
-49.245.93.188
  49.247.128.34
  49.247.135.55
  49.247.204.78
@@ -90469,130 +75692,39 @@
  49.247.21.169
  49.247.213.18
  49.247.215.43
+49.247.24.96
  49.248.109.74
  49.248.32.110
  49.248.84.138
  49.249.239.198
  49.255.35.114
  49.255.93.10
-49.3.20.161
  49.3.224.99
-49.3.44.137
+49.34.28.32
+49.36.120.219
+49.36.138.67
+49.36.142.127
  49.36.32.210
  49.36.39.94
  49.36.6.64
  49.37.0.203
  49.37.215.246
+49.37.7.82
  49.4.31.138
+49.48.105.17
  49.48.109.79
-49.48.11.219
  49.48.33.4
  49.48.86.25
-49.5.12.160
  49.50.105.62
  49.50.107.221
  49.50.164.24
  49.50.209.131
  49.50.28.133
  49.50.77.206
-49.51.10.125
-49.51.10.180
-49.51.10.24
-49.51.10.34
-49.51.10.61
-49.51.11.133
-49.51.11.210
-49.51.11.68
-49.51.12.169
-49.51.12.179
-49.51.12.205
-49.51.12.221
-49.51.12.230
-49.51.12.241
-49.51.12.244
-49.51.12.25
-49.51.12.44
-49.51.12.60
-49.51.12.61
-49.51.13.14
-49.51.13.40
-49.51.134.254
-49.51.150.122
-49.51.153.23
-49.51.153.85
-49.51.155.120
-49.51.155.205
-49.51.159.98
-49.51.160.107
  49.51.160.139
-49.51.160.173
-49.51.160.201
-49.51.160.240
-49.51.160.252
-49.51.160.31
-49.51.160.47
-49.51.160.77
-49.51.160.84
-49.51.160.91
-49.51.161.114
-49.51.161.141
-49.51.161.145
-49.51.161.183
-49.51.161.186
-49.51.161.209
-49.51.161.236
-49.51.161.252
  49.51.161.40
-49.51.161.77
-49.51.161.95
-49.51.162.172
-49.51.172.33
-49.51.230.78
-49.51.232.87
-49.51.241.239
-49.51.242.147
-49.51.242.196
-49.51.242.225
-49.51.243.251
-49.51.244.189
-49.51.252.116
-49.51.253.158
-49.51.253.249
-49.51.33.14
-49.51.34.136
-49.51.34.227
-49.51.49.117
-49.51.51.127
-49.51.51.24
-49.51.51.53
-49.51.52.89
-49.51.8.104
-49.51.8.17
-49.51.8.172
-49.51.8.188
-49.51.8.195
-49.51.8.24
-49.51.8.99
-49.51.9.105
-49.51.9.134
-49.51.9.157
-49.51.9.19
-49.51.9.196
-49.51.9.204
-49.51.9.206
-49.51.9.216
-49.51.9.77
-49.51.9.87
  49.51.90.173
-49.51.90.60
-49.51.93.254
-49.64.176.209
-49.64.252.15
-49.64.252.173
  49.64.52.109
-49.65.187.1
-49.67.11.91
-49.67.183.240
  49.68.123.52
  49.68.124.192
  49.68.124.248
@@ -90600,7 +75732,6 @@
  49.68.129.72
  49.68.131.148
  49.68.131.194
-49.68.131.29
  49.68.131.71
  49.68.146.254
  49.68.151.194
@@ -90636,7 +75767,6 @@
  49.68.248.197
  49.68.248.67
  49.68.249.219
-49.68.249.255
  49.68.249.26
  49.68.250.118
  49.68.251.197
@@ -90651,17 +75781,12 @@
  49.68.58.134
  49.68.58.159
  49.68.58.163
-49.68.69.150
  49.68.76.59
  49.68.77.182
  49.68.83.170
  49.68.83.240
  49.68.98.37
-49.69.211.18
-49.7.11.37
-49.7.234.50
-49.7.234.52
-49.7.58.243
+49.7.233.114
  49.70.106.4
  49.70.119.0
  49.70.123.252
@@ -90677,44 +75802,35 @@
  49.70.34.196
  49.70.34.61
  49.70.48.38
-49.70.64.183
-49.70.64.41
  49.70.80.76
  49.70.89.243
  49.70.95.248
-49.71.124.210
  49.71.133.125
-49.72.110.160
  49.72.111.207
  49.72.212.22
-49.72.38.153
+49.72.249.21
  49.73.124.227
  49.73.136.145
  49.73.177.205
-49.73.229.32
+49.73.177.243
+49.73.177.89
  49.73.229.4
-49.73.235.149
-49.73.239.60
+49.73.229.72
  49.73.252.126
-49.73.252.89
-49.73.4.109
+49.73.4.30
  49.73.4.4
-49.73.4.53
  49.73.7.162
-49.73.84.175
-49.74.105.175
+49.73.90.156
  49.74.219.26
  49.75.14.240
  49.75.14.75
-49.75.141.82
-49.75.153.48
-49.75.214.194
-49.75.237.49
+49.75.141.244
+49.75.141.58
  49.75.237.98
+49.75.27.182
+49.75.7.35
  49.75.9.128
  49.76.204.58
-49.77.191.109
-49.77.208.131
  49.80.122.175
  49.80.175.16
  49.80.99.109
@@ -90722,7 +75838,6 @@
  49.81.100.163
  49.81.103.62
  49.81.106.68
-49.81.107.31
  49.81.120.240
  49.81.122.202
  49.81.123.73
@@ -90735,7 +75850,6 @@
  49.81.156.134
  49.81.156.149
  49.81.178.95
-49.81.180.239
  49.81.223.125
  49.81.223.134
  49.81.237.96
@@ -90750,64 +75864,57 @@
  49.81.75.99
  49.81.91.113
  49.81.91.226
-49.81.91.40
  49.81.99.137
  49.81.99.16
  49.82.100.167
  49.82.136.3
-49.82.14.148
  49.82.192.122
  49.82.200.238
-49.82.208.70
  49.82.212.34
  49.82.222.107
  49.82.222.180
  49.82.224.17
  49.82.228.87
  49.82.234.243
-49.82.245.144
  49.82.248.85
  49.82.249.71
  49.82.252.63
  49.82.253.169
  49.82.255.73
-49.83.108.143
+49.83.164.220
+49.83.20.113
  49.84.113.238
-49.84.124.225
  49.84.125.254
  49.84.127.92
+49.84.145.177
+49.84.173.23
+49.84.176.65
  49.84.190.68
-49.84.27.67
-49.84.70.22
  49.85.179.51
  49.85.189.194
  49.85.216.36
-49.85.236.87
-49.85.246.62
+49.85.236.84
+49.85.250.131
  49.85.250.244
  49.85.54.87
  49.85.98.132
-49.86.199.150
-49.87.123.82
-49.87.131.36
+49.86.206.80
  49.87.201.232
  49.87.220.25
+49.87.23.237
  49.87.250.42
  49.87.46.40
-49.87.62.99
  49.87.73.77
-49.88.112.109
  49.88.112.110
  49.88.112.111
-49.88.112.112
  49.88.112.113
-49.88.112.114
  49.88.112.115
  49.88.112.117
  49.88.112.118
  49.88.112.4
  49.88.112.60
  49.88.112.65
+49.88.112.67
  49.88.112.68
  49.88.112.69
  49.88.112.70
@@ -90817,6 +75924,7 @@
  49.88.112.75
  49.88.112.77
  49.89.103.106
+49.89.109.101
  49.89.115.124
  49.89.137.129
  49.89.137.242
@@ -90830,7 +75938,6 @@
  49.89.195.111
  49.89.198.62
  49.89.209.125
-49.89.218.132
  49.89.228.167
  49.89.228.185
  49.89.228.63
@@ -90847,6 +75954,7 @@
  49.89.68.212
  49.89.76.96
  49.89.80.45
+49.89.85.202
  49.89.89.54
  49.89.95.219
  49.91.240.239
@@ -90989,6 +76097,7 @@
  4soulpower.systems
  4st1d.codesandbox.io
  4success.zapto.org
+4teename.com
  4thave.co.uk
  4themes.ru
  4tukgrw1cx7xhco2c70eqswtmv0qhxvi.welt.tl
@@ -91016,7 +76125,6 @@
  5.0.102.186
  5.0.163.8
  5.1.104.130
-5.1.34.90
  5.1.53.46
  5.10.186.222
  5.10.206.195
@@ -91028,11 +76136,8 @@
  5.101.107.190
  5.101.119.90
  5.101.123.24
-5.101.15.173
  5.101.151.106
  5.101.174.40
-5.101.197.143
-5.101.197.161
  5.101.214.186
  5.101.221.238
  5.101.77.153
@@ -91042,11 +76147,11 @@
  5.102.168.215
  5.102.168.217
  5.102.173.71
+5.102.189.79
  5.102.193.168
  5.102.205.76
  5.102.58.41
-5.103.116.2
-5.103.118.110
+5.103.135.31
  5.103.137.146
  5.104.105.194
  5.104.105.209
@@ -91054,22 +76159,12 @@
  5.104.105.223
  5.104.105.241
  5.104.105.247
-5.104.108.127
-5.104.110.58
-5.105.1.168
-5.105.138.40
-5.105.194.192
-5.109.247.91
  5.11.129.236
  5.11.134.152
  5.11.254.13
-5.12.206.214
-5.12.234.94
  5.128.100.109
-5.128.121.2
-5.128.143.237
  5.128.156.71
-5.128.81.130
+5.128.223.8
  5.128.87.126
  5.13.129.154
  5.130.103.126
@@ -91077,24 +76172,25 @@
  5.133.11.117
  5.133.11.118
  5.133.11.119
-5.133.168.15
  5.133.179.243
+5.133.211.171
  5.133.24.117
  5.133.65.82
-5.134.196.70
-5.134.61.34
  5.135.123.36
  5.135.129.180
+5.135.136.220
  5.135.14.247
  5.135.140.215
  5.135.153.117
  5.135.154.68
+5.135.154.75
  5.135.156.68
  5.135.159.65
  5.135.160.228
  5.135.161.7
  5.135.166.43
  5.135.174.215
+5.135.176.163
  5.135.176.208
  5.135.177.202
  5.135.179.178
@@ -91104,7 +76200,6 @@
  5.135.181.92
  5.135.182.83
  5.135.182.84
-5.135.183.232
  5.135.183.49
  5.135.184.46
  5.135.184.72
@@ -91114,6 +76209,7 @@
  5.135.199.2
  5.135.199.29
  5.135.23.3
+5.135.237.134
  5.135.237.216
  5.135.239.81
  5.135.34.152
@@ -91123,31 +76219,27 @@
  5.135.74.187
  5.135.78.52
  5.135.94.191
-5.136.244.170
  5.137.154.211
-5.137.83.134
+5.137.155.172
  5.14.150.182
-5.14.18.88
  5.14.200.167
  5.14.67.200
+5.140.141.78
  5.140.212.175
  5.140.233.250
-5.140.56.121
  5.140.69.113
  5.140.71.226
  5.141.131.164
  5.141.151.5
-5.141.223.140
-5.141.244.28
  5.141.244.52
  5.141.244.97
  5.141.81.106
+5.143.13.167
  5.143.25.0
  5.143.49.89
  5.143.67.38
  5.143.69.129
  5.143.8.76
-5.143.90.96
  5.144.12.15
  5.144.130.12
  5.144.176.130
@@ -91163,33 +76255,25 @@
  5.148.32.240
  5.149.144.102
  5.149.205.141
-5.149.205.230
  5.149.250.76
  5.149.252.252
  5.149.254.109
  5.149.64.194
-5.15.174.136
+5.149.95.112
  5.15.47.26
  5.15.58.64
  5.150.213.70
-5.150.236.83
+5.150.230.8
  5.150.239.205
  5.150.240.82
  5.150.249.254
-5.151.118.100
-5.151.153.201
-5.151.153.202
-5.152.0.128
-5.152.0.198
  5.152.0.200
  5.152.0.210
  5.152.145.162
-5.152.148.131
  5.152.158.4
  5.152.203.117
  5.152.203.118
  5.152.206.196
-5.152.207.195
  5.152.222.99
  5.153.140.179
  5.153.140.180
@@ -91199,16 +76283,16 @@
  5.153.234.154
  5.153.238.103
  5.153.54.179
-5.154.174.49
  5.154.5.165
-5.154.5.182
  5.154.5.201
  5.154.5.212
  5.154.5.88
  5.157.11.172
  5.157.11.8
  5.157.11.87
-5.157.14.17
+5.157.13.3
+5.157.14.120
+5.157.14.141
  5.157.14.241
  5.157.14.73
  5.157.19.193
@@ -91227,24 +76311,24 @@
  5.157.24.138
  5.157.24.152
  5.157.24.153
+5.157.24.161
  5.157.24.192
+5.157.24.204
  5.157.24.245
+5.157.24.246
  5.157.24.84
-5.157.26.235
  5.157.26.248
  5.157.27.150
  5.157.27.190
  5.157.27.193
  5.157.27.219
  5.157.27.224
-5.157.27.28
-5.157.27.58
+5.157.27.65
  5.157.27.78
  5.157.27.82
  5.157.32.121
  5.157.32.13
  5.157.32.14
-5.157.33.127
  5.157.38.42
  5.157.5.114
  5.157.5.155
@@ -91252,8 +76336,9 @@
  5.157.52.133
  5.157.58.72
  5.157.59.210
+5.157.61.141
  5.157.7.35
-5.157.8.164
+5.158.119.13
  5.158.123.153
  5.158.187.169
  5.158.236.116
@@ -91262,35 +76347,28 @@
  5.159.50.62
  5.16.13.38
  5.16.72.81
-5.160.103.202
  5.160.243.112
  5.160.243.115
-5.160.243.142
  5.160.243.153
-5.160.25.194
-5.160.50.50
-5.160.85.188
-5.160.90.202
  5.164.150.22
+5.164.174.100
  5.164.200.148
  5.164.223.21
-5.164.224.55
  5.164.235.84
  5.164.250.121
  5.164.254.8
  5.164.57.110
-5.165.212.149
  5.165.243.30
  5.165.252.109
  5.165.252.198
  5.165.252.70
  5.165.47.119
  5.165.66.212
-5.165.7.165
  5.165.73.230
  5.166.49.110
  5.166.56.250
  5.166.57.222
+5.167.12.99
  5.167.34.60
  5.167.64.0
  5.167.64.1
@@ -93341,10 +78419,9 @@
  5.167.71.98
  5.167.71.99
  5.17.89.13
-5.17.94.86
  5.170.140.114
-5.172.17.90
  5.173.128.41
+5.173.233.123
  5.175.225.107
  5.178.135.226
  5.178.193.43
@@ -93355,21 +78432,23 @@
  5.180.150.238
  5.180.22.75
  5.180.220.106
-5.180.220.131
-5.180.220.53
+5.180.220.233
+5.180.220.41
+5.180.220.70
+5.180.221.60
+5.180.221.66
  5.180.246.109
+5.180.246.116
  5.180.246.172
  5.180.246.194
+5.180.246.229
  5.180.247.14
  5.180.247.26
  5.180.247.40
  5.180.247.67
-5.181.151.77
-5.181.170.19
-5.181.170.209
+5.180.97.88
+5.181.170.245
  5.181.192.237
-5.181.209.190
-5.181.31.172
  5.181.4.201
  5.181.4.247
  5.181.93.140
@@ -93377,13 +78456,7 @@
  5.182.209.18
  5.182.209.21
  5.182.209.29
-5.182.209.34
-5.182.209.38
-5.182.209.46
-5.182.210.147
-5.182.210.189
  5.182.210.66
-5.182.210.83
  5.182.210.84
  5.182.210.95
  5.182.211.138
@@ -93392,21 +78465,22 @@
  5.182.211.216
  5.182.211.220
  5.182.211.238
-5.182.245.36
  5.182.26.126
  5.182.26.129
  5.182.48.115
  5.183.130.143
-5.183.130.196
  5.183.254.63
  5.183.255.154
+5.183.255.184
  5.183.255.186
-5.183.255.24
+5.183.255.233
  5.183.80.79
  5.183.92.121
  5.183.92.146
  5.183.92.163
  5.183.92.164
+5.183.92.181
+5.183.92.248
  5.183.92.25
  5.183.92.26
  5.183.92.37
@@ -93426,22 +78500,18 @@
  5.188.11.114
  5.188.11.115
  5.188.11.165
-5.188.159.48
  5.188.168.127
+5.188.206.0
+5.188.206.201
  5.188.206.202
-5.188.206.211
-5.188.206.38
+5.188.206.203
  5.188.210.10
  5.188.210.18
-5.188.210.203
-5.188.210.226
  5.188.210.242
-5.188.210.245
  5.188.210.31
  5.188.210.36
  5.188.210.41
  5.188.210.46
-5.188.210.59
  5.188.210.61
  5.188.210.66
  5.188.210.8
@@ -93452,7 +78522,6 @@
  5.188.216.204
  5.188.216.208
  5.188.216.218
-5.188.216.227
  5.188.216.29
  5.188.216.41
  5.188.216.60
@@ -93468,8 +78537,9 @@
  5.188.231.10
  5.188.231.44
  5.188.33.194
+5.188.35.101
  5.188.35.104
-5.188.35.6
+5.188.35.107
  5.188.48.10
  5.188.48.12
  5.188.48.13
@@ -93487,7 +78557,10 @@
  5.188.56.58
  5.188.56.60
  5.188.62.140
+5.188.62.147
  5.188.62.24
+5.188.84.115
+5.188.84.119
  5.188.84.147
  5.188.84.15
  5.188.84.183
@@ -93503,23 +78576,20 @@
  5.188.84.45
  5.188.84.59
  5.188.84.65
-5.188.84.92
-5.188.86.25
+5.188.84.95
  5.188.9.76
  5.188.93.31
  5.189.128.186
  5.189.128.206
-5.189.130.129
  5.189.130.21
  5.189.130.228
-5.189.131.178
  5.189.132.254
  5.189.133.231
+5.189.136.107
  5.189.136.127
  5.189.140.133
  5.189.140.14
  5.189.140.222
-5.189.140.80
  5.189.141.207
  5.189.144.193
  5.189.147.147
@@ -93534,12 +78604,10 @@
  5.189.168.53
  5.189.171.225
  5.189.173.197
-5.189.176.171
  5.189.177.201
  5.189.178.241
  5.189.178.42
  5.189.182.247
-5.189.183.214
  5.189.184.249
  5.189.187.219
  5.189.187.89
@@ -93552,25 +78620,30 @@
  5.189.98.149
  5.19.140.86
  5.190.124.177
-5.190.168.86
+5.190.145.0
+5.190.145.228
+5.190.189.35
  5.190.209.3
  5.190.56.120
-5.190.65.41
+5.190.81.150
+5.190.81.39
+5.190.81.69
+5.195.10.174
  5.196.102.147
-5.196.110.170
-5.196.117.224
+5.196.116.202
  5.196.121.87
-5.196.127.124
  5.196.148.255
  5.196.148.75
  5.196.167.44
  5.196.195.139
  5.196.198.147
+5.196.204.17
  5.196.215.231
  5.196.218.24
  5.196.23.219
  5.196.239.210
  5.196.255.171
+5.196.27.163
  5.196.27.37
  5.196.29.108
  5.196.33.177
@@ -93586,16 +78659,12 @@
  5.196.72.11
  5.196.73.52
  5.196.75.140
-5.196.75.178
  5.196.75.208
  5.196.75.231
-5.196.75.47
  5.196.75.95
  5.196.8.72
  5.196.81.99
-5.196.83.78
  5.196.88.214
-5.196.89.191
  5.196.95.80
  5.199.130.127
  5.199.130.188
@@ -93609,10 +78678,7 @@
  5.2.188.23
  5.2.203.194
  5.2.212.254
-5.2.214.232
-5.2.221.9
  5.2.246.108
-5.2.249.195
  5.2.67.174
  5.2.67.51
  5.2.68.74
@@ -93637,9 +78703,9 @@
  5.2.79.145
  5.2.79.179
  5.2.79.82
+5.20.26.89
  5.20.91.12
  5.200.55.159
-5.200.64.54
  5.200.68.167
  5.200.85.197
  5.200.90.156
@@ -93647,7 +78713,6 @@
  5.201.164.104
  5.201.177.163
  5.202.112.26
-5.202.149.38
  5.202.192.146
  5.202.193.74
  5.204.191.80
@@ -93668,32 +78733,26 @@
  5.206.232.190
  5.206.236.45
  5.206.88.106
-5.22.128.97
  5.22.135.97
  5.225.220.76
  5.226.138.3
  5.226.70.68
  5.228.232.101
-5.228.242.230
  5.23.102.194
  5.23.103.98
-5.23.48.143
  5.230.22.248
  5.230.69.18
  5.230.69.2
-5.238.200.120
-5.240.27.151
+5.235.184.107
+5.238.251.2
  5.248.165.128
  5.248.19.91
  5.248.224.67
  5.248.225.78
  5.248.241.239
-5.248.72.115
  5.248.86.134
  5.249.147.91
  5.249.148.162
-5.249.70.232
-5.251.46.91
  5.252.193.211
  5.252.194.137
  5.252.194.29
@@ -93702,19 +78761,15 @@
  5.253.18.191
  5.253.204.22
  5.253.204.44
+5.253.24.90
  5.253.25.217
-5.253.26.96
-5.253.84.150
-5.253.84.226
  5.253.86.13
  5.253.86.183
  5.254.101.226
  5.254.132.73
  5.254.56.74
  5.254.67.148
-5.254.86.236
  5.254.89.174
-5.255.171.226
  5.255.172.227
  5.255.250.106
  5.255.250.115
@@ -93733,13 +78788,12 @@
  5.255.81.155
  5.255.86.110
  5.255.91.73
-5.26.155.2
+5.26.165.231
+5.28.30.73
+5.3.147.137
  5.3.169.222
  5.3.6.82
  5.32.175.72
-5.32.176.108
-5.32.25.94
-5.32.71.134
  5.34.158.102
  5.34.178.126
  5.34.180.177
@@ -93747,15 +78801,14 @@
  5.34.181.17
  5.34.221.226
  5.35.136.128
-5.35.187.5
-5.35.201.90
  5.35.203.113
  5.36.123.12
-5.36.126.96
  5.36.148.103
-5.36.227.207
+5.36.159.222
  5.36.78.32
-5.37.143.177
+5.36.99.54
+5.37.205.251
+5.37.253.100
  5.38.131.156
  5.39.101.15
  5.39.119.11
@@ -93763,7 +78816,6 @@
  5.39.165.20
  5.39.169.117
  5.39.200.88
-5.39.217.7
  5.39.219.98
  5.39.221.49
  5.39.222.159
@@ -93785,6 +78837,7 @@
  5.39.81.217
  5.39.83.234
  5.39.83.33
+5.39.84.56
  5.39.85.81
  5.39.86.52
  5.39.87.36
@@ -93797,25 +78850,21 @@
  5.39.94.46
  5.39.95.38
  5.39.97.155
-5.40.64.180
  5.42.246.46
-5.43.143.137
  5.44.100.108
  5.44.103.9
  5.44.169.215
-5.44.203.155
  5.44.25.146
+5.44.39.14
  5.44.45.150
-5.44.45.161
-5.44.5.170
  5.45.110.20
  5.45.124.42
  5.45.179.174
  5.45.74.50
  5.45.77.3
  5.45.84.166
+5.45.97.170
  5.51.60.216
-5.53.138.156
  5.53.142.228
  5.53.146.179
  5.55.253.99
@@ -93829,38 +78878,29 @@
  5.56.18.35
  5.56.20.2
  5.56.253.193
-5.56.27.145
-5.56.60.113
-5.56.92.52
  5.57.34.34
-5.58.18.104
-5.58.20.105
  5.58.39.77
  5.58.49.28
  5.58.58.119
  5.58.58.209
-5.58.60.133
  5.58.95.179
  5.59.136.226
  5.59.141.152
-5.59.141.221
+5.59.142.97
  5.59.143.43
  5.59.145.129
  5.59.35.26
-5.59.82.131
  5.61.216.182
  5.61.50.213
  5.61.51.32
  5.61.57.93
  5.62.1.79
-5.62.167.14
  5.62.19.46
  5.62.20.21
-5.62.20.22
  5.62.20.23
+5.62.20.25
  5.62.20.38
  5.62.20.49
-5.62.20.56
  5.62.37.16
  5.62.39.232
  5.62.39.37
@@ -93877,33 +78917,27 @@
  5.62.60.55
  5.62.62.54
  5.62.62.55
-5.62.63.201
  5.63.146.172
  5.63.158.232
  5.63.165.178
  5.63.187.116
  5.65.85.255
  5.66.138.88
-5.66.146.24
-5.66.162.199
  5.66.2.50
  5.68.53.151
  5.69.182.15
  5.69.192.61
  5.69.89.34
-5.70.221.67
  5.71.155.237
  5.71.186.2
-5.74.13.38
+5.76.146.189
  5.76.147.117
-5.77.254.236
  5.77.35.249
  5.79.105.33
  5.79.109.46
  5.79.109.48
  5.79.123.3
  5.79.165.108
-5.79.214.179
  5.79.42.20
  5.79.66.20
  5.79.68.161
@@ -93930,7 +78964,6 @@
  5.8.16.110
  5.8.16.71
  5.8.16.72
-5.8.16.73
  5.8.16.75
  5.8.16.77
  5.8.16.78
@@ -93944,24 +78977,14 @@
  5.8.51.231
  5.8.71.45
  5.8.88.75
-5.82.118.199
  5.83.161.153
  5.83.161.68
  5.83.162.160
  5.83.163.164
  5.83.2.230
-5.83.72.23
  5.83.93.197
  5.88.118.169
-5.88.130.165
-5.88.135.45
  5.88.155.130
-5.88.184.182
-5.88.185.249
-5.88.201.222
-5.89.175.250
-5.89.193.135
-5.89.243.30
  5.89.33.136
  5.9.104.23
  5.9.105.49
@@ -94066,16 +79089,14 @@
  5.9.94.237
  5.9.98.178
  5.9.99.120
-5.90.214.19
+5.90.0.10
+5.90.13.153
  5.90.217.45
  5.90.219.156
-5.90.223.74
-5.90.39.41
  5.90.81.34
-5.90.88.116
-5.91.12.87
-5.91.2.243
-5.95.35.109
+5.90.90.172
+5.91.20.171
+5.91.5.221
  5.aba.vg
  5.top4top.io
  5.zxczj.top
@@ -94103,7 +79124,6 @@
  50.116.37.141
  50.116.39.127
  50.116.39.67
-50.116.4.220
  50.116.40.88
  50.116.42.126
  50.116.42.245
@@ -94129,7 +79149,6 @@
  50.117.102.101
  50.117.102.110
  50.117.102.128
-50.117.249.202
  50.117.96.182
  50.118.160.119
  50.118.172.64
@@ -94138,8 +79157,6 @@
  50.121.226.159
  50.121.94.246
  50.125.224.3
-50.125.254.155
-50.126.67.154
  50.13.90.140
  50.131.204.71
  50.132.102.166
@@ -94178,14 +79195,14 @@
  50.192.59.93
  50.193.202.81
  50.194.102.27
+50.194.145.45
  50.195.182.98
-50.195.197.105
  50.195.7.180
  50.196.105.87
  50.196.126.233
  50.196.148.195
-50.196.27.214
  50.196.55.129
+50.197.117.77
  50.197.162.169
  50.197.210.138
  50.197.38.230
@@ -94193,15 +79210,11 @@
  50.2.13.166
  50.2.190.18
  50.20.209.84
-50.200.136.108
-50.201.166.215
-50.201.2.171
+50.20.246.174
  50.201.51.216
  50.201.58.84
  50.202.139.150
-50.202.44.35
  50.203.146.253
-50.204.219.101
  50.205.119.150
  50.205.151.218
  50.205.36.167
@@ -94209,7 +79222,6 @@
  50.206.145.228
  50.207.130.198
  50.207.130.238
-50.208.56.148
  50.22.0.250
  50.22.163.2
  50.22.53.71
@@ -94217,29 +79229,21 @@
  50.220.121.211
  50.220.121.222
  50.225.135.130
-50.227.195.3
  50.227.46.1
  50.228.81.138
  50.23.43.242
  50.23.69.44
  50.23.76.241
  50.230.160.35
-50.232.204.114
-50.232.60.196
-50.233.148.74
  50.233.228.147
  50.233.42.98
-50.234.212.4
  50.235.28.146
-50.235.67.4
  50.235.92.14
  50.235.92.65
  50.236.0.129
-50.236.133.10
  50.236.148.246
  50.236.148.254
  50.236.225.58
-50.236.62.30
  50.236.77.190
  50.237.206.138
  50.237.206.174
@@ -94248,20 +79252,16 @@
  50.240.188.72
  50.240.190.22
  50.240.254.245
-50.241.229.220
  50.242.100.89
  50.242.118.99
  50.243.170.153
-50.243.2.110
  50.244.173.237
  50.244.9.1
  50.245.107.73
  50.245.153.217
  50.245.168.106
-50.245.199.220
  50.245.253.185
  50.245.46.181
-50.245.87.89
  50.246.120.125
  50.247.168.180
  50.247.168.184
@@ -94271,22 +79271,17 @@
  50.247.72.33
  50.248.158.50
  50.248.238.238
-50.248.41.235
  50.250.34.229
  50.250.56.129
  50.250.75.153
-50.251.216.225
-50.251.216.228
  50.251.29.57
+50.251.99.225
  50.253.187.214
  50.253.49.189
  50.254.135.209
  50.254.218.37
-50.255.64.233
  50.26.216.137
-50.27.236.101
  50.28.1.43
-50.28.10.39
  50.28.105.15
  50.28.11.222
  50.28.18.205
@@ -94299,29 +79294,8 @@
  50.3.177.106
  50.3.177.72
  50.3.177.76
-50.3.195.47
  50.3.197.128
-50.3.197.53
  50.3.197.90
-50.3.203.11
-50.3.203.12
-50.3.203.13
-50.3.203.14
-50.3.203.15
-50.3.203.16
-50.3.203.18
-50.3.203.204
-50.3.203.205
-50.3.203.207
-50.3.203.208
-50.3.203.209
-50.3.203.210
-50.3.203.211
-50.3.203.212
-50.3.203.213
-50.3.203.214
-50.3.203.215
-50.3.203.216
  50.3.203.43
  50.3.203.44
  50.3.203.45
@@ -94353,24 +79327,20 @@
  50.3.203.93
  50.3.203.95
  50.3.203.96
-50.3.238.179
  50.3.238.197
-50.3.238.199
-50.3.238.201
  50.3.238.215
  50.3.74.72
-50.3.79.46
  50.3.84.161
  50.30.24.217
  50.30.37.150
-50.30.92.24
+50.30.47.30
  50.30.93.94
  50.31.10.228
-50.31.138.103
  50.31.146.37
  50.31.147.175
-50.31.26.152
  50.31.30.22
+50.31.49.101
+50.31.62.184
  50.31.63.190
  50.31.9.77
  50.31.96.11
@@ -94381,15 +79351,12 @@
  50.35.64.236
  50.39.132.235
  50.4.247.28
-50.4.38.160
  50.4.46.52
  50.4.69.112
  50.45.232.189
  50.46.218.6
  50.5.46.195
  50.5.78.127
-50.53.142.12
-50.53.239.161
  50.53.250.162
  50.56.109.107
  50.56.114.172
@@ -94401,9 +79368,6 @@
  50.57.108.76
  50.57.190.90
  50.57.191.85
-50.57.65.102
-50.57.72.4
-50.58.161.85
  50.59.162.79
  50.59.191.53
  50.59.209.166
@@ -94415,13 +79379,15 @@
  50.62.160.95
  50.62.161.140
  50.62.161.211
+50.62.168.155
  50.62.169.100
-50.62.176.140
  50.62.176.151
  50.62.176.178
  50.62.176.220
  50.62.176.236
+50.62.176.241
  50.62.176.247
+50.62.176.28
  50.62.176.36
  50.62.176.69
  50.62.176.75
@@ -94430,34 +79396,48 @@
  50.62.177.206
  50.62.177.223
  50.62.177.230
+50.62.177.24
  50.62.177.40
+50.62.177.41
  50.62.177.55
  50.62.177.91
+50.62.208.125
+50.62.208.139
+50.62.208.149
  50.62.208.155
  50.62.208.166
  50.62.208.167
+50.62.208.182
+50.62.208.200
  50.62.208.36
+50.62.208.55
  50.62.208.86
  50.62.30.5
  50.62.35.16
  50.63.12.201
  50.63.167.184
-50.63.194.14
-50.63.194.163
-50.63.194.175
+50.63.194.159
+50.63.194.47
+50.63.194.53
  50.63.196.103
  50.63.196.149
-50.63.196.18
+50.63.196.159
+50.63.196.183
  50.63.196.76
-50.63.197.25
+50.63.197.133
+50.63.197.135
+50.63.197.170
+50.63.197.173
+50.63.197.27
  50.63.197.36
  50.63.197.67
+50.63.197.68
+50.63.197.79
  50.63.197.88
-50.63.197.99
  50.63.52.157
  50.63.58.84
  50.63.92.10
-50.65.66.137
+50.63.92.12
  50.66.45.43
  50.67.234.213
  50.68.104.92
@@ -94466,27 +79446,26 @@
  50.7.138.133
  50.7.184.58
  50.7.240.10
-50.7.246.66
  50.7.71.91
  50.7.94.62
  50.70.141.143
  50.70.203.159
-50.71.150.181
  50.72.45.183
  50.73.92.26
  50.74.77.54
  50.75.168.170
-50.75.53.43
  50.75.7.82
+50.76.222.227
  50.77.133.114
  50.77.8.169
+50.78.200.149
  50.80.224.218
  50.81.111.72
  50.82.157.158
  50.82.198.7
-50.83.157.117
  50.84.12.108
  50.84.210.194
+50.87.144.103
  50.87.144.115
  50.87.144.158
  50.87.144.23
@@ -94497,21 +79476,14 @@
  50.87.38.190
  50.88.20.178
  50.88.217.109
-50.88.93.72
-50.88.97.117
  50.89.240.142
  50.90.3.116
  50.91.114.38
  50.92.104.195
-50.92.135.140
-50.92.241.85
-50.96.52.82
  50.97.138.113
  50.97.149.160
  50.98.187.238
  50.98.242.171
-50.99.143.119
-50.99.214.102
  50.99.218.122
  500-365.net
  500-plus.you24.eu
@@ -94543,67 +79515,51 @@
  51.103.136.63
  51.103.142.75
  51.103.146.87
-51.103.161.69
-51.103.31.232
  51.103.36.201
  51.103.36.217
  51.103.36.90
-51.103.53.79
-51.103.85.188
-51.104.174.140
+51.103.50.173
+51.103.74.212
  51.104.208.250
  51.104.242.17
+51.104.242.82
  51.105.5.16
-51.105.53.53
  51.107.76.178
  51.11.240.55
  51.11.39.131
  51.116.179.1
  51.116.180.53
-51.116.234.30
-51.116.235.117
-51.124.86.45
  51.13.65.199
  51.132.133.220
  51.132.52.203
  51.136.33.31
-51.136.50.73
  51.140.15.164
-51.140.184.205
  51.140.48.231
  51.140.67.211
-51.140.95.34
  51.141.0.227
-51.141.15.79
  51.141.161.253
  51.141.167.27
  51.141.79.141
-51.143.156.228
  51.143.17.220
-51.143.32.202
  51.143.41.1
  51.143.46.79
+51.144.104.42
  51.144.106.161
  51.144.116.91
  51.144.73.114
-51.144.82.206
-51.144.90.26
  51.145.208.244
  51.148.126.146
  51.148.153.60
+51.148.160.195
  51.15.1.221
  51.15.1.6
  51.15.10.158
-51.15.101.61
  51.15.106.26
-51.15.107.32
-51.15.109.207
  51.15.11.24
+51.15.111.185
  51.15.113.84
  51.15.118.15
-51.15.119.179
  51.15.124.1
-51.15.126.171
  51.15.133.6
  51.15.135.121
  51.15.136.191
@@ -94614,7 +79570,6 @@
  51.15.145.148
  51.15.147.154
  51.15.147.166
-51.15.148.90
  51.15.154.16
  51.15.154.19
  51.15.154.74
@@ -94623,12 +79578,10 @@
  51.15.162.102
  51.15.165.15
  51.15.166.138
-51.15.17.226
  51.15.17.53
  51.15.171.127
  51.15.171.192
  51.15.171.227
-51.15.171.31
  51.15.177.121
  51.15.177.162
  51.15.178.205
@@ -94640,20 +79593,20 @@
  51.15.181.38
  51.15.185.78
  51.15.186.6
-51.15.193.25
  51.15.195.248
  51.15.199.181
+51.15.201.113
+51.15.202.33
  51.15.204.155
  51.15.204.27
  51.15.205.46
-51.15.207.196
  51.15.209.130
  51.15.209.55
-51.15.21.205
  51.15.210.208
  51.15.212.200
  51.15.214.21
  51.15.214.80
+51.15.218.190
  51.15.219.140
  51.15.219.5
  51.15.220.237
@@ -94666,10 +79619,11 @@
  51.15.233.75
  51.15.234.207
  51.15.235.211
-51.15.238.26
  51.15.239.164
+51.15.241.88
  51.15.243.117
  51.15.248.110
+51.15.251.105
  51.15.254.2
  51.15.34.228
  51.15.35.252
@@ -94695,6 +79649,7 @@
  51.15.58.219
  51.15.59.15
  51.15.59.9
+51.15.6.33
  51.15.61.244
  51.15.63.229
  51.15.63.43
@@ -94704,7 +79659,6 @@
  51.15.68.210
  51.15.68.66
  51.15.7.145
-51.15.7.151
  51.15.70.13
  51.15.71.147
  51.15.71.53
@@ -94715,15 +79669,11 @@
  51.15.79.163
  51.15.80.14
  51.15.81.22
-51.15.83.55
  51.15.86.162
-51.15.86.197
  51.15.87.62
-51.15.88.191
  51.15.89.198
  51.15.90.245
  51.15.95.161
-51.15.95.252
  51.15.99.182
  51.15.99.240
  51.154.131.18
@@ -94734,8 +79684,8 @@
  51.154.46.234
  51.154.53.96
  51.154.60.34
-51.154.61.78
  51.158.100.79
+51.158.101.115
  51.158.105.98
  51.158.107.168
  51.158.108.135
@@ -94743,23 +79693,19 @@
  51.158.111.168
  51.158.111.229
  51.158.111.242
-51.158.112.139
  51.158.112.98
  51.158.115.105
  51.158.120.84
  51.158.123.35
  51.158.124.238
-51.158.124.242
+51.158.127.6
  51.158.147.13
  51.158.153.18
  51.158.160.2
  51.158.162.242
-51.158.163.140
  51.158.171.117
-51.158.173.39
  51.158.175.21
-51.158.177.212
-51.158.183.187
+51.158.179.244
  51.158.184.190
  51.158.185.32
  51.158.189.0
@@ -94768,10 +79714,7 @@
  51.158.20.200
  51.158.28.129
  51.158.29.101
-51.158.29.191
-51.158.31.190
  51.158.64.175
-51.158.65.150
  51.158.66.95
  51.158.67.190
  51.158.68.133
@@ -94779,41 +79722,31 @@
  51.158.68.68
  51.158.70.82
  51.158.72.182
+51.158.76.17
+51.158.77.121
  51.158.98.121
  51.158.99.51
  51.159.0.145
  51.159.1.213
-51.159.130.28
+51.159.129.22
+51.159.142.77
+51.159.145.38
+51.159.163.221
  51.159.169.74
-51.159.19.143
-51.159.24.172
  51.159.28.62
  51.159.30.99
  51.159.56.35
-51.159.59.23
-51.159.67.165
-51.159.7.107
-51.159.7.122
-51.159.78.172
-51.159.89.94
-51.159.93.160
  51.159.93.80
  51.159.94.210
-51.159.95.8
  51.161.116.175
  51.161.118.180
-51.161.119.98
-51.161.12.231
  51.161.19.242
  51.161.32.211
-51.161.34.69
  51.161.36.145
  51.161.43.235
  51.161.45.174
  51.161.52.46
-51.161.52.56
  51.161.57.117
-51.161.57.15
  51.161.57.155
  51.161.62.153
  51.161.68.186
@@ -94822,25 +79755,19 @@
  51.161.84.86
  51.161.9.155
  51.161.98.215
-51.171.246.148
+51.171.216.194
  51.174.100.89
-51.174.172.148
-51.174.207.190
  51.174.28.217
  51.174.76.107
  51.175.126.46
  51.175.47.205
-51.175.64.95
-51.175.84.243
  51.178.128.54
  51.178.136.52
  51.178.137.106
  51.178.138.1
  51.178.142.175
+51.178.142.55
  51.178.143.70
-51.178.144.91
-51.178.156.248
-51.178.161.143
  51.178.17.63
  51.178.182.104
  51.178.182.70
@@ -94863,6 +79790,7 @@
  51.178.43.9
  51.178.45.204
  51.178.47.46
+51.178.47.65
  51.178.50.174
  51.178.50.20
  51.178.51.152
@@ -94882,9 +79810,6 @@
  51.178.86.97
  51.178.87.42
  51.178.9.100
-51.182.101.43
-51.182.82.148
-51.183.87.86
  51.195.10.2
  51.195.10.26
  51.195.10.28
@@ -94899,11 +79824,11 @@
  51.195.149.88
  51.195.166.160
  51.195.166.161
+51.195.188.98
  51.195.200.181
  51.195.200.198
  51.195.200.253
  51.195.202.145
-51.195.203.247
  51.195.4.41
  51.195.40.43
  51.195.42.226
@@ -94915,16 +79840,11 @@
  51.195.53.6
  51.195.55.114
  51.195.6.99
-51.195.62.87
+51.195.62.41
  51.195.88.92
-51.195.88.93
-51.195.91.161
  51.195.91.168
-51.198.120.90
-51.210.102.82
  51.210.103.96
  51.210.105.39
-51.210.106.68
  51.210.107.15
  51.210.107.217
  51.210.109.104
@@ -94935,21 +79855,17 @@
  51.210.111.212
  51.210.111.223
  51.210.13.215
-51.210.139.3
  51.210.14.124
  51.210.148.31
  51.210.15.107
  51.210.151.13
  51.210.151.134
-51.210.154.190
  51.210.159.130
  51.210.179.130
  51.210.179.20
  51.210.182.187
-51.210.183.86
  51.210.183.93
  51.210.190.104
-51.210.239.217
  51.210.240.92
  51.210.242.100
  51.210.242.101
@@ -94978,7 +79894,6 @@
  51.210.242.200
  51.210.242.208
  51.210.242.212
-51.210.242.213
  51.210.242.216
  51.210.242.242
  51.210.242.244
@@ -94999,12 +79914,12 @@
  51.210.246.131
  51.210.246.58
  51.210.247.67
-51.210.254.25
  51.210.28.195
  51.210.34.150
  51.210.34.62
  51.210.40.91
  51.210.42.196
+51.210.45.112
  51.210.5.171
  51.210.61.169
  51.210.80.127
@@ -95021,29 +79936,22 @@
  51.222.14.78
  51.222.15.75
  51.222.19.123
-51.222.19.44
-51.222.22.213
  51.222.25.161
  51.222.25.197
  51.222.26.176
  51.222.26.189
  51.222.26.229
  51.222.29.39
-51.222.31.236
  51.222.56.152
-51.222.71.16
-51.222.8.122
  51.222.9.153
-51.222.9.223
  51.222.9.32
  51.223.171.193
  51.254.100.220
-51.254.100.56
  51.254.101.227
  51.254.102.19
  51.254.113.107
+51.254.113.145
  51.254.114.105
-51.254.114.46
  51.254.117.33
  51.254.118.224
  51.254.120.159
@@ -95067,6 +79975,7 @@
  51.254.143.24
  51.254.156.114
  51.254.157.144
+51.254.157.21
  51.254.164.244
  51.254.164.248
  51.254.167.223
@@ -95076,6 +79985,7 @@
  51.254.182.63
  51.254.199.134
  51.254.203.205
+51.254.204.117
  51.254.205.6
  51.254.207.92
  51.254.210.100
@@ -95100,31 +80010,12 @@
  51.254.37.156
  51.254.37.192
  51.254.37.237
-51.254.4.226
  51.254.44.148
  51.254.47.198
  51.254.47.231
  51.254.48.93
-51.254.49.100
-51.254.49.101
-51.254.49.102
-51.254.49.103
-51.254.49.104
-51.254.49.105
-51.254.49.106
-51.254.49.107
-51.254.49.108
-51.254.49.109
-51.254.49.110
-51.254.49.111
-51.254.49.96
-51.254.49.97
-51.254.49.98
-51.254.49.99
  51.254.63.223
  51.254.71.120
-51.254.75.176
-51.254.75.188
  51.254.83.239
  51.254.83.80
  51.254.93.76
@@ -95132,28 +80023,11 @@
  51.254.97.23
  51.254.99.229
  51.255.101.157
-51.255.106.231
-51.255.109.160
-51.255.109.161
-51.255.109.162
-51.255.109.163
-51.255.109.164
-51.255.109.165
-51.255.109.166
-51.255.109.167
-51.255.109.168
-51.255.109.169
-51.255.109.170
-51.255.109.171
-51.255.109.172
-51.255.109.173
-51.255.109.174
-51.255.109.175
-51.255.142.69
  51.255.149.249
  51.255.149.50
  51.255.161.222
  51.255.163.60
+51.255.164.109
  51.255.164.193
  51.255.165.160
  51.255.167.128
@@ -95176,12 +80050,10 @@
  51.255.207.29
  51.255.207.3
  51.255.233.146
-51.255.233.149
-51.255.28.53
-51.255.32.128
  51.255.35.41
  51.255.36.85
  51.255.36.88
+51.255.40.172
  51.255.42.170
  51.255.42.173
  51.255.45.144
@@ -95199,7 +80071,8 @@
  51.255.85.26
  51.255.87.121
  51.255.95.26
-51.37.2.123
+51.255.95.82
+51.37.187.52
  51.38.101.119
  51.38.103.163
  51.38.103.199
@@ -95207,11 +80080,11 @@
  51.38.125.235
  51.38.126.75
  51.38.127.227
+51.38.128.30
  51.38.129.120
  51.38.129.49
  51.38.129.83
  51.38.130.242
-51.38.131.234
  51.38.134.203
  51.38.135.159
  51.38.140.12
@@ -95222,23 +80095,22 @@
  51.38.179.113
  51.38.185.101
  51.38.186.53
+51.38.187.198
  51.38.187.226
  51.38.187.74
  51.38.188.101
  51.38.188.63
-51.38.189.20
-51.38.190.242
  51.38.191.126
  51.38.214.71
  51.38.226.94
  51.38.227.167
+51.38.231.81
  51.38.233.93
  51.38.237.230
  51.38.238.165
  51.38.238.205
  51.38.244.38
  51.38.32.230
-51.38.35.139
  51.38.35.229
  51.38.37.254
  51.38.40.76
@@ -95274,25 +80146,26 @@
  51.38.83.96
  51.38.93.189
  51.38.93.190
+51.38.95.10
  51.39.189.65
+51.4.147.32
  51.5.147.178
  51.52.235.215
  51.6.146.148
  51.6.164.145
-51.68.11.195
  51.68.11.211
  51.68.11.231
  51.68.121.235
  51.68.122.147
  51.68.122.155
  51.68.123.192
-51.68.140.243
+51.68.137.174
  51.68.141.101
  51.68.141.240
  51.68.143.201
  51.68.143.212
-51.68.149.147
  51.68.149.159
+51.68.149.166
  51.68.149.169
  51.68.149.181
  51.68.152.18
@@ -95330,20 +80203,19 @@
  51.68.33.31
  51.68.36.57
  51.68.44.13
-51.68.44.143
  51.68.44.154
+51.68.5.179
  51.68.61.17
-51.68.71.178
  51.68.71.187
  51.68.71.239
  51.68.85.93
  51.68.86.247
  51.68.88.26
-51.68.89.100
  51.68.90.171
  51.68.90.244
  51.68.91.191
  51.68.93.212
+51.68.93.89
  51.68.94.206
  51.68.97.209
  51.75.103.216
@@ -95353,6 +80225,7 @@
  51.75.129.231
  51.75.131.235
  51.75.140.153
+51.75.141.135
  51.75.142.24
  51.75.143.67
  51.75.144.43
@@ -95372,7 +80245,6 @@
  51.75.169.151
  51.75.17.122
  51.75.170.50
-51.75.173.232
  51.75.18.212
  51.75.18.215
  51.75.188.112
@@ -95388,7 +80260,6 @@
  51.75.23.214
  51.75.233.37
  51.75.24.200
-51.75.240.147
  51.75.240.227
  51.75.242.135
  51.75.246.176
@@ -95399,9 +80270,9 @@
  51.75.28.25
  51.75.33.122
  51.75.33.127
+51.75.39.125
  51.75.5.52
  51.75.52.118
-51.75.52.127
  51.75.53.141
  51.75.53.167
  51.75.55.212
@@ -95411,16 +80282,14 @@
  51.75.66.142
  51.75.66.92
  51.75.69.184
-51.75.69.90
  51.75.71.111
-51.75.86.211
  51.75.90.164
  51.75.92.67
+51.75.98.35
  51.77.103.164
  51.77.108.33
  51.77.109.98
  51.77.112.168
-51.77.119.42
  51.77.135.89
  51.77.137.211
  51.77.140.110
@@ -95443,13 +80312,11 @@
  51.77.152.20
  51.77.152.209
  51.77.163.186
-51.77.168.11
  51.77.193.204
  51.77.193.245
  51.77.194.232
  51.77.200.101
  51.77.200.139
-51.77.201.240
  51.77.201.36
  51.77.201.87
  51.77.202.151
@@ -95490,22 +80357,22 @@
  51.77.78.0
  51.77.94.244
  51.77.95.120
-51.77.98.150
  51.79.111.220
  51.79.130.84
  51.79.140.161
  51.79.141.100
+51.79.141.228
  51.79.142.57
-51.79.144.234
  51.79.146.10
  51.79.147.177
-51.79.153.197
  51.79.157.254
  51.79.158.206
  51.79.159.176
  51.79.159.229
  51.79.160.193
-51.79.171.203
+51.79.161.86
+51.79.162.140
+51.79.165.107
  51.79.176.204
  51.79.176.221
  51.79.197.112
@@ -95515,14 +80382,12 @@
  51.79.44.52
  51.79.46.0
  51.79.49.178
-51.79.50.142
  51.79.53.134
  51.79.53.139
  51.79.53.145
  51.79.53.146
  51.79.55.141
  51.79.60.149
-51.79.60.165
  51.79.65.236
  51.79.66.198
  51.79.67.77
@@ -95545,12 +80410,10 @@
  51.81.0.103
  51.81.118.2
  51.81.122.148
-51.81.122.150
-51.81.133.133
  51.81.133.218
  51.81.152.33
  51.81.155.35
-51.81.161.246
+51.81.161.250
  51.81.18.91
  51.81.226.60
  51.81.28.244
@@ -95562,7 +80425,7 @@
  51.81.31.172
  51.81.31.61
  51.81.31.62
-51.81.31.65
+51.81.31.64
  51.81.31.66
  51.81.33.194
  51.81.34.189
@@ -95570,7 +80433,6 @@
  51.81.40.0
  51.81.43.50
  51.81.46.170
-51.81.53.171
  51.81.56.15
  51.81.56.49
  51.81.6.160
@@ -95602,27 +80464,27 @@
  51.83.131.42
  51.83.132.153
  51.83.132.19
-51.83.132.71
  51.83.134.17
  51.83.134.233
  51.83.135.163
  51.83.135.200
  51.83.136.109
+51.83.171.1
  51.83.171.11
-51.83.171.12
-51.83.171.14
  51.83.171.25
-51.83.174.126
  51.83.180.147
  51.83.180.203
  51.83.180.241
  51.83.185.192
-51.83.186.93
  51.83.187.201
+51.83.187.52
  51.83.189.0
  51.83.191.213
  51.83.191.214
  51.83.191.222
+51.83.191.223
+51.83.191.225
+51.83.191.226
  51.83.200.164
  51.83.200.176
  51.83.200.179
@@ -95634,12 +80496,10 @@
  51.83.33.156
  51.83.33.202
  51.83.33.88
-51.83.35.139
  51.83.40.227
  51.83.41.120
  51.83.41.129
  51.83.42.108
-51.83.42.66
  51.83.45.246
  51.83.45.65
  51.83.67.9
@@ -95653,7 +80513,6 @@
  51.83.97.44
  51.83.98.104
  51.83.99.227
-51.89.1.122
  51.89.100.108
  51.89.103.161
  51.89.107.21
@@ -95675,7 +80534,7 @@
  51.89.165.197
  51.89.165.90
  51.89.166.108
-51.89.179.224
+51.89.173.199
  51.89.187.170
  51.89.195.68
  51.89.201.9
@@ -95692,8 +80551,10 @@
  51.89.235.94
  51.89.25.72
  51.89.36.180
+51.89.4.140
  51.89.40.32
  51.89.62.241
+51.89.73.150
  51.89.76.220
  51.89.90.5
  51.91.10.114
@@ -95725,24 +80586,22 @@
  51.91.159.46
  51.91.185.74
  51.91.189.201
-51.91.197.15
  51.91.197.151
  51.91.204.85
  51.91.212.159
  51.91.229.147
  51.91.229.20
  51.91.248.152
-51.91.248.196
  51.91.249.178
  51.91.250.197
  51.91.250.49
-51.91.251.4
  51.91.255.147
+51.91.48.22
  51.91.56.133
+51.91.58.14
  51.91.62.130
  51.91.66.179
  51.91.66.183
-51.91.67.153
  51.91.68.164
  51.91.76.214
  51.91.76.3
@@ -95759,6 +80618,7 @@
  51.91.96.177
  51.91.98.249
  51.91.98.31
+51.91.99.233
  51.fi
  510-365.net
  510365365.com
@@ -95835,21 +80695,18 @@
  52.11.74.157
  52.11.87.3
  52.116.197.83
-52.116.21.156
  52.117.124.2
  52.117.93.182
+52.12.25.207
  52.12.94.219
  52.128.240.42
  52.128.56.98
+52.128.60.254
  52.129.47.88
  52.13.22.56
-52.130.75.32
+52.130.78.186
  52.130.79.154
-52.130.85.229
  52.130.85.31
-52.130.89.37
-52.130.91.56
-52.136.120.121
  52.138.0.111
  52.138.20.234
  52.139.193.220
@@ -95875,6 +80732,7 @@
  52.14.249.14
  52.14.39.185
  52.14.53.142
+52.14.73.246
  52.14.78.244
  52.14.87.72
  52.140.103.80
@@ -95886,18 +80744,14 @@
  52.142.25.231
  52.143.64.116
  52.144.114.197
+52.144.33.254
  52.144.70.194
  52.144.89.31
-52.146.13.131
  52.146.42.228
  52.146.46.244
  52.146.88.89
-52.147.166.246
-52.147.207.103
-52.148.155.190
  52.149.152.236
  52.149.180.228
-52.149.212.227
  52.15.103.61
  52.15.105.94
  52.15.111.162
@@ -95912,7 +80766,6 @@
  52.15.212.3
  52.15.215.225
  52.15.229.145
-52.15.241.41
  52.15.51.23
  52.15.65.61
  52.15.69.67
@@ -95930,8 +80783,6 @@
  52.156.78.167
  52.156.8.150
  52.157.151.24
-52.157.154.150
-52.157.219.51
  52.158.237.191
  52.16.130.54
  52.16.142.222
@@ -95940,27 +80791,24 @@
  52.16.198.150
  52.16.228.212
  52.16.230.146
-52.160.126.89
  52.161.12.190
  52.161.13.30
-52.161.20.135
  52.161.29.204
  52.161.92.66
+52.162.193.79
  52.162.206.182
  52.162.207.183
-52.162.249.219
-52.162.252.164
  52.162.254.120
  52.162.3.205
  52.162.34.184
-52.162.48.32
-52.162.51.15
  52.163.121.255
  52.163.127.48
  52.163.243.190
  52.163.53.174
  52.163.63.49
+52.163.90.151
  52.164.124.121
+52.164.203.22
  52.164.206.216
  52.164.209.35
  52.165.152.75
@@ -95974,8 +80822,6 @@
  52.167.12.183
  52.167.154.234
  52.167.156.52
-52.167.52.250
-52.167.53.243
  52.168.11.129
  52.168.122.218
  52.168.123.12
@@ -96018,23 +80864,17 @@
  52.170.72.140
  52.171.198.169
  52.171.211.43
-52.172.157.44
-52.172.159.131
  52.172.165.176
  52.172.46.238
-52.172.49.158
  52.173.143.59
  52.173.37.67
  52.173.74.94
-52.174.125.0
  52.174.162.66
-52.174.186.220
  52.174.236.181
  52.175.150.108
  52.175.201.251
  52.175.214.30
  52.175.217.141
-52.175.222.232
  52.175.223.122
  52.175.239.154
  52.175.245.207
@@ -96044,14 +80884,10 @@
  52.176.5.136
  52.176.90.129
  52.176.93.77
-52.176.94.86
  52.177.173.19
  52.177.187.62
-52.177.63.152
  52.178.166.4
  52.178.74.26
-52.179.117.250
-52.179.193.88
  52.179.208.169
  52.179.7.104
  52.18.100.70
@@ -96075,7 +80911,6 @@
  52.18.96.122
  52.183.121.151
  52.183.2.76
-52.183.27.125
  52.183.29.122
  52.183.32.246
  52.183.36.137
@@ -96087,23 +80922,18 @@
  52.185.205.1
  52.186.11.118
  52.186.13.110
-52.186.80.191
-52.186.84.111
  52.187.117.17
  52.187.130.77
  52.187.51.135
  52.187.56.107
  52.188.0.112
  52.188.113.116
+52.188.12.188
  52.188.121.92
-52.188.122.64
-52.188.14.45
  52.188.147.170
  52.188.153.36
  52.188.172.62
  52.188.175.62
-52.188.214.162
-52.188.54.163
  52.188.68.29
  52.188.69.174
  52.188.9.234
@@ -96142,6 +80972,7 @@
  52.197.191.92
  52.197.219.51
  52.198.215.35
+52.198.233.117
  52.199.105.160
  52.199.122.169
  52.199.147.232
@@ -96169,12 +81000,10 @@
  52.202.78.94
  52.202.79.158
  52.202.95.190
-52.203.117.144
  52.203.187.145
  52.204.182.74
  52.204.223.11
  52.205.106.150
-52.205.180.248
  52.205.206.62
  52.205.213.232
  52.205.226.111
@@ -96193,7 +81022,6 @@
  52.207.175.64
  52.207.210.41
  52.207.215.127
-52.207.217.145
  52.207.244.140
  52.207.249.12
  52.207.90.161
@@ -96236,6 +81064,7 @@
  52.212.133.210
  52.212.173.47
  52.212.190.46
+52.212.204.146
  52.212.251.179
  52.212.37.9
  52.212.67.94
@@ -96261,6 +81090,7 @@
  52.217.100.30
  52.217.4.38
  52.220.26.62
+52.221.107.193
  52.221.178.246
  52.221.182.149
  52.221.182.253
@@ -96273,6 +81103,7 @@
  52.221.203.250
  52.221.207.95
  52.221.217.53
+52.221.219.39
  52.221.220.84
  52.221.235.57
  52.221.237.237
@@ -96291,32 +81122,26 @@
  52.224.126.72
  52.224.164.31
  52.224.176.178
-52.224.28.255
  52.224.66.246
-52.228.64.198
-52.228.64.71
  52.229.159.234
  52.229.206.131
  52.229.52.83
  52.23.132.187
  52.23.165.240
  52.23.170.11
-52.23.222.157
  52.23.226.138
  52.23.237.5
  52.23.241.214
  52.23.242.161
-52.23.244.89
  52.23.245.243
  52.23.252.19
-52.230.16.127
  52.230.3.147
  52.231.15.155
  52.231.155.199
  52.231.167.166
-52.231.202.10
  52.231.33.90
  52.231.55.164
+52.231.73.247
  52.231.77.116
  52.231.92.23
  52.232.246.85
@@ -96327,7 +81152,6 @@
  52.236.32.160
  52.237.118.225
  52.237.166.210
-52.237.174.185
  52.24.21.90
  52.24.215.24
  52.24.239.236
@@ -96343,7 +81167,6 @@
  52.243.103.160
  52.246.178.21
  52.247.113.177
-52.247.124.192
  52.247.194.12
  52.247.203.36
  52.249.250.232
@@ -96358,7 +81181,6 @@
  52.25.237.167
  52.25.41.202
  52.25.81.249
-52.250.1.219
  52.250.15.227
  52.250.19.179
  52.250.50.246
@@ -96366,14 +81188,11 @@
  52.251.89.82
  52.252.0.233
  52.252.118.108
-52.252.145.66
-52.252.225.101
  52.252.7.14
  52.255.143.183
  52.255.147.248
  52.255.167.164
  52.255.199.24
-52.255.228.188
  52.255.238.86
  52.26.103.22
  52.26.168.183
@@ -96414,6 +81233,7 @@
  52.29.51.234
  52.29.86.104
  52.3.127.144
+52.3.14.50
  52.3.146.92
  52.3.177.50
  52.3.186.199
@@ -96467,7 +81287,6 @@
  52.33.207.80
  52.33.250.48
  52.33.255.97
-52.33.43.238
  52.33.97.72
  52.34.119.26
  52.34.13.150
@@ -96542,7 +81361,6 @@
  52.4.132.157
  52.4.208.102
  52.4.226.95
-52.4.237.96
  52.40.182.0
  52.40.227.98
  52.40.44.255
@@ -96564,6 +81382,7 @@
  52.42.219.234
  52.42.28.91
  52.42.40.31
+52.42.48.107
  52.42.55.24
  52.42.92.88
  52.42.99.187
@@ -96630,7 +81449,6 @@
  52.52.247.240
  52.52.26.74
  52.53.117.56
-52.53.163.100
  52.53.163.129
  52.53.165.23
  52.53.170.163
@@ -96718,6 +81536,7 @@
  52.59.87.74
  52.6.203.80
  52.6.92.255
+52.60.122.59
  52.60.132.247
  52.60.133.166
  52.60.179.9
@@ -96753,9 +81572,8 @@
  52.64.208.82
  52.65.123.63
  52.66.115.236
-52.66.15.137
+52.66.120.148
  52.66.175.182
-52.66.211.243
  52.67.135.8
  52.67.18.175
  52.67.242.2
@@ -96770,7 +81588,6 @@
  52.70.119.124
  52.70.129.232
  52.70.144.244
-52.70.236.157
  52.71.151.231
  52.71.155.178
  52.71.180.141
@@ -96778,7 +81595,6 @@
  52.72.143.118
  52.72.156.74
  52.73.119.192
-52.73.169.169
  52.73.45.110
  52.74.126.15
  52.74.156.128
@@ -96796,7 +81612,7 @@
  52.77.232.238
  52.77.233.168
  52.77.243.47
-52.78.107.210
+52.77.246.125
  52.78.139.36
  52.78.16.216
  52.78.163.216
@@ -96824,11 +81640,11 @@
  52.80.223.199
  52.80.245.201
  52.80.58.248
-52.82.31.161
  52.82.43.234
  52.83.142.85
  52.83.24.149
  52.83.65.53
+52.84.150.39
  52.86.11.253
  52.86.176.3
  52.87.117.72
@@ -96882,7 +81698,6 @@
  52.9.71.221
  52.90.100.167
  52.90.106.50
-52.90.202.39
  52.90.212.201
  52.90.231.255
  52.90.43.54
@@ -96900,9 +81715,9 @@
  52.91.31.242
  52.91.35.205
  52.91.57.181
-52.91.67.104
  52.91.80.70
  52.91.85.21
+52.91.99.242
  520023.trylightsale.ru
  520ktatami.com
  52112.wang
@@ -96968,9 +81783,7 @@
  54.145.157.200
  54.145.157.95
  54.145.170.41
-54.145.173.249
  54.145.20.246
-54.145.209.104
  54.145.218.247
  54.145.224.151
  54.146.0.132
@@ -96980,7 +81793,6 @@
  54.146.184.127
  54.146.242.46
  54.147.125.224
-54.147.140.250
  54.147.175.198
  54.147.18.154
  54.147.196.40
@@ -97014,7 +81826,6 @@
  54.149.72.167
  54.149.77.6
  54.149.85.173
-54.151.239.109
  54.152.103.104
  54.152.118.146
  54.152.153.114
@@ -97030,7 +81841,6 @@
  54.153.117.15
  54.153.120.224
  54.153.214.107
-54.153.22.9
  54.153.5.104
  54.153.94.156
  54.154.104.217
@@ -97045,17 +81855,13 @@
  54.157.150.160
  54.157.165.130
  54.157.165.4
-54.157.223.40
  54.157.236.185
  54.158.135.177
  54.158.145.45
  54.158.153.252
  54.158.222.214
-54.158.228.57
  54.158.237.114
  54.158.248.31
-54.158.252.216
-54.158.45.187
  54.158.52.132
  54.158.66.197
  54.158.70.15
@@ -97067,7 +81873,6 @@
  54.159.197.103
  54.159.216.68
  54.159.221.201
-54.159.237.129
  54.159.24.235
  54.160.137.46
  54.160.181.152
@@ -97077,7 +81882,6 @@
  54.161.173.61
  54.161.208.96
  54.161.243.127
-54.161.3.78
  54.161.67.194
  54.161.79.141
  54.162.108.115
@@ -97104,21 +81908,18 @@
  54.164.59.149
  54.164.74.19
  54.164.92.255
-54.165.155.181
  54.165.194.150
  54.165.194.22
  54.165.78.72
  54.165.81.162
  54.165.89.112
  54.165.99.78
-54.166.150.237
  54.166.17.133
  54.166.241.147
  54.166.49.162
  54.166.54.31
  54.166.71.60
  54.166.99.138
-54.167.226.168
  54.167.232.37
  54.167.249.28
  54.167.63.63
@@ -97147,7 +81948,6 @@
  54.171.61.6
  54.172.111.119
  54.172.112.27
-54.172.123.183
  54.172.137.215
  54.172.147.231
  54.172.17.60
@@ -97156,11 +81956,9 @@
  54.172.237.19
  54.172.243.9
  54.172.254.116
-54.172.255.87
  54.172.36.148
  54.172.38.151
  54.172.42.32
-54.172.53.228
  54.172.73.234
  54.172.78.140
  54.172.9.36
@@ -97193,7 +81991,6 @@
  54.175.130.245
  54.175.147.89
  54.175.148.135
-54.175.151.236
  54.175.199.188
  54.175.230.166
  54.175.242.98
@@ -97204,7 +82001,6 @@
  54.176.141.169
  54.176.18.9
  54.176.236.95
-54.177.125.83
  54.177.177.232
  54.178.155.230
  54.178.157.112
@@ -97215,7 +82011,7 @@
  54.180.137.207
  54.180.143.88
  54.180.146.55
-54.180.89.8
+54.180.153.211
  54.183.113.171
  54.183.120.61
  54.183.120.75
@@ -97231,11 +82027,9 @@
  54.183.188.22
  54.183.200.90
  54.183.206.25
-54.183.231.140
  54.183.250.50
  54.183.31.190
  54.183.99.239
-54.184.168.177
  54.184.174.227
  54.184.179.234
  54.184.22.217
@@ -97324,15 +82118,12 @@
  54.197.80.63
  54.197.83.119
  54.197.85.196
-54.198.113.82
+54.197.95.226
  54.198.122.109
  54.198.128.15
  54.198.19.34
-54.198.217.192
  54.198.231.227
-54.198.255.126
  54.198.32.146
-54.198.9.0
  54.198.95.193
  54.199.164.163
  54.199.173.66
@@ -97347,7 +82138,6 @@
  54.200.57.144
  54.200.66.62
  54.200.67.159
-54.200.77.208
  54.201.1.223
  54.201.121.208
  54.201.135.215
@@ -97402,7 +82192,6 @@
  54.205.184.74
  54.205.203.140
  54.205.24.230
-54.205.244.248
  54.205.4.133
  54.205.57.98
  54.206.217.88
@@ -97417,10 +82206,8 @@
  54.209.153.58
  54.209.164.251
  54.209.166.21
-54.209.231.49
  54.209.232.78
  54.209.235.55
-54.209.248.248
  54.209.34.199
  54.210.131.132
  54.210.162.76
@@ -97433,7 +82220,6 @@
  54.211.2.83
  54.211.30.171
  54.211.68.47
-54.211.75.192
  54.212.157.49
  54.212.194.137
  54.212.216.69
@@ -97488,31 +82274,28 @@
  54.218.54.73
  54.218.64.5
  54.218.66.116
-54.219.12.220
  54.219.133.177
  54.219.145.18
  54.219.161.245
  54.219.179.109
  54.219.185.231
  54.219.186.167
-54.219.196.112
+54.219.188.174
  54.219.49.219
  54.219.97.9
  54.220.131.143
  54.221.1.109
  54.221.124.177
  54.221.194.49
-54.221.214.249
  54.221.217.16
  54.221.26.246
  54.221.27.148
  54.221.84.53
  54.222.161.1
  54.222.181.198
-54.223.61.142
+54.223.64.146
  54.224.128.129
  54.224.130.89
-54.224.161.40
  54.224.206.20
  54.224.38.115
  54.224.95.8
@@ -97554,6 +82337,7 @@
  54.234.255.239
  54.234.38.217
  54.234.63.235
+54.235.163.229
  54.235.20.153
  54.235.232.110
  54.235.237.165
@@ -97623,7 +82407,6 @@
  54.245.180.77
  54.245.223.205
  54.245.37.134
-54.245.45.246
  54.245.49.155
  54.245.51.27
  54.245.55.114
@@ -97672,7 +82455,6 @@
  54.36.117.1
  54.36.120.120
  54.36.148.122
-54.36.148.146
  54.36.148.73
  54.36.153.59
  54.36.165.239
@@ -97687,26 +82469,24 @@
  54.36.203.239
  54.36.205.105
  54.36.232.247
+54.36.239.207
  54.36.241.186
  54.36.243.6
+54.36.246.232
  54.36.4.19
  54.36.42.250
  54.36.61.64
  54.36.62.114
-54.36.81.23
  54.36.81.31
  54.37.11.58
-54.37.124.0
  54.37.131.204
  54.37.141.106
  54.37.143.192
-54.37.150.194
  54.37.156.188
  54.37.159.12
  54.37.16.241
  54.37.17.21
  54.37.180.130
-54.37.19.104
  54.37.19.108
  54.37.19.149
  54.37.19.60
@@ -97725,7 +82505,6 @@
  54.37.224.163
  54.37.232.115
  54.37.235.183
-54.37.253.161
  54.37.253.178
  54.37.42.48
  54.37.64.149
@@ -97755,7 +82534,6 @@
  54.38.143.246
  54.38.156.28
  54.38.156.63
-54.38.157.192
  54.38.158.224
  54.38.177.175
  54.38.177.230
@@ -97768,7 +82546,6 @@
  54.38.185.90
  54.38.186.173
  54.38.186.60
-54.38.186.84
  54.38.188.231
  54.38.190.109
  54.38.190.187
@@ -97788,7 +82565,6 @@
  54.38.253.1
  54.38.33.178
  54.38.36.210
-54.38.4.8
  54.38.52.137
  54.38.53.251
  54.38.55.136
@@ -97804,38 +82580,23 @@
  54.38.94.63
  54.39.117.123
  54.39.133.203
-54.39.145.123
  54.39.156.171
  54.39.16.153
  54.39.16.73
-54.39.161.171
  54.39.172.233
  54.39.2.124
-54.39.215.32
-54.39.215.38
  54.39.22.116
  54.39.22.135
  54.39.22.191
  54.39.228.109
-54.39.233.81
-54.39.237.149
-54.39.237.152
-54.39.237.154
-54.39.237.155
-54.39.237.156
-54.39.237.157
-54.39.237.159
  54.39.243.49
  54.39.50.172
  54.39.50.204
  54.39.50.28
  54.39.66.201
-54.39.68.254
-54.39.72.83
  54.39.94.188
  54.39.98.233
  54.64.103.190
-54.64.242.2
  54.65.174.245
  54.65.195.120
  54.65.201.164
@@ -97866,8 +82627,8 @@
  54.71.18.178
  54.71.249.201
  54.71.43.135
-54.71.71.3
  54.72.153.184
+54.72.217.183
  54.72.249.230
  54.72.52.83
  54.75.68.0
@@ -97882,31 +82643,24 @@
  54.77.210.148
  54.77.216.217
  54.77.40.88
+54.78.51.110
  54.79.77.88
  54.79.89.2
  54.80.166.26
  54.80.185.214
-54.80.41.131
  54.80.44.9
  54.80.47.186
  54.80.55.31
  54.80.63.76
-54.81.104.194
-54.81.113.244
-54.81.163.11
-54.81.213.161
  54.81.223.190
  54.81.58.144
  54.82.185.0
-54.82.194.154
-54.82.219.98
  54.82.227.198
  54.82.229.41
  54.82.237.124
  54.83.140.45
  54.83.149.13
  54.83.207.248
-54.84.126.238
  54.84.134.79
  54.84.146.120
  54.84.175.38
@@ -97916,7 +82670,6 @@
  54.84.236.0
  54.84.241.220
  54.84.244.69
-54.84.252.231
  54.84.27.169
  54.84.29.118
  54.84.42.40
@@ -97924,22 +82677,17 @@
  54.84.74.81
  54.85.138.145
  54.85.141.111
-54.85.201.89
  54.85.67.8
  54.85.9.155
  54.86.10.136
  54.86.102.107
  54.86.168.193
-54.86.185.82
  54.86.200.191
  54.86.41.232
  54.87.139.109
  54.87.176.205
  54.87.177.220
-54.87.184.128
-54.87.247.226
  54.87.250.249
-54.87.66.192
  54.87.80.90
  54.87.90.203
  54.88.147.198
@@ -97955,8 +82703,6 @@
  54.89.225.128
  54.89.248.173
  54.89.252.81
-54.89.43.19
-54.89.46.30
  54.89.49.59
  54.89.52.5
  54.89.53.52
@@ -97966,7 +82712,6 @@
  54.90.168.47
  54.90.17.114
  54.90.173.1
-54.90.175.105
  54.90.198.18
  54.91.0.172
  54.91.154.177
@@ -97976,10 +82721,8 @@
  54.92.130.254
  54.92.14.235
  54.92.183.82
-54.92.187.253
  54.92.45.19
  54.92.80.57
-54.93.113.97
  54.93.126.184
  54.93.170.205
  54.93.180.92
@@ -97997,7 +82740,6 @@
  54.95.0.160
  54.95.190.219
  54.95.235.69
-54.95.243.240
  54.95.39.208
  5401546.synergyglobal.one
  541f1.xyz
@@ -98060,13 +82802,11 @@
  5689.nl
  56ace.website
  56q.ru
-57.66.56.211
  5700cf64234e71c0dbb53b5ca6b50802-dot-dbenitonline.ey.r.appspot.com
  5731773-dot-oaao-274308.uc.r.appspot.com
  5740389-dot-n-e-w-me-ss-age-po-rt-al.wl.r.appspot.com
  574hx1gb.info
  574ytw.unaux.com
-57576.wang
  5759fd9c2fc7.ngrok.io
  57667.wang
  576922384.snapchatprime.com
@@ -98075,45 +82815,25 @@
  57d3e30e.duckdns.org
  57vd9.app.link
  58.0.70.14
-58.106.192.133
-58.106.192.17
-58.106.192.170
-58.106.192.172
+58.1.242.115
+58.106.192.164
  58.106.192.39
-58.108.233.121
-58.108.249.145
  58.11.189.22
  58.11.57.98
-58.114.246.150
-58.114.246.240
-58.118.177.13
-58.118.207.38
-58.118.39.228
-58.119.1.202
-58.119.172.10
-58.119.2.18
-58.119.3.58
-58.119.4.58
  58.120.227.139
  58.120.27.153
  58.120.36.66
  58.120.80.234
-58.122.119.36
-58.122.222.190
  58.124.169.148
-58.124.248.233
  58.125.215.114
  58.126.223.166
  58.127.186.231
  58.130.120.224
-58.131.104.7
-58.137.160.183
-58.137.160.66
  58.140.67.144
  58.141.122.109
  58.141.144.18
  58.141.144.18bin.sh
-58.141.232.44
+58.142.103.185
  58.142.200.124
  58.142.200.124bin.sh
  58.142.231.188
@@ -98123,7 +82843,6 @@
  58.143.189.75
  58.143.198.47
  58.143.198.47bin.sh
-58.145.16.147
  58.145.168.170
  58.147.170.114
  58.147.170.116
@@ -98132,83 +82851,34 @@
  58.147.170.226
  58.147.170.82
  58.147.171.114
-58.147.176.235
-58.147.183.23
-58.149.14.164
  58.149.49.186
  58.149.52.124
  58.150.99.144
  58.151.80.76
-58.152.115.103
-58.152.130.212
-58.152.139.19
  58.152.157.173
-58.152.168.217
-58.152.172.249
-58.152.194.200
-58.152.206.190
-58.152.222.54
-58.152.34.47
-58.152.37.235
-58.152.37.54
-58.152.38.147
-58.152.58.61
-58.152.69.217
  58.152.74.2
  58.152.74.77
-58.152.89.3
  58.153.112.168
-58.153.121.112
-58.153.135.214
-58.153.221.41
+58.153.128.51
+58.153.158.47
  58.158.0.86
  58.16.204.238
-58.16.29.26
-58.16.83.221
  58.162.143.57
  58.162.218.151
  58.162.229.173
  58.17.185.231
  58.17.186.205
  58.17.200.197
-58.17.81.70
  58.171.135.242
  58.171.153.81
  58.171.38.26
-58.176.123.36
-58.176.167.115
-58.176.43.99
+58.176.134.217
  58.176.45.132
-58.177.13.195
-58.177.139.102
  58.177.156.69
  58.177.86.10
  58.179.192.105
  58.179.21.69
  58.179.84.18
-58.18.102.140
-58.18.130.101
-58.18.133.165
-58.18.143.110
-58.18.172.102
-58.18.215.26
-58.18.35.20
-58.18.37.35
-58.18.57.13
-58.18.85.231
-58.181.171.200
-58.181.194.52
-58.181.61.40
-58.182.1.187
-58.182.11.253
-58.182.110.51
-58.182.163.181
-58.182.165.40
-58.182.173.200
-58.182.23.169
-58.182.30.170
-58.182.67.11
-58.182.72.92
  58.184.252.3
  58.185.183.60
  58.185.69.243
@@ -98216,191 +82886,99 @@
  58.19.214.104
  58.19.42.140
  58.20.108.76
-58.20.128.66
-58.20.231.162
-58.20.243.15
-58.20.248.119
-58.20.249.195
  58.20.30.77
-58.20.41.53
  58.20.52.71
  58.20.54.143
-58.20.91.67
-58.208.152.3
-58.208.152.45
-58.208.171.229
-58.208.172.128
-58.208.180.170
-58.208.236.152
-58.208.57.88
+58.208.135.34
+58.208.136.118
+58.208.152.232
+58.208.171.201
+58.208.180.163
+58.208.180.5
+58.208.212.190
+58.208.226.37
+58.208.236.45
+58.208.54.108
+58.208.57.17
  58.208.73.11
-58.208.84.93
-58.209.211.56
+58.209.192.50
  58.209.213.217
-58.209.228.3
  58.209.239.23
  58.209.33.208
-58.21.165.134
-58.21.199.126
  58.210.128.130
-58.210.154.44
-58.210.172.118
  58.210.173.50
  58.210.180.180
-58.210.200.82
-58.210.239.86
-58.210.243.26
-58.210.244.146
  58.210.3.219
-58.210.64.98
  58.210.82.250
  58.210.88.98
  58.211.144.220
-58.211.153.58
  58.211.203.122
  58.211.21.234
  58.211.237.70
-58.211.24.230
-58.211.247.62
  58.211.43.124
  58.211.82.170
+58.211.91.219
+58.212.209.43
  58.212.59.53
  58.213.102.62
-58.213.104.138
-58.213.106.34
  58.213.116.170
  58.213.149.86
  58.213.155.227
  58.213.166.140
-58.213.197.74
-58.213.51.41
-58.213.51.43
  58.213.60.30
  58.213.76.154
-58.213.87.162
-58.213.91.10
-58.213.91.12
-58.213.91.6
-58.213.91.8
-58.214.11.123
  58.214.156.110
-58.214.156.55
-58.214.27.130
-58.214.36.86
  58.215.120.178
  58.215.120.180
  58.215.13.190
-58.215.142.167
-58.215.201.86
-58.215.221.82
-58.215.235.146
-58.215.57.185
-58.215.57.240
-58.215.65.8
-58.215.65.99
-58.215.76.226
-58.215.9.158
-58.216.149.158
-58.216.156.195
-58.216.164.67
-58.216.176.179
-58.216.176.183
-58.216.176.184
-58.216.176.209
-58.216.176.211
-58.216.176.212
-58.216.176.214
-58.216.199.246
-58.216.207.110
-58.216.216.74
  58.216.218.236
-58.216.51.206
-58.216.8.106
-58.216.8.83
-58.217.157.209
-58.217.157.233
-58.217.157.46
-58.217.157.7
-58.217.157.90
-58.217.55.54
+58.217.0.36
  58.218.10.103
  58.218.127.122
  58.218.127.8
  58.218.16.191
  58.218.16.227
  58.218.17.129
-58.218.185.20
-58.218.200.145
-58.218.210.162
-58.218.239.164
-58.218.251.214
  58.218.26.111
  58.218.30.167
  58.218.5.3
-58.219.212.86
  58.219.22.106
  58.219.227.184
  58.22.132.50
  58.22.212.184
-58.22.218.108
  58.22.56.13
-58.22.93.108
+58.22.93.103
  58.22.93.115
  58.22.93.39
-58.22.93.64
+58.22.95.235
  58.220.10.164
  58.220.10.171
-58.220.109.222
  58.220.24.75
-58.220.25.2
  58.220.39.196
  58.220.39.204
  58.220.39.205
-58.220.41.53
-58.220.46.62
-58.220.46.7
-58.220.56.13
  58.220.56.64
  58.220.87.226
  58.220.95.86
  58.220.95.92
-58.221.144.130
-58.221.149.90
-58.221.161.10
-58.221.190.98
-58.221.2.210
+58.221.183.130
  58.221.204.114
-58.221.220.6
-58.221.245.142
-58.221.44.224
-58.221.5.238
-58.221.55.221
-58.221.60.119
-58.221.60.131
  58.221.62.191
  58.221.62.199
  58.221.62.204
-58.221.62.214
  58.221.62.221
  58.221.62.228
  58.221.64.51
-58.221.72.119
-58.221.91.166
-58.222.1.178
-58.222.10.58
+58.221.8.106
  58.222.107.253
-58.222.11.82
  58.222.133.82
-58.222.141.114
  58.222.20.220
-58.222.24.171
+58.224.116.160
  58.225.75.151
  58.226.129.29
  58.226.23.129
  58.226.23.55
  58.227.193.198
-58.227.252.120
-58.228.50.59
  58.228.50.98
  58.229.114.170
  58.229.157.178
@@ -98408,35 +82986,28 @@
  58.229.194.122bfac0332.moe
  58.229.208.158
  58.229.208.244
+58.229.6.74
  58.23.131.18
-58.23.193.113
-58.23.199.10
  58.23.247.73
-58.23.58.195
  58.230.118.81
  58.230.123.88
  58.230.142.139
  58.230.147.230
  58.232.155.37
-58.232.55.7
-58.232.55.8
  58.233.207.30
  58.233.240.94
  58.233.251.109
-58.233.74.7
-58.234.158.62
+58.236.111.117
  58.236.160.218
  58.238.74.138
  58.239.153.252
  58.240.103.107
-58.240.132.111
  58.240.147.216
  58.240.148.13
  58.240.148.13bin.sh
  58.240.196.6
-58.240.9.11
-58.241.135.9
-58.241.230.77
+58.240.217.248
+58.241.58.208
  58.242.122.73
  58.242.169.14
  58.242.197.25
@@ -98455,213 +83026,114 @@
  58.243.189.67
  58.243.19.107
  58.243.19.196
-58.243.19.212
  58.243.19.227
  58.243.190.127
  58.243.20.165
  58.243.20.212
  58.243.20.236
-58.243.210.204
-58.243.56.192
-58.244.134.243
-58.244.181.154
-58.244.74.214
-58.245.223.163
-58.245.68.200
-58.246.134.186
+58.244.255.45
  58.246.136.250
-58.246.231.6
  58.246.60.162
  58.246.64.11
  58.246.68.6
  58.246.71.26
-58.247.120.118
-58.247.69.39
-58.247.83.230
-58.248.104.122
-58.248.112.201
-58.248.113.226
-58.248.116.216
-58.248.116.86
-58.248.117.107
-58.248.142.64
-58.248.17.84
-58.248.225.28
-58.248.72.237
-58.248.75.20
-58.248.84.254
-58.248.85.186
-58.249.11.16
-58.249.13.24
-58.249.19.55
-58.249.22.102
+58.247.51.194
+58.248.117.146
+58.248.175.230
+58.248.73.202
+58.248.83.7
+58.248.84.159
+58.249.14.128
  58.249.55.68
+58.249.8.247
+58.249.82.43
+58.249.87.90
  58.249.9.215
-58.249.90.84
  58.250.176.94
-58.250.26.242
-58.250.36.51
  58.250.44.53
  58.250.86.44
-58.251.218.97
-58.252.135.50
  58.252.2.236
-58.252.68.5
  58.252.8.124
+58.253.6.168
  58.254.184.102
  58.254.220.116
-58.254.35.146
  58.255.17.242
-58.255.77.17
-58.255.77.21
-58.26.4.68
-58.27.201.105
-58.27.207.18
-58.27.207.42
+58.255.191.79
+58.255.20.156
  58.27.95.2
-58.29.26.73
  58.30.76.243
-58.30.80.209
-58.32.211.77
-58.32.252.162
+58.30.77.194
  58.33.102.141
  58.33.107.221
-58.33.114.50
-58.33.114.54
  58.33.119.186
-58.33.124.4
-58.33.14.140
  58.33.160.139
-58.33.174.203
-58.33.183.225
  58.33.197.82
  58.33.35.82
  58.33.45.30
  58.33.49.196
-58.33.8.50
  58.33.84.251
-58.33.85.113
-58.33.98.130
  58.35.58.58
-58.37.183.99
-58.37.204.241
-58.37.3.198
  58.37.59.150
-58.39.153.77
  58.39.155.252
  58.39.171.239
  58.40.118.114
  58.40.124.174
-58.40.146.178
-58.40.66.150
-58.42.208.205
-58.42.237.23
-58.42.241.254
  58.42.244.200
  58.42.30.64
-58.45.138.79
-58.48.160.162
  58.48.168.166
  58.48.184.234
  58.48.196.127
  58.48.196.153
  58.48.226.103
-58.48.84.78
  58.49.116.78
  58.49.16.14
-58.49.210.174
-58.49.29.35
-58.49.29.51
-58.49.44.82
-58.49.58.199
  58.49.94.213
-58.49.94.230
-58.50.162.232
-58.51.62.109
+58.50.137.29
  58.52.105.16
  58.52.179.215
  58.53.128.61
-58.54.36.109
-58.56.112.163
  58.56.112.167
-58.56.132.210
  58.56.140.62
-58.56.181.46
+58.56.177.170
+58.56.178.170
  58.56.181.54
-58.56.22.117
+58.56.187.18
  58.56.32.238
  58.56.40.210
+58.56.51.208
  58.56.66.103
-58.56.76.166
-58.56.96.27
-58.56.96.28
-58.56.96.29
-58.57.100.34
-58.57.128.18
  58.57.13.171
  58.57.15.29
-58.57.183.170
  58.57.26.46
-58.57.4.199
  58.57.4.238
-58.58.177.230
  58.58.213.55
-58.58.42.70
-58.58.43.238
-58.58.55.178
+58.58.38.30
  58.58.58.114
  58.58.71.218
-58.59.176.3
-58.59.176.4
-58.59.54.78
+58.59.17.74
  58.6.140.8
  58.60.10.10
-58.60.109.242
-58.60.232.220
-58.60.232.221
-58.61.155.171
-58.61.28.210
-58.61.38.185
  58.62.18.194
-58.62.83.182
-58.63.128.250
-58.63.245.235
-58.63.60.83
-58.64.129.145
  58.64.129.15
-58.64.155.101
-58.64.158.186
-58.64.171.69
  58.64.178.77
  58.64.188.26
  58.64.193.193
  58.64.193.218
-58.64.200.114
-58.64.200.178
  58.64.204.170
  58.65.136.170
  58.65.145.83
-58.65.153.246
  58.65.167.165
-58.65.169.6
-58.65.218.138
-58.69.151.116
-58.69.161.161
-58.69.60.253
-58.69.75.172
  58.69.87.58
  58.7.197.214
  58.71.15.10
-58.71.29.162
  58.71.5.154
+58.72.165.39
  58.74.76.18
  58.75.126.235
-58.76.151.51
-58.76.182.254
  58.78.157.152
  58.8.2.250
-58.8.207.209
  58.8.218.80
+58.8.228.109
  58.8.84.48
  58.82.170.50
  58.82.212.192
@@ -98677,12 +83149,14 @@
  58.84.31.157
  58.84.31.169
  58.84.31.17
+58.84.31.173
  58.84.31.201
  58.84.31.209
  58.84.31.21
  58.84.31.217
  58.84.31.25
  58.84.31.33
+58.84.31.41
  58.84.31.45
  58.84.31.57
  58.84.31.65
@@ -98690,7 +83164,6 @@
  58.84.31.81
  58.84.31.97
  58.84.6.58
-58.85.209.7
  58.87.114.13
  58.87.114.217
  58.87.119.211
@@ -98701,7 +83174,6 @@
  58.87.65.87
  58.87.66.82
  58.87.67.126
-58.87.67.159
  58.87.67.226
  58.87.69.15
  58.87.71.16
@@ -98712,24 +83184,20 @@
  58.87.78.55
  58.87.78.80
  58.87.84.31
-58.87.88.72
  58.87.90.156
  58.87.94.75
  58.87.95.121
+58.88.217.63
  58.9.182.62
  58.9.99.67
-58.96.148.49
+58.90.164.173
  58.96.175.218
-58.96.211.50
-58.96.237.121
  58.96.241.137
  58.96.50.39
  58.97.201.45
  58.97.205.164
  58.97.206.33
  58.97.214.5
-58.97.214.7
-58.97.215.196
  58.97.215.240
  58.97.72.83
  58.97.8.10
@@ -98758,40 +83226,24 @@
  58jcdz.cn
  58yuesao.top
  58zwp.com
-59.0.216.197
-59.0.75.71
-59.1.109.120
-59.1.174.31
-59.1.86.1
-59.10.99.194
+59.10.151.102
  59.100.12.173
  59.100.94.83
  59.102.148.151
-59.102.157.189
-59.102.249.180
+59.103.114.114
  59.103.139.131
  59.103.164.174
-59.103.201.151
  59.103.254.36
  59.106.141.147
  59.106.171.70
  59.108.35.198
  59.108.94.125
-59.11.209.138
-59.11.209.158
-59.11.209.183
-59.11.209.198
-59.11.209.250
-59.11.215.130
-59.11.67.238
  59.110.0.79
  59.110.1.58
  59.110.12.12
  59.110.12.129
  59.110.153.239
-59.110.213.242
-59.110.40.173
-59.110.42.216
+59.110.236.196
  59.110.50.141
  59.110.54.10
  59.110.70.236
@@ -98799,311 +83251,52 @@
  59.111.103.165
  59.111.89.240
  59.111.93.64
+59.115.118.12
  59.115.118.99
  59.115.3.8
  59.120.113.240
-59.120.120.1
-59.120.143.120
  59.120.20.133
-59.120.221.107
  59.120.5.154
-59.120.54.42
-59.120.55.33
-59.120.91.73
  59.124.139.7
-59.124.159.4
-59.124.168.155
  59.124.170.48
-59.124.171.171
-59.124.203.151
  59.124.224.180
+59.124.224.244
  59.124.225.204
-59.124.226.199
-59.124.230.138
  59.124.230.65
  59.124.242.27
  59.124.6.166
-59.124.70.43
-59.124.70.44
  59.124.74.34
  59.124.74.42
  59.124.74.53
  59.124.74.56
-59.124.84.112
  59.124.90.113
  59.124.93.169
-59.125.129.119
-59.125.131.111
-59.125.142.63
-59.125.189.76
-59.125.189.77
-59.125.196.15
-59.125.204.199
  59.125.214.115
-59.125.218.249
-59.125.219.88
-59.125.243.2
-59.125.250.70
-59.125.26.116
  59.125.28.51
-59.125.41.144
-59.125.65.160
-59.125.9.109
-59.126.0.8
  59.126.1.160
-59.126.100.220
-59.126.100.240
-59.126.100.30
-59.126.104.9
-59.126.106.102
  59.126.108.147
  59.126.108.47
-59.126.108.93
-59.126.110.72
-59.126.110.82
-59.126.112.252
-59.126.113.22
-59.126.116.37
-59.126.116.43
-59.126.124.201
-59.126.126.194
-59.126.126.240
-59.126.127.50
-59.126.149.208
-59.126.154.100
-59.126.154.166
-59.126.164.45
-59.126.164.65
-59.126.165.165
-59.126.168.192
-59.126.169.60
-59.126.170.11
-59.126.170.121
-59.126.170.234
-59.126.171.70
-59.126.176.34
-59.126.177.25
-59.126.177.66
-59.126.178.22
-59.126.178.78
-59.126.179.108
-59.126.179.191
-59.126.179.204
-59.126.182.212
-59.126.183.105
-59.126.186.29
-59.126.187.172
-59.126.192.181
-59.126.194.205
-59.126.195.141
-59.126.195.151
-59.126.196.216
-59.126.201.207
-59.126.201.212
-59.126.203.101
-59.126.204.232
-59.126.205.43
-59.126.206.7
-59.126.208.3
-59.126.212.218
-59.126.213.67
-59.126.219.227
-59.126.22.160
-59.126.224.65
-59.126.225.187
-59.126.226.19
-59.126.228.233
-59.126.229.157
-59.126.229.253
-59.126.234.80
+59.126.172.201
  59.126.236.248
-59.126.237.108
-59.126.239.83
-59.126.24.114
-59.126.240.14
-59.126.241.41
-59.126.242.95
-59.126.244.95
-59.126.250.107
-59.126.251.230
-59.126.251.3
-59.126.251.40
-59.126.252.13
-59.126.254.95
-59.126.27.139
-59.126.27.57
-59.126.29.238
-59.126.3.201
-59.126.32.227
-59.126.33.118
-59.126.33.232
-59.126.34.51
-59.126.35.23
-59.126.35.90
-59.126.37.211
-59.126.38.35
-59.126.39.118
-59.126.40.106
-59.126.42.250
-59.126.43.72
-59.126.47.63
-59.126.51.156
  59.126.51.197
-59.126.52.102
-59.126.52.21
-59.126.53.132
-59.126.58.152
-59.126.58.62
-59.126.60.100
-59.126.62.95
-59.126.63.115
-59.126.65.84
-59.126.70.245
-59.126.8.12
-59.126.8.149
-59.126.8.169
-59.126.80.35
-59.126.82.249
-59.126.83.121
-59.126.83.139
-59.126.84.2
-59.126.84.234
-59.126.89.170
-59.126.90.148
-59.126.90.23
-59.127.10.30
-59.127.102.103
-59.127.102.122
-59.127.105.175
-59.127.121.32
-59.127.13.6
-59.127.131.230
-59.127.133.232
-59.127.136.221
-59.127.136.26
-59.127.136.99
-59.127.138.140
-59.127.139.162
-59.127.139.168
-59.127.140.153
-59.127.142.124
-59.127.144.140
-59.127.145.30
-59.127.146.175
-59.127.147.73
-59.127.152.10
  59.127.152.203
-59.127.155.164
-59.127.156.126
-59.127.161.179
-59.127.165.252
-59.127.167.112
  59.127.168.43
-59.127.17.105
-59.127.17.22
-59.127.17.46
-59.127.174.187
-59.127.176.11
-59.127.177.170
-59.127.177.95
-59.127.179.46
-59.127.181.118
-59.127.181.163
-59.127.185.27
-59.127.186.35
-59.127.187.124
-59.127.192.55
-59.127.193.144
-59.127.198.19
-59.127.2.53
-59.127.203.204
-59.127.210.204
-59.127.211.252
-59.127.217.127
-59.127.217.99
-59.127.219.79
-59.127.22.74
-59.127.222.128
-59.127.224.87
-59.127.225.134
-59.127.225.189
-59.127.226.19
-59.127.227.40
-59.127.228.140
-59.127.229.115
-59.127.229.201
-59.127.234.145
-59.127.235.21
-59.127.236.201
-59.127.239.10
-59.127.239.162
-59.127.24.43
-59.127.240.13
-59.127.240.48
-59.127.243.44
-59.127.243.90
-59.127.252.213
-59.127.252.31
-59.127.253.174
  59.127.27.243
-59.127.28.111
-59.127.30.61
-59.127.32.102
-59.127.34.40
-59.127.36.120
-59.127.39.189
-59.127.41.52
-59.127.43.140
-59.127.45.61
-59.127.47.182
-59.127.51.206
-59.127.51.27
-59.127.52.44
-59.127.52.59
-59.127.53.80
-59.127.55.147
-59.127.57.125
-59.127.62.175
-59.127.62.65
-59.127.62.82
-59.127.64.54
-59.127.65.21
-59.127.66.49
-59.127.72.147
-59.127.73.174
-59.127.76.90
-59.127.80.39
-59.127.93.103
-59.127.96.179
  59.128.66.213
  59.128.66.213bin.sh
+59.13.100.29
  59.13.125.142
-59.13.182.88
-59.14.134.135
-59.144.119.76
  59.144.139.18
  59.144.48.34
+59.144.81.163
  59.145.111.67
  59.145.146.166
-59.148.18.42
-59.148.19.1
  59.148.20.152
-59.148.20.65
  59.148.249.10
  59.148.253.194
  59.148.42.146
-59.148.48.122
-59.148.88.120
-59.149.115.177
-59.149.135.248
-59.149.174.229
-59.149.21.159
-59.149.60.131
-59.15.16.138
  59.15.18.223
  59.15.18.223bin.sh
-59.15.196.97
-59.15.209.6
  59.15.3.197
  59.151.192.6
  59.151.192.96
@@ -99115,17 +83308,13 @@
  59.151.231.113
  59.151.239.36
  59.151.244.11
-59.151.246.19
  59.151.247.12
-59.151.43.20
  59.151.47.42
  59.152.104.54
  59.152.111.241
-59.152.201.214
  59.152.237.118
-59.152.246.226
-59.152.251.30
  59.152.62.40
+59.152.91.26
  59.153.121.161
  59.153.121.162
  59.153.121.164
@@ -99143,42 +83332,26 @@
  59.160.155.67
  59.160.171.91
  59.162.86.8
-59.163.146.20
  59.167.120.116
  59.167.155.59
-59.17.56.114
  59.173.115.51
-59.173.12.166
  59.173.120.253
  59.173.133.249
-59.173.151.229
  59.173.240.186
  59.174.151.114
-59.174.185.203
  59.174.186.27
  59.174.51.108
-59.175.109.62
  59.175.116.137
-59.175.153.34
-59.175.228.60
  59.175.86.132
  59.175.87.197
-59.177.104.112
-59.177.105.44
  59.177.37.32
-59.177.38.119
-59.177.76.135
-59.178.79.229
-59.178.81.185
-59.178.88.224
  59.18.136.223
-59.180.169.3
+59.180.170.214
  59.181.106.18
  59.181.122.64bin.sh
-59.181.153.91
  59.181.98.224
  59.186.106.20
-59.187.202.80
+59.187.241.38
  59.187.242.46
  59.188.133.34
  59.188.221.251
@@ -99189,288 +83362,168 @@
  59.19.150.135
  59.19.255.104
  59.19.29.102
-59.2.46.167
  59.2.8.36
  59.20.252.136
-59.20.31.84
-59.21.12.38
  59.21.150.93
-59.22.144.211
  59.22.233.81
  59.23.168.115
  59.23.168.115bin.sh
  59.23.205.191
  59.23.24.187
  59.24.1.84
-59.24.233.144
-59.24.253.203
  59.24.49.35
  59.25.142.68
  59.25.144.49
-59.25.174.112
  59.25.6.100
  59.26.214.148
  59.27.101.41
  59.27.101.80
  59.27.124.26
  59.27.134.193
-59.27.78.16
  59.27.95.144
  59.28.44.229
-59.28.94.51
  59.29.135.151
-59.29.80.231
  59.3.117.32
  59.3.117.32bin.sh
-59.3.210.6
  59.3.28.131
  59.3.93.107
  59.3.94.190
  59.30.12.254
-59.31.61.106
-59.31.61.107
  59.31.90.206
  59.33.229.65
-59.33.32.170
-59.33.37.158
-59.33.37.173
-59.33.44.94
+59.33.32.67
  59.34.233.229
-59.35.235.74
-59.36.148.69
-59.36.162.23
-59.36.162.52
-59.36.163.239
-59.36.175.59
  59.36.178.98
-59.36.21.119
-59.36.75.227
-59.37.161.161
  59.37.22.82
  59.37.47.26
-59.37.56.106
-59.37.8.105
  59.38.218.3
-59.38.35.102
  59.39.183.34
  59.4.98.61
-59.40.79.114
  59.40.80.41
  59.41.198.116
  59.41.244.200
-59.41.68.114
-59.41.93.236
+59.41.64.34
+59.41.65.51
  59.42.10.71
-59.42.116.66
-59.44.150.165
-59.44.206.198
-59.44.37.156
+59.42.206.22
  59.45.142.12
-59.45.142.253
-59.45.27.187
-59.45.40.120
-59.45.40.52
-59.45.96.200
-59.46.0.36
-59.46.13.127
-59.46.13.129
-59.46.13.130
-59.46.13.136
-59.46.13.71
-59.46.136.138
  59.46.136.139
-59.46.136.141
  59.46.169.194
-59.46.43.58
-59.46.53.210
-59.46.96.14
-59.46.96.7
-59.46.98.162
-59.47.0.219
-59.47.121.133
-59.47.122.105
  59.47.229.130
-59.47.36.131
+59.48.146.66
  59.48.149.251
-59.48.173.146
-59.48.174.2
-59.48.240.250
-59.48.38.210
-59.49.17.27
-59.49.38.158
-59.49.50.54
-59.5.198.75
  59.5.230.140bin.sh
-59.50.102.242
-59.50.25.175
-59.50.85.195
  59.50.85.74
-59.54.54.226
-59.55.128.147
-59.55.128.170
-59.55.36.171
-59.55.38.235
-59.55.38.35
-59.55.39.248
-59.55.74.4
-59.56.103.1
-59.56.103.2
-59.56.103.91
+59.52.187.117
+59.53.183.198
+59.55.36.4
+59.55.39.50
  59.56.106.103
-59.56.111.85
  59.56.126.143
-59.56.65.13
-59.56.71.215
-59.56.74.16
  59.56.99.130
-59.57.13.92
-59.57.14.138
  59.57.150.170
-59.57.183.209
-59.57.32.31
  59.58.139.126
  59.58.150.93
+59.58.164.194
  59.58.19.24
  59.58.58.26
-59.6.147.79
  59.6.180.232
-59.60.191.210
-59.61.160.222
-59.61.172.199
  59.61.241.46
-59.63.163.165
-59.63.206.206
-59.63.208.191
-59.63.212.100
+59.63.204.76
  59.63.225.99
-59.64.129.37
-59.64.129.38
-59.64.129.41
-59.64.129.42
-59.64.129.43
-59.64.129.47
-59.64.129.48
-59.64.129.84
  59.72.109.90
-59.72.114.79
-59.78.88.145
+59.72.122.148
  59.8.137.21
  59.8.137.6
  59.8.91.185
-59.83.229.100
-59.84.226.80
  59.86.247.99
-59.88.228.143
-59.89.240.229
-59.89.240.70
-59.89.241.103
-59.9.157.71
+59.88.229.182
+59.88.231.18
+59.88.231.49
  59.9.77.181
-59.90.29.2
  59.90.30.197
-59.90.40.157
  59.91.122.1
  59.91.122.57
-59.91.201.110
-59.91.201.147
-59.91.202.6
-59.91.203.138
-59.92.180.173
-59.92.181.177
-59.92.181.226
-59.92.182.128
-59.92.182.243
-59.92.183.184
+59.92.180.157
+59.92.180.195
+59.92.180.249
+59.92.180.59
+59.92.181.102
+59.92.181.156
+59.92.183.238
  59.92.216.236
-59.92.218.166
+59.92.218.177
+59.92.218.27
  59.92.69.22
-59.93.105.126
-59.93.108.103
  59.93.133.220
  59.93.133.63
-59.93.16.154
-59.93.16.192
-59.93.17.183
-59.93.17.238
-59.93.17.33
-59.93.18.111
-59.93.18.224
-59.93.19.203
-59.93.19.244
-59.93.236.24
-59.94.128.241
-59.94.128.9
-59.94.130.172
-59.94.176.30
-59.94.180.129
-59.95.103.13
-59.95.174.159
-59.95.174.226
-59.95.175.157
-59.95.175.48
-59.95.175.6
-59.95.68.103
+59.93.18.235
+59.93.19.149
+59.93.19.36
+59.93.236.178
+59.93.236.20
+59.93.237.127
+59.93.239.99
+59.94.180.117
+59.94.180.131
+59.94.182.100
+59.94.182.184
+59.94.182.189
+59.94.182.50
+59.94.182.64
+59.94.183.107
+59.94.183.187
+59.95.172.138
+59.95.172.231
+59.95.174.245
+59.95.174.48
+59.95.175.26
  59.95.69.8
-59.96.132.7
-59.96.26.80
-59.96.37.128
-59.96.37.209
-59.96.37.213
-59.96.39.177
-59.96.84.37
-59.97.128.29
-59.97.141.18
-59.97.168.56
-59.97.169.20
-59.97.170.53
-59.97.172.236
-59.97.172.5
-59.97.173.103
-59.97.173.26
-59.97.173.79
-59.97.174.170
-59.97.175.24
-59.97.18.112
-59.97.21.76
-59.97.238.208
+59.96.24.235
+59.96.25.104
+59.96.25.130
+59.96.26.88
+59.96.27.55
+59.96.36.164
+59.96.36.21
+59.96.37.57
+59.96.38.127
+59.96.38.165
+59.96.38.203
+59.97.169.66
+59.97.170.17
+59.97.170.5
+59.97.170.80
+59.97.171.253
+59.97.172.98
+59.97.174.188
  59.97.60.13
  59.97.98.45
-59.98.7.7
-59.99.136.19
-59.99.138.110
-59.99.139.224
-59.99.140.207
-59.99.140.98
-59.99.141.165
-59.99.142.28
-59.99.144.207
-59.99.151.224
-59.99.188.241
-59.99.189.17
-59.99.189.47
-59.99.190.46
-59.99.191.182
-59.99.191.192
-59.99.191.226
-59.99.191.253
-59.99.195.203
+59.98.181.234
+59.99.139.9
+59.99.142.126
+59.99.142.37
+59.99.142.75
+59.99.143.194
+59.99.143.247
+59.99.188.232
+59.99.188.238
+59.99.189.160
+59.99.190.187
+59.99.191.17
  59.99.207.23
-59.99.40.212
-59.99.40.37
-59.99.41.180
-59.99.41.35
-59.99.42.111
-59.99.42.57
-59.99.43.232
-59.99.44.145
-59.99.45.109
-59.99.45.130
-59.99.46.42
-59.99.47.133
-59.99.93.101
-59.99.93.168
-59.99.94.135
-59.99.94.165
+59.99.40.78
+59.99.43.212
+59.99.43.33
+59.99.44.182
+59.99.45.138
+59.99.45.242
+59.99.92.132
+59.99.92.234
+59.99.92.49
+59.99.93.144
+59.99.93.200
+59.99.93.246
  590466-dot-n-e-w-me-ss-age-po-rt-al.wl.r.appspot.com
  5918062d-fb42-4707-b098-e2c266e14d95.htmlpasta.com
  591860.playcode.io
@@ -99578,6 +83631,7 @@
  5svvzk0neu-2nqcpcb4z.vercel.app
  5t3lz59tt.com
  5techexplore.com
+5teename.com
  5till9.co.uk
  5u2mr.com
  5ubuortfa5u.bankofamericaslpemr.com
@@ -99597,52 +83651,29 @@
  6-one.com.tw
  6.gucac.com
  6.ldayl.com
-60.0.237.167
  60.1.145.166
-60.10.134.52
-60.10.182.29
  60.10.193.68
  60.10.204.121
-60.10.34.103
-60.10.57.137
-60.10.65.178
-60.10.65.23
  60.108.128.186
-60.11.46.194
-60.11.9.112
+60.11.113.164
+60.11.115.86
  60.113.215.60
-60.12.124.70
-60.12.168.222
  60.12.214.184
-60.12.26.9
  60.12.33.109
-60.12.33.9
-60.12.48.38
  60.126.10.253
  60.126.37.246
  60.13.126.151
-60.13.146.20
-60.13.194.158
-60.13.194.71
  60.13.2.159
  60.13.2.162
-60.13.218.82
-60.13.219.17
-60.13.226.223
+60.13.226.130
  60.13.230.199
-60.13.240.104
  60.13.251.214
  60.13.61.176
  60.132.121.224
-60.132.85.215
  60.15.67.178
  60.16.104.173
  60.16.12.57
-60.16.138.240
-60.160.21.8
  60.161.13.44
-60.161.134.67
-60.161.137.162
  60.161.152.65
  60.162.123.120
  60.162.155.188
@@ -99652,131 +83683,68 @@
  60.162.187.162
  60.162.191.233
  60.162.191.86
-60.162.227.89
  60.163.205.193
-60.164.249.51
-60.164.251.91
+60.164.243.198
  60.165.219.14
-60.165.242.196
-60.165.53.184
-60.165.53.185
-60.165.54.65
-60.166.22.74
  60.166.85.100
-60.167.103.154
  60.167.112.252
-60.167.113.108
  60.167.116.95
  60.167.117.147
  60.167.117.150
  60.167.119.82
  60.167.132.113
-60.167.132.24
-60.167.133.236
-60.167.133.54
-60.167.134.30
  60.167.135.134
-60.167.135.5
-60.167.177.107
-60.167.177.28
-60.167.178.170
-60.167.180.193
-60.167.189.120
-60.167.189.172
  60.167.20.13
-60.167.22.151
  60.167.23.78
-60.167.239.99
  60.167.52.68
  60.167.53.152
  60.167.53.208
  60.167.53.223
-60.167.71.8
-60.167.82.105
  60.167.82.139
  60.167.82.157
  60.167.82.209
-60.167.82.229
-60.167.82.249
-60.167.82.25
-60.167.82.95
-60.168.129.33
-60.168.129.36
  60.168.206.152
+60.168.207.1
+60.168.207.111
  60.168.207.40
-60.169.114.190
-60.169.114.202
-60.169.114.47
+60.168.81.212
+60.168.93.234
  60.169.115.107
  60.169.115.111
-60.169.115.134
  60.169.115.192
-60.169.115.30
  60.169.94.103
-60.169.94.181
-60.169.94.189
  60.169.94.19
-60.169.94.51
  60.169.94.65
  60.169.95.13
  60.169.95.72
  60.169.95.77
-60.17.148.145
  60.17.33.254
  60.170.101.25
-60.170.119.252
-60.170.152.153
-60.170.166.177
  60.170.189.102
+60.170.189.7
  60.170.192.7
  60.170.218.225
  60.170.255.63
-60.170.27.76
-60.170.38.29
  60.171.124.69
-60.171.124.72
-60.171.135.254
  60.171.137.229
  60.171.137.234
  60.171.208.199
-60.172.160.43
  60.172.186.134
-60.172.47.2
  60.172.50.164
  60.173.146.42
-60.173.152.45
-60.173.156.55
-60.173.16.121
-60.173.215.2
-60.173.241.134
-60.173.241.87
-60.173.255.176
+60.173.161.143
  60.173.58.218
-60.173.85.163
  60.174.118.123
-60.174.130.19
-60.174.217.87
-60.174.234.44
-60.174.234.62
+60.174.234.57
  60.174.236.98
  60.174.242.172
-60.174.248.244
  60.174.40.118
  60.174.72.198
-60.175.1.242
  60.175.124.27
-60.175.153.105
  60.175.204.158
-60.175.90.102
-60.178.118.197
-60.178.220.210
-60.178.30.27
  60.178.44.149
  60.178.7.237
-60.18.128.4
-60.18.135.203
-60.18.171.119
-60.18.184.72
+60.18.33.208
  60.182.96.196
  60.183.150.155
  60.183.155.121
@@ -99788,133 +83756,86 @@
  60.184.95.135
  60.185.135.252
  60.185.159.249
-60.186.161.200
-60.186.57.142
+60.186.99.140
  60.187.236.172
-60.189.251.141
  60.189.30.4
-60.189.62.80
  60.19.20.235
-60.19.207.199
-60.19.255.153
  60.19.64.4
+60.19.64.6
  60.190.127.59
-60.190.128.41
-60.190.143.82
  60.190.194.220
-60.190.24.225
-60.190.249.119
-60.190.249.121
  60.190.250.120
-60.190.252.21
-60.190.252.29
+60.190.6.134
  60.190.94.69
-60.191.1.16
-60.191.107.132
  60.191.11.241
  60.191.119.124
-60.191.119.99
  60.191.125.106
-60.191.125.35
  60.191.134.34
  60.191.187.235
-60.191.19.35
-60.191.223.52
-60.191.223.6
-60.191.226.18
-60.191.230.14
-60.191.250.30
  60.191.29.210
  60.191.43.2
-60.191.8.154
-60.191.8.155
-60.191.8.156
+60.191.58.202
  60.191.84.93
  60.191.84.96
-60.191.94.118
-60.191.94.119
-60.191.94.120
-60.194.65.243
  60.196.69.234
-60.199.195.35
-60.199.223.17
+60.199.132.161
  60.199.223.196
  60.2.145.75
-60.2.154.228
-60.2.218.210
-60.2.245.166
-60.2.37.210
-60.2.44.182
  60.20.128.152
+60.205.140.63
  60.205.177.84
  60.205.181.62
  60.205.188.24
-60.205.217.54
+60.205.210.253
+60.205.212.8
  60.205.221.72
+60.205.222.162
  60.205.226.185
  60.205.229.123
-60.206.112.119
-60.206.193.1
-60.208.111.194
-60.208.150.230
-60.208.249.237
-60.208.52.214
-60.208.85.204
  60.209.103.93bin.sh
-60.209.112.27
  60.209.129.217
  60.209.132.86
-60.209.136.34
  60.209.162.20
  60.209.165.19
  60.209.198.71
-60.209.202.14
  60.209.240.80
  60.209.244.173
  60.209.255.142
  60.209.26.70
  60.209.57.205
-60.209.73.185
  60.209.8.48
-60.21.137.218
  60.21.81.2
  60.210.104.22
-60.210.168.142
-60.210.7.222
+60.210.40.210
  60.211.110.32
-60.211.15.14
-60.211.176.106
  60.211.218.78
  60.211.22.227
-60.211.236.14
  60.211.28.221
  60.211.29.18
  60.211.94.123
  60.211.94.184
  60.211.94.68
  60.211.94.68bin.sh
+60.212.100.83
  60.212.107.162
  60.212.107.162bin.sh
  60.212.124.131
  60.212.153.164
  60.212.157.188
+60.212.160.78
+60.212.169.162
  60.212.180.197
  60.212.206.246
  60.212.217.50
-60.212.221.73
  60.212.233.125
  60.212.24.148
  60.212.26.164
  60.212.28.254
-60.212.64.99
+60.213.11.250
  60.213.121.185
  60.213.171.219
  60.213.177.63
-60.213.184.26
-60.213.46.22
  60.213.88.124
-60.214.132.222
-60.214.143.78
  60.214.144.94
  60.214.147.82
  60.214.199.60
@@ -99922,11 +83843,11 @@
  60.214.239.108
  60.214.33.185
  60.214.34.129
+60.214.37.114
+60.214.49.153
  60.214.55.159
  60.214.89.63
-60.215.104.103
  60.215.161.69
-60.215.181.44
  60.215.190.176
  60.215.202.140
  60.215.203.48
@@ -99934,23 +83855,13 @@
  60.215.3.73
  60.216.101.46
  60.216.135.7
-60.216.249.20
-60.216.75.24
  60.217.120.44
-60.217.138.161
  60.217.223.62
  60.217.62.236
-60.217.64.137
  60.217.64.237
  60.217.84.28
-60.218.134.59
-60.218.184.100
-60.219.103.106
-60.219.171.134
-60.22.6.122
-60.22.89.108
-60.22.91.164
  60.220.108.127
+60.220.109.7
  60.220.146.169
  60.220.159.223
  60.220.185.149
@@ -99958,179 +83869,103 @@
  60.220.185.22
  60.220.185.35
  60.220.185.61
-60.220.185.64
  60.220.185.90
-60.220.187.75
-60.220.220.136
-60.220.226.102
-60.220.241.87
-60.220.242.92
  60.220.26.105
-60.221.49.49
+60.221.59.90
  60.222.233.208
-60.223.245.66
-60.223.251.177
  60.223.93.22
-60.224.132.108
  60.225.218.39
  60.228.245.111
-60.23.54.94
-60.23.60.39
  60.231.41.229
  60.234.43.164
-60.235.183.70
  60.235.24.222
  60.237.91.10
  60.24.100.27
  60.24.124.52
-60.24.69.246
  60.24.71.52
  60.24.72.131
-60.24.78.99
+60.240.116.156
  60.241.231.114
  60.241.53.60
+60.243.126.210
  60.243.149.14
  60.244.109.18
-60.244.121.125
-60.244.146.157
  60.245.56.109
-60.246.122.219
  60.246.171.51
+60.246.65.138
  60.246.7.4
  60.247.103.41
  60.247.27.157
-60.248.121.166
  60.248.131.75
-60.248.154.223
-60.248.154.99
-60.248.160.2
+60.248.167.26
  60.248.199.194
  60.248.2.163
-60.248.255.117
-60.248.42.205
-60.248.60.14
-60.248.61.44
-60.249.117.5
-60.249.123.105
-60.249.133.137
-60.249.135.162
-60.249.145.25
-60.249.178.194
-60.249.179.136
-60.249.206.148
+60.248.249.190
  60.249.212.131
  60.249.217.225
-60.249.220.99
  60.249.28.77
-60.249.29.205
-60.249.39.74
  60.249.78.226
  60.249.82.121
  60.249.86.37
-60.249.90.30
  60.25.115.177
+60.25.117.219
  60.25.172.29
  60.25.218.103
  60.25.243.204
-60.250.110.35
-60.250.139.180
  60.250.159.191
  60.250.164.169
-60.250.198.27
-60.250.213.157
-60.250.213.158
  60.250.23.233
  60.250.77.209
-60.250.90.48
-60.250.94.62
-60.250.94.66
  60.251.129.61
  60.251.133.227
  60.251.136.127
-60.251.137.215
-60.251.151.163
-60.251.154.152
-60.251.203.79
-60.251.229.205
-60.251.237.1
  60.251.60.100
  60.253.14.166
-60.253.42.72
  60.253.43.137
  60.253.46.20
  60.253.51.57
+60.253.60.174
  60.253.60.52
  60.253.62.43
  60.253.8.65
  60.253.8.81
  60.254.104.109
-60.254.11.226
-60.254.11.247
-60.254.11.9
-60.254.4.69
+60.254.104.110
+60.254.115.64
  60.254.40.116
-60.255.152.155
-60.255.171.4
-60.255.41.184
-60.255.77.249
-60.26.103.105
+60.26.12.181
  60.26.230.19
-60.26.87.71
  60.27.119.51
  60.28.189.111
  60.28.243.10
  60.28.60.49
  60.29.123.202
-60.29.18.91
+60.29.197.119
  60.29.37.54
-60.3.127.11
-60.3.140.83
  60.3.208.37
-60.30.26.94
-60.30.92.74
  60.30.98.194
-60.34.123.232
-60.34.145.107
  60.48.1.149
-60.48.209.124
+60.48.96.61
  60.49.0.221
  60.49.71.199
-60.5.174.236
-60.5.35.38
  60.5.63.53
  60.50.16.200
-60.50.251.106
  60.50.52.199
  60.50.99.134
-60.51.107.238
  60.51.111.99
  60.51.170.105
  60.51.228.233
  60.51.36.129
  60.51.4.203
  60.52.27.154
-60.52.55.44
  60.52.84.101
  60.53.126.184
  60.53.203.3
-60.53.229.147
-60.53.81.7
-60.6.132.170
-60.6.158.10
-60.6.158.41
  60.6.209.7
  60.66.209.229
  60.7.222.2
  60.7.94.111
-60.8.177.210
-60.8.177.242
-60.8.197.210
-60.8.211.2
-60.8.216.98
  60.8.229.219
-60.8.247.46
-60.8.75.182
-60.9.98.32
  60.93.23.51
  60.93.62.64
  60112501-dot-sydneyma.appspot.com
@@ -100149,42 +83984,28 @@
  60minutesoffame.com
  60triple.com
  60xggrhtuemyoowf7.easy.co
-61.0.24.199
-61.0.24.241
-61.0.7.166
-61.1.34.158
+61.0.39.205
  61.100.14.227
  61.100.181.218
  61.100.186.87
  61.100.5.136
  61.101.130.209
  61.102.93.50
-61.106.112.172
  61.107.72.165
  61.109.159.126
  61.109.164.150
  61.109.164.23
  61.110.22.144
-61.111.14.125
  61.115.1.182
  61.118.35.94
  61.12.67.133
  61.12.82.102
  61.129.112.168
-61.130.110.234
  61.130.181.138
-61.130.98.66
-61.131.20.133
-61.131.207.66
-61.131.228.76
+61.131.45.187
  61.131.45.210
-61.131.45.67
-61.132.110.126
  61.132.225.82
-61.132.227.16
-61.132.52.19
  61.132.52.29
-61.132.52.35
  61.132.52.45
  61.133.122.19
  61.133.232.248
@@ -100194,228 +84015,138 @@
  61.133.232.252
  61.133.232.253
  61.133.232.254
-61.133.238.130
-61.133.247.224
-61.133.254.162
  61.133.77.176
-61.134.23.106
-61.134.55.201
-61.135.1.100
-61.135.215.237
-61.136.101.178
-61.136.144.163
+61.134.36.102
+61.136.101.166
  61.136.144.41
  61.136.163.183
-61.136.163.244
  61.136.163.245
  61.136.163.246
-61.136.184.75
  61.136.40.177
-61.136.79.32
-61.136.81.156
-61.138.117.21
-61.138.28.45
-61.138.95.30
-61.139.104.194
  61.139.105.163
  61.14.228.134
  61.140.13.161
  61.141.138.186
  61.141.222.94
-61.141.235.210
-61.141.236.46
+61.141.64.130
  61.141.64.20
  61.141.64.249
-61.141.64.25
  61.141.65.32
+61.141.65.35
  61.141.65.40
  61.142.20.11
+61.142.20.14
  61.142.20.18
  61.142.20.19
  61.142.20.21
  61.142.20.22
  61.142.20.25
+61.142.20.26
  61.142.20.28
  61.142.20.29
-61.142.20.3
  61.142.20.32
  61.142.20.33
+61.142.20.34
  61.142.20.39
  61.142.20.4
+61.142.20.48
  61.142.20.5
-61.142.20.50
  61.142.20.6
-61.142.20.7
  61.142.20.8
-61.142.21.1
-61.142.21.15
-61.142.21.28
  61.142.21.29
-61.142.244.174
-61.142.29.2
  61.142.72.150
-61.143.152.10
-61.143.152.11
-61.143.152.14
-61.143.152.3
-61.143.152.4
-61.143.152.7
-61.143.152.9
  61.143.208.3
-61.143.213.99
-61.143.43.4
-61.144.96.223
  61.145.178.134
-61.145.181.28
  61.145.182.27
  61.145.185.121
-61.145.216.2
-61.146.199.186
-61.147.103.107
+61.145.61.7
  61.147.107.94
  61.147.107.95
-61.147.108.92
-61.147.174.126
-61.147.204.122
  61.147.48.95
  61.147.67.206
-61.148.149.130
-61.148.199.206
-61.148.202.54
-61.148.222.198
  61.148.56.158
  61.148.90.118
-61.149.142.110
  61.149.254.214
-61.15.70.53
-61.15.98.7
  61.150.104.98
-61.150.106.246
-61.150.114.0
  61.150.114.203
  61.150.115.117
-61.150.43.67
-61.150.44.50
  61.150.76.240
  61.151.130.20
  61.151.130.22
-61.152.110.33
  61.152.116.107
-61.152.144.97
-61.152.197.221
-61.152.90.81
  61.152.93.170
-61.153.103.215
-61.153.111.235
+61.153.144.123
+61.153.144.126
  61.153.184.111
  61.153.2.133
  61.154.164.241
-61.154.197.18
+61.154.197.7
  61.155.0.253
  61.155.106.101
  61.155.106.14
-61.155.137.205
  61.155.138.100
-61.155.142.70
  61.155.2.142
  61.155.209.51
  61.155.217.77
  61.155.233.227
  61.155.233.234
  61.155.234.38
-61.155.238.88
-61.155.83.22
  61.156.208.53
  61.156.215.57
  61.156.31.52
  61.157.18.2
-61.157.245.4
-61.157.91.111
  61.157.91.159
  61.158.114.188
-61.158.166.130
-61.158.167.184
-61.158.170.180
-61.158.198.137
-61.159.128.198
-61.159.167.45
-61.160.196.28
-61.160.200.58
-61.160.201.73
-61.160.210.74
  61.160.215.11
+61.160.215.21
  61.160.216.63
  61.160.217.15
  61.160.251.98
-61.160.64.37
  61.160.69.154
-61.160.9.18
  61.160.96.90
  61.161.250.202
-61.161.48.213
  61.161.86.194
-61.162.164.228
-61.162.164.33
  61.162.168.8bin.sh
  61.162.55.42
-61.162.57.22
-61.163.104.156
  61.163.136.104bin.sh
-61.163.141.250
+61.163.140.252
  61.163.156.160
-61.163.158.137
-61.163.170.1
-61.163.216.136
-61.163.218.33
-61.163.36.4
+61.163.192.212
  61.163.4.185
  61.163.4.246
  61.164.145.8
-61.164.161.12
  61.164.246.45
  61.164.248.135
  61.164.34.4
  61.164.41.76
  61.164.47.132
-61.164.57.108
-61.164.66.170
-61.164.96.82
-61.164.96.98
-61.165.157.11
  61.165.32.222
  61.166.55.153
-61.167.119.195
-61.167.119.218
-61.167.119.228
  61.167.250.12
-61.167.36.206
  61.168.139.52
-61.168.141.250
  61.168.222.143
-61.170.211.60
  61.170.216.231
-61.171.17.64
-61.172.115.43
  61.172.17.140
-61.174.155.104
-61.174.16.174
+61.174.152.197
+61.174.152.199
+61.174.154.219
+61.174.155.0
+61.174.155.69
+61.174.156.25
+61.174.156.89
+61.174.157.211
+61.174.159.105
+61.174.159.125
  61.174.171.62
  61.174.212.58
-61.174.243.62
-61.174.50.171
  61.174.9.146
  61.175.113.0
  61.175.113.125
  61.175.121.76
-61.175.201.204
-61.175.97.108
-61.176.223.8
+61.175.247.18
  61.176.87.179
-61.177.124.55
-61.177.124.56
  61.177.125.242
  61.177.144.130
-61.177.152.42
  61.177.172.104
  61.177.172.107
  61.177.172.128
@@ -100426,21 +84157,11 @@
  61.177.172.177
  61.177.172.54
  61.177.172.61
-61.177.199.246
+61.177.81.122
  61.177.81.158
-61.178.103.138
-61.178.103.148
-61.178.171.158
-61.178.18.189
-61.178.18.191
-61.178.188.10
-61.178.190.219
  61.178.197.191
-61.178.222.83
  61.178.243.56
-61.178.32.88
-61.178.66.14
-61.179.180.155
+61.179.183.88
  61.179.191.163
  61.179.219.114
  61.179.247.228
@@ -100449,60 +84170,29 @@
  61.179.90.225
  61.179.91.8
  61.180.184.214
-61.180.64.52
+61.180.65.11
+61.180.65.198
  61.180.65.82
-61.180.65.85
  61.181.14.196
  61.181.198.167
-61.181.241.89
-61.181.255.77
  61.181.80.253
  61.182.219.179
  61.182.227.245
  61.182.230.86
-61.182.245.27
  61.182.57.161
-61.183.137.210
  61.183.139.131
  61.183.144.188
  61.183.15.9
  61.183.158.70
-61.183.35.124
-61.183.37.9
  61.183.41.108
-61.183.52.106
-61.183.52.133
-61.183.52.144
-61.183.52.146
-61.183.52.5
-61.183.9.115
-61.183.9.17
  61.184.119.32
  61.184.136.164
  61.184.196.122
-61.184.220.16
-61.184.25.246
-61.184.80.4
-61.184.93.5
-61.185.114.227
-61.185.131.172
-61.185.140.39
-61.185.18.34
-61.185.18.37
-61.185.216.22
-61.185.28.125
-61.186.130.102
-61.186.39.15
-61.187.152.246
+61.185.114.130
  61.187.190.94
  61.188.18.141
  61.188.220.206
-61.188.84.255
-61.189.20.38
-61.189.20.39
-61.189.20.45
  61.189.43.58
-61.19.114.51
  61.19.127.228
  61.19.145.66
  61.19.146.5
@@ -100511,109 +84201,41 @@
  61.19.246.238
  61.19.246.25
  61.19.249.103
-61.19.254.40
  61.19.255.69
-61.19.30.156
-61.19.35.42
  61.19.40.50
-61.19.64.9
  61.19.65.30
-61.19.82.166
-61.190.123.15
  61.190.172.2
-61.190.18.46
-61.190.82.146
-61.190.82.147
-61.190.82.148
-61.190.82.149
-61.190.82.150
  61.190.91.66
-61.191.103.104
-61.191.130.42
-61.191.137.138
-61.191.137.139
-61.191.23.19
-61.191.27.122
  61.191.55.33
  61.194.24.197
-61.197.137.241
  61.2.122.1
-61.2.140.193
+61.2.212.80
  61.2.243.4
-61.2.255.180
-61.2.44.54
-61.213.118.28
-61.216.102.1
-61.216.104.177
-61.216.105.119
  61.216.107.38
-61.216.13.247
-61.216.130.60
  61.216.131.31
-61.216.139.13
  61.216.146.85
-61.216.158.11
  61.216.168.173
-61.216.168.72
-61.216.187.227
  61.216.28.103
-61.216.40.209
  61.216.43.72
-61.216.44.125
-61.216.51.177
-61.216.57.229
  61.218.122.198
-61.218.134.110
-61.218.134.112
  61.218.36.21
  61.218.5.190
  61.218.51.130
-61.219.11.153
-61.219.17.47
  61.219.247.98
  61.219.249.103
-61.219.48.77
-61.220.101.99
-61.220.128.67
-61.220.142.90
-61.220.150.137
-61.220.196.1
-61.220.35.110
-61.220.65.126
-61.221.225.143
-61.221.225.172
-61.221.247.236
-61.221.4.145
-61.221.64.176
+61.221.30.58
  61.221.64.5
-61.221.80.157
  61.222.155.229
  61.222.155.230
-61.223.7.161
-61.224.104.10
-61.227.234.42
-61.227.76.144
-61.228.130.203
-61.228.131.12
  61.228.131.86
  61.228.36.185
  61.230.170.34
-61.230.192.132
-61.232.206.226
-61.237.147.33
  61.238.103.233
-61.238.197.237
  61.238.90.17
  61.239.162.198
  61.239.214.81
  61.239.229.92
  61.239.93.94
-61.240.12.110
-61.240.148.110
-61.240.148.35
-61.240.17.182
-61.241.112.81
-61.241.166.105
  61.241.170.149
  61.241.170.161
  61.241.170.204
@@ -100623,34 +84245,26 @@
  61.241.170.50
  61.241.171.170
  61.242.169.92
-61.244.186.241
  61.244.186.33
-61.244.247.105
  61.244.70.248
  61.244.80.223
+61.245.146.174
  61.245.149.204
-61.245.177.13
  61.246.32.180
  61.246.39.159
  61.247.178.158
  61.247.25.22
-61.247.51.133
-61.247.65.101
-61.247.75.183
  61.250.179.81
  61.250.179.89
  61.250.206.110
  61.250.209.35
  61.250.92.26
-61.250.94.3
-61.251.255.5
  61.252.120.81
  61.254.broadband2.iol.cz
-61.255.110.111
-61.255.110.112
  61.255.126.2
  61.28.116.83
  61.29.96.146
+61.3.214.58
  61.3.217.201
  61.32.154.211
  61.32.6.30
@@ -100659,34 +84273,18 @@
  61.37.212.83
  61.39.130.75
  61.39.86.40
-61.39.86.48
  61.39.86.49
  61.41.9.213
-61.42.119.50
  61.43.153.120
  61.47.61.97
  61.47.7.71
-61.48.20.58
-61.48.217.219
-61.49.105.170
-61.49.49.22
  61.5.21.117
  61.5.69.226
-61.50.117.74
-61.50.195.4
-61.50.195.5
-61.50.252.193
  61.51.111.187
-61.51.122.18
-61.51.122.22
-61.51.122.26
-61.51.122.38
  61.51.18.235
  61.51.227.43
-61.51.81.90
  61.52.10.4
  61.52.100.125
-61.52.100.36
  61.52.100.47
  61.52.100.68
  61.52.101.233
@@ -100695,95 +84293,72 @@
  61.52.11.87
  61.52.128.79
  61.52.131.12
-61.52.135.144
-61.52.158.222
-61.52.158.68
-61.52.174.1
+61.52.134.83
+61.52.15.145
+61.52.157.187
+61.52.157.70
+61.52.169.168
  61.52.175.7
  61.52.180.62
-61.52.193.156
+61.52.181.186
+61.52.195.224
  61.52.196.74
  61.52.212.132
+61.52.212.161
  61.52.215.120
-61.52.215.166
-61.52.215.234
+61.52.240.71
  61.52.28.126
  61.52.28.79
-61.52.30.55
-61.52.34.145
+61.52.33.211
+61.52.34.128
  61.52.34.168
-61.52.35.112
  61.52.38.37
  61.52.43.138
-61.52.51.206
-61.52.56.49
  61.52.60.44
+61.52.61.91
  61.52.8.199
  61.52.8.235
  61.52.8.244
  61.52.85.184
-61.52.96.169
+61.52.87.91
  61.52.96.37
  61.52.98.12
  61.52.98.151
  61.52.98.32bin.sh
-61.52.98.45
-61.52.99.142
  61.52.99.240
-61.52.99.98
-61.53.1.230
  61.53.11.91
  61.53.116.228
  61.53.119.67
-61.53.120.78
-61.53.122.204
-61.53.138.111
-61.53.138.19
-61.53.14.35
-61.53.148.18
+61.53.119.71
+61.53.122.28
+61.53.123.222
+61.53.126.201
  61.53.172.203
-61.53.189.197
  61.53.241.13
+61.53.26.184
  61.53.72.40
-61.53.82.173
+61.53.82.195
  61.53.84.140
-61.53.86.54
-61.53.87.160
-61.53.87.186
+61.53.86.124
+61.53.89.93
  61.53.90.194
  61.53.96.12
+61.53.99.9
  61.54.166.59
-61.54.218.30
-61.54.231.129
-61.54.232.239
+61.54.215.61
  61.54.248.217
  61.54.249.180
-61.54.42.105
  61.54.43.28
-61.54.5.60
-61.54.57.220
-61.54.58.172
-61.54.60.102
-61.54.62.114
  61.54.64.102
-61.54.77.6
  61.54.78.161
  61.54.99.22
  61.55.141.11
-61.55.159.151
  61.55.199.29
  61.55.62.74
-61.56.180.152
-61.56.183.55
-61.57.111.235
-61.57.81.193
-61.58.178.58
-61.58.186.97
-61.58.72.237
  61.6.102.116
  61.6.127.188
  61.6.147.172
-61.6.200.56
+61.6.201.210
  61.6.235.228
  61.6.30.199
  61.6.37.23
@@ -100793,122 +84368,76 @@
  61.6.84.171
  61.6.96.130
  61.6.96.19
-61.61.238.124
-61.61.239.186
-61.61.90.100
-61.62.157.233
-61.62.24.129
  61.62.24.204
  61.62.24.204bin.sh
-61.63.107.70
-61.64.10.10
-61.65.112.84
  61.65.172.121
  61.67.240.189
  61.69.193.189
-61.69.193.28
+61.69.195.145
  61.7.132.54
  61.7.138.118
+61.7.138.168
  61.7.139.229
  61.7.141.34
  61.7.142.39
-61.7.146.96
  61.7.147.29
  61.7.167.53
  61.7.177.145
-61.7.177.218
  61.7.177.38
+61.7.183.172
  61.7.183.186
  61.7.183.201
+61.7.183.28
  61.7.191.221
  61.7.191.73
-61.7.191.92
-61.7.214.154
  61.7.233.195
  61.7.235.211
-61.70.110.107
-61.70.132.80
-61.71.116.193
  61.72.181.146
  61.72.211.28
  61.72.255.26
-61.73.108.51
  61.73.191.170
  61.73.51.247
  61.74.246.120
  61.76.115.205
  61.76.169.138
  61.76.222.210
-61.76.74.20
  61.77.185.5
-61.77.34.77
-61.78.100.69
-61.78.14.128
+61.77.198.11
  61.78.210.199bin.sh
  61.78.62.22
-61.79.139.181
-61.79.150.239
  61.79.229.112
  61.79.229.112bin.sh
  61.8.3.157
  61.8.68.238
  61.8.75.186
  61.8.79.68
-61.80.117.152
-61.80.117.155
-61.80.117.246
  61.80.179.118
-61.80.232.217
-61.81.158.158
  61.82.120.130
  61.82.196.172
  61.82.79.253
  61.83.210.246
-61.84.138.57
-61.84.150.39
-61.84.174.11
-61.84.174.35
+61.83.32.157
  61.84.196.50
-61.84.207.132
-61.84.207.133
-61.84.207.97
-61.84.208.45
-61.84.250.133
-61.84.250.216
-61.84.250.57
-61.84.250.7
-61.84.250.71
-61.84.250.77
  61.85.224.42
  61.85.46.47
  61.9.48.102
  61.90.38.173
-61.91.168.98
-61.91.181.162
  61.91.183.86
  61.91.235.226
  61.91.58.158
  61.91.79.40
  61.91.80.107
-61.92.186.222
  61.93.107.87
-61.93.14.110
  61.93.201.198
-61.93.207.118
  61.93.240.170
  61.93.240.18
  61.93.240.65
-61.94.156.190
-61.95.175.74
  61.95.233.61
  61.95.254.195
  61.96.111.133
-61.96.242.84
-61.96.244.193
-61.96.64.182
+61.96.168.214
  61.97.243.109
  61.97.248.72
-61.97.249.174
  61.98.205.218
  61.99.25.130
  61.99.26.40
@@ -100938,7 +84467,6 @@
  62.103.225.208
  62.103.31.24
  62.103.66.57
-62.103.71.86
  62.103.74.230
  62.103.87.101
  62.106.122.90
@@ -100955,13 +84483,13 @@
  62.109.19.103
  62.109.2.235
  62.109.2.52
-62.109.31.192
+62.11.176.215
  62.11.179.173
  62.11.72.101
-62.110.66.66
  62.112.11.188
  62.112.194.132
  62.112.9.142
+62.113.18.223
  62.113.196.48
  62.113.238.135
  62.113.238.136
@@ -100969,19 +84497,16 @@
  62.113.240.122
  62.113.251.95
  62.113.255.8
+62.113.5.136
  62.113.5.217
  62.113.9.217
-62.114.122.175
  62.116.100.88
  62.116.178.196
-62.116.255.52
  62.116.37.200
  62.117.240.207
  62.117.59.229
  62.118.147.22
  62.119.24.133
-62.12.5.178
-62.122.103.110
  62.122.156.74
  62.122.195.162
  62.122.201.170
@@ -100990,6 +84515,7 @@
  62.13.193.206
  62.133.130.122
  62.133.174.247
+62.133.47.144
  62.138.0.25
  62.138.1.43
  62.138.13.36
@@ -101000,15 +84526,14 @@
  62.138.18.158
  62.138.2.243
  62.138.206.160
-62.138.242.20
  62.14.231.138
  62.140.23.192
  62.140.247.10
-62.140.250.122
  62.140.252.72
  62.140.252.74
  62.141.44.19
  62.141.45.90
+62.141.46.70
  62.141.47.10
  62.141.50.135
  62.141.66.110
@@ -101020,7 +84545,9 @@
  62.149.175.39
  62.149.20.10
  62.149.20.29
+62.149.20.51
  62.149.202.3
+62.149.230.21
  62.149.29.152
  62.149.29.47
  62.149.29.48
@@ -101028,29 +84555,22 @@
  62.149.7.164
  62.149.7.167
  62.149.7.172
-62.150.126.58
-62.150.135.217
-62.150.191.66
-62.150.192.1
  62.151.176.197
  62.151.177.85
-62.151.178.144
  62.151.183.34
  62.152.58.16
  62.153.103.153
  62.153.89.22
-62.16.207.60
  62.16.41.210
  62.162.111.153
  62.162.228.66
+62.162.58.40
  62.163.191.99
  62.163.24.180
  62.165.204.143
-62.168.159.42
  62.168.57.109
  62.169.198.18
  62.169.209.105
-62.170.20.41
  62.171.129.32
  62.171.135.115
  62.171.137.184
@@ -101059,7 +84579,6 @@
  62.171.142.179
  62.171.144.155
  62.171.145.148
-62.171.148.41
  62.171.152.105
  62.171.154.12
  62.171.154.196
@@ -101068,7 +84587,6 @@
  62.171.157.83
  62.171.160.189
  62.171.161.47
-62.171.164.116
  62.171.164.192
  62.171.164.69
  62.171.168.212
@@ -101076,20 +84594,20 @@
  62.171.175.89
  62.171.177.203
  62.171.177.80
-62.171.179.106
  62.171.180.108
  62.171.181.68
  62.171.183.29
  62.171.185.159
-62.171.186.21
-62.171.186.33
  62.171.188.160
  62.171.190.193
  62.171.191.136
+62.171.191.176
  62.171.191.72
+62.173.139.133
  62.173.139.164
  62.173.145.48
  62.173.149.24
+62.173.152.105
  62.173.152.15
  62.173.154.183
  62.176.1.194
@@ -101097,15 +84615,13 @@
  62.176.5.93
  62.176.87.170
  62.178.137.113
-62.182.112.251
+62.178.138.46
  62.182.114.164
  62.182.124.205
  62.182.124.206
+62.182.206.118
  62.182.62.35
-62.182.82.219
-62.182.95.222
  62.183.11.8
-62.183.22.63
  62.183.98.181
  62.189.71.12
  62.192.240.250
@@ -101125,11 +84641,8 @@
  62.201.220.50
  62.201.233.59
  62.201.96.142
-62.203.197.178
  62.205.132.245
  62.205.248.22
-62.209.198.65
-62.210.101.43
  62.210.103.45
  62.210.105.112
  62.210.105.116
@@ -101162,10 +84675,7 @@
  62.210.139.92
  62.210.141.185
  62.210.141.227
-62.210.141.35
-62.210.141.43
  62.210.141.58
-62.210.143.164
  62.210.143.245
  62.210.146.148
  62.210.146.7
@@ -101173,7 +84683,6 @@
  62.210.148.247
  62.210.148.87
  62.210.149.68
-62.210.151.81
  62.210.152.87
  62.210.152.90
  62.210.157.10
@@ -101182,12 +84691,10 @@
  62.210.162.182
  62.210.162.219
  62.210.162.89
-62.210.167.176
  62.210.167.199
  62.210.167.201
  62.210.167.89
  62.210.170.165
-62.210.172.8
  62.210.177.221
  62.210.177.34
  62.210.177.44
@@ -101219,7 +84726,7 @@
  62.210.209.171
  62.210.209.245
  62.210.209.94
-62.210.217.207
+62.210.211.168
  62.210.217.35
  62.210.217.36
  62.210.243.247
@@ -101234,7 +84741,6 @@
  62.210.31.10
  62.210.37.82
  62.210.5.92
-62.210.5.96
  62.210.6.33
  62.210.69.173
  62.210.69.176
@@ -101250,7 +84756,6 @@
  62.210.80.66
  62.210.82.105
  62.210.82.173
-62.210.82.83
  62.210.83.122
  62.210.83.206
  62.210.83.87
@@ -101269,39 +84774,28 @@
  62.212.73.211
  62.212.83.41
  62.213.14.166
-62.213.82.18
  62.214.253.214
  62.214.255.75
-62.215.194.209
  62.215.29.18
  62.216.81.175
  62.216.93.204
  62.217.124.203
-62.217.139.158
-62.217.139.196
-62.217.139.245
-62.217.146.114
  62.219.162.155
-62.219.164.172
-62.219.17.134
  62.219.194.210
-62.219.7.6
  62.220.170.66
-62.220.177.141
  62.221.199.121
  62.228.152.100
  62.228.205.38
-62.228.74.213
-62.23.142.219
  62.23.15.92
-62.231.163.161
  62.231.245.5
  62.232.8.82
  62.233.37.237
  62.233.57.200
+62.233.73.23
  62.234.103.165
  62.234.107.104
  62.234.110.91
+62.234.114.180
  62.234.114.64
  62.234.115.87
  62.234.116.144
@@ -101311,14 +84805,11 @@
  62.234.120.3
  62.234.121.61
  62.234.124.104
-62.234.125.137
-62.234.126.132
  62.234.127.234
  62.234.130.216
  62.234.130.87
  62.234.134.156
  62.234.137.128
-62.234.137.26
  62.234.139.142
  62.234.146.45
  62.234.15.136
@@ -101331,13 +84822,13 @@
  62.234.182.174
  62.234.188.157
  62.234.188.160
-62.234.19.124
  62.234.193.119
  62.234.20.135
  62.234.20.222
  62.234.20.26
  62.234.213.198
  62.234.217.203
+62.234.218.151
  62.234.22.198
  62.234.22.200
  62.234.239.134
@@ -101346,19 +84837,15 @@
  62.234.41.136
  62.234.42.203
  62.234.43.48
-62.234.57.138
-62.234.59.58
  62.234.6.147
  62.234.6.66
-62.234.60.226
+62.234.6.68
  62.234.67.135
  62.234.68.31
-62.234.75.193
  62.234.78.62
  62.234.8.154
  62.234.80.115
-62.234.87.235
-62.234.89.176
+62.234.87.242
  62.234.94.202
  62.234.97.207
  62.238.161.92
@@ -101369,16 +84856,12 @@
  62.24.181.135
  62.24.252.133
  62.24.78.2
-62.240.156.126
-62.240.157.54
+62.240.158.16
  62.240.2.41
-62.240.25.67
+62.240.26.2
  62.240.4.4
-62.244.140.37
-62.244.190.91
  62.244.252.146
  62.245.152.33
-62.250.77.255
  62.251.102.242
  62.251.109.216
  62.251.109.38
@@ -101391,7 +84874,6 @@
  62.254.31.211
  62.255.175.74
  62.28.102.242
-62.28.135.104
  62.28.137.98
  62.28.190.194
  62.28.217.62
@@ -101403,6 +84885,7 @@
  62.31.126.33
  62.31.181.67
  62.31.181.68
+62.31.238.18
  62.31.75.71
  62.33.103.24
  62.33.168.46
@@ -101410,9 +84893,9 @@
  62.33.207.201
  62.33.207.202
  62.33.207.98
+62.33.54.95
  62.34.241.167
  62.36.8.2
-62.38.139.152
  62.38.246.130
  62.38.75.208
  62.38.77.184
@@ -101425,26 +84908,23 @@
  62.4.21.231
  62.4.23.127
  62.4.29.73
-62.4.52.12
  62.4.60.50
-62.43.216.11
+62.42.141.33
+62.42.55.217
  62.44.70.253
  62.44.82.61
  62.45.101.226
  62.45.4.139
  62.45.9.116
  62.45.96.7
-62.46.175.44
-62.48.254.33
+62.56.168.66
  62.56.250.68
  62.57.227.12
  62.57.90.188
  62.59.252.145
  62.6.237.182
  62.60.136.109
-62.60.176.194
  62.60.178.195
-62.60.178.229
  62.63.157.106
  62.67.212.41
  62.67.235.148
@@ -101460,6 +84940,7 @@
  62.74.153.118
  62.74.215.136
  62.74.219.154
+62.74.247.182
  62.75.141.82
  62.75.161.37
  62.75.187.192
@@ -101468,25 +84949,24 @@
  62.75.202.55
  62.75.204.249
  62.75.222.59
-62.76.114.187
  62.76.184.138
  62.76.93.40
  62.76.96.6
  62.77.152.150
  62.77.55.23
-62.78.47.212
+62.78.43.54
  62.78.92.35
-62.80.163.236
+62.80.163.237
  62.80.227.49
  62.80.235.224
  62.81.76.18
  62.82.161.68
  62.83.78.94
  62.84.75.50
+62.84.89.53
  62.85.22.115
  62.85.77.116
  62.87.151.132
-62.87.151.138
  62.87.151.186
  62.89.28.108
  62.90.175.115
@@ -101503,16 +84983,13 @@
  62.96.10.98
  62.96.251.229
  62.97.116.82
-62.97.160.161
  62.97.41.107
-62.97.49.121
  62.97.49.122
  62.98.82.208
  62.99.178.46
  62.99.71.228
  62.99.78.120
  62.99.78.177
-62.99.79.12
  62.99.90.10
  620021.com
  6200294-dot-oaao-274308.uc.r.appspot.com
@@ -101576,12 +85053,10 @@
  63.142.161.4
  63.142.252.72
  63.142.54.90
-63.143.110.211
  63.143.32.126
  63.143.38.226
  63.143.45.19
  63.143.96.181
-63.143.96.50
  63.143.98.57
  63.145.54.201
  63.145.54.202
@@ -101597,9 +85072,6 @@
  63.151.9.74
  63.153.241.58
  63.155.93.9
-63.156.176.6
-63.164.96.14
-63.168.21.195
  63.170.254.21
  63.199.35.6
  63.220.1.43
@@ -101609,13 +85081,12 @@
  63.224.37.22
  63.227.116.162
  63.228.117.101
-63.228.42.221
+63.228.117.99
  63.231.128.225
  63.235.160.54
  63.238.56.225
  63.240.155.81
  63.240.240.74
-63.240.250.44
  63.243.252.246
  63.245.178.211
  63.245.66.76
@@ -101635,10 +85106,11 @@
  63.249.96.19
  63.250.32.183
  63.250.32.184
-63.250.32.210
+63.250.32.211
  63.250.32.241
  63.250.32.242
  63.250.32.245
+63.250.32.246
  63.250.32.76
  63.250.33.127
  63.250.36.66
@@ -101663,26 +85135,26 @@
  63.34.167.224
  63.41.222.247
  63.41.36.219
-63.41.9.210
+63.41.36.220
  63.80.184.72
-63.80.187.100
  63.80.187.102
  63.80.187.103
  63.80.187.104
  63.80.187.106
  63.80.187.107
  63.80.187.108
-63.80.187.95
-63.80.187.98
-63.80.187.99
-63.80.191.164
-63.80.191.165
-63.80.191.166
-63.80.191.167
-63.80.191.170
-63.80.191.171
-63.80.191.174
-63.80.191.175
+63.80.187.109
+63.80.187.111
+63.80.187.113
+63.80.187.114
+63.80.187.116
+63.80.191.135
+63.80.191.136
+63.80.191.139
+63.80.191.140
+63.80.191.141
+63.80.191.143
+63.80.191.144
  63.80.191.180
  63.80.191.182
  63.80.191.183
@@ -101694,15 +85166,12 @@
  63.80.191.190
  63.80.191.191
  63.80.191.192
-63.80.191.193
  63.80.191.194
+63.80.191.195
  63.80.89.137
-63.81.82.102
-63.81.82.104
-63.81.82.106
-63.81.82.113
-63.81.82.115
-63.81.82.117
+63.80.89.187
+63.81.82.100
+63.81.82.101
  63.81.82.120
  63.81.82.121
  63.81.82.122
@@ -101715,19 +85184,38 @@
  63.81.82.137
  63.81.82.138
  63.81.82.140
-63.81.82.180
-63.81.82.181
-63.81.82.183
-63.81.82.186
+63.81.82.145
+63.81.82.146
+63.81.82.147
+63.81.82.148
+63.81.82.151
+63.81.82.152
+63.81.82.155
+63.81.82.158
+63.81.82.175
+63.81.82.176
  63.81.82.192
  63.81.82.194
-63.81.82.26
  63.81.82.29
  63.81.82.32
-63.81.82.43
-63.81.82.44
-63.81.82.68
-63.81.90.91
+63.81.82.36
+63.81.82.39
+63.81.82.69
+63.81.82.72
+63.81.82.74
+63.81.82.75
+63.81.82.76
+63.81.82.77
+63.81.82.78
+63.81.82.80
+63.81.82.81
+63.81.90.101
+63.81.90.102
+63.81.90.103
+63.81.90.105
+63.81.90.107
+63.81.90.156
+63.81.90.164
  63.81.90.92
  63.81.90.98
  63.83.78.100
@@ -101736,25 +85224,29 @@
  63.83.78.109
  63.83.78.11
  63.83.78.110
+63.83.78.113
+63.83.78.115
+63.83.78.116
+63.83.78.118
+63.83.78.123
+63.83.78.125
+63.83.78.128
  63.83.78.13
+63.83.78.16
+63.83.78.17
+63.83.78.18
+63.83.78.19
+63.83.78.20
+63.83.78.21
+63.83.78.24
+63.83.78.27
+63.83.78.29
  63.83.78.4
-63.83.78.47
-63.83.78.48
-63.83.78.49
  63.83.78.5
-63.83.78.52
-63.83.78.56
-63.83.78.58
-63.83.78.61
  63.83.78.64
  63.83.78.65
  63.83.78.66
  63.83.78.67
-63.83.78.88
-63.83.78.90
-63.83.78.91
-63.83.78.94
-63.83.78.96
  63.83.78.97
  63.83.78.98
  63.83.78.99
@@ -101794,20 +85286,17 @@
  64.111.116.116
  64.111.99.8
  64.113.32.29
-64.118.201.6
  64.118.84.6
  64.118.84.7
  64.119.197.105
-64.119.197.115
+64.119.213.61
  64.120.239.130
  64.120.51.146
-64.121.237.50
  64.124.100.52
  64.128.143.65
  64.128.143.70
  64.13.225.150
  64.130.171.107
-64.130.180.230
  64.130.215.121
  64.131.184.3
  64.134.167.232
@@ -101827,12 +85316,12 @@
  64.140.150.169
  64.140.169.42
  64.141.19.180
+64.145.65.228
  64.145.76.26
+64.145.79.147
  64.145.79.166
  64.145.79.214
-64.145.79.33
-64.145.79.94
-64.145.93.229
+64.145.94.3
  64.145.94.64
  64.147.114.20
  64.147.6.186
@@ -101856,7 +85345,6 @@
  64.17.30.238
  64.171.9.91
  64.18.194.51
-64.18.250.92
  64.180.6.192
  64.180.80.127
  64.182.235.13
@@ -101865,8 +85353,8 @@
  64.183.100.166
  64.183.185.42
  64.183.73.122
-64.183.78.70
  64.185.14.18
+64.187.167.252
  64.187.169.41
  64.187.175.226
  64.187.217.234
@@ -101878,10 +85366,10 @@
  64.188.44.114
  64.189.249.37
  64.190.203.117
-64.190.92.64
  64.20.36.237
  64.20.49.154
  64.20.50.138
+64.20.53.82
  64.201.134.235
  64.202.102.218
  64.202.161.41
@@ -101906,7 +85394,6 @@
  64.22.67.37
  64.225.102.125
  64.225.104.20
-64.225.106.89
  64.225.109.187
  64.225.112.216
  64.225.113.246
@@ -101915,7 +85402,6 @@
  64.225.117.206
  64.225.119.164
  64.225.121.105
-64.225.124.42
  64.225.125.7
  64.225.18.167
  64.225.25.159
@@ -101925,23 +85411,20 @@
  64.225.39.69
  64.225.41.230
  64.225.43.21
-64.225.43.55
-64.225.44.22
  64.225.45.81
  64.225.47.15
  64.225.53.232
  64.225.55.239
  64.225.56.47
  64.225.64.215
-64.225.64.96
+64.225.65.250
  64.225.67.233
-64.225.68.218
  64.225.70.10
  64.225.71.231
-64.225.72.229
  64.225.74.251
  64.225.74.47
  64.225.75.212
+64.225.75.30
  64.225.78.96
  64.225.79.138
  64.227.0.234
@@ -101953,12 +85436,8 @@
  64.227.100.165
  64.227.100.204
  64.227.101.139
-64.227.101.45
-64.227.104.19
  64.227.105.229
  64.227.105.88
-64.227.106.112
-64.227.106.15
  64.227.109.20
  64.227.111.127
  64.227.111.211
@@ -101969,18 +85448,17 @@
  64.227.13.20
  64.227.15.172
  64.227.17.246
-64.227.19.127
  64.227.19.129
  64.227.2.136
  64.227.2.138
  64.227.2.152
+64.227.2.189
  64.227.2.2
  64.227.20.14
  64.227.21.35
  64.227.24.158
  64.227.24.186
  64.227.25.222
-64.227.26.36
  64.227.26.97
  64.227.27.232
  64.227.27.54
@@ -101988,21 +85466,11 @@
  64.227.31.182
  64.227.31.71
  64.227.31.81
-64.227.32.97
  64.227.33.176
-64.227.34.226
-64.227.35.132
  64.227.35.148
  64.227.37.126
  64.227.37.201
  64.227.37.93
-64.227.38.194
-64.227.38.210
-64.227.39.77
-64.227.41.242
-64.227.42.182
-64.227.42.185
-64.227.42.191
  64.227.44.187
  64.227.45.247
  64.227.46.1
@@ -102010,20 +85478,14 @@
  64.227.53.63
  64.227.57.139
  64.227.58.145
-64.227.64.219
  64.227.64.242
  64.227.67.106
  64.227.69.170
-64.227.69.178
  64.227.71.34
  64.227.72.109
  64.227.73.149
-64.227.74.255
-64.227.75.111
  64.227.75.56
  64.227.77.253
-64.227.77.84
-64.227.78.60
  64.227.8.206
  64.227.81.135
  64.227.84.163
@@ -102031,9 +85493,7 @@
  64.227.93.129
  64.227.94.175
  64.227.97.122
-64.227.97.195
  64.227.97.247
-64.227.99.233
  64.231.23.193
  64.232.166.231
  64.233.128.23
@@ -102059,10 +85519,7 @@
  64.27.10.80
  64.27.7.215
  64.29.146.185
-64.30.37.40
  64.31.10.194
-64.31.8.10
-64.32.0.99
  64.32.104.210
  64.32.122.161
  64.32.137.180
@@ -102088,20 +85545,15 @@
  64.42.183.66
  64.44.133.131
  64.44.40.66
+64.44.48.38
  64.46.4.160
  64.46.6.37
-64.46.83.194
  64.50.161.60
-64.52.169.202
  64.52.84.166
  64.52.85.184
  64.52.85.67
  64.53.14.211
-64.53.185.71
  64.53.207.60
-64.57.122.74
-64.57.124.245
-64.57.126.122
  64.59.72.248
  64.6.104.146
  64.6.107.34
@@ -102116,7 +85568,6 @@
  64.62.252.163
  64.64.104.10
  64.64.225.130
-64.64.226.111
  64.64.227.224
  64.64.227.83
  64.64.229.51
@@ -102127,13 +85578,11 @@
  64.64.240.38
  64.64.241.33
  64.64.242.67
+64.64.245.122
  64.64.247.166
-64.67.106.111
-64.67.24.39
+64.68.115.87
  64.68.224.190
  64.68.224.2
-64.68.236.225
-64.68.250.119
  64.69.57.110
  64.69.57.119
  64.69.57.127
@@ -102230,13 +85679,10 @@
  64.69.57.76
  64.69.57.98
  64.71.131.100
-64.71.178.100
-64.71.178.84
  64.71.73.142
  64.71.74.75
  64.71.78.243
  64.71.79.6
-64.72.230.154
  64.74.160.251
  64.74.215.158
  64.74.215.59
@@ -102274,7 +85720,6 @@
  64.90.50.241
  64.90.50.250
  64.90.50.44
-64.90.50.70
  64.90.50.79
  64.90.50.87
  64.90.51.156
@@ -102314,8 +85759,6 @@
  64.91.248.243
  64.91.254.11
  64.91.4.131
-64.91.60.164
-64.91.60.84
  64.92.112.118
  64.94.208.202
  64.94.208.236
@@ -102346,25 +85789,23 @@
  649552219977630-dot-aql-rkl-evh.appspot.com
  64afe3595b5d8be9d60b91dae8c8bac4c1d83d72.info
  64bcf0cbd205160fc348d46e26baa31239b47dfa.info
+65.0.138.25
  65.0.167.226
+65.0.183.54
  65.0.220.72
  65.0.3.156
  65.0.31.205
  65.0.87.128
-65.0.88.170
  65.101.247.82
  65.101.247.83
  65.102.49.62
  65.107.59.68
-65.110.220.53
+65.110.221.61
  65.111.119.55
  65.111.165.14
  65.111.165.192
  65.111.173.161
-65.120.128.118
-65.127.136.154
  65.128.19.157
-65.128.30.78
  65.130.33.85
  65.130.39.119
  65.130.39.18
@@ -102373,19 +85814,19 @@
  65.151.189.73
  65.155.32.108
  65.155.32.143
-65.155.32.147
  65.155.32.171
-65.155.32.183
-65.155.32.190
-65.155.32.202
-65.155.32.228
+65.155.32.174
+65.155.32.226
  65.155.32.235
+65.155.32.241
  65.155.32.61
  65.155.32.65
-65.155.32.74
  65.155.32.79
-65.155.32.84
-65.158.126.62
+65.155.32.83
+65.155.32.91
+65.169.38.37
+65.169.39.29
+65.169.39.38
  65.17.190.193
  65.171.1.175
  65.172.242.149
@@ -102398,7 +85839,6 @@
  65.18.192.85
  65.18.192.91
  65.181.123.254
-65.181.123.41
  65.181.124.236
  65.181.84.82
  65.181.90.133
@@ -102408,10 +85848,8 @@
  65.183.76.89
  65.184.156.234
  65.187.208.122
-65.189.77.139
  65.19.167.131
  65.19.167.132
-65.19.174.248
  65.19.181.224
  65.191.76.227
  65.196.87.161
@@ -102422,7 +85860,6 @@
  65.23.154.17
  65.24.37.71
  65.24.54.99
-65.243.148.134
  65.25.114.133
  65.254.32.98
  65.254.51.178
@@ -102431,7 +85868,6 @@
  65.26.224.48
  65.27.134.105
  65.27.179.78
-65.28.34.215
  65.30.124.236
  65.36.62.20
  65.36.83.142
@@ -102443,69 +85879,8 @@
  65.41.75.21
  65.49.132.179
  65.49.14.72
-65.49.19.102
-65.49.194.252
  65.49.196.138
-65.49.20.100
-65.49.20.101
-65.49.20.102
-65.49.20.103
-65.49.20.104
-65.49.20.105
-65.49.20.106
-65.49.20.107
-65.49.20.108
-65.49.20.109
-65.49.20.110
-65.49.20.111
-65.49.20.112
-65.49.20.113
-65.49.20.114
-65.49.20.115
-65.49.20.116
-65.49.20.117
-65.49.20.118
-65.49.20.119
-65.49.20.120
-65.49.20.121
-65.49.20.122
-65.49.20.123
-65.49.20.124
-65.49.20.125
-65.49.20.126
-65.49.20.66
-65.49.20.68
-65.49.20.69
-65.49.20.70
-65.49.20.71
-65.49.20.72
-65.49.20.73
-65.49.20.74
-65.49.20.75
-65.49.20.76
-65.49.20.77
-65.49.20.78
-65.49.20.79
-65.49.20.80
-65.49.20.81
-65.49.20.82
-65.49.20.83
-65.49.20.84
-65.49.20.85
-65.49.20.86
-65.49.20.87
-65.49.20.88
-65.49.20.89
-65.49.20.90
-65.49.20.91
-65.49.20.92
-65.49.20.93
-65.49.20.94
-65.49.20.95
-65.49.20.96
-65.49.20.97
-65.49.20.98
-65.49.20.99
+65.49.198.117
  65.49.201.168
  65.49.204.184
  65.49.206.125
@@ -102514,9 +85889,7 @@
  65.49.221.49
  65.49.222.222
  65.49.227.228
-65.49.52.162
  65.49.71.68
-65.49.76.131
  65.50.209.87
  65.51.251.218
  65.52.123.63
@@ -102531,10 +85904,6 @@
  65.60.11.122
  65.60.144.25
  65.60.44.2
-65.60.44.3
-65.60.44.4
-65.60.44.5
-65.60.44.6
  65.60.53.122
  65.61.221.151
  65.64.8.59
@@ -102544,7 +85913,6 @@
  65.79.201.78
  65.79.201.79
  65.79.205.104
-65.87.231.10
  65.88.123.136
  65.94.25.216
  65.96.153.214
@@ -102594,9 +85962,7 @@
  66.11.230.202
  66.11.240.250
  66.11.32.201
-66.11.41.98
  66.110.114.178
-66.110.120.2
  66.110.255.228
  66.111.39.40
  66.111.41.200
@@ -102608,12 +85974,10 @@
  66.112.212.51
  66.112.218.245
  66.112.218.78
-66.113.195.77
-66.113.212.22
+66.113.208.183
  66.113.221.43
-66.113.223.208
  66.114.33.90
-66.115.111.205
+66.115.147.95
  66.115.149.227
  66.115.149.228
  66.115.149.230
@@ -102627,23 +85991,14 @@
  66.118.142.60
  66.118.164.146
  66.118.198.247
-66.119.160.235
-66.119.169.237
-66.128.241.205
-66.128.244.113
  66.128.254.32
  66.128.255.4
  66.128.34.136
-66.129.151.99
-66.129.153.118
-66.130.183.142
-66.130.187.185
  66.131.46.83
  66.132.216.24
  66.135.227.178
  66.135.34.113
  66.135.79.25
-66.138.38.201
  66.143.231.89
  66.146.162.21
  66.146.193.33
@@ -102656,29 +86011,24 @@
  66.15.76.101
  66.150.114.30
  66.150.70.244
-66.150.71.203
  66.150.71.206
-66.151.211.50
  66.151.242.154
-66.152.189.122
  66.154.105.122
  66.154.105.123
  66.154.107.47
  66.154.112.136
  66.154.125.164
-66.158.213.201
  66.160.128.215
  66.160.134.3
  66.160.144.159
-66.160.199.9
+66.160.201.118
  66.160.201.176
  66.165.95.169
+66.168.169.184
  66.168.204.54
  66.168.40.18
  66.168.89.81
  66.171.177.230
-66.171.58.17
-66.171.9.233
  66.172.106.169
  66.172.110.160
  66.172.8.101
@@ -102693,19 +86043,16 @@
  66.175.222.66
  66.175.230.5
  66.176.110.18
-66.176.38.186
  66.179.32.5
  66.18.172.21
  66.18.4.147
  66.18.66.193
+66.181.161.30
  66.181.94.150
-66.185.53.6
  66.186.10.67
-66.189.122.244
-66.189.215.249
+66.189.32.7
  66.189.4.165
  66.191.121.190
-66.191.60.89
  66.192.70.36
  66.193.171.195
  66.193.171.202
@@ -102719,9 +86066,9 @@
  66.193.171.236
  66.193.171.247
  66.193.171.249
-66.198.240.26
-66.198.246.101
+66.198.240.10
  66.199.146.96
+66.199.191.89
  66.199.233.138
  66.203.207.67
  66.206.13.51
@@ -102739,34 +86086,28 @@
  66.207.205.182
  66.207.69.154
  66.207.91.103
+66.207.93.28
  66.208.117.228
  66.208.124.99
  66.209.50.134
  66.209.69.165
-66.212.17.162
-66.212.195.79
  66.213.244.147
  66.214.138.114
  66.214.249.234
  66.215.102.131
-66.215.65.145
+66.215.76.77
  66.216.127.211
  66.216.236.131
-66.220.12.90
  66.220.123.13
  66.220.247.9
+66.220.30.42
  66.222.149.143
-66.222.218.19
-66.222.249.2
  66.222.252.124
-66.223.209.18
  66.226.77.13
  66.228.132.9
  66.228.135.203
  66.228.42.10
-66.228.42.26
  66.228.43.177
-66.228.46.113
  66.228.48.100
  66.228.53.224
  66.228.53.23
@@ -102780,8 +86121,6 @@
  66.229.1.242
  66.229.161.86
  66.229.214.115
-66.229.72.188
-66.229.92.206
  66.230.192.172
  66.230.213.52
  66.230.230.230
@@ -102795,18 +86134,15 @@
  66.238.70.101
  66.240.183.76
  66.240.192.138
-66.240.205.34
  66.240.219.146
  66.240.231.154
-66.240.236.119
  66.240.237.155
  66.240.237.172
  66.244.236.248
-66.244.251.246
+66.248.171.120
  66.248.180.44
  66.248.202.132
  66.248.205.80
-66.248.206.76
  66.251.139.83
  66.251.139.92
  66.251.160.254
@@ -102823,11 +86159,8 @@
  66.34.200.215
  66.34.246.52
  66.36.120.3
-66.36.137.27
  66.36.242.84
  66.36.40.210
-66.37.110.238
-66.38.81.102
  66.40.25.236
  66.41.244.120
  66.42.103.223
@@ -102849,26 +86182,23 @@
  66.42.83.35
  66.42.99.216
  66.44.14.135
-66.45.235.146
  66.45.248.245
  66.45.251.148
  66.45.255.91
  66.46.188.158
  66.49.84.65
  66.54.249.38
-66.54.98.231
  66.55.152.251
  66.55.161.16
  66.55.211.146
  66.56.28.91
  66.56.83.6
+66.56.83.69
  66.57.6.23
-66.60.110.202
-66.61.218.6
  66.61.94.36
  66.63.165.7
  66.64.14.18
-66.65.148.22
+66.64.15.178
  66.68.187.140
  66.68.85.16
  66.69.20.214
@@ -102898,7 +86228,6 @@
  66.70.218.233
  66.70.225.220
  66.70.228.168
-66.70.238.23
  66.70.247.216
  66.71.188.11
  66.71.241.146
@@ -102906,13 +86235,10 @@
  66.71.247.94
  66.74.111.244
  66.76.12.94
-66.76.248.44
-66.76.27.71
  66.76.58.60
  66.79.163.22
  66.8.203.16
  66.82.22.79
-66.83.166.14
  66.84.18.202
  66.84.9.244
  66.85.147.16
@@ -102920,7 +86246,6 @@
  66.85.157.104
  66.85.157.66
  66.85.157.73
-66.85.236.175
  66.85.46.4
  66.85.47.62
  66.90.118.42
@@ -102966,8 +86291,6 @@
  67.107.8.13
  67.107.89.60
  67.11.139.67
-67.11.150.52
-67.134.32.83
  67.149.32.99
  67.15.177.55
  67.154.191.164
@@ -102979,25 +86302,22 @@
  67.162.53.22
  67.163.129.15
  67.163.135.106
-67.163.37.233
  67.164.15.15
  67.165.9.74
  67.167.104.190
+67.168.188.25
  67.168.223.110
-67.168.28.124
  67.168.56.253
  67.170.122.121
  67.170.192.229
  67.170.193.219
  67.170.250.203
  67.170.72.219
-67.173.127.128
  67.173.5.122
  67.174.205.218
+67.175.41.25
  67.176.235.114
  67.180.251.161
-67.181.132.191
-67.184.114.214
  67.186.197.78
  67.187.165.231
  67.189.112.138
@@ -103009,13 +86329,14 @@
  67.19.66.10
  67.190.118.9
  67.190.159.9
+67.190.164.104
+67.191.74.66
  67.192.106.18
  67.192.120.182
  67.192.120.211
  67.192.246.178
  67.192.9.250
  67.193.108.70
-67.193.79.192
  67.197.147.243
  67.197.153.19
  67.197.155.219
@@ -103037,13 +86358,13 @@
  67.2.93.100
  67.20.174.54
  67.20.61.70
-67.200.151.42
  67.201.11.53
  67.202.202.202
  67.202.75.242
  67.204.1.222
  67.204.21.1
  67.204.21.17
+67.205.10.97
  67.205.108.141
  67.205.128.177
  67.205.131.191
@@ -103066,7 +86387,6 @@
  67.205.142.48
  67.205.144.65
  67.205.145.123
-67.205.145.234
  67.205.146.12
  67.205.146.211
  67.205.147.108
@@ -103100,6 +86420,7 @@
  67.205.171.198
  67.205.174.190
  67.205.174.209
+67.205.176.202
  67.205.176.238
  67.205.178.62
  67.205.178.8
@@ -103107,9 +86428,7 @@
  67.205.181.220
  67.205.181.229
  67.205.181.52
-67.205.182.46
  67.205.183.125
-67.205.183.14
  67.205.184.79
  67.205.187.133
  67.205.187.181
@@ -103120,7 +86439,9 @@
  67.205.191.127
  67.205.31.50
  67.205.38.108
-67.206.200.122
+67.205.39.172
+67.206.160.50
+67.206.163.238
  67.206.200.42
  67.206.213.202
  67.206.220.213
@@ -103128,10 +86449,8 @@
  67.207.147.51
  67.207.157.225
  67.207.207.142
-67.207.32.112
  67.207.82.122
  67.207.84.158
-67.207.84.36
  67.207.84.53
  67.207.85.223
  67.207.86.191
@@ -103160,7 +86479,6 @@
  67.211.155.95
  67.211.156.165
  67.211.157.223
-67.211.208.194
  67.211.209.16
  67.211.209.18
  67.211.218.74
@@ -103168,14 +86486,12 @@
  67.212.186.138
  67.212.186.194
  67.212.186.250
-67.212.218.242
  67.212.238.201
  67.213.212.11
  67.213.212.12
  67.213.212.16
  67.213.82.137
  67.213.87.21
-67.213.88.27
  67.214.167.194
  67.215.224.101
  67.215.248.8
@@ -103183,7 +86499,6 @@
  67.215.7.110
  67.215.9.234
  67.215.9.236
-67.216.133.253
  67.216.192.11
  67.216.200.240
  67.216.204.183
@@ -103191,9 +86506,7 @@
  67.216.216.103
  67.216.218.208
  67.216.220.27
-67.216.221.59
  67.216.223.29
-67.216.58.76
  67.217.12.169
  67.218.131.214
  67.218.133.193
@@ -103211,13 +86524,11 @@
  67.220.144.83
  67.220.144.90
  67.221.105.148
-67.221.137.226
  67.221.193.55
  67.222.1.40
  67.222.10.47
  67.222.109.40
  67.222.131.151
-67.222.138.46
  67.222.16.112
  67.225.130.109
  67.225.139.208
@@ -103233,7 +86544,6 @@
  67.225.3.192
  67.225.31.100
  67.227.134.140
-67.227.152.142
  67.227.153.77
  67.227.167.130
  67.227.193.174
@@ -103248,7 +86558,6 @@
  67.229.159.125
  67.229.159.126
  67.229.175.5
-67.229.197.186
  67.229.243.119
  67.229.29.10
  67.229.29.107
@@ -103292,16 +86601,13 @@
  67.229.48.242
  67.229.48.243
  67.229.48.247
-67.229.57.234
  67.229.97.227
  67.23.244.96
-67.230.161.179
  67.230.173.18
  67.230.190.2
  67.230.191.205
  67.230.51.241
  67.231.16.205
-67.231.21.21
  67.233.127.107
  67.234.103.103
  67.234.117.8
@@ -103325,7 +86631,6 @@
  67.240.254.142
  67.241.11.18
  67.241.150.89
-67.245.36.139
  67.245.47.152
  67.247.22.17
  67.249.107.195
@@ -103335,14 +86640,12 @@
  67.253.192.121
  67.253.203.141
  67.253.72.119
-67.253.90.179
-67.255.114.169
+67.255.201.168
+67.255.207.90
  67.255.253.25
  67.29.139.234
  67.4.169.128
  67.40.148.193
-67.42.197.20
-67.43.7.162
  67.48.50.126
  67.5.28.164
  67.52.119.174
@@ -103354,9 +86657,7 @@
  67.55.90.132
  67.59.151.227
  67.59.156.163
-67.6.13.119
  67.60.137.219
-67.61.119.3
  67.63.94.101
  67.69.76.13
  67.69.76.169
@@ -103365,15 +86666,11 @@
  67.70.18.29
  67.71.223.61
  67.75.2.39
-67.78.106.21
  67.78.143.182
-67.78.173.90
  67.78.86.18
  67.79.44.82
  67.80.164.152
  67.80.191.100
-67.83.127.71
-67.83.175.24
  67.83.49.234
  67.84.138.165
  67.85.105.1
@@ -103404,10 +86701,10 @@
  68.0.185.136
  68.0.230.118
  68.1.44.65
-68.1.64.48
  68.10.137.56
  68.10.18.22
  68.101.62.26
+68.102.242.116
  68.102.85.136
  68.104.65.149
  68.105.210.206
@@ -103420,18 +86717,16 @@
  68.111.3.250
  68.113.97.155
  68.114.229.171
-68.114.95.61
  68.115.200.170
  68.116.209.127
  68.116.41.6
  68.116.72.158
  68.119.137.39
  68.119.215.85
-68.12.98.161
  68.129.153.254
-68.132.136.198
  68.132.210.10
  68.132.64.146
+68.134.118.57
  68.134.124.227
  68.134.161.187
  68.135.5.60
@@ -103439,23 +86734,18 @@
  68.145.134.63
  68.145.170.102
  68.146.105.4
-68.146.204.203
  68.148.103.103
  68.148.133.128
  68.15.151.20
  68.15.188.5
-68.15.224.140
  68.15.4.29
-68.150.109.112
  68.150.197.122
-68.150.248.120
-68.150.88.99
-68.16.12.78
-68.162.121.232
  68.166.0.184
+68.167.178.187
  68.168.115.243
  68.168.142.29
  68.168.142.91
+68.168.184.205
  68.168.213.251
  68.168.213.252
  68.169.147.228
@@ -103463,6 +86753,7 @@
  68.169.43.232
  68.169.51.212
  68.170.36.100
+68.170.75.134
  68.171.103.75
  68.171.131.137
  68.171.179.72
@@ -103471,7 +86762,6 @@
  68.171.65.230
  68.172.243.146
  68.173.125.43
-68.173.245.139
  68.174.15.223
  68.175.107.153
  68.178.103.180
@@ -103545,9 +86835,7 @@
  68.183.137.83
  68.183.139.169
  68.183.140.19
-68.183.141.242
  68.183.141.36
-68.183.143.152
  68.183.143.192
  68.183.145.59
  68.183.146.178
@@ -103559,7 +86847,6 @@
  68.183.156.109
  68.183.158.1
  68.183.159.1
-68.183.159.55
  68.183.159.95
  68.183.16.53
  68.183.169.251
@@ -103568,53 +86855,44 @@
  68.183.178.26
  68.183.179.184
  68.183.179.79
-68.183.18.0
  68.183.18.169
  68.183.18.233
-68.183.180.142
  68.183.180.82
  68.183.181.221
  68.183.181.7
  68.183.181.83
  68.183.182.100
-68.183.182.103
-68.183.182.99
+68.183.184.7
  68.183.186.142
  68.183.186.231
  68.183.186.232
  68.183.186.29
  68.183.188.105
  68.183.188.159
-68.183.188.250
-68.183.188.37
  68.183.188.82
-68.183.188.89
  68.183.189.200
  68.183.189.30
  68.183.19.26
  68.183.190.199
  68.183.190.43
-68.183.191.152
  68.183.191.39
  68.183.192.217
  68.183.193.148
  68.183.203.140
  68.183.203.160
  68.183.203.98
-68.183.206.109
  68.183.207.62
-68.183.207.70
  68.183.208.127
  68.183.208.224
  68.183.208.248
  68.183.208.60
  68.183.209.163
  68.183.210.111
-68.183.210.146
  68.183.211.117
  68.183.212.10
  68.183.215.125
  68.183.215.41
+68.183.215.68
  68.183.217.193
  68.183.217.207
  68.183.218.177
@@ -103629,22 +86907,14 @@
  68.183.221.115
  68.183.221.244
  68.183.221.27
-68.183.226.4
  68.183.227.87
-68.183.228.104
  68.183.228.203
  68.183.229.218
  68.183.229.95
  68.183.23.190
-68.183.230.117
  68.183.230.184
-68.183.231.199
-68.183.231.221
  68.183.231.225
  68.183.231.238
-68.183.231.26
-68.183.231.69
-68.183.231.8
  68.183.232.63
  68.183.232.96
  68.183.234.51
@@ -103661,21 +86931,19 @@
  68.183.28.137
  68.183.29.78
  68.183.31.114
-68.183.34.176
  68.183.34.58
  68.183.35.255
  68.183.36.245
-68.183.36.5
  68.183.38.145
  68.183.41.140
  68.183.48.80
+68.183.49.136
  68.183.50.27
  68.183.52.2
  68.183.53.170
  68.183.54.149
  68.183.54.191
  68.183.54.79
-68.183.55.223
  68.183.57.194
  68.183.58.220
  68.183.63.109
@@ -103694,7 +86962,6 @@
  68.183.75.207
  68.183.75.251
  68.183.75.56
-68.183.76.95
  68.183.78.119
  68.183.78.137
  68.183.78.53
@@ -103702,38 +86969,31 @@
  68.183.83.38
  68.183.86.159
  68.183.87.153
-68.183.88.170
  68.183.88.186
  68.183.89.147
-68.183.92.52
+68.183.94.63
  68.183.95.100
  68.184.192.42
  68.184.193.116
-68.184.194.34
  68.185.36.187
-68.186.187.8
+68.185.72.86
  68.186.241.2
  68.186.33.98
-68.186.85.14
+68.187.120.240
  68.188.11.189
  68.188.112.97
  68.188.63.149
  68.189.184.40
-68.189.200.115
  68.190.212.219
  68.191.26.14
-68.192.21.94
  68.193.247.240
-68.193.34.13
  68.194.85.201
+68.196.44.188
+68.199.157.183
  68.199.159.147
-68.199.18.122
-68.199.236.241
  68.199.40.52
  68.2.104.20
-68.2.151.73
  68.200.165.128
-68.200.175.178
  68.202.138.246
  68.203.9.66
  68.204.106.148
@@ -103741,6 +87001,7 @@
  68.204.88.29
  68.206.159.58
  68.206.25.169
+68.207.51.6
  68.222.218.18
  68.224.249.74
  68.224.6.232
@@ -103750,34 +87011,26 @@
  68.228.184.215
  68.229.125.163
  68.231.7.169
-68.232.62.69
  68.233.22.64
  68.233.33.2
  68.234.41.136
  68.234.44.108
  68.235.139.17
-68.235.152.22
  68.236.156.170
-68.236.212.86
  68.251.59.20
  68.253.255.10
-68.255.154.241
  68.255.156.146
-68.32.243.30
-68.37.209.35
-68.37.92.238
  68.38.37.15
-68.38.55.139
  68.39.235.42
  68.4.215.225
  68.41.134.30
  68.41.31.115
+68.42.204.116
  68.44.137.144
  68.44.243.74
  68.46.38.171
  68.47.30.132
  68.47.41.211
-68.48.100.230
  68.48.131.251
  68.48.240.245
  68.49.83.73
@@ -103787,10 +87040,9 @@
  68.50.46.131
  68.53.195.9
  68.54.100.49
-68.56.204.162
+68.55.245.140
  68.6.208.62
  68.60.2.57
-68.60.73.193
  68.61.132.238
  68.62.245.148
  68.64.168.226
@@ -103808,23 +87060,17 @@
  68.67.90.225
  68.67.95.68
  68.68.162.133
-68.68.203.72
  68.69.155.181
  68.7.42.133
  68.7.42.238
  68.71.133.101
+68.71.242.113
  68.71.37.13
-68.73.117.66
  68.73.49.153
  68.80.60.182
  68.82.238.247
-68.84.120.29
-68.89.132.242
-68.94.186.136
  68.94.189.59
-68.96.85.98
  68.99.180.30
-68.99.206.195
  681-365.net
  68113.dojnh.com
  6823-dot-n-e-w-me-ss-age-po-rt-al.wl.r.appspot.com
@@ -103893,19 +87139,15 @@
  68r4a.app.link
  69-lk.us-south.cf.appdomain.cloud
  69.0.163.102
-69.1.100.197
-69.1.128.209
-69.1.3.244
  69.10.135.205
  69.10.136.56
  69.10.37.130
  69.10.40.42
  69.10.62.78
  69.117.48.170
-69.118.182.115
  69.119.193.9
+69.119.30.86
  69.119.85.43
-69.12.15.213
  69.12.28.148
  69.12.66.200
  69.12.66.212
@@ -103930,101 +87172,83 @@
  69.13.39.34
  69.13.39.39
  69.13.39.40
-69.130.207.107
-69.130.94.155
  69.132.254.27
  69.132.38.22
+69.136.1.174
  69.136.133.28
  69.136.135.88
  69.137.140.197
-69.138.101.197
  69.138.189.201
  69.14.145.75
  69.14.157.165
  69.14.208.221
-69.140.120.42
  69.143.214.211
-69.143.96.163
+69.143.239.238
  69.144.148.236
+69.144.190.16
  69.144.99.202
-69.146.228.143
-69.146.251.94
  69.147.219.103
  69.147.219.108
-69.147.219.110
-69.147.219.117
+69.147.219.109
  69.147.219.121
  69.147.219.122
-69.147.219.125
-69.147.219.130
-69.147.219.141
-69.147.219.165
-69.147.219.170
-69.147.219.19
-69.147.219.197
+69.147.219.17
+69.147.219.195
+69.147.219.201
  69.147.219.202
-69.147.219.206
-69.147.219.237
+69.147.219.208
+69.147.219.240
  69.147.219.242
  69.147.219.246
  69.147.219.42
  69.147.219.45
-69.147.219.80
+69.147.219.85
+69.147.219.87
  69.147.220.111
-69.147.220.14
+69.147.220.120
  69.147.220.141
+69.147.220.150
+69.147.220.182
+69.147.220.183
  69.147.220.195
-69.147.220.199
  69.147.220.20
-69.147.220.229
+69.147.220.23
  69.147.220.241
+69.147.220.245
  69.147.220.36
-69.147.220.40
-69.147.220.48
-69.147.220.53
-69.147.220.7
  69.147.220.89
  69.147.221.101
  69.147.221.109
+69.147.221.116
+69.147.221.118
  69.147.221.122
  69.147.221.128
-69.147.221.129
-69.147.221.132
-69.147.221.138
-69.147.221.142
-69.147.221.164
-69.147.221.184
-69.147.221.192
+69.147.221.162
+69.147.221.17
+69.147.221.172
+69.147.221.174
  69.147.221.199
  69.147.221.203
  69.147.221.215
+69.147.221.220
  69.147.221.221
-69.147.221.23
+69.147.221.228
  69.147.221.233
  69.147.221.243
-69.147.221.247
-69.147.221.26
+69.147.221.253
  69.147.221.37
-69.147.221.45
-69.147.221.46
-69.147.221.51
  69.147.221.61
-69.147.221.70
-69.147.221.73
+69.147.221.78
  69.147.221.87
  69.147.222.113
-69.147.222.114
-69.147.222.119
-69.147.222.164
  69.147.222.169
-69.147.222.19
-69.147.222.252
+69.147.222.171
+69.147.222.222
+69.147.222.244
+69.147.222.246
  69.147.222.28
-69.147.222.6
-69.147.222.76
  69.15.68.38
  69.150.120.253
-69.158.207.141
  69.158.53.171
  69.158.55.140
  69.159.45.249
@@ -104034,10 +87258,9 @@
  69.160.8.50
  69.162.105.66
  69.162.111.67
-69.162.117.142
  69.162.69.205
  69.162.79.242
-69.162.83.246
+69.162.94.166
  69.162.99.158
  69.162.99.42
  69.163.146.251
@@ -104105,6 +87328,7 @@
  69.163.162.240
  69.163.162.245
  69.163.162.247
+69.163.162.253
  69.163.162.44
  69.163.162.47
  69.163.163.120
@@ -104120,7 +87344,6 @@
  69.163.163.217
  69.163.163.22
  69.163.163.32
-69.163.163.53
  69.163.163.57
  69.163.163.6
  69.163.163.88
@@ -104153,7 +87376,6 @@
  69.163.165.204
  69.163.165.209
  69.163.165.22
-69.163.165.233
  69.163.165.89
  69.163.166.12
  69.163.166.126
@@ -104172,7 +87394,6 @@
  69.163.179.6
  69.163.196.154
  69.163.197.8
-69.163.224.103
  69.163.234.137
  69.163.248.109
  69.163.33.84
@@ -104186,13 +87407,9 @@
  69.164.202.31
  69.164.205.136
  69.164.212.86
-69.164.216.8
-69.165.224.111
-69.165.75.3
  69.167.13.148
  69.167.151.209
  69.168.166.85
-69.17.201.133
  69.170.216.69
  69.170.74.138
  69.171.117.203
@@ -104202,7 +87419,9 @@
  69.171.17.39
  69.171.17.45
  69.171.17.46
+69.171.209.176
  69.171.209.241
+69.171.209.69
  69.171.66.223
  69.171.71.21
  69.171.72.101
@@ -104211,8 +87430,6 @@
  69.171.78.120
  69.171.78.223
  69.171.78.225
-69.171.80.45
-69.172.161.147
  69.172.165.196
  69.172.172.249
  69.172.245.54
@@ -104225,13 +87442,9 @@
  69.175.44.42
  69.175.49.230
  69.175.83.34
-69.175.89.170
-69.175.89.171
-69.175.89.172
-69.175.89.173
-69.175.89.174
  69.176.89.100
  69.176.89.89
+69.176.90.33
  69.176.90.6
  69.176.90.7
  69.178.49.209
@@ -104239,6 +87452,7 @@
  69.179.38.78
  69.179.39.184
  69.179.4.41
+69.181.162.176
  69.183.32.121
  69.194.11.249
  69.194.15.75
@@ -104263,6 +87477,7 @@
  69.197.189.27
  69.197.189.44
  69.197.189.51
+69.197.190.131
  69.197.32.119
  69.199.44.59
  69.2.244.202
@@ -104280,20 +87495,21 @@
  69.218.221.5
  69.22.184.249
  69.23.123.146
+69.232.39.139
  69.237.82.158
  69.243.112.142
  69.245.71.26
  69.246.26.72
-69.247.82.140
+69.247.40.211
  69.248.146.7
  69.248.230.219
+69.248.86.234
  69.249.137.104
  69.249.242.128
  69.25.236.60
  69.25.27.246
-69.251.82.109
-69.255.141.238
-69.255.146.74
+69.253.104.186
+69.254.146.8
  69.30.198.178
  69.30.198.186
  69.30.198.202
@@ -104318,6 +87534,7 @@
  69.30.221.250
  69.30.233.236
  69.30.234.186
+69.30.234.187
  69.30.234.2
  69.30.236.2
  69.30.242.98
@@ -104335,25 +87552,20 @@
  69.4.32.137
  69.4.80.126
  69.4.81.88
-69.4.89.121
  69.4.89.125
  69.4.90.23
  69.4.94.104
  69.4.94.107
  69.4.94.142
  69.41.0.45
-69.42.66.94
-69.42.81.14
-69.42.89.216
  69.43.168.202
  69.46.88.136
  69.46.88.189
-69.47.136.105
  69.47.161.24
  69.47.172.7
+69.49.142.14
  69.50.181.85
  69.51.16.248
-69.51.20.152
  69.51.24.27
  69.51.24.28
  69.55.202.185
@@ -104362,10 +87574,8 @@
  69.55.49.187
  69.55.54.65
  69.55.55.188
-69.55.61.74
  69.55.62.9
  69.57.164.32
-69.57.239.254
  69.58.0.173
  69.58.0.174
  69.58.0.175
@@ -104376,7 +87586,6 @@
  69.58.178.59
  69.58.3.12
  69.58.3.231
-69.58.3.235
  69.58.4.140
  69.59.18.113
  69.59.18.206
@@ -104387,7 +87596,6 @@
  69.61.8.226
  69.62.183.244
  69.63.16.6
-69.63.68.194
  69.63.73.171
  69.64.32.101
  69.64.32.45
@@ -104399,7 +87607,7 @@
  69.64.51.162
  69.64.51.250
  69.64.51.41
-69.64.52.173
+69.64.54.201
  69.64.57.168
  69.64.57.208
  69.64.67.68
@@ -104416,11 +87624,7 @@
  69.73.97.50
  69.75.122.146
  69.75.133.122
-69.75.212.190
  69.75.234.157
-69.8.34.165
-69.80.29.102
-69.81.146.13
  69.84.240.11
  69.85.223.162
  69.85.70.37
@@ -104433,17 +87637,14 @@
  69.90.185.10
  69.92.102.44
  69.92.132.198
-69.92.203.224
  69.94.114.50
  69.94.12.235
  69.94.125.100
-69.94.151.39
-69.94.151.62
-69.94.152.28
-69.94.152.29
  69.94.152.34
  69.94.152.36
-69.94.152.60
+69.94.152.40
+69.94.152.43
+69.94.152.48
  69.94.200.179
  69.94.27.169
  69348.psdzy.com
@@ -104523,21 +87724,16 @@
  7-medya.com
  7.r2dd.com
  70-40-210-173.unifiedlayer.com
-70.104.137.16
-70.106.126.222
  70.106.150.91
  70.106.193.69
  70.109.53.128
  70.110.160.224
  70.112.162.144
-70.112.177.13
  70.113.86.177
-70.114.22.142
  70.114.59.237
  70.115.61.60
  70.116.186.185
  70.116.38.90
-70.117.251.213
  70.117.70.82
  70.119.144.148
  70.120.196.27
@@ -104547,14 +87743,12 @@
  70.123.116.221
  70.123.125.237
  70.124.232.70
-70.126.152.216
  70.126.196.23
  70.126.25.40
  70.127.155.33
-70.127.209.1
+70.129.177.108
  70.131.38.109
  70.15.194.32
-70.15.200.145
  70.15.242.21
  70.15.38.113
  70.16.157.162
@@ -104562,48 +87756,35 @@
  70.162.143.252
  70.164.0.233
  70.165.65.233
-70.166.167.60
+70.166.167.37
+70.166.167.59
  70.166.204.38
-70.166.99.248
-70.167.236.170
  70.168.249.154
  70.168.249.162
  70.168.249.163
  70.168.249.164
  70.169.129.246
-70.169.134.185
  70.169.149.231
  70.169.150.122
  70.169.17.134
-70.169.55.123
  70.169.70.90
-70.169.8.204
  70.171.130.61
-70.172.240.128
-70.173.222.174
  70.173.251.218
-70.174.251.162
  70.177.74.63
-70.179.168.149
-70.18.5.86
  70.183.15.51
-70.183.50.201
  70.184.112.55
  70.184.255.218
  70.184.38.52
  70.184.69.146
-70.185.13.98
  70.185.188.47
  70.185.56.136
  70.189.73.127
+70.190.107.25
  70.191.39.150
  70.225.137.126
  70.226.119.80
-70.23.62.161
-70.23.98.162
  70.231.80.204
  70.232.179.26
-70.24.168.175
  70.24.190.204
  70.244.38.189
  70.25.19.229
@@ -104611,10 +87792,7 @@
  70.30.250.20
  70.32.0.110
  70.32.115.157
-70.32.5.234
-70.32.6.108
-70.32.6.16
-70.32.73.244
+70.32.23.20
  70.32.78.87
  70.32.78.99
  70.32.84.74
@@ -104635,6 +87813,7 @@
  70.37.50.171
  70.37.75.157
  70.39.150.82
+70.39.233.211
  70.39.250.211
  70.40.210.173
  70.40.213.248
@@ -104643,41 +87822,27 @@
  70.45.228.96
  70.45.30.28
  70.48.238.90
-70.50.146.68
  70.50.151.36
  70.51.39.119
  70.53.185.165
-70.53.208.25
  70.54.172.241
  70.55.91.16
-70.59.233.94
  70.60.132.34
  70.60.238.62
  70.60.86.202
-70.61.141.138
  70.61.166.78
  70.62.73.10
  70.63.170.86
-70.64.122.204
+70.63.80.180
  70.64.48.41
-70.65.107.59
  70.66.139.68
-70.67.16.174
+70.66.160.38
  70.68.135.187
-70.68.226.192
  70.68.70.171
-70.71.181.172
  70.71.236.58
-70.71.243.196
-70.71.247.214
-70.72.206.251
-70.73.144.181
  70.76.22.120
  70.77.230.251
-70.79.253.243
  70.79.47.133
-70.80.245.209
-70.81.245.174
  70.81.37.76
  70.82.34.55
  70.82.75.118
@@ -104697,12 +87862,10 @@
  70.88.133.182
  70.88.217.49
  70.89.104.61
-70.89.57.206
  70.90.21.193
  70.91.125.129
  70.91.244.209
  70.91.56.201
-70.91.60.25
  70.92.245.226
  70.95.127.0
  70.95.8.84
@@ -104725,44 +87888,38 @@
  70efbf02d17896982d2d1d0d249d51e2-dot-oo0-987.appspot.com
  70vimq4rswsc.talagaremix.com
  71.0.190.224
-71.10.54.40
  71.100.48.61
-71.100.73.66
  71.100.77.227
  71.105.116.2
  71.105.155.204
-71.105.48.7
  71.112.212.196
+71.114.26.66
  71.114.46.209
  71.12.94.6
  71.122.164.51
  71.125.57.64
  71.126.181.208
  71.127.156.63
+71.127.221.147
  71.13.105.122
  71.13.67.246
  71.13.87.122
  71.13.92.62
  71.135.93.156
  71.136.240.167
-71.14.237.124
+71.14.94.199
  71.142.245.248
  71.144.19.146
  71.145.210.56
  71.146.114.111
-71.15.138.7
  71.15.245.148
  71.15.26.56
-71.15.45.96
  71.161.78.198
  71.161.90.231
-71.163.171.154
  71.163.243.192
-71.163.29.121
  71.168.214.49
  71.171.103.147
  71.171.85.29
-71.172.46.202
  71.172.89.73
  71.173.141.58
  71.174.105.126
@@ -104772,12 +87929,9 @@
  71.178.34.116
  71.183.100.76
  71.183.205.122
-71.185.240.175
  71.185.31.91
  71.186.165.41
-71.187.147.239
  71.187.166.187
-71.187.208.102
  71.189.180.111
  71.189.24.112
  71.189.47.10
@@ -104786,35 +87940,30 @@
  71.19.144.89
  71.19.154.84
  71.19.157.74
-71.19.218.14
  71.190.219.156
  71.191.75.67
  71.193.164.3
  71.194.108.170
-71.196.250.233
  71.197.211.156
+71.197.233.207
  71.198.208.72
-71.200.246.11
  71.200.70.202
  71.200.89.21
  71.203.12.84
  71.204.162.179
  71.205.226.44
-71.206.121.2
+71.207.95.182
  71.208.12.25
  71.208.148.77
-71.208.160.24
  71.208.184.143
-71.208.229.246
  71.208.25.136
  71.208.49.101
  71.208.57.55
  71.208.63.90
  71.208.76.221
  71.209.190.79
-71.209.226.194
+71.209.33.111
  71.211.148.102
-71.211.16.236
  71.212.144.220
  71.212.181.171
  71.212.184.130
@@ -104845,57 +87994,45 @@
  71.221.0.72
  71.222.26.182
  71.222.58.207
+71.222.59.188
  71.222.8.178
  71.223.45.131
  71.225.121.125
  71.226.40.140
  71.227.242.72
-71.229.141.129
  71.231.145.228
  71.232.26.19
  71.232.94.108
  71.233.156.100
-71.233.192.189
-71.234.198.55
+71.233.226.154
  71.235.124.243
  71.237.150.172
-71.237.97.77
-71.239.114.100
  71.242.127.196
  71.244.185.101
  71.244.226.161
  71.244.49.72
  71.244.60.230
  71.244.60.231
-71.246.232.148
  71.249.186.99
-71.249.192.39
  71.254.155.66
  71.254.194.75
  71.255.235.140
  71.255.255.151
-71.255.99.214
  71.28.168.11
  71.33.138.58
  71.33.232.126
  71.34.11.30
  71.36.97.135
-71.38.117.8
  71.38.90.235
  71.40.162.211
-71.40.234.166
  71.40.28.250
  71.40.45.94
  71.40.50.162
  71.41.156.62
+71.41.160.10
  71.41.28.170
-71.41.76.58
-71.41.76.62
-71.42.105.34
-71.42.105.40
  71.42.187.120
  71.42.187.121
-71.42.226.210
  71.43.112.11
  71.43.118.162
  71.49.116.179
@@ -104909,52 +88046,31 @@
  71.54.188.54
  71.54.62.22
  71.56.235.108
-71.57.148.139
  71.57.180.213
  71.57.241.246
-71.58.90.64
  71.59.28.167
  71.59.90.148
  71.6.135.131
-71.6.146.130
  71.6.146.185
  71.6.146.186
-71.6.147.254
  71.6.158.166
  71.6.165.200
  71.6.167.142
  71.6.167.197
  71.6.199.23
-71.6.231.186
-71.6.231.8
-71.6.231.80
-71.6.231.81
-71.6.231.83
-71.6.231.86
-71.6.231.87
-71.6.232.4
-71.6.232.5
-71.6.232.6
-71.6.232.8
  71.60.113.9
  71.60.192.20
-71.62.13.183
  71.63.10.44
  71.63.116.146
  71.65.137.8
-71.66.203.234
-71.67.85.90
  71.72.140.136
  71.72.196.159
  71.73.29.10
  71.73.5.169
  71.74.184.137
  71.75.226.212
-71.77.232.211
  71.78.158.190
  71.79.11.136
-71.8.191.52
-71.80.68.60
  71.80.74.41
  71.81.1.99
  71.81.191.103
@@ -104962,18 +88078,16 @@
  71.84.132.243
  71.84.150.28
  71.85.106.211
-71.85.115.26
  71.85.218.231
  71.86.81.122
  71.87.222.108
  71.88.207.47
  71.89.209.212
  71.92.202.13
-71.92.253.115
  71.92.88.102
  71.93.148.59
  71.93.27.91
-71.94.136.19
+71.94.223.41
  7108329659.com
  710a6ba4667144d5a4e35f4764a5f51a.svc.dynamics.com
  710exoticcannabis.com
@@ -104988,6 +88102,7 @@
  71zhuan.com
  72.10.32.139
  72.10.75.10
+72.10.9.207
  72.11.135.222
  72.11.140.74
  72.11.145.8
@@ -104995,16 +88110,12 @@
  72.11.166.13
  72.12.203.182
  72.128.6.3
-72.131.69.125
-72.132.27.158
+72.132.67.64
  72.133.177.119
  72.133.228.89
-72.134.205.184
-72.134.245.7
  72.134.81.111
  72.135.224.85
  72.135.232.168
-72.136.98.208
  72.137.165.110
  72.137.167.242
  72.139.68.174
@@ -105014,10 +88125,7 @@
  72.14.186.84
  72.14.190.72
  72.14.191.154
-72.142.122.53
  72.143.15.82
-72.149.243.21
-72.15.126.171
  72.15.247.113
  72.161.0.225
  72.161.12.229
@@ -105028,41 +88136,38 @@
  72.167.161.46
  72.167.164.44
  72.167.164.72
+72.167.190.150
+72.167.190.167
+72.167.190.198
  72.167.190.213
  72.167.190.231
  72.167.190.234
+72.167.190.29
  72.167.190.6
  72.167.224.135
  72.167.227.34
  72.167.232.164
+72.167.232.165
  72.167.35.118
  72.167.96.176
  72.169.65.177
  72.169.66.157
  72.17.22.30
-72.17.60.150
-72.172.163.106
-72.176.72.30
  72.177.149.53
  72.177.87.97
  72.18.130.41
-72.180.13.251
  72.182.107.80
  72.183.63.214
  72.184.90.48
  72.186.136.247
  72.186.137.156
-72.187.238.18
-72.187.32.247
  72.188.158.235
+72.188.173.74
  72.189.135.139
  72.189.179.92
  72.189.180.98
  72.189.57.105
-72.19.61.122
-72.190.149.120
  72.191.113.27
-72.191.13.164
  72.193.250.108
  72.194.159.49
  72.194.195.147
@@ -105075,47 +88180,63 @@
  72.196.126.147
  72.198.122.235
  72.198.29.30
-72.2.20.39
+72.199.49.30
  72.20.137.133
-72.20.91.172
+72.200.38.229
  72.202.236.62
  72.203.86.47
+72.204.180.9
  72.208.206.234
  72.208.58.240
  72.208.58.48
  72.210.252.134
+72.210.252.135
  72.210.252.143
  72.210.252.144
  72.210.252.145
+72.210.252.149
  72.210.252.150
  72.210.252.152
+72.210.252.154
+72.210.252.156
  72.213.167.55
  72.217.158.195
+72.217.158.208
+72.217.158.212
  72.218.206.7
-72.219.185.161
  72.22.247.189
  72.220.27.151
-72.221.1.78
  72.221.164.34
  72.221.164.35
+72.221.164.36
  72.221.164.42
  72.221.164.43
-72.221.164.52
+72.221.164.44
+72.221.164.47
+72.221.164.50
+72.221.164.54
+72.221.164.61
+72.221.196.134
+72.221.196.139
+72.221.196.150
+72.221.232.136
  72.221.232.138
-72.221.232.139
-72.221.232.140
+72.221.232.145
  72.221.232.147
-72.222.206.147
-72.223.168.77
+72.221.232.153
+72.223.168.76
+72.223.168.78
+72.223.168.81
  72.223.168.82
-72.223.19.37
  72.224.193.17
+72.225.135.76
  72.225.198.139
+72.225.59.76
  72.225.7.80
  72.226.15.212
  72.229.35.40
+72.230.215.245
  72.230.237.11
-72.231.10.31
  72.231.243.181
  72.232.167.73
  72.232.202.66
@@ -105134,13 +88255,12 @@
  72.237.117.71
  72.237.117.81
  72.237.117.86
-72.238.158.71
  72.238.18.57
  72.239.229.208
-72.239.45.223
  72.24.91.196
  72.240.123.84
  72.240.126.32
+72.241.88.142
  72.243.138.146
  72.249.108.180
  72.249.108.220
@@ -105149,26 +88269,14 @@
  72.249.235.201
  72.250.153.47
  72.250.184.57
-72.250.20.19
  72.250.42.191
-72.251.172.189
-72.251.173.243
  72.251.234.218
  72.251.243.50
-72.252.113.178
-72.252.196.30
  72.252.4.146
  72.252.4.165
  72.252.4.194
  72.252.4.57
-72.255.1.235
-72.255.48.65
-72.255.61.161
-72.255.62.117
  72.26.111.6
-72.26.42.66
-72.27.119.171
-72.27.211.193
  72.28.240.148
  72.29.55.174
  72.29.64.13
@@ -105185,19 +88293,18 @@
  72.32.69.162
  72.34.235.197
  72.34.43.74
+72.34.61.254
  72.37.199.41
-72.37.212.230
-72.38.10.236
-72.4.44.28
+72.37.217.1
+72.38.161.250
  72.42.162.79
  72.43.207.8
  72.43.232.254
  72.45.49.211
  72.46.135.146
  72.46.157.102
-72.46.205.70
-72.46.207.50
  72.47.248.48
+72.48.231.97
  72.49.49.11
  72.50.240.124
  72.51.34.249
@@ -105206,41 +88313,36 @@
  72.52.150.93
  72.52.169.207
  72.52.184.212
+72.52.216.50
  72.52.231.202
  72.52.251.129
  72.52.255.82
  72.52.87.47
-72.52.94.130
  72.53.134.182
  72.65.240.25
  72.65.246.83
  72.65.246.84
  72.65.62.50
-72.66.56.197
  72.66.79.45
  72.68.100.221
  72.68.122.216
  72.68.29.212
  72.68.47.222
  72.69.217.132
+72.69.64.96
  72.69.99.47
  72.71.251.161
  72.74.160.36
  72.74.34.120
  72.76.221.220
  72.76.243.86
-72.78.146.111
  72.78.238.89
-72.79.35.91
  72.79.54.220
-72.79.59.106
  72.80.116.10
  72.80.213.48
-72.83.216.67
  72.83.232.54
  72.84.247.5
  72.84.73.68
-72.89.151.110
  72.89.32.196
  72.9.108.190
  72.9.110.70
@@ -105251,8 +88353,6 @@
  72.90.89.108
  72.91.70.103
  72.93.243.211
-72.93.4.198
-72.95.129.172
  72.95.23.83
  72.95.96.187
  720movies.net
@@ -105282,128 +88382,96 @@
  72clothing.com
  72dpi.co.il
  72l.saniketaoci.com
-73.0.234.21
-73.0.3.179
-73.10.241.32
  73.100.185.180
  73.100.19.104
-73.100.40.178
-73.100.76.249
-73.101.32.233
+73.106.77.37
+73.106.78.253
+73.106.79.53
  73.109.183.238
  73.11.153.150
  73.110.170.108
  73.110.20.93
-73.110.222.253
  73.111.221.162
  73.112.123.203
  73.112.84.96
-73.115.206.4
  73.116.193.136
  73.117.1.162
  73.119.255.56
  73.119.50.38
+73.12.120.10
+73.120.248.195
+73.123.70.198
  73.126.97.99
  73.128.186.71
+73.128.250.176
  73.129.131.230
  73.131.78.250
  73.131.84.13
-73.138.249.174
  73.138.75.151
-73.14.213.38
-73.14.24.92
  73.140.125.230
-73.140.91.148
-73.150.137.124
-73.150.145.210
-73.150.47.81
-73.151.61.69
-73.152.124.98
+73.147.45.121
+73.15.65.228
  73.152.178.212
-73.156.166.223
  73.158.127.66
-73.159.2.104
  73.16.207.94
  73.160.77.80
-73.163.180.189
+73.165.155.245
  73.168.170.206
-73.170.128.14
+73.169.177.150
  73.170.134.121
  73.170.139.223
  73.170.66.172
-73.171.96.175
  73.175.16.198
  73.176.158.102
-73.177.64.108
  73.181.212.48
-73.181.227.249
-73.183.226.75
  73.184.146.247
-73.184.77.174
  73.185.17.0
  73.187.102.50
  73.189.164.139
-73.189.168.196
  73.189.217.187
-73.189.22.49
  73.189.248.47
-73.189.62.217
  73.19.95.114
  73.191.105.147
  73.192.213.22
+73.192.22.99
  73.196.205.64
-73.198.176.236
-73.198.61.215
-73.199.203.9
+73.199.167.196
  73.200.123.136
+73.202.108.116
  73.202.118.127
-73.202.219.27
  73.202.246.138
  73.205.112.214
  73.206.244.166
  73.207.192.158
-73.207.197.12
-73.209.10.214
  73.209.24.166
  73.209.24.30
  73.21.65.208
  73.211.134.215
-73.213.130.141
  73.213.160.205
  73.213.26.179
  73.215.122.31
  73.215.97.122
+73.216.132.208
  73.217.107.99
  73.217.79.105
  73.22.153.25
-73.221.214.80
-73.221.57.101
-73.222.179.128
  73.222.94.184
-73.224.88.169
  73.225.145.238
  73.225.8.164
  73.227.192.92
+73.228.107.58
  73.228.154.233
  73.229.153.51
-73.23.206.15
-73.23.82.133
  73.230.167.70
  73.230.25.82
  73.231.231.83
-73.232.46.104
-73.234.13.63
  73.235.226.74
  73.236.136.223
  73.239.11.159
-73.239.122.196
  73.239.197.175
-73.239.95.24
-73.240.190.65
  73.243.176.4
  73.243.243.50
  73.246.122.153
-73.246.233.197
  73.247.175.212
  73.251.84.166
  73.254.207.2
@@ -105412,62 +88480,52 @@
  73.3.250.179
  73.31.14.186
  73.32.108.199
+73.35.159.252
  73.35.60.4
+73.36.232.192
  73.37.123.160
  73.38.213.196
+73.39.161.79
  73.39.60.223
  73.43.26.125
  73.43.98.10
-73.44.39.140
  73.45.212.48
  73.45.37.120
  73.46.218.63
  73.46.231.94
-73.48.143.14
-73.5.121.204
+73.48.173.56
+73.48.200.230
  73.5.7.33
  73.53.78.243
  73.54.145.203
-73.54.80.47
+73.54.48.212
  73.55.128.120
-73.57.140.214
-73.57.140.229
  73.60.227.128
  73.61.161.136
  73.61.6.1
-73.62.12.214
  73.62.252.237
+73.63.221.72
  73.64.197.49
  73.66.1.20
  73.7.135.222
-73.71.251.179
-73.72.178.177
-73.72.191.95
-73.72.62.223
  73.73.230.131
  73.73.90.68
-73.75.219.82
  73.76.205.231
-73.76.254.89
  73.78.197.165
-73.78.37.96
  73.8.77.18
-73.82.37.183
-73.82.77.214
  73.83.103.79
  73.83.172.74
  73.83.4.148
  73.84.152.17
  73.84.156.242
-73.85.125.227
  73.85.21.193
  73.90.205.30
+73.90.206.182
  73.93.184.25
  73.93.252.130
  73.95.116.240
  73.96.105.70
  73.96.30.69
-73.97.112.239
  73.97.164.59
  73.97.177.193
  73.97.88.48
@@ -105492,21 +88550,16 @@
  74.101.225.121
  74.102.101.74
  74.102.39.43
-74.102.4.70
-74.103.153.52
  74.103.37.117
  74.104.160.135
  74.105.127.227
  74.105.205.211
  74.105.42.230
-74.106.249.155
  74.108.124.180
  74.108.25.169
  74.108.75.95
-74.108.96.147
  74.110.110.234
  74.110.143.106
-74.113.179.112
  74.115.50.111
  74.116.59.195
  74.116.59.8
@@ -105516,59 +88569,15 @@
  74.118.156.131
  74.118.192.251
  74.119.146.38
-74.120.14.16
+74.119.238.38
  74.120.14.17
-74.120.14.18
-74.120.14.19
-74.120.14.20
-74.120.14.21
-74.120.14.22
-74.120.14.23
-74.120.14.24
-74.120.14.25
-74.120.14.26
-74.120.14.27
-74.120.14.28
-74.120.14.29
-74.120.14.30
-74.120.14.31
+74.120.14.38
  74.120.14.39
  74.120.14.40
  74.120.14.53
+74.120.14.54
  74.120.14.55
  74.120.14.56
-74.120.14.64
-74.120.14.65
-74.120.14.66
-74.120.14.67
-74.120.14.68
-74.120.14.69
-74.120.14.70
-74.120.14.71
-74.120.14.72
-74.120.14.73
-74.120.14.74
-74.120.14.75
-74.120.14.76
-74.120.14.77
-74.120.14.78
-74.120.14.79
-74.120.14.80
-74.120.14.81
-74.120.14.82
-74.120.14.83
-74.120.14.84
-74.120.14.85
-74.120.14.86
-74.120.14.87
-74.120.14.88
-74.120.14.89
-74.120.14.90
-74.120.14.91
-74.120.14.92
-74.120.14.93
-74.120.14.94
-74.120.14.95
  74.120.170.183
  74.120.172.232
  74.120.173.145
@@ -105584,42 +88593,36 @@
  74.123.23.40
  74.124.198.60
  74.124.214.119
+74.124.217.215
  74.124.219.29
  74.129.23.72
  74.130.243.103
  74.130.83.133
  74.132.148.190
  74.133.100.74
+74.133.72.70
  74.133.89.164
  74.135.120.91
-74.135.241.186
  74.137.220.142
  74.137.238.251
  74.138.14.217
  74.138.26.36
  74.140.187.123
  74.140.220.0
-74.142.184.206
  74.15.64.117
  74.192.146.131
  74.192.32.213
  74.194.230.68
  74.196.136.236
-74.196.77.244
  74.199.14.89
  74.199.84.77
-74.2.185.132
  74.200.208.146
-74.201.173.132
-74.201.249.114
  74.202.182.46
  74.202.242.19
  74.202.242.20
  74.202.242.26
  74.202.242.28
  74.202.26.143
-74.203.87.157
-74.204.163.90
  74.204.66.105
  74.205.120.232
  74.205.223.153
@@ -105669,7 +88672,6 @@
  74.214.242.140
  74.215.176.158
  74.215.219.214
-74.215.5.186
  74.215.52.77
  74.217.28.153
  74.218.23.14
@@ -105684,14 +88686,13 @@
  74.220.219.101
  74.220.219.113
  74.220.219.123
-74.221.64.5
-74.222.20.242
  74.231.220.202
  74.231.52.50
  74.235.17.68
  74.244.125.55
  74.3.104.66
  74.3.160.18
+74.4.178.63
  74.40.205.197
  74.50.34.82
  74.50.51.115
@@ -105709,15 +88710,12 @@
  74.55.54.10
  74.55.73.74
  74.55.90.82
-74.56.2.87
-74.56.213.35
  74.56.229.191
  74.57.99.81
  74.58.215.226
  74.58.7.11
  74.58.8.196
  74.59.132.126
-74.59.48.190
  74.6.22.174
  74.62.154.190
  74.62.215.218
@@ -105728,103 +88726,36 @@
  74.63.220.148
  74.63.221.49
  74.63.223.110
+74.63.239.242
  74.63.253.10
  74.63.255.26
-74.67.241.156
  74.7.84.106
  74.70.21.65
-74.71.152.200
  74.72.123.96
-74.73.114.82
-74.75.104.224
+74.75.117.254
  74.76.61.139
  74.77.90.160
  74.78.203.230
  74.78.31.240
-74.80.36.134
  74.81.68.114
-74.82.1.8
-74.82.10.115
  74.82.195.39
  74.82.209.133
  74.82.250.119
-74.82.4.123
-74.82.4.150
-74.82.47.10
-74.82.47.11
-74.82.47.12
-74.82.47.13
-74.82.47.14
-74.82.47.15
-74.82.47.16
-74.82.47.17
-74.82.47.18
-74.82.47.19
  74.82.47.194
-74.82.47.2
-74.82.47.20
-74.82.47.21
-74.82.47.22
-74.82.47.23
-74.82.47.24
-74.82.47.25
-74.82.47.26
-74.82.47.27
-74.82.47.28
-74.82.47.29
-74.82.47.3
-74.82.47.30
-74.82.47.31
-74.82.47.32
-74.82.47.33
-74.82.47.34
-74.82.47.35
-74.82.47.36
-74.82.47.37
-74.82.47.38
-74.82.47.39
-74.82.47.4
-74.82.47.40
-74.82.47.41
-74.82.47.42
-74.82.47.43
-74.82.47.44
-74.82.47.45
-74.82.47.46
-74.82.47.47
-74.82.47.48
-74.82.47.49
-74.82.47.5
-74.82.47.50
-74.82.47.51
-74.82.47.52
-74.82.47.53
-74.82.47.54
-74.82.47.55
-74.82.47.56
-74.82.47.57
-74.82.47.58
-74.82.47.59
-74.82.47.6
-74.82.47.60
-74.82.47.61
-74.82.47.62
-74.82.47.7
-74.82.47.8
-74.82.47.9
  74.83.173.67
  74.83.192.123
  74.83.221.29
  74.83.246.125
+74.83.41.124
  74.83.47.209
  74.84.144.229
  74.84.144.234
-74.84.144.68
  74.85.156.94
  74.85.157.198
  74.85.45.254
  74.87.158.138
-74.88.21.70
+74.89.187.158
+74.90.193.77
  74.91.23.194
  74.91.24.186
  74.91.28.228
@@ -105834,7 +88765,6 @@
  74.94.194.3
  74.94.77.18
  74.95.1.114
-74.96.165.56
  74.96.23.39
  74.97.180.91
  74.98.242.97
@@ -105858,23 +88788,18 @@
  75.101.111.132
  75.101.224.25
  75.102.27.238
+75.102.27.90
  75.102.39.180
-75.103.129.47
  75.103.66.26
-75.108.247.251
-75.109.121.239
-75.109.210.34
-75.109.220.58
+75.109.210.102
  75.109.47.186
  75.11.8.111
  75.111.125.131
-75.111.168.21
  75.112.160.49
  75.112.74.197
-75.113.150.10
-75.114.100.166
  75.114.235.105
  75.118.181.246
+75.119.198.104
  75.119.205.12
  75.119.215.210
  75.121.69.141
@@ -105897,7 +88822,7 @@
  75.127.11.150
  75.127.11.8
  75.127.14.170
-75.127.6.23
+75.127.180.211
  75.127.6.62
  75.127.68.106
  75.127.7.137
@@ -105910,48 +88835,35 @@
  75.127.7.94
  75.128.159.46
  75.128.246.180
-75.128.56.219
  75.129.64.107
  75.13.245.193
  75.130.218.151
-75.130.9.98
  75.133.43.81
  75.133.96.235
  75.134.150.171
  75.134.188.74
  75.134.55.44
  75.136.121.230
-75.136.196.255
-75.138.68.248
  75.139.38.211
-75.140.100.87
  75.140.162.212
  75.140.35.198
  75.142.211.18
  75.143.100.75
-75.143.172.32
  75.143.218.62
  75.143.247.51
  75.145.243.13
-75.147.34.130
+75.145.83.205
  75.148.91.168
  75.149.226.102
  75.150.192.33
  75.150.62.125
  75.151.213.85
  75.152.34.243
-75.152.64.24
-75.154.127.9
-75.155.172.108
-75.155.187.117
-75.155.214.45
-75.157.113.34
  75.157.151.52
-75.157.193.75
  75.158.39.231
-75.159.148.121
  75.159.162.115
-75.159.75.29
+75.16.168.140
+75.161.231.107
  75.161.69.95
  75.162.197.233
  75.164.153.130
@@ -105960,7 +88872,6 @@
  75.169.3.39
  75.171.42.202
  75.172.114.142
-75.173.32.3
  75.174.245.231
  75.175.2.246
  75.177.178.218
@@ -105971,8 +88882,7 @@
  75.188.38.166
  75.189.232.247
  75.189.236.133
-75.190.114.202
-75.24.62.81
+75.191.136.182
  75.250.130.109
  75.3.206.157
  75.31.93.181
@@ -105982,23 +88892,19 @@
  75.40.189.179
  75.44.16.251
  75.46.43.6
+75.51.10.233
  75.51.34.205
  75.55.97.119
-75.57.26.201
  75.58.56.188
-75.59.232.200
-75.64.27.5
  75.65.31.8
  75.65.6.212
  75.67.100.2
  75.67.227.208
-75.67.246.162
-75.70.112.193
  75.70.181.65
  75.71.161.216
  75.71.41.239
+75.72.115.194
  75.73.90.226
-75.74.159.131
  75.74.7.227
  75.75.232.111
  75.75.232.154
@@ -106012,25 +88918,20 @@
  75.83.186.62
  75.83.214.104
  75.83.253.194
-75.83.58.8
  75.84.167.25
-75.85.105.207
  75.85.186.143
  75.86.10.139
  75.86.142.122
  75.87.195.62
  75.97.22.214
  75.97.38.113
-75.98.175.110
  75.98.226.29
  75.98.36.146
  75.98.4.34
  75.99.123.26
  75.99.13.123
-75.99.199.179
  75.99.213.61
  75.99.231.238
-75.99.69.186
  7520.ca
  7521550a119fe3171a82df8e0644d569e796b36b.info
  752f7b76.ngrok.io
@@ -106046,6 +88947,7 @@
  756486.54652321.top
  756776567.weebly.com
  75733.prohoster.biz
+75759502c1574e120231f8cd455e5c26-dot-idyllic-chimera-296111.et.r.appspot.com
  757ssh.us-south.cf.appdomain.cloud
  758walker.com
  75abd9f5.ngrok.io
@@ -106071,25 +88973,19 @@
  76.0.44.111
  76.0.6.35
  76.0.65.207
+76.10.140.209
  76.10.173.20
  76.100.17.13
  76.102.103.136
-76.102.221.224
  76.103.215.236
  76.103.7.22
  76.104.80.47
  76.105.163.246
-76.109.160.210
-76.109.54.235
  76.109.57.66
-76.11.50.217
  76.12.191.16
  76.12.235.47
  76.120.75.139
-76.121.142.176
  76.121.70.69
-76.122.53.123
-76.127.99.120
  76.14.109.203
  76.14.11.121
  76.14.151.130
@@ -106110,36 +89006,31 @@
  76.164.201.201
  76.164.202.3
  76.164.52.102
-76.167.112.160
  76.167.148.205
  76.167.150.16
  76.167.150.74
-76.168.162.197
  76.168.54.203
  76.170.32.158
-76.171.66.198
  76.173.137.100
  76.173.238.49
-76.173.250.27
  76.174.129.203
  76.174.222.32
  76.175.162.101
-76.175.254.238
  76.176.17.13
+76.178.102.91
  76.178.135.121
  76.178.199.119
+76.179.49.161
  76.18.1.104
  76.18.47.66
-76.180.99.249
+76.180.77.24
  76.181.44.116
  76.182.177.11
-76.183.201.70
  76.183.211.188
-76.184.115.29
-76.185.195.20
  76.186.123.165
+76.186.30.175
  76.188.24.162
-76.19.33.60
+76.189.147.212
  76.198.37.16
  76.2.23.216
  76.2.40.112
@@ -106147,8 +89038,6 @@
  76.20.210.129
  76.20.63.24
  76.204.247.110
-76.21.34.25
-76.210.186.38
  76.213.142.127
  76.214.9.223
  76.216.16.130
@@ -106157,7 +89046,6 @@
  76.23.24.168
  76.23.58.234
  76.230.156.129
-76.233.80.93
  76.240.162.156
  76.250.150.193
  76.251.85.6
@@ -106165,7 +89053,6 @@
  76.254.145.213
  76.254.145.225
  76.254.156.163
-76.26.52.132
  76.27.179.47
  76.27.59.190
  76.28.178.62
@@ -106187,9 +89074,8 @@
  76.66.118.204
  76.69.29.42
  76.7.128.243
+76.71.35.151
  76.72.169.18
-76.72.176.83
-76.72.186.216
  76.72.254.222
  76.73.235.153
  76.74.170.209
@@ -106197,11 +89083,8 @@
  76.76.252.217
  76.76.83.23
  76.79.75.82
-76.8.5.241
  76.8.60.53
  76.80.210.138
-76.80.39.131
-76.81.242.230
  76.85.128.198
  76.87.58.38
  76.88.107.25
@@ -106212,8 +89095,6 @@
  76.9.203.185
  76.90.98.232
  76.91.225.192
-76.91.229.144
-76.94.78.238
  76.95.18.197
  76.95.50.98
  76.98.136.198
@@ -106241,32 +89122,21 @@
  76internet-yapkredi.com
  76srv.com
  76wzxjp.com
-77.0.24.234
+77.0.120.107
  77.0.59.23
  77.1.31.40
-77.1.44.65
-77.1.82.1
  77.10.116.114
  77.10.155.33
  77.10.169.81
  77.10.232.62
  77.10.235.18
-77.10.24.41
  77.10.28.238
-77.10.69.144
  77.101.132.253
  77.102.36.44
-77.104.102.230
-77.105.100.105
-77.105.100.55
-77.105.101.233
  77.105.44.25
  77.105.87.97
  77.106.183.115
-77.107.41.175
-77.107.42.154
-77.107.51.33
-77.107.61.73
+77.107.49.205
  77.107.87.51
  77.108.78.18
  77.108.78.20
@@ -106276,9 +89146,7 @@
  77.109.173.12
  77.109.191.140
  77.109.191.149
-77.109.20.222
-77.110.25.253
-77.110.27.226
+77.117.191.84
  77.117.219.76
  77.119.128.158
  77.119.229.106
@@ -106286,7 +89154,6 @@
  77.12.28.166
  77.12.69.249
  77.12.86.151
-77.12.99.234
  77.120.113.64
  77.120.113.69
  77.120.116.85
@@ -106294,37 +89161,33 @@
  77.120.122.114
  77.120.122.15
  77.120.122.22
+77.120.137.143
  77.120.163.103
  77.120.215.104
  77.120.246.83
  77.120.26.102
-77.120.33.175
  77.120.93.135
  77.121.14.86
  77.121.5.131
  77.121.81.204
  77.121.92.243
-77.122.142.190
-77.122.48.74
  77.122.57.126
  77.124.25.166
  77.125.5.174
+77.126.13.38
  77.126.73.2
  77.127.71.241
  77.13.125.186
+77.13.126.120
  77.130.135.14
-77.131.118.34
+77.130.32.135
  77.132.119.80
-77.137.85.158
+77.137.147.250
  77.138.170.206
-77.139.205.249
  77.140.201.98
  77.140.225.184
  77.141.8.209
-77.152.26.39
-77.153.171.249
  77.156.242.132
-77.158.187.246
  77.158.71.118
  77.160.194.161
  77.161.42.100
@@ -106334,64 +89197,51 @@
  77.163.123.22
  77.163.136.136
  77.163.184.129
-77.164.173.191
  77.164.213.131
  77.164.241.157
  77.165.60.53
  77.166.83.167
-77.167.12.43
  77.169.131.80
+77.169.139.87
  77.169.19.45
  77.169.93.186
  77.170.252.23
  77.171.142.247
  77.174.237.229
  77.175.30.187
+77.180.10.134
  77.180.134.95
-77.180.68.2
-77.181.4.111
-77.182.130.112
-77.182.178.162
-77.182.75.225
-77.183.50.13
-77.183.52.136
+77.182.6.193
+77.185.120.245
+77.189.185.240
  77.189.215.178
  77.189.87.239
-77.190.203.171
+77.190.113.73
+77.190.58.171
+77.191.153.39
  77.191.56.178
  77.195.143.45
-77.198.48.5
  77.199.87.64
-77.2.20.75
-77.2.99.73
+77.2.10.204
+77.2.93.191
  77.20.215.213
  77.20.246.114
-77.20.64.223
-77.202.38.49
-77.203.62.59
-77.204.13.78
  77.205.239.34
  77.207.15.243
  77.21.162.116
  77.21.162.12
-77.21.162.75
-77.21.164.162
-77.21.165.162
-77.21.167.136
-77.21.184.57
+77.21.163.158
+77.21.164.100
+77.21.164.240
+77.21.164.63
  77.21.185.109
-77.21.186.12
-77.21.225.8
  77.211.170.149
  77.211.170.214
  77.216.117.6
-77.216.46.44
  77.22.129.191
  77.22.22.165
  77.22.238.8
-77.22.7.9
  77.220.185.190
-77.220.193.120
  77.220.193.195
  77.220.193.23
  77.220.214.225
@@ -106410,7 +89260,6 @@
  77.222.115.97
  77.222.134.242
  77.222.139.57
-77.222.152.4
  77.222.245.115
  77.222.40.169
  77.222.40.188
@@ -106419,67 +89268,59 @@
  77.222.61.212
  77.223.97.25
  77.225.198.136
+77.227.30.183
+77.228.51.39
  77.229.174.102
+77.229.208.245
  77.229.214.66
  77.229.63.105
  77.23.10.143
  77.23.98.20
-77.230.178.147
  77.230.68.103
-77.231.136.127
  77.232.100.165
  77.232.133.132
  77.232.134.106
  77.232.143.121
  77.232.166.225
  77.232.167.200
-77.232.184.4
  77.232.186.2
-77.232.6.81
  77.232.72.10
  77.232.72.113
+77.233.10.214
  77.233.10.37
  77.234.235.174
  77.234.41.22
  77.234.89.132
  77.235.161.242
+77.235.175.28
+77.235.175.51
  77.236.189.18
  77.236.192.200
  77.236.196.249
  77.236.196.27
  77.236.206.11
-77.236.64.250
  77.236.76.74
  77.236.97.247
-77.237.87.207
-77.238.120.20
  77.238.129.146
  77.238.211.119
  77.238.212.227
  77.238.79.111
  77.239.148.134
-77.239.65.206
-77.240.101.94
-77.240.153.122
  77.240.230.231
  77.240.253.66
  77.241.20.215
-77.241.49.239
  77.242.107.2
  77.242.16.26
+77.242.16.87
  77.242.17.114
-77.242.20.190
  77.242.219.206
  77.242.235.134
-77.242.235.225
  77.242.25.38
  77.242.27.23
  77.242.28.168
  77.242.29.1
  77.242.37.212
-77.242.80.2
  77.242.94.26
-77.243.181.54
  77.243.183.120
  77.243.183.80
  77.243.191.18
@@ -106491,22 +89332,20 @@
  77.243.191.44
  77.243.191.46
  77.243.218.63
-77.243.26.56
+77.243.23.119
  77.243.51.53
  77.244.210.246
  77.244.211.39
  77.244.26.125
  77.244.42.178
-77.244.46.48
  77.245.101.254
-77.245.110.212
  77.245.112.48
-77.245.15.162
  77.245.153.89
-77.245.6.164
+77.245.7.198
  77.245.76.93
  77.246.191.192
-77.247.108.77
+77.246.49.50
+77.247.109.15
  77.247.111.98
  77.247.127.150
  77.247.178.130
@@ -106516,11 +89355,11 @@
  77.247.181.162
  77.247.181.163
  77.247.181.165
-77.247.226.42
  77.247.250.70
  77.247.251.17
  77.247.94.131
  77.248.178.74
+77.248.202.212
  77.248.247.204
  77.249.193.223
  77.249.69.106
@@ -106531,22 +89370,20 @@
  77.250.24.18
  77.250.60.51
  77.250.67.102
+77.252.53.67
  77.252.83.30
  77.253.199.228
-77.253.224.156
+77.255.51.173
  77.27.168.117
-77.27.69.62
  77.28.0.204
  77.28.116.110
  77.28.255.80
  77.28.96.196
  77.28.96.206
-77.28.97.78
-77.3.130.8
-77.3.213.71
-77.30.74.78
+77.3.165.107
+77.3.226.217
+77.3.75.201
  77.31.161.222
-77.31.252.125
  77.34.108.241
  77.34.111.22
  77.34.113.183
@@ -106554,22 +89391,20 @@
  77.34.16.184
  77.34.161.181
  77.34.167.226
+77.34.174.136
  77.34.181.166
  77.34.203.47
  77.34.41.80
-77.35.181.237
  77.35.181.85
  77.35.204.188
  77.35.205.93
-77.35.207.248
  77.35.226.131
-77.35.24.126
  77.35.243.224
  77.35.25.172
-77.35.250.6
  77.35.27.78
  77.35.34.197
  77.35.62.96
+77.37.103.133
  77.37.131.164
  77.37.138.239
  77.37.156.166
@@ -106581,7 +89416,6 @@
  77.37.236.10
  77.37.240.23
  77.38.21.239
-77.38.33.51
  77.38.42.145
  77.39.117.115
  77.4.29.197
@@ -106605,28 +89439,25 @@
  77.40.178.236
  77.40.18.149
  77.40.2.151
-77.40.2.169
  77.40.2.205
  77.40.2.43
+77.40.21.102
  77.40.25.99
  77.40.3.13
-77.40.3.139
  77.40.3.185
  77.40.3.23
  77.40.3.53
  77.40.3.58
-77.40.36.193
  77.40.40.25
  77.40.74.105
+77.40.88.209
  77.41.154.78
  77.43.1.226
-77.43.239.81
  77.43.65.44
  77.43.86.106
  77.45.84.15
+77.45.85.95
  77.45.86.15
-77.46.137.17
-77.46.137.21
  77.46.138.1
  77.46.138.33
  77.47.114.199
@@ -106635,7 +89466,7 @@
  77.48.137.65
  77.48.187.2
  77.48.206.106
-77.49.149.171
+77.49.192.188
  77.50.75.162
  77.50.78.135
  77.50.80.43
@@ -106644,28 +89475,21 @@
  77.51.134.247
  77.51.189.219
  77.52.183.34
-77.53.102.34
-77.53.116.27
-77.53.145.97
  77.53.214.86
-77.53.242.193
  77.53.53.196
  77.55.211.77
-77.56.105.35
  77.56.6.24
  77.56.63.223
  77.56.65.5
-77.57.160.88
  77.57.53.115
-77.58.17.83
+77.57.88.41
+77.58.124.151
  77.58.58.11
  77.59.160.219
  77.59.248.2
-77.6.9.186
  77.61.155.107
  77.64.162.103
  77.64.234.44
-77.65.52.170
  77.65.65.90
  77.65.79.5
  77.66.1.97
@@ -106678,27 +89502,26 @@
  77.68.13.126
  77.68.20.215
  77.68.62.77
+77.68.64.28
  77.68.64.29
  77.68.82.58
  77.68.86.20
  77.68.87.99
  77.68.9.178
-77.69.209.99
+77.69.153.222
  77.69.23.183
  77.70.16.245
  77.70.29.86
-77.71.30.84
-77.71.82.6
+77.70.35.87
+77.72.1.25
  77.72.138.108
  77.72.144.197
-77.72.2.21
  77.72.4.74
  77.72.71.66
  77.72.83.192
  77.73.166.231
  77.73.167.131
  77.73.167.217
-77.73.48.8
  77.73.69.101
  77.73.69.137
  77.73.69.50
@@ -106706,11 +89529,10 @@
  77.73.70.2
  77.73.70.28
  77.73.91.146
-77.74.168.56
  77.74.78.80
  77.75.128.202
-77.75.145.94
  77.75.161.167
+77.75.6.34
  77.75.76.160
  77.75.76.161
  77.75.76.162
@@ -106769,30 +89591,28 @@
  77.79.246.80
  77.79.246.81
  77.79.93.3
+77.8.117.184
+77.8.119.231
  77.81.100.88
  77.81.139.36
  77.81.139.37
  77.81.139.41
  77.81.139.44
  77.81.139.46
-77.81.21.117
  77.81.247.72
-77.81.27.180
  77.81.29.62
  77.81.7.90
-77.81.87.207
  77.82.175.109
  77.82.190.0
  77.82.220.41
  77.82.225.89
+77.82.28.126
  77.82.69.126
  77.82.90.234
  77.83.117.240
  77.83.149.91
  77.83.85.202
  77.83.87.196
-77.83.87.215
-77.83.87.221
  77.83.87.47
  77.83.88.118
  77.85.169.149
@@ -106803,6 +89623,7 @@
  77.85.238.130
  77.87.193.69
  77.87.196.119
+77.87.212.42
  77.87.67.122
  77.87.75.12
  77.88.208.162
@@ -106812,10 +89633,7 @@
  77.88.47.87
  77.89.204.254
  77.89.207.22
-77.89.208.22
-77.89.232.70
  77.89.242.238
-77.89.244.198
  77.89.246.62
  77.89.248.157
  77.89.251.138
@@ -106830,20 +89648,16 @@
  77.93.197.57
  77.93.197.58
  77.93.208.64
-77.93.211.209
  77.93.223.9
  77.93.235.250
  77.93.235.34
  77.93.248.67
-77.93.251.188
  77.93.254.106
  77.93.255.91
  77.93.42.134
  77.94.1.84
  77.94.112.234
-77.94.137.91
  77.94.250.178
-77.94.84.7
  77.95.141.193
  77.95.167.41
  77.95.225.77
@@ -106875,7 +89689,6 @@
  777global.online
  777hustle777.info
  778002991822.com
-77856.wang
  779.dmtxsc.com
  7798991.com
  77990.us-south.cf.appdomain.cloud
@@ -106888,30 +89701,23 @@
  77rv.net
  77st.net
  77yxx.com
+78.0.122.167
  78.0.189.19
-78.101.169.80
  78.101.198.92
-78.101.26.131
+78.101.231.28
  78.102.136.61
  78.105.98.40
  78.106.209.103
  78.106.212.158
-78.107.237.199
-78.107.58.130
  78.108.102.8
  78.108.108.162
  78.108.110.113
  78.108.111.113
  78.108.16.132
  78.108.169.17
-78.108.177.50
-78.108.177.51
-78.108.177.52
-78.108.177.53
-78.108.177.54
  78.108.38.155
+78.108.43.212
  78.108.89.240
-78.109.53.7
  78.11.170.73
  78.11.32.28
  78.11.32.3
@@ -106920,35 +89726,28 @@
  78.110.161.155
  78.110.50.104
  78.110.50.112
+78.110.50.117
  78.110.50.120
  78.110.50.121
  78.110.50.127
+78.110.64.111
  78.111.105.171
  78.111.120.110
-78.111.13.73
-78.111.249.108
  78.111.250.174
  78.111.250.49
-78.111.97.180
-78.111.97.182
+78.111.97.179
  78.111.99.178
-78.112.179.120
-78.113.231.245
-78.115.149.84
  78.117.21.233
-78.118.61.162
-78.118.96.201
  78.119.180.62
-78.12.39.73
  78.122.204.92
  78.122.30.59
  78.122.94.173
+78.126.219.180
+78.127.238.59
  78.128.113.118
+78.128.113.119
  78.128.113.120
-78.128.113.162
-78.128.113.222
  78.128.113.42
-78.128.113.6
  78.128.113.66
  78.128.114.111
  78.129.143.154
@@ -106966,43 +89765,38 @@
  78.131.52.120
  78.131.56.112
  78.131.58.83
-78.132.140.85
  78.132.180.141
  78.132.193.63
+78.132.219.66
+78.132.3.240
  78.132.44.10
-78.133.126.100
  78.133.163.190
  78.133.186.115
  78.133.186.129
  78.133.206.129
-78.133.241.213
  78.133.94.243
  78.134.109.13
-78.134.17.143
-78.134.3.70
+78.134.109.31
  78.134.5.173
-78.134.70.74
  78.134.86.105
  78.134.90.115
  78.134.96.251
  78.136.30.118
  78.137.168.192
-78.137.4.123
-78.138.127.98
  78.138.129.104
  78.138.131.248
+78.138.157.26
  78.138.157.42
  78.138.187.231
  78.138.88.236
  78.139.17.130
  78.139.216.117
  78.139.91.76
-78.140.201.254
-78.140.48.91
  78.140.6.68
  78.140.7.239
  78.141.123.99
  78.141.196.180
+78.141.212.200
  78.141.223.107
  78.141.35.10
  78.142.109.84
@@ -107011,13 +89805,10 @@
  78.142.194.29
  78.142.194.34
  78.142.194.6
-78.142.201.118
  78.142.210.210
  78.142.232.27
-78.142.239.9
  78.142.6.117
  78.143.96.35
-78.145.69.44
  78.151.161.24
  78.153.146.222
  78.153.199.9
@@ -107028,31 +89819,27 @@
  78.154.223.168
  78.154.56.77
  78.154.60.207
-78.155.118.15
  78.155.205.102
  78.155.85.67
-78.156.4.67
  78.156.9.173
  78.157.28.15
  78.157.28.26
  78.157.28.35
-78.157.42.59
  78.157.91.120
  78.158.10.192
  78.158.11.226
+78.158.164.98
  78.158.191.5
-78.158.218.39
  78.159.103.53
  78.159.108.204
  78.159.113.147
  78.159.97.29
  78.159.97.56
+78.159.99.208
  78.159.99.85
-78.161.79.150
-78.162.146.91
+78.160.172.118
  78.163.128.163
  78.163.200.185
-78.164.158.133
  78.164.67.9
  78.165.84.158
  78.166.101.188
@@ -107062,7 +89849,6 @@
  78.17.167.21
  78.171.16.229
  78.171.20.4
-78.172.6.159
  78.173.11.230
  78.173.196.151
  78.173.2.232
@@ -107078,125 +89864,80 @@
  78.175.144.33
  78.175.230.81
  78.176.77.217
-78.177.70.144
  78.180.152.74
  78.180.153.97
  78.180.154.110
  78.180.155.1
  78.180.157.169
  78.181.103.113
-78.182.242.138
-78.182.33.175
  78.186.109.7
  78.186.111.109
  78.186.112.235
-78.186.115.78
-78.186.125.177
-78.186.133.164
-78.186.135.20
-78.186.15.235
-78.186.160.14
  78.186.210.142
  78.186.216.101
  78.186.216.216
  78.186.238.58
-78.186.244.78
-78.186.39.211
-78.186.40.28
  78.186.67.212
  78.186.71.251
  78.187.100.171
  78.187.12.211
-78.187.132.179
-78.187.133.26
  78.187.137.194
  78.187.156.31
-78.187.174.71
-78.187.204.58
-78.187.235.44
  78.187.240.125
  78.187.41.200
  78.187.42.96
  78.187.59.175
-78.187.77.171
-78.187.8.225
  78.188.168.64
-78.188.177.246
-78.188.181.106
  78.188.215.146
  78.188.222.90
  78.188.225.197
-78.188.39.194
  78.188.4.124
  78.188.61.165
  78.188.64.92
-78.188.65.48
-78.188.80.214
-78.188.92.154
  78.188.98.18
  78.189.10.14
  78.189.190.196
+78.189.191.195
  78.189.235.4
  78.189.49.35
-78.189.49.86
  78.189.54.23
  78.189.64.42
-78.189.76.127
-78.190.186.189
+78.189.90.149
  78.190.2.129
  78.190.48.3
  78.191.246.237
  78.192.104.95
  78.192.18.48
-78.192.61.77
  78.193.74.165
-78.194.135.43
+78.2.107.26
+78.2.12.121
+78.2.121.62
+78.2.137.83
  78.20.135.129
  78.20.168.99
  78.20.94.222
-78.201.210.74
-78.202.185.88
  78.204.123.164
  78.205.222.137
  78.206.229.130
  78.21.234.68
-78.210.70.16
-78.217.177.232
  78.217.36.106
-78.218.86.6
  78.22.187.27
-78.220.102.122
  78.220.111.71
-78.222.68.65
-78.225.251.4
-78.227.38.86
-78.228.142.126
+78.229.73.50
  78.23.204.168
  78.23.46.93
-78.230.146.74
-78.230.224.211
  78.231.235.92
  78.232.152.36
  78.232.91.228
-78.235.37.237
  78.24.101.86
  78.24.111.198
  78.24.219.147
-78.244.141.1
  78.244.161.131
-78.244.50.209
-78.247.112.21
-78.247.203.215
  78.249.119.122
  78.25.112.42
  78.25.120.105
-78.25.143.16
  78.25.32.182
-78.251.252.26
-78.26.143.44
-78.26.146.69
  78.26.151.247
-78.26.180.80
  78.27.139.13
  78.27.145.51
  78.27.147.17
@@ -107206,10 +89947,8 @@
  78.29.42.94
  78.30.239.58
  78.30.33.213
-78.30.42.54
-78.30.52.227
  78.30.62.18
-78.31.74.10
+78.31.71.213
  78.32.128.32
  78.32.157.222
  78.32.159.52
@@ -107217,11 +89956,10 @@
  78.35.250.110
  78.35.251.85
  78.35.73.135
-78.36.10.97
  78.36.152.186
  78.36.16.214
  78.36.197.146
-78.36.200.4
+78.36.254.75
  78.37.167.239
  78.37.233.108
  78.37.27.139
@@ -107230,23 +89968,13 @@
  78.38.122.249
  78.38.123.110
  78.38.189.249
-78.38.67.212
-78.39.193.36
-78.39.205.171
-78.39.95.153
-78.39.95.231
-78.39.95.50
-78.4.183.254
-78.40.139.80
  78.40.180.217
  78.40.217.86
  78.40.244.243
-78.40.82.190
  78.41.174.196
  78.41.174.198
  78.41.40.16
  78.41.92.44
-78.42.204.191
  78.42.244.89
  78.43.177.73
  78.43.204.223
@@ -107256,19 +89984,15 @@
  78.46.151.58
  78.46.17.17
  78.46.173.117
-78.46.173.189
  78.46.188.239
  78.46.189.199
  78.46.191.14
  78.46.196.116
  78.46.200.216
  78.46.208.107
-78.46.217.146
  78.46.218.20
  78.46.254.164
  78.46.29.110
-78.46.40.146
-78.46.40.206
  78.46.46.195
  78.46.50.246
  78.46.60.149
@@ -107294,15 +90018,18 @@
  78.47.41.177
  78.47.50.83
  78.47.61.83
+78.47.70.166
  78.47.87.196
-78.49.10.151
-78.49.152.171
-78.54.119.113
+78.48.186.244
+78.49.139.72
+78.54.148.107
+78.54.17.25
  78.54.182.248
-78.55.5.223
+78.55.129.122
  78.56.201.4
  78.57.227.227
  78.58.111.81
+78.59.94.122
  78.6.228.32
  78.60.130.181
  78.60.203.75
@@ -107311,24 +90038,11 @@
  78.63.194.215
  78.63.28.146
  78.66.160.74
-78.66.209.22
-78.66.211.179
-78.67.213.148
-78.67.99.227
-78.68.121.208
-78.69.194.105
-78.71.2.168
-78.71.212.230
-78.72.123.247
-78.72.222.170
-78.72.228.239
-78.72.43.150
  78.73.141.174
-78.73.54.32
-78.78.184.48
-78.79.194.229
  78.8.111.87
  78.8.126.198
+78.8.160.0
+78.8.160.52
  78.8.188.1
  78.8.188.100
  78.8.188.136
@@ -107344,39 +90058,29 @@
  78.80.179.178
  78.81.245.153
  78.82.203.247
-78.82.238.69
  78.83.103.4
  78.83.159.190
  78.83.199.235
-78.83.202.221
  78.83.242.229
  78.83.53.171
  78.84.115.146
-78.84.129.82
-78.84.137.60
  78.84.137.90
+78.84.150.191
  78.84.22.156
  78.84.88.35
  78.85.20.134
-78.87.225.164
  78.88.229.104
-78.9.173.115
  78.90.136.18
  78.90.228.121
  78.90.6.104
-78.90.65.47
  78.90.78.210
  78.90.81.184
  78.90.91.220
  78.92.254.169
  78.92.254.9
-78.93.123.139
-78.93.123.59
-78.94.20.238
  78.94.240.180
  78.94.255.174
  78.94.31.171
-78.96.32.107
  78.97.11.154
  78.97.206.149
  7803000.com
@@ -107403,26 +90107,17 @@
  78ij.xyz
  78mcp.com
  78ug45egfdy089l095d.top
-79.0.129.162
-79.0.214.80
-79.1.154.24
  79.10.148.140
  79.10.163.113
-79.10.172.251
  79.10.198.229
-79.10.246.8
  79.10.31.51
  79.10.82.174
-79.10.86.129
  79.100.49.51
  79.100.49.79
  79.101.1.25
  79.101.106.74
-79.101.213.99
-79.101.217.66
  79.101.33.50
  79.101.40.114
-79.101.44.3
  79.101.45.94
  79.101.55.161
  79.101.55.162
@@ -107431,21 +90126,16 @@
  79.104.25.218
  79.104.38.30
  79.104.55.134
-79.104.59.202
  79.106.14.13
  79.106.15.98
  79.106.165.238
  79.106.165.30
  79.106.166.154
-79.106.22.152
  79.106.224.231
  79.106.224.238
  79.106.229.51
  79.106.230.1
-79.106.245.172
-79.106.245.179
  79.106.34.2
-79.106.34.3
  79.106.34.4
  79.106.34.6
  79.106.34.9
@@ -107459,14 +90149,14 @@
  79.106.45.125
  79.106.66.25
  79.107.186.220
+79.107.83.14
  79.108.206.93
  79.108.207.194
-79.11.192.131
  79.11.241.187
-79.11.243.44
+79.11.246.239
  79.110.112.210
-79.110.17.36
-79.110.17.41
+79.110.17.188
+79.110.17.61
  79.110.28.41
  79.110.28.50
  79.110.31.59
@@ -107474,43 +90164,29 @@
  79.111.13.155
  79.111.213.23
  79.111.97.164
-79.113.203.187
  79.114.118.212
  79.114.75.198
  79.115.193.3
-79.115.243.21
+79.115.245.227
  79.116.28.250
  79.117.192.229
  79.117.93.38
  79.118.179.194
-79.118.22.248
-79.118.72.141
  79.118.74.90
+79.119.10.103
  79.12.16.76
-79.12.27.141
  79.120.10.166
  79.120.118.82
  79.120.149.152
-79.120.167.65
-79.120.175.103
  79.120.177.106
  79.120.54.174
  79.120.70.47
  79.121.103.71
+79.121.113.69
  79.123.136.96
  79.124.23.9
-79.124.3.100
  79.124.60.174
-79.124.62.110
-79.124.62.218
-79.124.62.222
-79.124.62.246
  79.124.62.26
-79.124.62.34
-79.124.62.53
-79.124.62.55
-79.124.62.82
-79.124.62.86
  79.124.7.253
  79.124.78.143
  79.124.78.43
@@ -107519,25 +90195,20 @@
  79.124.8.8
  79.125.163.225
  79.125.168.63
+79.125.168.71
  79.125.183.146
  79.125.4.162
-79.127.110.162
  79.127.115.53
  79.127.124.131
-79.127.126.254
  79.127.36.98
  79.127.56.186
  79.127.57.43
  79.129.118.73
  79.129.135.116
-79.129.22.230
  79.129.29.237
  79.129.48.221
  79.129.6.235
-79.13.246.172
-79.130.10.15
  79.130.248.75
-79.130.252.104
  79.131.119.185
  79.131.166.130
  79.131.59.111
@@ -107545,8 +90216,7 @@
  79.132.200.190
  79.132.200.193
  79.132.200.3
-79.132.200.80
-79.132.201.136
+79.132.201.105
  79.132.201.249
  79.132.202.137
  79.132.205.34
@@ -107554,15 +90224,12 @@
  79.133.228.55
  79.133.6.236
  79.134.173.69
-79.134.195.74
  79.134.7.134
  79.135.73.141
  79.136.1.41
  79.136.1.46
-79.136.11.93
  79.136.30.33
  79.136.31.253
-79.136.42.93
  79.136.44.119
  79.136.44.59
  79.136.64.176
@@ -107573,7 +90240,6 @@
  79.137.115.56
  79.137.20.253
  79.137.222.49
-79.137.254.51
  79.137.28.159
  79.137.33.20
  79.137.34.248
@@ -107592,15 +90258,13 @@
  79.137.84.210
  79.137.86.157
  79.137.91.151
-79.138.8.183
+79.138.29.147
  79.14.154.4
  79.140.167.238
-79.140.228.108
-79.140.30.20
+79.140.230.147
  79.141.161.20
  79.141.163.78
  79.142.129.218
-79.142.133.88
  79.142.248.130
  79.142.65.64
  79.142.68.85
@@ -107622,11 +90286,11 @@
  79.143.87.240
  79.143.87.241
  79.144.122.1
+79.144.122.149
  79.146.246.163
  79.146.37.169
  79.146.80.165
  79.147.9.208
-79.148.111.106
  79.148.135.55
  79.148.238.69
  79.148.6.120
@@ -107639,39 +90303,34 @@
  79.152.156.4
  79.152.93.174
  79.153.136.88
+79.153.212.16
  79.153.212.209
  79.154.14.4
  79.155.135.142
  79.155.84.250
+79.155.92.77
  79.156.103.16
  79.158.112.102
-79.16.11.33
+79.16.70.21
  79.160.172.212
-79.160.41.238
-79.160.69.186
  79.161.252.14
+79.161.71.79
  79.164.171.32
  79.164.176.68
-79.164.226.101
-79.164.238.134
-79.165.121.108
  79.165.225.234
  79.168.204.180
  79.168.231.184
-79.168.6.101
+79.168.72.161
  79.169.137.95
  79.169.184.113
-79.17.240.117
  79.170.40.168
+79.170.40.170
+79.170.40.231
  79.170.44.116
-79.170.44.150
  79.171.13.166
  79.171.13.182
  79.172.193.32
  79.172.201.60
-79.173.124.142
-79.173.209.34
-79.173.84.28
  79.173.88.244
  79.174.187.54
  79.174.24.137
@@ -107682,71 +90341,59 @@
  79.175.57.77
  79.177.26.177
  79.178.211.152
-79.18.80.77
-79.180.97.113
+79.179.101.167
  79.181.20.138
  79.181.83.16
-79.183.121.203
+79.183.43.87
+79.184.171.155
  79.184.174.202
  79.184.42.196
-79.185.62.212
  79.186.161.176
-79.187.16.142
  79.188.138.170
  79.188.20.242
  79.188.246.2
  79.188.40.187
-79.188.44.86
  79.188.57.19
  79.188.68.89
-79.188.9.30
  79.189.19.46
-79.190.14.42
-79.190.213.51
  79.191.136.158
  79.191.41.240
+79.193.115.186
  79.193.119.45
  79.194.164.2
-79.194.169.40
-79.194.72.111
-79.195.10.244
-79.195.67.118
-79.203.111.130
-79.205.163.81
-79.205.171.203
-79.208.186.109
+79.194.165.164
+79.198.225.42
+79.2.211.167
+79.205.214.225
  79.208.255.153
-79.209.69.139
+79.209.66.111
+79.209.69.217
  79.209.72.250
-79.209.79.115
  79.21.45.9
-79.210.161.145
  79.210.161.164
-79.211.189.120
+79.210.163.90
  79.213.65.226
-79.214.50.46
  79.217.207.233
  79.217.21.51
-79.218.126.247
-79.225.116.242
+79.225.87.171
  79.225.89.67
  79.226.155.226
-79.227.248.18
+79.229.41.186
  79.229.47.239
-79.230.169.70
  79.232.164.246
-79.233.167.217
+79.232.94.94
  79.235.154.231
  79.235.175.228
+79.236.191.150
  79.236.191.88
+79.237.3.141
  79.238.16.241
  79.238.22.30
  79.238.27.32
-79.24.232.193
  79.244.122.142
  79.244.63.194
  79.246.123.15
-79.25.105.98
+79.248.110.247
  79.25.112.10
  79.255.119.158
  79.27.107.176
@@ -107754,52 +90401,38 @@
  79.27.214.141
  79.3.15.149
  79.3.92.101
-79.31.216.211
-79.32.168.14
  79.33.133.33
  79.33.26.212
+79.33.3.156
  79.37.107.74
  79.40.151.82
  79.41.123.117
  79.43.221.23
-79.44.108.193
  79.46.98.117
-79.47.218.146
  79.5.1.73
-79.50.117.78
-79.53.184.114
  79.53.244.30
-79.53.98.253
+79.54.111.106
  79.54.115.243
  79.54.39.148
  79.60.230.185
  79.61.191.231
-79.62.34.228
  79.63.131.98
  79.66.247.203
  79.67.137.168
-79.68.32.168
  79.7.0.87
  79.7.114.1
  79.7.158.208
-79.7.182.180
  79.7.218.151
  79.77.133.30
  79.77.33.130
  79.77.48.143
+79.77.72.174
  79.8.112.131
-79.8.155.177
-79.8.178.21
  79.8.196.108
-79.8.32.58
-79.80.28.22
  79.81.217.156
-79.83.216.222
  79.84.114.36
-79.86.104.195
  79.9.102.153
  79.9.171.88
-79.9.21.146
  79.9.219.22
  79.94.60.252
  79.96.175.83
@@ -107937,11 +90570,9 @@
  8.12.161.82
  8.129.172.40
  8.129.209.71
-8.131.228.94
-8.134.56.204
+8.129.217.8
  8.14.146.83
  8.15.224.120
-8.19.180.156
  8.208.21.185
  8.208.76.238
  8.208.76.28
@@ -107954,13 +90585,12 @@
  8.209.78.146
  8.209.82.155
  8.209.95.59
+8.210.1.51
  8.210.101.132
  8.210.108.24
-8.210.128.108
  8.210.141.183
  8.210.146.161
  8.210.162.171
-8.210.173.28
  8.210.18.56
  8.210.185.144
  8.210.194.45
@@ -107968,8 +90598,9 @@
  8.210.212.28
  8.210.214.87
  8.210.217.170
+8.210.224.66
  8.210.229.68
-8.210.34.2
+8.210.250.65
  8.210.76.208
  8.210.77.199
  8.210.79.220
@@ -107977,26 +90608,24 @@
  8.210.86.251
  8.210.92.32
  8.211.170.221
+8.211.3.151
  8.22.68.28
-8.23.66.254
+8.242.232.14
  8.26.191.44
-8.27.118.34
  8.28.16.254
  8.30.196.204
  8.33.7.95
  8.38.89.146
  8.38.89.152
  8.4.9.137
-8.40.183.187
  8.81.199.35.bc.googleusercontent.com
  8.9.40.245
  8.9.6.126
  8.dojnh.com
  80-87-45.ga
+80.0.141.86
  80.1.223.121
  80.1.31.151
-80.10.25.6
-80.10.8.213
  80.100.128.128
  80.100.203.151
  80.100.93.182
@@ -108004,12 +90633,12 @@
  80.101.82.203
  80.102.22.14
  80.102.50.2
+80.104.172.215
  80.104.200.223
-80.104.8.71
  80.106.15.98
+80.106.207.242
  80.106.228.1
  80.106.247.145
-80.106.30.116
  80.107.117.210
  80.107.17.85
  80.108.14.34
@@ -108017,14 +90646,11 @@
  80.108.82.95
  80.109.153.122
  80.109.75.19
-80.11.151.56
  80.110.188.114
  80.111.142.213
  80.112.137.211
-80.114.130.156
  80.114.3.91
  80.115.166.124
-80.116.209.21
  80.116.4.204
  80.117.224.199
  80.120.248.141
@@ -108033,66 +90659,57 @@
  80.122.92.78
  80.123.143.202
  80.123.162.21
-80.123.220.134
  80.127.116.96
  80.128.149.233
-80.128.150.40
  80.13.172.171
-80.13.205.230
-80.13.37.68
+80.13.7.156
  80.131.70.151
  80.132.114.125
-80.132.193.179
+80.132.122.225
  80.133.42.235
-80.135.126.42
+80.133.43.149
+80.133.43.249
  80.135.227.251
  80.137.123.245
  80.137.175.16
-80.138.162.31
+80.138.172.81
+80.139.60.100
  80.14.120.85
-80.14.166.111
  80.14.187.157
  80.14.39.22
-80.141.223.215
-80.142.115.181
-80.146.53.22
+80.14.48.194
  80.147.194.242
-80.147.37.219
  80.147.82.165
-80.149.158.186
  80.15.100.37
  80.15.14.46
  80.15.195.37
  80.151.40.92
-80.153.141.224
  80.153.22.20
  80.153.76.217
  80.162.194.35
  80.162.220.72
-80.163.4.187
  80.164.71.77
  80.168.134.174
  80.169.143.166
  80.169.225.123
  80.172.255.60
-80.174.107.37
+80.174.250.179
  80.175.219.102
-80.179.12.174
  80.179.149.111
  80.179.42.40
  80.179.42.44
-80.180.201.221
  80.182.120.119
-80.182.205.245
+80.182.207.243
  80.183.24.80
  80.183.80.215
+80.184.84.38
  80.187.106.189
  80.187.122.31
+80.187.127.27
  80.188.204.250
  80.188.239.106
  80.189.197.11
  80.19.177.242
-80.190.129.133
  80.190.145.165
  80.190.188.74
  80.191.140.58
@@ -108101,14 +90718,9 @@
  80.191.169.76
  80.191.169.79
  80.191.169.81
-80.191.223.242
  80.191.242.1
-80.192.139.206
-80.193.248.50
  80.193.29.218
  80.194.62.218
-80.197.125.83
-80.2.201.66
  80.200.55.144
  80.200.58.215
  80.201.85.82
@@ -108117,13 +90729,9 @@
  80.209.230.160
  80.209.231.126
  80.209.242.26
-80.21.126.234
  80.21.190.42
  80.210.109.88
  80.210.21.233
-80.210.23.22
-80.210.34.120
-80.210.59.2
  80.211.102.87
  80.211.11.250
  80.211.128.5
@@ -108132,7 +90740,6 @@
  80.211.134.89
  80.211.138.17
  80.211.139.155
-80.211.14.29
  80.211.145.54
  80.211.148.133
  80.211.151.190
@@ -108160,32 +90767,22 @@
  80.211.239.70
  80.211.242.10
  80.211.242.73
-80.211.250.182
  80.211.31.159
-80.211.42.112
  80.211.59.139
-80.211.61.19
  80.211.67.216
  80.211.70.92
  80.211.71.44
  80.211.75.205
-80.211.87.47
  80.211.89.87
  80.211.95.118
  80.211.99.98
-80.212.21.211
  80.212.26.71
-80.212.63.139
-80.213.12.220
  80.213.212.137
-80.216.145.58
-80.217.110.221
-80.217.17.129
+80.215.135.199
+80.216.100.169
  80.217.191.235
-80.219.113.82
-80.22.165.54
+80.220.141.42
  80.221.242.209
-80.224.172.179
  80.227.134.221
  80.227.174.18
  80.229.116.110
@@ -108193,16 +90790,16 @@
  80.229.14.115
  80.229.147.76
  80.229.157.225
+80.229.19.117
  80.229.28.60
  80.229.46.51
  80.229.46.9
  80.231.93.159
  80.232.248.17
-80.233.134.163
  80.234.31.69
  80.234.43.26
+80.234.99.36
  80.235.87.104
-80.236.212.67
  80.236.39.33
  80.237.159.104
  80.237.2.74
@@ -108210,12 +90807,9 @@
  80.238.124.88
  80.238.125.164
  80.239.140.197
-80.239.140.67
-80.239.199.100
  80.24.119.213
  80.240.129.221
  80.240.130.152
-80.240.140.144
  80.240.16.182
  80.240.19.44
  80.240.20.107
@@ -108224,7 +90818,6 @@
  80.240.250.222
  80.240.254.139
  80.240.51.48
-80.241.113.140
  80.241.209.102
  80.241.210.218
  80.241.211.136
@@ -108232,7 +90825,6 @@
  80.241.212.116
  80.241.212.139
  80.241.212.78
-80.241.215.100
  80.241.217.150
  80.241.217.54
  80.241.221.135
@@ -108245,7 +90837,6 @@
  80.241.46.6
  80.241.60.207
  80.242.123.135
-80.242.196.50
  80.242.39.76
  80.243.111.41
  80.243.8.126
@@ -108253,13 +90844,11 @@
  80.244.224.122
  80.244.237.21
  80.244.237.22
-80.244.79.156
  80.245.105.135
  80.245.105.235
  80.245.106.12
  80.245.106.242
  80.245.115.97
-80.245.239.48
  80.246.130.97
  80.246.2.153
  80.246.31.31
@@ -108278,7 +90867,6 @@
  80.248.2.5
  80.248.225.150
  80.249.1.140
-80.249.144.77
  80.249.148.39
  80.249.176.206
  80.25.87.49
@@ -108293,18 +90881,13 @@
  80.251.219.235
  80.251.221.21
  80.252.133.26
-80.252.135.121
-80.252.250.211
-80.253.20.94
-80.253.22.126
  80.253.244.42
-80.253.246.204
-80.253.246.54
  80.253.29.58
  80.253.92.137
  80.253.94.252
  80.254.102.78
  80.254.165.132
+80.254.215.27
  80.254.48.93
  80.255.192.237
  80.255.3.106
@@ -108318,11 +90901,10 @@
  80.255.3.87
  80.255.91.38
  80.26.176.21
-80.26.192.202
+80.26.96.212
  80.28.102.26
  80.28.255.69
  80.29.54.20
-80.29.85.37
  80.3.253.26
  80.3.41.245
  80.31.201.18
@@ -108332,7 +90914,6 @@
  80.32.195.155
  80.36.22.198
  80.37.181.60
-80.38.139.178
  80.38.224.51
  80.39.164.46
  80.39.206.217
@@ -108342,21 +90923,17 @@
  80.48.183.166
  80.48.255.145
  80.48.255.154
-80.48.68.150
  80.49.132.158
  80.49.154.148
  80.49.157.179
  80.49.205.6
  80.49.42.28
-80.49.71.106
  80.50.141.118
  80.51.81.83
  80.52.205.66
  80.53.156.62
  80.53.57.146
  80.55.101.146
-80.57.9.229
-80.58.140.38
  80.59.13.139
  80.59.233.178
  80.60.120.119
@@ -108364,24 +90941,17 @@
  80.63.106.90
  80.64.172.68
  80.64.27.39
-80.65.197.234
  80.65.23.139
  80.65.28.57
-80.66.77.110
-80.66.85.122
  80.67.172.162
  80.67.18.36
-80.67.223.41
  80.67.26.40
  80.67.28.145
  80.67.28.6
-80.67.29.49
  80.67.30.137
-80.68.116.7
+80.68.105.7
  80.68.2.100
  80.68.2.74
-80.68.226.42
-80.70.146.18
  80.70.17.209
  80.70.17.225
  80.70.22.1
@@ -108430,31 +91000,23 @@
  80.71.117.38
  80.71.121.68
  80.71.121.70
-80.71.125.57
  80.71.13.138
  80.71.136.204
-80.71.39.213
  80.72.121.179
  80.72.28.69
-80.72.42.254
  80.73.13.219
+80.73.87.198
  80.73.9.10
  80.73.9.236
-80.73.91.130
-80.75.117.162
-80.76.178.45
-80.76.182.243
-80.76.182.249
  80.76.195.26
-80.76.229.142
  80.76.55.26
  80.76.80.108
  80.77.155.83
-80.77.32.224
  80.78.65.187
-80.78.69.194
  80.78.75.59
+80.78.76.98
  80.78.77.114
+80.78.79.170
  80.79.114.34
  80.79.116.132
  80.79.116.134
@@ -108477,74 +91039,60 @@
  80.80.234.140
  80.82.147.1
  80.82.147.2
+80.82.155.27
  80.82.208.58
  80.82.51.45
  80.82.55.71
  80.82.64.114
  80.82.64.127
  80.82.64.140
-80.82.64.208
  80.82.64.21
  80.82.64.210
  80.82.64.215
-80.82.64.219
  80.82.64.242
  80.82.64.68
  80.82.64.70
  80.82.65.186
-80.82.65.74
  80.82.65.82
-80.82.65.90
  80.82.66.176
  80.82.68.199
  80.82.68.228
-80.82.68.29
  80.82.69.122
  80.82.69.193
  80.82.69.209
  80.82.70.112
  80.82.70.118
  80.82.70.140
-80.82.70.168
  80.82.70.189
  80.82.70.206
  80.82.70.225
  80.82.70.231
  80.82.70.24
  80.82.70.249
-80.82.70.25
  80.82.70.33
+80.82.77.132
  80.82.77.138
  80.82.77.139
  80.82.77.146
-80.82.77.193
-80.82.77.212
-80.82.77.227
-80.82.77.245
  80.82.77.33
-80.82.77.5
  80.82.77.66
-80.82.78.100
  80.82.78.112
  80.82.78.166
  80.82.78.170
+80.82.78.20
  80.82.78.38
-80.82.78.4
-80.82.78.82
  80.82.78.85
  80.82.78.87
  80.82.78.9
-80.83.26.62
  80.83.90.42
-80.84.114.26
-80.84.59.216
  80.85.239.242
  80.85.56.51
  80.85.86.175
  80.85.86.53
  80.85.87.122
  80.85.87.245
-80.87.160.145
+80.87.177.147
+80.87.177.151
  80.87.184.49
  80.87.185.233
  80.87.193.46
@@ -108560,7 +91108,7 @@
  80.89.137.54
  80.89.156.216
  80.89.238.119
-80.89.97.203
+80.90.135.240
  80.90.228.170
  80.90.40.243
  80.90.82.70
@@ -108574,41 +91122,19 @@
  80.91.55.42
  80.92.181.3
  80.92.189.70
-80.92.232.39
  80.92.84.168
  80.93.124.148
-80.93.210.82
-80.93.212.42
-80.93.213.213
+80.93.213.210
  80.93.213.246
  80.93.217.42
  80.93.220.21
  80.93.48.49
  80.94.118.192
  80.94.22.165
-80.94.229.194
  80.94.247.13
-80.94.93.10
-80.94.93.101
-80.94.93.104
  80.94.93.107
-80.94.93.117
-80.94.93.13
-80.94.93.20
-80.94.93.21
-80.94.93.23
-80.94.93.27
-80.94.93.30
-80.94.93.33
-80.94.93.39
-80.94.93.41
-80.94.93.42
-80.94.93.47
-80.94.93.48
-80.94.93.57
-80.94.93.60
-80.94.93.61
-80.94.93.62
+80.94.93.56
+80.94.93.81
  80.94.93.95
  80.95.109.6
  80.95.248.151
@@ -108618,6 +91144,7 @@
  80.98.150.9
  80.98.185.104
  80.98.249.181
+80.99.254.185
  8004print.com
  800emailsupport.com
  800fiabe.it
@@ -108648,27 +91175,24 @@
  80yuanma.com
  81.0.198.25
  81.0.79.105
+81.0.95.163
  81.1.213.36
-81.1.244.18
+81.10.121.164
  81.10.2.58
  81.105.178.194
-81.105.223.91
-81.110.14.23
+81.106.154.164
  81.110.170.57
  81.110.182.176
  81.111.112.45
-81.111.145.16
-81.111.26.227
  81.111.91.234
  81.117.225.245
-81.12.119.166
+81.12.119.169
  81.12.13.152
  81.12.169.126
  81.12.169.254
  81.12.224.61
-81.12.52.130
-81.12.94.122
-81.128.222.137
+81.12.29.148
+81.12.29.44
  81.130.146.18
  81.130.188.5
  81.130.234.235
@@ -108676,75 +91200,56 @@
  81.133.142.45
  81.134.179.184
  81.134.82.82
-81.135.62.18
  81.136.146.213
  81.137.6.81
  81.138.20.196
-81.140.188.188
-81.141.131.2
  81.144.138.34
-81.145.109.76
  81.145.194.114
-81.148.254.0
  81.149.104.32
  81.15.163.2
  81.15.163.4
-81.150.18.92
  81.151.114.101
-81.151.114.46
-81.152.178.192
-81.156.114.72
  81.156.115.104
-81.156.238.169
-81.156.74.147
  81.16.122.128
  81.16.124.168
  81.16.143.187
-81.16.250.105
  81.16.33.31
  81.16.33.33
-81.16.6.38
  81.16.9.2
  81.16.9.222
  81.161.226.4
  81.161.61.110
-81.161.61.130
  81.161.61.88
  81.161.63.100
  81.161.63.101
-81.161.63.102
  81.161.63.103
  81.161.63.251
  81.161.63.252
  81.161.63.253
+81.161.65.104
  81.162.243.249
  81.163.28.120
  81.163.36.139
  81.163.36.210
  81.163.38.224
  81.163.43.206
+81.163.52.60
  81.163.57.147
  81.163.57.220
  81.163.62.221
  81.163.80.146
-81.164.191.37
-81.165.154.148
+81.163.80.170
+81.164.70.26
  81.165.180.252
-81.167.109.247
+81.165.210.66
+81.166.194.150
  81.167.175.244
-81.167.186.96
-81.167.205.200
-81.167.244.222
-81.167.249.169
  81.167.49.109
  81.168.130.3
  81.168.57.169
-81.169.131.10
  81.169.134.66
  81.169.138.128
  81.169.140.14
-81.169.143.99
-81.169.154.76
  81.169.167.146
  81.169.174.142
  81.169.179.225
@@ -108764,22 +91269,16 @@
  81.17.16.170
  81.17.20.38
  81.17.20.50
-81.17.246.205
  81.17.30.13
  81.17.30.215
  81.17.30.40
  81.17.81.34
-81.17.92.4
  81.17.93.134
  81.17.94.50
-81.170.133.7
  81.170.143.54
  81.170.143.75
-81.170.147.24
-81.170.147.49
  81.170.150.236
  81.170.171.48
-81.170.253.234
  81.171.12.44
  81.171.22.143
  81.171.29.146
@@ -108789,8 +91288,7 @@
  81.174.11.10
  81.174.11.159
  81.174.11.227
-81.174.154.124
-81.174.34.1
+81.174.246.185
  81.174.65.27
  81.175.28.110
  81.175.71.121
@@ -108805,7 +91303,6 @@
  81.177.73.7
  81.18.200.214
  81.18.224.52
-81.18.28.196
  81.18.33.26
  81.18.34.98
  81.18.90.43
@@ -108815,8 +91312,6 @@
  81.182.13.137
  81.182.187.3
  81.182.217.13
-81.182.239.9
-81.182.246.50
  81.182.248.193
  81.182.254.124
  81.182.6.245
@@ -108833,27 +91328,18 @@
  81.19.2.35
  81.19.215.118
  81.19.3.16
-81.190.32.21
  81.190.7.246
  81.191.197.63
  81.191.233.173
-81.192.178.163
  81.192.184.214
  81.192.188.112
-81.192.192.208
-81.192.193.237
-81.192.52.89
-81.192.53.131
-81.192.53.154
  81.192.68.126
  81.192.87.130
  81.193.45.123
  81.196.127.37
-81.196.69.79
  81.197.110.223
+81.198.10.42
  81.198.119.241
-81.198.147.21
-81.198.223.106
  81.198.27.236
  81.198.79.162
  81.198.79.164
@@ -108871,7 +91357,6 @@
  81.200.248.145
  81.200.49.126
  81.200.63.108
-81.201.209.89
  81.201.50.131
  81.205.107.8
  81.205.194.182
@@ -108880,59 +91365,46 @@
  81.208.39.28
  81.209.177.136
  81.209.177.189
-81.21.217.186
  81.21.67.202
  81.21.79.214
  81.21.86.97
-81.211.16.42
  81.211.68.14
  81.211.8.234
  81.212.163.230
-81.213.108.250
-81.213.166.175
-81.214.108.7
-81.214.134.142
-81.214.15.53
+81.214.132.220
  81.214.22.2
  81.214.253.80
  81.214.254.203
  81.214.39.214
  81.215.193.112
-81.215.196.141
-81.215.198.238
  81.215.230.173
-81.215.9.195
-81.216.26.217
+81.217.43.222
  81.218.162.85
  81.218.187.53
  81.218.195.216
-81.218.199.121
  81.218.25.210
  81.219.10.62
+81.219.174.227
  81.22.176.154
  81.22.46.125
  81.22.46.196
-81.22.46.209
  81.22.46.222
-81.22.47.154
+81.22.47.158
  81.22.47.174
  81.22.47.189
  81.22.47.198
  81.22.47.25
  81.22.47.34
+81.22.60.146
  81.22.60.18
  81.22.98.49
  81.223.72.134
  81.224.160.81
  81.224.44.164
-81.225.160.128
  81.226.160.5
-81.226.169.192
-81.226.191.14
  81.227.171.215
  81.227.192.51
  81.229.232.77
-81.229.44.206
  81.229.89.161
  81.23.109.186
  81.23.32.47
@@ -108942,41 +91414,25 @@
  81.233.144.222
  81.233.184.27
  81.235.252.20
-81.235.62.176
  81.236.222.167
  81.236.246.232
-81.237.106.93
  81.237.206.224
  81.24.102.112
-81.24.114.22
  81.24.247.58
  81.24.35.80
  81.24.82.69
  81.241.91.170
-81.242.208.79
  81.242.91.23
-81.243.152.143
  81.243.223.62
-81.244.103.97
-81.246.233.248
-81.248.1.143
-81.248.104.172
-81.248.238.182
-81.248.4.6
-81.248.63.63
-81.248.75.189
  81.249.129.138
  81.25.120.224
  81.25.229.123
-81.25.53.204
-81.25.58.50
  81.250.147.230
-81.250.162.238
  81.251.181.185
+81.252.243.157
  81.254.31.130
  81.254.90.197
  81.255.105.165
-81.26.241.240
  81.27.79.18
  81.27.81.170
  81.28.164.55
@@ -109002,13 +91458,11 @@
  81.31.241.198
  81.31.251.203
  81.33.4.214
+81.33.78.114
  81.34.18.81
-81.34.201.56
  81.34.219.232
-81.35.63.40
  81.35.67.42
  81.36.14.52
-81.36.42.115
  81.36.42.178
  81.39.121.17
  81.4.102.200
@@ -109017,11 +91471,9 @@
  81.4.110.153
  81.4.111.88
  81.4.127.228
-81.4.127.34
-81.40.254.90
  81.40.255.189
+81.42.224.142
  81.43.147.148
-81.43.65.253
  81.43.98.133
  81.46.215.112
  81.46.215.118
@@ -109029,10 +91481,8 @@
  81.46.215.94
  81.47.161.135
  81.5.103.14
-81.5.117.195
  81.5.88.224
-81.51.52.243
-81.52.152.47
+81.50.191.42
  81.53.91.83
  81.56.94.102
  81.57.217.41
@@ -109051,7 +91501,6 @@
  81.68.105.55
  81.68.106.155
  81.68.106.79
-81.68.107.229
  81.68.108.77
  81.68.112.29
  81.68.113.212
@@ -109064,10 +91513,8 @@
  81.68.123.65
  81.68.126.101
  81.68.127.249
-81.68.127.26
  81.68.128.180
  81.68.128.198
-81.68.128.31
  81.68.129.2
  81.68.130.11
  81.68.132.197
@@ -109078,29 +91525,26 @@
  81.68.137.163
  81.68.137.90
  81.68.139.110
-81.68.139.163
-81.68.140.10
  81.68.140.251
  81.68.142.128
  81.68.143.165
  81.68.144.156
-81.68.145.65
  81.68.147.53
  81.68.150.7
+81.68.153.106
  81.68.154.150
  81.68.155.143
  81.68.156.111
  81.68.157.218
-81.68.162.234
+81.68.159.121
  81.68.163.129
-81.68.163.71
+81.68.166.245
  81.68.167.79
  81.68.169.179
  81.68.175.38
  81.68.179.112
  81.68.181.52
  81.68.181.60
-81.68.183.98
  81.68.184.217
  81.68.186.207
  81.68.188.221
@@ -109108,7 +91552,6 @@
  81.68.191.188
  81.68.191.219
  81.68.193.31
-81.68.194.208
  81.68.194.214
  81.68.195.113
  81.68.199.196
@@ -109123,52 +91566,38 @@
  81.68.216.53
  81.68.217.130
  81.68.217.15
-81.68.217.58
  81.68.223.9
  81.68.224.201
  81.68.224.51
  81.68.224.66
-81.68.225.106
-81.68.225.241
  81.68.225.56
  81.68.226.158
  81.68.227.125
  81.68.227.246
  81.68.227.46
-81.68.229.173
  81.68.230.252
  81.68.232.133
  81.68.234.113
  81.68.236.73
  81.68.238.7
  81.68.242.64
-81.68.242.67
  81.68.243.185
  81.68.244.151
  81.68.244.183
  81.68.244.19
-81.68.244.249
  81.68.246.68
-81.68.249.112
-81.68.251.104
  81.68.253.104
  81.68.253.14
-81.68.253.20
  81.68.253.95
  81.68.255.197
  81.68.65.90
  81.68.66.41
-81.68.67.173
-81.68.67.193
  81.68.69.42
  81.68.69.54
  81.68.69.68
  81.68.70.18
  81.68.72.231
-81.68.74.171
  81.68.75.34
-81.68.77.112
-81.68.77.218
  81.68.78.179
  81.68.78.48
  81.68.80.227
@@ -109185,13 +91614,11 @@
  81.68.92.29
  81.68.96.254
  81.68.97.72
-81.68.98.210
  81.68.99.93
  81.69.10.179
  81.69.11.51
  81.69.12.142
  81.69.12.67
-81.69.13.127
  81.69.13.213
  81.69.13.95
  81.69.14.160
@@ -109206,17 +91633,13 @@
  81.69.174.79
  81.69.175.143
  81.69.177.174
-81.69.177.253
  81.69.177.96
  81.69.18.110
  81.69.185.203
  81.69.19.167
  81.69.19.79
-81.69.194.23
-81.69.20.62
  81.69.21.163
  81.69.218.33
-81.69.225.138
  81.69.225.84
  81.69.228.153
  81.69.228.173
@@ -109224,10 +91647,7 @@
  81.69.230.208
  81.69.231.21
  81.69.232.30
-81.69.233.249
-81.69.233.68
-81.69.237.64
-81.69.240.182
+81.69.24.249
  81.69.241.68
  81.69.242.112
  81.69.242.114
@@ -109237,9 +91657,7 @@
  81.69.243.134
  81.69.243.46
  81.69.244.177
-81.69.244.32
  81.69.245.138
-81.69.245.152
  81.69.245.83
  81.69.249.10
  81.69.249.196
@@ -109247,19 +91665,13 @@
  81.69.25.239
  81.69.250.101
  81.69.250.222
-81.69.251.147
-81.69.251.84
  81.69.253.62
-81.69.255.247
  81.69.27.157
  81.69.28.23
-81.69.28.239
  81.69.3.109
  81.69.3.201
  81.69.3.227
  81.69.30.95
-81.69.32.57
-81.69.33.231
  81.69.34.152
  81.69.35.41
  81.69.37.18
@@ -109271,30 +91683,24 @@
  81.69.56.253
  81.69.57.115
  81.69.57.69
-81.69.58.191
+81.69.58.218
+81.69.58.54
  81.69.59.55
  81.69.7.105
  81.69.7.163
  81.69.8.165
  81.69.8.18
  81.69.9.125
-81.69.9.170
-81.69.9.71
  81.7.10.238
  81.7.17.202
  81.70.10.77
  81.70.102.35
-81.70.102.91
  81.70.103.201
-81.70.105.137
  81.70.105.82
  81.70.11.106
  81.70.11.20
  81.70.13.198
-81.70.143.114
  81.70.143.188
-81.70.144.93
-81.70.145.127
  81.70.145.250
  81.70.146.26
  81.70.147.144
@@ -109305,25 +91711,17 @@
  81.70.153.10
  81.70.153.243
  81.70.154.62
-81.70.154.64
  81.70.155.11
  81.70.155.157
-81.70.155.18
  81.70.155.196
  81.70.155.219
  81.70.156.134
  81.70.157.132
  81.70.157.186
  81.70.157.44
-81.70.157.5
-81.70.158.191
  81.70.159.196
-81.70.159.213
-81.70.159.7
  81.70.161.216
-81.70.175.35
  81.70.18.171
-81.70.181.84
  81.70.2.223
  81.70.2.91
  81.70.20.177
@@ -109341,35 +91739,24 @@
  81.70.21.113
  81.70.21.18
  81.70.22.100
-81.70.22.3
  81.70.222.231
  81.70.23.139
  81.70.25.150
  81.70.31.196
-81.70.35.194
  81.70.36.8
-81.70.38.176
-81.70.38.8
  81.70.39.239
  81.70.40.161
-81.70.40.171
  81.70.43.103
  81.70.43.144
  81.70.43.97
-81.70.45.240
  81.70.46.191
  81.70.46.31
-81.70.49.236
-81.70.53.168
  81.70.54.208
  81.70.55.21
-81.70.57.145
  81.70.57.192
  81.70.7.32
-81.70.76.15
  81.70.78.38
  81.70.79.18
-81.70.81.165
  81.70.84.101
  81.70.86.140
  81.70.9.240
@@ -109381,44 +91768,33 @@
  81.70.99.146
  81.71.119.159
  81.71.119.160
-81.71.119.176
-81.71.119.84
+81.71.120.65
  81.71.126.16
  81.71.128.135
  81.71.13.210
  81.71.135.16
-81.71.135.79
  81.71.136.41
  81.71.138.119
  81.71.138.240
+81.71.138.241
  81.71.139.210
-81.71.14.95
  81.71.140.116
  81.71.142.20
-81.71.142.89
-81.71.147.156
-81.71.147.245
  81.71.147.40
  81.71.16.134
  81.71.19.202
-81.71.2.14
-81.71.22.142
  81.71.26.161
  81.71.28.144
  81.71.28.205
  81.71.3.99
  81.71.32.176
  81.71.33.216
-81.71.36.126
  81.71.38.138
-81.71.4.235
  81.71.45.162
  81.71.68.119
  81.71.68.204
-81.71.68.248
  81.71.7.144
  81.71.7.201
-81.71.70.182
  81.71.71.95
  81.71.72.138
  81.71.76.151
@@ -109427,10 +91803,8 @@
  81.71.83.237
  81.71.85.116
  81.71.85.80
-81.8.176.236
-81.80.84.113
-81.82.132.105
-81.82.192.90
+81.71.88.53
+81.8.37.98
  81.82.201.5
  81.82.211.25
  81.82.228.134
@@ -109462,12 +91836,8 @@
  81.9.227.65
  81.90.188.81
  81.90.3.226
-81.91.136.3
-81.91.154.195
-81.91.157.134
+81.91.137.43
  81.91.176.128
-81.91.190.49
-81.91.190.50
  81.91.208.8
  81.91.219.98
  81.92.202.202
@@ -109475,20 +91845,15 @@
  81.92.207.106
  81.92.207.82
  81.92.207.99
-81.92.58.217
  81.93.218.200
  81.93.240.199
  81.93.240.46
  81.93.240.71
-81.94.68.146
-81.95.1.104
  81.95.114.105
-81.95.119.167
  81.95.124.6
  81.95.13.42
  81.95.13.51
  81.95.131.10
-81.95.230.211
  81.95.45.234
  81.95.5.146
  81.95.7.22
@@ -109521,30 +91886,23 @@
  81cbd50754804973894115930bc620f5.testing-url.ws
  81cf7e.netlify.com
  81rc4uw1b4roh99dmn.cf
-82.1.150.122
  82.1.4.99
+82.10.139.206
  82.10.188.54
  82.10.220.141
  82.10.24.188
  82.102.12.212
-82.102.137.130
-82.102.173.66
+82.102.16.152
  82.102.21.214
  82.102.27.10
  82.102.27.118
  82.102.28.107
-82.102.30.130
-82.102.85.44
  82.103.116.126
  82.103.118.42
  82.103.70.227
-82.103.90.198
-82.103.95.134
  82.112.166.170
  82.112.191.139
-82.112.62.181
-82.113.63.230
-82.114.181.163
+82.114.100.241
  82.114.248.25
  82.114.69.226
  82.114.70.2
@@ -109554,13 +91912,13 @@
  82.114.82.90
  82.114.90.90
  82.114.94.68
+82.115.215.148
  82.115.215.254
  82.115.215.74
  82.116.32.13
-82.116.38.167
  82.116.79.5
  82.117.166.77
-82.117.196.30
+82.117.194.229
  82.117.211.14
  82.117.215.14
  82.117.226.12
@@ -109575,13 +91933,10 @@
  82.118.242.108
  82.118.242.25
  82.118.242.76
-82.118.249.2
  82.124.198.234
  82.127.124.78
  82.127.135.212
-82.127.237.205
  82.127.74.162
-82.127.92.201
  82.128.141.82bin.sh
  82.128.247.149
  82.130.102.15
@@ -109590,8 +91945,6 @@
  82.131.156.40
  82.131.178.19
  82.131.188.148
-82.131.242.230
-82.133.19.74
  82.135.136.132
  82.135.148.201
  82.135.197.104
@@ -109599,12 +91952,14 @@
  82.135.248.243
  82.135.249.133
  82.136.99.247
+82.137.11.16
  82.137.224.192
  82.137.224.193
  82.137.245.41
  82.137.250.156
-82.137.85.127
  82.138.24.188
+82.139.146.190
+82.139.190.41
  82.140.113.229
  82.141.147.80
  82.142.135.10
@@ -109618,7 +91973,6 @@
  82.146.46.47
  82.146.51.150
  82.146.56.147
-82.146.59.119
  82.146.61.193
  82.146.62.52
  82.146.63.105
@@ -109628,31 +91982,24 @@
  82.147.120.32
  82.147.120.36
  82.147.120.41
-82.147.149.42
  82.147.220.206
  82.147.45.66
  82.147.67.70
  82.147.80.146
  82.147.93.63
-82.148.19.103
-82.148.19.150
-82.148.19.237
  82.148.25.100
  82.148.25.99
-82.148.30.192
-82.148.30.236
  82.150.140.40
  82.151.113.56
  82.151.114.197
  82.151.220.89
  82.155.146.249
-82.155.162.12
  82.155.28.72
+82.158.219.109
  82.158.34.200
+82.158.61.225
  82.159.109.89
-82.159.200.114
  82.16.128.254
-82.160.140.77
  82.160.151.123
  82.160.151.24
  82.160.151.79
@@ -109675,41 +92022,40 @@
  82.165.198.170
  82.165.23.226
  82.165.236.212
-82.165.48.119
+82.165.54.211
  82.165.73.97
  82.165.75.233
  82.165.80.32
-82.165.80.81
  82.165.83.163
-82.165.83.29
-82.165.86.113
  82.165.86.114
-82.165.87.188
+82.165.86.244
  82.166.152.154
-82.166.183.128
  82.166.212.178
  82.166.62.243
-82.169.239.184
  82.176.164.40
  82.177.176.1
+82.177.52.162
+82.177.66.97
+82.177.80.88
  82.177.87.98
-82.178.34.70
-82.178.54.240
+82.178.0.249
+82.178.185.83
+82.178.20.242
+82.179.123.213
  82.18.172.128
  82.181.218.229
  82.181.91.236
-82.183.2.151
+82.184.101.66
  82.192.81.160
  82.192.88.11
+82.193.100.83
  82.193.103.110
-82.193.110.177
  82.193.145.123
  82.193.15.3
-82.193.158.50
  82.194.17.45
+82.194.17.86
  82.194.182.54
  82.194.38.52
-82.194.48.186
  82.194.66.135
  82.194.85.198
  82.194.86.23
@@ -109719,10 +92065,7 @@
  82.196.11.13
  82.196.11.246
  82.196.11.77
-82.196.111.211
-82.196.111.89
  82.196.113.78
-82.196.115.225
  82.196.12.70
  82.196.14.163
  82.196.14.6
@@ -109741,22 +92084,18 @@
  82.197.214.197
  82.197.215.125
  82.199.102.10
-82.199.61.239
-82.2.193.244
+82.199.45.165
+82.199.47.90
+82.20.251.200
  82.200.105.254
  82.200.160.178
  82.200.164.134
-82.200.171.114
+82.200.171.115
  82.200.171.116
-82.200.174.6
  82.200.205.30
  82.200.226.226
-82.200.233.4
-82.200.247.240
-82.200.50.6
  82.200.55.38
  82.200.65.218
-82.200.80.174
  82.200.81.3
  82.200.81.5
  82.200.88.50
@@ -109768,36 +92107,25 @@
  82.202.167.55
  82.202.167.56
  82.202.197.224
-82.202.197.233
-82.202.65.12
  82.202.68.231
  82.202.99.217
  82.203.227.192
  82.204.141.94
  82.206.222.21
-82.207.104.194
-82.207.21.118
+82.207.255.45
  82.207.255.58
-82.207.27.206
  82.207.56.202
  82.207.57.10
  82.207.59.154
-82.207.87.24
-82.208.114.143
-82.208.115.192
  82.208.149.161
  82.208.173.16
  82.208.72.210
  82.209.118.57
-82.209.130.95
-82.209.131.93
-82.209.132.156
  82.209.133.186
  82.209.206.126
  82.209.216.156
  82.209.219.244
  82.209.232.109
-82.209.67.22
  82.21.164.47
  82.21.207.53
  82.211.24.102
@@ -109812,14 +92140,13 @@
  82.211.24.66
  82.211.31.210
  82.211.50.144
+82.211.50.217
  82.211.50.243
  82.211.57.140
  82.211.57.142
  82.211.57.149
  82.211.57.164
  82.211.57.187
-82.211.58.56
-82.211.58.60
  82.211.9.158
  82.211.9.163
  82.211.9.18
@@ -109827,15 +92154,10 @@
  82.211.9.23
  82.211.9.50
  82.211.9.68
-82.212.103.10
  82.213.194.180
  82.213.205.29
  82.213.225.154
-82.213.230.160
-82.213.231.238
-82.213.233.104
  82.213.78.2
-82.214.224.30
  82.216.110.29
  82.217.127.4
  82.217.194.145
@@ -109843,8 +92165,6 @@
  82.22.110.203
  82.22.211.81
  82.22.22.112
-82.220.0.85
-82.220.38.244
  82.221.100.229
  82.221.102.177
  82.221.102.181
@@ -109852,7 +92172,6 @@
  82.221.106.178
  82.221.109.194
  82.221.111.136
-82.221.113.209
  82.221.128.191
  82.221.128.31
  82.221.128.81
@@ -109884,113 +92203,82 @@
  82.221.99.238
  82.221.99.239
  82.222.167.10
-82.222.59.94
  82.222.97.21
  82.223.101.182
  82.223.104.73
  82.223.11.124
  82.223.120.84
  82.223.14.245
-82.223.19.45
  82.223.198.224
  82.223.69.17
-82.223.73.138
  82.224.63.194
  82.225.49.121
-82.228.108.208
+82.227.82.111
  82.228.6.131
-82.230.52.13
-82.233.232.25
  82.239.200.118
  82.242.45.193
  82.244.37.15
  82.246.125.71
  82.25.143.213
  82.25.245.121
-82.252.137.53
  82.252.143.139
  82.252.146.88
-82.252.150.198
-82.253.28.46
  82.254.243.42
  82.255.203.175
-82.255.38.238
+82.26.147.60
  82.3.220.15
  82.33.148.31
  82.37.31.3
  82.38.182.164
  82.39.166.139
  82.39.38.172
-82.39.82.18
  82.45.166.85
-82.47.214.29
+82.46.93.104
  82.48.182.76
-82.5.222.144
  82.5.67.222
  82.51.132.48
-82.52.129.87
-82.53.184.73
-82.54.10.123
  82.54.238.83
+82.58.219.5
  82.6.139.142
  82.60.7.40
  82.62.110.252
  82.62.153.15
-82.62.48.206
-82.62.67.4
-82.63.94.81
+82.62.225.40
  82.64.104.190
-82.64.131.215
  82.64.132.50
  82.64.15.100
-82.64.15.127
  82.64.165.77
  82.64.167.80
  82.64.170.170
-82.64.179.79
  82.64.182.28
  82.64.185.151
-82.64.197.218
  82.64.20.76
  82.64.201.47
  82.64.206.205
-82.64.212.80
-82.64.220.36
-82.64.231.55
  82.64.234.148
-82.64.247.199
  82.64.247.22
  82.64.247.247
  82.64.25.166
  82.64.25.207
  82.64.32.76
-82.64.32.81
  82.64.45.205
  82.64.46.144
  82.64.49.27
  82.64.57.228
-82.64.70.163
-82.64.71.54
-82.64.81.51
  82.64.83.141
  82.64.89.125
-82.65.1.45
  82.65.104.195
  82.65.108.248
  82.65.110.124
  82.65.115.199
  82.65.117.46
-82.65.119.113
  82.65.165.177
  82.65.166.65
  82.65.173.65
  82.65.190.68
-82.65.197.87
-82.65.204.172
  82.65.210.19
  82.65.23.62
  82.65.27.68
-82.65.3.217
  82.65.3.231
  82.65.33.144
  82.65.33.15
@@ -109999,14 +92287,12 @@
  82.65.86.43
  82.65.87.128
  82.66.234.57
-82.66.81.44
+82.67.1.3
  82.67.234.103
-82.67.235.179
  82.67.247.11
  82.67.68.28
  82.68.49.227
  82.69.119.77
-82.69.203.174
  82.71.0.201
  82.71.23.33
  82.73.140.167
@@ -110018,31 +92304,19 @@
  82.76.135.94
  82.76.52.155
  82.77.136.63
-82.77.172.31
-82.77.20.77
-82.77.206.149
  82.77.55.46
-82.77.63.61
  82.77.99.158
  82.78.179.117
-82.78.201.172
  82.79.1.241
  82.79.232.226
  82.79.232.29
-82.79.232.54
  82.79.58.192
  82.79.75.239
  82.8.232.51
-82.80.157.97
  82.80.191.120
  82.81.102.84
-82.81.170.125
-82.81.19.203
-82.81.199.8
  82.81.4.57
  82.81.55.84
-82.81.63.243
-82.81.69.65
  82.81.73.245
  82.82.242.131
  82.82.254.86
@@ -110050,7 +92324,6 @@
  82.94.228.100
  82.94.35.199
  82.95.118.115
-82.96.37.228
  82.98.104.217
  82.98.141.7
  82.98.160.105
@@ -110089,14 +92362,10 @@
  82kai.net
  82n651up8ce6lyi9r3w03q05149kf77dhgov.co
  82sz.com
-83.0.199.89
-83.1.199.157
  83.1.213.1
  83.1.215.1
  83.100.193.124
-83.102.172.104
  83.102.180.27
-83.102.217.96
  83.103.147.110
  83.103.150.72
  83.103.179.156
@@ -110108,29 +92377,22 @@
  83.103.59.192
  83.103.72.130
  83.11.160.187
-83.110.102.25
-83.110.198.160
  83.110.213.149
  83.110.214.35
  83.110.225.215
-83.110.5.234
-83.110.80.172
-83.111.21.130
+83.114.99.154
  83.118.200.190
-83.12.148.202
  83.12.153.149
  83.12.171.68
  83.12.244.50
-83.128.21.250
  83.128.49.155
-83.128.53.226
  83.13.19.85
  83.13.191.186
-83.13.209.154
-83.132.47.162
+83.132.163.151
  83.133.121.137
  83.133.127.251
  83.135.130.200
+83.135.172.195
  83.135.175.254
  83.135.194.93
  83.135.195.162
@@ -110140,17 +92402,14 @@
  83.135.200.105
  83.135.202.248
  83.135.202.78
-83.135.206.103
-83.135.93.95
-83.135.95.253
-83.136.113.33
-83.136.114.154
+83.135.89.168
  83.136.123.228
  83.136.126.153
  83.136.176.64
  83.136.176.67
  83.136.176.90
  83.136.45.25
+83.137.202.253
  83.137.41.10
  83.137.53.31
  83.137.54.101
@@ -110158,29 +92417,21 @@
  83.138.48.14
  83.14.56.203
  83.142.167.128
-83.142.167.207
  83.142.193.145
  83.142.197.99
  83.142.52.116
-83.142.52.39
  83.142.52.40
  83.142.53.199
  83.142.54.101
  83.142.54.143
-83.142.54.29
-83.142.54.82
  83.142.55.201
  83.142.55.89
  83.142.83.21
-83.143.133.76
  83.143.134.34
  83.143.24.27
-83.143.246.30
  83.143.26.34
  83.143.31.254
-83.144.113.114
  83.144.117.139
-83.144.81.178
  83.145.138.21
  83.146.55.208
  83.147.152.1
@@ -110200,6 +92451,7 @@
  83.159.240.104
  83.16.100.218
  83.16.192.82
+83.160.81.177
  83.161.157.200
  83.161.158.205
  83.161.192.36
@@ -110208,20 +92460,16 @@
  83.162.211.100
  83.162.240.14
  83.162.251.163
-83.162.47.217
  83.163.153.74
  83.163.211.75
  83.164.146.86
+83.165.46.251
  83.165.50.235
-83.166.100.170
-83.166.101.237
  83.166.241.216
-83.167.1.125
  83.167.203.174
  83.167.244.167
  83.167.247.177
  83.167.27.4
-83.167.29.29
  83.167.73.151
  83.167.87.198
  83.168.84.130
@@ -110235,7 +92483,6 @@
  83.168.84.89
  83.168.86.189
  83.169.17.225
-83.169.197.13
  83.169.20.144
  83.169.208.218
  83.169.21.32
@@ -110251,7 +92498,6 @@
  83.170.193.178
  83.170.200.34
  83.171.114.92
-83.171.122.188
  83.171.236.98
  83.171.252.101
  83.171.252.167
@@ -110262,7 +92508,6 @@
  83.171.252.83
  83.171.252.96
  83.171.253.171
-83.171.253.20
  83.171.253.221
  83.171.253.226
  83.171.253.245
@@ -110271,7 +92516,6 @@
  83.171.253.90
  83.171.254.244
  83.171.255.84
-83.171.96.64
  83.171.98.129
  83.171.98.47
  83.171.99.160
@@ -110282,95 +92526,76 @@
  83.174.233.94
  83.175.111.138
  83.175.166.234
-83.176.246.79
  83.179.210.166
-83.18.0.141
  83.18.149.38
  83.18.190.64
-83.184.127.230
+83.18.207.66
  83.19.92.133
  83.19.99.66
-83.196.10.75
  83.196.244.125
  83.198.144.132
-83.199.8.45
+83.2.189.15
+83.2.189.6
  83.2.189.66
  83.20.207.43
  83.200.131.138
  83.202.231.25
-83.205.76.159
-83.208.87.187
+83.205.45.224
  83.209.106.141
  83.209.113.57
  83.209.114.139
  83.209.114.176
  83.209.121.104
  83.209.219.235
-83.209.252.83
  83.212.102.225
  83.212.111.202
+83.212.79.85
  83.213.113.249
  83.213.167.112
-83.215.158.207
-83.216.126.164
-83.216.126.214
  83.216.160.146
  83.216.190.83
+83.216.192.40
+83.216.203.202
  83.217.154.155
  83.218.158.174
  83.218.162.181
  83.219.1.201
  83.219.139.66
-83.219.144.181
  83.219.149.60
  83.22.53.166
-83.220.116.230
+83.22.6.20
  83.220.144.22
-83.220.162.174
  83.220.173.158
  83.220.32.76
  83.221.163.157
  83.221.175.184
  83.221.211.116
-83.221.215.138
-83.221.215.66
+83.221.222.209
  83.221.222.94
+83.221.244.244
  83.221.95.83
  83.222.178.177
-83.222.223.106
  83.222.5.124
-83.224.136.129
-83.224.144.150
-83.224.155.232
  83.227.81.9
  83.228.102.154
  83.228.47.75
-83.228.97.218
  83.229.149.191
  83.23.113.142
  83.23.172.159
  83.231.34.133
  83.231.34.192
-83.233.106.108
-83.233.195.161
-83.233.201.201
  83.233.30.201
-83.233.60.31
  83.233.72.144
  83.233.72.172
  83.233.72.174
-83.234.201.102
  83.234.206.200
  83.234.206.47
  83.234.42.3
  83.234.76.155
-83.235.176.144
  83.236.135.251
-83.236.16.130
  83.238.39.250
  83.239.138.38
  83.239.38.2
-83.239.46.124
  83.240.102.11
  83.240.15.151
  83.240.242.218
@@ -110384,35 +92609,24 @@
  83.244.54.230
  83.248.66.194
  83.25.14.196
-83.250.112.85
  83.250.140.254
-83.250.21.186
-83.250.58.75
  83.251.241.0
-83.251.36.148
-83.251.43.108
  83.252.154.124
-83.254.119.42
-83.255.28.40
-83.255.85.92
  83.255.94.204
  83.27.180.187
-83.3.151.42
  83.30.244.216
  83.30.46.3
-83.31.183.51
  83.32.181.76
  83.32.58.232
-83.35.105.212
  83.36.104.129
  83.37.158.47
  83.37.233.136
  83.38.39.93
  83.39.80.87
-83.4.100.251
  83.41.87.245
+83.42.165.145
  83.43.53.115
-83.44.21.4
+83.45.101.123
  83.45.243.249
  83.45.57.6
  83.46.26.156
@@ -110421,17 +92635,14 @@
  83.48.89.147
  83.48.97.152
  83.49.35.5
-83.51.252.70
-83.54.96.193
  83.54.97.16
  83.55.0.232
-83.56.104.6
  83.56.24.88
  83.56.82.242
  83.57.100.174
  83.58.102.30
  83.58.97.92
-83.59.212.127
+83.59.96.57
  83.6.146.196
  83.6.159.151
  83.6.163.133
@@ -110441,17 +92652,12 @@
  83.64.132.254
  83.68.251.177
  83.69.125.126
-83.69.222.102
-83.69.230.5
  83.69.237.89
  83.69.90.191
-83.69.93.64
  83.70.212.143
-83.76.5.44
  83.78.237.223
+83.78.56.171
  83.78.71.208
-83.79.177.242
-83.79.59.54
  83.81.29.140
  83.83.155.43
  83.85.139.94
@@ -110460,38 +92666,21 @@
  83.85.9.236
  83.85.97.52
  83.86.39.14
+83.9.153.19
  83.96.205.72
  83.96.213.63
+83.96.237.121
  83.97.108.73
  83.97.111.202
  83.97.20.100
  83.97.20.101
-83.97.20.111
-83.97.20.112
-83.97.20.114
-83.97.20.115
-83.97.20.116
-83.97.20.117
-83.97.20.118
-83.97.20.155
-83.97.20.161
-83.97.20.170
-83.97.20.174
-83.97.20.183
-83.97.20.193
-83.97.20.218
-83.97.20.222
  83.97.20.245
-83.97.20.246
  83.97.20.248
-83.97.20.25
  83.97.20.29
  83.97.20.30
  83.97.20.31
  83.97.20.34
-83.97.20.35
  83.97.20.39
-83.97.20.51
  83.97.20.90
  83.97.20.98
  83.97.20.99
@@ -110499,6 +92688,9 @@
  83.98.136.17
  83.99.168.149
  83.99.245.20
+83.99.83.188
+83.99.83.190
+83.99.83.192
  83010624-96-20190711114544.webstarterz.com
  8304153-89850-dot-bles05.wn.r.appspot.com
  8322344-dot-n-e-w-me-ss-age-po-rt-al.wl.r.appspot.com
@@ -110522,21 +92714,17 @@
  84.1.150.59
  84.1.159.129
  84.1.30.70
-84.1.35.197
-84.101.76.23
  84.102.96.90
+84.104.111.74
  84.104.86.54
  84.105.163.103
  84.105.166.237
  84.106.37.98
-84.107.133.11
  84.107.72.15
  84.108.31.35
  84.108.77.68
  84.110.106.22
-84.110.53.130
  84.111.145.182
-84.112.191.19
  84.112.215.118
  84.112.42.60
  84.112.47.232
@@ -110544,26 +92732,25 @@
  84.113.144.10
  84.113.25.238
  84.115.141.72
-84.118.107.8
+84.117.41.161
  84.118.161.63
  84.118.239.130
  84.120.107.50
  84.120.137.133
  84.121.196.149
  84.122.1.218
+84.123.120.168
  84.123.13.17
  84.126.137.181
  84.126.71.50
  84.127.40.16
-84.131.116.218
-84.133.170.124
-84.133.172.166
  84.133.172.231
  84.136.19.229
-84.137.24.217
+84.137.19.117
  84.137.26.145
  84.140.144.150
  84.140.148.249
+84.141.40.90
  84.145.126.138
  84.145.76.125
  84.15.143.111
@@ -110571,20 +92758,19 @@
  84.15.160.174
  84.15.173.108
  84.15.209.197
-84.154.244.15
-84.154.244.76
+84.151.185.245
  84.154.252.185
-84.155.122.70
  84.16.126.83
-84.16.238.19
  84.16.238.31
  84.16.248.172
  84.16.249.85
  84.16.38.218
-84.160.57.228
+84.16.46.130
+84.160.51.185
  84.161.193.215
-84.162.122.37
-84.166.212.158
+84.166.211.225
+84.166.212.38
+84.166.213.148
  84.166.216.28
  84.168.252.185
  84.17.15.2
@@ -110601,7 +92787,6 @@
  84.17.48.37
  84.17.48.4
  84.17.49.105
-84.17.49.129
  84.17.49.191
  84.17.49.48
  84.17.49.54
@@ -110616,45 +92801,49 @@
  84.17.51.68
  84.17.51.70
  84.17.51.8
+84.17.52.82
  84.17.54.71
  84.17.55.102
  84.17.55.113
  84.17.55.118
  84.17.55.125
  84.17.55.21
+84.17.55.24
  84.17.55.6
  84.17.55.8
  84.17.60.218
+84.17.60.70
  84.17.61.189
  84.17.61.225
-84.170.116.244
  84.170.129.9
-84.171.152.11
+84.171.148.4
+84.172.224.206
+84.172.225.21
  84.172.225.84
-84.172.229.162
+84.172.227.146
  84.172.229.208
-84.172.231.106
+84.172.231.225
  84.172.232.106
-84.172.232.133
  84.172.233.119
  84.174.96.222
-84.176.63.126
  84.178.176.99
-84.18.100.238
-84.183.211.1
+84.178.178.249
+84.178.189.194
+84.181.28.52
  84.183.211.60
  84.184.84.210
  84.184.87.110
-84.184.94.156
-84.185.52.58
+84.185.49.198
  84.185.60.125
  84.186.209.237
  84.19.178.210
  84.19.188.216
+84.190.138.127
  84.191.208.22
  84.194.158.124
+84.194.181.154
  84.194.55.181
-84.197.122.50
+84.195.100.120
  84.197.198.167
  84.199.237.190
  84.2.128.210
@@ -110662,7 +92851,6 @@
  84.200.14.253
  84.200.206.82
  84.200.84.220
-84.201.130.54
  84.201.147.68
  84.201.150.241
  84.201.170.4
@@ -110686,21 +92874,18 @@
  84.201.183.62
  84.201.183.63
  84.201.231.52
-84.202.130.225
  84.202.88.73
+84.203.0.167
  84.203.99.141
  84.204.144.174
-84.204.168.242
  84.204.40.154
  84.205.15.25
  84.205.47.232
  84.209.1.53
-84.209.133.126
  84.209.139.0
  84.209.31.168
  84.209.48.106
  84.209.60.46
-84.21.170.61
  84.21.191.41
  84.21.191.96
  84.210.227.110
@@ -110712,18 +92897,16 @@
  84.213.229.82
  84.213.92.152
  84.214.103.73
+84.214.150.146
  84.214.55.15
-84.215.88.26
-84.216.160.201
  84.216.51.36
  84.217.240.49
  84.217.82.227
  84.22.116.140
-84.22.136.158
-84.22.136.17
  84.22.138.150
  84.22.144.202
  84.22.198.26
+84.22.35.142
  84.22.35.35
  84.22.36.53
  84.22.42.213
@@ -110736,17 +92919,11 @@
  84.221.217.183
  84.226.245.96
  84.226.56.42
-84.228.120.49
-84.228.49.175
-84.229.233.3
-84.23.138.151
-84.23.141.177
  84.232.113.247
-84.232.120.113
+84.232.141.249
  84.232.168.102
  84.232.18.171
  84.232.223.152
-84.232.24.31
  84.232.24.37
  84.232.78.2
  84.232.78.30
@@ -110754,6 +92931,7 @@
  84.234.18.53
  84.234.201.188
  84.234.251.132
+84.236.105.208
  84.236.122.160
  84.236.171.41
  84.236.185.247
@@ -110762,31 +92940,21 @@
  84.236.6.226
  84.236.90.99
  84.237.195.20
-84.238.140.107
  84.238.24.35
  84.238.44.49
-84.238.96.208
  84.239.39.142
  84.239.39.89
+84.240.207.204
  84.240.26.123
-84.240.28.49
  84.240.9.6
-84.241.52.38
-84.242.116.94
-84.242.132.114
  84.242.139.108
-84.242.176.138
  84.242.183.146
  84.242.183.150
  84.242.50.202
  84.243.108.186
-84.243.13.142
  84.244.104.14
-84.244.14.149
  84.244.180.102
  84.244.20.92
-84.244.44.163
-84.245.121.77
  84.245.219.96
  84.246.144.167
  84.246.150.177
@@ -110797,20 +92965,16 @@
  84.247.232.209
  84.247.238.51
  84.247.44.46
-84.247.50.198
+84.247.50.246
  84.247.50.250
  84.247.51.123
-84.248.202.97
  84.250.5.191
-84.252.121.99
  84.252.55.124
-84.254.38.12
  84.254.39.129
  84.254.90.125
  84.255.194.237
  84.255.203.218
  84.255.204.59
-84.255.243.69
  84.255.244.61
  84.255.249.163
  84.255.249.179
@@ -110819,25 +92983,18 @@
  84.26.232.111
  84.3.59.133
  84.30.178.241
+84.30.58.160
  84.33.109.107
  84.33.119.102
-84.38.110.18
  84.38.129.217
-84.38.132.54
  84.38.134.198
-84.38.184.53
+84.38.184.216
  84.38.184.79
  84.38.185.122
-84.38.187.199
-84.38.187.220
-84.38.187.221
-84.38.187.235
  84.38.3.249
  84.38.64.183
  84.38.66.11
-84.38.95.147
  84.39.241.53
-84.40.136.249
  84.40.94.170
  84.40.96.129
  84.42.204.37
@@ -110846,7 +93003,6 @@
  84.42.33.178
  84.42.45.165
  84.42.62.141
-84.43.106.153
  84.43.181.174
  84.43.90.54
  84.45.121.135
@@ -110856,7 +93012,6 @@
  84.47.226.66
  84.47.226.68
  84.5.107.140
-84.5.164.59
  84.50.37.100
  84.51.0.195
  84.51.0.197
@@ -110867,13 +93022,9 @@
  84.51.33.98
  84.51.56.123
  84.51.56.69
-84.51.58.168
-84.51.59.169
-84.51.60.137
  84.51.92.9
  84.52.108.218
  84.52.53.11
-84.52.85.238
  84.53.192.243
  84.53.225.118
  84.53.238.49
@@ -110893,39 +93044,26 @@
  84.54.58.82
  84.54.58.84
  84.55.70.80
+84.55.91.155
  84.57.168.97
  84.58.161.111
-84.58.27.25
-84.60.34.178
  84.61.40.68
  84.63.136.83
  84.63.171.4
  84.63.47.114
  84.64.17.153
-84.65.126.223
-84.65.3.80
+84.67.0.100
  84.67.12.223
  84.67.126.130
-84.67.3.10
-84.68.32.199
  84.69.193.148
  84.7.123.249
  84.7.96.195
  84.71.195.200
-84.71.251.13
-84.71.40.199
-84.71.76.36
  84.72.111.202
-84.73.124.186
  84.73.156.202
-84.73.17.41
  84.74.104.18
-84.74.63.96
  84.75.176.24
-84.75.24.162
  84.75.253.40
-84.75.60.192
-84.75.98.210
  84.75.98.31
  84.77.56.14
  84.80.143.197
@@ -110937,7 +93075,6 @@
  84.92.24.249
  84.92.92.247
  84.93.41.20
-84.95.2.159
  84.99.18.247
  840215.servicesbpd.club
  840e4d67.ngrok.io
@@ -110967,9 +93104,6 @@
  84j4n5.godaddysites.com
  85.0.200.60
  85.0.223.190
-85.1.121.57
-85.1.18.231
-85.1.29.150
  85.10.130.23
  85.10.192.158
  85.10.195.47
@@ -110986,52 +93120,42 @@
  85.10.53.90
  85.10.56.138
  85.100.122.211
-85.100.126.91
  85.100.43.171
+85.100.73.76
  85.101.118.60
  85.101.119.249
  85.102.200.49
  85.102.76.165
-85.103.30.47
  85.103.33.158
  85.104.56.227
  85.104.59.244
-85.105.100.160
  85.105.111.166
  85.105.155.236
  85.105.156.8
-85.105.192.117
  85.105.201.226
  85.105.205.77
-85.105.218.93
  85.105.220.188
  85.105.224.141
  85.105.23.115
-85.105.242.73
-85.105.243.119
  85.105.243.229
-85.105.255.37
-85.105.44.145
+85.105.4.210
+85.105.4.244
+85.105.73.217
  85.105.83.125
  85.105.86.151
  85.105.97.45
-85.106.223.57
-85.106.227.127
+85.106.4.10
  85.106.8.102
  85.109.127.48
  85.109.43.176
  85.109.58.221
  85.109.82.114
-85.11.155.160
  85.11.55.215
  85.111.12.199
-85.111.55.19
-85.111.74.140
-85.112.44.170
+85.111.52.8
  85.112.76.58
-85.112.87.116
+85.112.87.117
  85.112.87.118
-85.113.0.202
  85.113.136.32
  85.113.140.196
  85.113.38.197
@@ -111041,14 +93165,13 @@
  85.114.135.126
  85.114.140.127
  85.114.141.60
-85.114.165.95
  85.114.38.206
  85.114.96.154
-85.115.173.73
  85.115.224.150
  85.116.120.106
  85.116.125.149
  85.116.157.117
+85.117.234.44
  85.117.235.155
  85.117.56.103
  85.117.56.73
@@ -111058,35 +93181,28 @@
  85.117.61.186
  85.117.62.202
  85.117.63.98
+85.117.82.3
  85.118.105.20
  85.119.108.134
  85.119.154.60
  85.119.80.219
-85.119.83.25
  85.12.15.41
  85.12.33.30
-85.121.205.185
-85.128.142.215
  85.128.60.158
  85.13.134.81
  85.13.229.138
  85.13.237.23
-85.132.116.31
  85.132.37.196
-85.132.79.170
  85.132.96.242
  85.133.130.132
  85.133.143.35
-85.133.190.156
+85.133.197.169
  85.135.95.218
  85.138.184.157
  85.138.240.40
-85.139.15.102
-85.14.10.115
  85.14.243.31
  85.14.243.50
  85.14.79.26
-85.140.218.114
  85.142.45.77
  85.143.210.193
  85.143.213.2
@@ -111094,38 +93210,36 @@
  85.143.220.38
  85.143.221.251
  85.143.228.200
+85.143.228.220
  85.143.228.78
  85.143.254.20
  85.145.142.46
  85.146.16.131
  85.146.208.186
  85.148.168.20
-85.149.60.10
  85.149.70.74
  85.15.179.235
  85.15.179.236
  85.15.189.204
  85.15.190.89
  85.15.200.145
+85.152.147.175
  85.152.162.105
  85.152.174.56
-85.152.20.146
  85.154.100.103
+85.154.21.218
  85.158.181.41
  85.158.241.222
  85.159.178.172
  85.159.237.71
  85.159.27.133
-85.159.27.40
  85.16.88.152
  85.163.113.115
  85.163.113.35
  85.163.113.58
  85.163.224.168
  85.163.53.75
-85.164.159.23
  85.164.188.252
-85.165.177.124
  85.165.8.86
  85.166.127.166
  85.167.127.116
@@ -111147,19 +93261,17 @@
  85.17.75.108
  85.17.90.143
  85.170.178.143
-85.170.233.95
+85.171.112.206
  85.171.52.251
-85.172.10.110
  85.172.107.1
  85.172.12.245
  85.172.170.146
  85.172.189.189
  85.172.38.232
+85.172.39.174
  85.172.98.94
  85.173.165.36
  85.174.193.241
-85.174.193.69
-85.175.100.254
  85.175.171.169
  85.175.227.3
  85.175.4.251
@@ -111174,15 +93286,11 @@
  85.18.236.229
  85.184.138.108
  85.184.191.57
-85.184.248.246
+85.185.149.28
  85.185.152.146
  85.185.152.148
  85.185.152.155
-85.185.161.50
-85.185.169.41
-85.185.169.42
  85.185.236.173
-85.185.75.243
  85.186.38.228
  85.187.158.15
  85.187.158.180
@@ -111191,67 +93299,50 @@
  85.187.245.10
  85.187.247.58
  85.187.255.6
-85.187.6.146
-85.187.69.214
-85.187.7.23
  85.190.0.5
  85.190.2.200
  85.190.2.205
  85.190.240.197
  85.190.42.199
+85.190.72.36
  85.191.200.51
  85.192.130.228
  85.192.191.6
-85.194.102.234
  85.194.238.131
  85.195.206.199
-85.195.222.234
  85.195.232.197
  85.195.234.244
  85.195.255.212
  85.195.54.110
  85.195.92.173
-85.196.135.154
  85.196.136.1
  85.196.136.13
  85.196.136.17
  85.196.136.9
+85.196.173.25
  85.196.183.162
-85.196.211.100
  85.196.25.2
-85.196.80.134
  85.197.190.65
  85.198.115.122
-85.198.133.22
  85.198.142.186
  85.198.185.26
  85.198.250.135
  85.198.250.240
-85.2.78.38
-85.202.176.146
+85.2.140.103
  85.202.194.129
  85.202.194.17
  85.202.194.218
-85.202.194.37
-85.202.194.76
  85.202.195.131
  85.202.195.190
-85.202.195.230
  85.202.195.31
  85.202.195.56
  85.202.195.74
  85.202.195.84
  85.202.229.205
-85.203.46.132
-85.203.46.94
  85.204.116.111
  85.204.116.139
  85.204.116.216
  85.204.116.68
-85.204.116.91
-85.204.116.93
-85.204.131.228
-85.204.132.207
  85.204.231.216
  85.204.246.107
  85.204.246.138
@@ -111263,36 +93354,28 @@
  85.206.57.202
  85.207.128.82
  85.208.109.193
-85.208.109.221
  85.208.140.118
  85.208.185.212
-85.208.203.4
-85.208.209.223
-85.208.210.186
+85.208.211.221
  85.208.213.114
  85.208.213.38
  85.208.22.162
  85.208.69.13
  85.208.76.1
  85.208.76.2
-85.208.87.151
-85.208.87.165
+85.208.85.203
  85.208.87.84
  85.209.0.186
  85.209.150.204
-85.209.150.86
  85.209.151.18
-85.209.43.164
-85.209.43.182
-85.209.43.80
  85.209.48.42
  85.209.89.243
-85.21.144.39
  85.21.63.219
  85.212.110.31
-85.212.128.19
+85.212.170.94
+85.212.187.71
+85.212.30.17
  85.212.72.71
-85.212.98.32
  85.214.103.48
  85.214.108.223
  85.214.134.8
@@ -111306,15 +93389,13 @@
  85.214.161.252
  85.214.166.228
  85.214.185.51
-85.214.19.222
-85.214.195.251
  85.214.20.76
  85.214.202.180
  85.214.204.63
+85.214.215.94
  85.214.220.236
  85.214.226.124
  85.214.240.9
-85.214.242.144
  85.214.242.199
  85.214.244.174
  85.214.25.136
@@ -111333,7 +93414,6 @@
  85.214.78.60
  85.214.88.96
  85.214.93.64
-85.214.95.50
  85.214.97.248
  85.215.9.88
  85.215.92.224
@@ -111342,6 +93422,7 @@
  85.217.137.77
  85.217.170.105
  85.217.192.39
+85.217.198.29
  85.218.32.42
  85.221.199.54
  85.221.209.198
@@ -111349,14 +93430,9 @@
  85.222.206.142
  85.222.69.218
  85.223.214.130
-85.224.217.159
-85.224.71.160
  85.225.145.83
-85.226.108.59
-85.226.136.209
  85.226.140.177
-85.227.203.156
-85.227.246.148
+85.226.142.63
  85.228.216.200
  85.228.239.10
  85.228.51.221
@@ -111364,20 +93440,19 @@
  85.23.51.254bin.sh
  85.23.7.190
  85.23.74.139
-85.230.125.61
-85.230.178.63
  85.232.129.67
  85.232.244.35
  85.232.25.226
+85.233.132.14
  85.233.255.168
  85.234.117.151
  85.234.125.120
  85.234.126.107
  85.234.143.94
  85.234.145.132
-85.234.145.20
  85.235.190.138
  85.235.66.147
+85.236.243.3
  85.236.25.18
  85.237.201.58
  85.237.44.125
@@ -111393,35 +93468,22 @@
  85.238.106.106
  85.238.167.170
  85.238.168.253
+85.238.184.237
  85.239.121.168
-85.239.152.164
  85.239.35.123
  85.239.35.124
  85.239.35.130
-85.239.35.243
  85.239.42.68
  85.24.135.103
-85.24.160.164
-85.24.163.112
-85.24.164.102
-85.24.186.23
  85.24.194.41
-85.24.232.32
-85.240.208.186
  85.240.233.220
-85.240.75.253
  85.241.106.203
  85.241.214.129
  85.241.39.182
-85.243.193.182
  85.244.234.165
  85.245.145.254
  85.245.19.44
-85.245.193.18
  85.245.204.149
-85.245.209.184
-85.245.245.202
-85.245.26.254
  85.245.83.77
  85.246.168.252
  85.246.59.168
@@ -111429,14 +93491,12 @@
  85.247.0.210
  85.247.109.182
  85.247.151.109
-85.247.33.128
  85.248.227.163
  85.248.227.164
  85.248.227.165
  85.248.6.41
  85.249.107.197
-85.249.175.200
-85.249.42.30
+85.249.161.240
  85.25.119.252
  85.25.138.55
  85.25.185.58
@@ -111454,61 +93514,46 @@
  85.25.95.141
  85.25.95.51
  85.250.81.39
+85.251.134.91
  85.252.123.110
+85.254.18.43
  85.254.72.27
-85.255.203.42
+85.26.143.66
  85.26.164.61
  85.26.165.119
  85.26.165.174
-85.26.165.44
+85.26.165.177
  85.26.199.81
  85.26.230.29
  85.29.136.213
-85.29.136.63
-85.3.206.174
-85.30.179.80
  85.30.215.48
-85.30.232.135
  85.30.248.210
-85.30.42.173
-85.30.61.54
  85.33.122.226
  85.38.164.51
  85.40.107.210
  85.41.101.82
-85.42.217.145
  85.45.123.234
  85.48.35.208
-85.5.121.39
  85.5.155.94
-85.5.89.225
  85.51.12.244
  85.52.217.114
-85.55.23.178
  85.58.120.201
-85.6.195.205
-85.6.249.129
  85.60.193.225
-85.62.11.130
+85.61.97.199
  85.62.153.243
-85.62.34.210
  85.65.31.136
  85.66.32.181
-85.67.184.171
  85.67.241.46
  85.70.104.25
  85.70.156.209
  85.70.97.59
-85.72.110.235
  85.72.186.146
+85.72.187.200
  85.72.188.238
  85.72.32.44
-85.72.38.209
-85.72.51.33
-85.73.0.131
  85.73.20.86
  85.73.25.57
-85.73.88.6
+85.74.150.230
  85.74.174.199
  85.75.114.159
  85.75.226.62
@@ -111518,9 +93563,6 @@
  85.84.212.12
  85.85.12.67
  85.87.89.170
-85.89.170.99
-85.89.183.27
-85.89.187.195
  85.9.134.10
  85.9.20.135
  85.9.20.138
@@ -111539,14 +93581,9 @@
  85.92.165.225
  85.92.183.37
  85.92.183.97
-85.92.219.199
  85.92.59.59
-85.93.182.254
  85.93.20.102
  85.93.20.130
-85.93.20.247
-85.93.20.248
-85.93.20.6
  85.93.20.70
  85.93.20.82
  85.93.20.83
@@ -111560,25 +93597,19 @@
  85.93.20.91
  85.93.20.92
  85.93.218.204
-85.94.100.153
  85.94.201.138
  85.94.33.242
  85.95.167.186
-85.95.245.50
  85.95.245.63
  85.96.187.204
-85.96.200.217
-85.96.205.169
  85.97.148.176
  85.97.177.82
  85.97.178.127
  85.97.178.51
  85.97.204.234
-85.98.243.215
-85.98.44.116
+85.98.10.14
  85.99.227.200
  85.99.231.250
-85.99.246.150
  85.99.52.195
  8501sanl.com
  850648486-dot-n-e-w-me-ss-age-po-rt-al.wl.r.appspot.com
@@ -111601,29 +93632,25 @@
  86-club.tw
  86.0.196.72
  86.0.33.192
-86.1.199.175
  86.100.63.127
  86.101.128.189
  86.101.129.2
  86.101.129.22
  86.101.129.225
  86.101.129.233
-86.101.154.50
+86.101.154.141
  86.101.224.233
-86.102.142.118
-86.102.20.250
  86.102.3.226
  86.102.30.75
  86.102.37.254
-86.104.14.43
  86.104.15.20
  86.104.18.51
  86.104.194.116
-86.104.194.195
-86.104.194.196
  86.104.194.88
  86.105.1.116
  86.105.1.13
+86.105.103.161
+86.105.103.99
  86.105.18.15
  86.105.18.170
  86.105.18.185
@@ -111645,8 +93672,6 @@
  86.106.92.23
  86.107.110.78
  86.107.187.54
-86.108.109.91
-86.108.35.252
  86.109.105.151
  86.109.165.202
  86.109.170.199
@@ -111660,69 +93685,52 @@
  86.111.144.10
  86.111.146.250
  86.111.88.138
-86.120.131.210
+86.120.101.38
  86.120.14.8
  86.120.157.254
-86.120.160.33
-86.120.218.146
  86.120.79.84
-86.121.156.19
-86.121.162.163
-86.121.235.236
-86.122.102.104
-86.122.105.213
+86.121.196.181
  86.122.170.50
-86.122.21.75
-86.122.53.165
-86.123.114.6
-86.123.138.111
  86.123.188.209
-86.123.55.43
-86.124.131.5
-86.124.193.174
+86.123.229.234
  86.124.230.115
  86.124.249.9
  86.124.88.83
  86.125.112.230
  86.125.169.47
  86.125.205.28
+86.125.60.80
  86.126.146.24
  86.127.18.112
  86.127.199.105
-86.129.197.74
-86.129.245.167
+86.127.34.167
  86.130.133.133
  86.130.243.174
  86.130.244.78
  86.130.65.178
-86.131.171.141
-86.131.171.252
-86.134.255.97
  86.137.132.77
-86.138.24.26
  86.14.0.69
  86.141.123.144
-86.141.235.71
+86.142.114.73
  86.142.241.133
  86.143.124.247
  86.144.134.215
  86.144.181.162
  86.148.151.170
  86.149.8.23
-86.150.207.14
  86.154.142.238
-86.154.58.165
+86.157.235.199
  86.159.105.46
  86.159.154.192
  86.16.194.177
+86.16.246.240
  86.160.58.252
  86.164.170.51
  86.165.30.176
  86.166.224.72
-86.168.158.24
  86.169.186.53
-86.169.196.8
  86.172.40.22
+86.173.32.184
  86.173.62.115
  86.175.171.213
  86.177.237.106
@@ -111733,69 +93741,58 @@
  86.188.246.2
  86.188.250.209
  86.19.105.25
-86.19.160.244
  86.19.20.105
-86.192.140.174
  86.192.141.30
  86.193.209.93
-86.193.249.186
+86.194.89.156
  86.198.239.114
  86.198.239.197
  86.199.232.189
-86.2.188.146
-86.20.194.52
-86.207.132.149
  86.21.115.71
  86.213.176.61
  86.213.63.181
  86.22.221.170
-86.223.227.27
  86.223.236.86
  86.23.210.63
  86.235.226.160
-86.24.104.62
  86.24.173.237
+86.245.200.190
  86.247.207.79
+86.248.72.198
  86.249.75.133
+86.253.181.34
  86.26.149.239
  86.28.76.188
  86.30.96.58
  86.31.163.247
  86.31.177.60
  86.34.157.3
-86.34.40.215
-86.35.35.99
  86.38.10.57
  86.42.166.147
-86.45.145.20
  86.47.252.137
  86.49.108.37
  86.49.157.42
  86.51.26.11
  86.52.44.102
  86.56.238.247
-86.57.131.182
-86.57.154.68
  86.57.167.132
  86.57.181.122
  86.57.216.191
  86.57.216.23
+86.57.236.67
  86.57.243.168
  86.58.206.100
  86.60.155.217
  86.60.179.136
-86.60.36.170
  86.61.66.59
  86.62.120.68
  86.62.58.160
  86.62.58.203
  86.62.58.91
-86.63.66.230
  86.67.203.117
  86.68.41.70
  86.75.201.236
-86.76.7.132
-86.82.45.70
+86.81.169.254
  86.83.88.212
  86.84.198.19
  86.86.93.95
@@ -111809,14 +93806,12 @@
  86.92.131.171
  86.92.137.53
  86.94.204.81
-86.95.129.250
  86.95.8.249
+86.96.44.188
+86.97.23.124
  86.97.97.216
-86.98.215.67
  86.98.223.14
  86.98.72.177
-86.98.9.52
-86.99.130.96
  86.99.17.120
  860259.com
  861365365.com
@@ -111843,23 +93838,18 @@
  86buortfa86.bankofamericaslpemr.com
  86g8ur.000webhostapp.com
  86mld.com
-87.0.53.166
-87.1.74.226
-87.101.178.215
+87.101.114.182
  87.101.64.182
-87.101.66.145
+87.101.83.228
  87.101.92.130
  87.101.94.67
  87.103.120.250
  87.103.126.98
-87.103.172.19
  87.103.174.109
  87.103.174.147
  87.103.196.236
-87.103.206.93
-87.103.208.30
+87.103.204.97
  87.103.245.190
-87.104.119.9
  87.106.108.154
  87.106.126.71
  87.106.133.138
@@ -111874,6 +93864,8 @@
  87.106.18.12
  87.106.181.84
  87.106.189.77
+87.106.202.10
+87.106.202.11
  87.106.204.174
  87.106.205.195
  87.106.210.109
@@ -111889,7 +93881,9 @@
  87.106.76.218
  87.106.94.225
  87.107.116.255
+87.107.159.35
  87.107.165.144
+87.107.72.98
  87.11.240.80
  87.110.181.30
  87.110.188.59
@@ -111901,26 +93895,19 @@
  87.116.161.9
  87.116.179.78
  87.116.180.185
-87.116.181.105
-87.116.181.129
-87.116.181.158
-87.116.181.69
+87.116.182.3
  87.116.191.211
  87.117.1.169
  87.117.169.23
  87.117.19.29
  87.117.194.22
  87.117.204.95
-87.117.211.122
  87.117.228.94
  87.117.230.164
  87.117.234.172
  87.117.234.186
  87.117.234.195
-87.117.39.96
-87.117.45.19
  87.117.48.149
-87.117.49.160
  87.118.108.204
  87.118.110.27
  87.118.116.103
@@ -111940,18 +93927,13 @@
  87.119.119.105
  87.120.129.82
  87.120.179.74
-87.120.213.252
-87.120.215.98
  87.120.246.53
  87.120.254.114
-87.120.254.179
  87.120.254.98
  87.120.37.79
  87.120.55.114
  87.120.6.218
  87.120.8.5
-87.121.115.181
-87.121.25.120
  87.121.29.201
  87.121.37.156
  87.121.49.238
@@ -111959,14 +93941,20 @@
  87.121.76.86
  87.121.77.130
  87.121.77.67
-87.122.123.253
+87.122.126.49
  87.122.185.98
+87.122.209.142
  87.122.217.197
  87.122.218.137
  87.122.222.66
+87.122.222.91
  87.122.223.181
+87.122.239.120
  87.122.86.44
+87.123.109.144
  87.123.110.2
+87.123.144.8
+87.123.162.171
  87.123.168.43
  87.123.35.187
  87.123.35.235
@@ -111976,68 +93964,67 @@
  87.123.42.20
  87.123.42.78
  87.123.43.35
+87.123.50.55
  87.123.51.122
-87.123.52.124
+87.123.53.47
  87.123.56.118
+87.123.62.19
  87.123.64.200
+87.123.66.148
  87.123.66.77
  87.123.72.192
+87.123.75.54
+87.123.81.240
  87.123.94.123
+87.123.94.192
  87.124.164.13
  87.124.164.14
-87.126.166.107
-87.126.166.109
-87.126.173.200
+87.125.39.142
  87.126.64.193
-87.13.147.184
-87.13.200.175
  87.132.163.60
  87.132.217.50
  87.134.172.12
  87.138.108.161
  87.139.46.114
+87.14.106.192
  87.14.191.42
+87.140.193.0
  87.142.199.191
-87.142.205.75
+87.143.146.94
  87.143.157.158
+87.143.157.161
  87.146.254.112
+87.147.72.215
  87.150.48.212
-87.150.61.104
+87.150.54.178
  87.151.150.28
  87.151.61.254
-87.155.138.219
  87.156.39.63
  87.157.179.156
-87.157.185.19
+87.157.181.93
  87.157.191.185
  87.16.72.110
  87.162.125.84
  87.163.35.148
  87.165.81.185
-87.166.41.238
+87.166.22.55
+87.166.40.130
  87.169.126.200
-87.17.139.251
  87.17.218.205
  87.170.179.202
  87.171.95.165
+87.172.226.136
  87.172.228.223
-87.172.231.28
  87.173.180.42
-87.173.206.65
  87.173.22.17
-87.173.86.253
  87.177.227.50
-87.177.229.63
-87.178.49.39
-87.178.50.207
-87.178.51.190
-87.178.51.75
-87.178.58.158
+87.177.229.123
+87.178.51.192
  87.178.59.158
-87.178.59.159
-87.18.136.27
+87.178.60.14
+87.178.87.192
+87.180.15.183
  87.180.254.178
-87.180.9.110
  87.181.191.66
  87.182.231.191
  87.187.144.72
@@ -112047,22 +94034,18 @@
  87.188.125.211
  87.188.154.192
  87.188.192.193
-87.188.216.150
-87.189.112.184
-87.19.151.62
-87.19.203.140
-87.19.26.74
+87.188.197.58
+87.188.200.172
  87.193.48.235
  87.196.184.69
-87.197.119.114
+87.196.38.121
  87.197.137.223
-87.197.153.129
  87.197.157.206
  87.197.163.118
  87.197.56.50
-87.200.7.118
-87.203.126.69
+87.200.181.152
  87.204.102.195
+87.204.167.139
  87.204.220.68
  87.205.85.162
  87.206.227.194
@@ -112073,14 +94056,14 @@
  87.213.228.114
  87.214.199.95
  87.214.96.147
-87.217.91.78
  87.218.156.4
  87.218.217.138
  87.218.60.219
-87.220.213.123
-87.220.213.184
+87.220.212.165
+87.220.9.105
  87.221.255.204
-87.225.106.80
+87.225.106.89
+87.225.90.97
  87.226.165.143
  87.227.140.10
  87.227.140.42
@@ -112089,6 +94072,7 @@
  87.228.211.216
  87.229.120.152
  87.229.143.10
+87.229.224.6
  87.229.230.194
  87.229.24.252
  87.229.246.66
@@ -112098,33 +94082,35 @@
  87.230.81.124
  87.231.27.105
  87.234.138.201
+87.236.20.174
  87.236.212.196
-87.236.233.189
  87.237.120.219
-87.238.133.168
  87.239.171.138
+87.240.62.141
  87.240.90.215
  87.241.1.186
-87.241.128.55
-87.241.132.129
  87.241.143.6
  87.241.44.41
  87.241.56.181
-87.242.13.15
  87.242.225.165
  87.242.234.181
  87.242.78.186
-87.243.134.220
+87.244.147.54
  87.244.181.136
  87.244.182.241
+87.244.228.204
  87.244.4.93
  87.244.67.11
  87.245.163.250
  87.245.163.252
  87.245.170.253
  87.246.46.132
+87.246.58.27
  87.246.59.44
  87.246.7.0
+87.246.7.133
+87.246.7.138
+87.246.7.148
  87.246.7.157
  87.246.7.35
  87.246.7.36
@@ -112138,6 +94124,7 @@
  87.246.7.48
  87.246.7.50
  87.246.7.53
+87.246.7.55
  87.246.7.56
  87.247.111.222
  87.247.143.225
@@ -112145,60 +94132,23 @@
  87.247.3.234
  87.248.171.235
  87.248.182.115
-87.248.186.163
-87.248.19.119
  87.249.212.26
  87.249.217.57
  87.250.222.22
  87.251.122.178
-87.251.216.2
+87.251.144.104
+87.251.145.144
  87.251.228.114
-87.251.245.80
-87.251.250.84
-87.251.66.126
-87.251.70.200
-87.251.70.211
-87.251.70.240
-87.251.70.79
-87.251.70.83
-87.251.73.100
-87.251.73.101
-87.251.73.252
-87.251.74.10
-87.251.74.11
-87.251.74.13
-87.251.74.16
-87.251.74.18
-87.251.74.19
-87.251.74.2
  87.251.74.205
-87.251.74.206
-87.251.74.253
-87.251.74.3
-87.251.74.30
-87.251.74.31
-87.251.74.4
-87.251.74.58
-87.251.74.59
-87.251.74.7
-87.251.74.74
-87.251.74.76
-87.251.74.78
-87.251.74.8
-87.251.74.9
  87.251.76.122
  87.251.77.206
  87.251.86.16
  87.252.183.184
-87.252.226.79
  87.253.135.238
  87.253.22.102
  87.254.138.170
-87.254.171.179
  87.255.13.217
  87.255.193.50
-87.255.198.166
-87.255.217.154
  87.255.64.214
  87.255.77.51
  87.255.8.74
@@ -112207,32 +94157,26 @@
  87.26.40.62
  87.26.76.188
  87.26.79.238
-87.27.124.239
-87.27.214.5
-87.27.5.116
-87.27.80.152
  87.29.33.163
  87.3.46.64
-87.3.76.140
  87.4.244.67
  87.4.82.218
+87.5.72.125
  87.5.76.242
-87.6.179.102
  87.61.90.230
+87.61.94.166
  87.63.126.70
  87.65.195.214
-87.65.251.29
  87.68.138.18
+87.7.199.62
  87.7.93.49
  87.75.105.186
  87.76.11.57
-87.76.12.118
  87.76.34.142
+87.76.34.253
  87.76.35.105
  87.76.35.189
  87.76.35.58
-87.76.9.176
-87.78.43.163
  87.79.184.155
  87.79.254.225
  87.79.67.225
@@ -112240,27 +94184,21 @@
  87.79.94.221
  87.81.219.92
  87.88.166.206
-87.9.201.90
-87.92.133.188
  87.92.153.19
  87.93.166.105
-87.93.33.20
+87.95.209.86
  87.96.174.27
-87.96.227.67
-87.96.235.131
  87.97.155.156
  87.97.24.108
  87.98.137.135
  87.98.143.87
  87.98.148.135
-87.98.150.101
  87.98.152.173
  87.98.156.62
  87.98.157.128
  87.98.167.75
  87.98.174.237
  87.98.177.105
-87.98.177.109
  87.98.177.115
  87.98.178.115
  87.98.179.7
@@ -112270,7 +94208,6 @@
  87.98.222.207
  87.98.228.144
  87.98.241.34
-87.98.253.31
  87.99.93.100
  870-365.net
  8710433-dot-n-e-w-me-ss-age-po-rt-al.wl.r.appspot.com
@@ -112313,20 +94250,15 @@
  87n3t-m3m50.com
  88.10.126.6
  88.100.162.153
-88.101.23.66
  88.102.13.246
-88.103.121.242
  88.103.224.255
  88.103.230.210
-88.104.157.43
+88.110.51.78
  88.114.100.214
-88.115.153.107
-88.116.89.102
  88.118.131.30
-88.118.214.226
+88.119.1.29
  88.119.128.181
  88.119.130.21
-88.119.135.22
  88.119.197.200
  88.119.220.136
  88.119.254.139
@@ -112336,61 +94268,50 @@
  88.12.47.65
  88.12.49.249
  88.120.105.119
-88.120.200.172
-88.121.123.242
  88.121.139.70
  88.121.22.235
  88.125.91.158
  88.127.172.137
-88.127.243.203
  88.128.92.95
-88.129.208.35
-88.129.208.46
-88.129.208.50
  88.129.235.44
  88.129.253.94
  88.129.28.55
  88.129.82.123
  88.13.9.239
+88.130.134.80
  88.130.221.66
-88.130.63.17
  88.130.66.146
-88.131.253.74
  88.132.194.239bin.sh
  88.132.217.184
  88.132.66.26
  88.133.164.179
-88.134.145.15
  88.134.149.7
  88.135.1.138
  88.135.210.179
-88.135.38.250
  88.135.39.143
-88.135.39.162
  88.135.40.156
  88.135.40.3
  88.135.40.83
  88.135.41.137
  88.135.41.25
-88.135.42.137
  88.135.42.199
+88.135.42.226
  88.135.42.33
  88.135.43.112
-88.135.43.14
  88.135.43.200
  88.135.43.208
  88.135.44.106
  88.135.44.185
+88.135.44.209
  88.135.44.216
  88.135.44.252
-88.135.44.5
  88.135.47.234
  88.135.63.176
+88.138.153.178
+88.138.29.218
  88.14.225.24
-88.145.179.233
  88.146.204.49
  88.147.142.103
-88.147.146.203
  88.147.153.239
  88.147.153.82
  88.147.16.44
@@ -112398,18 +94319,14 @@
  88.147.174.73
  88.147.244.250
  88.147.254.66
-88.147.90.15
-88.147.99.13
-88.148.113.204
+88.148.113.195
+88.148.113.205
+88.148.113.213
  88.148.113.214
  88.148.113.223
  88.148.113.245
-88.148.47.83
-88.148.47.86
-88.149.143.25
  88.149.150.0
  88.149.180.139
-88.149.228.212
  88.149.229.74
  88.15.157.153
  88.15.202.82
@@ -112432,17 +94349,18 @@
  88.151.101.31
  88.151.140.190
  88.151.243.106
+88.151.72.147
  88.152.204.13
  88.152.233.143
  88.153.216.102
  88.153.35.32
+88.156.18.249
  88.156.97.210
  88.157.229.58
-88.157.9.224
+88.157.66.158
  88.159.128.67
  88.159.132.102
  88.161.75.239
-88.162.25.1
  88.162.54.93
  88.165.81.34
  88.19.212.168
@@ -112474,7 +94392,6 @@
  88.198.109.4
  88.198.151.153
  88.198.16.153
-88.198.17.136
  88.198.188.142
  88.198.19.164
  88.198.196.79
@@ -112501,23 +94418,18 @@
  88.198.57.103
  88.198.59.60
  88.198.91.74
+88.198.91.76
  88.198.92.47
  88.199.21.75
  88.199.42.178
-88.199.82.10
  88.199.82.114
  88.199.82.66
  88.199.82.68
-88.199.94.21
-88.199.94.60
-88.199.94.90
  88.2.208.71
  88.2.217.111
  88.200.128.151
  88.201.141.106
  88.201.143.117
-88.201.158.183
-88.201.19.164
  88.201.242.91
  88.202.177.242
  88.202.183.8
@@ -112526,15 +94438,8 @@
  88.202.230.221
  88.203.203.150
  88.204.210.194
-88.204.242.54
-88.204.245.146
-88.205.230.63
-88.206.119.124
-88.206.140.64
-88.206.173.43
  88.206.65.222
  88.206.81.70
-88.207.109.156
  88.207.124.255
  88.208.205.79
  88.208.220.105
@@ -112550,21 +94455,16 @@
  88.210.15.24
  88.212.201.94
  88.212.3.30
+88.212.43.251
  88.212.44.33
  88.213.214.254
-88.214.10.154
  88.214.11.71
-88.214.24.240
-88.214.24.243
  88.214.24.77
-88.214.26.32
-88.214.26.37
-88.214.26.53
  88.215.177.224
  88.215.2.29
  88.216.6.222
  88.217.113.112
-88.217.116.107
+88.217.118.80
  88.217.124.128
  88.217.172.165
  88.217.181.215
@@ -112580,8 +94480,6 @@
  88.218.16.59
  88.218.16.60
  88.218.16.65
-88.218.17.100
-88.218.17.103
  88.218.17.109
  88.218.17.197
  88.218.17.199
@@ -112591,57 +94489,46 @@
  88.218.17.223
  88.218.17.232
  88.218.17.252
-88.218.193.65
  88.218.227.162
  88.218.227.208
  88.218.92.124
  88.22.81.69
  88.220.179.195
  88.220.43.198
-88.220.67.18
-88.223.165.44
  88.225.209.75
+88.225.220.60
  88.226.96.242
  88.227.171.93
  88.23.19.201
  88.233.55.85
-88.233.79.50
  88.236.163.250
  88.236.187.82
  88.240.3.192
  88.247.10.31
-88.247.117.206
  88.247.138.7
+88.247.151.51
  88.247.165.215
-88.247.166.200
  88.247.170.207
  88.247.185.165
  88.247.194.52
-88.247.211.187
  88.247.212.56
  88.247.237.206
  88.247.26.143
  88.247.31.189
-88.247.48.101
  88.247.49.109
-88.247.55.119
  88.247.9.171
-88.248.12.247
-88.248.135.166
  88.248.136.231
-88.248.140.53
  88.248.23.216
  88.248.55.136
+88.249.118.13
  88.249.120.205
  88.249.181.198
-88.249.203.133
-88.249.233.128
  88.249.244.82
  88.25.218.150
-88.250.197.122
+88.250.172.184
  88.250.210.8
  88.250.223.190
-88.250.236.251
+88.250.254.90
  88.252.242.152
  88.255.102.114
  88.255.102.19
@@ -112649,12 +94536,10 @@
  88.255.102.60
  88.255.102.99
  88.255.106.24
-88.255.106.25
  88.255.106.27
  88.255.106.29
  88.255.132.179
  88.255.182.170
-88.255.217.102
  88.255.217.166
  88.255.217.71
  88.255.236.5
@@ -112662,26 +94547,19 @@
  88.26.174.1
  88.26.181.16
  88.26.34.89
-88.28.206.1
-88.38.118.83
  88.40.214.138
-88.43.93.227
-88.43.93.228
  88.5.20.125
  88.5.71.126
  88.6.141.132
-88.67.105.92
-88.68.171.107
+88.64.230.250
  88.7.137.57
+88.71.112.210
  88.73.13.238
  88.73.23.219
  88.74.200.23
-88.74.200.41
  88.78.137.199
-88.79.208.11
+88.78.140.188
  88.8.137.122
-88.80.112.32
-88.80.112.34
  88.80.148.234
  88.80.189.129
  88.80.20.35
@@ -112689,16 +94567,12 @@
  88.80.21.143
  88.82.181.44
  88.82.95.146
-88.83.54.237
-88.84.131.90
  88.84.212.14
  88.84.223.251
  88.85.97.150
  88.86.125.50
  88.86.241.192
  88.86.243.241
-88.87.141.14
-88.87.207.27
  88.87.69.242
  88.87.72.134
  88.87.72.72
@@ -112707,20 +94581,23 @@
  88.87.85.103
  88.88.105.184
  88.88.130.173
-88.88.173.170
-88.88.82.147
+88.89.120.76
  88.89.52.144
+88.89.93.210
+88.89.93.225
  88.9.178.174
  88.9.42.113
  88.90.66.38
  88.91.106.5
  88.91.13.146
+88.91.13.177
  88.97.21.155
-88.98.232.53
  88.98.235.134
  88.98.237.182
  88.98.240.31
  88.98.88.158
+88.99.10.249
+88.99.10.252
  88.99.104.135
  88.99.109.66
  88.99.115.156
@@ -112739,8 +94616,8 @@
  88.99.209.230
  88.99.209.94
  88.99.213.166
+88.99.231.246
  88.99.236.84
-88.99.250.15
  88.99.33.103
  88.99.35.171
  88.99.38.113
@@ -112795,7 +94672,6 @@
  88mailcenter.weebly.com
  88mscco.com
  89.0.231.214
-89.0.233.69
  89.0.99.104
  89.100.106.42
  89.102.198.78
@@ -112821,11 +94697,8 @@
  89.108.84.112
  89.109.23.122
  89.109.239.183
-89.109.250.155
  89.109.35.231
-89.109.53.65
  89.109.55.165
-89.110.6.17
  89.111.132.132
  89.111.132.172
  89.111.132.208
@@ -112835,37 +94708,25 @@
  89.113.84.51
  89.114.237.38
  89.115.120.43
-89.115.153.208
-89.12.136.56
  89.12.180.184
  89.12.188.58
-89.120.131.168
  89.120.146.186
  89.120.156.28
  89.120.17.179
-89.120.226.213
-89.121.133.208
-89.121.149.42
-89.121.161.88
  89.121.205.18
-89.122.124.170
-89.122.129.239
  89.122.183.130
  89.122.186.71
  89.123.12.95
-89.123.15.76
-89.129.31.250
  89.130.250.155
  89.132.116.240
  89.132.118.246
  89.132.175.246
-89.132.19.60
  89.132.207.82
  89.133.10.60
  89.133.103.216
  89.133.180.150
  89.133.180.22
-89.133.42.56
+89.133.242.58
  89.133.65.79
  89.133.68.65
  89.133.95.177
@@ -112877,17 +94738,10 @@
  89.135.150.137
  89.135.176.129
  89.136.120.205
-89.136.52.0
-89.136.88.89
  89.137.11.41
  89.137.246.181
-89.14.1.31
-89.14.229.126
-89.14.28.131
-89.14.59.130
  89.141.67.231
  89.142.130.107
-89.142.132.148
  89.142.193.82
  89.143.122.162
  89.143.198.104
@@ -112905,13 +94759,10 @@
  89.144.25.95
  89.144.25.96
  89.144.25.97
-89.144.47.244
-89.144.47.246
  89.144.47.28
-89.144.47.8
+89.148.195.206
  89.149.12.188
  89.149.235.45
-89.150.212.201
  89.151.135.90
  89.151.179.147
  89.151.34.234
@@ -112923,10 +94774,8 @@
  89.158.62.170
  89.16.103.241
  89.160.49.80
-89.160.72.171
  89.161.130.94
-89.162.214.154
-89.163.139.136
+89.163.139.215
  89.163.140.245
  89.163.143.76
  89.163.143.8
@@ -112936,7 +94785,6 @@
  89.163.151.69
  89.163.155.202
  89.163.209.26
-89.163.211.40
  89.163.212.74
  89.163.219.10
  89.163.220.75
@@ -112948,33 +94796,33 @@
  89.163.227.192
  89.163.239.216
  89.163.240.188
-89.163.251.166
  89.163.251.200
  89.163.251.59
  89.163.255.78
  89.164.145.204
  89.164.225.197
+89.164.232.67
  89.165.2.239
-89.165.3.29
  89.169.35.160
-89.17.137.136
  89.171.129.58
  89.171.190.107
  89.173.20.134
  89.174.105.118
  89.174.71.111
  89.175.175.206
-89.177.13.220
+89.175.188.58
  89.178.18.43
+89.178.208.42
  89.179.126.155
+89.179.126.97
  89.179.242.150
-89.179.247.249
  89.179.41.211
  89.18.136.217
  89.18.168.135
-89.18.208.150
  89.18.27.192
-89.182.61.54
+89.182.102.119
+89.182.71.24
+89.182.79.169
  89.182.94.153
  89.184.152.198
  89.184.67.155
@@ -112982,21 +94830,20 @@
  89.185.231.103
  89.185.93.190
  89.186.0.10
+89.186.7.6
  89.187.142.208
-89.187.164.96
  89.187.168.132
  89.187.168.134
  89.187.168.135
  89.187.168.136
-89.187.168.140
+89.187.168.142
  89.187.168.148
  89.187.168.149
  89.187.168.162
  89.187.168.166
-89.187.170.129
-89.187.177.101
  89.187.177.103
  89.187.177.105
+89.187.177.107
  89.187.177.108
  89.187.177.85
  89.187.177.86
@@ -113012,7 +94859,6 @@
  89.188.124.145
  89.189.172.88
  89.189.174.121
-89.189.181.161
  89.189.191.51
  89.189.222.150
  89.189.223.236
@@ -113021,10 +94867,8 @@
  89.19.20.202
  89.19.47.137
  89.19.47.157
-89.19.47.245
  89.19.47.249
  89.19.47.39
-89.19.47.40
  89.19.47.43
  89.19.47.76
  89.19.47.93
@@ -113038,85 +94882,69 @@
  89.190.165.4
  89.190.19.162
  89.191.226.107
-89.191.228.153
-89.2.103.209
+89.191.226.40
+89.191.226.57
  89.20.102.139
  89.20.47.191
  89.200.137.67
-89.200.182.10
  89.201.192.154
  89.201.192.210
  89.201.192.244
  89.201.193.165
  89.201.193.216
-89.201.193.220
-89.201.193.246
-89.201.193.27
  89.201.193.43
-89.201.193.72
  89.201.194.170
  89.201.194.183
  89.201.194.198
  89.201.194.242
-89.201.195.126
-89.201.195.132
  89.201.195.165
  89.201.195.62
  89.202.127.4
-89.203.29.74
+89.205.125.180
  89.205.35.133
-89.205.41.202
-89.205.83.49
  89.205.87.153
+89.207.131.23
  89.207.92.107
  89.207.93.238
-89.208.146.99
  89.208.254.11
  89.208.255.98
  89.208.35.79
  89.208.8.50
-89.21.77.158
-89.210.144.252
-89.210.185.78
  89.211.223.6
  89.212.160.214
-89.212.227.136
  89.212.9.96
+89.212.90.179
+89.214.28.57
  89.214.70.58
-89.215.69.195
+89.216.102.123
  89.216.104.9
  89.216.118.80
  89.216.122.92
  89.216.28.53
  89.216.29.79
  89.216.47.154
-89.216.48.230
  89.216.99.102
  89.216.99.251
  89.218.11.2
-89.218.118.22
  89.218.133.170
-89.218.140.251
-89.218.218.202
+89.218.172.166
+89.218.205.82
  89.218.5.106
  89.218.5.108
  89.218.5.110
  89.218.72.51
  89.218.81.206
-89.219.26.226
  89.219.90.183
  89.22.101.6
  89.22.103.213
-89.22.108.247
-89.22.151.78
+89.22.108.215
  89.22.17.62
-89.22.174.150
  89.22.187.111
-89.22.191.247
  89.22.249.241
  89.22.255.48
  89.22.54.199
  89.22.66.2
+89.220.252.147
  89.221.208.77
  89.221.247.62
  89.221.250.20
@@ -113133,17 +94961,12 @@
  89.23.119.185
  89.23.194.174
  89.23.196.60
-89.23.198.165
  89.23.230.189
  89.230.96.42
  89.231.32.193
  89.232.192.40
-89.232.220.82
  89.232.37.103
  89.233.183.64
-89.233.219.172
-89.233.219.46
-89.233.219.93
  89.234.157.254
  89.234.17.115
  89.234.17.116
@@ -113157,7 +94980,6 @@
  89.236.112.100
  89.236.17.108
  89.236.239.25
-89.236.58.248
  89.237.113.144
  89.237.32.129
  89.237.32.177
@@ -113192,79 +95014,51 @@
  89.238.166.139
  89.238.167.44
  89.238.183.231
-89.238.185.210
-89.238.185.214
  89.238.186.230
-89.238.21.169
  89.238.217.146
-89.238.226.142
  89.238.77.110
  89.238.81.138
  89.239.65.140
  89.24.119.126
  89.24.221.82
  89.24.76.185
-89.24.80.102
  89.242.110.185
-89.244.120.128
  89.244.124.162
-89.244.126.13
+89.244.179.177
+89.244.76.156
+89.244.76.224
  89.245.118.5
-89.245.241.203
+89.245.241.0
+89.245.251.203
  89.245.254.227
  89.245.83.194
+89.245.84.80
+89.245.95.213
+89.246.56.133
  89.246.56.16
  89.246.60.151
-89.247.13.238
  89.247.153.218
  89.247.153.48
-89.247.36.132
-89.247.41.105
+89.247.153.76
  89.248.111.164
  89.248.159.202
  89.248.160.132
-89.248.160.139
-89.248.160.150
-89.248.160.178
  89.248.160.192
  89.248.160.215
  89.248.160.217
-89.248.162.137
-89.248.162.161
  89.248.162.170
  89.248.162.179
-89.248.162.217
  89.248.163.3
  89.248.166.183
  89.248.167.131
  89.248.167.133
  89.248.167.141
-89.248.167.160
-89.248.167.161
-89.248.167.162
-89.248.167.163
-89.248.167.169
-89.248.167.171
-89.248.167.177
-89.248.167.186
-89.248.168.112
-89.248.168.127
-89.248.168.152
-89.248.168.157
  89.248.168.171
-89.248.168.176
  89.248.168.188
  89.248.168.204
-89.248.168.217
-89.248.168.220
-89.248.168.238
  89.248.168.29
-89.248.168.51
-89.248.168.62
-89.248.168.78
  89.248.169.103
-89.248.169.12
-89.248.169.94
+89.248.169.16
  89.248.170.232
  89.248.171.134
  89.248.171.137
@@ -113280,19 +95074,13 @@
  89.248.172.10
  89.248.172.139
  89.248.172.140
-89.248.172.16
  89.248.172.169
  89.248.172.175
  89.248.172.196
  89.248.172.20
  89.248.172.200
-89.248.172.208
  89.248.172.53
-89.248.172.85
-89.248.174.193
  89.248.174.199
-89.248.174.203
-89.248.174.3
  89.248.174.31
  89.248.174.39
  89.248.174.4
@@ -113304,6 +95092,7 @@
  89.249.247.209
  89.249.255.152
  89.25.21.170
+89.25.212.146
  89.25.23.210
  89.25.23.212
  89.250.148.154
@@ -113312,16 +95101,18 @@
  89.251.144.37
  89.251.147.97
  89.252.143.70
+89.252.168.124
  89.252.174.205
  89.252.178.31
  89.252.19.66
  89.252.191.154
+89.252.191.172
  89.252.228.135
  89.252.40.18
  89.253.225.14
  89.253.247.144
-89.255.231.20
  89.255.60.4
+89.26.250.40
  89.27.175.95
  89.27.62.27
  89.28.117.31
@@ -113341,45 +95132,22 @@
  89.31.46.208
  89.31.57.5
  89.32.150.160
-89.32.153.221
  89.32.204.210
  89.32.227.230
  89.32.249.21
-89.32.41.180
  89.32.41.79
-89.33.193.197
-89.33.193.198
-89.33.193.199
-89.33.193.20
-89.33.193.202
-89.33.193.204
-89.33.193.205
-89.33.193.208
-89.33.193.209
-89.33.193.21
-89.33.193.210
-89.33.193.211
-89.33.193.212
  89.33.25.104
  89.33.40.70
-89.33.45.96
  89.33.64.134
  89.33.78.174
  89.34.111.122
  89.34.16.212
  89.34.16.7
  89.34.17.15
-89.34.199.128
  89.34.208.216
  89.34.208.223
-89.34.208.229
  89.34.236.193
-89.34.236.213
-89.34.236.236
-89.34.236.237
-89.34.236.238
  89.34.236.252
-89.34.236.254
  89.34.26.129
  89.34.27.10
  89.34.27.149
@@ -113392,22 +95160,19 @@
  89.34.27.49
  89.34.27.57
  89.34.27.59
-89.34.30.9
  89.35.178.108
-89.35.210.205
+89.35.249.177
  89.35.249.80
  89.35.30.113
  89.35.30.124
-89.35.30.202
+89.35.30.21
  89.35.31.163
  89.35.34.96
  89.35.39.60
  89.35.39.74
  89.35.50.5
  89.36.133.62
-89.36.160.112
  89.36.175.10
-89.36.195.238
  89.36.212.129
  89.36.212.17
  89.36.213.13
@@ -113420,7 +95185,6 @@
  89.36.224.3
  89.36.224.4
  89.36.224.9
-89.36.83.59
  89.37.122.216
  89.37.192.194
  89.37.193.44
@@ -113431,8 +95195,6 @@
  89.38.150.236
  89.38.151.110
  89.38.151.18
-89.38.177.193
-89.38.182.22
  89.38.96.141
  89.38.96.153
  89.38.96.206
@@ -113442,7 +95204,6 @@
  89.39.106.94
  89.39.108.202
  89.39.114.41
-89.39.126.228
  89.39.174.13
  89.39.3.12
  89.40.113.141
@@ -113452,14 +95213,14 @@
  89.40.115.180
  89.40.142.176
  89.40.143.199
-89.40.181.202
+89.40.143.228
  89.40.181.229
  89.40.217.40
  89.40.48.186
-89.40.73.217
+89.40.73.221
  89.40.73.225
-89.40.73.227
  89.40.73.236
+89.40.73.247
  89.40.9.189
  89.41.106.8
  89.42.133.58
@@ -113473,36 +95234,36 @@
  89.43.202.44
  89.43.202.83
  89.43.203.101
-89.43.4.154
  89.43.5.134
  89.43.60.117
  89.44.10.26
  89.44.103.58
  89.44.205.130
  89.44.205.133
-89.44.205.6
-89.44.247.190
  89.44.247.232
  89.45.193.69
  89.45.226.116
-89.45.243.126
  89.45.67.54
  89.45.67.99
  89.46.100.105
  89.46.100.144
+89.46.104.164
+89.46.104.181
  89.46.105.182
  89.46.105.196
  89.46.105.197
+89.46.105.240
  89.46.106.216
+89.46.106.217
  89.46.106.234
  89.46.107.190
-89.46.108.103
  89.46.108.164
  89.46.108.165
+89.46.109.88
  89.46.110.195
+89.46.110.213
+89.46.114.160
  89.46.204.81
-89.46.235.111
-89.46.235.200
  89.46.82.5
  89.46.86.183
  89.46.86.65
@@ -113513,19 +95274,13 @@
  89.64.90.219
  89.65.244.169
  89.65.52.189
-89.66.169.254
-89.66.173.101
-89.68.225.6
  89.69.179.180
  89.69.254.27
  89.70.104.207
  89.71.241.168
-89.72.147.92
  89.72.212.205
-89.77.225.154
-89.78.5.56
+89.79.122.26
  89.89.5.129
-89.9.92.243
  89.95.83.154
  89.96.255.77
  89.97.218.142
@@ -113636,45 +95391,27 @@
  8zbuofa8z.bankofamericaslpemr.com
  9-29.com
  9-35.xyz
-90.0.0.247
-90.1.175.166
-90.1.83.4
  90.103.18.205
+90.103.250.248
  90.104.116.167
-90.104.241.224
  90.104.32.46
-90.108.242.20
-90.109.157.142
-90.109.173.254
-90.116.139.42
+90.107.31.1
+90.108.40.33
  90.117.73.79
  90.120.153.230
  90.120.235.42
  90.125.145.184
-90.125.191.31
-90.125.5.97
  90.126.42.245
+90.127.133.96
  90.129.248.85
-90.134.210.113
-90.142.41.33
-90.142.62.31
-90.145.215.170
  90.146.153.21
  90.146.16.34
  90.146.219.186
  90.15.236.171
-90.15.29.43
  90.150.180.66
-90.150.199.137
-90.150.199.55
-90.150.200.146
-90.150.201.18
-90.150.205.49
  90.150.52.45
-90.150.59.155
-90.150.87.125
+90.150.81.4
  90.150.87.79
-90.150.90.116
  90.151.180.215
  90.152.200.81
  90.154.108.66
@@ -113690,23 +95427,15 @@
  90.160.140.35
  90.162.115.79
  90.163.133.120
-90.164.220.146
+90.163.146.77
  90.168.34.174
  90.168.34.229
  90.170.20.2
  90.171.35.83
-90.173.241.88
  90.173.78.53
-90.174.217.106
-90.177.191.78
-90.177.236.49
-90.177.244.100
  90.178.102.136
  90.178.144.139
-90.180.12.4
-90.180.217.217
  90.181.150.210
-90.181.4.93
  90.182.165.18
  90.182.36.30
  90.183.101.238
@@ -113714,6 +95443,7 @@
  90.183.158.50
  90.185.249.111
  90.187.222.89
+90.187.250.113
  90.187.60.105
  90.187.75.113
  90.187.76.85
@@ -113724,59 +95454,53 @@
  90.188.255.142
  90.188.32.50
  90.188.35.190
-90.188.4.226
+90.188.38.252
  90.189.110.170
  90.189.116.152
-90.189.117.121
  90.189.141.225
  90.189.172.54
  90.189.209.144
  90.189.210.122
+90.191.220.38
  90.191.87.93
-90.194.151.59
-90.196.234.158
+90.197.152.100
  90.204.41.78
  90.208.97.104
  90.212.218.18
-90.213.243.129
-90.218.6.27
-90.222.3.118
-90.222.80.64
+90.214.214.226
  90.224.203.97
  90.224.222.108
  90.224.222.108bin.sh
  90.224.68.175
-90.224.81.216
  90.226.231.19
  90.226.40.204
  90.227.1.125
  90.227.130.6
  90.23.113.104
+90.23.198.2
  90.23.26.205
-90.230.98.250
-90.231.155.253
-90.231.156.76
-90.231.81.74
-90.232.29.30
-90.235.164.5
-90.247.219.143
-90.255.134.118
+90.231.85.246
+90.247.214.39
+90.253.55.55
+90.255.147.68
+90.27.35.249
  90.3.120.143
-90.3.58.135
  90.30.233.46
  90.34.246.35
+90.40.194.27
  90.45.28.27
+90.45.66.58
  90.49.130.21
  90.49.95.3
-90.50.171.92
-90.50.247.183
  90.51.18.170
  90.51.20.22
  90.52.3.121
+90.56.124.93
  90.56.169.224
  90.57.120.237
-90.59.96.116
-90.64.13.197
+90.57.179.48
+90.63.101.53
+90.64.31.58
  90.64.84.19
  90.66.148.219
  90.66.20.136
@@ -113784,20 +95508,18 @@
  90.73.37.62
  90.73.38.79
  90.74.52.246
-90.75.209.16
  90.76.107.69
  90.76.59.11
  90.79.213.142
  90.8.253.128
-90.84.234.68
  90.84.242.139
  90.84.41.202
-90.87.42.207
  90.88.168.105
  90.89.18.34
  90.90.193.172
  90.90.38.135
-90.92.94.43
+90.90.51.36
+90.92.12.49
  90.93.226.18
  900800.com
  900990099009kk.000webhostapp.com
@@ -113825,20 +95547,16 @@
  90f4uopj34.win
  90secondwebsitebuilder.com
  91.0.189.75
+91.10.200.184
  91.102.117.212
-91.102.155.145
  91.102.224.50
-91.102.82.239
-91.103.110.54
  91.103.196.170
  91.103.248.23
-91.103.248.92
  91.103.31.45
  91.104.78.118
  91.105.135.113
  91.105.135.181
  91.105.152.168
-91.105.152.193
  91.105.239.11
  91.105.94.200
  91.106.131.90
@@ -113847,19 +95565,19 @@
  91.106.199.101
  91.107.6.115
  91.108.140.153
+91.108.141.235
  91.108.178.222
  91.108.43.228
  91.109.13.108
  91.109.132.19
  91.109.142.203
  91.109.15.52
-91.109.174.42
  91.109.26.72
  91.109.3.188
  91.109.5.170
  91.11.86.153
  91.110.176.196
-91.115.22.59
+91.114.63.211
  91.117.31.181
  91.120.21.66
  91.120.21.93
@@ -113886,6 +95604,7 @@
  91.121.133.13
  91.121.133.211
  91.121.134.201
+91.121.134.43
  91.121.14.107
  91.121.141.219
  91.121.142.210
@@ -113910,11 +95629,11 @@
  91.121.169.194
  91.121.173.98
  91.121.176.34
-91.121.177.158
  91.121.177.212
  91.121.178.31
  91.121.179.219
  91.121.18.20
+91.121.180.57
  91.121.181.140
  91.121.181.180
  91.121.181.6
@@ -113935,15 +95654,12 @@
  91.121.232.214
  91.121.242.107
  91.121.246.168
-91.121.249.36
  91.121.25.16
  91.121.28.184
  91.121.30.154
  91.121.30.186
-91.121.30.96
  91.121.31.95
  91.121.33.63
-91.121.35.207
  91.121.45.5
  91.121.48.78
  91.121.5.216
@@ -113955,7 +95671,6 @@
  91.121.67.119
  91.121.67.146
  91.121.67.151
-91.121.68.60
  91.121.70.43
  91.121.74.44
  91.121.75.27
@@ -113973,7 +95688,6 @@
  91.121.84.66
  91.121.86.22
  91.121.86.38
-91.121.86.61
  91.121.88.158
  91.121.88.225
  91.121.89.135
@@ -113988,29 +95702,21 @@
  91.122.159.193
  91.122.193.80
  91.122.198.128
+91.122.213.228
  91.122.46.120
-91.124.106.181
  91.124.120.172
-91.124.160.226
-91.124.163.232
-91.125.123.125
+91.124.246.209
  91.125.212.60
  91.126.18.130
-91.126.206.191
  91.126.234.159
-91.126.45.232
  91.127.240.222
-91.129.104.141
-91.131.192.5
  91.132.138.44
  91.132.138.54
  91.132.138.62
  91.132.147.168
-91.132.196.138
  91.134.13.250
  91.134.133.251
  91.134.135.95
-91.134.136.45
  91.134.138.46
  91.134.140.84
  91.134.143.172
@@ -114020,22 +95726,6 @@
  91.134.157.246
  91.134.172.23
  91.134.180.0
-91.134.185.80
-91.134.185.81
-91.134.185.82
-91.134.185.83
-91.134.185.84
-91.134.185.85
-91.134.185.86
-91.134.185.87
-91.134.185.88
-91.134.185.89
-91.134.185.90
-91.134.185.91
-91.134.185.92
-91.134.185.93
-91.134.185.94
-91.134.185.95
  91.134.188.229
  91.134.201.164
  91.134.207.16
@@ -114044,7 +95734,6 @@
  91.134.231.96
  91.134.240.130
  91.134.242.199
-91.134.242.66
  91.134.248.230
  91.134.248.235
  91.134.248.249
@@ -114055,27 +95744,20 @@
  91.135.0.187
  91.135.101.228
  91.135.148.198
-91.135.193.146
  91.135.194.22
  91.135.242.203
-91.136.48.27
-91.136.48.84
  91.137.140.89
+91.137.247.8
+91.137.251.184
  91.137.251.31
  91.138.184.109
-91.138.215.5
  91.139.1.158
  91.139.140.18
  91.139.198.77
  91.139.221.41
-91.140.86.163
-91.141.209.21
+91.140.73.133
  91.142.174.224
  91.142.209.68
-91.143.138.83
-91.143.194.146
-91.143.45.210
-91.143.61.18
  91.144.142.125
  91.144.142.19
  91.144.147.160
@@ -114083,23 +95765,18 @@
  91.144.150.207
  91.144.158.133
  91.144.20.198
-91.144.21.15
  91.144.218.61
-91.144.249.132
-91.144.30.132
  91.144.30.172
-91.145.54.163
  91.146.121.3
  91.146.59.186
  91.147.210.86
  91.147.235.99
  91.148.106.63
  91.148.141.210
-91.148.159.171
  91.149.139.198
  91.149.157.145
+91.149.231.20
  91.149.231.4
-91.149.231.6
  91.15.75.156
  91.15.75.77
  91.15.76.169
@@ -114109,41 +95786,36 @@
  91.150.189.122
  91.150.77.57
  91.150.77.58
-91.151.104.212
  91.152.120.228
  91.152.8.173
  91.155.2.97
+91.155.247.71
  91.155.25.9
  91.155.49.185
+91.157.47.55
  91.160.19.34
  91.163.206.48
  91.164.161.49
-91.164.29.129
  91.168.145.151
  91.169.100.84
-91.173.165.153
  91.174.162.196
  91.174.80.149
  91.179.185.146
  91.181.235.31
  91.183.53.241
  91.184.52.3
-91.184.81.7
  91.185.198.234
-91.185.206.66
-91.185.212.7
-91.185.216.4
+91.185.215.207
  91.185.226.136
  91.185.236.236
  91.185.236.24
  91.185.36.26
-91.185.40.183
-91.185.48.163
  91.185.54.129
  91.185.55.179
  91.185.57.104
  91.185.58.88
  91.185.59.254
+91.186.228.97
  91.186.8.91
  91.186.9.53
  91.186.9.54
@@ -114152,16 +95824,16 @@
  91.187.119.118
  91.187.123.106
  91.187.123.18
-91.187.185.183
-91.187.78.57
  91.187.80.246
  91.188.124.225
  91.188.124.232
+91.188.197.192
  91.188.230.149
  91.188.244.204
  91.188.247.38
  91.189.123.230
  91.189.201.70
+91.189.216.154
  91.189.47.155
  91.191.173.120
  91.191.250.142
@@ -114187,20 +95859,17 @@
  91.192.195.131
  91.192.2.168
  91.192.20.164
+91.192.207.68
  91.192.214.204
  91.192.24.202
-91.192.36.164
-91.193.117.45
  91.193.130.8
  91.193.200.21
+91.193.217.28
  91.193.237.116
  91.193.252.112
  91.193.252.250
-91.193.253.129
-91.193.253.188
  91.193.253.248
  91.193.4.136
-91.194.190.135
  91.194.250.136
  91.194.42.51
  91.194.77.112
@@ -114209,27 +95878,23 @@
  91.194.84.78
  91.195.124.11
  91.195.124.9
-91.195.156.41
  91.195.157.4
  91.195.192.38
-91.195.254.206
-91.196.100.35
  91.196.100.93
-91.196.149.179
  91.196.150.45
+91.196.38.10
  91.196.50.33
-91.196.61.115
  91.196.70.11
  91.196.70.40
  91.197.135.106
  91.197.135.132
  91.197.135.17
  91.197.145.90
-91.197.174.16
  91.197.234.187
  91.197.44.133
  91.198.220.225
  91.199.118.137
+91.2.173.53
  91.2.51.251
  91.20.155.34
  91.200.114.243
@@ -114237,28 +95902,22 @@
  91.200.12.76
  91.200.124.197
  91.200.125.75
-91.200.126.90
  91.200.13.64
-91.200.57.218
-91.201.188.240
-91.201.191.182
  91.201.240.101
-91.202.133.201
  91.202.133.75
-91.202.145.97
-91.202.16.63
  91.203.114.112
  91.203.114.71
  91.203.136.162
  91.203.145.116
-91.203.167.39
  91.203.174.191
+91.203.176.204
  91.203.224.177
  91.203.236.226
  91.203.25.28
  91.203.27.168
  91.203.36.102
  91.203.39.246
+91.203.82.235
  91.204.14.132
  91.204.14.181
  91.204.14.191
@@ -114266,14 +95925,12 @@
  91.204.149.5
  91.204.15.107
  91.204.15.117
-91.204.15.174
  91.204.15.24
+91.204.15.93
  91.204.163.19
-91.204.250.45
-91.204.250.52
  91.204.84.64
  91.205.123.185
-91.205.128.232
+91.205.128.129
  91.205.128.65
  91.205.130.129
  91.205.130.65
@@ -114283,7 +95940,6 @@
  91.205.168.46
  91.205.172.184
  91.205.173.54
-91.205.173.71
  91.205.174.26
  91.205.212.53
  91.205.215.57
@@ -114293,17 +95949,15 @@
  91.205.241.86
  91.206.110.190
  91.206.148.243
-91.206.15.85
  91.206.16.214
+91.206.168.14
  91.206.183.148
+91.207.102.152
  91.207.102.154
  91.207.102.156
  91.207.102.158
  91.207.172.115
-91.207.175.154
-91.207.185.153
  91.207.238.107
-91.207.244.212
  91.207.253.116
  91.207.5.102
  91.208.184.110
@@ -114319,6 +95973,7 @@
  91.209.8.228
  91.209.89.33
  91.21.85.176
+91.21.87.184
  91.210.102.199
  91.210.136.202
  91.210.145.247
@@ -114334,36 +95989,27 @@
  91.210.47.85
  91.210.59.205
  91.211.124.217
-91.211.146.202
  91.211.172.104
  91.211.195.27
  91.211.248.35
  91.211.251.42
  91.211.3.110
  91.211.3.111
-91.211.48.180
-91.211.48.213
-91.211.48.235
-91.211.88.110
  91.211.88.113
  91.211.88.52
-91.211.91.62
  91.212.124.160
  91.212.127.100
  91.212.150.241
-91.212.96.206
  91.213.119.246
  91.213.197.15
-91.213.46.214
-91.213.50.119
-91.214.115.100
+91.213.46.98
+91.214.128.243
  91.214.130.253
  91.214.133.207
  91.214.179.39
  91.214.202.24
  91.214.31.234
  91.214.64.173
-91.215.145.31
  91.215.187.35
  91.215.195.143
  91.215.216.13
@@ -114391,17 +96037,17 @@
  91.216.93.71
  91.217.202.174
  91.217.42.3
-91.217.61.14
  91.217.82.148
  91.218.114.4
  91.218.114.79
  91.218.127.142
  91.218.160.153
  91.218.163.74
+91.218.202.33
  91.218.202.6
+91.218.66.7
  91.218.86.194
  91.219.171.97
-91.219.235.76
  91.219.236.31
  91.219.236.61
  91.219.236.83
@@ -114411,22 +96057,20 @@
  91.219.238.234
  91.219.25.232
  91.219.253.115
-91.219.253.42
  91.219.4.151
  91.219.88.121
  91.221.108.181
  91.221.108.182
-91.221.221.21
  91.221.252.18
  91.221.52.49
  91.221.70.248
  91.221.71.41
+91.222.128.59
  91.222.165.233
  91.222.171.246
-91.222.196.82
  91.222.236.111
  91.222.236.117
-91.222.236.37
+91.222.236.167
  91.222.236.97
  91.222.239.144
  91.222.239.146
@@ -114434,20 +96078,21 @@
  91.222.239.238
  91.222.239.53
  91.222.239.54
+91.222.239.77
  91.223.136.228
-91.223.180.182
+91.223.180.18
  91.223.212.208
  91.223.68.29
  91.224.20.71
-91.224.206.27
+91.224.22.74
+91.224.59.14
  91.224.70.159
  91.224.70.91
  91.224.92.211
  91.224.92.212
  91.224.92.214
-91.225.111.150
+91.224.98.206
  91.225.161.200
-91.225.163.253
  91.225.168.33
  91.225.190.77
  91.225.208.83
@@ -114456,67 +96101,48 @@
  91.225.208.87
  91.225.226.39
  91.225.77.52
-91.226.115.55
-91.226.116.217
+91.226.106.181
+91.226.190.33
  91.226.192.8
  91.226.212.131
  91.226.212.218
  91.226.213.133
-91.226.253.160
  91.226.45.66
  91.226.5.245
-91.227.112.196
  91.227.122.167
  91.227.220.149
  91.227.220.154
  91.228.8.162
-91.228.84.250
-91.228.85.136
-91.228.85.197
-91.228.85.45
-91.228.87.159
-91.228.87.180
-91.229.112.16
  91.229.78.76
  91.229.79.152
+91.23.154.170
  91.230.138.11
  91.230.146.146
  91.230.154.221
  91.230.199.174
  91.230.25.200
-91.230.53.86
  91.231.127.89
  91.231.179.65
  91.231.213.51
  91.231.70.61
-91.231.85.152
  91.231.87.174
  91.232.105.116
  91.232.105.180
-91.232.162.77
  91.232.165.143
  91.232.197.100
  91.232.4.149
  91.233.250.106
-91.233.250.211
  91.233.43.165
  91.233.43.33
-91.233.48.110
  91.234.104.98
+91.234.194.113
  91.234.195.123
  91.234.195.179
+91.234.195.181
+91.234.195.182
  91.234.195.40
-91.234.34.49
  91.234.60.94
-91.234.62.21
-91.234.62.228
-91.234.62.229
-91.234.62.233
-91.234.62.237
-91.234.62.238
-91.234.62.239
-91.234.62.26
-91.234.62.27
+91.234.62.174
  91.234.99.193
  91.234.99.203
  91.234.99.234
@@ -114533,23 +96159,15 @@
  91.235.143.184
  91.235.143.197
  91.235.178.161
-91.235.186.212
-91.235.187.132
  91.235.237.17
  91.235.244.205
  91.235.254.180
  91.235.254.211
  91.235.255.7
-91.236.116.121
-91.236.116.89
  91.236.12.168
  91.236.12.33
  91.236.12.84
  91.236.141.219
-91.236.142.69
-91.236.172.4
-91.236.177.162
-91.236.61.166
  91.236.7.126
  91.236.74.121
  91.237.121.11
@@ -114557,12 +96175,10 @@
  91.237.127.186
  91.237.161.162
  91.237.161.211
+91.237.161.217
  91.237.248.40
-91.237.27.102
  91.237.69.17
-91.237.73.68
  91.237.77.5
-91.237.94.12
  91.238.104.179
  91.238.134.99
  91.238.161.3
@@ -114570,250 +96186,21 @@
  91.238.223.41
  91.238.230.148
  91.238.255.71
-91.239.142.37
  91.239.152.227
  91.239.152.228
  91.239.18.172
-91.239.206.212
  91.239.26.202
  91.239.69.182
-91.240.243.100
-91.240.243.101
-91.240.243.102
-91.240.243.103
-91.240.243.104
-91.240.243.105
-91.240.243.106
-91.240.243.107
-91.240.243.108
-91.240.243.109
-91.240.243.110
-91.240.243.111
-91.240.243.112
-91.240.243.113
-91.240.243.114
-91.240.243.115
-91.240.243.116
-91.240.243.117
-91.240.243.118
-91.240.243.119
-91.240.243.120
-91.240.243.121
-91.240.243.122
-91.240.243.123
-91.240.243.124
-91.240.243.125
-91.240.243.126
-91.240.243.127
-91.240.243.128
-91.240.243.129
-91.240.243.130
-91.240.243.131
-91.240.243.132
-91.240.243.133
-91.240.243.134
-91.240.243.135
-91.240.243.136
-91.240.243.137
-91.240.243.138
-91.240.243.139
-91.240.243.140
-91.240.243.141
-91.240.243.142
-91.240.243.143
-91.240.243.144
-91.240.243.145
-91.240.243.146
-91.240.243.147
-91.240.243.148
-91.240.243.149
-91.240.243.150
-91.240.243.151
-91.240.243.152
-91.240.243.153
-91.240.243.154
-91.240.243.155
-91.240.243.156
-91.240.243.157
-91.240.243.158
-91.240.243.159
-91.240.243.160
-91.240.243.161
-91.240.243.162
-91.240.243.163
-91.240.243.164
-91.240.243.165
-91.240.243.166
-91.240.243.167
-91.240.243.168
-91.240.243.169
-91.240.243.17
-91.240.243.170
-91.240.243.171
-91.240.243.172
-91.240.243.173
-91.240.243.174
-91.240.243.175
-91.240.243.176
-91.240.243.177
-91.240.243.178
-91.240.243.179
-91.240.243.18
-91.240.243.180
-91.240.243.181
-91.240.243.182
-91.240.243.183
-91.240.243.184
-91.240.243.185
-91.240.243.186
-91.240.243.187
-91.240.243.188
-91.240.243.189
-91.240.243.19
-91.240.243.190
-91.240.243.191
-91.240.243.192
-91.240.243.193
-91.240.243.194
-91.240.243.195
-91.240.243.196
-91.240.243.197
-91.240.243.198
-91.240.243.199
-91.240.243.20
-91.240.243.200
-91.240.243.201
-91.240.243.202
-91.240.243.203
-91.240.243.204
-91.240.243.205
-91.240.243.206
-91.240.243.207
-91.240.243.208
-91.240.243.209
-91.240.243.21
-91.240.243.210
-91.240.243.211
-91.240.243.212
-91.240.243.213
-91.240.243.214
-91.240.243.215
-91.240.243.216
-91.240.243.217
-91.240.243.218
-91.240.243.219
-91.240.243.22
-91.240.243.220
-91.240.243.221
-91.240.243.222
-91.240.243.223
-91.240.243.224
-91.240.243.225
-91.240.243.226
-91.240.243.227
-91.240.243.228
-91.240.243.229
-91.240.243.23
-91.240.243.230
-91.240.243.231
-91.240.243.232
-91.240.243.233
-91.240.243.234
-91.240.243.235
-91.240.243.236
-91.240.243.237
-91.240.243.238
-91.240.243.239
-91.240.243.24
-91.240.243.240
-91.240.243.241
-91.240.243.25
-91.240.243.26
-91.240.243.27
-91.240.243.28
-91.240.243.29
-91.240.243.30
-91.240.243.31
-91.240.243.32
-91.240.243.33
-91.240.243.34
-91.240.243.35
-91.240.243.36
-91.240.243.37
-91.240.243.38
-91.240.243.39
-91.240.243.40
-91.240.243.41
-91.240.243.42
-91.240.243.43
-91.240.243.44
-91.240.243.45
-91.240.243.46
-91.240.243.47
-91.240.243.48
-91.240.243.49
-91.240.243.50
-91.240.243.51
-91.240.243.52
-91.240.243.53
-91.240.243.54
-91.240.243.55
-91.240.243.56
-91.240.243.57
-91.240.243.58
-91.240.243.59
-91.240.243.60
-91.240.243.61
-91.240.243.62
-91.240.243.63
-91.240.243.64
-91.240.243.65
-91.240.243.66
-91.240.243.67
-91.240.243.68
-91.240.243.69
-91.240.243.70
-91.240.243.71
-91.240.243.72
-91.240.243.73
-91.240.243.74
-91.240.243.75
-91.240.243.76
-91.240.243.77
-91.240.243.78
-91.240.243.79
-91.240.243.80
-91.240.243.81
-91.240.243.82
-91.240.243.83
-91.240.243.84
-91.240.243.85
-91.240.243.86
-91.240.243.87
-91.240.243.88
-91.240.243.89
-91.240.243.90
-91.240.243.91
-91.240.243.92
-91.240.243.93
-91.240.243.94
-91.240.243.95
-91.240.243.96
-91.240.243.97
-91.240.243.98
-91.240.243.99
  91.240.54.254
  91.240.97.141
  91.240.97.69
  91.241.131.179
+91.241.19.122
  91.241.19.223
-91.241.19.236
-91.241.19.42
-91.241.19.67
+91.241.19.84
  91.241.194.245
-91.241.49.170
-91.241.51.152
  91.242.136.103
+91.243.101.163
  91.243.101.25
  91.243.175.249
  91.243.80.144
@@ -114825,51 +96212,45 @@
  91.244.181.85
  91.244.217.177
  91.244.253.66
+91.244.72.121
  91.244.73.243
  91.244.76.80
  91.244.78.12
+91.245.203.247
  91.245.34.95
  91.245.72.125
  91.246.213.100
  91.246.213.104
  91.246.213.36
-91.246.227.175
  91.246.65.158
  91.246.74.202
  91.247.250.215
  91.248.19.19
-91.248.22.145
-91.250.24.220
  91.250.242.12
  91.250.6.108
  91.250.83.53
-91.3.74.144
  91.3.75.126
-91.33.24.123
-91.34.67.167
+91.3.75.4
  91.37.223.62
-91.38.164.70
-91.4.148.1
  91.4.52.70
-91.4.89.13
  91.43.74.172
  91.44.225.23
-91.44.76.70
+91.44.66.181
+91.44.69.74
  91.46.47.216
  91.5.98.81
  91.50.246.75
-91.59.96.86
  91.61.51.165
  91.62.203.200
  91.63.17.107
  91.64.181.141
+91.64.27.194
  91.64.35.46
-91.64.49.192
  91.64.59.28
  91.64.78.4
  91.65.147.205
  91.65.185.51
-91.65.186.124
+91.65.214.115
  91.65.51.107
  91.65.70.241
  91.66.145.154
@@ -114883,36 +96264,35 @@
  91.72.219.110
  91.73.131.254
  91.73.197.90
-91.74.129.82
-91.75.121.71
-91.75.177.113
  91.75.75.46
  91.77.162.117
  91.77.165.170
  91.77.166.52
  91.77.168.231
  91.77.225.97
-91.80.3.65
  91.82.40.118
  91.82.41.200
  91.82.42.2
  91.82.46.25
  91.83.160.181
-91.83.161.98
+91.83.161.183
  91.83.162.111
+91.83.162.31
  91.83.162.55
+91.83.163.71
  91.83.227.134
  91.83.227.160
  91.83.227.206
  91.83.227.5
+91.83.42.176
  91.83.93.103
  91.83.93.105
  91.83.93.124
+91.86.183.31
  91.87.123.173
  91.87.153.218
  91.87.73.6
  91.87.94.245
-91.89.125.223
  91.89.13.85
  91.90.112.34
  91.90.122.131
@@ -114928,10 +96308,7 @@
  91.92.109.43
  91.92.115.210
  91.92.144.166
-91.92.186.2
  91.92.191.134
-91.92.213.148
-91.92.214.64
  91.92.34.146
  91.92.34.8
  91.92.66.87
@@ -114939,18 +96316,12 @@
  91.92.78.248
  91.92.79.234
  91.92.80.25
-91.93.120.188
  91.93.132.210
-91.93.140.179
-91.93.170.220
-91.93.44.162
-91.93.63.187
-91.93.64.64
+91.93.163.188
  91.93.69.211
  91.93.73.148
  91.93.97.106
  91.98.108.189
-91.98.142.221
  91.98.149.207
  91.98.26.62
  91.98.32.223
@@ -114963,7 +96334,6 @@
  91.98.6.127
  91.98.64.222
  91.98.68.49
-91.98.96.76
  910-365.com
  91131994de4.xyz
  911718.net
@@ -114999,72 +96369,36 @@
  91ruitue.com
  92-help.com
  92.100.156.249
-92.100.194.241
-92.101.219.220
  92.101.92.69
  92.103.168.50
  92.104.173.28
-92.104.40.51
-92.106.102.227
-92.106.7.62
-92.107.140.193
-92.107.59.10
+92.105.128.47
+92.107.146.247
  92.108.242.45
  92.110.58.125
  92.111.126.154
  92.111.156.14
+92.111.178.114
  92.112.244.182
-92.112.245.7
-92.114.16.108
-92.114.194.160
  92.114.35.161
  92.114.75.210
  92.115.134.57
-92.116.105.132
-92.116.130.158
+92.116.134.85
+92.116.15.39
  92.116.173.51
-92.116.34.226
+92.116.2.8
  92.116.39.13
  92.116.43.127
+92.117.129.108
  92.117.134.98
-92.117.139.34
-92.117.248.109
+92.117.238.76
  92.117.255.212
  92.117.53.153
-92.118.113.78
  92.118.149.91
-92.118.160.1
-92.118.160.13
-92.118.160.17
  92.118.160.21
-92.118.160.25
-92.118.160.29
-92.118.160.33
-92.118.160.37
-92.118.160.41
  92.118.160.45
-92.118.160.49
-92.118.160.5
-92.118.160.53
-92.118.160.57
-92.118.160.61
-92.118.160.9
-92.118.161.1
  92.118.161.13
-92.118.161.17
-92.118.161.21
-92.118.161.25
-92.118.161.29
-92.118.161.33
-92.118.161.37
-92.118.161.41
-92.118.161.45
-92.118.161.49
-92.118.161.5
  92.118.161.53
-92.118.161.57
-92.118.161.61
-92.118.161.9
  92.118.190.105
  92.118.208.114
  92.118.208.218
@@ -115075,19 +96409,18 @@
  92.118.211.20
  92.118.211.43
  92.118.211.72
+92.118.211.86
  92.118.27.173
+92.118.27.241
  92.118.37.238
+92.118.63.222
  92.119.112.226
  92.119.112.62
  92.119.115.94
  92.119.159.40
-92.119.160.233
-92.119.193.36
  92.119.237.137
-92.124.129.242
  92.124.139.1
  92.125.141.181
-92.126.223.237
  92.126.241.114
  92.127.59.99
  92.13.34.71
@@ -115099,23 +96432,27 @@
  92.15.224.201
  92.151.79.102
  92.154.123.47
-92.154.54.87
  92.154.95.236
-92.170.11.63
+92.157.233.216
  92.184.102.138
-92.184.102.17
-92.184.102.192
  92.184.102.196
-92.184.102.224
-92.184.102.230
+92.184.102.225
+92.184.102.237
  92.184.102.40
  92.184.102.53
  92.184.102.79
-92.184.104.199
-92.184.104.240
-92.184.104.97
+92.184.102.94
+92.184.102.99
+92.184.104.15
+92.184.104.253
+92.184.104.52
  92.184.105.163
-92.184.112.160
+92.184.107.93
+92.184.108.19
+92.184.108.194
+92.184.108.23
+92.184.108.8
+92.184.112.107
  92.184.112.195
  92.184.112.218
  92.184.112.231
@@ -115124,33 +96461,36 @@
  92.184.112.72
  92.184.112.79
  92.184.116.114
+92.184.116.123
  92.184.116.130
  92.184.116.183
  92.184.116.37
-92.184.116.69
+92.184.124.124
  92.184.124.127
-92.184.124.172
-92.186.241.141
+92.184.124.71
+92.184.97.165
+92.184.98.213
  92.187.228.47
-92.189.247.153
  92.19.213.191
-92.19.248.152
  92.19.249.3
  92.190.153.246
  92.190.177.39
  92.190.182.62
  92.192.1.198
+92.192.100.16
  92.192.100.162
-92.192.24.173
-92.192.28.154
-92.192.7.172
-92.193.200.249
+92.192.108.46
+92.192.56.153
+92.192.59.116
+92.193.211.229
+92.193.233.0
  92.193.235.147
-92.194.125.189
+92.193.244.27
+92.193.252.109
+92.194.105.148
+92.194.121.35
  92.194.40.25
  92.194.56.59
-92.194.83.85
-92.195.52.239
  92.196.147.235
  92.20.12.134
  92.20.224.214
@@ -115158,13 +96498,10 @@
  92.20.74.204
  92.20.8.10
  92.20.86.49
-92.201.43.2
+92.203.93.154
  92.204.132.129
  92.204.132.78
-92.204.163.231
-92.204.163.239
  92.204.163.66
-92.204.164.90
  92.204.171.210
  92.204.40.25
  92.207.217.36
@@ -115184,18 +96521,15 @@
  92.217.95.88
  92.218.60.143
  92.219.151.94
-92.219.195.102
  92.219.206.119
  92.219.48.156
  92.220.142.145
  92.220.163.15
  92.220.61.122
-92.220.8.137
  92.221.141.145
  92.221.166.189
  92.221.40.80
  92.221.41.97
-92.221.82.243
  92.222.121.155
  92.222.121.156
  92.222.121.157
@@ -115209,7 +96543,6 @@
  92.222.207.223
  92.222.207.228
  92.222.208.174
-92.222.209.223
  92.222.221.49
  92.222.64.195
  92.222.70.236
@@ -115230,34 +96563,33 @@
  92.222.93.227
  92.222.94.117
  92.222.96.225
-92.223.103.137
-92.223.87.8
+92.223.89.91
  92.223.93.145
  92.225.43.130
  92.231.44.2
  92.232.198.59
-92.233.111.233
-92.233.171.64
+92.233.202.239
  92.236.71.145
  92.237.158.97
+92.237.169.12
  92.237.198.149
+92.237.20.100
  92.237.242.79
  92.238.170.6
  92.238.234.158
  92.24.51.238
+92.240.143.150
  92.240.238.35
  92.240.32.12
  92.240.68.152
  92.240.68.153
  92.240.69.195
-92.241.108.185
  92.241.17.80
  92.241.190.214
  92.241.234.141
  92.241.65.174
  92.241.65.38
  92.241.66.138
-92.241.73.62
  92.241.82.242
  92.241.92.218
  92.241.93.154
@@ -115265,30 +96597,25 @@
  92.242.126.154
  92.242.234.102
  92.242.240.34
-92.242.249.206
  92.242.254.12
  92.242.254.8
  92.242.255.47
-92.242.39.77
  92.242.62.123
-92.242.70.24
  92.243.0.38
  92.243.1.246
  92.243.13.72
  92.243.15.162
  92.243.21.182
  92.243.84.187
-92.244.113.166
  92.244.2.237
  92.244.36.73
  92.244.96.108
  92.244.99.229
-92.245.175.165
  92.246.16.39
+92.246.20.200
  92.246.84.133
  92.246.84.195
  92.247.11.242
-92.247.119.131
  92.247.124.253
  92.247.125.153
  92.247.125.161
@@ -115328,31 +96655,28 @@
  92.247.151.174
  92.247.169.43
  92.247.2.26
+92.247.23.114
  92.247.31.37
  92.247.83.35
  92.247.93.142
  92.248.14.109
+92.248.32.46
  92.248.33.122
  92.248.40.136
  92.248.44.208
  92.249.122.108
  92.249.13.235
  92.249.143.44
-92.249.172.166
  92.249.219.47
-92.249.44.232
  92.249.47.250
-92.251.11.134
  92.251.115.56
-92.251.13.37
-92.251.75.85
+92.251.153.174
  92.251.84.63
-92.252.172.243
+92.252.165.38
  92.252.185.162
  92.252.241.11
  92.252.241.202
  92.253.144.180
-92.254.236.240
  92.255.164.166
  92.255.170.159
  92.255.170.66
@@ -115366,37 +96690,28 @@
  92.255.196.91
  92.255.198.132
  92.255.202.72
+92.255.232.100
  92.255.248.230
  92.255.252.44
  92.27.142.29
-92.27.196.33
  92.27.246.202
  92.31.218.173
-92.32.243.126
  92.32.37.83
-92.32.39.145
-92.33.163.190
-92.33.187.238
  92.33.190.164
-92.33.224.164
  92.35.234.131
  92.35.235.164
  92.35.64.208
  92.35.94.126
  92.36.219.190
  92.36.220.112
-92.37.93.255
  92.38.136.69
  92.38.163.44
-92.38.163.96
  92.38.225.177
  92.38.226.16
-92.38.45.250
  92.38.45.68
  92.39.130.130
  92.39.247.20
  92.39.70.138
-92.40.122.85
  92.40.173.182
  92.42.107.139
  92.42.110.214
@@ -115404,14 +96719,11 @@
  92.42.47.188
  92.42.8.20
  92.42.8.5
-92.43.104.99
-92.43.187.34
  92.43.20.29
  92.43.29.162
  92.45.165.20
  92.45.51.207
  92.45.51.208
-92.45.51.210
  92.45.51.212
  92.45.51.214
  92.45.51.217
@@ -115421,17 +96733,11 @@
  92.45.51.227
  92.45.51.229
  92.45.51.230
-92.45.51.254
-92.46.121.26
-92.46.126.244
-92.46.127.238
  92.46.215.82
  92.47.62.134
-92.47.92.46
  92.48.124.21
  92.49.181.20
-92.49.184.122
-92.49.214.185
+92.49.182.172
  92.49.214.237
  92.50.112.146
  92.50.136.106
@@ -115443,27 +96749,21 @@
  92.51.241.168
  92.51.73.14
  92.51.89.126
-92.52.149.100
  92.52.186.123
  92.52.204.23
  92.53.103.158
  92.53.111.240
  92.53.119.193
+92.53.123.166
  92.53.146.92
  92.53.193.100
  92.53.202.215
+92.53.50.12
  92.53.64.203
-92.53.65.40
-92.53.65.52
-92.53.96.165
  92.53.96.175
  92.54.126.211
  92.54.200.66
-92.54.237.230
  92.54.237.237
-92.55.121.197
-92.55.66.133
-92.57.150.133
  92.60.190.249
  92.60.194.244
  92.60.224.50
@@ -115477,56 +96777,36 @@
  92.63.168.227
  92.63.192.231
  92.63.192.96
-92.63.196.23
+92.63.196.111
+92.63.196.164
  92.63.196.33
-92.63.196.47
+92.63.196.54
  92.63.197.153
  92.63.197.190
  92.63.197.53
  92.63.197.55
-92.63.197.58
  92.63.197.60
  92.63.197.61
-92.63.197.66
-92.63.197.71
  92.63.197.88
-92.63.197.95
-92.63.197.97
  92.63.203.197
  92.63.87.10
  92.63.87.9
  92.63.91.108
  92.63.91.81
  92.63.91.84
-92.64.165.32
  92.64.167.225
  92.64.254.225
-92.68.176.97
-92.70.192.85
  92.70.243.58
+92.75.165.138
  92.79.100.106
  92.79.91.147
  92.8.84.191
  92.8.85.159
-92.80.124.104
  92.80.217.82
-92.81.10.94
-92.81.119.26
-92.81.19.48
  92.81.222.217
-92.81.23.31
-92.81.7.38
-92.81.94.146
-92.82.173.220
  92.82.196.167
-92.82.208.71
-92.82.235.198
-92.82.75.189
-92.83.223.158
  92.84.56.10
-92.85.150.203
  92.85.169.16
-92.85.44.90
  92.86.10.42
  92.86.127.175
  92.86.218.107
@@ -115544,6 +96824,7 @@
  92.96.94.231
  92.97.79.98
  92.98.243.43
+92.98.7.153
  92.99.1.197
  92.99.216.187
  9201mobiliref032.com
@@ -115573,10 +96854,7 @@
  92ld0-fund.online
  93.100.132.97
  93.100.138.129
-93.100.151.99
  93.103.12.195
-93.103.147.135
-93.103.198.205
  93.104.208.65
  93.104.209.34
  93.104.210.119
@@ -115585,9 +96863,9 @@
  93.104.210.29
  93.104.213.162
  93.107.187.162
-93.108.137.140
  93.108.242.140
-93.11.126.83
+93.109.0.36
+93.11.169.221
  93.113.110.87
  93.113.111.100
  93.113.111.193
@@ -115595,11 +96873,8 @@
  93.113.131.129
  93.113.206.62
  93.113.49.1
-93.114.133.190
  93.114.133.202
-93.114.183.4
  93.114.184.8
-93.114.204.149
  93.114.41.133
  93.114.44.253
  93.114.82.154
@@ -115607,12 +96882,14 @@
  93.114.82.21
  93.114.86.226
  93.115.0.118
+93.115.0.198
  93.115.0.215
  93.115.1.195
  93.115.138.250
  93.115.20.130
  93.115.202.96
  93.115.23.117
+93.115.231.213
  93.115.240.26
  93.115.241.194
  93.115.26.162
@@ -115622,8 +96899,6 @@
  93.115.28.92
  93.115.29.28
  93.115.29.78
-93.115.40.113
-93.115.79.95
  93.115.86.246
  93.115.92.169
  93.115.95.202
@@ -115632,24 +96907,13 @@
  93.116.226.60
  93.116.234.240
  93.116.57.4
-93.116.84.8
-93.117.219.246
  93.117.72.27
-93.118.109.57
-93.118.115.77
  93.118.72.92
  93.118.74.237
  93.119.107.251
  93.119.123.233
  93.119.48.44
-93.12.182.198
  93.120.140.41
-93.122.192.214
-93.122.193.117
-93.122.226.16
-93.122.233.221
-93.122.239.141
-93.123.16.172
  93.123.180.164
  93.123.225.151
  93.123.73.123
@@ -115657,7 +96921,6 @@
  93.124.125.4
  93.124.59.188
  93.124.60.90
-93.125.101.10
  93.125.109.16
  93.125.114.97
  93.125.22.130
@@ -115669,50 +96932,38 @@
  93.125.99.2
  93.125.99.40
  93.125.99.69
-93.126.21.49
  93.126.25.33
  93.126.60.99
+93.126.62.37
  93.126.62.83
  93.126.73.213
  93.126.94.192
  93.126.98.242
  93.127.145.162
  93.127.145.40
-93.131.54.47
-93.133.1.48
-93.135.172.246
-93.136.113.244
-93.136.126.127
+93.136.132.129
  93.136.175.65
  93.137.155.54
  93.138.24.130
  93.138.30.240
-93.14.35.190
-93.141.187.2
  93.144.60.9
  93.145.115.206
  93.145.164.6
  93.145.61.6
  93.145.62.142
-93.145.80.83
  93.146.237.163
  93.147.129.222
  93.147.141.5
  93.147.212.206
-93.147.248.121
-93.148.22.156
  93.148.231.30
-93.148.249.77
  93.149.12.2
-93.149.208.70
  93.149.233.109
+93.149.236.91
  93.15.41.61
+93.15.83.200
  93.150.190.51
  93.150.44.250
  93.150.45.26
-93.151.171.129
-93.151.220.213
-93.152.139.99
  93.152.158.132
  93.153.95.186
  93.155.164.41
@@ -115721,25 +96972,16 @@
  93.157.62.102
  93.157.62.58
  93.158.211.196
+93.158.213.144
  93.158.216.52
  93.158.228.206
  93.158.228.230
-93.158.231.175
-93.158.85.35
-93.159.141.166
-93.159.190.107
-93.162.245.106
  93.167.67.69
  93.170.113.159
-93.170.119.71
  93.170.129.150
  93.170.15.177
-93.170.25.39
-93.170.27.192
  93.170.53.188
  93.171.100.238
-93.171.103.209
-93.171.136.132
  93.171.205.34
  93.171.208.194
  93.172.212.252
@@ -115748,25 +96990,16 @@
  93.174.0.38
  93.174.163.252
  93.174.176.103
-93.174.188.69
  93.174.88.123
  93.174.88.31
-93.174.89.20
-93.174.89.41
-93.174.89.43
-93.174.89.52
-93.174.89.55
  93.174.93.119
  93.174.93.12
-93.174.93.123
  93.174.93.129
  93.174.93.146
  93.174.93.149
-93.174.93.159
  93.174.93.174
  93.174.93.181
  93.174.93.192
-93.174.93.195
  93.174.93.198
  93.174.93.210
  93.174.93.213
@@ -115789,28 +97022,22 @@
  93.174.95.64
  93.174.95.81
  93.175.203.124
-93.175.214.107
  93.175.234.1
  93.176.163.158
  93.176.168.90
-93.176.179.125
  93.176.184.180
+93.176.187.74
  93.176.84.35
  93.176.84.45
  93.177.118.196
-93.177.119.176
  93.177.119.240
-93.177.137.211
  93.177.82.226
-93.178.15.63
  93.178.200.122
-93.178.88.222
  93.179.102.31
  93.179.118.218
  93.179.125.49
  93.179.197.152
  93.179.231.77
-93.180.157.61
  93.180.178.213
  93.180.64.135
  93.180.64.220
@@ -115824,13 +97051,9 @@
  93.183.184.23
  93.183.184.253
  93.183.196.115
-93.183.226.218
-93.184.125.45
  93.184.164.231
  93.184.164.233
-93.185.207.150
  93.185.4.90
-93.185.65.183
  93.185.93.162
  93.186.104.20
  93.186.148.33
@@ -115838,7 +97061,6 @@
  93.187.182.176
  93.187.200.218
  93.188.161.145
-93.188.162.209
  93.188.164.193
  93.188.164.198
  93.188.166.222
@@ -115862,30 +97084,23 @@
  93.190.142.240
  93.190.143.82
  93.190.206.3
-93.190.21.90
  93.190.41.97
  93.190.58.4
-93.191.114.183
-93.191.156.125
-93.191.156.197
  93.192.188.169
-93.192.85.39
  93.195.244.142
  93.196.103.122
  93.197.34.128
  93.2.194.252
-93.2.210.101
  93.201.236.52
  93.202.128.198
-93.202.139.223
+93.202.182.231
  93.203.35.140
  93.209.119.77
  93.209.179.201
-93.209.180.2
  93.21.224.154
-93.210.15.96
  93.210.21.58
-93.217.170.219
+93.210.22.206
+93.217.174.176
  93.22.37.164
  93.220.35.181
  93.222.192.185
@@ -115896,21 +97111,20 @@
  93.225.176.180
  93.228.9.224
  93.23.196.55
-93.234.250.181
  93.236.51.145
+93.239.9.71
  93.241.228.102
  93.241.232.101
  93.242.24.229
  93.25.118.228
  93.25.168.37
  93.252.143.162
-93.254.71.79
-93.255.62.99
-93.28.179.161
-93.30.204.148
-93.30.211.244
+93.252.45.140
+93.252.65.239
+93.252.86.245
+93.254.127.208
  93.32.81.205
-93.32.81.49
+93.34.138.188
  93.34.147.89
  93.34.234.124
  93.35.186.155
@@ -115920,29 +97134,20 @@
  93.38.121.152
  93.38.127.179
  93.39.115.176
-93.39.227.213
-93.4.85.26
  93.41.126.26
-93.41.182.232
  93.41.193.212
-93.41.233.225
-93.41.238.94
  93.42.121.254
  93.42.196.218
  93.42.224.202
-93.42.249.235
  93.42.7.100
  93.43.193.42
+93.43.223.61
  93.43.231.1
+93.43.35.161
  93.43.96.209
-93.46.218.89
-93.46.34.242
  93.46.54.4
-93.46.62.173
-93.46.63.37
  93.48.88.51
  93.49.164.197
-93.49.247.215
  93.5.133.202
  93.5.195.169
  93.5.72.88
@@ -115951,30 +97156,24 @@
  93.51.176.72
  93.51.199.110
  93.51.247.104
+93.54.63.134
  93.55.242.131
-93.56.220.4
  93.56.94.164
  93.57.249.8
-93.57.30.14
-93.57.37.230
  93.57.43.233
  93.57.81.162
  93.61.137.226
  93.63.108.202
-93.63.167.100
  93.63.173.228
  93.63.37.231
  93.63.75.62
  93.64.183.162
  93.64.5.34
  93.67.138.66
-93.67.226.245
  93.67.249.134
-93.67.249.237
  93.69.7.20
+93.7.88.127
  93.71.201.63
-93.71.9.21
-93.73.157.229
  93.73.199.52
  93.73.36.6
  93.74.111.222
@@ -115988,62 +97187,50 @@
  93.75.197.17
  93.75.38.205
  93.75.48.211
-93.76.159.235
-93.76.222.18
-93.76.71.130
-93.77.168.101
-93.77.231.16
-93.78.109.77
+93.77.239.137
  93.8.133.221
-93.8.151.167
  93.8.87.97
-93.80.250.181
  93.81.252.222
  93.81.97.152
  93.82.220.150
  93.83.126.93
-93.84.111.7
-93.84.212.62
-93.84.79.135
+93.84.173.169
+93.84.175.36
+93.84.181.126
  93.85.132.194
  93.86.206.139
  93.86.49.105
  93.86.68.186
-93.86.86.127
  93.86.92.95
  93.87.123.245
+93.87.129.113
  93.87.17.1
  93.87.28.158
+93.87.40.41
  93.87.74.202
  93.87.75.118
  93.87.92.126
  93.88.107.125
  93.88.96.126
  93.89.159.8
-93.89.225.103
-93.89.225.145
-93.89.225.179
-93.89.225.54
-93.89.225.92
-93.89.232.19
-93.89.232.2
+93.89.225.2
  93.89.235.77
  93.89.81.97
  93.89.84.93
  93.9.186.203
+93.9.209.70
  93.90.147.104
  93.90.206.167
  93.90.207.43
  93.90.207.46
  93.90.31.26
  93.90.73.137
+93.91.112.247
  93.91.146.30
-93.92.131.194
-93.92.205.180
+93.92.248.23
  93.93.195.94
  93.93.46.180
  93.93.71.228
-93.94.89.46
  93.94.91.107
  93.95.100.163
  93.95.100.171
@@ -116051,8 +97238,10 @@
  93.95.217.45
  93.95.240.245
  93.95.88.13
-93.97.219.82
+93.99.104.210
+93.99.146.89
  93.99.176.84
+93.99.4.28
  93.99.53.201
  93.99.6.158
  93020300-dot-sydneyma.appspot.com
@@ -116077,10 +97266,8 @@
  93b30803f9a3572cddf0c106624dcb69.info
  93jhwpuyranq.talagaremix.com
  94-237-53-115.uk-lon1.upcloud.host
-94.1.160.177
  94.100.18.70
  94.100.28.201
-94.100.93.251
  94.101.141.244
  94.101.142.8
  94.101.251.191
@@ -116089,9 +97276,8 @@
  94.102.212.234
  94.102.48.193
  94.102.49.104
-94.102.49.106
-94.102.49.109
  94.102.49.11
+94.102.49.117
  94.102.49.135
  94.102.49.137
  94.102.49.164
@@ -116105,16 +97291,14 @@
  94.102.49.211
  94.102.49.26
  94.102.49.37
+94.102.49.59
  94.102.49.7
  94.102.49.82
  94.102.49.92
+94.102.49.93
  94.102.49.98
  94.102.5.24
  94.102.5.32
-94.102.50.137
-94.102.50.138
-94.102.50.155
-94.102.50.163
  94.102.50.56
  94.102.51.155
  94.102.51.17
@@ -116122,9 +97306,7 @@
  94.102.51.231
  94.102.51.238
  94.102.51.246
-94.102.51.28
  94.102.51.30
-94.102.51.75
  94.102.51.78
  94.102.51.95
  94.102.52.241
@@ -116135,12 +97317,8 @@
  94.102.54.78
  94.102.54.87
  94.102.56.210
-94.102.56.216
-94.102.57.240
  94.102.57.241
  94.102.58.3
-94.102.59.64
-94.102.59.99
  94.102.63.245
  94.102.63.52
  94.102.63.74
@@ -116149,23 +97327,21 @@
  94.103.122.210
  94.103.92.140
  94.103.95.137
+94.105.108.65
  94.106.214.115
-94.107.85.46
  94.112.121.49
  94.112.132.191
  94.114.122.116
  94.114.158.146
  94.114.70.23
-94.12.31.76
  94.123.220.188
  94.124.193.242
+94.124.193.67
  94.124.6.181
  94.124.93.146
  94.126.32.51
  94.127.188.21
  94.127.188.97
-94.127.212.183
-94.127.217.200
  94.127.217.66
  94.127.222.36
  94.127.68.158
@@ -116196,6 +97372,7 @@
  94.130.69.46
  94.130.71.31
  94.130.73.18
+94.130.73.22
  94.130.75.8
  94.130.84.44
  94.130.89.38
@@ -116205,8 +97382,8 @@
  94.134.250.165
  94.134.3.239
  94.134.33.146
+94.134.41.134
  94.134.42.223
-94.134.44.30
  94.136.138.142
  94.136.154.49
  94.136.154.53
@@ -116231,7 +97408,7 @@
  94.139.165.219
  94.139.166.175
  94.139.166.59
-94.139.167.62
+94.139.187.73
  94.139.226.102
  94.140.114.164
  94.140.114.190
@@ -116259,21 +97436,20 @@
  94.142.245.124
  94.143.43.230
  94.143.83.203
+94.152.193.237
  94.152.193.238
  94.152.214.74
-94.153.144.58
  94.153.157.18
  94.153.169.22
  94.153.212.102
  94.153.224.194
  94.153.224.202
-94.153.227.14
+94.154.107.50
  94.154.159.99
  94.154.18.59
  94.155.115.161
  94.155.33.133
  94.155.33.165
-94.155.33.184
  94.155.33.190
  94.155.33.191
  94.155.33.192
@@ -116286,9 +97462,11 @@
  94.155.33.207
  94.155.33.70
  94.155.33.71
+94.155.33.72
  94.155.33.73
  94.155.33.74
  94.155.33.75
+94.155.33.76
  94.155.33.78
  94.155.33.79
  94.155.33.80
@@ -116298,6 +97476,7 @@
  94.155.33.85
  94.155.33.87
  94.156.11.66
+94.156.119.230
  94.156.128.114
  94.156.128.69
  94.156.128.72
@@ -116321,21 +97500,17 @@
  94.158.245.114
  94.158.245.15
  94.159.31.10
-94.159.50.98
  94.16.120.18
  94.16.121.91
-94.16.159.144
  94.162.117.161
  94.174.64.12
  94.176.148.34
  94.176.148.35
  94.176.234.118
  94.176.235.169
-94.177.16.254
  94.177.161.160
  94.177.171.51
  94.177.171.73
-94.177.176.116
  94.177.181.123
  94.177.183.28
  94.177.189.119
@@ -116343,6 +97518,7 @@
  94.177.199.78
  94.177.204.145
  94.177.207.151
+94.177.214.158
  94.177.232.252
  94.177.236.107
  94.177.236.48
@@ -116353,32 +97529,12 @@
  94.177.253.126
  94.177.254.76
  94.178.127.231
-94.178.174.67
-94.178.174.7
-94.178.175.201
  94.179.135.230
  94.18.231.202
  94.180.223.10
-94.180.24.11
-94.180.24.123
-94.180.24.4
-94.180.24.59
  94.180.246.38
  94.180.249.187
-94.180.25.163
-94.180.25.176
-94.180.25.231
-94.180.25.242
-94.180.25.53
  94.180.253.213
-94.180.28.103
-94.180.28.13
-94.180.28.157
-94.180.28.2
-94.180.28.248
-94.180.28.57
-94.180.28.89
-94.180.57.15
  94.181.174.45
  94.181.33.149
  94.181.37.97
@@ -116386,18 +97542,13 @@
  94.181.46.72
  94.182.181.178
  94.182.191.215
-94.182.196.110
  94.182.197.202
  94.182.25.74
-94.183.231.81
-94.183.26.32
  94.183.31.11
  94.183.40.126
-94.183.97.39
  94.184.208.62
  94.185.83.100
  94.185.85.45
-94.187.148.21
  94.188.28.106
  94.188.39.158
  94.189.132.47
@@ -116408,41 +97559,29 @@
  94.19.7.55
  94.19.73.106
  94.190.177.213
-94.190.35.174
-94.190.41.137
  94.190.52.103
-94.190.55.103
  94.190.76.239
  94.191.100.11
-94.191.105.19
  94.191.107.157
  94.191.107.25
-94.191.119.31
  94.191.2.245
-94.191.23.15
+94.191.37.65
  94.191.38.203
  94.191.43.241
-94.191.53.248
  94.191.60.213
  94.191.61.146
  94.191.62.154
  94.191.62.195
-94.191.66.227
  94.191.71.246
  94.191.75.220
  94.191.81.127
-94.192.223.164
  94.192.225.46
-94.195.13.48
-94.195.75.209
-94.196.250.108
  94.198.1.179
  94.198.160.31
  94.198.195.42
  94.198.215.22
  94.198.240.26
  94.198.41.118
-94.198.65.186
  94.198.96.3
  94.199.151.22
  94.199.173.115
@@ -116451,19 +97590,17 @@
  94.199.178.233
  94.199.181.248
  94.2.133.202
-94.20.200.122
+94.2.202.101
  94.20.21.37
  94.200.114.161
  94.200.114.162
  94.200.126.42
-94.200.149.186
  94.200.16.22
  94.200.17.144
  94.200.178.238
  94.200.179.62
  94.200.195.218
  94.200.38.114
-94.200.76.222
  94.205.247.10
  94.207.243.199
  94.208.111.187
@@ -116472,21 +97609,22 @@
  94.209.17.157
  94.21.106.192
  94.21.118.140
-94.21.139.151
-94.21.141.222
  94.21.155.91
-94.21.242.223
+94.210.6.98
  94.212.219.138
+94.212.31.69
  94.213.107.137
+94.216.192.38
  94.216.222.151
  94.217.126.220
-94.218.206.59
+94.218.22.254
  94.218.59.205
  94.219.243.166
  94.22.47.242
-94.222.139.222
+94.224.179.119
  94.224.184.11
  94.224.187.205
+94.224.211.150
  94.224.83.208
  94.225.169.79
  94.225.254.149
@@ -116494,26 +97632,23 @@
  94.228.10.70
  94.228.11.6
  94.228.180.218
-94.228.198.44
  94.228.2.33
  94.228.203.179
  94.228.203.84
  94.228.214.5
  94.228.215.83
-94.228.224.144
+94.228.229.111
  94.228.4.249
  94.229.161.60
  94.23.1.8
  94.23.11.114
+94.23.11.6
  94.23.12.182
  94.23.12.38
  94.23.121.50
  94.23.13.27
-94.23.150.165
  94.23.154.171
-94.23.160.207
  94.23.160.33
-94.23.176.17
  94.23.179.193
  94.23.179.199
  94.23.19.147
@@ -116530,7 +97665,6 @@
  94.23.216.33
  94.23.218.10
  94.23.222.84
-94.23.225.175
  94.23.229.64
  94.23.236.143
  94.23.237.171
@@ -116541,14 +97675,15 @@
  94.23.254.205
  94.23.26.146
  94.23.3.129
+94.23.3.150
  94.23.30.216
+94.23.32.131
  94.23.33.22
  94.23.36.11
  94.23.38.191
  94.23.4.47
  94.23.44.120
  94.23.45.15
-94.23.5.135
  94.23.51.183
  94.23.69.61
  94.23.70.195
@@ -116557,17 +97692,11 @@
  94.23.86.67
  94.23.9.102
  94.230.119.144
-94.230.128.59
  94.230.134.77
  94.230.208.147
  94.230.208.148
-94.230.64.87
-94.230.68.160
  94.230.70.6
-94.230.78.71
-94.231.130.172
  94.231.182.117
-94.231.182.45
  94.231.216.63
  94.231.80.100
  94.231.88.101
@@ -116575,10 +97704,12 @@
  94.232.126.225
  94.232.136.126
  94.232.200.144
+94.232.43.193
  94.232.44.38
-94.232.44.52
  94.232.46.15
+94.232.46.190
  94.232.46.40
+94.233.61.5
  94.236.182.92
  94.236.192.75
  94.236.23.242
@@ -116588,13 +97719,11 @@
  94.237.124.184
  94.237.125.30
  94.237.64.138
-94.237.72.12
  94.237.80.207
  94.237.80.66
-94.24.244.42
  94.240.30.99
  94.240.38.170
-94.241.167.3
+94.241.165.160
  94.242.129.46
  94.242.206.227
  94.242.213.9
@@ -116602,28 +97731,26 @@
  94.242.241.177
  94.242.246.24
  94.242.249.114
-94.242.250.62
  94.242.255.31
  94.242.55.98
  94.242.57.190
  94.242.57.57
  94.242.62.18
-94.242.62.20
  94.242.62.68
-94.243.119.222
  94.243.140.162
  94.243.219.122
+94.243.27.7
  94.243.27.8
  94.244.134.107
-94.244.183.20
  94.244.97.244
-94.245.50.181
  94.247.134.77
  94.247.241.70
-94.247.53.254
  94.25.104.250
  94.25.228.74
+94.25.238.119
  94.25.238.151
+94.25.238.196
+94.25.238.242
  94.25.95.138
  94.250.208.112
  94.250.248.75
@@ -116632,32 +97759,20 @@
  94.250.255.68
  94.253.15.25
  94.253.237.25
-94.253.3.208
  94.254.19.97
-94.254.60.101
  94.254.73.7
-94.254.96.21
  94.254.97.68
  94.255.11.188
-94.255.197.33
-94.255.244.80
-94.255.246.112
-94.255.246.218
-94.255.247.17
-94.255.247.18
-94.255.247.4
-94.26.123.94
  94.26.124.252
  94.26.142.10
+94.26.49.71
  94.26.90.13
+94.26.90.186
  94.26.90.41
  94.26.90.45
  94.26.90.80
  94.27.179.126
-94.27.249.65
  94.28.31.99
-94.29.7.221
-94.29.72.109
  94.30.181.58
  94.30.181.60
  94.30.181.62
@@ -116667,17 +97782,16 @@
  94.32.66.15
  94.32.66.48
  94.34.224.165
-94.36.219.200
-94.38.54.215
  94.40.127.166
+94.40.23.46
+94.41.1.28
+94.41.60.94
  94.42.144.10
-94.43.10.214
  94.43.101.161
  94.43.101.202
  94.43.139.153
  94.43.139.185
  94.43.139.99
-94.43.169.70
  94.43.191.27
  94.43.85.6
  94.45.223.134
@@ -116685,29 +97799,25 @@
  94.46.186.242
  94.46.186.49
  94.46.3.139
-94.50.162.191
+94.5.60.14
+94.50.161.142
  94.50.179.67
  94.51.216.224
  94.52.112.227
-94.53.116.52
  94.53.120.109
-94.53.71.214
  94.53.83.30
  94.57.252.133
+94.57.252.137
  94.57.252.147
  94.59.75.146
  94.60.136.242
-94.60.252.179
-94.60.98.142
  94.61.153.12
  94.61.159.92
  94.62.201.87
  94.62.245.6
-94.63.114.4
  94.63.78.106
  94.64.238.33
  94.65.145.254
-94.65.181.131
  94.65.252.104
  94.65.252.176
  94.65.56.190
@@ -116716,32 +97826,25 @@
  94.66.50.68
  94.67.106.234
  94.67.207.203
-94.67.223.84
-94.67.250.52
-94.67.253.6
  94.67.255.125
-94.68.12.26
-94.68.132.100
  94.68.204.178
  94.68.45.149
-94.68.70.220
-94.69.226.48
-94.7.247.100
+94.69.217.245
  94.70.116.69
  94.70.93.64
  94.71.122.24
-94.71.80.72
  94.71.83.157
  94.72.143.141
  94.72.143.26
  94.72.143.28
  94.73.145.120
-94.73.193.106
-94.73.250.66
-94.73.252.193
  94.74.106.231
  94.74.124.248
+94.74.130.246
+94.74.168.75
  94.74.172.142
+94.74.181.123
+94.74.191.235
  94.75.207.99
  94.75.228.26
  94.75.243.135
@@ -116749,18 +97852,13 @@
  94.75.246.151
  94.75.253.76
  94.75.253.85
-94.76.145.10
-94.76.184.130
  94.76.247.61
  94.76.92.10
  94.79.4.53
  94.79.54.195
  94.8.176.160
-94.85.247.130
  94.9.141.241
  94.96.24.9
-94.96.87.54
-94.97.49.75
  94.98.60.183
  94.99.112.138
  94.99.114.74
@@ -116788,7 +97886,6 @@
  948522.blob.core.windows.net
  949111-dot-n-e-w-me-ss-age-po-rt-al.wl.r.appspot.com
  95.0.11.100
-95.0.149.15
  95.0.183.21
  95.0.194.241
  95.0.206.10
@@ -116799,10 +97896,9 @@
  95.0.37.74
  95.0.66.136
  95.0.66.138
+95.0.66.72
  95.0.66.76
  95.0.66.97
-95.10.87.2
-95.102.61.21
  95.102.9.127
  95.104.114.50
  95.104.194.16
@@ -116815,11 +97911,11 @@
  95.106.106.220
  95.106.209.218
  95.106.222.26
+95.106.244.217
  95.107.163.114
  95.107.199.90
  95.107.6.3
-95.107.99.76
-95.109.56.77
+95.109.113.247
  95.109.94.168
  95.110.132.26
  95.110.153.164
@@ -116834,16 +97930,16 @@
  95.110.234.93
  95.111.128.185
  95.111.128.43
-95.111.227.79
+95.111.147.200
  95.111.230.170
  95.111.231.86
  95.111.234.125
-95.111.235.135
  95.111.235.189
  95.111.235.214
  95.111.236.142
  95.111.240.199
  95.111.245.205
+95.111.248.29
  95.111.251.230
  95.111.252.182
  95.111.253.158
@@ -116852,31 +97948,29 @@
  95.111.63.16
  95.111.74.98
  95.112.107.25
-95.112.193.156
-95.112.208.127
  95.112.52.179
  95.112.76.213
-95.114.104.7
+95.114.4.49
+95.114.83.29
  95.115.140.16
-95.117.35.69
-95.117.88.33
-95.118.76.235
+95.115.98.112
+95.116.119.218
+95.116.164.170
+95.116.33.185
+95.118.15.138
  95.122.154.149
  95.122.97.103
  95.128.137.176
  95.128.142.76
  95.128.144.1
-95.128.162.108
-95.128.166.195
  95.128.167.173
+95.128.167.209
  95.128.168.227
-95.128.190.196
+95.128.42.70
  95.128.43.164
  95.128.43.213
  95.128.46.70
  95.128.63.245
-95.129.114.23
-95.129.4.19
  95.13.148.48
  95.13.65.5
  95.13.65.96
@@ -116900,27 +97994,23 @@
  95.13.93.7
  95.13.95.115
  95.13.95.24
-95.130.168.234
-95.131.10.118
+95.130.63.120
  95.131.70.76
-95.132.232.40
  95.133.163.58
  95.133.163.98
  95.134.130.182
-95.134.195.166
-95.134.232.185
+95.134.187.126
  95.135.142.198
+95.136.111.129
  95.136.47.170
  95.137.156.236
  95.137.240.3
  95.137.240.30
  95.138.228.28
  95.138.33.28
-95.14.128.16
  95.140.116.18
  95.140.27.135
-95.141.135.171
-95.141.142.46
+95.140.27.48
  95.141.17.0
  95.141.17.1
  95.141.17.10
@@ -117184,7 +98274,6 @@
  95.142.112.19
  95.142.112.20
  95.142.112.27
-95.142.120.13
  95.142.121.18
  95.142.161.63
  95.142.161.87
@@ -117197,12 +98286,9 @@
  95.142.39.144
  95.142.39.195
  95.142.44.203
-95.142.84.234
-95.143.128.178
  95.143.133.180
  95.143.135.226
  95.143.139.2
-95.143.153.180
  95.143.192.159
  95.143.193.125
  95.143.21.122
@@ -117214,18 +98300,18 @@
  95.143.21.89
  95.143.218.179
  95.143.22.121
-95.143.22.126
  95.143.22.155
+95.143.22.169
  95.143.22.220
-95.143.22.81
+95.143.22.36
+95.143.22.79
  95.143.22.97
-95.143.220.5
  95.143.239.198
-95.143.82.202
  95.146.90.213
-95.149.204.205
  95.15.140.230
  95.15.162.191
+95.152.63.103
+95.153.126.185
  95.153.167.63
  95.153.31.77
  95.153.99.152
@@ -117239,19 +98325,13 @@
  95.154.200.173
  95.154.200.178
  95.154.24.73
-95.154.29.197
  95.154.75.180
  95.154.81.65
  95.154.90.99
  95.155.110.127
-95.155.198.93
  95.155.199.202
-95.155.204.63
-95.155.36.152
  95.155.44.9
  95.155.59.81
-95.155.63.186
-95.156.115.227
  95.156.125.190
  95.158.153.105
  95.158.153.145
@@ -117264,15 +98344,12 @@
  95.158.153.72
  95.158.19.130
  95.158.217.19
-95.158.36.113
  95.158.63.46
  95.158.63.61
-95.160.181.237
  95.160.23.204
  95.161.12.45
  95.161.188.246
  95.161.196.146
-95.161.196.148
  95.163.141.218
  95.163.141.220
  95.163.141.222
@@ -117283,24 +98360,19 @@
  95.163.196.101
  95.163.207.184
  95.163.255.15
-95.163.255.16
-95.163.255.18
-95.164.65.11
  95.164.65.194
  95.165.104.89
  95.165.106.133
-95.165.13.239
  95.165.136.243
+95.165.141.61
  95.165.150.25
  95.165.160.18
  95.165.160.46
  95.165.163.188
  95.165.164.170
  95.165.167.37
-95.165.172.171
+95.165.182.230
  95.165.187.202
-95.165.19.114
-95.165.201.178
  95.165.252.94
  95.165.26.27
  95.165.96.126
@@ -117308,19 +98380,17 @@
  95.167.139.66
  95.167.159.250
  95.167.178.149
-95.167.212.219
  95.167.228.7
  95.167.243.167
  95.168.116.115
  95.168.120.3
+95.168.120.55
  95.168.170.105
-95.168.191.136
  95.168.96.42
  95.169.1.147
  95.169.10.152
  95.169.213.76
  95.169.214.217
-95.169.22.100
  95.169.22.174
  95.169.5.166
  95.169.6.123
@@ -117330,18 +98400,14 @@
  95.17.44.96
  95.170.115.154
  95.170.118.79
-95.170.166.238
  95.170.70.25
  95.170.88.58
  95.171.126.17
  95.172.44.186
-95.172.47.168
  95.172.83.162
  95.172.83.90
  95.173.148.247
-95.173.178.134
  95.173.183.28
-95.173.253.215
  95.174.0.176
  95.174.109.43
  95.174.124.153
@@ -117356,7 +98422,7 @@
  95.176.228.103
  95.179.131.110
  95.179.132.92
-95.179.137.90
+95.179.133.82
  95.179.138.23
  95.179.148.197
  95.179.149.174
@@ -117369,27 +98435,28 @@
  95.179.183.224
  95.179.187.193
  95.179.188.215
+95.179.189.134
  95.179.191.229
  95.179.210.17
  95.179.212.50
  95.179.214.152
  95.179.250.205
  95.180.167.208
+95.180.213.60
  95.180.230.63
  95.181.131.153
  95.181.131.199
-95.181.143.71
+95.181.151.194
  95.181.155.112
  95.181.155.166
  95.181.157.114
  95.181.172.61
  95.181.172.79
-95.181.188.200
+95.181.198.17
  95.181.214.105
  95.181.230.146
  95.181.37.114
  95.181.45.234
-95.181.86.74
  95.182.113.34
  95.182.120.176
  95.182.126.243
@@ -117399,22 +98466,15 @@
  95.183.51.24
  95.183.52.148
  95.183.55.40
-95.185.128.236
  95.187.50.31
  95.188.120.88
  95.188.71.19
-95.189.101.81
  95.189.78.2
-95.19.193.163
+95.19.50.138
  95.19.50.169
  95.19.50.182
  95.19.50.222
-95.192.121.160
  95.195.215.245
-95.195.3.157
-95.196.204.24
-95.197.16.248
-95.197.47.175
  95.20.162.171
  95.208.253.143
  95.209.155.91
@@ -117453,20 +98513,16 @@
  95.211.247.201
  95.211.81.194
  95.211.9.228
-95.212.57.212
  95.213.145.218
  95.213.159.171
  95.213.171.142
  95.213.193.198
+95.213.193.232
  95.213.214.13
  95.213.217.188
  95.213.224.102
  95.213.229.163
-95.213.229.74
  95.213.236.64
-95.213.238.170
-95.214.113.165
-95.214.53.156
  95.215.19.22
  95.215.205.18
  95.215.206.244
@@ -117496,6 +98552,7 @@
  95.216.147.49
  95.216.15.164
  95.216.152.179
+95.216.155.54
  95.216.159.206
  95.216.165.43
  95.216.169.53
@@ -117505,7 +98562,6 @@
  95.216.197.12
  95.216.198.89
  95.216.207.86
-95.216.208.207
  95.216.21.47
  95.216.224.251
  95.216.226.201
@@ -117544,7 +98600,6 @@
  95.216.8.166
  95.216.9.240
  95.216.96.167
-95.216.96.172
  95.216.96.93
  95.216.97.16
  95.216.97.232
@@ -117563,29 +98618,24 @@
  95.217.153.193
  95.217.163.234
  95.217.176.235
-95.217.179.118
  95.217.180.216
-95.217.183.155
  95.217.183.221
  95.217.184.215
+95.217.186.24
  95.217.187.5
  95.217.187.64
  95.217.187.75
-95.217.190.150
  95.217.190.53
  95.217.194.209
  95.217.194.32
-95.217.195.80
  95.217.195.91
  95.217.197.206
+95.217.201.184
  95.217.203.187
  95.217.205.27
-95.217.208.171
  95.217.213.50
-95.217.223.192
  95.217.227.99
  95.217.23.149
-95.217.231.195
  95.217.32.177
  95.217.33.109
  95.217.35.79
@@ -117601,53 +98651,51 @@
  95.217.78.80
  95.217.93.21
  95.217.96.82
+95.219.145.19
  95.220.131.150
  95.222.180.222
  95.222.26.248
+95.223.73.5
+95.223.75.152
  95.223.75.255
-95.225.199.1
  95.227.198.80
  95.227.234.14
  95.229.138.72
  95.229.138.87
+95.23.146.80
  95.232.200.250
  95.233.68.206
-95.235.174.145
  95.235.60.135
-95.236.163.148
-95.236.224.191
  95.239.146.11
-95.239.146.230
-95.24.120.22
  95.24.138.201
-95.24.81.43
  95.241.189.148
  95.243.136.198
  95.244.34.150
-95.244.86.94
  95.246.13.139
  95.247.233.159
  95.247.254.165
-95.248.188.176
+95.248.39.88
  95.249.139.210
+95.249.37.8
+95.249.72.69
  95.25.37.148
-95.250.100.185
-95.250.164.146
+95.25.75.112
  95.251.21.85
-95.251.67.60
  95.251.9.69
  95.252.206.130
  95.253.100.189
  95.253.238.77
-95.255.133.196
  95.255.173.199
  95.255.49.42
-95.27.84.87
+95.26.59.225
+95.27.157.246
+95.27.252.129
+95.28.230.114
  95.28.55.192
  95.29.42.110
-95.30.183.124
  95.30.218.137
  95.30.218.165
+95.30.218.166
  95.30.218.169
  95.30.62.85
  95.31.119.210
@@ -117655,115 +98703,90 @@
  95.31.172.45
  95.31.186.116
  95.31.209.113
-95.31.241.178
  95.31.4.224
  95.31.5.29
  95.32.187.56
-95.32.21.129
  95.32.237.107
-95.33.255.103
  95.37.142.183
-95.37.17.104
-95.38.24.51
+95.38.252.152
  95.38.252.97
  95.39.12.16
  95.42.189.34
  95.43.42.100
-95.46.157.238
  95.46.44.198
-95.46.74.61
  95.47.116.72
  95.47.140.172
  95.47.140.42
-95.47.255.185
  95.48.228.45
-95.49.59.241
  95.5.72.78
  95.50.22.78
  95.50.85.99
  95.51.180.226
+95.53.178.139
  95.53.180.175
-95.53.197.8
-95.53.99.121
  95.54.162.66
  95.54.196.135
-95.54.58.205
  95.54.65.34
  95.55.124.172
-95.56.243.207
-95.57.218.103
-95.58.113.109
-95.58.164.130
-95.58.247.134
  95.59.105.179
  95.59.26.160
  95.59.26.9
  95.59.7.26
  95.6.64.145
  95.6.70.92
-95.6.77.61
  95.65.124.252
  95.65.30.156
  95.65.81.152
  95.65.89.96
-95.65.98.184
  95.66.142.18
  95.66.182.136
  95.67.130.200
  95.67.238.218
  95.67.38.55
  95.67.46.86
-95.67.56.20
-95.67.63.106
-95.67.65.18
  95.67.82.237
  95.68.115.202
  95.68.116.41
-95.68.147.182
-95.68.240.242
  95.69.249.63
-95.7.0.189
  95.7.6.73
  95.70.133.40
-95.70.174.200
  95.70.37.199
+95.70.63.4
  95.71.124.203
  95.71.124.31
  95.71.125.50
  95.71.126.250
  95.71.185.236
-95.71.196.63
-95.71.203.98
+95.71.91.49
  95.72.166.146
-95.72.53.200
+95.72.226.125
+95.73.203.195
  95.73.64.148
  95.73.88.170
  95.76.142.243
+95.76.18.172
  95.77.104.79
-95.77.118.131
  95.77.16.197
  95.77.98.196
  95.77.98.92
  95.78.127.226
  95.78.162.117
+95.78.174.219
  95.78.251.116
  95.79.112.74
  95.79.114.174
  95.79.34.35
  95.79.35.133
+95.79.36.55
  95.79.41.188
  95.79.50.121
  95.79.55.196
  95.79.57.206
  95.80.10.185
-95.80.116.66
-95.80.128.189
  95.80.252.189
  95.80.254.162
  95.80.254.85
  95.80.64.108
-95.80.79.106
-95.81.227.172
  95.81.80.112
  95.82.136.170
  95.82.146.70
@@ -117773,13 +98796,11 @@
  95.84.134.107
  95.84.141.162
  95.84.158.121
-95.84.164.43
  95.84.187.154
  95.84.19.130
  95.84.195.16
  95.84.240.168
  95.85.1.116
-95.85.10.43
  95.85.11.140
  95.85.13.8
  95.85.15.40
@@ -117789,12 +98810,12 @@
  95.85.19.99
  95.85.23.210
  95.85.25.101
-95.85.25.177
  95.85.26.75
  95.85.28.125
  95.85.28.173
  95.85.30.184
  95.85.31.179
+95.85.31.92
  95.85.33.224
  95.85.34.53
  95.85.37.17
@@ -117813,7 +98834,6 @@
  95.85.51.248
  95.85.53.200
  95.85.56.40
-95.85.58.118
  95.85.61.36
  95.85.8.239
  95.85.9.204
@@ -117827,27 +98847,20 @@
  95.87.24.151
  95.87.249.178
  95.87.25.234
-95.87.9.254
  95.89.101.132
  95.89.87.163
-95.9.118.147
  95.9.150.33
  95.9.180.128
  95.9.194.13
-95.9.237.183
  95.9.5.93
-95.9.67.155
  95.90.180.206
+95.90.181.63
  95.90.198.207
-95.90.233.52
  95.90.32.165
  95.90.32.39
-95.91.15.6
  95.91.221.219
-95.91.252.183
  95.91.45.50
  95.93.216.34
-95.93.29.85
  95.97.10.18
  95.97.209.10
  95.97.27.33
@@ -117870,12 +98883,12 @@
  95photo.cn
  95s8f4.xyz
  96.125.164.243
+96.125.200.34
  96.125.228.110
  96.125.228.213
  96.126.100.115
  96.126.102.27
  96.126.105.56
-96.126.105.99
  96.126.107.57
  96.126.110.231
  96.126.113.73
@@ -117885,17 +98898,9 @@
  96.126.123.143
  96.126.127.143
  96.127.137.202
-96.127.137.203
-96.127.137.204
-96.127.137.205
-96.127.137.206
  96.127.142.210
  96.127.175.10
-96.127.175.11
-96.127.175.12
-96.127.175.13
  96.127.175.138
-96.127.175.14
  96.127.54.22
  96.127.84.101
  96.127.90.211
@@ -117903,17 +98908,13 @@
  96.18.233.136
  96.19.194.191
  96.2.21.190
-96.20.87.164
  96.22.82.34
  96.224.227.210
-96.224.32.210
  96.225.173.33
  96.225.97.17
-96.228.53.12
  96.230.255.189
  96.231.141.105
  96.232.127.10
-96.232.191.72
  96.233.194.4
  96.233.77.159
  96.234.42.12
@@ -117926,32 +98927,23 @@
  96.239.73.246
  96.241.75.151
  96.242.147.73
-96.242.174.18
  96.245.227.43
  96.245.74.37
  96.247.204.58
-96.250.213.40
  96.252.37.32
  96.253.78.75
  96.254.171.10
-96.255.110.243
-96.255.219.187
  96.255.84.96
-96.255.96.11
  96.27.143.106
  96.27.249.5
-96.28.3.48
-96.30.124.51
  96.30.195.215
  96.30.197.216
  96.30.51.176
  96.30.79.114
  96.31.77.62
  96.35.44.209
+96.35.86.14
  96.36.76.212
-96.37.111.44
-96.38.126.30
-96.38.149.44
  96.38.41.34
  96.39.152.89
  96.39.76.211
@@ -117968,64 +98960,46 @@
  96.44.162.82
  96.44.179.242
  96.45.173.216
-96.45.174.247
-96.45.34.9
  96.46.0.208
  96.46.16.216
+96.46.27.45
  96.47.0.66
  96.47.114.108
  96.47.224.42
  96.47.230.215
  96.47.230.238
  96.47.231.58
-96.48.129.99
  96.48.243.148
  96.50.41.57
  96.50.71.94
-96.51.101.23
-96.53.74.110
-96.53.9.26
-96.54.172.77
-96.55.18.58
-96.55.57.139
-96.55.58.16
+96.54.58.1
  96.57.24.186
  96.57.248.252
-96.57.5.210
  96.57.99.138
  96.61.113.203
-96.64.25.41
  96.65.53.141
  96.66.15.147
-96.66.155.147
  96.66.200.209
  96.67.86.201
  96.67.86.202
-96.67.97.105
-96.68.124.117
-96.69.13.140
  96.69.174.252
-96.69.47.229
  96.69.8.235
  96.69.88.83
  96.70.52.227
-96.71.40.62
-96.71.8.46
  96.72.36.135
  96.72.36.136
-96.74.82.9
  96.75.134.85
  96.77.231.29
  96.77.43.233
  96.77.77.53
  96.78.158.107
-96.78.175.41
-96.78.175.45
  96.78.45.206
  96.79.125.33
  96.8.114.178
+96.8.116.100
  96.8.116.110
  96.8.120.113
+96.8.120.61
  96.8.122.163
  96.8.122.172
  96.8.122.178
@@ -118034,21 +99008,14 @@
  96.80.107.217
  96.82.74.129
  96.82.74.134
-96.82.91.33
-96.83.113.250
-96.84.101.250
  96.84.128.196
-96.85.243.77
  96.85.35.233
  96.85.6.65
  96.86.208.249
  96.86.208.250
  96.86.235.11
-96.86.67.234
-96.87.122.123
  96.87.184.101
  96.87.188.193
-96.87.237.210
  96.88.212.146
  96.9.183.85
  96.9.209.210
@@ -118067,18 +99034,13 @@
  96.9.77.71
  96.9.79.20
  96.9.79.233
-96.9.80.101
-96.9.84.245
  96.9.86.70
-96.9.86.77
  96.9.88.139
  96.9.90.58
-96.91.109.121
  96.91.14.37
  96.91.204.122
  96.92.157.164
  96.92.208.34
-96.93.196.89
  96.94.168.154
  96.ip-51-255-193.eu
  960365365.com
@@ -118095,25 +99057,20 @@
  9672197-dot-n-e-w-me-ss-age-po-rt-al.wl.r.appspot.com
  968cpw.com
  968zy.com
-96965.wang
  96b4d58e213077161.temporary.link
  96c8714c-d919-44cf-a1a1-dd300c4b3a06.htmlcomponentservice.com
  96e2cf79e31193f971e8489181b1b4939a832cff.info
  96mxu.weblium.site
-97.103.245.132
  97.104.188.19
  97.105.123.102
  97.105.129.229
-97.105.15.251
-97.105.156.2
  97.107.127.214
  97.107.131.216
-97.107.134.124
  97.107.137.23
  97.107.137.60
  97.107.180.178
  97.108.176.18
-97.115.157.201
+97.114.49.134
  97.119.11.213
  97.120.83.237
  97.122.230.25
@@ -118121,7 +99078,6 @@
  97.123.15.35
  97.123.32.124
  97.123.53.71
-97.125.219.154
  97.127.139.114
  97.127.17.64
  97.127.20.166
@@ -118132,7 +99088,6 @@
  97.64.19.42
  97.64.23.80
  97.64.25.167
-97.64.251.164
  97.64.28.21
  97.64.32.103
  97.64.33.182
@@ -118143,75 +99098,69 @@
  97.66.248.3
  97.66.48.226
  97.66.79.173
-97.68.140.254
+97.68.55.50
  97.69.160.248
  97.73.104.2
  97.74.119.80
  97.74.215.181
  97.74.228.59
-97.74.229.113
  97.74.232.157
-97.74.236.154
  97.74.237.196
  97.74.24.101
  97.74.24.112
+97.74.24.114
+97.74.24.117
+97.74.24.132
  97.74.24.136
-97.74.24.174
+97.74.24.181
  97.74.24.182
  97.74.24.193
  97.74.24.194
+97.74.24.195
  97.74.24.197
  97.74.24.200
  97.74.24.205
+97.74.24.214
  97.74.24.215
-97.74.24.218
+97.74.24.217
  97.74.24.227
+97.74.24.41
  97.74.24.88
-97.74.24.98
  97.74.4.42
-97.75.144.178
  97.76.170.128
-97.78.186.147
  97.78.198.94
  97.79.239.42
  97.81.244.191
-97.82.41.156
  97.82.79.83
-97.83.108.94
  97.83.173.243
-97.83.248.117
  97.83.27.217
  97.84.232.105
  97.84.59.149
  97.85.106.29
+97.85.107.81
  97.85.36.15
+97.85.36.157
  97.86.179.24
  97.87.142.144
  97.88.8.34
  97.90.115.171
  97.90.49.141
  97.93.25.93
-97.93.82.209
  97.95.223.36
-97.96.252.200
  97.99.205.241
  97.99.222.71
-97.99.231.157
  97.99.3.171
  97.ip-144-217-95.net
  970380605.servehalflife.com
  971b0617.ngrok.io
-97263.wang
  97290mobilty093.com
  972916-dot-n-e-w-me-ss-age-po-rt-al.wl.r.appspot.com
  972923681372744665.weebly.com
  97321.wang
  973259.com
-97326.wang
+97332.wang
  97357.wang
  97361.wang
-97372.wang
-97373.wang
  97382.wang
  97391.wang
  97397.wang
@@ -118227,14 +99176,11 @@
  97587.wang
  97597.wang
  975975.afraa.org
-97598.wang
  97619.wang
  97631.wang
  97635.wang
  97663.wang
-97675.wang
  97685.wang
-97689.wang
  976secv4.nyc3.digitaloceanspaces.com
  978671949685378-dot-wetransfer-auth-file-344.appspot.com
  97boss.com
@@ -118248,17 +99194,13 @@
  98.110.234.97
  98.111.229.44
  98.111.246.120
-98.113.143.106
  98.113.162.148
  98.115.144.45
  98.115.159.208
  98.115.21.123
  98.116.105.49
-98.116.107.56
-98.116.218.64
  98.119.219.27
-98.124.38.4
-98.124.41.225
+98.121.184.252
  98.125.104.165
  98.125.110.244
  98.125.156.24
@@ -118294,17 +99236,8 @@
  98.126.215.93
  98.126.215.98
  98.126.31.114
-98.126.7.234
-98.128.159.108
-98.128.159.54
-98.128.181.235
-98.128.198.243
-98.128.211.232
+98.127.47.148
  98.128.212.156
-98.128.219.24
-98.128.240.123
-98.128.240.201
-98.128.250.21
  98.129.77.98
  98.13.75.196
  98.130.2.58
@@ -118322,16 +99255,15 @@
  98.143.148.45
  98.146.212.146
  98.149.65.159
+98.149.7.255
  98.15.140.226
-98.15.9.64
-98.151.19.47
+98.150.68.80
  98.151.250.238
-98.153.109.186
  98.154.3.215
+98.154.87.18
  98.155.238.182
  98.156.108.211
  98.157.226.168
-98.158.43.47
  98.159.110.14
  98.159.110.19
  98.159.110.2
@@ -118344,6 +99276,7 @@
  98.159.110.228
  98.159.110.231
  98.159.110.232
+98.159.110.69
  98.159.89.120
  98.159.99.102
  98.159.99.21
@@ -118361,7 +99294,6 @@
  98.159.99.39
  98.159.99.58
  98.161.246.162
-98.162.25.28
  98.162.25.29
  98.162.25.7
  98.162.96.41
@@ -118370,81 +99302,77 @@
  98.164.197.138
  98.164.197.227
  98.164.199.153
-98.164.31.113
  98.165.125.14
-98.165.196.253
+98.165.128.190
  98.168.253.24
  98.169.195.23
  98.171.21.129
  98.172.191.218
+98.172.232.157
  98.172.31.3
  98.172.69.141
  98.174.204.209
  98.175.197.111
  98.175.252.149
-98.177.190.42
  98.177.194.32
  98.178.240.9
  98.179.182.136
  98.182.212.15
  98.183.37.222
+98.184.33.193
+98.184.33.210
  98.184.33.212
  98.184.33.218
  98.185.94.76
  98.185.94.94
  98.186.166.96
+98.187.23.114
  98.188.180.122
  98.188.47.132
  98.188.47.150
  98.189.109.138
-98.19.16.19
+98.189.186.79
  98.190.102.40
  98.190.102.62
  98.191.119.59
-98.191.6.172
  98.191.71.139
  98.192.202.192
  98.192.74.164
  98.193.226.113
-98.194.236.160
-98.196.104.250
+98.193.25.179
  98.197.37.7
  98.197.62.37
  98.198.28.199
  98.199.196.197
-98.199.252.13
-98.201.192.205
+98.202.12.197
+98.202.144.43
  98.202.232.200
  98.203.162.230
  98.206.254.200
  98.211.219.75
-98.211.33.202
  98.211.69.104
  98.213.183.28
  98.216.19.89
  98.219.121.217
  98.219.172.82
-98.22.26.221
  98.224.62.239
  98.225.157.78
  98.226.179.220
  98.226.186.214
  98.226.204.55
-98.23.122.25
  98.23.125.149
  98.231.32.93
  98.231.33.178
  98.232.203.165
  98.233.39.111
+98.234.185.70
  98.234.207.237
  98.234.95.214
  98.236.166.189
  98.239.128.154
-98.24.30.170
  98.242.225.185
  98.246.66.238
  98.247.106.211
-98.247.50.138
  98.247.52.166
  98.248.116.197
  98.248.173.253
@@ -118452,26 +99380,20 @@
  98.251.9.73
  98.253.193.165
  98.253.34.137
-98.254.104.71
  98.254.192.194
  98.254.59.36
  98.254.86.7
-98.28.92.55
+98.26.226.238
  98.29.195.204
-98.31.40.27
-98.32.243.104
  98.32.83.73
  98.33.214.231
  98.34.104.24
-98.34.138.143
  98.35.16.77
-98.35.87.71
  98.36.148.46
-98.5.123.187
+98.37.181.224
  98.6.168.194
-98.6.205.218
-98.6.245.254
  98.6.30.246
+98.7.197.47
  98.8.246.84
  98.ip-51-91-254.eu
  98.yt69sf.com
@@ -118494,14 +99416,13 @@
  98568.wang
  98579.wang
  98581.wang
-98583.wang
  98586.wang
  98589.wang
-98598.wang
+98596.wang
  985s4f.xyz
+98612.wang
  98623.wang
  986598430511083-dot-r4y-07i-rfg.appspot.com
-98663.wang
  98668.wang
  98685.wang
  98698.wang
@@ -118511,6 +99432,7 @@
  9875172-dot-oaao-274308.uc.r.appspot.com
  9876428683239892.z13.web.core.windows.net
  987654345678.000webhostapp.com
+9876543456886756565656-secondary.z19.web.core.windows.net
  9876567hgh345.weebly.com
  9876678.weebly.com
  987678990.weebly.com
@@ -118524,18 +99446,14 @@
  98fc40c5287be2095d2f2b2452c7a94b1ea06155.info
  98mob-3ref.com
  99.105.236.40
+99.113.165.165
+99.113.188.39
  99.124.216.71
-99.126.19.81
  99.127.234.110
-99.129.133.191
  99.135.180.41
  99.14.51.66
-99.144.117.165
-99.148.135.55
  99.148.197.14
-99.149.243.207
  99.152.32.222
-99.155.232.76
  99.164.139.172
  99.185.76.161
  99.190.215.3
@@ -118565,44 +99483,28 @@
  99.198.118.186
  99.2.136.115
  99.2.23.230
-99.224.3.76
-99.224.44.237
+99.224.2.221
  99.226.23.213
-99.226.251.13
  99.229.254.209
  99.231.145.194
-99.231.79.201
  99.233.30.4
  99.236.76.38
  99.239.41.18
-99.241.203.141
  99.242.65.99
-99.243.162.115
-99.243.168.213
-99.246.165.190
-99.249.231.78
-99.249.39.41
+99.247.57.16
  99.25.248.162
  99.252.108.66
  99.252.27.6
-99.255.162.63
  99.255.184.174
-99.255.244.77
-99.255.62.67
  99.29.112.187
  99.33.195.164
  99.34.232.58
-99.35.124.46
-99.44.78.234
  99.54.134.182
  99.56.114.255
  99.58.163.117
  99.61.83.139
  99.65.75.153
-99.67.57.104
-99.71.113.187
  99.73.215.70
-99.76.133.167
  99.78.113.71
  99.78.113.72
  99.78.120.186
@@ -118612,10 +99514,8 @@
  99.79.9.179
  99.88.47.34
  99.89.34.3
-99.90.34.142
  99.96.118.24
  99.96.122.99
-99.97.218.164
  99.98.219.253
  990244728374797421.weebly.com
  9906.000webhostapp.com
@@ -118722,7 +99622,6 @@
  9kbgftfr82z4.space
  9kiemtra.xyz
  9ldh.cc
-9ldjs.yolasite.com
  9lineofcode.com
  9m.no
  9mx9.xyz
@@ -118763,6 +99662,7 @@ a-americanaemsuacasa.com
  a-americanasemjunho.com
  a-americanaspromocoes.com
  a-ccesonligne.yolasite.com
+a-com-securedportal-dot-owaonk399399393.uk.r.appspot.com
  a-d-b-e.ew.r.appspot.com
  a-docu-sign.link
  a-e2k.addroits.com
@@ -118879,8 +99779,6 @@ a0489475.xsph.ru
  a0490572.xsph.ru
  a0491450.xsph.ru
  a0491671.xsph.ru
-a0495986.xsph.ru
-a0496579.xsph.ru
  a06kz.mentriqq.com
  a098327634868288934.web.app
  a0991d3c6bd14af994610478701f22cf39296297.info
@@ -119003,6 +99901,7 @@ a76214be64b7eb928a4b66831b78347d.com
  a76h.saytanet.com
  a76oaur-e-isso.com
  a770d2767fe4c4466f1d5fa08c190d86-dot-dbenitonline.ey.r.appspot.com
+a78tech.org
  a7b325782a54fda97da7831c4f3748dd7cb2d3aa.info
  a7ce8qqf-18em1mf46.vercel.app
  a7ioui.puit.xyz
@@ -119143,7 +100042,6 @@ aamazon-new-sale.online
  aamazon.live
  aamazoni.buzz
  aamazonn.atoryel.icu
-aamazonnm.xyz
  aamazonu.buzz
  aamazonw.xyz
  aamazoon.myddns.me
@@ -119166,6 +100064,7 @@ aanjoinavj.duckdns.org
  aanlwgbipwloeaggvsgoztqrrv-dot-gleowayel400503.uc.r.appspot.com
  aanmelden-nn.com
  aanniboss.000webhostapp.com
+aannnamanaile.xyz
  aanqylta.com
  aanvraag-formulier.net
  aaoblilgucyykajo-dot-millinium.ey.r.appspot.com
@@ -119189,6 +100088,7 @@ aaprozjzyzbscglw-dot-millinium.ey.r.appspot.com
  aapvdrrynezckkxt-dot-millinium.ey.r.appspot.com
  aaqcqtwdwtphqmgt-dot-millinium.ey.r.appspot.com
  aaqkxovdbxceyscjlalshyzcri-dot-gleowayel400503.uc.r.appspot.com
+aaqtbentlqahbamabghatchtati.blogspot.com
  aaradhyam.me
  aarausa.org
  aarb.top
@@ -119552,7 +100452,6 @@ about-business-facebook.com
  about-copyrightform.tk
  about-copyrightnotice.com
  about-copyrights-verify.ml
-about-copyrightshelpcenter.cf
  about-instagramcopyright.com
  about-instagramverified.ml
  about-lnstagram.net
@@ -119620,7 +100519,6 @@ absantprovedor.com
  absaonlinebanking.mailview2865.xyz
  abscete.info
  abschiedvonmatthiascom.chifanassume.top
-absencetelefone.weebly.com
  absentbabybraid.cyou
  absentknot.co
  absentomar.net
@@ -120101,7 +100999,6 @@ accedi-portale.com
  accedi-subito-app2020.it
  accediapp-mobile-isp.com
  accedissl.naptel.net
-acceesagreiwebsecuree.com
  accelerate.zero1creations.com
  accent-assurances.com
  accent8bay.com
@@ -120232,6 +101129,7 @@ accessonliiine.com
  accessopds2.000webhostapp.com
  accessopostale.com
  accessorya.com
+accessorytwo.org
  accesspower.buzz
  accesspress.rdsarkar.com
  accesspyment-appid.serveirc.com
@@ -120693,7 +101591,6 @@ account.google.com.id-pbr.life
  account.google.com.ios-id.co
  account.google.com.ios-id.live
  account.google.com.suporte-br.cc
-account.helper-update-co-jp.top
  account.imanage.support-center.getstrts.com
  account.imanage.support.3dsactivities.com
  account.justns.ru
@@ -120935,8 +101832,6 @@ accountsafedhfeuwhuiewailfewjdsnmjcdsba.xyz
  accountsafeguidshichjwkqbefjkfnwqf.xyz
  accountsafetyfeedback.com
  accountsaz.xyz
-accountsbill-ee.com
-accountsbilling-ee.com
  accountsbills.com
  accountscheck-ee.com
  accountscheckupdates.com
@@ -121040,6 +101935,7 @@ accountupdate.cycg393.top
  accountupdate.qzhorc.top
  accountupdate.rzioru.top
  accountupdate.tnhxkr.ph
+accountupdate.xwrycf.top
  accountupdate1221.weebly.com
  accountupdate190.weebly.com
  accountupdateeee.weebly.com
@@ -121197,6 +102093,7 @@ acessoriamente.com
  acessoritaiti-com.umbler.net
  acessos.plivbr.com
  acessoscaixacheckin.com
+acessoseguro.itau.com.br.mbarquiteturabrandao.com.br
  acessoseguro.myddns.me
  acessosegurocred.com
  acessotaucard.com
@@ -121410,6 +102307,7 @@ actialuzaciones-zonausegurabnbeta1.com
  actieve-omgeving.icu
  actilav.com
  actiniumramen.com
+action-absaza.cf
  action-payeesecure.com
  action-required-pay-pal.000webhostapp.com
  action001.000webhostapp.com
@@ -121516,6 +102414,7 @@ activeorganizelevel.tk
  activeserviceprovider.com
  activesucuentabg.webcindario.com
  activesusdatos.webcindario.com
+activesusproducto.com
  activesusproductosaqui.com
  activesusuproductosaqui.com
  activethreatconsulting.com
@@ -121844,7 +102743,6 @@ adfull.org
  adg-placement.com
  adgedo.com
  adgmyebggebphfrvky.top
-adgrtreytfdeefspj.xyz
  adguinchos.com.br
  adgy.svcoding.com
  adhbr.svcoding.com
@@ -122041,13 +102939,10 @@ admiral-markets.com
  admiralkirk.de
  admiralmarketsltd.com
  admirelog.com
-admiring-albattani-00a963.netlify.app
  admiring-curran-5ae35f.netlify.app
  admiring-goldstine-f942bc.netlify.app
  admiring-mcclintock-863f18.netlify.com
  admiring-stonebraker-197734.netlify.app
-admiring-swartz-59b41c.netlify.app
-admiring-volhard-23ac2e.netlify.app
  admission.tuf.edu.pk
  admission.undip.org
  admissions.ekyaschools.com
@@ -122085,7 +102980,6 @@ adobe--pdf.000webhostapp.com
  adobe-docs.000webhostapp.com
  adobe-document.cf
  adobe-flash-player.pro
-adobe-maxhealth-auths.tk
  adobe-net.000webhostapp.com
  adobe-pdf-ingredion.live
  adobe-pdf-ingredion.net
@@ -122141,7 +103035,6 @@ adoring-payne-239d48.netlify.app
  adoring-shirley-d7bbb2.netlify.app
  adoring-thompson-05755a.netlify.app
  adoring-thompson-05755a.netlify.com
-adoring-wiles-0b46c2.netlify.app
  adoring-wright-9e5daf.netlify.app
  adoring-yalow-fd2ea6.netlify.app
  adorned-judge.000webhostapp.com
@@ -122706,11 +103599,9 @@ afeestgk276j-buxod-com.eoldal.hu
  afertille.cloudaccess.host
  afet.ml
  affableguru.com
-affairglobal.cloud
  affaldsbeholderskraldecontainercom.shaxiaca.top
  affancollections.com
  affectionate-northcutt-f7f341.netlify.com
-affectionate-visvesvaraya-34894c.netlify.app
  affettuoso-diameter.000webhostapp.com
  afficu.com
  affiliatecracks.com
@@ -122867,6 +103758,7 @@ afunnything.ddns.net
  afvectorsecurity.com.mencobabertahan.com
  afvsgxgdfvvyheruhgujeipkkgbjnfhbcfvagtevdgsvc.000webhostapp.com
  afweb.ru
+afwfcsgssvscsc.us
  afwffuhmxebbrzug-dot-millinium.ey.r.appspot.com
  afwkglmuq.biogenicherb.com
  afxn1.weblium.site
@@ -122906,7 +103798,6 @@ agbmjqadhpvqxpwc-dot-millinium.ey.r.appspot.com
  agbo-chinaonline.com
  agbofx.goruli.com
  agboolafarms.com
-agbxnxuyukdajufc-dot-owaonk399399393.uk.r.appspot.com
  agcpgdtovqjkipkjqglbhcswgnwlyvwnhrrv-dot-cryptic-now-290917.ey.r.appspot.com
  ageawidduhkmoheg-dot-millinium.ey.r.appspot.com
  agec.svcoding.com
@@ -123098,10 +103989,8 @@ agirlsvideos2.xyz
  agirlsvideos6.xyz
  agirlsvideos7.xyz
  agirlsvideos8.xyz
-agitated-banach-76b326.netlify.app
  agitated-kowalevski-210546.netlify.app
  agitated-panini-ed4eeb.netlify.app
-agitated-pike-459f9f.netlify.app
  agitiste.com
  agiye.com
  agkewqorzxmcbvznfqiroeid-97550011473jp.com.zxzlhtj.cn
@@ -123162,6 +104051,7 @@ agreementprovidemail.weebly.com
  agreements-info.com
  agreementsecure.info
  agregatudomaiss.com
+agreiwebservice.com
  agressor.beget.tech
  agreview.net
  agri-allied.co.uk
@@ -124052,14 +104942,12 @@ akzy.top
  al-azharhi.sch.id
  al-enjaz.com
  al-hadin.com
-al-halilgroups.com
  al-kawthar.top
  al-lameenwcc.com.my
  al-mas-hotel.com
  al-masi.com
  al-muniir.com
  al-nidaa.com.my
-al-pi.ru
  al-rehaili.net
  al-samer.net
  al-sharqgroup.com
@@ -124185,7 +105073,6 @@ albahriconsult.com
  albajifood.com
  albalove.al
  albamnca.com
-albanations.express
  albandaryrealestate.net
  albanianewss.info
  albaraa-eg.com
@@ -124316,13 +105203,16 @@ alert-accountservice.kozow.com
  alert-activate-wf.com
  alert-amazoncenter.serveirc.com
  alert-amzn.serveirc.com
+alert-cancellation-payee.com
  alert-center-wells.com
  alert-confrim00.gq
+alert-customer-payment.com
  alert-deregister.com
  alert-deregistered-device.com
  alert-deregistered-uk.com
  alert-deregistereddevice.com
  alert-device-added.cc
+alert-device-cancellation.com
  alert-device-uk.com
  alert-device.cc
  alert-devicepayee.com
@@ -124335,7 +105225,6 @@ alert-newdevice-attempt.link
  alert-newpayee.com
  alert-newpayeenotice.com
  alert-online-protection.cc
-alert-onlinesecure.com
  alert-payee-detected.cc
  alert-payee-device.com
  alert-payeesecurity.com
@@ -125284,7 +106173,6 @@ altotune.uk
  altqualidade.com
  altrainc.in
  altriga.com
-altruck.co.nz
  altsouth.org
  altuntuval.com
  alturasouthend.com
@@ -125364,6 +106252,7 @@ am2r.addroits.com
  am4z0n-ac0untupdt3.ddns.net
  am6qh.svcoding.com
  am86m.com
+ama-get.xyz
  ama-z0onvehlyfiy.serveirc.com
  ama-zon.huananshangcheng.com
  ama-zon.pswpxk.icu
@@ -125458,7 +106347,7 @@ amamzouu.buzz
  aman-enterprises.co.in
  amanahaccountants.co.uk
  amanaround-thehouse.com
-amanccount.da2bb84-92b5-47f4-a389-b706f8bfff.cyou
+amanccount.3jgaueunu2psafce5vgasvpkron759h.me
  amanda-johnson.com
  amanda43goffin.000webhostapp.com
  amanda5246437.xyz
@@ -125537,9 +106426,7 @@ amatiblog.it
  amatiran.online
  amatnage.gq
  amatormusic.com
-amautokey.com
  amavihotel.com
-amavon.top
  amaxillo.com
  amaxon.cc
  amaxownxms.com
@@ -125610,6 +106497,7 @@ amazdjfqslrcdubqgeidklqgdv-dot-gleowayel400503.uc.r.appspot.com
  amazeamazon.ddns.net
  amazedbygrace.ddns.net
  amazedelectrical.com.au
+amazen-service-center-jp.xyz
  amazenaws.com
  amazeod.webstarterz.com
  amazeodn.webstarterz.com
@@ -125620,11 +106508,9 @@ amazextrabalt.com
  amazing-bardeen-fb1e7f.netlify.app
  amazing-brown-b1a97c.netlify.app
  amazing-colden-4c8872.netlify.app
-amazing-joliot-dcf0cf.netlify.app
-amazing-leakey-2434e6.netlify.app
+amazing-johnson-c44571.netlify.app
  amazing-spence-7a27fa.netlify.app
  amazing-swartz-d31e02.netlify.app
-amazing-wing-ae1491.netlify.app
  amazing.abc-australia.club
  amazingbdshop.com
  amazingdonutco.com
@@ -125635,7 +106521,6 @@ amazingnutrients.com.ar
  amazingsales.in
  amazinverify.com
  amaziuponm.com
-amazjapac.top
  amazloms.com
  amazmaonms.temp.swtest.ru
  amazmnan.buzz
@@ -125687,6 +106572,7 @@ amazo.dnyzjy.com
  amazo.fun
  amazo.zbbcct.com
  amazoccount.3hmvwxdcr1cu8sszev8oce.monster
+amazocn-account-update-co-jp.icu
  amazocontrol.com
  amazoen-account.com
  amazoen-login.com
@@ -125704,7 +106590,6 @@ amazom-account.rzaazudedrjzm.xyz
  amazom-co.space
  amazom-mail.xyz
  amazom-on.buzz
-amazoma.cc
  amazomm-testjingzi3r-jp.pw
  amazomnn.xyz
  amazoms.monster
@@ -125785,6 +106670,7 @@ amazon-check-co-jp.p9i.xyz
  amazon-check-co-jp.r1k.top
  amazon-check-co-jp.r1u.top
  amazon-check-co-jp.rz1.top
+amazon-check-co-jp.u1g.top
  amazon-check-co-jp.u1i.top
  amazon-check-co-jp.w1l.top
  amazon-check-co-jp.w1r.top
@@ -125912,7 +106798,6 @@ amazon-j.top
  amazon-japan.cc
  amazon-japane.com
  amazon-jkfualirjwe.xyz
-amazon-jo.live
  amazon-jojp.shop
  amazon-jp.art
  amazon-jp.cn
@@ -126108,7 +106993,6 @@ amazon-verifyappid.serveirc.com
  amazon-verifyapps.servepics.com
  amazon-verifycardissuer-service.datarecover-panel.ooguy.com
  amazon-viewaccount.serveirc.com
-amazon-vip-servicecenter-jp.buzz
  amazon-w.top
  amazon-webauthmanageserviceupdatepolicyterms-a1.kozow.com
  amazon-webs-int-account-services.theworkpc.com
@@ -126456,7 +107340,6 @@ amazon.co.jp.ferymg6ghf1fn.com
  amazon.co.jp.fidsi21oapdasd2.mvpturfcare.com
  amazon.co.jp.fs33re-e3wfv4w-2eqvw8.party
  amazon.co.jp.fsdghdfsa.xyz
-amazon.co.jp.g8ejxi4xhwqtoday.xyz
  amazon.co.jp.gb.login.sighyouraccount.co
  amazon.co.jp.gb.signin.id-23099456664.infoupdate.click
  amazon.co.jp.gb.signin.id-9388412.confirminfo.net
@@ -127216,7 +108099,6 @@ amazonxxw.buzz
  amazonysp.xyz
  amazonyzm.xyz
  amazonz.cc
-amazonzn.co
  amazonzne.xyz
  amazonzon.top
  amazonzooa.xyz
@@ -127293,6 +108175,7 @@ ambiseg.servsites.com.br
  ambitionconcepts.com
  ambitiousopponent.co.za
  ambivalent-legends.000webhostapp.com
+ambiyah-grup.ddns.net
  ambra.org.au
  ambrasil.net
  ambronn.net
@@ -127823,9 +108706,6 @@ amozon.co.jp-fca0ca029f9f6e6ee4da108babb11847ded43710.ph
  amozon.co.jp.aeabkm9567.icu
  amozon.co.jp.aghcy5455.icu
  amozon.co.jp.signine-amnzocn.in
-amozon.co.jp.siing-amoaeon.cc
-amozon.co.jp.sing--amoazeon.ccwww.amozon.co.jp.sing-amoazeon.cc
-amozon.co.jp.sing-amoaozon.cc
  amozon.co.jp.sinng-amuano.in
  amozon.co.jp.sinung-aoumeon.cc
  amozon.co.jp.siung-amuzanou.cc
@@ -127912,8 +108792,6 @@ amulet11.ru
  amumufree.weebly.com
  amurehotel.mn
  amusedpersonals.com
-amuseget.cloud
-amusego.cloud
  amushknm.beget.tech
  amuyetrse.com
  amv.org.mx
@@ -127928,6 +108806,7 @@ amwezcon-verservii.xyz
  amwiouiollkcamar-dot-millinium.ey.r.appspot.com
  amwltd.com
  amwstg.efserver.net
+amx-jp.website
  amx-jp.xyz
  amxricxnasrepro.com
  amxsupporrt.com
@@ -128141,6 +109020,8 @@ anazom-cardae.com
  anazom-cardas.com
  anazom-web.rghhjkvbfdgiokjlbvnqretyutvbj.xyz
  anazom.67calderroad.com
+anazom.nongtianyuan.top
+anazom.tastenet.top
  anazom.website
  anazom.weightlosshotel.com
  anazomn.top
@@ -128371,11 +109252,9 @@ anglophobiac-perfec.000webhostapp.com
  angolancordial.com
  angriestsemidomed.info
  angry-banach-851887.netlify.app
-angry-bassi-e84c8b.netlify.app
-angry-blackwell-58a110.netlify.app
  angry-davinci-c45b1d.netlify.app
-angry-kowalevski-f5c154.netlify.app
  angry-shockley-8e072b.netlify.app
+angry-turing-961641.netlify.app
  angryvlad.xyz
  angrywantag.figueroaads123.repl.co
  angsanaspa.com
@@ -128529,7 +109408,6 @@ anli158.com
  anmahcollege.com
  anmao.panor.fr
  anmazcconon.xyz
-anmazoonweb.xyz
  anmcarhsi.goruli.com
  anmeldung.dmd.dance
  anmm.godaddysites.com
@@ -128562,7 +109440,7 @@ annazom.buzz
  annazom.space
  annazon-chikes-co-jp.in-actiche.top
  annazon-loginto.jp.busoi.buzz
-annazon-vpsssupportinto.co.jp.buwei.buzz
+annazon-logintocp.jp.poqlab.top
  annazon.club
  annazon.co.jp.praxgkm.cn
  annazon.co.uk
@@ -128657,6 +109535,7 @@ anounces.continuingtasks.com
  anounymouspai.ddns.net
  anovaskin.com.np
  anovrhhtapixxbgh-dot-millinium.ey.r.appspot.com
+anozoam.anozommia.icu
  anphogppjkgvipyh-dot-millinium.ey.r.appspot.com
  anprax.com
  anpud5f5xe6x.com
@@ -128698,7 +109577,6 @@ antarasecuriteprivee.com
  antarcticaemployed.com
  antaresns.com
  antaresofficial1.com
-antdfr.work
  antebhotscoy.malingpaypalid.com
  antec.it
  antecedents.org
@@ -129244,6 +110122,7 @@ apkliteltaucheckin.com
  apkltauconsultadigital.com
  apkmail0.com
  apkmamu.com
+apkmodz.com
  apkonez.tk
  apkplayonline.com
  apkpure.ai
@@ -131248,6 +112127,7 @@ applnch-014626637.sangekasra.ir
  applnch-015390800.sangekasra.ir
  applnch-015632076.sangekasra.ir
  applnch-015633285.sangekasra.ir
+applnch-015993877.sangekasra.ir
  applnch-017233143.sangekasra.ir
  applnch-022707629.sangekasra.ir
  applnch-024774318.sangekasra.ir
@@ -131256,6 +112136,7 @@ applnch-029167598.sangekasra.ir
  applnch-044260227.sangekasra.ir
  applnch-054351732.sangekasra.ir
  applnch-063662959.sangekasra.ir
+applnch-066768580.sangekasra.ir
  applnch-072227407.sangekasra.ir
  applnch-079577450.sangekasra.ir
  applnch-102999286.sangekasra.ir
@@ -131273,9 +112154,11 @@ applnch-142014671.sangekasra.ir
  applnch-143183260.sangekasra.ir
  applnch-145959631.sangekasra.ir
  applnch-147517777.sangekasra.ir
+applnch-149343199.sangekasra.ir
  applnch-157464449.sangekasra.ir
  applnch-163619084.sangekasra.ir
  applnch-164061821.sangekasra.ir
+applnch-164371296.sangekasra.ir
  applnch-167051991.sangekasra.ir
  applnch-170022010.sangekasra.ir
  applnch-178716168.sangekasra.ir
@@ -131300,14 +112183,13 @@ applnch-287696202.sangekasra.ir
  applnch-290805621.sangekasra.ir
  applnch-291899259.sangekasra.ir
  applnch-298942986.sangekasra.ir
-applnch-305180638.sangekasra.ir
  applnch-319990881.sangekasra.ir
  applnch-341384175.sangekasra.ir
+applnch-347084199.sangekasra.ir
  applnch-355101276.sangekasra.ir
  applnch-356451805.sangekasra.ir
  applnch-364855650.sangekasra.ir
  applnch-371757095.sangekasra.ir
-applnch-378571724.sangekasra.ir
  applnch-379400165.sangekasra.ir
  applnch-392171825.sangekasra.ir
  applnch-394077665.sangekasra.ir
@@ -131325,6 +112207,7 @@ applnch-445591060.sangekasra.ir
  applnch-445900928.sangekasra.ir
  applnch-453508383.sangekasra.ir
  applnch-462199144.sangekasra.ir
+applnch-469638615.sangekasra.ir
  applnch-471561169.sangekasra.ir
  applnch-477716809.sangekasra.ir
  applnch-482026220.sangekasra.ir
@@ -131333,8 +112216,10 @@ applnch-494645366.sangekasra.ir
  applnch-504151202.sangekasra.ir
  applnch-505488818.sangekasra.ir
  applnch-507389595.sangekasra.ir
+applnch-515911797.sangekasra.ir
  applnch-516759597.sangekasra.ir
  applnch-526755286.sangekasra.ir
+applnch-527237471.sangekasra.ir
  applnch-529063964.sangekasra.ir
  applnch-531704674.sangekasra.ir
  applnch-535196668.sangekasra.ir
@@ -131352,6 +112237,7 @@ applnch-581006838.sangekasra.ir
  applnch-581957672.sangekasra.ir
  applnch-589694389.sangekasra.ir
  applnch-599563048.sangekasra.ir
+applnch-600516172.sangekasra.ir
  applnch-600740509.sangekasra.ir
  applnch-603981102.sangekasra.ir
  applnch-606644132.sangekasra.ir
@@ -131373,9 +112259,11 @@ applnch-687517185.sangekasra.ir
  applnch-693790946.sangekasra.ir
  applnch-697962384.sangekasra.ir
  applnch-698934376.sangekasra.ir
+applnch-703675682.sangekasra.ir
  applnch-718929681.sangekasra.ir
  applnch-720581847.sangekasra.ir
  applnch-726213025.sangekasra.ir
+applnch-726890162.sangekasra.ir
  applnch-733908744.sangekasra.ir
  applnch-735504802.sangekasra.ir
  applnch-736527649.sangekasra.ir
@@ -131387,11 +112275,13 @@ applnch-770772140.sangekasra.ir
  applnch-773323942.sangekasra.ir
  applnch-777055489.sangekasra.ir
  applnch-778272568.sangekasra.ir
+applnch-785533721.sangekasra.ir
  applnch-790700818.sangekasra.ir
  applnch-792817815.sangekasra.ir
  applnch-793511062.sangekasra.ir
  applnch-809562049.sangekasra.ir
  applnch-814838902.sangekasra.ir
+applnch-833373087.sangekasra.ir
  applnch-849046471.sangekasra.ir
  applnch-855212479.sangekasra.ir
  applnch-860723456.sangekasra.ir
@@ -131401,6 +112291,7 @@ applnch-876795213.sangekasra.ir
  applnch-894102924.sangekasra.ir
  applnch-900073994.sangekasra.ir
  applnch-900392897.sangekasra.ir
+applnch-904452844.sangekasra.ir
  applnch-906590999.sangekasra.ir
  applnch-911788560.sangekasra.ir
  applnch-916493500.sangekasra.ir
@@ -131783,7 +112674,6 @@ apscontact.000webhostapp.com
  apsdisable-account3.ddns.net
  apservicemailcenter.serveirc.com
  apsign-chase.servepics.com
-apsigning-amzon.in
  apsitprogrammer.000webhostapp.com
  apskids.in
  apslimited-prority.com
@@ -132349,7 +113239,6 @@ armatura-protecciones.com
  armazon.webstarterz.com
  armazones.com
  armazonetm.temp.swtest.ru
-armbelly.cloud
  armbuddy.co.za
  armchaisrmarch.com
  armengara.ml
@@ -132436,6 +113325,7 @@ array-bite843.ml
  arrayinfotec.com
  arrearirundalumcareer.in
  arredamentogiapponesecom.augerqisafety.top
+arrestme.cyou
  arriederal.info
  arrienting.info
  arriveedesign.com
@@ -132909,7 +113799,6 @@ asdutrafbtr.xyz
  asdwb.xyz
  asdwf.xyz
  asdwx.duckdns.org
-asdyuio.cam
  asean-india.org
  aseanlegaltech.com
  aseavjkzpxvzrtza-dot-millinium.ey.r.appspot.com
@@ -133278,7 +114167,6 @@ assinejanetfix.com
  assipducjdiyddey-dot-millinium.ey.r.appspot.com
  assist-amazon.servecounterstrike.com
  assist-att.net
-assist-payee.link
  assist-paypal.com
  assist-protect.tk
  assist-secure.banyak-rezeky.xyz
@@ -133710,6 +114598,7 @@ ativar-app.tk
  ativarempresa.com
  ativarmeuacess0.me
  ative.nl
+atividadegerenciada.email
  atjhqmqqxopafgejjazgfangzs-dot-gleowayel400503.uc.r.appspot.com
  atjrmerotir.com
  atjtourjogja.com
@@ -133753,8 +114642,6 @@ atlogiiinssss.weebly.com
  atlp106t511tr5typy.godaddysites.com
  atltdf.net
  atm2003web.000webhostapp.com
-atmaillgo.weebly.com
-atmailnioww.weebly.com
  atme.cl
  atmen.top
  atmisgrdmnjlvxdx-dot-millinium.ey.r.appspot.com
@@ -133955,7 +114842,6 @@ att666736788.weebly.com
  att6thtghhhhhtyptyp.godaddysites.com
  att7.godaddysites.com
  att7634gf.weebly.com
-att7637.weebly.com
  att763yh.weebly.com
  att9tp5rfp06tyl.godaddysites.com
  attaccessonline.weebly.com
@@ -134624,7 +115510,6 @@ attupdatemaiil.weebly.com
  attupdatemiail.weebly.com
  attupdatepo.weebly.com
  attupdaternet.weebly.com
-attupdates09.weebly.com
  attupdatesecurity.com
  attupdateserc.weebly.com
  attupdatesreminder.weebly.com
@@ -134762,6 +115647,7 @@ atu107.com
  atu616.ca
  atu946.ca
  atual.netlify.app
+atualacessoria.email
  atualiz142.sslblindado.com
  atualiza-caixa.com
  atualiza-cef.com
@@ -135290,6 +116176,7 @@ authenticate-lloydsbank.com
  authenticate-login-advanced-security.com
  authenticate-login-pp-details.com
  authenticate-new-payee.com
+authenticate-nwest.com
  authenticate-online.com
  authenticate-onlinepayee.com
  authenticate-onlinepayment.com
@@ -135344,7 +116231,6 @@ authonlineaccount.network
  authorcheck.com
  authorisable-closur.000webhostapp.com
  authorisation-newdevice.com
-authorisation-security.com
  authorisation-support.com
  authorisationsecured.com
  authorise-accounts.com
@@ -135353,7 +116239,6 @@ authorise-cancellation.cc
  authorise-device.co.uk
  authorise-mobilebanking.com
  authorise-mynewdevice.com
-authorise-mynewpayee.com
  authorise-newdevice-login.com
  authorise-newdevice-online.com
  authorise-newpayee-llyds.com
@@ -135646,6 +116531,7 @@ autsvcgowbqcczmrbnjk.top
  autt-vll.cf
  auttopro05.com
  auttopro34.com
+auttopro74.com
  auttopro8.com
  auttopro93.com
  auttopro94.com
@@ -135891,6 +116777,7 @@ avsecure.avsecure.cf
  avsesovs.000webhostapp.com
  avsiii.gr
  avsproduction.am
+avsvmcloud.com
  avszeso.000webhostapp.com
  avszpes.000webhostapp.com
  avtaha.org.il
@@ -135903,6 +116790,7 @@ avtonomnoe-otoplenie.dp.ua
  avtopodbor-barnaul.ru
  avtopodbor-vsk.ru
  avtorizachiy.000webhostapp.com
+avtoshkola-serpukhov.ru
  avtotest-taxi.ru
  avtovokzaly.kz
  avtxoyehyefhkkau-dot-millinium.ey.r.appspot.com
@@ -135971,8 +116859,7 @@ awesdrt.com
  awese.xyz
  aweseoic.com
  aweseoik.com
-awesome-brattain-bd734a.netlify.app
-awesome-brown-533d56.netlify.app
+awesome-bohr-733975.netlify.app
  awesome-curran-91d1ca.netlify.app
  awesome-lovelace-d0f31e.netlify.app
  awesome-wilson-8b0eac.netlify.app
@@ -136429,6 +117316,7 @@ azfilmizle1.azermedia.az
  azg.goruli.com
  azgwhozb.ug
  azhand-gostar.ir
+azharseo.website
  azharsultan.com
  azhq.svcoding.com
  azhub.us
@@ -136592,6 +117480,7 @@ b-access.com
  b-akt.addroits.com
  b-cube.shop
  b-faceit.fun
+b-general-zona.webcindario.com
  b-jkh.svcoding.com
  b-litjens.nl
  b-lop.com
@@ -137026,7 +117915,6 @@ bagnd.com
  bagolyvill.sxoon.com
  bagp.jaysbrand.com
  bagraphics.net
-bagsurvcal.casa
  bagtcp.com
  baguiogiftpack.000webhostapp.com
  baguiogiftpacks.000webhostapp.com
@@ -137046,7 +117934,6 @@ bahateb.com
  bahcelievler-rotary.org
  bahchama.com
  bahenremsliqemig-dot-millinium.ey.r.appspot.com
-bahfahfabc-arnaizon-co-jp.buzz
  bahhhhas.com
  bahia-loja.com
  bahia-ofertas.com
@@ -137139,7 +118026,6 @@ bakhtalruda.net
  bakhtar.hu
  bakicaudormeal.com
  bakinbakalim.com
-baking-intesa.com
  baking-siena.com
  bakita.life
  bakker.be
@@ -137171,7 +118057,6 @@ balancingorder.com
  balancingpigeon.com
  balancingrelax.com
  balancingsierra.com
-balancsesugarchristmans.us
  balangandaonline.com
  balaphonics.com
  balatoniborhetek.hu
@@ -137184,7 +118069,6 @@ balcon.in.ua
  balconservice.ru
  baldhairstyle.com
  baldorclip.icu
-baldprint.cloud
  baldwincity.buzz
  baleful-bunks.000webhostapp.com
  balehosts.com
@@ -137322,7 +118206,6 @@ banca-mps-ita.com
  banca-mps-ltalia.com
  banca-pichincha.webcindario.com
  banca-santanderonline.es
-banca-virtual-colpatrea-com.ibx.lat
  banca-webpichnch.webcindario.com
  bancabancolombia.webcindario.com
  bancabip.ddns.net
@@ -137734,6 +118617,7 @@ bankieren.triodos.nl.07nizzh405.cf
  banking-account.work
  banking-alerts-halifax.com
  banking-auth-payee.com
+banking-disable.com
  banking-lloyd.net
  banking-online-secure-info.com
  banking-payee-auth.com
@@ -137792,7 +118676,6 @@ bankofamerica.accountlimited-identityconfirmation.com
  bankofamerica.bofa-april.xyz
  bankofamerica.certgator.net
  bankofamerica.com-app-signin.top
-bankofamerica.com-online-banking-sign-in.netsecurelogin.com
  bankofamerica.com-online-login.top
  bankofamerica.com-online-signin.top
  bankofamerica.com.coinmintoption.com
@@ -138009,7 +118892,6 @@ barca.md
  barcaacademyistanbul.com
  barcases.com
  barcelona-court-5624.pancakeapps.com
-barcelonaceramicas.com
  barcelonaoctober.xyz
  barcgaranti.com
  barched8.beget.tech
@@ -138167,6 +119049,7 @@ basgte.xyz
  basgxabjgstdwwhl-dot-millinium.ey.r.appspot.com
  bash.givemexyz.in
  bash.givemexyz.xyz
+basharikasm.com
  basheijns.nl
  bashheal.com
  bashirahindonesia.com
@@ -139139,6 +120022,7 @@ bebetter.si
  bebews.000webhostapp.com
  bebitcoin.ru
  bebjirgdiuzwrail-dot-millinium.ey.r.appspot.com
+bebrave.earth
  beburkart.ch
  beca.goruli.com
  becakgalonkencang13.guhweoro.com
@@ -139272,6 +120156,7 @@ beheer-29-06.info
  beheer-29.info
  beheer-achterstand.info
  beheer-factuur.info
+beheernet.xyz
  beheshtsoft.com
  behfarmer.com
  behighrewind.com
@@ -140337,7 +121222,6 @@ bgdclvvernrnsqgn-dot-millinium.ey.r.appspot.com
  bgdirectory.net
  bgeneraal.webcindario.com
  bgeneral-403.cba.pl
-bgeneral-activar.webcindario.com
  bgeneral-enlinea.webcindario.com
  bgeneral-sesion.webcindario.com
  bgeneral-sesion2.webcindario.com
@@ -140358,9 +121242,9 @@ bghcrqiinvvv.com
  bghqyf1.com
  bghrw.xyz
  bghrzozmeypsqgbr-dot-millinium.ey.r.appspot.com
+bghvqlmxwerajsez-dot-motast.nw.r.appspot.com
  bgibagiakunfreefire.000webhostapp.com
  bgidnsd.com
-bgifudcdywahbdtn-dot-owaonk399399393.uk.r.appspot.com
  bgirlsvideos.xyz
  bgirlsvideos1.xyz
  bgiyabajeetsfdkh-dot-millinium.ey.r.appspot.com
@@ -140638,6 +121522,7 @@ bigdiamondeals.com
  bigdrives.cf
  bigdrop-server.eu
  bigequalunit.kikisabreu.repl.co
+bigevilbooleanlogic--five-nine.repl.co
  bigf-group.com
  bigfantv.net
  bigfashionday.com
@@ -140805,6 +121690,7 @@ billing-information-update.com.supersindicoprofissional.com
  billing-information.co.uk
  billing-infosupport.com
  billing-interactransfer.com
+billing-my3alerts.com
  billing-myaccount.com
  billing-myee.com
  billing-myeesupport.com
@@ -140850,7 +121736,6 @@ billing.o2-secure.com
  billing.paypal-activity.net
  billing.premiumnetflixcancelmembership.com
  billing.secure-verify-account.cc
-billing.techghor.com
  billing.threeuk.info
  billing.up-three.co.uk
  billing.verify-my-3.com
@@ -141037,6 +121922,7 @@ biocoaching.fr
  biocodax.com
  biodegradableliving.com
  biodieseldelplata.com
+biodiversitysrilanka.org
  bioenecco.com
  biofersrl.com.ru
  biogaurd.in
@@ -141090,7 +121976,6 @@ bipvy.com
  biquan365.com
  biquyetcongai.com
  biquyettansoi.com
-bir365.com
  birajman.com
  birance.live
  birch-jar.000webhostapp.com
@@ -141304,7 +122189,6 @@ bizbiz.tech
  bizbizeturkiyenim.com
  bizcalifornia.com
  bizcloudz.net
-bizdataoffers.com
  bizertanet.tn
  bizhaznik.com
  bizhaznik.net
@@ -141720,7 +122604,6 @@ bliplets.com
  blipsdpxpxfwecdijaeohnnbpu-dot-gleowayel400503.uc.r.appspot.com
  blisonsa.com
  bliss-system20.com
-blissful-shaw-d5bb40.netlify.app
  blissful-starts.000webhostapp.com
  blissful-swartz-8b4cd4.netlify.app
  blissfulworldinsuredhome.com
@@ -141965,7 +122848,6 @@ blooddonationforms.000webhostapp.com
  bloodillsug.work
  bloodink.com
  bloodpressoretuo.us
-bloodpressureen911.us
  bloodredkjhksjd.us
  bloodthirsty-grease.000webhostapp.com
  bloodveinscruffy.com
@@ -142448,7 +123330,6 @@ boasecure.site
  boasecurity.arixbd.com
  boasteel.us
  boasthk.com
-boatbeam.cloud
  boatcluboflakelanier.com
  boatentolhab.xyz
  boaterprofile.com
@@ -142741,7 +123622,6 @@ bokepgadis.zyns.com
  bokepgroup18.whatsapp-k.com
  bokepgrup.hot1.shop
  bokepgrup2020terbaru.000webhostapp.com
-bokepgrupwhatsappjoin.wikaba.com
  bokephdvs.camdvr.org
  bokephot1812.000webhostapp.com
  bokephot18new.viralls98.ga
@@ -142752,6 +123632,7 @@ bokephotwhatsappgrup2020.fiwvw.ml
  bokepind18.000webhostapp.com
  bokepinddo.gq
  bokepindo-grupgadis-vcs-gratis-cewekindonesia.000webhostapp.com
+bokepindo-khusus18sv.duckdns.org
  bokepindo.h6d.shop
  bokepindo.jav2.org
  bokepindo.my03.com
@@ -143013,6 +123894,7 @@ booking-online.rv20.net
  booking.od.ua
  bookingfestas.com
  bookingfutsalsalary.com
+bookingg.photos
  bookinghotworld.ws
  bookitbaby.net
  booklegaluk.com
@@ -143106,6 +123988,7 @@ bores.xyz
  borgernewsherald.com
  borgierun.com
  boring-bose-301401.netlify.app
+boring-brattain-92c901.netlify.app
  boring-davinci-0516c7.netlify.app
  boring-hugle-a7b937.netlify.app
  boring-leavitt-bc3f65.netlify.app
@@ -143176,6 +124059,7 @@ bosspattaya.com
  bosstodaka.com
  bossuinem.com
  bosswords.co
+bosta-swiss-chs.blogspot.com
  bostaneagrobio.tn
  bostelbekersv.com
  bostjyqthfwtdfxijntofywodaldmhnmrmvs-dot-gl494903049.wl.r.appspot.com
@@ -143446,14 +124330,11 @@ bpokepnewkorea9.zpetto.com
  bpoled.com
  bpolevolutionprepagata.com
  bpolprepagata5333.com
-bpolprepagataevolution.com
  bpolsbloccare.com
  bpolsbloccare5333.com
  bpolsicurezzaweb.com
-bpost-be.icu
  bpost-diensten.site
  bpost-pakketservice.su
-bpost-pakkettendienst.icu
  bpostverify.com
  bpoxnet.com
  bppnbhigvgdteocx-dot-millinium.ey.r.appspot.com
@@ -143834,11 +124715,13 @@ brassy-bolder-nectarine.glitch.me
  bratecbrt.com
  bratserahotel.com
  bravatindia.com
+brave-boyd-ae628f.netlify.app
  brave-golick-080358.netlify.app
  brave-haibt-a1f1ea.netlify.app
  brave-lalande-027fa7.netlify.app
  brave-poincare-c1bcee.netlify.app
  brave-shares.ml
+brave-snyder-7f6c07.netlify.app
  brave-software.info
  brave-wing-e40215.netlify.app
  braveheartsriding.org
@@ -144299,7 +125182,6 @@ brucenickerson-art.com
  brucewaketrust.co.uk
  bruche-mossig-piemont.fr
  bructureast.info
-brudergilde.de
  brueckecom.shaxiaact.top
  brufthu.com
  brugesballooningcom.baerseventhere.top
@@ -144727,6 +125609,7 @@ buffenough.com
  bufferingtin.ml
  buffitup.com.au
  bufordisleapt.buzz
+bug-codasshop.ygto.com
  bug-event-freefire12.ml
  bug-event01.cf
  bug.codashop.claim018.my.id
@@ -144807,7 +125690,6 @@ buivanhuy.com
  bujunairmar.com
  buka-appleid-h3127.omong-kosong.com
  buka-pemblokiran20.ml
-buka.eu-gb.cf.appdomain.cloud
  bukaglobally.site
  bukatrip.id
  bukavuexplorer.com
@@ -144929,7 +125811,6 @@ burgesshillconstitutionalclub.org
  burgundy.netdns.net
  burgundyred.org
  burhanmubin.com
-burialagree.cloud
  burked-governments.000webhostapp.com
  burkegeneratorservices.com
  burkert-ideenreich.de
@@ -145231,6 +126112,7 @@ buyukeczane.org
  buyukkarapinar.com
  buyung-puyuh.telkomberbagi.com
  buyuniqueitem.in
+buywatch.casa
  buywfdbrfsbfbfeb.com
  buyzinga.co.uk
  buz-zcredits.com
@@ -145318,6 +126200,7 @@ bw0ds.mentriqq.com
  bwaez.xyz
  bwbnhhjtoawzshsktaktfcndok-dot-gleowayel400503.uc.r.appspot.com
  bwbskmpvlsmbeovw-dot-millinium.ey.r.appspot.com
+bwdhhzlhyvvoqipu-dot-mandax.oa.r.appspot.com
  bwe8.byethost12.com
  bweam.app.link
  bweaqvmxakxugfcq-dot-millinium.ey.r.appspot.com
@@ -145337,7 +126220,6 @@ bwlaphjdpiourqns-dot-millinium.ey.r.appspot.com
  bwlodarczyk.2-0.pl
  bwmc.handipants.com
  bwmednpfeqdmmrnuchuorrqomk-dot-gleowayel400503.uc.r.appspot.com
-bwnccwclqlnjvuoi-dot-owaonk399399393.uk.r.appspot.com
  bwngpyhcrtbkphot.join-grupwhatsapp.ml
  bwnmktxjdskozium-dot-millinium.ey.r.appspot.com
  bwntsfuwfmlbieuxleriheigjrkbovkpnddj-dot-glenxpecial3009493.ey.r.appspot.com
@@ -146095,7 +126977,6 @@ caliberair.ca
  caliberation.club
  calibered-rag.000webhostapp.com
  calibered.com
-calibrationkick.top
  calibreups.temp.swtest.ru
  calicocorners.ddns.net
  calidadresidencia.xyz
@@ -146336,6 +127217,7 @@ canbertcongco1972.blogspot.be
  canbruixa.com
  cancel-affirm.com
  cancel-attempted-payment.com
+cancel-beneficiary.me
  cancel-device.link
  cancel-directdebit.net
  cancel-directdebits.net
@@ -146367,7 +127249,6 @@ cancel-payee-verify.com
  cancel-payee.co
  cancel-payeeonline.com
  cancel-payeeverification.com
-cancel-payementonline.com
  cancel-paymentprotection.com
  cancel-payments.co
  cancel-payments.info
@@ -146395,12 +127276,12 @@ cancelhalifaxpayee.com
  cancelhlfx.com
  cancellation-app.ru
  cancellation-immediate.com
+cancellation-payee-alert.com
  cancellation-payment.cc
  cancellation-payment.net
  cancellation-payment.uk
  cancellation-payments.info
  cancellation-removing.com
-cancellation-secure-device.com
  cancellation-support.co.uk
  cancellation-update.cc
  cancellationi-tunesrequestapplstore.com
@@ -146409,6 +127290,7 @@ cancelling-payee.cc
  cancelloginpayee.com
  cancelmyorders-ipkc.serveirc.com
  cancelmyorders-mlw.serveirc.com
+cancelnewaddedpayee.com
  cancelnewdevice.cc
  cancelnewpayeelogin.net
  canceloperation.com
@@ -146646,7 +127528,6 @@ capitalprogrammanagtllc.is-a-financialadvisor.com
  capitalregion.com.au
  capitalschool.edu.pk
  capitaltradefx.com
-capitalwear.cloud
  capitec-za.webnode.com
  caplem.com
  caplessenmity.net
@@ -146687,7 +127568,6 @@ captaloneeautonfirm.hopto.org
  captcha.pay.pai.umleiten.ch.theredmillbakehouse.com.au
  captchasystemredirection.info
  captivetouch.com
-captivityamong.top
  captorsparappally.com
  captsts.com
  capture-babysitting.com
@@ -146728,6 +127608,7 @@ carapene.temp.swtest.ru
  caravelair.com.au
  caravelstudio.gr
  carbcoaches.com
+carbofixhero.icu
  carbon-aquifer-280307.nw.r.appspot.com
  carbonazin.com
  carbonlooptechnologies.com
@@ -146741,6 +127622,7 @@ carcomfortplus.com
  carconceptheidenaude.baerqiread.top
  carconsultingorg.shaxiacalendar.top
  card-amazon-co-jp.top
+card-czanozoncojp.akuupdate.top
  card-itau.com
  card-rakuten-co-jp.top
  card-rakuten-co-jp.vip
@@ -146765,6 +127647,7 @@ cardercustomguitars.com
  cardermerry.xyz
  cardflippy.com
  cardholdiehan.com
+cardi.top
  cardidentity-com.preview-domain.com
  cardinallandscapellc.com
  cardinfo401034em.monster
@@ -146811,7 +127694,6 @@ careinsurance247.com
  carelifesfoundation.in
  carelinknurse.xyz
  caremeinternational.com
-carenhanh.vn
  carepakistan.org
  careplayit.vip
  carereport.life
@@ -147259,6 +128141,7 @@ caseid-430568255.pale.pk
  caseid-473479937.pale.pk
  caseid-476159807.pale.pk
  caseid-499550331.pale.pk
+caseid-523852910.pale.pk
  caseid-563612359.pale.pk
  caseid-583494286.pale.pk
  caseid-693637601.pale.pk
@@ -147274,6 +128157,7 @@ caseid-962170731.pale.pk
  caseid-977316716.pale.pk
  caseid-979660947.pale.pk
  caseid-accountdisabel-uptedapple.yangterukirdalam.com
+caseid171733723.pale.pk
  caseid48-paypal.com
  casekolo.xyz
  caseleen.xyz
@@ -147376,7 +128260,6 @@ cassodayk.xyz
  cassovia.sk
  cast-den.pw
  castaneapa.buzz
-castaway-destroyers.000webhostapp.com
  castel.saint-henri.be
  castell-distillery.com
  castelli.gr
@@ -147499,6 +128382,7 @@ caution-www.arcseam.com.au
  cautionppal.xyz
  cauumdy.gq
  cavalluindistella.com
+cavalry.vn
  cavalrzyguard.com
  cavancameroon.com
  cave-france.com
@@ -147539,7 +128423,6 @@ cb18e51be1ada7af017b86dbbc3db0c32eb6fd59.ph
  cb1c6eae2d.wixsite.com
  cb2a.addroits.com
  cb491.svcoding.com
-cb79510.tmweb.ru
  cb98944.tmweb.ru
  cbacpartnership.org
  cbahiateajuda.com
@@ -148246,6 +129129,7 @@ centermeinkontode.aba.vg
  centerofbiopolitics.com
  centeroflifechurch.com
  centeroflightyoga.com
+centerofmetro.com
  centerpontosmultipresente.center
  centerpontosmultipresente.live
  centerpontosmultipresente.space
@@ -148403,6 +129287,7 @@ cert-chase.com.a8f5f167f44f4964e6c998dee827110c.com
  cert-upgrservtrust.com
  certaintrouble.com
  certainvelvet.com
+certidaoatual.email
  certifi777777777777777777777777777777catedpages1392014541112020.advance-enable-certificate-of-pages-notify-000300120124.my.id
  certifiably.xyz
  certifica-accesso-app.com
@@ -148707,6 +129592,7 @@ chaatgrup-whatsapp.owhaja99.gq
  chaattgrup-whatsapp.chat12.ml
  chaattt-whaattsapp.getz9.shop
  chaauthorization.payr.xyz
+chabahu.xyz
  chabongviet.vn
  chabusl.com
  chacalbooks.com
@@ -148717,6 +129603,7 @@ chachastyles.net
  chackaatt.weebly.com
  chackatt.weebly.com
  chadacventures.com
+chadananjaanhaimeriok.ams3.digitaloceanspaces.com
  chadcast.com
  chadconant.name
  chaddforkapt.buzz
@@ -148831,6 +129718,7 @@ chanzom.cf
  chaoeonline.com
  chaohu.06wi.com
  chaos-promotion.kinghost.net
+chaosdeal.monster
  chaosoriflame2.000webhostapp.com
  chaoswarprivate.000webhostapp.com
  chaotrang.com
@@ -149314,7 +130202,6 @@ chaseverification.jjhtgfuel.com
  chaseverification.org.trafficsvisiters.xyz
  chaseverification.support.irstaxauditrelief.xyz
  chaseverification.zapto.org
-chaseverifications.online
  chaseverificationsecure.com
  chaseverifyingpaymentproblemonline.movieherostyle.com
  chasewells.net
@@ -149904,6 +130791,7 @@ chatwhatsapp872.giize.com
  chatwhatsapp981.giize.com
  chatwhatsapp998.giize.com
  chatwhatsappbgqblh4c0j950a5rsjqnlm.tk
+chatwhatsappbkp.join-my18grupp.tk
  chatwhatsappbkp.whatsappgroupp.cf
  chatwhatsappbkp.whatsappgroupp.ml
  chatwhatsappbkp.whttsapp-grupp.tk
@@ -149919,6 +130807,7 @@ chatwhatsappgirls.tk
  chatwhatsappgroupporn18.mrslove.com
  chatwhatsappgrubsx.pubgproperties.com
  chatwhatsappgrubsx.tk
+chatwhatsappgrup.mabar-kopraljono.ga
  chatwhatsappgrup.mypop3.net
  chatwhatsappgrup1.zzux.com
  chatwhatsappgrupbokep.ocry.com
@@ -150083,7 +130972,6 @@ check511.duckdns.org
  check72paypal.com
  checkaccont.paypal.com.chavinconsultores.com
  checkaccountid.ml
-checkaccounts-ee.com
  checkaccountstatusd.does-it.net
  checkactivitytoday.com
  checkalltgeda.com
@@ -150196,6 +131084,7 @@ checkuo11.xyz
  checkupassistantmlicroftupaccourntacceslivesecuiredirectsc.ga
  checkupdater.gq
  checkviolationis-temp376.ga
+checkviolations-apl00998766.gq
  checkvk.hop.ru
  checkwp.top
  checkyouraccountamazon.kozow.com
@@ -150554,6 +131443,7 @@ chlpbkffbcaagvrd-dot-millinium.ey.r.appspot.com
  chmabouropaore.com
  chmiola.net
  chnaeppchenonlinecom.shuiadiscover.top
+chnchikjfjxlgbir-dot-mandax.oa.r.appspot.com
  chnes14wealthandstdymoduleorganisationoo.duckdns.org
  chnes17wsdywealthandmoduleorganisationui.duckdns.org
  chnesstdyqudusisabadassniggainthestgls.ydns.eu
@@ -150578,7 +131468,6 @@ chocodaps.com
  chocolat.website.radio.br
  chocolatecaress.icu
  chocolatelinesq13.live
-chocolaterewardinghypotenuse.josealbertoal21.repl.co
  chocolateslacolonia.com
  chocolaticity.net
  chocollat.ru
@@ -150686,7 +131575,6 @@ christinekeller.ch
  christinetilleyphotography.com
  christmas-around-the-world.org
  christmasatredeemer.org
-christmaslender.com
  christmasofficeinfo.shaxianame.top
  christministry.us
  christon.ac.tz
@@ -150884,6 +131772,7 @@ cidigisaystexion.info
  cidpe-psicologia.com
  cidrd.com.do
  cidrodidi.com
+cieflia344-biglobe.xyz
  cieletamiesnecom.batwoqisep.top
  cielopromocao.ml
  cienciassocialesuaz.com.mx
@@ -151164,7 +132053,6 @@ cityvslyon.com
  citywerkz.com
  ciugq7834es.com
  ciuj.ir
-ciukbanor.wang
  ciupekcapitalcoin.com
  civic-depth-281113.oa.r.appspot.com
  civic-item501520387469238.online
@@ -151353,6 +132241,7 @@ claim-kbc.com
  claim-mytaxrebates-govuk.com
  claim-mytaxrefunds-govuk.com
  claim-pulsa-token-psbb.000webhostapp.com
+claim-rebate-gov.com
  claim-tax-gov.uk
  claim-tax-rebate.com
  claim-tax-refundgovuk.com
@@ -151589,6 +132478,7 @@ clearsolutionow.com
  cleartitleescrow.com
  cleartypeswitch.com
  clearviewpartners.in
+clearviewplasticsurgery.com
  clearviewretirement.com
  clearwaterriveroutfitting.com
  clearwaterwd.com
@@ -151623,6 +132513,7 @@ clever-bhabha.netlify.app
  clever-blackwell-b81e70.netlify.com
  clever-clever-appea.000webhostapp.com
  clever-ibis.cloudvent.net
+clever-jones-5f08ce.netlify.app
  clever-meninsky-dfb705.netlify.app
  clever-morse-8cf2a8.netlify.app
  clever-swirles-441f6e.netlify.app
@@ -151854,7 +132745,6 @@ clinicavitalefsa.com.br
  clinicconsortium.org
  clinicglassesglove.com
  clinictrack.net
-clinimedoa.info
  clinique-ennadjah-oran.dz
  cliniquefranceville.net
  cliniteqmid.mx
@@ -151907,6 +132797,7 @@ clock.noixun.com
  clockdalcop.com
  clockowner.com
  clocktowercommunications.com
+clockwatch.casa
  clodbrdfkcixkzqbgpoyddxrmuycyoxjguhp-dot-cedar-code-289917.nn.r.appspot.com
  cloellacollection.com
  clogin-capitalone.com
@@ -152231,7 +133122,6 @@ cnaweb.mrslove.com
  cnbaileybridge.net
  cnbkxeusqrjtdincgvuqsnoavf-dot-gleowayel400503.uc.r.appspot.com
  cnc.4f2000.com
-cnc.c25e6559668942.xyz
  cnc.iotbotnet.xyz
  cnc.luxstresser.xyz
  cnc.stressdem.vip
@@ -152252,7 +133142,6 @@ cnecj2018.com
  cnedriect.com
  cnesa.cn
  cnet.rogagot.com
-cnetusnew.top
  cnewhbwfktscivbr-dot-millinium.ey.r.appspot.com
  cnewswork.000webhostapp.com
  cneyxagfrdour9r-amazon-account-verification.formcharms.com
@@ -152356,7 +133245,6 @@ co-jp-system-checkinfo.xyz
  co-mender.com
  co-onlineoperative.com
  co-operativbnk.online
-co-vid-tax-rebate.com
  co.app-list-75301.casa
  co.app-list-85301.casa
  co.app-list-99301.casa
@@ -152461,7 +133349,6 @@ cockroachexterminationperth.com.au
  cocktailcontent.com
  cocktailpayment.com
  cocky-chandrasekhar-72cffa.netlify.app
-cocky-fermi-522012.netlify.app
  cocky-galileo-fb18bb.netlify.app
  cocky-solder.000webhostapp.com
  cocky-wescoff-aac502.netlify.app
@@ -152496,15 +133383,15 @@ codashop-phmlbb.ezua.com
  codashop-topup.3-a.net
  codashop2020.acmetoy.com
  codashopbug-free.xxuz.com
+codashopdiamond.ezua.com
  codashopeventsactivity.ga
  codashopeventsactivity.gq
-codashopeventts.cf
  codashopfreeresmi2020.000webhostapp.com
  codashopmlbb.mrbasic.com
-codashopmlbb1.mrslove.com
  codashopnewevents7s.gq
  codashopofficiall.000webhostapp.com
  codashoppmlbb.itemdb.com
+codashoppnews.ga
  codashopxfreeml.wikaba.com
  codashopxmlme.wikaba.com
  codashpnewpaymenta72.ooguy.com
@@ -152584,6 +133471,7 @@ cofico.com.br
  cofigrmwebais.000webhostapp.com
  cofima-spa.it
  cofip-funds.com
+cofirmservice.com
  cofrance-telecommefr.fr
  cofrjkmmkwgadoqx-dot-millinium.ey.r.appspot.com
  cog.intown-solutions.com
@@ -152805,7 +133693,6 @@ coloniali.tk
  colonic-chases.000webhostapp.com
  colonnade-consultancy.co.uk
  colonus-hedging.com
-colonyivory.cloud
  coloorad.gq
  color-harmony.com
  color.pubguc.world
@@ -153195,7 +134082,6 @@ commercialrealestatect.com
  commercialrealestatenorcross.com
  commercialremodelingpearland.com
  commerickers.biz
-commerzbank-phototan.icu
  commerzensonbank.com
  commerzonlinebanking.org
  commight.xyz
@@ -153344,6 +134230,7 @@ compassionate-downg.000webhostapp.com
  compassionate-dubinsky-013951.netlify.app
  compassionate-elion-c7cf66.netlify.app
  compassionate-engelbart-fc46a8.netlify.app
+compassionate-lovelace-693fc9.netlify.app
  compassionatecarejupiter.com
  compasslisting10726505.com
  compasslisting26706585.com
@@ -153358,14 +134245,15 @@ competaprint.com
  competencialeal.com
  competent-agnesi-e535b5.netlify.app
  competent-borg-190248.netlify.com
-competent-fermat-31fe8c.netlify.app
  competent-heisenberg-c2c3b9.netlify.app
+competent-saha-e015e8.netlify.app
  competent-swartz-de35fc.netlify.app
  competent-wing-ccdf5b.netlify.app
  competition1322.redirect-servers95.live
  competition5579.chksrvnewtoday12.life
  competition8571.nonamevar30.live
  competitionalertie.000webhostapp.com
+competitivevaguesubweb--five-nine.repl.co
  compila-ora-per-i-nuovi-certificati.net
  compila-ora.com
  compilazione-modulo-web-online.com
@@ -153383,6 +134271,7 @@ compl-fbook-96400157.imiane.ma
  complainant.info
  complainerscla.xyz
  complaint-vk.000webhostapp.com
+complaintappealsupports.cf
  complaintboardonline.com
  complan.hu
  complejoindustrialtiuna.com.ve
@@ -153471,6 +134360,7 @@ compte-interdit-bancaire.net
  compte-labanquepostale.fr
  compte-pour-tous.fr
  compte.at
+compte.vpacci.com
  compteclient.cagrico-servicecms.fr
  compteiikg.000webhostapp.com
  comptenetlfix-update.com
@@ -153511,7 +134401,6 @@ comteconerneraphedb.info
  comun1c10nes0y0atenc10n.com
  comunaghergheasa.ro
  comune.gioiadeimarsi.aq.it
-comune.royal-eng.ps
  comunicacaovertical.com.br
  comunicado.novoatendimentocaixa.tk
  comunicadosempreamigopresente.clibragostgitales.com
@@ -153549,6 +134438,7 @@ concareengineers.com
  concatstring.com
  concealing-provisio.000webhostapp.com
  conceivable-freedom.000webhostapp.com
+conceldquickjkds.us
  concentration-descirconscriptions.com
  concentricd.xyz
  conceptbrands.com.au
@@ -153560,7 +134450,6 @@ conceptscoach.com.au
  conceptz.co.in
  concernedcitizensph.org
  concert-71.ml
-concertavenue.cloud
  conchovalleyobgyn.com
  concience.tk
  conciergehousecalls.com
@@ -153635,7 +134524,8 @@ confident-brattain-61219f.netlify.app
  confident-fermi-1e9947.netlify.app
  confident-hoover-947da2.netlify.com
  confident-hoover-e7a38c.netlify.app
-confident-leakey-e46006.netlify.app
+confident-jackson-33845e.netlify.app
+confident-kare-2a7dac.netlify.app
  confident-swirles-be2a43.netlify.app
  confidentialite-profils.webnode.cr
  confidentiality.info
@@ -153680,6 +134570,7 @@ confirm-account-for-repairing-00781.my.id
  confirm-account-page-service-site.my.id
  confirm-account-page-service.my.id
  confirm-account-repair-info.my.id
+confirm-accountfb.com
  confirm-accounts-support-reporting.my.id
  confirm-anymention.net.pl
  confirm-apple.sytes.net
@@ -153706,7 +134597,6 @@ confirm-needed.com
  confirm-new-payee.cc
  confirm-newdevices.com
  confirm-newpayee.com
-confirm-payee-alert.com
  confirm-payee-online.cc
  confirm-payee-ref8920.com
  confirm-payee-reference006.com
@@ -154308,10 +135198,12 @@ content-71757835.voltoq.com
  content-724169532.helenquan.ca
  content-72436611.latuka.com.bo
  content-755417093355.keegan21.com
+content-75832817.keegan21.com
  content-77749454.interiorholic.net
  content-796468717.helenquan.ca
  content-80692424.bidsolutions.cl
  content-808801491.helenquan.ca
+content-812162152761.keegan21.com
  content-821961247.helenquan.ca
  content-837936425.helenquan.ca
  content-844948014.helenquan.ca
@@ -154499,7 +135391,6 @@ controllo-urgente-mps.com
  controllo-urgente-we-bank.com
  controlloaccessi-ban.com
  controlloaggiornamento.com
-controlloanagrafico-web.com
  controlloautomatico.000webhostapp.com
  controlmaxheacom.nckila.gdn
  controlparental.fr
@@ -154650,6 +135541,7 @@ copy-pasted-link.com
  copyfuti.hu
  copyhelpcenter-instagram.ml
  copyhgritstsupportteam.ml
+copyrghtinstagram.in
  copyrgihtcontactaccount-inst.cf
  copyright-appealhelp.com
  copyright-belform.ml
@@ -154725,6 +135617,7 @@ copyrighthelpsupportscenter.com
  copyrighthelpteams.com
  copyrightinfohelp.com
  copyrightinfrigementsupports.ml
+copyrightinghelpcenters.ga
  copyrightinsagram.000webhostapp.com
  copyrightinstagram.business
  copyrightk-instagram.tk
@@ -154738,6 +135631,7 @@ copyrightmediasupport-10007483190.com
  copyrightmusical.com
  copyrightnotice-ig.ml
  copyrightnoticesupports.com
+copyrightobjectionhelpform.ml
  copyrightofinstagram.ml
  copyrights-center.com
  copyrights-helpcenterss.com
@@ -155724,19 +136618,17 @@ cpcalendars.as2r.link
  cpcalendars.auth-redirect.amazon.com-caseid.ooguy.com
  cpcalendars.authentication-appleservice-appleid.giize.com
  cpcalendars.beautyblendersponge.xyz
-cpcalendars.bennett-snaps.com
  cpcalendars.bonitafurniture.icu
  cpcalendars.capofthemonth.icu
  cpcalendars.carrier-ref.com
  cpcalendars.cgilogsecuredaccess.com
  cpcalendars.cikaperformance.ma
  cpcalendars.coronaknowledge.com
-cpcalendars.d-tv.tv
+cpcalendars.defigios.com
  cpcalendars.democraticvalues.icu
  cpcalendars.device-ref2082.com
  cpcalendars.dewasa-bebas.login-ke-whatsapp.tk
  cpcalendars.drwax.as
-cpcalendars.electrum-bsv.io
  cpcalendars.eurotoolslogz.net
  cpcalendars.facebook-security20.gq
  cpcalendars.fightingforfit.icu
@@ -155744,7 +136636,6 @@ cpcalendars.findmyiphone-icloud.com
  cpcalendars.freehealthstudy.icu
  cpcalendars.globalamazonservices.com
  cpcalendars.goimail1.appleid-appstore-signin.com
-cpcalendars.hali-payee-alert.com
  cpcalendars.harmonypads.top
  cpcalendars.help-account-amazon-covid19.giize.com
  cpcalendars.help-lnstagramcopyright.tk
@@ -155773,7 +136664,6 @@ cpcalendars.messenger-beta.to
  cpcalendars.messenger-check.to
  cpcalendars.mfacebook-com.cf
  cpcalendars.mymenuforlife.xyz
-cpcalendars.n3tflx-billing.info
  cpcalendars.negativebetafund.icu
  cpcalendars.netflix-subscription.secure-appsgood.com
  cpcalendars.netflixlive.club
@@ -155786,7 +136676,6 @@ cpcalendars.paypal-verificationsupport.com
  cpcalendars.paypalensure24.info
  cpcalendars.paypals.mattiasvaucher.com
  cpcalendars.paypalsupport24.com
-cpcalendars.premiercoininvest.com
  cpcalendars.propertysalesusa.icu
  cpcalendars.purchaseinstantalertsupport.gleeze.com
  cpcalendars.rebate-claims.org
@@ -155794,6 +136683,7 @@ cpcalendars.redirect.googlewebappsmailes.com
  cpcalendars.relativeaccesspayments.com
  cpcalendars.restoreaccounts-paypal.theworkpc.com
  cpcalendars.restoremyaccounts-paypal.giize.com
+cpcalendars.runtzdispensary.org
  cpcalendars.secure-apple.session-confirmation.cloudns.asia
  cpcalendars.secure.login.apple.com.zmxkjbajsjrehpreotrt.com
  cpcalendars.secure.login.apple.com.zzdwjihqdowdpejfr.com
@@ -155807,12 +136697,14 @@ cpcalendars.servicessupportaccount.theworkpc.com
  cpcalendars.serviceupgrade.gq
  cpcalendars.signin-authentication-accountamazonfr.giize.com
  cpcalendars.spirtworld.xyz
+cpcalendars.stashdasher.com
  cpcalendars.summaryaccountpaypalstore.com
  cpcalendars.support-bankofamerica.giize.com
  cpcalendars.support-info-gb.com
  cpcalendars.support-panel.com
  cpcalendars.supportcenterservice-securityaccount-amazon.theworkpc.com
  cpcalendars.sweetdreamsfairy.icu
+cpcalendars.thepsychedelics.net
  cpcalendars.threemobile-secure.com
  cpcalendars.updatessecures.com
  cpcalendars.updateverifyaccount.info
@@ -155859,14 +136751,13 @@ cpcontacts.appleid.com.managers.redirectmantepkanbro.com
  cpcontacts.appleld.es
  cpcontacts.auth08.com
  cpcontacts.axmacap.com
-cpcontacts.bennett-snaps.com
  cpcontacts.bonitafurniture.icu
  cpcontacts.capofthemonth.icu
  cpcontacts.carrier-ref.com
  cpcontacts.case-id2927.com
  cpcontacts.chase-webonline1.com
  cpcontacts.coronavirus-tee.com
-cpcontacts.d-tv.tv
+cpcontacts.defigios.com
  cpcontacts.democraticvalues.icu
  cpcontacts.device-ref2082.com
  cpcontacts.dewasa-bebas.login-ke-whatsapp.tk
@@ -155881,10 +136772,10 @@ cpcontacts.hali-payee-alert.com
  cpcontacts.harmonypads.top
  cpcontacts.help-account-amazon-covid19.giize.com
  cpcontacts.help-lnstagramcopyright.tk
+cpcontacts.henryfloressantatecla.com
  cpcontacts.hmrnic.com
  cpcontacts.hsbc-newpaymentreview.com
  cpcontacts.https-www-paypal.com
-cpcontacts.hyperionanalytics.xyz
  cpcontacts.icloud.com-wl.info
  cpcontacts.instagrambusinessaccount.com
  cpcontacts.join-chat-whatsapp-bokep-grup-smasmp.tk
@@ -155912,7 +136803,6 @@ cpcontacts.messenger-check.to
  cpcontacts.mfacebook-com.cf
  cpcontacts.mymanchesterescorts.xyz
  cpcontacts.mymenuforlife.xyz
-cpcontacts.n3tflx-billing.info
  cpcontacts.negativebetafund.icu
  cpcontacts.netflix-subscription.secure-appsgood.com
  cpcontacts.netflixmovie.xyz
@@ -155928,12 +136818,13 @@ cpcontacts.paypals.mattiasvaucher.com
  cpcontacts.paypalsupport24.com
  cpcontacts.paypl-updatesecurtyinfo.loseyourip.com
  cpcontacts.pharmchecker.xyz
-cpcontacts.premiercoininvest.com
  cpcontacts.propertysalesusa.icu
+cpcontacts.quaternity.finance
  cpcontacts.rebate-claims.org
  cpcontacts.redirect.googlewebappsmailes.com
  cpcontacts.relativeaccesspayments.com
  cpcontacts.restoreaccounts-paypal.theworkpc.com
+cpcontacts.runtzdispensary.org
  cpcontacts.secure.login.apple.com.zmxkjbajsjrehpreotrt.com
  cpcontacts.secure.login.apple.com.zzdwjihqdowdpejfr.com
  cpcontacts.secure.login.appleid-web.com.yyrepost.com
@@ -155948,11 +136839,13 @@ cpcontacts.signin02ac-verifyrecent-activity.mywire.org
  cpcontacts.silkflowerexperts.icu
  cpcontacts.simplesubtraction.xyz
  cpcontacts.spirtworld.xyz
+cpcontacts.stashdasher.com
  cpcontacts.summaryaccountpaypalstore.com
  cpcontacts.support-info-gb.com
  cpcontacts.support-panel.com
  cpcontacts.supportie.ga
  cpcontacts.sweetdreamsfairy.icu
+cpcontacts.thepsychedelics.net
  cpcontacts.threemobile-secure.com
  cpcontacts.updateaccount-covid19.giize.com
  cpcontacts.updatessecures.com
@@ -156110,6 +137003,7 @@ cr.davidturneyphotography.com
  cr.dyamm.com
  cr.keystofineindyhomes.com
  cr.lnet.org.il
+cr.mffg.sakj.top
  cr.mnfg.shwxtfood.com
  cr.mnfg.taipei-nightclubs.com
  cr.mntg.meilihanzhuang.com
@@ -156123,7 +137017,6 @@ cr.mufg.jp.9j46xf4k8cxa.xyz
  cr.mufg.jp.costa-del-sol-swingers.com
  cr.mufg.jp.crownjfashion.com
  cr.mufg.jp.efxcvx5xch2z.xyz
-cr.mufg.jp.hplm.top
  cr.mufg.lxymw.com
  cr.mufg.marinawrestling.com
  cr.mufg.my-advantage-tennis-shop.com
@@ -156139,7 +137032,6 @@ cr.nufg.nvpg.top
  cr.www.dyamm.com
  cr0lxr0ugec0vld19.com
  cr1.197946.com
-cr2ee.org.uk
  cr7lolscope.com
  cr7power.000webhostapp.com
  cr96cmgkrx2t41u3.boxberry.msk.ru
@@ -156345,7 +137237,6 @@ crasyhost.com
  crasyt-71.tk
  crat86prinkk.ml
  cratecompanyhousing.com
-craterlegend.top
  cratesgftspubg.zzux.com
  cratesgifts12.zyns.com
  cratespubgm12.otzo.com
@@ -156380,7 +137271,6 @@ crbsms.org
  crc2k18.mooo.com
  crcdhdnebcviyvuf-dot-millinium.ey.r.appspot.com
  crcrgfvzepozxjlroxwsuqewtk-dot-gleowayel400503.uc.r.appspot.com
-crcsdogs.org
  crcse.com
  crditoshared.appspot.com
  crdt-agrcole-compte-securipass.u670943hb3.ha004.t.michaelgchan.com
@@ -156473,7 +137363,8 @@ credemapp.com
  credenciaisltaucard.getenjoyment.net
  credenciales-microsoftt.zz.com.ve
  credenciamentobh.creatorlink.net
-credentialsupdatemyinfo.com
+credentialsupdatepayment.com
+credentialupdatelogin.com
  credentrawsheq.cf
  credenzialiaggiorna.com
  crediacces.com
@@ -156527,6 +137418,7 @@ credit-suisse.services
  credit.agricole.fr.caperiverresources.com.au
  creditacc.info
  creditagric0le.fr
+creditagricolio.ddns.net
  creditapp-beta.capitalone.bonitor.ir
  creditapplique.info
  creditcapital.tdnyc.top
@@ -156864,6 +137756,7 @@ cryptosplenetic.xyz
  cryptosuissecapital.com
  cryptotest.beget.tech
  cryptousagroup.com
+crypttic.bluewavejewels.com
  cryson.com.br
  crystal-interfinance.com
  crystal42762.xyz
@@ -157407,7 +138300,6 @@ cuddl.id
  cuddlegetit.com
  cueewwvaoqrsvxko-dot-millinium.ey.r.appspot.com
  cueitfohosksxjqy-dot-millinium.ey.r.appspot.com
-cuencadistributions.com
  cuenta-confirm.informacion-cuenta.com
  cuenta72paypal.com
  cuentaalertaa.blogspot.com
@@ -158412,7 +139304,6 @@ d39x1.svcoding.com
  d3africa.com
  d3c00.duckdns.org
  d3c0d3dd0cx.000webhostapp.com
-d3c951u8e9d88t5e1a581955ef6189b.club
  d3cb9edf305b923eeb70dfb5e6e426ce28eba8e7.net
  d3dqx.saytanet.com
  d3ed5595.ngrok.io
@@ -158577,6 +139468,7 @@ daffodilmarketing.com
  daffos.xyz
  daffymezlematic.com
  dafia.org
+dafssdfzsdfnmnaanaile.xyz
  daftargiveaway2020joss.000webhostapp.com
  daftargiveaways2020.000webhostapp.com
  daftarmenumasakan.web.id
@@ -158862,10 +139754,10 @@ danmcneilcouncillor.xyz
  danmusa.com
  dannexgh.com
  dannields2.com
+dannosa.com
  danny82.xyz
  danrsm.com
  dansagouty.temp.swtest.ru
-dansample.cf
  danseboutique.com
  danska31.000webhostapp.com
  danske-tjeneste-online.sellything.digital
@@ -158958,6 +139850,7 @@ dark11.otzo.com
  dark1223.000webhostapp.com
  darkblessing.net
  darkestalleys.com
+darkgreysharpautocad--five-nine.repl.co
  darkloader.ru
  darkloader.xyz
  darkmatterco.net
@@ -159154,7 +140047,6 @@ datarescue.cl
  datasciencechallenge.com
  datascientist-shop.fr
  datasec.du.r.appspot.com
-datasecure-lloydbank.com
  datasecure-lloyds.com
  dataserviceinformation.ga
  datashapers.io
@@ -159196,6 +140088,7 @@ datingmetonight.online
  datingonlineclub.ml
  datingtimehere2.com
  dationlie-2020.000webhostapp.com
+datiotiskiot.com
  datisprint.com
  dative.ml
  datkay-0.tk
@@ -159387,6 +140280,7 @@ dazzling-booth-ce3eaa.netlify.app
  dazzling-calculating.ga
  dazzling-dijkstra-742e18.netlify.app
  dazzling-goldberg-17f6fe.netlify.app
+dazzling-kalam-42778c.netlify.app
  dazzlingskill.com
  db-office365.000webhostapp.com
  db-phototan-wiederherstellen.de
@@ -159466,6 +140360,7 @@ dbsnxtirvlmhvwzq-dot-millinium.ey.r.appspot.com
  dbsprize.asia
  dbsprizes.com
  dbssistem.com.tr
+dbsvote.com
  dbtjt.com.ru
  dbttxbucyaebwptbxpg.top
  dbuiscieajjcbuhs-dot-millinium.ey.r.appspot.com
@@ -160011,7 +140906,6 @@ deepvenom.000webhostapp.com
  deepwebeye.com
  deepxstate.org
  deerboots.club
-deercensus.cloud
  deerelegacy.com
  deerhytumactv.xyz
  deersailorh.com
@@ -160525,7 +141419,6 @@ derdwerdesign.com
  derechoglobal.com.mx
  deregister-alertdevice.com
  deregister-app.cc
-deregister-confirmlogin-online.com
  deregister-dev.online
  deregister-device-alert.com
  deregister-device-info.com
@@ -160561,6 +141454,7 @@ deregister-payeeaccount.com
  deregister-secure-online.com
  deregister-secure.com
  deregister-signin.com
+deregister-unauthorized-payee.com
  deregister-unsecuredevice-security.co.uk
  deregister-unverifieddevice.com
  deregister-validatelogin.com
@@ -160635,6 +141529,7 @@ dertierfotografde.chifanbudget.top
  deruiterstaalkabel.nl
  dervosipniarubainc.com
  derwahnsinn.at
+derwho.com
  derxone.ug
  deryw.club
  des-forges.com
@@ -160642,7 +141537,6 @@ des-maries-a-croquer.imie-nantes.fr
  desaabang.com
  desaart.com
  desafio-parchis.000webhostapp.com
-desafioserasaexperian.com.br
  desafiovertical.com
  desahancewekbening.myz.info
  desainrumahterbaik.co
@@ -160714,7 +141608,6 @@ desertpeoplewalkers.com
  desertskyvacationrentals.com
  desertteam.me
  desertvistaconsulting.co
-deservejury.cloud
  deserveopposed.com
  desgovernadosopodcast.com.br
  desgummn.com
@@ -160732,6 +141625,7 @@ desighiza.com
  design-tshirt.com
  design.kinraidee.xyz
  design.smrt.site
+design1.com
  designaz88.xyz
  designbrochure.us
  designconceptwithkamal.ca
@@ -160745,7 +141639,6 @@ designerforuiy.com
  designergazi.com
  designerinteriorfabrics.com
  designerjeddah.com
-designerliving.co.za
  designermall.ru
  designerseguroweb.com
  designersnake.top
@@ -160778,7 +141671,6 @@ desinfectercoronavirus.com
  desing.co
  desintox.site
  desinytravel.com
-desireblind.cloud
  desiringhands.com
  desite.gr
  desjardins-2fraudalert.com
@@ -160894,8 +141786,6 @@ detected-modificati.000webhostapp.com
  detected-suspicioust01.000webhostapp.com
  detectivequest.icu
  detemopenahub.com
-determinationdiffu.site
-determined-meitner-98db4c.netlify.app
  determined-wilson-e0dff1.netlify.app
  determineomar.com
  detestable-prism.000webhostapp.com
@@ -160947,6 +141837,7 @@ dev-seu.pantheonsite.io
  dev-sfnlogin.pantheonsite.io
  dev-site.ovh
  dev-snccosicoco-com-udandlc1andmnbvid6485andmktenandlc.pantheonsite.io
+dev-snccossicoco-com-udandlcmnbvandid6485andmktenandlb.pantheonsite.io
  dev-st3.pantheonsite.io
  dev-team-176.pantheonsite.io
  dev-testmystore.my
@@ -161074,6 +141965,7 @@ device-approve.com
  device-auth.lb-idlloydplc.com
  device-authenticator.com
  device-authorisation-online.com
+device-authorisation.com
  device-authorisations.com
  device-authorise.co.uk
  device-cancellation.cc
@@ -161104,7 +141996,6 @@ device-gb-deregister.com
  device-gived.xyz
  device-hplc-verify.com
  device-icloud.com
-device-identification.com
  device-issues-halifax.com
  device-limited.com
  device-login-halifax.com
@@ -161169,6 +142060,7 @@ devicebreach.com
  devicechecksecurity.000webhostapp.com
  devicecontrol-help.com
  devicecontrol-manage.com
+devicederegistration-manage.com
  devicederegistration-verify.com
  devicederegistration.com
  deviceful-errors.000webhostapp.com
@@ -161177,6 +142069,7 @@ deviceid-halifax.com
  deviceinfo-secure.com
  devicemanagerhalifax.com
  devicemoon.com
+devicepayeecancellation.com
  deviceprotection-alert.cc
  deviceprotection-payee.com
  deviceprotection-unknown.link
@@ -161716,7 +142609,6 @@ dia-dos-namorados-ame.com
  dia-dos-pais-especial-cupom8930.com
  diaaal7awy.ddns.net
  diaadi.com
-diabaetsprotociaie.us
  diabasic-balances.000webhostapp.com
  diabbetes.net
  diabetcentro.info
@@ -162071,7 +142963,7 @@ digitalangels.eu
  digitalartstuv.tk
  digitalathsala.000webhostapp.com
  digitalauth-amzn237.gotdns.ch
-digitalbanking-signin-auth.com
+digitalbanking-mobile-signin.com
  digitalbattery.webhop.me
  digitalbccr.com
  digitalbitbox.com
@@ -162299,7 +143191,6 @@ diplomatafrica.com
  diplomatie.gov.mr
  diplomatplastic.com
  diplomatshipping.net
-dipterous-parcels.000webhostapp.com
  diqnptcfog.duckdns.org
  diradeact.com
  dirapps-home.com
@@ -162367,7 +143258,6 @@ disable-accountid-verifapple.wdawdwadnjkef.co.uk
  disable-devhalireg.com
  disable-mobilebanking.com
  disable-newpayee.com
-disable-onlinepayee.com
  disable772account.sistemaaccountprima26252sistemserverus-2.com
  disabled-45907143.ifms-enargeia.gr
  disabled-52324487.ifms-enargeia.gr
@@ -163312,7 +144202,6 @@ doeshappymediumhavethecoronavirus.com
  doevctcaghaqnleczlvbbpnlqdrxhbojstgt-dot-cedar-code-289917.nn.r.appspot.com
  doextbyeywdukdaq-dot-millinium.ey.r.appspot.com
  dofaredolle.kissr.com
-dofat.cloud
  dofirstdr.tk
  doforlovan.ga
  dofus-art.com
@@ -163675,7 +144564,6 @@ dong7707.at
  dongadesign.cn
  dongamruoutaybac.com
  dongatewayapt.buzz
-dongbuqroup.com
  dongfangpack.com
  dongguanclaim.com
  dongguanjixie.com
@@ -163761,7 +144649,6 @@ doonprojects.com
  door-ma.com
  door-verwijzingslink.nl
  doorauttomation.com
-doorbike.cloud
  doorblitz.com
  doorlife.co.in
  dooromall.com
@@ -163809,7 +144696,6 @@ dorel-br.com
  doremifasol.online
  doreresidential.com
  dorians-geo.ru
-doriansallee.ru
  dorizating.top
  dorjibari.com.bd
  dorogobogato.site
@@ -164159,6 +145045,7 @@ dpskesharia.com
  dpsoma.com
  dpt-hph.gov.la
  dptc.lunchtimesport.com
+dptoatualacessoria.win
  dptsco.ir
  dpttnwjgizlslenc-dot-millinium.ey.r.appspot.com
  dptzimup.000webhostapp.com
@@ -164254,7 +145141,6 @@ dragonflytattoo.com.my
  dragongiveaways.ga
  dragonpunchint.com
  dragonsknot.com
-dragonspread.cloud
  dragoparks.com
  drailling.tk
  draincorp.psypher.co.za
@@ -164342,9 +145228,8 @@ dreamtrips.cheap
  dreamx.online
  dreamy-edison-db79ca.netlify.app
  dreamy-goldberg-a2a25d.netlify.app
-dreamy-hoover-64e4ec.netlify.app
-dreamy-kowalevski-57be72.netlify.app
-dreamy-mcclintock-3d0213.netlify.app
+dreamy-hamilton-6c3156.netlify.app
+dreamy-lumiere-1e60d8.netlify.app
  dreamy-pare-460633.netlify.app
  dreamy-ritchie-e6e48b.netlify.app
  dreamyeyesare23.us-south.cf.appdomain.cloud
@@ -164990,7 +145875,6 @@ dukanhaimerepass.000webhostapp.com
  dukdns33.ddnsking.com
  dukdong.co.kr
  duke6.tk
-dukemature.cloud
  duketownschoolcalabar.com
  dukevinchy.com
  dukfcxltujujlrqiudbcykhjcohrjjnrahuc-dot-gl494903049.wl.r.appspot.com
@@ -165035,7 +145919,6 @@ duniagames.10xze.my.id
  dunianhamudjercv.000webhostapp.com
  duniwqczcrniazft-dot-millinium.ey.r.appspot.com
  dunkingbirdproductions.com
-dunrsaibs.wang
  dunti.info
  dunveganbrewing.ca
  dunwoodycarservice.com
@@ -165661,7 +146544,6 @@ e-invoice-mbres.me
  e-invoice-mbres.net
  e-invoice-mbres.org
  e-invoice-ticgums.org
-e-it.site
  e-kedai.my
  e-kunden-saprkasse.com
  e-lai.com
@@ -165900,8 +146782,8 @@ eaeloridgahmehuu-dot-millinium.ey.r.appspot.com
  eaeos7.qwwxatw8p5h2.institute
  eafreight.ltd
  eafxxcikfj4.icu
+eager-dijkstra-0acd86.netlify.app
  eager-goldberg-1a890f.netlify.app
-eager-goodall-1ddc8e.netlify.app
  eagergreyhound.com
  eagermindssystems.com
  eagle-family.co.uk
@@ -166542,6 +147424,7 @@ ebay.megasoftisp.com
  ebay.online-verify.digital
  ebay.reconfirm-posting.us
  ebay.restore-user.com
+ebay.seller-issues-uk.com
  ebay.sporting-goods.cycling-bicycles.itm59l2o3s5.com
  ebay.suspicious-accountactivity.com
  ebay.ws.it.ws.mezarkabristanisleri.com
@@ -166589,7 +147472,6 @@ ebigcoins.com
  ebik.com
  ebike4all.com
  ebilling-secure.co.uk
-ebilling-secure.com
  ebilling-secured.co.uk
  ebills.thetrissilent.com
  ebillupdateshaw.is-an-accountant.com
@@ -166679,6 +147561,7 @@ ec2-54-86-202-197.compute-1.amazonaws.com
  ec21-com-ec21d10adc3949babpud59abid64855mktbe56e057f20f883e.pantheonsite.io
  ec2cforjumppingboard.info
  ec33b.com
+ecac.xyz
  ecafela.com
  ecampus.mk
  ecap.co.in
@@ -166821,6 +147704,7 @@ economic-donkey.surge.sh
  economicdisgrace.win
  economicimpactnotice.org
  economicparachute.com
+economycoma.monster
  economyfurnace-my.sharepoint.com
  economylinuxhostingwithcpanel.biz
  ecoohungary.com
@@ -166844,7 +147728,6 @@ ecosnobberysucks.com
  ecosolarion.com
  ecosouthafrica.icu
  ecosro.com
-ecosys.cc
  ecotaskforce.com
  ecotecar.com.br
  ecotermra.ro
@@ -166874,8 +147757,8 @@ ecrpropiedades.com.ar
  ecs-solutions.net
  ecs-tr.com
  ecsax.com
+ecstasytell.monster
  ecstatic-dijkstra-b76bf6.netlify.app
-ecstatic-engelbart-eacf07.netlify.app
  ecstatic-euler-0e9341.netlify.app
  ecstatic-tesla-1cfa67.netlify.app
  ecsunlocked.com
@@ -167251,7 +148134,6 @@ ee-billinginsupport.com
  ee-billingissue.support
  ee-billingpage.com
  ee-billingplan.com
-ee-billingprocess-secure.com
  ee-billingrestrictions.com
  ee-billingresubmit.com
  ee-billings-update.com
@@ -167361,6 +148243,7 @@ ee-infohub.com
  ee-invalid-payment.com
  ee-issues.com
  ee-limited.com
+ee-limited.uk
  ee-liveupdates.com
  ee-login-account.com
  ee-login-auth.com
@@ -167433,7 +148316,6 @@ ee-paymentservice.com
  ee-paymentsupdate.com
  ee-paymentsupport.com
  ee-paymentsupport.net
-ee-paymentupdates-secure.com
  ee-paynow.com
  ee-paysecure.com
  ee-payservice.com
@@ -167464,6 +148346,7 @@ ee-secure-infoaccount.com
  ee-secure-login.com
  ee-secure-online.com
  ee-secure-php.com
+ee-secure-process.com
  ee-secure-validation.info
  ee-secure.online
  ee-secureaccounts.com
@@ -167630,6 +148513,7 @@ ee.securbilling.help
  ee.securbillingreview.help
  ee.services-paybill-online.co.uk
  ee.support.update-billing.mobi
+ee.turkiye-gov-tr-ucret-geri-iadesine-basvuru.xyz
  ee.uk-alerts.com
  ee.uk-billing-signin.com
  ee.uk.acc-info563.com
@@ -167702,7 +148586,6 @@ eebilling-secure.com
  eebilling-setup.co.uk
  eebilling-setup.com
  eebilling-support.000webhostapp.com
-eebilling-support.net
  eebilling-update.cc
  eebilling-updates.com
  eebilling-valid.com
@@ -167719,7 +148602,6 @@ eebillings-update.com
  eebillingsupdate.com
  eebillingsupportuk.com
  eebillingupdate.com
-eebillingupdate.online
  eebillingupdates.com
  eebilll.com
  eebillsupport-uk.com
@@ -167755,6 +148637,7 @@ eegroup2020.co.uk
  eehelp-page.com
  eehelp.net
  eehelpdesk-customerbill.com
+eehelpsite.com
  eehelpsupport.com
  eehesfsqtiebhmts-dot-millinium.ey.r.appspot.com
  eehome-payhub.com
@@ -167762,6 +148645,7 @@ eehub-online.com
  eehub-verifyme.com
  eeicyduecgxmunqi-dot-millinium.ey.r.appspot.com
  eeinfo-updatebill.com
+eeinfohub.co.uk
  eeiowia.000webhostapp.com
  eeizzwjpfhvruykg-dot-millinium.ey.r.appspot.com
  eejfoqbmmabxpdyj-dot-millinium.ey.r.appspot.com
@@ -167915,6 +148799,7 @@ eflugvvprdhamaevnuvnncixdzbqmwvddyqx-dot-cryptic-now-290917.ey.r.appspot.com
  efmgecbsotlljvgq-dot-millinium.ey.r.appspot.com
  efmny.org
  efmqglqztf.duckdns.org
+efootball2021mobile.jetos.com
  efore.info
  eformdaiadeleryapihizmet.xyz
  eforvlntxqnehwga-dot-millinium.ey.r.appspot.com
@@ -168326,7 +149211,6 @@ ekster.info
  ekstrabladt.com
  ektas.svcoding.com
  ektasamajikkalyanhitsanstha.org
-ektasi.com
  ektecwca.ru
  ektglzwqwgiirbkf-dot-millinium.ey.r.appspot.com
  ektnrarejfoepluk-dot-millinium.ey.r.appspot.com
@@ -168493,6 +149377,7 @@ elegant-dandy-fridge.glitch.me
  elegant-galileo-15e0de.netlify.app
  elegant-galileo-15e0de.netlify.com
  elegant-meitner-d64348.netlify.app
+elegant-pare-dd660f.netlify.app
  elegant-ramanujan-de9a6a.netlify.app
  elegant-rosalind-177243.netlify.app
  elegantbits.net
@@ -168711,6 +149596,7 @@ elongive.io
  elongivesbtc.com
  elonsave.life
  eloomo.com
+eloquent-aryabhata-f27487.netlify.app
  eloquent-borg-4ce756.netlify.app
  eloquent-mirzakhani-ba8bed.netlify.app
  eloquent-panini-318cb2.netlify.app
@@ -168913,7 +149799,6 @@ embracinghiscall.com
  embramedica.com.br
  embrava.eu
  embroity.com
-embryostream.cloud
  embunpajar.com
  embusducet.topkorder.su
  embutec.com.br
@@ -169615,7 +150500,6 @@ enstylehomes.com
  ensube-bmw-ebasvuruformu.com
  ensurago.com
  ensure-7paypal.com
-ensurepassion.cloud
  ensurgeiansclaiminsurer.com
  ensutouchsirimmalaysia.com
  ent-covid19-gouv.info
@@ -169692,7 +150576,6 @@ enviadoclientesms-com.umbler.net
  envicom.nl
  enviedepices.fr
  enview-subscriptionitunesordernr9910237.cf
-enviousjuicyinversion.omarbaez.repl.co
  envirnoamics-inc.com
  envirodrilling.com
  envirohealth.org
@@ -169824,6 +150707,7 @@ epic-jackson-dcf183.netlify.app
  epic-jones-53ac3b.netlify.app
  epic-newton-e68f7c.netlify.app
  epic-northcutt-8db189.netlify.app
+epic-wright-e28664.netlify.app
  epicbabez.ml
  epicbrowser.su
  epiccreations.net.au
@@ -169845,6 +150729,7 @@ episodehackfreegems.com
  episodepan.co
  epitisgis.gr
  epitomic-squadron.000webhostapp.com
+epivneweventl.otzo.com
  epixarte.com
  epjltiwbmceynpyw-dot-millinium.ey.r.appspot.com
  epjqvbsmyvjshqqaodmf.top
@@ -169888,7 +150773,6 @@ epoyoifrjxysjtue-dot-millinium.ey.r.appspot.com
  epperfums.com
  eppieskidsduathlon.org
  epprecovery.sytes.net
-eprcgh.org
  epreparations.com
  epress.ie
  eprints-user.com
@@ -169919,12 +150803,12 @@ eq3u-easemanasejarepletadeboasescolhas.com
  eq5ahiqg.firebaseapp.com
  eqapakua.xyz
  eqbfjdhsltjcjcavoghgsygylgsqwcmyfcdi-dot-glegen303939423233.ue.r.appspot.com
+eqbfyxlnmrwdodpu-dot-copper-imprint-296111.nw.r.appspot.com
  eqbqttvzxoicsxzuaeavsvmepmsibhbtgupw-dot-glenxpecial3009493.ey.r.appspot.com
  eqbrhcqjhx.melusfkp.com
  eqbryum.ml
  eqbw9bdho9.firebaseapp.com
  eqc6.jaysbrand.com
-eqclgnvrvkpamuab-dot-owaonk399399393.uk.r.appspot.com
  eqcozbyftbsqdksuxbhjyrdkfu-dot-gloff849483.uk.r.appspot.com
  eqcytxnslsfjzhgcnszewjyvwk-dot-gleowayel400503.uc.r.appspot.com
  eqd.sovereignty2020.com
@@ -169951,7 +150835,6 @@ equator-motorsport.ml
  equatoreggplantz.com
  equatorialclumsyautotote--five-nine.repl.co
  equatorialguineaonline.com
-equdeowjnzzxlftg-dot-fedeco-auth-servicas.nw.r.appspot.com
  equestarianpelhamsparkway.com
  equidadpoblana.com
  equifirstcourierexpress.com
@@ -169998,7 +150881,6 @@ er4w.awaykart.com
  er6pe.svcoding.com
  era-app.com
  erabbied3rrre61.e8273.pro
-erabill.cloud
  eracvv.me
  eradicative-ratings.000webhostapp.com
  eraganhuh.com
@@ -170152,7 +151034,6 @@ erp.dadagroup.org
  erpahome.com
  erpcontadmin.com
  erpgbphxfkhdbueszqqlwbugct-dot-gleowayel400503.uc.r.appspot.com
-erpnngemia.wang
  erpoffice.ga
  erpoweredent.at
  erpvousgztkkpynobzaibjbsoy-dot-gleowayel400503.uc.r.appspot.com
@@ -170253,7 +151134,6 @@ eruditetechnologies.com
  erugutrane.com
  eruquantum.com
  erusuconsultants.com
-ervnetv.xyz
  erw9.addroits.com
  erwerwed.com
  erwmdtwlfnkbzvzm-dot-millinium.ey.r.appspot.com
@@ -170315,7 +151195,6 @@ esamina-dati.com
  esanjobs.org
  esapcepro-org.com
  esayansknife.work
-escalose-mia.com
  escalum.com.mx
  escang.com
  escanor11.ddns.net
@@ -170356,7 +151235,6 @@ escuelanormalbenvver.000webhostapp.com
  escuelanormalveracruzana1.000webhostapp.com
  escuelaonline-org.upsuradventistas.net
  escuelaonline.org
-escuelasdeveracruzuninorm.000webhostapp.com
  escuelaunosanagustin.com
  escvy.space
  esdcf.weebly.com
@@ -170494,7 +151372,6 @@ espacotieli.com.br
  espanabancosantander-clientes.nhbesantnet.com
  esparklight.com
  espaytakht.com
-espceagreiijsk.net
  especial-das-maes.com
  especialdasemana.xyz
  especialdejulho.com
@@ -171337,12 +152214,12 @@ eventmlbhdiamondgratiss.zyns.com
  eventmobilelegend837.zyns.com
  eventmobilelegends.2waky.com
  eventmobilelegends2k20.otzo.com
-eventnewmoonton.cf
  eventos.alfatravel.com.br
  eventosolution.com
  eventostrinity.com
  eventosvallarta.com.mx
  eventpharaohsuit.com
+eventpicfree.otzo.com
  eventpoint-ready20a-web.azurewebsites.net
  eventpressecom.batwoqisep.top
  eventpubg-s13.000webhostapp.com
@@ -171376,7 +152253,6 @@ events.tencenters.com
  events15ucpubg.com
  eventsactivity-mlbb.ga
  eventsactivity-mlbb.ml
-eventsbylarisa.ro
  eventscartitan.parkpubg.com
  eventsdofus.com
  eventseason13.4dq.com
@@ -171385,6 +152261,7 @@ eventseason15.myz.info
  eventsetmaterial.com
  eventsfreeskinmlbb.dynamic-dns.net
  eventshareonline.nl
+eventskiinfree.otzo.com
  eventskin.lucky76.ml
  eventskinfreedm.otzo.com
  eventskingratis2020.zgarena.top
@@ -171408,7 +152285,6 @@ eventtdiamoondgratiss.my.id
  eventterbaru775.000webhostapp.com
  eventtitan.ff-garenac.gq
  eventtqsdmd.com
-eventtskinfree.cf
  eventunipinvtp.000webhostapp.com
  eventupdate.eventinfo.top
  eventweaponlangka.000webhostapp.com
@@ -171498,10 +152374,18 @@ evirement-secure-authentification.000webhostapp.com
  evirement-ser-vice-authentification.000webhostapp.com
  evisalink.com
  evisionlegal.com
+evisloch.de
  evisualsoft-001-site3.atempurl.com
  eviteapermanenciadobloqueioagora.com
+eviteexpiramento-embreve.club
+eviteexpiramentobreve.club
+eviteexpiramentoem-breve.club
+eviteexpiramentoembreve.club
  eviteobloqueio.000webhostapp.com
  eviteobloqueio.online
+eviteoexpiramentobreve.club
+eviteoexpiramentoembreve.club
+eviteoexpiramentoproximo.club
  eviteoperigocompreonlineaqui.com
  eviworks.com
  evkegwaszhberevzubysvyrfedhc.top
@@ -171693,6 +152577,7 @@ examplemethod.co
  exams-success.com
  examsinfo.in
  exappendiculate.xyz
+exaqaeuckwyrjzov-dot-mandax.oa.r.appspot.com
  exarchadi.tk
  exatasconsultoria.com
  exaxn.xyz
@@ -171772,6 +152657,7 @@ executives.rubedo-ontwikkeling.nl
  executivetavel.com
  executivtrading.ro
  exee.space
+exemplarykaleidoscopicapplications.adasdfff.repl.co
  exempletes.info
  exenberger.at
  exeobmens.com
@@ -171881,7 +152767,6 @@ expertlogisticsindian.com
  expertsteelset.pl
  expertswebservices.com
  expiable-hopes.000webhostapp.com
-explainfinish.cloud
  explathe.xyz
  explcisms.com
  expleffienal.info
@@ -172360,8 +153245,9 @@ f0486646.xsph.ru
  f0487671.xsph.ru
  f0490078.xsph.ru
  f0490470.xsph.ru
-f0495320.xsph.ru
-f0495332.xsph.ru
+f0495086.xsph.ru
+f0497360.xsph.ru
+f0497457.xsph.ru
  f04qvvbwwhmxc09y.com
  f0b.casa
  f0bea11ce084c97ca99bce9df2a07eec-dot-dbenitonline.ey.r.appspot.com
@@ -172512,7 +153398,6 @@ fabiobabini.com
  fabiogutierrez.com.br
  fabiotrad.com.br
  fabit-systems.com
-fableticsusnew.top
  fabn.goruli.com
  fabook12.000webhostapp.com
  fabooklatco-login-com11005678900987654321.filesusr.com
@@ -172851,7 +153736,6 @@ facebook-ads-manager.id4892011844.com
  facebook-ads-manager.listing-ad-id2919671273.com
  facebook-ads-manager.listing-ad.id8237691611.com
  facebook-ads-manager.search-results-local-properties-for-sale.us
-facebook-and-video.weebly.com
  facebook-app-video.weebly.com
  facebook-app-videos.weebly.com
  facebook-applogin.cf
@@ -173487,7 +154371,6 @@ facebook.com.multitechlabs.com
  facebook.com.mx.plclatam.com
  facebook.com.mxseller.com
  facebook.com.onlinegiveaway.net
-facebook.com.pages.casa
  facebook.com.profile000102457539.info
  facebook.com.rajchhetri.me
  facebook.com.rdfodyfuksgbw.com
@@ -173631,7 +154514,7 @@ facebook.mhrtrading.com
  facebook.mobileappsfb.club
  facebook.motthavenbar.com
  facebook.my-domino.eu
-facebook.my-domino.online
+facebook.my-domino.pl
  facebook.myaccount-e7hu3kf.com
  facebook.nac.ge
  facebook.nuebeyywo.ga
@@ -173691,7 +154574,6 @@ facebook.verified-online-members.com
  facebook.verifikasi-blokir.ml
  facebook.weblls.com
  facebook.webservis.ru
-facebook.worldtrade-llc.com
  facebook.wpcoders.online
  facebook.ytznews.com
  facebook.zi10.cf
@@ -174183,6 +155065,7 @@ fagnersilva.com.br
  fahadps.000webhostapp.com
  fahamsaham.com
  fahd2010.ddns.net
+faheycwqblaczrflo-dot-mandax.oa.r.appspot.com
  fahreddin.info
  fahrschule-a-hoffmeister.de
  fahrzeuge-detalis.com
@@ -174648,14 +155531,12 @@ fashionjourney.xyz
  fashionmall4u.com
  fashionmusicalinstrumentmall.xyz
  fashionnationwin.ru
-fashionnow.biz
  fashionphotographycourse.com
  fashionrunway.000webhostapp.com
  fashionshoesbykfcom.batwoqisent.top
  fashionspace.in
  fashionstreets.co.uk
  fashiontattoo.xyz
-fashiontoday.biz
  fashionupnext.com
  fashionvista.us
  fashporium.shop
@@ -174748,7 +155629,6 @@ fathertrot.org
  fathina.co
  fathomable-binocula.000webhostapp.com
  fathostc.com
-fathschzsdjuccwq-dot-owaonk399399393.uk.r.appspot.com
  fatigued-teams.000webhostapp.com
  fatileogroup.com
  fatimaferreira.com
@@ -174759,7 +155639,6 @@ fatmanurtaskesen.com
  fatopetshop.com
  fatpenis.theworkpc.com
  fatrecipesdoc.com
-fatridge.cloud
  fatrockermusic.com
  fatrolfordpd.com
  fatsnake.duckdns.org
@@ -174808,7 +155687,6 @@ faustundhaus.de
  fautjzvjykmbihjd-dot-millinium.ey.r.appspot.com
  fauwxjcbjzeeruld-dot-millinium.ey.r.appspot.com
  fav1.ru
-favdazaojr.wang
  favglbgboxdkbzih-dot-millinium.ey.r.appspot.com
  favilnius.lt
  favinho.com.br
@@ -176493,6 +157371,7 @@ fcpro.pt
  fcpzjwwybtrtmhbbickjepdnkg-dot-gloff849483.uk.r.appspot.com
  fcrbn.goruli.com
  fcrly.com
+fcrreyedjzpnynvj-dot-motast.nw.r.appspot.com
  fcs.ci
  fcshenghui.com
  fctcrear.000webhostapp.com
@@ -176577,6 +157456,7 @@ fdrptdrmtueidpis-dot-millinium.ey.r.appspot.com
  fdrt.duckdns.org
  fdsaty-71.ml
  fdsawertygt.gq
+fdsawsupport.com
  fdsdfgdfgdf.ru
  fdsdy.co
  fdsfddfgdfgdf.ru
@@ -176727,7 +157607,6 @@ fegatech.com
  feggg.7jtba3.cn
  fegrp-download.com
  fegytxmqxkbzmxkrnxkliykbnxorixssnred-dot-off94032393204.uk.r.appspot.com
-fehler-451.de
  fehler-siegen.de
  feiashao.space
  feicuixue.com
@@ -176906,7 +157785,6 @@ ferolt.com
  ferozainternational.com
  ferramentariahonorio.com.br
  ferramentariamorais.com.br
-ferramentascnp.site
  ferraraconsultores.com.mx
  ferreiraservicoseletricos.com.br
  ferretphobos.com
@@ -176930,7 +157808,6 @@ fertilizarsrl.dynalias.com
  fertperfect.netlify.app
  fertway.com.br
  fervent-almeida-5d322e.netlify.app
-fervent-blackwell-938898.netlify.app
  fervent-fermi-24cf74.netlify.app
  fervent-jones-3bf2ab.netlify.app
  fervent-liskov-d44a90.netlify.app
@@ -176959,7 +157836,6 @@ festival.zpubgz.com
  festivalcigar.com
  festivalcup.nl
  festivaldescons.fr
-festivalfrostnews16.com
  festivalmadiba.com
  festivaloffers.xyz
  festive-blackwell-13e96d.netlify.app
@@ -177547,6 +158423,7 @@ filterfleet.club
  filteroggy.pw
  filteronsnap.000webhostapp.com
  filthy-peel.ga
+filthyoddpentagon.adasdfff.repl.co
  filto.ml
  filuscredits.com
  filyoshaber.com
@@ -177732,6 +158609,7 @@ finet.net
  finewine.ga
  finezza.co.ke
  fingerlakesconnections.com
+fingertop.monster
  finik18topw.cc
  finished-reliabilit.000webhostapp.com
  finishedmarketingx.com
@@ -177852,7 +158730,6 @@ firmaza1grosz.pl
  firmendealsde.chifanassume.top
  firmeza.mx
  firmpartnerings.com
-firmrocket.cloud
  firmyb2b.pl
  firnabulking.com
  firoznadiadwala.com
@@ -178291,6 +159168,7 @@ flamboyant-carson-fdb74e.netlify.app
  flamboyant-curran-b75893.netlify.app
  flamboyant-euclid.netlify.com
  flamboyant-hugle-470038.netlify.app
+flamboyant-wiles-fafcbb.netlify.app
  flame-burger.com
  flameare-71.gq
  flames4drop.com
@@ -178331,7 +159209,6 @@ flashsale88.com
  flashsalesdom.com
  flashsupportupdate2020.weebly.com
  flashviewers.com
-flatabellytosakdjodj.us
  flatbellytipsde.us
  flatbottle.com.ua
  flatearthdirect.com
@@ -178789,7 +159666,6 @@ focus.by
  focusbrand.cn
  focused-almeida-639b46.netlify.app
  focused-banach-1fecd7.netlify.app
-focused-goldberg-ddd972.netlify.app
  focusedsecondaryregression--five-nine.repl.co
  focusedvisual.com
  focusmktcancun.com
@@ -178952,6 +159828,7 @@ foraproletarianparty.org
  foraystrumem.xyz
  forb-fbookcom-04601903.ctiaspire.com
  forb-fbookcom-079648419309.ctiaspire.com
+forb-fbookcom-195550868.ctiaspire.com
  forb-fbookcom-216608940.ctiaspire.com
  forb-fbookcom-381203219364.ctiaspire.com
  forb-fbookcom-43648030414.ctiaspire.com
@@ -179047,6 +159924,7 @@ forgetthebudget.com
  forgivenesseffect.com
  forgnogcy.info
  forgoal7.co.vu
+forgoodhealth.work
  forgotaccount-appleverifys.com.vezfrke.com
  forhealthyfamily.com
  forinedexline.gq
@@ -179082,12 +159960,12 @@ form.ref10-return.com
  form.support-updateaccid.bnlpes.com
  form.typeform.com
  form8.sadek-webdesigner.com
-formacao.org.br
  formacioncis.com
  formacionz.com
  formafitness.com.br
  formal-audio-279012.uc.r.appspot.com
  formalab.info
+formalbody.cyou
  formalincom.nckiamerican.gdn
  formandbackground.com
  formanymens24.co.com
@@ -179370,7 +160248,6 @@ fpqkl.com
  fpqnstvuiukqokak-dot-millinium.ey.r.appspot.com
  fpqvu8fp.firebaseapp.com
  fpqwlybynyjomwqw-dot-millinium.ey.r.appspot.com
-fprukmltlyjjpsgg-dot-owaonk399399393.uk.r.appspot.com
  fps1w.svcoding.com
  fpsdz.net
  fpstjxtzjleqczrc-dot-millinium.ey.r.appspot.com
@@ -179532,6 +160409,7 @@ franklino901.com
  franklyn.nikhilsangy.com
  frankrebe21342.com
  frankroth.com
+franks0912.com
  franksmith.co
  franktechnik.com
  frannewarive.xyz
@@ -179686,6 +160564,7 @@ freeclaim.my-garena3.ml
  freeclaimmembernew.ga
  freeclaimmembernew.gq
  freeclaimpubgm14.zzux.com
+freeclaimskinm.otzo.com
  freecomus.shuiaeat.top
  freecontent.date
  freecontent.stream
@@ -179776,6 +160655,7 @@ freefreightquote.net
  freegamesviking.com
  freegate023.homeftp.net
  freegiftcardd.000webhostapp.com
+freegiftlucky.cf
  freegifts4455.000webhostapp.com
  freegiveaway.sytes.net
  freegiveaway00.000webhostapp.com
@@ -179788,7 +160668,6 @@ freehotersmailers.buzz
  freeinfo.it
  freeinstafollowers47k.000webhostapp.com
  freeinstafollowersinstant.000webhostapp.com
-freeitempubgnewss112.mrslove.com
  freeitemspinn.com
  freejface.000webhostapp.com
  freejoingrubsb.otzo.com
@@ -179868,6 +160747,7 @@ freerock.000webhostapp.com
  freerullete500.000webhostapp.com
  freeseotraining.in
  freeshop1122.000webhostapp.com
+freeskibepucf.otzo.com
  freeskin-v2.mrbasic.com
  freeskinclaimnow.com
  freeskineventpubg.jetos.com
@@ -180076,6 +160956,7 @@ friend123321.000webhostapp.com
  friendly-benz-f5a10e.netlify.app
  friendly-clarke-3697d8.netlify.app
  friendly-feynman-34bc35.netlify.app
+friendly-leakey-be1b69.netlify.app
  friendly-stonebraker-12bd85.netlify.app
  friendlycabdavis.com
  friendlydonkey-26f4.azurewebsites.net
@@ -180203,7 +161084,6 @@ frosty-ardinghelli-2fad11.netlify.app
  frosty-benz-329e5d.netlify.app
  frosty-bore.netlify.com
  frosty-curie-82a6dc.netlify.app
-frosty-heisenberg-b7f927.netlify.app
  frosty-nobel-ca7f68.netlify.app
  frosty-ramanujan-09342d.netlify.app
  frosty-ramanujan-a68bb2.netlify.app
@@ -180679,7 +161559,6 @@ fushfkjshdlkdj.org
  fushun.yfqzdfd.com
  fusion-school.com.ua
  fusionautosales.net
-fusiondigitalinfo.com
  fusionenterprises.ca
  fusionfiresolutions.com
  fusionmediafilms.com
@@ -180911,6 +161790,7 @@ fyxmkcsodhmniili-dot-millinium.ey.r.appspot.com
  fyyz0.codesandbox.io
  fz-mabrouki.com
  fz124ejfs034gadshbaf23.monster
+fzaliwaqjcsbwobfuhldzyxuyk-dot-idyllic-chimera-296111.et.r.appspot.com
  fzasdjrgoivaqung-dot-millinium.ey.r.appspot.com
  fzbfhn.webwave.dev
  fzbxbj.com
@@ -181085,6 +161965,7 @@ gabi.fenixpuntonet.com
  gabidesign.it
  gabifrota.com
  gabisan-shipping.com
+gablandscapes.com
  gabona-ca.000webhostapp.com
  gabonembassyuk.co.uk
  gabonggropbokep.freedm7.com
@@ -181322,7 +162203,6 @@ galinapotapova.com
  galja.xxuz.com
  gallag.000webhostapp.com
  gallaidur.com
-gallant-lamport-25795f.netlify.app
  gallant-mcclintock-bb8625.netlify.app
  gallant-northcutt-0c0fcb.netlify.app
  gallant-snyder-9f35e9.netlify.app
@@ -181575,7 +162455,6 @@ garedhsred.net
  garena-a.ru
  garena-com99.tk
  garena-diamante-agosto.com
-garena-free-fire-bonus-clientes-login-2020-incio.operacions-clientesperu.com
  garena-freefire39.tk
  garena-gratisdiamond.ocries.com
  garena-reedem-kode-2020.000webhostapp.com
@@ -182031,7 +162910,7 @@ geaceleaf.com
  geannsmi.com
  gearandtours.com
  geardox.site
-gearmonarchy.top
+geargarblog.com
  geartatin.com
  gearybush.com
  geaswer.com
@@ -182068,6 +162947,7 @@ geeksknowthis.com
  geekwork.pl
  geekyhillbilly.com
  geekyjuice.com
+geelyparaguay.com
  geenicreations.com
  geepaulcast.com
  geeryuio.work
@@ -182176,7 +163056,6 @@ generadorbylsd.000webhostapp.com
  generadorpunto.weebly.com
  general-broker.com
  general-catalog.net
-general-enlineab.webcindario.com
  general-memberships-privileges.info
  general-play.com
  general-video.net
@@ -182258,7 +163137,6 @@ genuinevivah.com
  genuskinusa.com
  genvtrydh.com
  genx-technology.com
-genxongnta.wang
  genxphones.com
  genyomalhas.com.br
  genzlvlt.com
@@ -182523,6 +163401,7 @@ getgohelp.com
  getgondidawvnbs.info
  getgoodvideo.com
  getgrowextrainches.com
+gethalloweeks.com
  gethardagain.net
  gethealthierhair.icu
  gethelp-update-mythree.co.uk
@@ -182645,7 +163524,6 @@ getvideoplay.com
  getvision2020.net
  getx8.com
  getyahoo.weebly.com
-getyoudollars.com
  getyouinfo.com
  getyournameinthegame.com
  getyourslot.com
@@ -182720,6 +163598,7 @@ gfjl.com.cn
  gfknoohfndnllhjr-dot-millinium.ey.r.appspot.com
  gfmtrader.com
  gfnewagh.com
+gfniwqvswuqpdtrj-dot-motast.nw.r.appspot.com
  gfnlmtcolrrb.pw
  gfocubzbtxcz.top
  gfojysakqu.topkorder.su
@@ -182925,7 +163804,6 @@ ghjkljj6.com
  ghjoxrqfbfngmfke-dot-millinium.ey.r.appspot.com
  ghjsbhenwdklm.weebly.com
  ghk987k.wgygug.xyz
-ghkysfgfcv.us
  ghlobal.anericanexfress.com.hjscuremai.gbdlaoied.com
  ghlpclb.goruli.com
  ghluuuwter.yujtrewtrey.from-ms.com
@@ -183001,7 +163879,6 @@ giantsinthesky.com
  gianttedopitli.ml
  giaodichbds247.com
  giaogasnhanh.com
-giaosuduongtronghieu.com
  giardinosullamaremma.it
  giasplayground.com
  giasso.com
@@ -183051,13 +163928,11 @@ gifs.vone.appskhonia.com
  gift-itemspubg.qhigh.com
  gift-spin.club
  gift-update-ml.cp-servlk.xyz
-giftaway10jt.myddns.rocks
  giftcardonlinechecker.com
  giftcardvalidation.com
  giftcerthelp.com
  gifted-blackwell-53ea1c.netlify.app
  gifted-goodall-ffa09f.netlify.app
-gifted-kalam-fc8e3d.netlify.app
  gifted-meitner-f631bf.netlify.app
  gifted-perlman-d02576.netlify.app
  gifted-shannon-408a18.netlify.app
@@ -183139,6 +164014,7 @@ gillianlindseymobley.casa
  gillingscamps.co.uk
  gilmarjanuariofreire.com
  gilogigamaster.top
+gilorese.com
  gilstrap-sneed.com
  gim-par.com
  gim8.pl
@@ -183318,7 +164194,6 @@ giveawayuang16.25u.com
  giveawayuang3.25u.com
  giveawayxhadiah.toh.info
  giveawayzone.ga
-givecitizen.cloud
  givehopeahand.org
  givejameswhitetheball.com
  givelucky-spin.wikaba.com
@@ -183392,7 +164267,6 @@ gjousf.les3h9.cn
  gjoyivxweuybklndkttnvecrtv-dot-gleowayel400503.uc.r.appspot.com
  gjr8.loveapple911.com
  gjrdtzrmuyjyhxomchswxrucnufymxgoyrjm-dot-gl494903049.wl.r.appspot.com
-gjsqnejvbzwfrixjkockyvhbfz-dot-owaonk399399393.uk.r.appspot.com
  gjsskveippuwhyqp-dot-millinium.ey.r.appspot.com
  gjst.svcoding.com
  gjtcrkkab.goruli.com
@@ -183730,6 +164604,7 @@ glosowanie-link.eu
  glosowanie-quiz.eu
  glosowanie-voucher.eu
  glossarial-marines.000webhostapp.com
+glossypowerlesstitle.adasdfff.repl.co
  glosuj-konkursy.eu
  glosuj-pomaganie.eu
  glosujemy-konkursy.eu
@@ -184377,6 +165252,7 @@ goofy-heisenberg-024343.netlify.app
  goofy-heisenberg-557073.netlify.app
  goofy-mcclintock-a02634.netlify.app
  goofy-shannon-7573c7.netlify.app
+goofy-wozniak-611f32.netlify.app
  googeoffice.netlify.app
  googgle.live
  googieapls.com
@@ -184478,7 +165354,6 @@ goooogleadsence.biz
  goopaw.com
  gooqleadvstat.com
  gooqlemgrteg.com
-gooroo.co.uk
  goosailichewurmane.xyz
  goosepower.com
  gooshoosemap.com
@@ -184697,7 +165572,6 @@ gov.hmrc.tax-reclaim.co
  gov.hmrc.tax-refunduk.co
  gov.hmrc.uk-reclaim.com
  gov.hmrc.uktaxrefund.uk
-gov.national-advice.org
  gov.pandemic-assistance.org
  gov.pandemic-information.digital
  gov.pandemic-recovery.org
@@ -184721,7 +165595,6 @@ gov.regain-tax.com
  gov.regainmytax.com
  gov.return-pay1.com
  gov.return-pay2.com
-gov.returns-help.com
  gov.support-gb-form.com
  gov.support-grnt.com
  gov.supporting-grant.co.uk
@@ -185006,6 +165879,7 @@ graal-gj.com
  grab2go.ca
  grabanski.com
  grabaocio.com
+grabbag4you.casa
  grabbark.com
  grabberweter.000webhostapp.com
  grabbitshop.com
@@ -185040,11 +165914,11 @@ gracewellscare.co.uk
  grachan.jp
  graciaberlin.com
  gracievideosmilfig.000webhostapp.com
-gracious-benz-745f90.netlify.app
  gracious-benz-c057e6.netlify.app
  gracious-colden-d8c349.netlify.app
  gracious-goldstine-6f9ab9.netlify.app
  gracious-lovelace-3d7ab6.netlify.app
+graciousfabulousmass--five-nine.repl.co
  graciouslyyourssydney.com
  graciouswordsmith.online
  gradamossine.nl
@@ -185099,6 +165973,7 @@ grandholidayvacations.in
  grandhomesgroup.com
  grandhospitall.com
  grandinvestment.com
+grandiose-luxurious-avocado.glitch.me
  grandiosemidnightbluetranslations--five-nine.repl.co
  grandirensemble85.com
  grandmarketltd.co.uk
@@ -185215,7 +166090,6 @@ greaterpudding.com
  greatestcolorsanddesign.com
  greatesttwitchpatriarch20.com
  greatfollowing.com.s3-website-ap-southeast-1.amazonaws.com
-greatgain.cloud
  greathalf.000webhostapp.com
  greatindiadeals.xyz
  greationnmsans.com
@@ -185597,6 +166471,7 @@ group-wa-bokep-terbaru.giize.com
  group-watsapp-me18.jetos.com
  group-whatsaop-xx.hostjaya-free.cf
  group-whatsapp-bokep2020.dumb1.com
+group-whatsapp-vii26.cf
  group-whatsapp-viip25.cf
  group-whatsapp-viip28.cf
  group-whatsapp-viral18plus.grup-syg.ml
@@ -186829,6 +167704,7 @@ grupmalangbong.000webhostapp.com
  grupmantepbener.000webhostapp.com
  grupmemekcoy.000webhostapp.com
  grupmpr.br.com
+grupnatasya.forumz.info
  grupnew-whatsapp2020.justdied.com
  grupnewjoin2020.gets5.com
  grupnewsexindo19.free17.cf
@@ -186975,6 +167851,7 @@ gruppobpm-italia.com
  gruppogm.net
  gruppointesa-attivazione-sicurezza.com
  gruppointesa.biz
+gruppointesa.nl
  gruppointesaisp.info
  gruppoisp-online.com
  gruppoisp-psd2.com
@@ -187561,6 +168438,7 @@ gt30.addroits.com
  gt786.al1av.com
  gta-fast.pro
  gta5hx.com
+gtadlrvxiepqtnrt-dot-motast.nw.r.appspot.com
  gtafbchq.rogagot.com
  gtavista.com
  gtaxonline.com
@@ -187711,17 +168589,21 @@ guide-13548252.zjlions.org
  guide-20922961.zjlions.org
  guide-25862689.zjlions.org
  guide-26644759.zjlions.org
+guide-31972066.zjlions.org
  guide-33638921.zjlions.org
  guide-35053861.zjlions.org
  guide-35309792.zjlions.org
  guide-43661525.zjlions.org
+guide-45493304.zjlions.org
  guide-45612749.zjlions.org
  guide-55264331.zjlions.org
+guide-57409539.zjlions.org
  guide-57747925.zjlions.org
  guide-58187148.zjlions.org
  guide-60399268.zjlions.org
  guide-68190176.zjlions.org
  guide-69042808.zjlions.org
+guide-73234043.zjlions.org
  guide-81027605.zjlions.org
  guide-84402677.zjlions.org
  guide-86385722.zjlions.org
@@ -187735,7 +168617,6 @@ guider1.com
  guiderite.org
  guides.prostruction.net
  guidescience.com
-guideshed.cloud
  guidesshop.com
  guidex.eu
  guido-mockel.de
@@ -187779,6 +168660,7 @@ gulhanhukuk.com
  gullihobber.de
  gullukomurelektronik.com
  gulosodeoz.com
+gulshanti.com
  gultetp.000webhostapp.com
  gulvuchtdkrltbtn-dot-millinium.ey.r.appspot.com
  gulxzpknhpcwhnpv-dot-millinium.ey.r.appspot.com
@@ -187869,7 +168751,6 @@ gutmannloaf.xyz
  gutskins.site
  gutturopalatine.xyz
  guudprints.com
-guujraat.casa
  guvenli-girisyap.blogspot.li
  guvex.myftp.info
  guyanansquare.space
@@ -188328,7 +169209,6 @@ habibi.gotdns.ch
  habibme.net
  habibzarifeh.com
  habiladj.com
-habilidadsocialdelaspersonas.com
  habita.org.br
  habitantmousere.com
  habitantpumpion.com
@@ -188397,7 +169277,6 @@ hacquetfr.chifanblow.top
  hada.com.vn
  hadex-eg.com
  hadiaabdullah.com
-hadiahayooz.myz.info
  hadiahclaim99.000webhostapp.com
  hadiahgratisff98.tk
  hadiahmu.ooguy.com
@@ -188577,6 +169456,7 @@ halfs-71.tk
  halfwayor.com
  hali-alerts-secure.com
  hali-alerts.com
+hali-approve-newdevice.com
  hali-cancel.live
  hali-devicelinked.com
  hali-devicepaired.com
@@ -188596,11 +169476,10 @@ hali-newpayeeremoval.com
  hali-official-bank.com
  hali-payee-alerts.com
  hali-payee-cancel.com
-hali-payee-device.com
  hali-payeepanel.com
+hali-preventpayee.link
  hali-removepayee.com
  hali-reviewpayee.com
-hali-reviewpayee.link
  hali-secure-icancel.com
  hali-secure-my-online-banking.com
  hali-secure-payee.live
@@ -188613,7 +169492,7 @@ hali-securityvaldation.com
  hali-suspicious-activity.com
  hali-suspiciouslogin.com
  hali-unaddpayee.com
-hali.access-online-login.live
+hali.access-online.live
  hali.add-newpayee.com
  hali.device-linked.com
  hali.disable-mypayee.com
@@ -188659,6 +169538,7 @@ halifax-authorize.com
  halifax-bank-alerts.com
  halifax-bank-mobile-alerts.com
  halifax-bank-online.com
+halifax-bank.link
  halifax-bankalerts.com
  halifax-banking-alert.com
  halifax-banking-alerts.com
@@ -188820,6 +169700,7 @@ halifax-payeesecurelogin.com
  halifax-payeeservice.com
  halifax-payeeservices.com
  halifax-payeeupdate.com
+halifax-paym-auth2.com
  halifax-paymentauthentication.com
  halifax-paymentauthorize.com
  halifax-paymentconfirm.com
@@ -188874,6 +169755,7 @@ halifax-secure-payee.com
  halifax-secure-payment.com
  halifax-secure-youraccount.com
  halifax-secure.info
+halifax-secure.live
  halifax-secure.online
  halifax-secure.verify-checkpayee.com
  halifax-securebanking.com
@@ -189426,6 +170308,7 @@ halifax.user-activity.com
  halifax.v3rif.com
  halifax.valid-payee.co.uk
  halifax.validate-activity.com
+halifax.validate-device-security.com
  halifax.validate-online-security.com
  halifax.validation-signin.com
  halifax.verif3y.com
@@ -189441,7 +170324,6 @@ halifax.verify-mydevice.com
  halifax.verify-payee-ref101.com
  halifax.verify-payee-ref13.com
  halifax.verify-payees.co.uk
-halifax.verify-unknown-device.com
  halifax.verify-unregister.com
  halifax.verify.uk.payee-securecheck.com
  halifax.verifymy-device.co.uk
@@ -189497,6 +170379,7 @@ halifaxfraudprotection.com
  halifaxfraudprotectionuk.com
  halifaxfraudresponseteam.com
  halifaxfraudteam.com
+halifaxgroupalerts.com
  halifaxgroupsecurity.com
  halifaxhelper.com
  halifaxid.it
@@ -189884,6 +170767,7 @@ hardcore-bell-fee8b7.netlify.app
  hardcore-clarke-52f90e.netlify.app
  hardcore-goldberg-324ede.netlify.app
  hardcore-kare-42d7c9.netlify.app
+hardcore-leakey-4d502c.netlify.app
  harddecisions.info
  harddecisions.org
  harddrive-recoverys.top
@@ -190401,6 +171285,7 @@ healing-yui223.com
  healingfigures.com
  healinghandsonthemove.com
  healingscienceresearch.com
+healingsystem.icu
  healmedicaltrauma.com
  healorganix.com
  health-and-beauty.pw
@@ -190436,7 +171321,6 @@ healthfirst-supply.com
  healthfirstbako.com
  healthgadzets.com
  healthgov-ca19.com
-healthhack.buzz
  healthiean.com
  healthief.best
  healthifyafrica.com
@@ -190449,6 +171333,7 @@ healthtekinc.com
  healthteq.tk
  healthtipsadvisor.com
  healthtrackbd.com
+healthtrick.work
  healthwiseonline.com.au
  healthy-challenge.in.ua
  healthy2infinity.com
@@ -190498,7 +171383,6 @@ heathered-busy-lightyear.glitch.me
  heathmowing.com
  heathrowairport-hotels.com
  heathrowtaxi.org
-heathvinius.casa
  heatingcoolingrepairservices.com
  heatingrug.com
  heatlyt.site
@@ -190510,7 +171394,6 @@ heavenhomerealtors.com
  heavenif.co.za
  heavenly-owners.000webhostapp.com
  heavenlydayspa.co.in
-heavenspeech.cloud
  heavy-71.ml
  heavy-equipo.com.pa
  heavyarmorsecurity.com
@@ -190970,6 +171853,7 @@ helpforpayment.000webhostapp.com
  helpforteam.com
  helpforviolatiom.000webhostapp.com
  helpforwindowsfile.com
+helpful-checkered-tilapia.glitch.me
  helpgamewow.cn
  helphomewelcomeshowdown.com
  helpinfo-amazon.servebeer.com
@@ -191293,7 +172177,7 @@ heuristic-davinci-7ea775.netlify.app
  heuristic-galileo-603085.netlify.com
  heuristic-goodall-bba8fa.netlify.app
  heuristic-jackson-bb67ca.netlify.app
-heuristic-pasteur-051f1a.netlify.app
+heuristic-kalam-fc336c.netlify.app
  heuristic-varahamihira-fec04e.netlify.app
  heviaqdrxwkcwuak-dot-millinium.ey.r.appspot.com
  hevizapartments.net
@@ -191957,12 +172841,10 @@ hjertevennlig.no
  hjesseseafoods.co.uk
  hjfeyu.club
  hjg.aqzsqsu.cn
-hjg.cskiah.cn
  hjg.dbjrowq.cn
  hjg.dbprdrn.cn
  hjg.eaebacc.cn
  hjg.gnrvnuv.cn
-hjg.jbbhtxn.cn
  hjg.jdxgwv.com.cn
  hjg.jfpbdn.com.cn
  hjg.jxlxtvh.cn
@@ -192220,7 +173102,6 @@ hmdrnuks.gotdns.ch
  hmebingerville.ci
  hmemzfjyxkqztpmv-dot-millinium.ey.r.appspot.com
  hmgj56hjtr.ddns.net
-hmgov-rebateform.com
  hmgovrc.com
  hmgsyypecwwzmbyyqxsivmigoyazvbpogoul-dot-glxcel49934343434.rj.r.appspot.com
  hmgwvseoylehymyfkjplnaztthguvqppvnwe-dot-cryptic-now-290917.ey.r.appspot.com
@@ -192830,7 +173711,6 @@ holidayinnboston.com
  holidayrentalgaucin.com
  holidays.hu
  holidaytihicom.shaxiabed.top
-holiestbloke.top
  holiganbetgiris.blogspot.com
  holiganbett1.blogspot.com
  holiganguncelgir.blogspot.com
@@ -192994,7 +173874,6 @@ homeforsale.facebokmarkettplace.com
  homeforsale.fbksmarketplace.us
  homeforsale.remaxmarketplace.us
  homeforsale.remaxmarketplacefbk.us
-homegym.vn
  homegymrebel.com
  homehealthot.net
  homehousedeal.com
@@ -193005,7 +173884,6 @@ homelandpropertyservices.co.uk
  homelandsecgov.com
  homelearningoficial.com
  homelier-ideal.000webhostapp.com
-homeloogiinbt.weebly.com
  homemadefbprofile.000webhostapp.com
  homemadefoodinkodambakkam.com
  homemadefoodmarket.com
@@ -193162,7 +174040,6 @@ hoomellhic.com
  hoomokef.com
  hoopearrings.000webhostapp.com
  hoopsnsand.com
-hoorror.cam
  hoosegowbeau.com
  hooseromele.club
  hoosevents.com
@@ -193173,7 +174050,6 @@ hootellarahalik.com
  hooucymivenpe.tk
  hopebuildersusa.com
  hopefinances.com
-hopeful-agnesi-39eab9.netlify.app
  hopeful-heisenberg-6b8cf3.netlify.app
  hopeful-hopper-597db0.netlify.app
  hopeful-mayer-24c3c1.netlify.app
@@ -193764,7 +174640,6 @@ hpshowroominchennai.in
  hpsiqtdocqofzstaeaxlwyrtrafubwhwkxcb-dot-cryptic-now-290917.ey.r.appspot.com
  hpskins.site
  hpsssbclass.000webhostapp.com
-hpstudyhub.com
  hpstudymaterialfreejobportalsinindia.000webhostapp.com
  hpsupport.site
  hptjagvmkimuzjpy-dot-millinium.ey.r.appspot.com
@@ -194005,6 +174880,7 @@ hs-suspicious-activity.co.uk
  hs-tonotifprosec.com
  hs-transaction-support.com
  hs-uk-remove-payee.com
+hs-unusual-activity.uk
  hs-verify-alertpayee.com
  hs-verify-me.net
  hs-verify-payments.com
@@ -194157,6 +175033,7 @@ hsbc.payee-alert.uk
  hsbc.payee-authorisation-3483.info
  hsbc.payee-authorise.co.uk
  hsbc.payee-cancel.uk
+hsbc.payee-deviceremove.com
  hsbc.payee-failure-cc.co.uk
  hsbc.payee-instruction.com
  hsbc.payee-personal.com
@@ -194451,6 +175328,7 @@ httpcolonforwardslashforwardslashwwwdotjenniferdanieldotcom.com
  httpfb-profille-judieeisidora.club
  httpfuturasciencesez.fr
  httpgoogledotcom.com
+httpmackmerreaattloginportal.weebly.com
  httppaypal.com.21stglobalequipment.org
  https-bbuanetcashspe.com
  https-bbuanetcaslhpe.com
@@ -194531,7 +175409,6 @@ huahinbridge.com
  huaian.06rl.com
  huaibangchina.com
  huaihua.06rl.com
-huaiingtzhu.wang
  hualish01.com
  huananzixun.com
  huangao6.com
@@ -194601,6 +175478,7 @@ huginyazarkasa.com
  hugomartinez.lopedevega.es
  hugout.tk
  hugoversichert.de
+hugozijtveld.nl
  hugwvxorcnvskhqj-dot-millinium.ey.r.appspot.com
  huhucow.com
  huhucow2.com
@@ -194614,7 +175492,6 @@ huictiathm.com
  huierti.cam
  huiertop.cam
  huifande.com
-huihanstin.wang
  huijlzzfvuggycvcdvahugznmbsloauxsiuf-dot-cedar-code-289917.nn.r.appspot.com
  huimoyu.com
  huiort.cam
@@ -194626,11 +175503,10 @@ huituda.com
  huityye.cam
  huiuioo.cam
  huiuytop.work
+huiweop.work
  huixingqiti.com
-huiyansze.wang
  huiyunrenjia.com
  huizhou.06rl.com
-huiziwavpe.wang
  hujandf.dynamic-dns.net
  hujjbsspnntoqwgwtvxzyzpunhobszusahii-dot-cryptic-now-290917.ey.r.appspot.com
  hujkl.info
@@ -194705,7 +175581,6 @@ hungerplanet.in
  hungertriathlon.com
  hunggiang.vn
  hunghuhuhjij1.duckdns.org
-hungry-clarke-fe66eb.netlify.app
  hungry-hawking-475114.netlify.app
  hungry-shockley-48c31c.netlify.app
  hungry-spence-11dfff.netlify.app
@@ -194746,7 +175621,6 @@ huntleyandassociatesfileportal.ml
  huntoperator.com
  huntsvilleae.buzz
  huntsvillelistings.buzz
-huoioiu.cam
  huojianqp.com
  huopty.cf
  huopty.ga
@@ -194760,6 +175634,7 @@ huqqkjecibzwvbcl-dot-millinium.ey.r.appspot.com
  hurdfloorinmi.cf
  hurerrowtviorfbqbnrfnvhvwo-dot-secret-argon-296111.uk.r.appspot.com
  hurkolezs.cloudaccess.host
+hurlfork.monster
  hurrican.sk
  hurricanechain.com.au
  hurried-lubricants.000webhostapp.com
@@ -194785,6 +175660,7 @@ husqvarnaweedeaterguide.com
  husredinc.com
  huss9922.0fees.us
  hussein.shop
+hussenah.work
  husstingbr.000webhostapp.com
  hustchellcap.com
  hustdomains.host
@@ -194807,7 +175683,6 @@ hutr.dermals.org
  hutruzcwqnpbccrz-dot-millinium.ey.r.appspot.com
  huttechservices.nl
  hutwhitmplt.com
-hutyui.work
  huupkhbwk.rogagot.com
  huvudstadsguiden.eu
  huxdsrladybxvazbqvxmcjurgf-dot-gleowayel400503.uc.r.appspot.com
@@ -195020,7 +175895,6 @@ hydrov.co.uk
  hydrowateronline.com
  hydruss-group.com
  hydrzogtnmarzch.com
-hydxxxx.web.app
  hyedg.xyz
  hyetiarice.com
  hyey.cn
@@ -195442,6 +176316,7 @@ ibrluzdevida.org
  ibs.prodivorce.org
  ibsavenbenk.com
  ibssamalta.eu
+ibstat.icu
  ibtilmjenixiuekbayyzeyohoc-dot-gleowayel400503.uc.r.appspot.com
  ibtkar-tmuz.com
  ibtrfmmunhqsonlp-dot-millinium.ey.r.appspot.com
@@ -196006,7 +176881,6 @@ icscards-registratie.zap411911-1.plesk06.zap-webspace.com
  icscards-sca.web.nitro-host.space
  icscards-verificatie.club
  icscards.life
-icscards.nl.3dsecurebeveiliging.cy5.xyz
  icscards.nl.loginsca.xyz
  icscards.nl.scamijncard.xyz
  icserie.org
@@ -196060,7 +176934,6 @@ id-case-33069181.benueheritage.org
  id-covid19.com
  id-ee-billing.com
  id-ee-co.uk
-id-ee-mybill.com
  id-ee-online-update.com
  id-ee-page.com
  id-ee-payment.link
@@ -196291,7 +177164,6 @@ identifi11.temp.swtest.ru
  identifi14.temp.swtest.ru
  identifi1ez-vous.yolasite.com
  identifi21.temp.swtest.ru
-identifi22.temp.swtest.ru
  identifianoange.yolasite.com
  identifiant-icloud.com
  identifiant-particuliers.com
@@ -196665,6 +177537,7 @@ ifgwtoupcjbrecdshcrppxrmbmaapzltqdjn-dot-spyexc3093493.ey.r.appspot.com
  ifhbgixttpvpaylr-dot-millinium.ey.r.appspot.com
  ifhkmqqmquowhhiosqkibapabd-dot-gleowayel400503.uc.r.appspot.com
  ifhmcrs.com
+ificum.biz
  ifilo.com.tr
  ifindever.com
  ifindmy-iphone.support
@@ -196867,6 +177740,7 @@ igneouschamomile.com
  igneousnirvana.com
  ignin.weebly.com
  ignited-dev.com
+ignitefox.monster
  igniteinternationalschool.com
  ignitemarketingpros.com
  igniter.fobbly.net
@@ -197120,7 +177994,6 @@ ikmgnxgfvimqtmik-dot-millinium.ey.r.appspot.com
  ikmjuh.awsedrfgt.xyz
  iknodrop.it
  iknowadrian.com
-iknowthatarrival.org
  iknowx.info
  iknowyouarehere.pro
  ikny.info
@@ -197730,7 +178603,6 @@ inc-paquette-post-disponible.com
  inc-post-ch-paquette.net
  inc-post-swiss-ch.info
  inc-post-swiss-inc.com
-inc-postgal.com
  inc-postswiss-colis.com
  inc-servicedisponible.com
  inc-signin.live
@@ -197765,6 +178637,7 @@ includeshop-pyments.servehttp.com
  including-paypal.com
  includingfunds.net
  inclufdnb.info
+inclusaodeprotesto.me
  incluschile.cl
  incogra.com
  incom-post.s3.amazonaws.com
@@ -197858,6 +178731,7 @@ index.cgi.store.apple.com.manage-order.review
  index.kroppsfunktion.com
  index30.com
  indexdoll.top
+indexgridss.z19.web.core.windows.net
  indexlogincapo.ddns.net
  indexs.club
  indhrigroup.com
@@ -197983,6 +178857,7 @@ inek-mantap.edacswbyrd.com
  inelegant-oils.000webhostapp.com
  inemuriculturecom.nckithailand.gdn
  inenkoche.info
+inerntbakkinqdbs.com
  inesmanila.com
  inesmuellercom.shaxiaaverage.top
  inestagram.live
@@ -198006,6 +178881,7 @@ inf0-sc0t1a83i.com
  infallible-beaver-bee18e.netlify.app
  infallible-dijkstra-423dc7.netlify.app
  infallible-fermat-910259.netlify.app
+infallible-lamport-0a1fc9.netlify.app
  infallible-payne-732367.netlify.app
  infamousstrike.com
  infantbaptism.net
@@ -198106,7 +178982,6 @@ info-fakty24.pl
  info-https.com
  info-icloud.co
  info-iki.com
-info-instagram-verified-badge-center.tk
  info-kyufukinsoumu.congqgenfy.icu
  info-kyufukinsoumu.emtgdtc.cn
  info-lelang.000webhostapp.com
@@ -198699,6 +179574,7 @@ inmarsat.servehalflife.com
  inmayjose.es
  inmeayjnmcevchjqkdupackwrr-dot-gleowayel400503.uc.r.appspot.com
  inmed.vn
+inmetroexodus.com
  inmicade.tk
  inmobicenter.net
  inmobiliaria-lex.com
@@ -198945,6 +179821,7 @@ inspiredwindows.com.au
  inspirelaw.ca
  inspiring-allen-c6367a.netlify.app
  inspiring-mcclintock-a45b4f.netlify.app
+inspiring-meitner-1746b9.netlify.app
  inspiring-noyce-1c2b6d.netlify.app
  inspiring-panini-3fa481.netlify.app
  inspocoach.com
@@ -199102,7 +179979,6 @@ instagram-copyriight.com
  instagram-copyriqht.com
  instagram-coryping.com
  instagram-cpyright-center.cf
-instagram-destek.brsgrafiktasarim.com
  instagram-direct-login.ml
  instagram-dmcopyright.com
  instagram-dv5duopvkb.igshid.ga
@@ -199177,8 +180053,8 @@ instagram-premium.herokuapp.com
  instagram-privacy.com
  instagram-private.xyz
  instagram-recovery-challenge.dynamic-dns.net
+instagram-recovery.gq
  instagram-removecopyright.com
-instagram-rus.xyz
  instagram-scratchcardcontest.now.sh
  instagram-secure.de
  instagram-secure.net
@@ -199304,7 +180180,6 @@ instagram.fwfctg.org
  instagram.galaxyjb.ga
  instagram.gawner.cz
  instagram.google-safety.de
-instagram.helpcontactsupport.ml
  instagram.helpform.net
  instagram.helpsupported.ml
  instagram.helpteam.cf
@@ -199374,6 +180249,7 @@ instagramaccount.verified-now.tk
  instagramaccountconfirm.com
  instagramaccounthelpcenter.com
  instagramaccountsconfirm.cf
+instagramaccountsecuritytm.patopay.net
  instagramaccountverify.epizy.com
  instagramactiveaccount.com
  instagramactivity.com
@@ -199443,7 +180319,6 @@ instagramcopyrighthelpsgroup.com
  instagramcopyrightinfringement.org
  instagramcopyrightinfringementhelpservice.cf
  instagramcopyrightlivehelp.com
-instagramcopyrightmanagament.com
  instagramcopyrightmanager.com
  instagramcopyrightmedia.tk
  instagramcopyrightnotices.com
@@ -199726,7 +180601,6 @@ instalog3log.000webhostapp.com
  instalogin.xyz
  instaloginpage.xyz
  instalogtest.000webhostapp.com
-instalrevive.cloud
  instalserie.pt
  instamagnet.000webhostapp.com
  instamagnet01.000webhostapp.com
@@ -200110,6 +180984,7 @@ internaladvocate.com
  internalmedia.net
  internalrevenueservice-gov.com
  internalseg.com
+internaluntriedconferences.adasdfff.repl.co
  internaprima.co.id
  international-colis.ouiheberg.net
  international-sound-awards.com
@@ -200150,6 +181025,7 @@ internetbankieren-beveiligdeonlineomgeving.10web.site
  internetbanking-apps.com
  internetbanking-caixa.duckdns.org
  internetbanking-caixa.giize.com
+internetbanking-caixa.pgacc.fun
  internetbanking-prevention.com
  internetbanking.altiseinatbnk.com
  internetbanking.banpara-b.digital
@@ -200228,7 +181104,6 @@ intesa-attivazione-psd2.000webhostapp.com
  intesa-san-paolo-security.com
  intesa-sanpaolo.io
  intesa-sbloccocarta.com
-intesa-sicurezza-clienti.com
  intesa-sicurezza-sp.com
  intesa-sp-conferma-ora.000webhostapp.com
  intesa-sp-sicurezza.com
@@ -200295,7 +181170,6 @@ intltaxnetwork.org
  intmkt3w41enr-mt3-s2qve.run
  intogram1.000webhostapp.com
  intoita.com
-intosquareonly.com
  intotheallow.hopto.org
  intoviewers.com
  intoxicated-twilight.com
@@ -200320,6 +181194,7 @@ intrnappsctlsaulxca1.com
  intrnet-dbs-baking.com
  intrnetbakking-dbs-sg.com
  intrnetbakkinq-dbs.com
+intrnetbaknggdbsg.com
  intrntbakkngsg.com
  intro-mijndigipass.cc
  introduction-espaceonline.webnode.com.co
@@ -200481,10 +181356,14 @@ invitegroupswhatsapp.ml
  invitegroupwa-dylandpros.000webhostapp.com
  invitegroupwhatsapnewww.000webhostapp.com
  invitegroupwhatsapp-berbagivideo.dns04.com
+invitegroupwhatsapp-carijodohataudoi.2waky.com
  invitegroupwhatsapp-pemersatubangsa.dns05.com
-invitegroupwhatsapp-pencaridoi.2waky.com
+invitegroupwhatsapp-pemersatubangsa.dumb1.com
+invitegroupwhatsapp-seruseruan.2waky.com
+invitegroupwhatsapp-seruseruan.dns05.com
  invitegroupwhatsapp-seruseruan.dumb1.com
  invitegroupwhatsapp-seruseruanaja.youdontcare.com
+invitegroupwhatsapp-tempatcarijodoh.2waky.com
  invitegroupwhatsapp18.xxxwhatapp.com
  invitegroupwhatsappp332.ml
  invitegrub-whatsapphot.my.id
@@ -200499,6 +181378,8 @@ invitewa.whatsapp-1026627.cf
  invitewa.whatsapp-1029.ga
  invitewa.whatsapp-19926620.gq
  invitewhatsapp-grupdewasa.xxicv.gq
+invitewhatsappgroup-berbagivideo.mrbonus.com
+invitewhatsappgroup-seruseruan.wikaba.com
  invitiamo-a-certificare-la-nuova-app.link
  invodi12.com
  invoeshdydbfhdh.com
@@ -200975,6 +181856,7 @@ irmasbeneditinasdp.com.br
  irmjqtolfacfeifo-dot-millinium.ey.r.appspot.com
  irnanoshop.com
  irnberger.co.at
+irntv.app.link
  irockkaraoke.com
  irockofarms.com
  irojvclzfq.duckdns.org
@@ -200990,7 +181872,6 @@ ironkeyinvestments.com
  ironmpcom.nckiconsulting.gdn
  ironn.000webhostapp.com
  ironrods.world
-ironstop.cloud
  irontwistings.ml
  iroquoislawnbowlingclub.ca
  iros6-nicates5.cf
@@ -201085,7 +181966,6 @@ isagawajinjajp.baerseventhing.top
  isague.com
  isaiahmcpeak.com
  isainternationalnewsorg.shaxiacalendar.top
-isajautthiaeyatu.ams3.digitaloceanspaces.com
  isaleartri.co.uk
  isam2016.in
  isamisa.com.pe
@@ -201093,7 +181973,6 @@ isapillsigninusingssl1partneridsiteidru.hardistyconstruction.com
  isastyles.com
  isatechnology.com
  isawards.org
-isawillwok.xyz
  isaxgzyezwmlkqcq-dot-millinium.ey.r.appspot.com
  isazscmqwtzhfkcy-dot-millinium.ey.r.appspot.com
  isbankasi-tr.com
@@ -201987,7 +182866,6 @@ ivmksxdvokbtlpfg-dot-millinium.ey.r.appspot.com
  ivobfuqhsqgsarjy-dot-millinium.ey.r.appspot.com
  ivobktgdnsclqitdxgjqxvcetylsyyzwbque-dot-cryptic-now-290917.ey.r.appspot.com
  ivobrandao.com
-ivorycoup.cloud
  ivozsfspcqfpspnvrlixbtyymv-dot-gleowayel400503.uc.r.appspot.com
  ivpaq.zkm2iqfu.mqziaqiu5al.pd1zddidu0.kt6qrcf.pe8jbvp.lqocxr6.gttv.xp0a5m4n.o4tfxoof.xq53f.uno
  ivqwqfdwnd.duckdns.org
@@ -202208,7 +183086,6 @@ j1yq0.oujevais.com
  j2168.onderhost.com
  j258.nichesite.org
  j259.mentriqq.com
-j270009399200202.us-south.cf.appdomain.cloud
  j284r.oujevais.com
  j2qp.awaykart.com
  j2x6m.svcoding.com
@@ -202816,6 +183693,7 @@ jbnkloading.com
  jbnkuser.com
  jbnortonandco.com
  jbnw.onderhost.com
+jbqgdrmegycncaha-dot-mandax.oa.r.appspot.com
  jbqs.awaykart.com
  jbqzpqkvullvkeqg-dot-millinium.ey.r.appspot.com
  jbrealestategroups.com
@@ -202862,6 +183740,7 @@ jcbintegrador.com.pe
  jcbouchatmarketing.com
  jcbs.buzz
  jcbsyefbw34.floridakeysspearfishing.com
+jcc-office365.com
  jcc.ac.uk.messageonlinemailn.bar
  jccusknyuk.duckdns.org
  jcdojnbdbcoopdap-dot-millinium.ey.r.appspot.com
@@ -202895,7 +183774,6 @@ jcraiwwecojbgctqltwlhtmpzoagmnsqjnxa-dot-cryptic-now-290917.ey.r.appspot.com
  jcredacw.com
  jcrizo.com.br
  jcrxrxfzuniwfemhmjdavwynvoiikjqedehq-dot-solar-vertex-285913.rj.r.appspot.com
-jcsfpnbmwjxklwdh-dot-owaonk399399393.uk.r.appspot.com
  jcsgt.codesandbox.io
  jcspender.com
  jcsportsnutrition.com
@@ -203102,6 +183980,7 @@ jentsq.ml
  jentsy.ml
  jeny-carasco.xyz
  jeodilse.com
+jeokiln.com
  jeopakistan.000webhostapp.com
  jepangsex-whatsappgrub-joinfree.zzux.com
  jepit.000webhostapp.com
@@ -203209,7 +184088,6 @@ jetzt-handwerker-finden.de
  jetzworld.com
  jeu-insta.000webhostapp.com
  jeubhuqozlbkzrvq-dot-millinium.ey.r.appspot.com
-jeuxhtml5-orangefr.com
  jevans912-profile.online
  jevn.in
  jevoxfcdyozpjuek-dot-millinium.ey.r.appspot.com
@@ -203248,7 +184126,6 @@ jfenghk.com
  jffdds.com
  jffttkzahixjmfod-dot-millinium.ey.r.appspot.com
  jfgrnzsvkwxecbkbgq.top
-jfheritage.com
  jfhlnhmoxmehvfrynqtelovblk-dot-gleowayel400503.uc.r.appspot.com
  jfi3.ru
  jfimstrkbevqldtg-dot-millinium.ey.r.appspot.com
@@ -203902,7 +184779,6 @@ jns-blog33.com
  jnsdeqwomkcolafy-dot-millinium.ey.r.appspot.com
  jnstowingal.com
  jntrader.com
-jntrd.cam
  jntssjj.com
  jntytech.com
  jntyygnrfsgoeehp-dot-millinium.ey.r.appspot.com
@@ -203911,7 +184787,6 @@ jnugqhtwcb.duckdns.org
  jnwbu.biogenicherb.com
  jnx-7.jaysbrand.com
  jnxbhjhplqltpzqhpvlnxewhfd-dot-gleowayel400503.uc.r.appspot.com
-jnxfdw.cn
  jnyouyi.com
  jnyuetu.com
  jnzbtb.cn
@@ -204072,7 +184947,6 @@ johnkostal.com
  johnlamb-secure.co.uk
  johnlencher.com
  johnmholly.com
-johnmullenmorgangroupdev.com
  johnmuyer.com
  johnmwells.net
  johnmwells.org
@@ -204483,7 +185357,6 @@ join-youtuber.jhte.my.id
  join-yuk-grup-bokepsnxs.000webhostapp.com
  join.4free9.com
  join.chat.whatsapp.yourt-32.tk
-join.cl8movement.co.za
  join.driverpartnerstest.com
  join.eventfreex.com
  join.grub-porno.com
@@ -204755,7 +185628,6 @@ joingrup.facebook-good.ga
  joingrup.hot-grup421.ml
  joingrup.sexidude.com
  joingrup.wa-sex.com
-joingrup.wa.get-now2rj.tk
  joingrup.whatsapp-6619.ga
  joingrup.whatsapp-bokep.tk
  joingrup.whatsapp-web-271.cf
@@ -205004,6 +185876,7 @@ joingrupwhatsapp12.otzo.com
  joingrupwhatsapp12.zzux.com
  joingrupwhatsapp120.wikaba.com
  joingrupwhatsapp17.hot49.cf
+joingrupwhatsapp18.cf
  joingrupwhatsapp18.sexidude.com
  joingrupwhatsapp18pluss.00.mrbasic.com
  joingrupwhatsapp2020.ngntd55.tk
@@ -205105,7 +185978,6 @@ joinsgrupwhatsapp-khusus.fartit.com
  joinsmembergrupwhstapp.ga
  joinss-wa18.ga
  joinss-whatsappp.wikaba.com
-joinss9.gq
  joinswa.bokepindo.vipxs.tk
  joinswa.hol7.com
  joint-grub-whatsaap.hols72.tk
@@ -205420,7 +186292,6 @@ jovetech.com.my
  jovial-albattani-dead8d.netlify.app
  jovial-carson-9ea7ef.netlify.app
  jovial-kirch-febbfc.netlify.app
-jovial-lichterman-49a271.netlify.app
  jovial-mcnulty-e1bcd9.netlify.app
  jovial-northcutt-b4c085.netlify.app
  jovtdntefexjxgnw-dot-millinium.ey.r.appspot.com
@@ -205522,13 +186393,9 @@ jp-portal.connect.auone-mobile021.com
  jp-ppy.com
  jp-rakuten-in.cyou
  jp-rakuten-login.ga
-jp-rakuten.a1j.top
  jp-rakuten.buzz
-jp-rakuten.d1g.top
-jp-rakuten.l1o.top
  jp-rakuten.net
-jp-rakuten.r1o.top
-jp-rakuten.x1c.top
+jp-rakuten.q7f.top
  jp-rakutenlogin.arocaproducciones.com
  jp-rakuteo-co.icu
  jp-review.online
@@ -205664,7 +186531,6 @@ jplymell.com
  jpm0rgan-chasewebsup01.ml
  jpmaepesboxirwhc-dot-millinium.ey.r.appspot.com
  jpmc.demo.aio.technology
-jpmcmorganactivationzone2ndc.duckdns.org
  jpmdvlzxkgvcbujw-dot-millinium.ey.r.appspot.com
  jpmkkvmnqtyacgunlkjezwiugr-dot-gleowayel400503.uc.r.appspot.com
  jpml.info
@@ -206188,7 +187054,6 @@ juanitacarrasco.com
  juanjorcom.shaxiabeauty.top
  juanmanuelnavia.com
  juanmoraga.tk
-juanqiuqt.wang
  juanthradio.com
  juantrejoo.com
  jubilant-beach.cloudvent.net
@@ -206201,6 +187066,7 @@ jucabas.000webhostapp.com
  juchetu.com
  judaye.host
  judgertet.com
+judgesign.monster
  judgestill.xyz
  judgmental-receiver.000webhostapp.com
  judicative-owner.000webhostapp.com
@@ -206304,6 +187170,7 @@ juma-ac.ae
  jumanji222.xyz
  jumapatagonia.com.ar
  jumbajumbadun.fun
+jumbochillyarchitects--five-nine.repl.co
  jumbosilcom.nckiregister.gdn
  jumeibuys.com
  jumiliaintl.ml
@@ -206446,7 +187313,6 @@ justforhalloween.com
  justformailing.fun
  justframeit.be
  justgotbranded.net
-justicethumb.cloud
  justifiable-forecas.000webhostapp.com
  justificatory-grind.000webhostapp.com
  justifycontrol.com
@@ -206489,6 +187355,7 @@ justtcasesfree.live
  justtops.com.tw
  justusemoulds.com
  justuskennelclub.com.br
+justveil.monster
  justwaterbh.com
  justwenger.cloudaccess.host
  justwer.site
@@ -206622,6 +187489,7 @@ jxrvveajvmelfzhw-dot-millinium.ey.r.appspot.com
  jxucpdnlsgspqvoz-dot-millinium.ey.r.appspot.com
  jxvcmfhkyvsofpfmjtldxzicpo.project2-297402.rj.r.appspot.com
  jxvjqacgxkelumcg-dot-millinium.ey.r.appspot.com
+jxwosokllpimpryo-dot-copper-imprint-296111.nw.r.appspot.com
  jxwymm.com
  jxygwrkycdjcmlts-dot-millinium.ey.r.appspot.com
  jxyrtadfrbvkucxbav.top
@@ -206794,6 +187662,7 @@ k6afg.weblium.site
  k6b9.jaysbrand.com
  k6dqp.awaykart.com
  k6hgy.awaykart.com
+k6prz6zy.cc
  k6qgzi7jtm-godtodtjm.vercel.app
  k749y.addroits.com
  k7753602.beget.tech
@@ -206844,7 +187713,6 @@ kabelfern1.moonfruit.com
  kabilya.bounceme.net
  kabiphotography.xyz
  kabiru.ru
-kabiryogashramlimbdi.com
  kabookapp.com
  kabrandialharb.flywheelsites.com
  kabsolug.com
@@ -207184,6 +188052,7 @@ karapinarmahder.org.tr
  karar.zapto.org
  kararnameduyurulari-turkiyegovtr.com
  karasiweb.ir
+karateforge.rm2uonline.com
  karatemanagement.chifanassociate.top
  karatemarketing.shaxiacause.top
  karavella12.hop.ru
@@ -207239,6 +188108,7 @@ karmacourse.ml
  karmadana.club
  karmaindex.com
  karmajewelryshop.com
+karmakoincodes.weebly.com
  karmakorm.ru
  karmanbiotech.com
  karmayogaacademy.com
@@ -207474,7 +188344,6 @@ kbc-jo.com
  kbc.be.contact-verificatie.website
  kbc.betaalverzoekenplatform.bar
  kbc.csam-corona.be
-kbc.javayears.ru
  kbc.profiel-instellingen.eu
  kbcannabis.ciip-cis.co
  kbcbe.bbnmncq.info
@@ -207522,6 +188391,7 @@ kbtfoyfvkoealojbqybneuntkp-dot-gleowayel400503.uc.r.appspot.com
  kbukubxwpeythoxyrqjhaekkod-dot-gleowayel400503.uc.r.appspot.com
  kburtdesigns.com
  kbutqebhj.vipsnapchatsexting.com
+kbuwdkndmlqpsxbr-dot-mandax.oa.r.appspot.com
  kbwkncjvwdxzzjqaev.top
  kbxcabg.info
  kbxevents.com
@@ -207669,8 +188539,8 @@ kedkekk.co.cc
  keeblerplain.buzz
  keen-borg-969525.netlify.app
  keen-brahmagupta-cec944.netlify.app
+keen-hamilton-b72ba2.netlify.app
  keen-mclean-b4780a.netlify.app
-keen-mestorf-4cfef8.netlify.app
  keen-pare-000b9f.netlify.app
  keen-ride-52e1b9.netlify.app
  keen-sight-280309.appspot.com
@@ -207992,6 +188862,7 @@ keyboardlessencom.shaxiaoh.top
  keybusiness.com.mx
  keycase.xyz
  keycreditsonline.com
+keyflippantcompiler--five-nine.repl.co
  keyfono.es
  keyforpo.xyz
  keyhole.agency
@@ -208097,6 +188968,7 @@ kgshaa.fff315.com
  kgsinsuranceagency.top
  kgsinsuranceagencys.buzz
  kgtgxlmrobbpvciemvcilgmdjcaxtgaulbjf-dot-offgl8876899977678.uk.r.appspot.com
+kgti.co.kr
  kgu.goruli.com
  kgusfufdcfbdycvvjomkqiidknyattbowgfv-dot-glegen303939423233.ue.r.appspot.com
  kgutjgdjdmlthice-dot-millinium.ey.r.appspot.com
@@ -208484,7 +189356,9 @@ kimziyaretetmisogren.com
  kinabolts.gq
  kincinsim.cabanova.com
  kind-davinci-b4f5be.netlify.app
+kind-euler-9c0570.netlify.app
  kind-jones-5c3725.netlify.app
+kind-leakey-daf6c0.netlify.app
  kind-mclean-2e4c71.netlify.app
  kind-meitner-91e0a2.netlify.com
  kind-spence-b0840b.netlify.app
@@ -209096,7 +189970,6 @@ kndesign.com.br
  kndh.sitebuilerguide.com
  kneadingmarches.com
  kneb.pl
-kneerelief.cloud
  knelect.xyz
  kneqe.xyz
  kneticwarrior.zapto.org
@@ -209549,7 +190422,6 @@ korturl.dk
  korumamiss.com.tr
  korzhxt.goruli.com
  kosahafager.com
-kosambia.000webhostapp.com
  koschool.h1n.ru
  kose.online
  koseisyoapi.buzz
@@ -209578,7 +190450,6 @@ kostacardsplayer.pro
  kostenlos-einfach-lokal-anzeigen.de
  kostenlose-webcams.com
  kosterra.com
-kostpik2.com
  kostuemoutlet24.de
  kostyabozov.000webhostapp.com
  kostyabozovyoutube.000webhostapp.com
@@ -210212,6 +191083,7 @@ kuskusi.org
  kusoe.edu.np
  kusoomclub.com
  kuspxvbmfptertgs-dot-millinium.ey.r.appspot.com
+kusriuv.firebaseapp.com
  kustkaluga.narod.ru
  kustomlynx.com
  kusturirp.us
@@ -210512,7 +191384,6 @@ l000888457covid.online
  l00c25cf32.temp.swtest.ru
  l09162020-fixmailhelpdesk.web.app
  l09d56a7.justinstalledpanel.com
-l0g1n-host-dec2-2.duckdns.org
  l0g1nn-rec0v3rdata.com
  l0gin-bofa.com
  l0ginsendtelegrafh-com.preview-domain.com
@@ -210624,6 +191495,7 @@ laborcomun.com.mx
  labordfinancialbank.com
  labordiamantende.chifanavoid.top
  labore-ma.blogspot.com
+laborerdilemma.com
  laboreta.com
  laborjlps.zzz.com.ua
  labotiguetadelmig.cat
@@ -210832,6 +191704,7 @@ lambadoria.beget.tech
  lambergkapital.com
  lambers.in
  lamborghiniauto.com
+lambros.biz
  lambroscenter.com
  lamdep24h.life
  lamdepbeauty.com
@@ -211106,7 +191979,6 @@ laschuk.com.br
  lascrucesn.buzz
  lascuola.nl
  lasdety.com
-lasdfty.casa
  laser-tiny-dinosaur.glitch.me
  lasercare.co
  laserkr.com
@@ -211213,7 +192085,6 @@ latvianskinny.000webhostapp.com
  laubblaesercom.shaxiaauthority.top
  laufen-in-koeln.club
  laughing-dubinsky-924c80.netlify.app
-laughing-goldberg-6817aa.netlify.app
  laughing-hermann-bd624b.netlify.app
  laughing-pike-c6b1d5.netlify.app
  laughing-pike-c6b1d5.netlify.com
@@ -211499,6 +192370,7 @@ lcs-page.info
  lcs-securitycheck.de
  lcsactivatie-online.zap618755-1.plesk10.zap-webspace.com
  lcscards-mijnactivatieonline.xyz
+lcscards-sca-login.zap638234-1.plesk11.zap-webspace.com
  lcsfg.com
  lctavano.tk
  lctkcvsdshtakwxn-dot-millinium.ey.r.appspot.com
@@ -211613,7 +192485,6 @@ leadsark.in
  leadsrus.co
  leadtipz.pw
  leadtribeca.com
-leaffreak.top
  leafless-employees.000webhostapp.com
  leafstone.in
  league0flegends-worlds2020-orb-euw.000webhostapp.com
@@ -211650,6 +192521,7 @@ lean19.com
  leanakaryar.com
  leancoding.co
  leandrokblo.com
+leangoodnaturedinterpreter.josealbertoal21.repl.co
  leanhxuan.net
  leanldedyjerlogh-dot-millinium.ey.r.appspot.com
  leanmanufacturing.com.ar
@@ -211940,6 +192812,7 @@ lemmjahuephydxgmspqjqjptsilimgwkfxfn-dot-glegen303939423233.ue.r.appspot.com
  lemmyjg93e.lemmyjg93e.dynv6.net
  lemnexotic.ro
  lemonagogo.com
+lemonchiffonpowderbluehypotenuse.adasdfff.repl.co
  lemondeourien.ddns.net
  lemongrasshostel.net
  lemonschools.ge
@@ -211975,6 +192848,7 @@ lennophthalmia.info
  lennycleaning.com
  lennysdeals.com
  lennywoehr.webcindario.com
+lenovofs.tk
  lenreactiv-shop.ru
  lensajalanjalan.com
  lensakaca21.com
@@ -212004,7 +192878,6 @@ leoncup.xyz
  leong.ws
  leonie.kenshung-ehost-services205-com.kenshung.com
  leopardyardeions.top
-leoprdt.cam
  leorecrea.com
  leorentacars.com
  leorich.com.tw
@@ -212110,9 +192983,9 @@ lethatch.se
  lethatrace.buzz
  letholedriving.co.za
  letiansichang.com
+letianviq.top
  letitbeslow.com
  letmakeitgood.com
-letmefindutk.xyz
  letmeshowww.000webhostapp.com
  letrikacom.nckiaccounting.gdn
  lets-go-to-russia.com
@@ -212514,6 +193387,7 @@ lieoo.ml
  lieouidya.wang
  liermadoni.temp.swtest.ru
  lieshitextile.com
+liesize.monster
  liev.duckdns.org
  lievengevaert.be
  lievevanstappen.com
@@ -212623,7 +193497,6 @@ lightou-71.cf
  lightpressprint.co.zw
  lightreach53.com
  lights-craft.net
-lightsalmondecentopposites--five-nine.repl.co
  lightsaver.work
  lightscafe.com
  lightscrawnyoutcomes--five-nine.repl.co
@@ -212889,7 +193762,6 @@ limmergarden.com
  limobai.com
  limoqppksf.duckdns.org
  limozo.eu
-limpfgh.cam
  limpiaredes.com
  limpiezaslucel.com
  limraitech.com
@@ -213163,7 +194035,6 @@ lipripperz.com
  lipsdchuatl.wang
  lipsticklearn.com
  liqpuxdhoksyrvpn-dot-millinium.ey.r.appspot.com
-liqrut.cam
  liqryu.casa
  liqstays.com
  liquid-format.000webhostapp.com
@@ -213184,6 +194055,7 @@ liquidasmartphon.online
  liquidatudohojenalu.com
  liquidatudomagalu.com
  liquidatudoomagazineluiza.com
+liquiddimbacktick.tiliyo6926.repl.co
  liquidoujunhos.com
  liquidyardk.com
  liquiidatododiia-magalu.com
@@ -213494,6 +194366,7 @@ livraisonspeed89.cloudaccess.host
  livraisonspeed97.cloudaccess.host
  livrariasmm.bidlocal.com.br
  livre-shop.net
+livreacesso.store
  livres.aixlesbains.fr
  livretdunumerique.lewebpedagogique.com
  livretplus.com
@@ -213673,7 +194546,8 @@ lloyd-online.login-online-support.com
  lloyd-payee-cancel.net
  lloyd-personal.onlinebankinguk.net
  lloyd-securebank.com
-lloyd-secureduser.com
+lloyd-securedonline.com
+lloyd-secureonline.com
  lloyd-verify.com
  lloyd.groupplc-supportgb.com
  lloyd.new-secure.co.uk
@@ -213739,6 +194613,7 @@ lloyds-new-payment.com
  lloyds-newpayee-authorisation142.com
  lloyds-newrecipient.com
  lloyds-online-banking-help.com
+lloyds-online-banking-payee-verify.com
  lloyds-online-login.payeesadded.com
  lloyds-online-secure.com
  lloyds-online-securedetails.com
@@ -213746,7 +194621,6 @@ lloyds-online.com
  lloyds-onlinedevices.com
  lloyds-payee-alerts.com
  lloyds-payee-authorization.com
-lloyds-payee-online-banking.com
  lloyds-payee.live
  lloyds-payeealert.com
  lloyds-payeedecline.com
@@ -213802,7 +194676,6 @@ lloyds.com.uk.systempayeeremove.com
  lloyds.de-registerdevices.com
  lloyds.deregister-new-device.com
  lloyds.deregister-newchanges.com
-lloyds.device-cancellation.net
  lloyds.device-deregistered.com
  lloyds.device-deregistration.com
  lloyds.fix-mypayee.com
@@ -213844,6 +194717,7 @@ lloyds.securepayeenotice.com
  lloyds.securitypayee.co.uk
  lloyds.settle-mypayee.uk
  lloyds.settlemypayee.uk
+lloyds.transactionid.co
  lloyds.txid.live
  lloyds.uk-secure-authenticate.com
  lloyds.uk-tax-it-or-lose-it.com
@@ -213883,8 +194757,8 @@ lloydsbank.deregister-unknown-payee.com
  lloydsbank.device-auth-new-verify.com
  lloydsbank.device-login-verify-auth.com
  lloydsbank.device-prevention-auth-login.com
-lloydsbank.device-security-shield-auth.com
  lloydsbank.device-verify-new-auth.com
+lloydsbank.group-device.com
  lloydsbank.lb-alertplc.com
  lloydsbank.lb-alerts.com
  lloydsbank.lb-device.com
@@ -213920,6 +194794,7 @@ lloydsbank.online-personal-login-info.com
  lloydsbank.online-personal-login-verify.com
  lloydsbank.online-personal-logon-uk.com
  lloydsbank.online-personal-validate.com
+lloydsbank.online-security-personal.com
  lloydsbank.online-validate-device.com
  lloydsbank.online-validate-login-info.com
  lloydsbank.online-verify-auth.com
@@ -213928,6 +194803,7 @@ lloydsbank.online-verify-personal.com
  lloydsbank.online-verify-registration.com
  lloydsbank.online-verify-security.com
  lloydsbank.payee-portal.co.uk
+lloydsbank.payee-secure-data-shield.com
  lloydsbank.personal-login-mobile-verify.com
  lloydsbank.personal-login-online-auth.com
  lloydsbank.personal-private-user.com
@@ -214272,6 +195148,7 @@ lnstagram-supportcentre.com
  lnstagram-supports-web.ml
  lnstagram-supportservice.ml
  lnstagram-suspiciousloginattempts.ml
+lnstagram-team-copyright.ga
  lnstagram-team-support.cf
  lnstagram-tickcopyright.ml
  lnstagram-verfysupport.com
@@ -214327,6 +195204,7 @@ lnstagramblueteakform.com
  lnstagramblueteakinfohelp.ml
  lnstagrambluetick.net
  lnstagrambluetickservice.ga
+lnstagrambluetikcreator.com
  lnstagrambusinesscontact.com
  lnstagrambusinessofficesupport.com
  lnstagrambusinessonline.com
@@ -214379,6 +195257,7 @@ lnstagramcopyrightsystem.com
  lnstagramcopyrightveryfy.cf
  lnstagramcopyrightviolationcenter.com
  lnstagramcopyrightviolationhelps.com
+lnstagramcopyrightviolationreports.ml
  lnstagramcopyrighty.ml
  lnstagramcopyrright.ml
  lnstagramcourtappeals.com
@@ -214685,7 +195564,6 @@ localizationdispositivo.000webhostapp.com
  localizershub.com
  locallbitcoins.com3-login-wefevj9gf43irk43fw.xyz
  locallyeshop.com
-localmania.xyz
  localnet.srv.br
  localobitcoin.com
  localpublicidad.com
@@ -214798,6 +195676,7 @@ log-facebook3.com
  log-facebook4.ml
  log-in-appleid-services.us
  log-in-appmazon-passwordsecure.gleeze.com
+log-in-facebook.fep4.ga
  log-in-mypayees.com
  log-in-pemblokiran.gq
  log-in-rakuten.ml
@@ -215129,6 +196008,7 @@ login-team-confirm.com
  login-tech.com
  login-telegram.com
  login-three-co-uk.com
+login-to-myaccount.garakola.com
  login-to-verify-r.weebly.com
  login-ugk8j9ybycp44seln0wg-user.signin-fsuvfeinib-unlock.club
  login-unzlmsfedktgmcfyvmle-user.intl-hupquneskz-region.club
@@ -215746,7 +196626,6 @@ lognmd0ficeonlinecollablositesincvoice.cf
  lognoutlookconfirm.zz.com.ve
  lognserpplap.molinasmusichouse.com
  lognweb.laxmiexport.cf
-logobd.com
  logobnl.webador.com
  logobossdenver.netlify.app
  logobossdragon.netlify.app
@@ -216022,7 +196901,6 @@ loot-hub.gq
  loot-hub.tk
  loot-lucky.fun
  loot-swap.com
-lootinglesson.cloud
  lootluck.tk
  lootmarket.info
  lootmarlket.com
@@ -216250,7 +197128,7 @@ loveyou01couple.000webhostapp.com
  loveyourvalentine.icu
  lovienmorelos.ru
  loving-northcutt-368286.netlify.app
-loving-roentgen-2140e8.netlify.app
+loving-swanson-b55ac6.netlify.app
  lovinggleamingargument.angueluisreyama.repl.co
  lovinghandsayurveda.com
  lovmesdkiunrgbouvyxmjqxiig-dot-gleowayel400503.uc.r.appspot.com
@@ -216426,6 +197304,7 @@ lsgskychefs.000webhostapp.com
  lsh.cactusss.cn
  lshcvpiuynscjsmhjddnyfpdsajeaohyfyyx-dot-cedar-code-289917.nn.r.appspot.com
  lshjzulzdas.top
+lshsgdvdjdgvxnworu.us
  lsiting-realty-fb-realestate-id4555.000webhostapp.com
  lsiuscanyo.xyz
  lsjackets.com
@@ -216587,7 +197466,9 @@ lucianbot.000webhostapp.com
  lucianodelarco.com.br
  lucianoweb.com.br
  luciatle-71.tk
+lucid-boyd-2763e1.netlify.app
  lucid-brahmagupta-91bfd6.netlify.app
+lucid-spence-2c65c2.netlify.app
  lucid.kiev.ua
  lucidfestival.com
  lucidinvestbank.com
@@ -216692,6 +197573,7 @@ luckythankyoufeedbackofficial.club
  luckytours.pk
  luckytriumph.com
  luckyx.giize.com
+luckyxdraw.com
  luckyxspin.com
  luckyxspines.itemdb.com
  luckyxxfree.giize.com
@@ -216843,7 +197725,6 @@ lusecproducts.top
  lushnailspeachtreecity.com.lushnail.online
  lusodecor.com
  lusteri.com
-lutherans.jp
  lutkj.com
  luttecovid19.zdcagency.ci
  luttywaals.com
@@ -217856,6 +198737,7 @@ m80.jaysbrand.com
  m85.saithingware.ru
  m87770f3jlmmbz.com
  m8ais-e-muitissimo-lindo-e-perfeito.com
+m8bsg.csb.app
  m8c1pkhb0f.gmz.cc
  m8fjy.jaysbrand.com
  m8fkx.jaysbrand.com
@@ -218609,6 +199491,7 @@ mail.aggiornamento-dati-utenza-web.com
  mail.agricareseeds.com
  mail.ahcindia.com
  mail.airsoftguns.sk
+mail.ajericoff.bluehoststaff.com
  mail.alerts-americanexpress.com
  mail.alferesbh.com.br
  mail.aliton.ru
@@ -218915,7 +199798,6 @@ mail.intesasanpaolomobilapps.com
  mail.invitewa.whatsapp-1092-9.ml
  mail.iosappdeveloper.in
  mail.irc-furrychat.xyz
-mail.itaucard-descontos.club
  mail.itmluckywin.com
  mail.itunesreset.info
  mail.iupsol.com
@@ -219012,6 +199894,8 @@ mail.mlbbskineventpromo07.webredirect.org
  mail.mlbbskineventpromo14.webredirect.org
  mail.mlbbskineventpromo18.webredirect.org
  mail.mobielupdate-mijning.top
+mail.mobilelegends.jan12.tk
+mail.mobilelegends.nows7.ml
  mail.mrdizi.com.au
  mail.msnllc.com
  mail.mxonline23.com
@@ -219026,7 +199910,6 @@ mail.new-payee-error.info
  mail.new-threebill.com
  mail.newgrub.xxx-wa.com
  mail.newhavenrestoration.org
-mail.newlogin-payeeprotection.com
  mail.newpayee-notification.cc
  mail.ng-slo.si.gtfgfv.gq
  mail.nitmail.com
@@ -219055,6 +199938,7 @@ mail.parathon.com
  mail.parkhill.k12.mo.us
  mail.part-sls.cc
  mail.payee-check-online.cc
+mail.payee-online-security.org
  mail.payeehelp-guide.com
  mail.payeeremoval-emergency.cc
  mail.payments-viewpayees.com
@@ -219119,7 +200003,6 @@ mail.request-cancellations.com
  mail.reregister-secured-system.com
  mail.restoremyaccounts-paypal.giize.com
  mail.restrictions-myo2account.com
-mail.review-mynewpayees.com
  mail.review-page-suspended6763.info
  mail.review-transactions.com
  mail.rewardskinpubg.myddns.rocks
@@ -219318,7 +200201,6 @@ mail.whatsappgrupinvite.com331.ga
  mail.whatsappgrupj.sexwa18-netuy.tk
  mail.whatsappnewgruphot.invt-grup11.ml
  mail.whatsappp-group.eventsnew.net
-mail.whatsappp-grup73.cf
  mail.whatsappsex.69.ocry.com
  mail.whatshaapjoingrupnew.freeseason.asia
  mail.wildepedique.nl
@@ -219448,6 +200330,7 @@ mailchristen.at
  maildc1519217828.mihandns.com
  maildomainserver.com
  maildvgcdhwdwwiwajs.weebly.com
+mailenvoye.uno
  maileratt-yahoologisticemailupgrade20.weebly.com
  mailered.hopto.org
  mailerpremium.com
@@ -219456,7 +200339,6 @@ mailfast.co.uk
  mailgoi001.applestore-id-apple.com
  mailgrupobancolombia.online
  mailguard.ie
-mailgw.royal-eng.ps
  mailhost.royal-eng.ps
  mailiaatt.weebly.com
  mailiattt.weebly.com
@@ -219706,6 +200588,7 @@ makalelisiteler.ayakkabilar.org
  makalu5.com
  makanankhasjogya.000webhostapp.com
  makanantuh.com
+makannyagantengkntol.tk
  makansob.com
  makapromo.com
  makarskaadventure.com
@@ -219770,7 +200653,6 @@ makkiya.ca
  makkupaiyan.com
  maklryanb.com
  makmurusa.com
-makopse-y-denisa.ru
  makosoft.hu
  makoto-osaka.com
  makpar.net
@@ -220505,7 +201387,6 @@ manuelvoss.de
  manufacturedhousingassociationregulatoryreform.org
  manufakturduschencom.shuiacause.top
  manuitu.work
-manullfee.com
  manunitedupdatenews.com
  manupuniversity.org
  manuscript.ge
@@ -221965,7 +202846,6 @@ materialescantu.com
  materialesgonzalitos.com.mx
  materialevent.org
  materialeventxmetro.com
-materialfestival.com
  materialhealth.net
  materialpayloadpubg.com
  materialpubgmetro.com
@@ -222229,7 +203109,6 @@ maz1.online
  mazaganx.xyz
  mazcclanswfloelf-dot-millinium.ey.r.appspot.com
  mazdank9.beget.tech
-mazechalk.cloud
  mazedecrypt.top
  mazeedkyabar.com
  mazeinfouma.ru
@@ -222661,6 +203540,7 @@ medicacademic.com
  medical-events.info
  medical-jets.com
  medical-news-reporting.com
+medical-prod.online
  medical.hsh-bh.com
  medicalbi.it
  medicalbillingclerks.ca
@@ -222679,7 +203559,6 @@ medicalsupplies2u.com
  medicalsuppliescrowns.com
  medicaltourismind.com
  medicalve.com
-medicarealetrsjhs.us
  medicaredentalinsurance.com
  medicaredirect.com
  medicelcoolers.cn
@@ -222979,7 +203858,6 @@ melasoft.com
  melatipuspa383.com
  melbournesperfectsmile.com.au
  melbournetelanganaforum.com.au
-melchers.com.cn
  meldensichan-geschenkkarten.com
  meldiproperties.com
  melev.com.br
@@ -224137,6 +205015,7 @@ midak-photography.com
  midas-buys15.jetos.com
  midasbuy-official.ga
  midasbuy9.com
+midasbuyeventsnow.com
  midasbuygift.com
  midasbuyo.com
  midasbuypubg15.zyns.com
@@ -224374,7 +205253,6 @@ mikilpi.cz
  mikipgehlp01rcvrsrvce01.my.id
  mikisrvcpgehlpbsns01.cvbpgeorghlp01.my.id
  mikisrvcpgehlpbsns01.my.id
-mikkellkhan.com
  mikkelraunsgaard.dk
  miklem.website
  miklertsase.com
@@ -224587,7 +205465,6 @@ minesports.biz
  minet.nl
  minevisim.com
  mingboxingshiye.com
-mingcan.top
  mingguanwms.com
  minghinis.com
  mingjuetech.com
@@ -224990,6 +205867,7 @@ mjm.dimaflix.com
  mjmhighendcom.shaxiacommittee.top
  mjnalha.ml
  mjnbkok.com
+mjoystick.com
  mjqlhebwxceuxcff-dot-millinium.ey.r.appspot.com
  mjqx.goruli.com
  mjryfbzumetmoxbk-dot-millinium.ey.r.appspot.com
@@ -225709,6 +206587,7 @@ mobilecarrier-refund.com
  mobilecarriertelus.com
  mobilecarrierwireless.site
  mobilecharacters.com.au
+mobilecodashop.ezua.com
  mobilecontent.info
  mobiledata-rog.com
  mobiledatechannel.com
@@ -225742,6 +206621,7 @@ mobilelegendes.medokoklol.xyz
  mobilelegends-events.com
  mobilelegends-infoskins.com
  mobilelegends.bugmoonton.cf
+mobilelegends.nows7.gq
  mobilelegendsactivity9c.cf
  mobilelegendsactivity9c.gq
  mobilelegendsactivitynew.cf
@@ -225918,9 +206798,7 @@ modernofficedecor.com
  modernrattan.com
  modernsfoodproducts.com
  modeschmuckankaufcom.chifanassume.top
-modest-bassi-73026b.netlify.app
  modest-murdock-a959b2.netlify.app
-modest-visvesvaraya-7c4983.netlify.app
  modest-yonath-531225.netlify.app
  modestclouds.eu
  modestimboynati.xyz
@@ -226023,6 +206901,7 @@ mohrcircle.icu
  mohrislands.buzz
  mohrrowapt.xyz
  mohseniyeh.com
+mohsinalienwarewaalaadmi.s3.us-east-2.amazonaws.com
  mohsinsaeedulhaq.com
  mohzaenisahrudin.my.id
  moi.gov.ly
@@ -226272,7 +207151,6 @@ monique45.xyz
  monirportfolio.com
  monirshouvo.github.io
  monitelauto.ro
-monitoraggiolive.info
  monitoramentodeprocessos.com.br
  monitorial-threats.000webhostapp.com
  monitoring-boot653.gq
@@ -226320,7 +207198,6 @@ monster-innovation.fr
  monsterclownhunt.com
  monstergenics.com
  monsterhomessree.ru
-monstertop.cloud
  monstrification.xyz
  monsuwiproperties.com
  mont0n-ml.gq
@@ -226407,6 +207284,7 @@ moonshineflatterer.com
  moonshinephilly.com
  moonspace.shop
  moonsuntravel.com
+moonton-free-skins.gq
  moonton-verify.serveirc.com
  moonton2020.ezua.com
  moontonfreegiftmlbb2020.ml
@@ -226741,7 +207619,6 @@ movingandmoving.gotdns.ch
  movingautoparts.com
  movingeaux.co
  movingmaniausa.com
-movingskilled.cloud
  movisafer.com
  mowceuamazon.monster
  mowceuamazon.xyz
@@ -227022,6 +207899,7 @@ msdjkhjcv.ug
  msdos1.com
  msdpharmaceuticals.com
  msdtcupdate.com
+msdwt-k12-in-us-orgg.tk
  msecure03c-csupport.serveirc.com
  msecurity.ro
  msenterpriseverifysecure.glitch.me
@@ -227357,6 +208235,7 @@ muikiddwiamvapdn-dot-millinium.ey.r.appspot.com
  muindlrie.com
  muitas-ofertas-especiais-pra-voce.com
  muitcalmarzch.com
+muiyrtui.cam
  mujex.isapi.org.uk
  mukaila.tank.jp
  mukbibzveoddgivh-dot-millinium.ey.r.appspot.com
@@ -227716,7 +208595,6 @@ mwww.ecure.runescape.com-xu.top
  mwxbuptyzasqfpowklhlkvriotpjewxxszzj-dot-glxcel49934343434.rj.r.appspot.com
  mwyxoeenttpailsd-dot-millinium.ey.r.appspot.com
  mx-ew.jaysbrand.com
-mx-jp.club
  mx-jp.website
  mx-kleinanzeigen.de
  mx-staging.bfni.ca
@@ -228011,6 +208889,9 @@ my.jcb.co.jp.wbin.top
  my.jcb.co.jp.xsltjt.com
  my.jcb.co.jp.yulion.vip
  my.jcb.co.jp.yxjcd.com
+my.jcb.co.qiduqi.top
+my.jcb.co.ytdahan.com
+my.jcb.qiduqi.top
  my.mzhrbs.work
  my.nativeforms.com
  my.navyfederal.databig1.xyz
@@ -228156,6 +209037,7 @@ my3.bill-verified.co.uk
  my3.billing-account.co.uk
  my3.billing-change.co.uk
  my3.billing-supportinc.com
+my3.billing-verify.com
  my3.billing.aempath.com
  my3.billing.uk-id0210.com
  my3.billinginfo.net
@@ -228241,6 +209123,7 @@ my3st.jaysbrand.com
  my3support-uk.co
  my3support.online
  my3supports.com
+my3supportuk.com
  my3suspension-paygbill.com
  my3techsupport.com
  my3three-restrictions.com
@@ -228422,6 +209305,7 @@ mybestlifestyle.com
  mybestsite.xyz
  mybeststore.info
  mybestwp.com
+mybharatbhumi.com
  mybible.000webhostapp.com
  mybill-new3.com
  mybill-o2.co.uk
@@ -228826,6 +209710,7 @@ myinvestvision.com
  myiptv.ca
  myj33p.com
  myjainshasan.com
+myjcb-carrd.top
  myjcb.update.co.jp.myjcb-service.top
  myjcbs-members.fsaiche.com
  myjcbs.com
@@ -229069,6 +209954,7 @@ mypromo.online
  mypropackaging.com
  myproposal.club
  myprrmkijvwmkykeqbdmhvtkntmcvlcnejhy-dot-gl494903049.wl.r.appspot.com
+mypubgevent.com
  mypuppysitter.com
  myqatar.com
  myqpotp.com
@@ -229155,8 +210041,7 @@ mysteuerberatungcom.chifanblow.top
  mystical-tradition.top
  mysticsister.ca
  mystifying-babbage-c8466f.netlify.app
-mystifying-dubinsky-7f845f.netlify.app
-mystifying-easley-ef8885.netlify.app
+mystifying-minsky-5cc6e7.netlify.app
  mystifying-sinoussi-6ea47d.netlify.app
  mystifying-wozniak-81b9b6.netlify.app
  mystifying-wozniak-81b9b6.netlify.com
@@ -229404,6 +210289,7 @@ mzxbvstjacmxpifcxqpzemozmfadsajuratu-dot-solar-vertex-285913.rj.r.appspot.com
  mzxdpdbxlohqaggjkrrerlwycvqqzistgogh-dot-offgl8876899977678.uk.r.appspot.com
  mzxvwcfzefpihaiklhqnqcazbe-dot-gleowayel400503.uc.r.appspot.com
  mzy48domenico.com
+mzzaczwm.cc
  mzzpgtscnjvumepzfp.top
  mzzxmwefxtifatdx-dot-millinium.ey.r.appspot.com
  n-5.addroits.com
@@ -229676,6 +210562,7 @@ nacoaudit.it
  nacoppuqzevyczujuofzwtfwrm-dot-gleowayel400503.uc.r.appspot.com
  nacorafr.nckifitness.gdn
  nactualizaciones.com
+nacukars.work
  nadegrees100.com
  naderuser.ddns.net
  nadez.ddns.net
@@ -229684,6 +210571,7 @@ nadiamurray32.ml
  nadidetadllar.com
  nadis.dyndns.dk
  nadluh.cz
+nadniuio.cam
  nadouch.com
  nadsupplies.co.za
  nadvexmail19mn.xyz
@@ -229902,7 +210790,6 @@ nanyang.yfqzdfd.com
  naoclpai.com
  naofiquedeforadessamega.com
  naofiquesemcombaterocorona.com
-naonsjdiuejahs.us
  naopbfiplyxpifbi-dot-millinium.ey.r.appspot.com
  naopinchi.cn
  naotraffic.com
@@ -230019,6 +210906,7 @@ nataliemorin.me
  nataliv.my03.com
  natalja8.zzux.com
  natalmelhorespresenteprodut9442.com
+natalpromolojas-com.umbler.net
  natalyasanarova.ru
  natalzull.com
  natanpronta.imfast.io
@@ -230232,6 +211120,7 @@ natwest.personals-payeerisk.com
  natwest.personals-payeerisks.com
  natwest.personals-spec.com
  natwest.personals-user.com
+natwest.protection-verify.com
  natwest.removenew-payee.com
  natwest.resetpayee.com
  natwest.reverse-payee.co.uk
@@ -230540,6 +211429,7 @@ ncvddedf.com
  ncven.us
  ncwqvsckedvrtlwucwnlwycqmj-dot-gleowayel400503.uc.r.appspot.com
  ncwt.com.cn
+ncwtwaratwuhrcec-dot-motast.nw.r.appspot.com
  ncxdr.xyz
  ncxps.com
  nczpmeeutknclmehwqekczyrel-dot-gleowayel400503.uc.r.appspot.com
@@ -230668,6 +211558,7 @@ needupdateto.seeyouramazoncard.club
  needupdboainf.com
  needyhonestmachinecode--five-nine.repl.co
  neelkanthazm.com
+neenaae.cam
  neeocacetsquuuczktrdonqnwkjqhgzwjavm-dot-cryptic-now-290917.ey.r.appspot.com
  neep-pr.com.br
  neerajsharma.org
@@ -230687,6 +211578,7 @@ nefilxfilmesseries-app.com
  neflexforcasts.com
  neflexservicedomain.com
  neflixmembersclub.com
+neflixpubg.com
  neformal.ajci.tk
  neformalforum.ru
  neftlix.us
@@ -230859,7 +211751,6 @@ nerv7.ddns.net
  nerve.com.pl
  nervosanguineous.xyz
  nervous-kilby-bf83ba.netlify.app
-nervous-northcutt-dd2c97.netlify.app
  nervous-payne-346c04.netlify.app
  nervousclear.co
  nervousdeserve.com
@@ -231045,6 +211936,7 @@ netflix-chance.com
  netflix-chile.com.sitiocrvzkr.com
  netflix-cl.com.pagogruhrs.com
  netflix-client-payment.movietvplans.online
+netflix-com.com
  netflix-comm.serveirc.com
  netflix-compte-gratuit.streamto.cc
  netflix-contact.info
@@ -231331,6 +212223,7 @@ netflixconfiguration.info
  netflixcovid-19.pt
  netflixcovid19s.com
  netflixcr.com
+netflixcustomer-service.com
  netflixdestek.cf
  netflixdevice.info
  netflixethiopia.000webhostapp.com
@@ -231348,6 +212241,7 @@ netflixlockdown.com
  netflixloginhelp.com
  netflixloginhome.com
  netflixmembership-renewal.com
+netflixnews.xyz
  netflixnoname.com
  netflixo.centurymusic.com.my
  netflixoferta.com
@@ -231360,7 +212254,6 @@ netflixplan.net
  netflixportal.service.useredit.request-userid.com
  netflixpre.com
  netflixpro.me
-netflixpromo.com.br
  netflixpromo2m.000webhostapp.com
  netflixpromocao24hrs.000webhostapp.com
  netflixrenewallupdate.com
@@ -231404,6 +212297,7 @@ netflx-pagoseguro.com
  netflx-payment.com
  netflx-verify.com
  netflx-verifyacctservice.com
+netflx.com.pl
  netflx.serveirc.com
  netflx1-sms98.com
  netflx14-inf0s8.com
@@ -231582,7 +212476,6 @@ neurotropic-dips.000webhostapp.com
  neuschelectrical.co.za
  neusoftware.com
  neutralsources.com
-neutralsuffer.cloud
  neutrondad.com
  neutrum.pl
  neuurosacrycl.dxpsites.net
@@ -231671,6 +212564,7 @@ new-payee-remove.uk
  new-payeealert.com
  new-payeedecline.com
  new-payeeonline.com
+new-payeesecurity.com
  new-payment.cc
  new-payments.com
  new-paymentsupport.com
@@ -231726,6 +212620,7 @@ new-threeupdate.info
  new-ton.org
  new-unusual-activity.com
  new-unusual-device.link
+new-updatemythree.info
  new-vidio-viral.grubporno.com
  new-webmail-upgrading.000webhostapp.com
  new-webmail-upgrading001.000webhostapp.com
@@ -231779,6 +212674,7 @@ newagentscom.shaxiarates.top
  newagesl.com
  newagro.ir
  newalert-nwest.cc
+newalicebluebooleanvalue.josealbertoal21.repl.co
  newaltinteriors.com
  newamericanteam.com
  newamsterdamhistorycenter.info
@@ -231789,7 +212685,6 @@ newarrivalssneakers.com
  newart45.cf
  newattmailupdate.weebly.com
  newattyahoomailupdatingservicewebpage.weebly.com
-newauthorityclone.com
  newazo.info
  newballs.org
  newbeach.fr
@@ -231853,7 +212748,6 @@ newdeviceadd-h-plc-info.com
  newdeviceattempt.com
  newdeviceinfo-secureonline.com
  newdevicelogin.com
-newdevicepayeealert.com
  newdeviceregistered-alert.com
  newdevices-managements.com
  newdevices.cc
@@ -232003,6 +212897,7 @@ newpayee-added-account.com
  newpayee-added-lloyds.com
  newpayee-added-remove.com
  newpayee-alertuk.com
+newpayee-deregister-secure.com
  newpayee-device-alert.com
  newpayee-device.com
  newpayee-halifax.com
@@ -232014,16 +212909,21 @@ newpayee-online.com
  newpayee-pendingalert.com
  newpayee-pendingalerts.com
  newpayee-pendingauth.com
+newpayee-registration-secured.com
+newpayee-removal-secured.com
  newpayee-removal.com
  newpayee-secalert831.com
  newpayee-secuirtyalert.com
+newpayee-secure-info.com
  newpayee-secureaccount.com
  newpayee-secured-uk.com
  newpayee-secured.com
+newpayee-security-online.com
  newpayee-securityvalidation.com
  newpayee-verifyalert.com
  newpayeeadd-secure.com
  newpayeecancel.net
+newpayeedevice.com
  newpayeehalifax.com
  newpayeehelp-halifax.com
  newpayeemanage-help.com
@@ -232261,7 +213161,6 @@ newworld.zzz.com.ua
  newworldsanket.com
  newxauthentverificationauth-paypal-payment-idfbmbm.tk
  newxico.kl.com.ua
-newyarlfm.weebly.com
  newyear2019.club
  newyearddnsaddressupdatelink.duckdns.org
  newyears-eve.com
@@ -232294,7 +213193,6 @@ nextcloudsolutions.ca
  nextcorpbolivia.com
  nextdenimltd.com
  nextdigitalday.ru
-nextgearng.com
  nextgenerationoceans.org
  nextgmindia.com
  nexthotorder.ru
@@ -232703,6 +213601,7 @@ niebuur.nl
  nieceextoll.com
  niedermeier-online.de
  niedzwiedz.co.uk
+nieepfenop.wang
  nieitkvkybwzaxfb-dot-millinium.ey.r.appspot.com
  nienowcenters.buzz
  nient2018.com
@@ -232726,8 +213625,6 @@ niezezlepouldn.com
  nifeript.com
  nifgvqnbtjsuqfvc-dot-millinium.ey.r.appspot.com
  nifty-colden-cb70e4.netlify.app
-nifty-meitner-d11310.netlify.app
-nifty-tereshkova-96832b.netlify.app
  niftygifting.com
  nifudrqot.vipsnapchatsexting.com
  nigarsas.com
@@ -232952,7 +213849,6 @@ nittemsmeconclave.com
  nityarong.com
  nitzaweb.com.br
  niu688.com
-niubiniubiniubi.xyz
  nivasoft.com
  nivelimoveis.com.br
  niveront.com
@@ -233120,7 +214016,6 @@ nl.sitepreview1.com
  nl.thelittleglutenfreekitchenco.com
  nl.tigerparalegal.com
  nl.toestelbeheer.top
-nl.upintheair.ca
  nl.xsph.ru
  nl153.ir
  nl158.ir
@@ -233385,6 +214280,7 @@ nocontent-orkvoaoq.velocityhub.com
  nocontent-powsrozz.velocityhub.com
  nocontent-ppcjbiph.velocityhub.com
  nocontent-pswozkqy.velocityhub.com
+nocontent-puwrkykl.velocityhub.com
  nocontent-qgupkexu.velocityhub.com
  nocontent-qktidkfm.velocityhub.com
  nocontent-qldbzpix.velocityhub.com
@@ -233400,6 +214296,7 @@ nocontent-syrxvomx.velocityhub.com
  nocontent-tnxsqiil.velocityhub.com
  nocontent-uibuwpss.velocityhub.com
  nocontent-upjhiolu.velocityhub.com
+nocontent-uropvkux.velocityhub.com
  nocontent-uvkquxnm.velocityhub.com
  nocontent-uvonrmnz.velocityhub.com
  nocontent-uxvxklgg.velocityhub.com
@@ -233981,7 +214878,6 @@ noticed-serv113.plokmir.org
  noticehelp-xnxxappleverify.toloanjgrf.com
  noticese.duckdns.org
  noticestat.com
-noticetip.cloud
  noticevertical.com
  noticiando.live
  noticianews.xyz
@@ -234131,6 +215027,7 @@ novavitta.com.br
  novaxcapitaltrade.co
  novdir.ru
  noveacom.link
+noveacom.online
  noveacom.site
  noveamining.com
  novelcoronavirus.cc
@@ -234216,6 +215113,7 @@ npagon.com
  npakbsgolrkvbcsi-dot-millinium.ey.r.appspot.com
  npay.store
  npdgtdaelayxiwbq-dot-millinium.ey.r.appspot.com
+npekgapplnch-164061821.sangekasra.ir
  npgxipdscjhyzuec-dot-millinium.ey.r.appspot.com
  nph1.jaysbrand.com
  nphdltd.com
@@ -234282,7 +215180,6 @@ nqwonmhcugyniwbfaqirgprrvcwlcmbiacry-dot-cryptic-now-290917.ey.r.appspot.com
  nqwonmhcugyniwbfaqirgprrvcwlcmbiacry.cryptic-now-290917.ey.r.appspot.com
  nqy7p.awaykart.com
  nqzoyvrhjrnhvfes-dot-millinium.ey.r.appspot.com
-nqzyykasftmnsbnberxuvrkmde-dot-owaonk399399393.uk.r.appspot.com
  nr.com.pk
  nr01petitieonline-covid19byfacebook.gq
  nr09p.jaysbrand.com
@@ -234510,7 +215407,6 @@ ntflxslgins.com
  ntflxsupprtlgns.com
  ntflxupdtpymnt.com
  ntfservices.us
-ntfx1.link
  ntfx2020.e-support-service.com
  ntfxaccountsupp.com
  ntg2k.jaysbrand.com
@@ -234571,6 +215467,7 @@ nuciferac.co.in
  nuckcitgulwboppa-dot-millinium.ey.r.appspot.com
  nucleokardecistalace.org.br
  nucleophilic-passwo.000webhostapp.com
+nuclrty.cam
  nucnxlpfzvbuhftn-dot-millinium.ey.r.appspot.com
  nuconta-nubank-voce-no-controle.com
  nuconta.nexl-7.com
@@ -234625,7 +215522,6 @@ numvicer.com
  nuncafoisorte.club
  nunezdaughter.com
  nunsmpvaqg.kzyneudxtb.top
-nunthesis.cloud
  nunucandies.com
  nunugurl.xyz
  nunulap.tk
@@ -234794,6 +215690,7 @@ nvwpyymjyohowgkt-dot-millinium.ey.r.appspot.com
  nvxabbpwrlpvwegpiyddqmaapx-dot-gloff849483.uk.r.appspot.com
  nvxgitbsgyxmmkag-dot-millinium.ey.r.appspot.com
  nw-industries.co.id
+nw-isecure-cancelpayee.com
  nw-resources.com
  nw-secured.co.uk
  nw5.7t6.dalianl.cn
@@ -235071,7 +215968,6 @@ o2-bill-account.com
  o2-bill-support.com
  o2-bill-verify.com
  o2-bill.info
-o2-bill.services
  o2-bill.support
  o2-billing-account.com
  o2-billing-alerts.com
@@ -235350,6 +216246,7 @@ objectionsupportform.tk
  objectiontocopyrightlnstagram.com
  objective-bassi-a0627e.netlify.app
  objective-fermi-75a252.netlify.com
+objective-mccarthy-369823.netlify.app
  objective-noether-d7eca4.netlify.app
  objectstream.ga
  objectway.ca
@@ -236017,7 +216914,7 @@ offdemega.com
  offdemes.com
  offended.feenode.net
  offenrichusers.brucebil.repl.co
-offenseleave.cloud
+offensiveflakypolygons.adasdfff.repl.co
  offer-cards.com
  offer.dukpoints.com
  offer.rbc-capital.digital
@@ -237063,6 +217960,8 @@ omronby.uno
  omrtw.com
  omrunheukfcantrb-dot-millinium.ey.r.appspot.com
  oms.theonlinereserve.com
+omsd-org.gq
+omsd-org.tk
  omshjijgxtlsesgn-dot-millinium.ey.r.appspot.com
  omsigroup.net
  omsoetxawtqrrlie-dot-millinium.ey.r.appspot.com
@@ -237336,8 +218235,6 @@ onickdoorsonline.com
  onige.cm
  onilinefriend995.000webhostapp.com
  oninet.al
-onionclo.com
-onionfreedom.cloud
  oniongames.jp
  onivallort.com
  onivenis.es
@@ -237354,7 +218251,6 @@ onlbc2.com
  onlearn24.com
  onli-ne.webredirect.org
  onli2connexionsinfg.webnode.at
-onlibebanking-digital-secure-info.com
  onliformat.000webhostapp.com
  onligne-messageriepro.webnode.com.co
  onlinbanking-asb.duckdns.org
@@ -237435,6 +218331,7 @@ online-dating-safe.com
  online-device-alert.com
  online-device-secure.com
  online-device-secured.com
+online-disable.com
  online-easy-web-td.com
  online-error-reporting.com
  online-error.cc
@@ -237455,6 +218352,7 @@ online-home-job-scheme.djsanjay.in
  online-ib.com
  online-ibercajadirecto-iniciar.com
  online-ideal-verzoek.icu
+online-identificatie.xyz
  online-inet.de
  online-info-fargo.com
  online-intim.ru
@@ -237727,7 +218625,6 @@ onlinebanking.asb.co.nz.login1-co.gq
  onlinebanking.asb.co.nz.login1-co.tk
  onlinebanking.asb.co.nz.logon1-home.cf
  onlinebanking.asb.co.nz.logon1.ml
-onlinebanking.co.nz-o.gq
  onlinebanking.ib.nab.com.au-balance.ga
  onlinebanking.mtb-com.access-online.digital
  onlinebanking.northerncu.ca-sn.com
@@ -237793,6 +218690,7 @@ onlinee.secure.login.az.argus-co-uk.buzz
  onlinee.secure.login.az.argusz.buzz
  onlineeregistration.com
  onlineetaindia.com
+onlineexcelfile-74637648764733esgx664-dot-west-2673846.df.r.appspot.com
  onlineexcelviewer.ddns.net
  onlinefantacysports.com
  onlinefbcontest.000webhostapp.com
@@ -237850,11 +218748,9 @@ onlineonedriv.netlify.app
  onlineorder11.000webhostapp.com
  onlinepakistandramas.com
  onlinepasvervangen.info
-onlinepayee-authorisation.com
  onlinepayee-new.com
  onlinepayee-registration.com
  onlinepayee-secure.com
-onlinepayee-support.com
  onlinepayementventeachat.000webhostapp.com
  onlinepayp.temp.swtest.ru
  onlinepcfixer.xyz
@@ -238497,7 +219393,6 @@ orange-offre.theworkpc.com
  orange-offres.mobile-forfait.optimus.org.rs
  orange-orange.webnode.be
  orange-prelevement.com
-orange-pro28.yolasite.com
  orange-pro6.yolasite.com
  orange-secure.dvrdns.org
  orange-security.cloud.coreoz.com
@@ -238557,6 +219452,7 @@ orangraphics.000webhostapp.com
  oraonline-togo.net
  orarwinfo.ru
  orasasaaoskset.tk
+oraspacemove.flywheelsites.com
  orasudiasu.com
  oratoriostsurukyo.com.br
  oratossigma12.000webhostapp.com
@@ -238806,7 +219702,6 @@ oryano.us
  oryktaco.com
  orytcqeh.goruli.com
  oryxplastics.com
-orziwiki.flywheelsites.com
  orzmpkssvyngwory-dot-millinium.ey.r.appspot.com
  os-dias-das-maes-ainda-nao-acabou.000webhostapp.com
  osa-co.com
@@ -239065,7 +219960,6 @@ oudasia.cn
  oudheverlee.top
  oudksizxzugegquxmytazkvrzlngetxqenjs-dot-cryptic-now-290917.ey.r.appspot.com
  oudnuhscmsqgqqbc-dot-millinium.ey.r.appspot.com
-oueasx.com
  oueqdcvqrvjdqvsgg.top
  ouesgvrzgeujoysx-dot-millinium.ey.r.appspot.com
  oufdesign.2020bhonlinequranclasses.net
@@ -239156,6 +220050,7 @@ ourtimev.hkmafile.com
  ourtlookmicro.netlify.app
  ourtlookmicro.netlify.com
  ourtruecolours.com
+ourwearypoint.adasdfff.repl.co
  ourworldspeaks.icu
  ouryahooadministration.weebly.com
  ouryoungminds.wordpress.com
@@ -239165,6 +220060,7 @@ ousitong.com
  oussamarrio.ddns.net
  oussamatravel.com
  out-look-284422.df.r.appspot.com
+out00c0-dot-jester-296210.ue.r.appspot.com
  out365.yeashi.xyz
  out98officeonline.netlify.app
  outbackfencing.com
@@ -239176,7 +220072,6 @@ outdoorism.com.au
  outdoorrb.com
  outdqfqxfeikrlws-dot-millinium.ey.r.appspot.com
  outershusht.com
-outerstadium.cloud
  outfieldersyrup.com
  outfish.bounceme.net
  outfitpubgm.com
@@ -240241,7 +221136,9 @@ pages-certificated-valid-invitation-14934922020.tk
  pages-certificated-valid-invitation-245242020.tk
  pages-help-identify-certificated-2020.my.id
  pages-reconfirm-active-info-2020.my.id
+pages-secur-confirmaton-identityi.my.id
  pages-secur-confirmaton.my.id
+pages-secur-confrmation-identityi.my.id
  pages-user-blocked.cf
  pages-user-blocked2.cf
  pages-user-blocked3.ga
@@ -240473,7 +221370,6 @@ pals7.neocities.org
  paltox.com
  paltweets.com
  paluddipizzabrasil.com
-palundrus.com
  palytte.net
  pamatea.com
  pamaucone.com
@@ -240525,7 +221421,6 @@ pandaparken.at
  pandaproject.ru
  pandatop1.ddns.net
  pandaxzyz.000webhostapp.com
-pandemic-help.org
  pandemic-helpgov.com
  pandemic-helppaymentgov.com
  pandemic-info.org
@@ -240620,6 +221515,7 @@ pantone-iq.com
  pantorouter.ir
  pantura09.com
  pantura10.com
+panvcewzu.wang
  panvelpropertyproject.com
  panxiyanqp.52doweb.cn
  panzerklaczen.xyz
@@ -240669,6 +221565,7 @@ papillonapothecary.com
  papirbest.hu
  papoosemutablev.com
  pappermintcom.baerqiprimary.top
+paprikasimperial.com
  papuaadventure.com
  papuapedulicovid.000webhostapp.com
  papuapulsa.000webhostapp.com
@@ -240985,7 +221882,6 @@ pasivect.co.uk
  paskha.biz.ua
  paskjldf.ug
  pasqualeserrani.com
-pass-code-login.ibx.lat
  pass-securite-societegenerale-configuration20.000webhostapp.com
  passaureisen.shaxiaasian.top
  passbusiness.info
@@ -241023,12 +221919,12 @@ pastaciyiz.biz
  pastadiamond.com
  pastaybasta.com
  pastaybastarosarito.com
+pastdeer.monster
  paste.ee
  paste.makomk.com
  paste.world
  pasteferinsider.com
  pasteiscolono.com.br
-pastelcoat.cloud
  pasteleriasblancoyazul.com
  pastelesgloriadelis.com.mx
  pastenter.com
@@ -241397,6 +222293,7 @@ paydepalneverisomeno.4lima.de
  paydestruction.com
  payecnseu.com
  payee-access.uk
+payee-accountconfirm.com
  payee-alertdevice.com
  payee-amends.com
  payee-assist-protection.com
@@ -241428,11 +222325,11 @@ payee-failure.info
  payee-halifax.com
  payee-info-centre.com
  payee-issue-alert.com
+payee-lloyds.com
  payee-online-cancel.com
  payee-online-issue.com
  payee-online-secure.net
  payee-online-security.net
-payee-online-security.org
  payee-onlinecheck.com
  payee-portal-halifax.com
  payee-prevention.co.uk
@@ -241441,7 +222338,6 @@ payee-registered.com
  payee-registration.net
  payee-removals.cc
  payee-remove-halifax.com
-payee-remove-lloyds.com
  payee-reset.online
  payee-resolveissue.info
  payee-resolves-issue.info
@@ -241465,7 +222361,6 @@ payee-secure-online.net
  payee-secure.biz
  payee-secure.cc
  payee-secure.digital
-payee-secure.page
  payee-secure.services
  payee-secure.vip
  payee-securekey.com
@@ -241527,6 +222422,7 @@ payeenot-requested.net
  payeeonlinehelp-secure.com
  payeeonlinerevision.com
  payeeprotection-hs.cc
+payeequery-bos.live
  payeercrypto.site
  payeeref-help.com
  payeeregistration-lloyds.com
@@ -243055,7 +223951,6 @@ paypalbit.tk
  paypalbusinessaccountsupport.com
  paypalbusinessaccountverifyservices.com
  paypalcases-id-1es14348.com
-paypalcases-id-1es94348.com
  paypalcharities.com
  paypalcheck24.com
  paypalcheckoutt.com
@@ -243089,6 +223984,7 @@ paypalh.link
  paypalhasme.myvnc.com
  paypalhelp-id-1e21654.com
  paypalhelp-id-1e44639.com
+paypalhelp-id-238714.com
  paypalhelp-id-2ch45310.com
  paypalhelp.ddns.net
  paypalhelpcentre.tk
@@ -243098,11 +223994,12 @@ paypalhold24.info
  paypalice.com
  paypalid-online.serveftp.com
  paypalid-verifedmyaccount.inspirasikita.org
-paypaliddispute.cf
  paypalii.tk
  paypalinc1.com
  paypalinc54.com
  paypalinc762.com
+paypalinfo-id-144899.com
+paypalinfo-id-167899.com
  paypalinfo.raylf.org
  paypalinfo1.com
  paypalinfo72.com
@@ -243116,8 +224013,6 @@ paypalissue.com
  paypalissued3512.info
  paypalissued3513.info
  paypalissued3517.info
-paypalissuer-id-1es94315.com
-paypalissuer-id-1es94345.com
  paypalissuse-id-1e21259.com
  paypalissuse-id-2e23659.com
  paypalissuse6528.info
@@ -243128,11 +224023,15 @@ paypalkshjfirkhbsd.dateeatinghousede.com
  paypalkundenservice-wixsite-com.filesusr.com
  paypall.account.payshieldonline.com
  paypall.elitebankgroup.com
+paypallimit-id-144899.com
+paypallimit-id-188499.com
  paypallimit-id-2ch35710.com
  paypallimit.info
+paypallimited-id-285714.com
  paypallimits.org
  paypalllimited.serveirc.com
  paypallllf.ddns.net
+paypallock-id-188459.com
  paypallooking.info
  paypalls-logins.webhop.me
  paypallsupport.serveirc.com
@@ -243154,6 +224053,8 @@ paypalrecovery-bntl.servebeer.com
  paypalrecovery-intl.serveirc.com
  paypalreset24.info
  paypalresolutionsuk.com
+paypalresolve-id-216714.com
+paypalresolve-id-235758.com
  paypalrestoreuk.ga
  paypalrestrictionsuk.com
  paypalrevision.com
@@ -243161,8 +224062,8 @@ paypals-ticket.com
  paypals.serveirc.com
  paypals.us
  paypalsecuirty.serveirc.com
-paypalsecur5e.hopto.org
  paypalsecure-app.serveirc.com
+paypalsecure-id-245482.com
  paypalsecure-id-2e12984.com
  paypalsecure-service08.com
  paypalsecure.emmyjanielimited.com.ng
@@ -243197,9 +224098,13 @@ paypalseverreslt.serveirc.com
  paypalsigninfo.deisemelo.com
  paypalsir.com
  paypalsite.cf
+paypalsolve-id-175458.com
+paypalsolve-id-188459.com
  paypalssdfmwemfmsdfz.buzz
  paypalstatus2407.info
  paypalstroe.com
+paypalsupport-id-235610.com
+paypalsupport-id-237610.com
  paypalsupport-id-2e38272.com
  paypalsupport-id-2e3d665.com
  paypalsupport-id-2e3d670.com
@@ -243285,8 +224190,6 @@ paypalupdate.itstudynepal.com
  paypalupdate.osamaalshareef.net
  paypalupdate2020.blogspot.com
  paypalupdated24.info
-paypalupdateinfo.serveirc.com
-paypalupdateservice.serveirc.com
  paypaluser-service09.webredirect.org
  paypaluser24.info
  paypaluserid.serveirc.com
@@ -243357,7 +224260,7 @@ paypeles.000webhostapp.com
  paypelsuspiciousattempt.000webhostapp.com
  paypeltsecuremngerupdte.com
  paypending.com
-payphelpdeesk.info
+paypial-us.com
  paypkonto.app
  paypl-account.com
  paypl-accountlimitedsecuref.com
@@ -243387,9 +224290,6 @@ payplticket6015291.info
  payplticket603150798.info
  payplticket6350815.info
  payplticket7103795.info
-payplticket713575.info
-payplticket770610.info
-payplticket770611.info
  payplticket79013590.info
  payplticket85331791.info
  payplticket9472492.info
@@ -243530,8 +224430,8 @@ pcc24org.batwoqishoes.top
  pccc114.vn
  pcchandraindia.com
  pccpw.com.br
-pccreed.com
  pcd50.shoofgoal.com
+pcdenunciasaceitas.email
  pcdesigns4you.com
  pcdlnfcntpeiujuudmdawpenitpgepmpqpmp-dot-solar-vertex-285913.rj.r.appspot.com
  pcdlnfcntpeiujuudmdawpenitpgepmpqpmp.solar-vertex-285913.rj.r.appspot.com
@@ -243721,7 +224621,6 @@ peachypalmer.net
  peacock.dating
  peacockproductions.com
  peajianet.com
-peakchance.cloud
  peakflooring.uk
  peakhandball.com
  peaksurvivor.com
@@ -243772,6 +224671,7 @@ pedantelves.com
  pedantic-booth-d4d494.netlify.app
  pedantic-darwin-5ae461.netlify.app
  pedantic-galileo-455160.netlify.app
+pedantic-leakey-6937ab.netlify.app
  pedantic-poincare-b83127.netlify.app
  pedantic-poincare-b83127.netlify.com
  pedantic-ptolemy-a9b902.netlify.app
@@ -243886,7 +224786,6 @@ pembatalaan-blokir-fb.otzo.com
  pembatalan-blokir-facebook.zyanapro.com
  pembatalan-blokir18.ml
  pembatalan-pemblokiiran.weebly.com
-pembatalan-pemblokiran-2020.weebly.com
  pembatalanakun.blokircfbb20.my.id
  pembatalanblockir-facebook.oottz.com
  pembatalanblokir-fb.jetos.com
@@ -243992,16 +224891,16 @@ pennystock-picks.info
  penochao.resultaweb.com.br
  penotorc.com
  pensile-wardroom.000webhostapp.com
-pensionaspect.cloud
  pensiunea-roxana.ro
  pensiuneafenyo.ro
  pensiunealaluna.com
+pensive-banach-da28c8.netlify.app
  pensive-benz-ea56f8.netlify.app
  pensive-boyd-6385b6.netlify.app
  pensive-hodgkin-9e7e57.netlify.app
+pensive-knuth-10c904.netlify.app
  pensive-lamarr-a7c3ce.netlify.app
  pensive-lumiere-2ab12d.netlify.app
-pensive-neumann-7ce75d.netlify.app
  pensive-swirles-c192f1.netlify.app
  pensoutlet.cn
  penta.com.au
@@ -244427,6 +225326,7 @@ petshappyhome.com
  petsittingexcellence.com
  petter8358227.xyz
  pettisvilleoh.xyz
+pettybluekeychanger.elmazoprieto.repl.co
  pettyrosso.it
  peturreja1971.blogspot.be
  peturreja1971.blogspot.com
@@ -244587,7 +225487,6 @@ ph25.jaysbrand.com
  ph4s.ru
  phadda.com
  phadishago.co.za
-phaedrasuzann.ru
  phaeremnhes.ddns.net
  phaetus.com
  phaimanhdanong.com
@@ -244889,7 +225788,6 @@ pianomusics.ga
  pianonet.cyou
  pianopartes.com
  pianostore.pl
-pianosubway.cloud
  piaoakl.000webhostapp.com
  piatpusa.com
  piavee.com
@@ -245199,7 +226097,6 @@ piszej.xyz
  pitawebs.com
  pitbullvideosfunny.000webhostapp.com
  pitbullzowna1.ddns.net
-pitchblast.cloud
  pitchpixels.com
  pitchrating.com
  pitchseed.com
@@ -245381,7 +226278,6 @@ plancoders.com
  plancul2020.000webhostapp.com
  plandese.com
  plane.com4reload.casa
-planebucket.cloud
  planejaragro.com.br
  planelocations.com
  planeoftcom.nckiamerican.gdn
@@ -245667,7 +226563,6 @@ plc-98898301.hgps.ie
  pldgsbexzhufkmov-dot-millinium.ey.r.appspot.com
  pldtdsll.net
  pldxs.rogagot.com
-pleadeurope.cloud
  pleadingelsosobl7a.com
  pleasanttravelchicago.com
  pleasantvalleydreamrides.com
@@ -245839,7 +226734,6 @@ plusmonthslitepageshare.com
  plusplus.vn
  plussizeforall.com
  plussizewomensa.co.za
-plussnlightenekj.us
  plusvraiquenature.fr
  plutomaiserf.myvnc.com
  plutoniy.hopto.org
@@ -245984,7 +226878,6 @@ po.do
  po.ibot.repl.co
  po1mdsacn9pytzqqafcx6spqjx.com
  po4438050.000webhostapp.com
-po5eljg4dfsa64oisdaflkjg87jjldsaetlkj.info
  poalim.circles.eco
  poalmskas12d.com
  poaswinal.com
@@ -245997,6 +226890,8 @@ pocahontasilz.top
  pochi.eek.jp
  pochta-rus.ru
  pochtarefund-xeq0sd.aakkl.xyz
+pochtarefund-xeq0vb.aakly.xyz
+pochtarefund-xeq0y1.aakmk.xyz
  pochtarefund-xeq10m.aakmr.xyz
  pochtarefund-xeq10q.aakmt.xyz
  pochtarefund-xeq138.aakna.xyz
@@ -246005,7 +226900,6 @@ pocked-capital.000webhostapp.com
  pocket-gear.com
  pocket-opera.de
  pocketcarb.co.jp.tribecabcn.com
-pocketcard.dzyshh.com
  pocketcart.in
  pocketexorcit.com
  pocketfsa.com
@@ -246377,6 +227271,7 @@ pool090.telepuzz.net
  poolarztcom.baerseventeam.top
  poolbook.ir
  pooldeckdr.com
+poolfit.cyou
  poolopeningcentraljersey.com
  poolscalifornia.top
  poolservicelasvegasnv.com
@@ -246615,7 +227510,7 @@ portale-lsp-antifrode-psd2.000webhostapp.com
  portale-siena.com
  portale-unipolsai.com
  portale-web-info.net
-portale.mps.cliente.namdevvivah.com
+portale.cliente.verifica.zzlifts.com
  portale.titolari.logi.privati.poste.clienti.kanmolifestyle.co.id
  portale.titolari.login.privati.sp.clienti.ayokemon.com
  portale.titolari.poste.it.info.clienti.10002930987.shophavaianas.co.id
@@ -247257,7 +228152,6 @@ pp-support.net
  pp-supportcentre.co.uk
  pp-supportline.co.uk
  pp-supportline.com
-pp-suspended-verify.com
  pp-suspicious-login.com
  pp-transfert-suivi.com
  pp-united-kingdom-012.com
@@ -247540,7 +228434,6 @@ pracujauzivej.cz
  pradapoland.pl
  pradaromania.com
  pradeepbattery.com
-pradistim.work
  pradofridman.com.br
  pradopro.ru
  praelusio.com
@@ -247877,7 +228770,6 @@ prevelo.com
  prevenciondelavadodedinero.com
  prevenciondelcoronavirus.com
  prevencionesenlinea.com
-prevenmedhealth.com
  prevent-payee.com
  preventcoronavirus19.com
  prevention-notknown.listencoerce.net
@@ -248106,7 +228998,6 @@ prismanet.000webhostapp.com
  prismatic-vial-290917.uc.r.appspot.com
  prisondepression.com
  prisonlog.info
-pristatrtaesteam.us
  pristineindia.org
  pristinepride.com
  pristinequill.com
@@ -248226,6 +229117,7 @@ prizeavariciousmarketing.estarlingramos.repl.co
  prizecollection.store
  prizepubgv1.com
  prizex15.com
+prizexmetro.jetos.com
  prj82008dev0720sec20ver004.ue.r.appspot.com
  prjcgntodltaaoht-dot-millinium.ey.r.appspot.com
  prjctsknkoflgndpnyeta.mlph21.com
@@ -248381,7 +229273,6 @@ producoesdahora.inclusaodahora.com.br
  product-kick.com
  productbeforebuying.com
  productersproff.shop
-productersproff.xyz
  productfb586787656454564373.com
  productiondelphi.minehosting.xyz
  productiondocument.com
@@ -248407,6 +229298,7 @@ produto-semanal.com
  produto-token8917827.tk
  produtoexclusivoeimperdiveleaqui.com
  produtonapromocao.com
+produtopromonatal-com.umbler.net
  produtos-com-qualidade-aproveite.com
  produtoseservicos-paravoce.com
  produtosnaoferta.com
@@ -248645,6 +229537,7 @@ profitablevacationrentals.com
  profitcall.net
  profitcoach.net
  profitcoins24.com
+profligerhjds.us
  proflines.ga
  profmaharaja.com
  profmetal.by
@@ -248771,7 +229664,6 @@ promesapuertorico.com
  promethi.ml
  promethiumswooth.com
  promfx.com
-promindscomplex.buzz
  promintra.in
  promise-my.com
  promixcopl.com
@@ -249153,7 +230045,6 @@ prozirk.com
  proziss.000webhostapp.com
  prposblnwtamlkeb-dot-millinium.ey.r.appspot.com
  prpr48714.staging-cloud.netregistry.net
-prrrts.work
  prs4music.network
  prsicilacap.org
  prsmaleri.se
@@ -249206,7 +230097,6 @@ prwssztigrkjofhqssyprtvkvg-dot-gleowayel400503.uc.r.appspot.com
  prx.lagatiteca.com
  prycil.info
  pryscillabarroso.com
-pryvaci-recovry-secur-identty-andromed.my.id
  prywatne-zdjecia.pl
  prywatne-zdjeciee.eu
  prywatnezdjecie.eu
@@ -249457,6 +230347,7 @@ ptyfwbwtplfeswqo-dot-millinium.ey.r.appspot.com
  ptysq.addroits.com
  ptzz360.com
  ptzznnofejjyigvtpdepvdfjfnavfqdpjedf-dot-off94032393204.uk.r.appspot.com
+pu6gmobile.com
  pu9g.com
  puamprrreuddhfgazmuirrfohmxwcbrgphjb-dot-solar-vertex-285913.rj.r.appspot.com
  puaol.weebly.com
@@ -249492,6 +230383,7 @@ pubg.help
  pubg.lib4yu.com
  pubg.team
  pubg.tencentcore.com
+pubg116.com
  pubg13.dynamic-dns.net
  pubg13.itsaol.com
  pubg13.net
@@ -249583,6 +230475,7 @@ pubggifts.ezua.com
  pubggifts.otzo.com
  pubggiftsn11.zyns.com
  pubggiftuc.com
+pubggiveword.com
  pubggmobileevent.com
  pubggold.com
  pubggroupmobile.com
@@ -249647,7 +230540,6 @@ pubgm15material.com
  pubgm18.com
  pubgm2020.qhigh.com
  pubgmaks15.com
-pubgmanja.com
  pubgmasi.com
  pubgmaxe16.com
  pubgmbest15.com
@@ -249674,10 +230566,12 @@ pubgmevent-s13.jkub.com
  pubgmeventredeem.com
  pubgmeventscollect.com
  pubgmexo.com
+pubgmexovip.com
  pubgmfest.com
  pubgmfree.net
  pubgmfreegunskins.000webhostapp.com
  pubgmfreesekin.otzo.com
+pubgmfrostfestiva.zyns.com
  pubgmgamer.com
  pubgmgets.4dq.com
  pubgmgetucs11.xyz
@@ -249774,7 +230668,6 @@ pubgmobileventid.com
  pubgmobileventspin.com
  pubgmobilevip.com
  pubgmobilewinter-s10.000webhostapp.com
-pubgmobilexmetrospin.com
  pubgmobilexvoting.com
  pubgmobille.online
  pubgmobille.xyz
@@ -249822,6 +230715,7 @@ pubgmyu.com
  pubgnazar.xmidasbuy.com
  pubgnblack.com
  pubgner.com
+pubgnewevent20.com
  pubgnews14.kozow.com
  pubgnhalloweeksnow.com
  pubgnov.com
@@ -250064,6 +230958,7 @@ pukuspikis83.000webhostapp.com
  pularvapes.ga
  pulbarlhbossqu.000webhostapp.com
  puleo.com.au
+pulgushenmy.wang
  puljxlxlzlexuuev-dot-millinium.ey.r.appspot.com
  pulka.pp.ua
  pullabest.com
@@ -250221,7 +231116,6 @@ purpleapples.shop
  purplebillioninitiative.org
  purplechristmas.litmus.online
  purpledigits.com
-purpledot.io
  purplehygiene.uk
  purpleinfinity.com.au
  purpleline.co.uk
@@ -251574,7 +232468,6 @@ queensaccessories.co.za
  queenslandworldwide.com
  queensrocketry.ca
  queenswati.000webhostapp.com
-queensworldtravel.com
  queenwash.net
  queenyconnection.com
  quefinanciamiento.com
@@ -251613,6 +232506,7 @@ questingpanda.com
  questoutwall.xyz
  questraworld.es
  queue-pleskqposexim.indusdrills.org
+queuemold.monster
  queurieamoozo.acutopetuis.top
  quewedsre.com
  qufcbleijvntljjd-dot-millinium.ey.r.appspot.com
@@ -251694,6 +232588,7 @@ quipertise.com
  quirky-clarke-d15627.netlify.app
  quirky-johnson-c4a60c.netlify.app
  quirky-noether-cd4453.netlify.app
+quirky-visvesvaraya-d08926.netlify.app
  quistsolutions.eu
  quitaragora.godaddysites.com
  quiteaqui.xyz
@@ -251713,6 +232608,8 @@ quizdespoteaux.com
  quizpreparation.com
  quizzes.ippogrifo.net
  quizzical-blackwell-df290c.netlify.app
+quizzical-clarke-9d05d3.netlify.app
+quizzical-golick-6f6518.netlify.app
  quizzical-lamport-2bde27.netlify.app
  quizzical-leakey-647bbb.netlify.app
  quizzical-ptolemy-1e6d7f.netlify.app
@@ -251743,7 +232640,6 @@ quotientcommunications.com
  qupalzajs.gq
  quqbedehdj.duckdns.org
  quqcbwhhyvudxwun-dot-millinium.ey.r.appspot.com
-quqrdiacik.casa
  qurabsaxiopolingalasz.ml
  quran.hillstationstudio.com
  quranclassonline.net
@@ -252144,6 +233040,7 @@ rabo-alertklant.info
  rabo-bankbetaalverzoek.live
  rabo-bankieren.me
  rabo-betaal-pas.info
+rabo-betaalproduct.info
  rabo-covid19.com
  rabo-covid19.online
  rabo-diensten.services
@@ -253189,6 +234086,7 @@ rakuten.co.jp.qcxzsx.asia
  rakuten.co.jp.qczcsb.asia
  rakuten.co.jp.qkhqh73.top
  rakuten.co.jp.qxelgao.icu
+rakuten.co.jp.raauten.xyz
  rakuten.co.jp.rakaten.xyz
  rakuten.co.jp.rakentonchangxint.xyz
  rakuten.co.jp.rakiten.xyz
@@ -253212,7 +234110,6 @@ rakuten.co.jp.rakuiten.xyz
  rakuten.co.jp.rakulpn.xyz
  rakuten.co.jp.rakulten.xyz
  rakuten.co.jp.rakumtn.xyz
-rakuten.co.jp.rakuntann.xyz
  rakuten.co.jp.rakuntenvip.xyz
  rakuten.co.jp.rakutaen.xyz
  rakuten.co.jp.rakutan.icu
@@ -253660,6 +234557,7 @@ rakutenaccsdfsawe.monster
  rakutenaccsdfsawe.xyz
  rakutenaccsdfsawefg.buzz
  rakutenaccsdfsawefg.monster
+rakutenam.buzz
  rakutenamsdnwwefklsdfwd.monster
  rakutenamsdnwwefklsdfwef.top
  rakutenamsdnwwefklsdfwn.top
@@ -254004,6 +234902,7 @@ rannochplay.com
  ranonlinedominationep7.site
  ranslitera.xyz
  ransomfalls.buzz
+rantiantang.top
  ranwa-prod.com
  rao.co.ke
  raobabojafaqnthcddmvunnhwq-dot-gleowayel400503.uc.r.appspot.com
@@ -254564,6 +235463,7 @@ re-login.recover-limited.account.pypl.94039-sys.com
  re-ms.ru
  re-newupdatepaypal-feedbacks.fromstatementsalerts.com
  re-pos.in
+re-registered-device.com
  re-securemyaccount-paypal.giize.com
  re-securemyaccount-paypal.ooguy.com
  re-updatepaymentinfotmationssss-setupid.com
@@ -254595,7 +235495,6 @@ reactivacionlbcpenlinea.verit-is.com
  reactivacionoutlaaklo.000webhostapp.com
  reactivacionperubcp.cilonss.com
  reactivalbcponline.on-pops.com
-reactivalbcponlineperu.cub-fae.com
  reactivaperuconbcponline.rec-tosw.com
  reactivarperubcpenlinea.rec-tivsps.com
  reactivassnt-online.preview-domain.com
@@ -254651,7 +235550,6 @@ read-14953324.bid-digital.com
  read-15241106.bid-digital.com
  read-15648891.bid-digital.com
  read-16342249.bid-digital.com
-read-16409972.ht-egypt.com
  read-17045524.bid-digital.com
  read-17608546.bid-digital.com
  read-17903797.bid-digital.com
@@ -254691,6 +235589,7 @@ read-37072121.bigshipmentglobal.com
  read-37485430.bid-digital.com
  read-37559128.bid-digital.com
  read-38212539.bid-digital.com
+read-38224786.ht-egypt.com
  read-38334365.bid-digital.com
  read-38351365.bid-digital.com
  read-38506088.bid-digital.com
@@ -254985,7 +235884,6 @@ realmeproreg.000webhostapp.com
  realnetworjismung.club
  realnewseventmlbb03.zyns.com
  realnewseventmlbbb.zyns.com
-realpatriot.ru
  realpro.lt
  realprofitdeal.su
  realprotect.com
@@ -255121,7 +236019,6 @@ recallquestionactscare.top
  recambiosscooter.es
  recamqxvppghyfhpfe.top
  recaptcha-in.pw
-recaptcha-ppl-id.cloudaccess.host
  recaptcha.beget.tech
  recargadimasff.com.br
  recargajogomdt.000webhostapp.com
@@ -255164,7 +236061,6 @@ rechlorg.shaxiaaudio.top
  rechnung.link
  rechnung.live
  rechnungr.servegame.com
-rechtsanwalt-liste24.de
  rechtsschutzinfocom.nckibasketball.gdn
  recibo-appssy.ddnsking.com
  recibo-appsy834.servebeer.com
@@ -255212,6 +236108,7 @@ reconfirm-social-network-tw.my.id
  reconfirmcldetails.com
  reconfrim-inpages-recovery10.gq
  reconfrim-inpages-recovery101.gq
+reconhecimentoprocessual.email
  reconstservr.cf
  recoranifen16dsldeb2mcdcw12780.uc.r.appspot.com
  record30ehsk2020pnfahplatf5460.nn.r.appspot.com
@@ -255478,7 +236375,6 @@ redirectsdown.blogspot.com.es
  redirectwebupdatedsecure.com-serverinternal.thewebmailsign.com
  redirectwwer.servequake.com
  redirmail-apsupp-003549874833478523.billing-update379323.xyz
-redironlineoneclick.com
  redirpcpoints.com
  redisecincs.com
  reditecte3.crm7.com.br
@@ -255610,7 +236506,6 @@ refinancia.info
  refinanz.org
  refinisherstrading.com
  refiundsqaue.com
-reflectdigital.cloud
  reflectionomar.men
  reflectionsat90plus.com
  reflectionzinbradeskno.000webhostapp.com
@@ -255647,6 +236542,7 @@ refund-claim-form.com
  refund-form-submit.com
  refund-form-vehicle.com
  refund-form216.com
+refund-gov-uk.co
  refund-hmrev-secure-application.com
  refund-myvehicletax-claim.com
  refund-referral.org
@@ -255658,7 +236554,6 @@ refund-ukgov.com
  refund-uktax.com
  refund-user-ref016.com
  refund-vehicle-form.com
-refund-warnings.online
  refund.government-hmrc.com
  refund.hmrc-tax-services.com
  refund.hmrc-taxgovernment.com
@@ -255667,12 +236562,12 @@ refund22.com
  refundapp-invoice89.servecounterstrike.com
  refundedsquare.com
  refundhmrc.org
+refundinterac-secured.xyz
  refundinterac.xyz
  refundlnterac.com
  refundmytax-uk.com
  refundpaiment.com
  refundpaymentnow52.com
-refundpaymentsuk.com
  refundprocess-hm-secure-gov.com
  refunds-rca.me
  refundsgov-help.com
@@ -255765,6 +236660,7 @@ registernewmemberjoins.ga
  registersegvro1bn.club
  registo01produt0ffcerto.com
  registomont24.mobi
+registra-interbankprestamo.tk
  registrate-reactivaperu2020.com
  registrate0h-pe.com
  registratie-beheren.top
@@ -255857,6 +236753,7 @@ rehmantrader.com
  rehobothevangelisticchurch.com
  rehobothwells.co.zw
  rehrlbau.de
+rei-treioc-vetrazre.appspot.com
  reicap.cl
  reichelbrooks.buzz
  reicim.org
@@ -255949,7 +236846,6 @@ rekvtanm-eoivf.cc
  rekvtanm-kpafp.cc
  rekvtanm-mkavz.cc
  rekvtanm-qbnvr.cc
-rekvtenn-ikuhjk.cc
  reladenestates.com
  relais-secure.fr
  relais237.com
@@ -255963,8 +236859,10 @@ relatorthefieldslernerfbmarketplace.us
  relax.relax.moncheri-relax.ru
  relax1.dyndns.dk
  relaxbikes.com
+relaxed-carson-0f4afe.netlify.app
  relaxed-franklin-fffcab.netlify.app
  relaxed-goldstine-ece9e8.netlify.app
+relaxed-lumiere-c67a98.netlify.app
  relaxed-notice.000webhostapp.com
  relaxed-pike-29ccd7.netlify.app
  relaxed-pike-9dcd69.netlify.app
@@ -256012,7 +236910,6 @@ reliefnygov-resource.net
  reliefofcosatu.fun
  reliefpaymenttransfer.com
  relievedimpressiveparallelcompiler--five-nine.repl.co
-relieverisk.cloud
  religioncluboutlet.de
  religiously.info
  religonclothes.com
@@ -256098,6 +236995,7 @@ remdrifta.gearhostpreview.com
  remedialbodywork.com.au
  remediesforstuff.com
  remediosemedicamentos.com.br
+remedydsd.casa
  remedyhawseholer.com
  remedysherpa.com
  remeliee99jettie.com
@@ -256143,6 +237041,7 @@ remont-dorogi.ru
  remont-obuvi96.ru
  remont-warszawa.pl
  remontdiy.ru
+remontoknadveri.su
  remontrvd.com
  remontstiralnikhmashin.ru
  remontvastrakhani.ru
@@ -256226,6 +237125,7 @@ removed-fbcom-16628519.freshhellas.gr
  removed-fbcom-22538728.freshhellas.gr
  removedevice-h-plc.com
  removegetit.com
+removehalifax-payee.com
  removehspayees.com
  removemobile-personal.com
  removemyhalifax-payee.com
@@ -256351,6 +237251,7 @@ renny77.xyz
  reno-kitchen.com
  renodrives.com.br
  renoplexe.com
+renoueikuyfaswoq-dot-motast.nw.r.appspot.com
  renouvellement-enligne.com
  renova-int.ru
  renovacaiixabr.000webhostapp.com
@@ -256473,12 +237374,12 @@ repairpartsmiami.com
  repairrefinedintenselyprogram.icu
  repairxlcom.shaxiaadd.top
  repairxlcom.shaxiaarts.top
-reparacionmueblesantiguosoviedo.es
  reparaties-ipad.nl
  reparationboitevitesseambares.com
  reparaturedvcom.shaxiaasian.top
  reparoaireroca.org
  repay-claim.com
+repayable-investmen.000webhostapp.com
  repaymentsuk.com
  repbccjexqbgfcdp-dot-millinium.ey.r.appspot.com
  repcamedical.com
@@ -256492,6 +237393,7 @@ replicahublot.cn
  replicanteherege.com
  replicarolexwatch.cn
  replicawatchesrolex.cn
+replikagift.me
  replinater.biz
  replorient.fr
  replug.link
@@ -256583,6 +237485,7 @@ reqoestrecovary.000webhostapp.com
  reqstorecovarypaqe.000webhostapp.com
  reqtms-xwzvxkyotd.nuxorpr.com
  requation.com
+requerimentodigital.world
  request-beneficiary.com
  request-confirmation-profile.support
  request-payee.net
@@ -256669,7 +237572,6 @@ reset-device.online
  reset-intagram.000webhostapp.com
  reset-paypal.com
  reset-sicurezza-online.com
-reset-your-device.com
  resetargmail.com
  resetemailprocess.azureedge.net
  resetlink4linkedinupdate.com
@@ -256677,6 +237579,7 @@ resetlink9206001000.cc
  resetpasswordinstagram.com
  resetpolicy.com
  resetting-defend-accounts-support-amazon.com
+resetting-device.com
  resettowellness.com
  resgatandomeuspontos.allowed.org
  resgatandomeuspontos.jumpingcrab.com
@@ -256744,6 +237647,7 @@ resolutioncommunityservices.com.au
  resolutionelectric.com
  resolutionhomesales.com
  resolve-fraud-help.com
+resolve-issue-support.com
  resolve-issues-with-account.com
  resolve-limit-issues.com
  resolve-mydevice.com
@@ -256904,6 +237808,7 @@ restricted-pp.com
  restricted3account.com
  restrictedclump.com
  restrictionmy-3billing.com
+restrictions-eeupdates.com
  restrictions-mybill-o2.com
  restrictions-mybillingee.com
  restrictions-mybillingo2.com
@@ -257037,7 +237942,6 @@ retikinepcgi.buzz
  retionaw.xyz
  retirafclgocr.com
  retiratubonobcp.com
-retiredevelop.cloud
  retirement-funding.com
  retirementrecoverysystem.com
  retirementscholarship.com
@@ -257146,7 +238050,9 @@ revenuecra-auth02.gleeze.com
  revenueemployementinterac.com
  revenueqc-interac.ca
  reverenddiameters2284.000webhostapp.com
+reverent-carson-2482a7.netlify.app
  reverent-goldwasser-b61599.netlify.app
+reverent-kilby-59ca26.netlify.app
  reverent-mclean-37a573.netlify.app
  reverify-access.com
  reverify-devices.cc
@@ -257170,6 +238076,7 @@ review-fb-policy.com
  review-fbactivity.com
  review-files.app.link
  review-form.net
+review-log-security.com
  review-login-2983.info
  review-login-3842.info
  review-login-5343.info
@@ -257297,7 +238204,6 @@ revolutionpropertiesllc.com
  revolutuk.info11.co.uk
  revolving-biz-line.com
  revolvingly.xyz
-revolvingsimplisticlaws--five-nine.repl.co
  revopilte3.club
  revovercortytems.000webhostapp.com
  revrzz.com
@@ -257646,7 +238552,6 @@ richardfarrellillustration.com
  richardkendall.co.uk
  richards.org.nz
  richards45643234.xyz
-richardsilk.com
  richardstubblawfirm.com
  richardyaco.com
  richborngoldenharvest.com
@@ -258211,7 +239116,6 @@ rmv-84731173.detalhesmusical.com.br
  rmv-85274614.detalhesmusical.com.br
  rmv-85384300.detalhesmusical.com.br
  rmv-87080337.detalhesmusical.com.br
-rmv-871838391.adventistgh.org
  rmv-887957336.adventistgh.org
  rmv-89534989.detalhesmusical.com.br
  rmv-899999877.adventistgh.org
@@ -258275,13 +239179,13 @@ rnt99.com
  rntlr.goruli.com
  rnuffrnhdwgyqdvanz.top
  rnuganbank.com
-rnuingplace.casa
  rnumfscsdsbhncpb-dot-millinium.ey.r.appspot.com
  rnviftfpqcgznrhk-dot-millinium.ey.r.appspot.com
  rnvrxw68.firebaseapp.com
  rnwkent.com
  rnxujshralkvowhdcdadrevxgb-dot-gleowayel400503.uc.r.appspot.com
  rnyethereswallet.com
+rnylfqcutofrmcen-dot-motast.nw.r.appspot.com
  roachguitars.com
  road2somewhere.com
  roada.goruli.com
@@ -258378,7 +239282,6 @@ roboticsurgerybangalore.com
  roboticwaterjets.com
  robotikhatun.com
  robotrade.com.vn
-robotwork.co
  robshepbooks.com
  robtozier.com
  robustclarity.com
@@ -258629,6 +239532,8 @@ romansyed.zarss.com
  romantampcraez.com
  romanthreads.com
  romantic-einstein-2fdaad.netlify.app
+romantic-gates-93886f.netlify.app
+romantic-golick-777dd1.netlify.app
  romantic-kowalevski-182a14.netlify.app
  romantic-pare-8c1dbe.netlify.app
  romantic-tesla-085262.netlify.app
@@ -259159,6 +240064,7 @@ rrfg.sw81k.cn
  rrfveziliekizqrvotzoaxsmjb-dot-gleowayel400503.uc.r.appspot.com
  rrgndkcwjguslvaj-dot-millinium.ey.r.appspot.com
  rrgodshsf.ug
+rrgpweofeqmpgnbl-dot-mandax.oa.r.appspot.com
  rrhawezkqsxjntoxysfmdhclhb-dot-gleowayel400503.uc.r.appspot.com
  rricthtfjjajgmbo-dot-millinium.ey.r.appspot.com
  rrif.ga
@@ -259598,7 +240504,6 @@ runescape-secured.com
  runescape-securedbonds.com
  runescape.bond-claim.com
  runescape.claimingbond.com
-runescape.com-ak.ru
  runescape.com-ars.xyz
  runescape.com-az.ru
  runescape.com-crs.xyz
@@ -259668,6 +240573,7 @@ runningriverswinecellar.com
  runningskin.xyz
  runningwellstore.com
  runpayrolladmin.com
+runscape.com-m.ru
  runsomes.weebly.com
  runtah.com
  runtefields.xyz
@@ -259825,8 +240731,6 @@ rvt-netflix.com
  rvtjbtawwsapgivreahlwxcunb-dot-gleowayel400503.uc.r.appspot.com
  rvtp.ilramodellestreghe.it
  rvtpnhecdxo.top
-rvvkutan-7is9ri.cc
-rvvkutan-fxxlnz.cc
  rvw-fb-29513838.ezstreet.lt
  rvw-fb-36731886.ezstreet.lt
  rvw-fb-48277654.ezstreet.lt
@@ -260101,6 +241005,8 @@ s0pg.onderhost.com
  s0s9p0pspuser.df.r.appspot.com
  s0yyweans02ytdkltawai0wmaoaeach1ohyc5wo.icu
  s1-netflix.com
+s1-tee4names.com
+s10-tee4names.com
  s10002.000webhostapp.com
  s1255.000webhostapp.com
  s12c-ctiasec1.com
@@ -260129,7 +241035,6 @@ s146.goserver.host
  s1591e46.xyz
  s15freeuc.com
  s16claimhere.com
-s16eventpubg.com
  s16spinsmetroroyales.com
  s17g70bu.web.app
  s18a-nao-fica-de-fora-aproveite.com
@@ -260222,6 +241127,7 @@ s45-flix-netflix2.com
  s4ep.jaysbrand.com
  s4nd777-com.preview-domain.com
  s4nnur-modalsepuluhribu.blogspot.com
+s5-tee4names.com
  s5-update9.com
  s50fr.lawapass.com
  s536335847.mialojamiento.es
@@ -260229,6 +241135,7 @@ s5682.com
  s5bp.svcoding.com
  s5eq.svcoding.com
  s5ey.mentriqq.com
+s6-tee4names.com
  s62mxcn.club
  s64254.hostnl02.fornex.host
  s645429586.onlinehome.us
@@ -260242,12 +241149,14 @@ s6iwsmpxzc.firebaseapp.com
  s6oo5atdgmtceep8on.com
  s6pj.mentriqq.com
  s6sz.ailacabs.com
+s7-tee4names.com
  s756-solution.com
  s76a.gazengel.com
  s77657453-onedrive.com
  s777s.ru
  s78su-update-my-netflix1.com
  s7qjh.svcoding.com
+s8-tee4names.com
  s8-update22.com
  s810695574.onlinehome.fr
  s835938836.online.de
@@ -260261,6 +241170,7 @@ s8pt3.mentriqq.com
  s8u913f0fed42f3c6a45b3.net
  s8vhs21.com
  s8wqph7m.firebaseapp.com
+s9-tee4names.com
  s92673tu.beget.tech
  s97n3.svcoding.com
  s9agency.com
@@ -260371,6 +241281,7 @@ sac24hrs.com
  sacacademy.in
  sacatendimentoonline.com
  sacatualizar.com
+sacboletimpublicado.bid
  sacev.net
  sachcodoc.net
  sachhay.vn
@@ -260382,7 +241293,6 @@ sachtrithuc.com
  saci.in
  sacitau.000webhostapp.com
  sacj.ru
-sacked-servos.000webhostapp.com
  sackofschiff.com
  sacmkd.tk
  sacola-aamericanas.myvnc.com
@@ -260406,6 +241316,7 @@ sactros123.000webhostapp.com
  sacwc.org
  sad-carson-c4a6fb.netlify.app
  sad-davinci-57030f.netlify.app
+sad-mirzakhani-c6ca8e.netlify.app
  sad-noether-cbf25c.netlify.app
  sad-noether-cbf25c.netlify.com
  sad-torvalds-cbad56.netlify.app
@@ -260555,7 +241466,6 @@ safetyapplecareservices.com
  safetyb14lling.servebeer.com
  safetyconsultantehs.com
  safetyharborhomestore.com
-safetyproper.cloud
  safetyrun.xyz
  safetytechspy.com
  safeyouform.com
@@ -260986,6 +241896,7 @@ same-same.co.uk
  samedaycoronavirustesting.com
  samedayloans.club
  sameera.gq
+samefirsthandexpertise.adasdfff.repl.co
  samegrelorm.ge
  samel.store
  samelczakcom.shaxiaauthority.top
@@ -261111,6 +242022,7 @@ sandiegofoodreviews.com
  sandiegohomes4u.com
  sandipshirsat.com
  sandmremodeling.net
+sandokhan-swiss.blogspot.com
  sandorachange.com
  sandorachans.ga
  sandorato.com
@@ -261208,7 +242120,6 @@ santa-seoranking.xyz
  santa0secur.cloudaccess.host
  santaanahuesca.ru
  santaander-appmvil.ovh
-santabookcaretorchristmas.us
  santacard.casa
  santaftpuser.unifiedmarketingsolutions.com
  santaideaoficial.com
@@ -261646,6 +242557,7 @@ sbcbell-att.weebly.com
  sbcccccccc.weebly.com
  sbccccllccc.weebly.com
  sbccp.org.br
+sbcglbameritech.weebly.com
  sbcglobal-account-upgrade.weebly.com
  sbcglobal-login.us
  sbcglobal-mail.yolasite.com
@@ -261961,7 +242873,6 @@ sclak.pl
  sclservice.it
  scm-hk.com
  scmasabacus.com
-scmbcc.md
  scmd.ro
  scmeaqxejbcchduqibaymkxfvwkbrioehzhg-dot-cryptic-now-290917.ey.r.appspot.com
  scmnxjzcyngarnxbvzmhlztlbwlaniocofba-dot-glenxpecial3009493.ey.r.appspot.com
@@ -262114,7 +243025,6 @@ scrimauran.twilightparadox.com
  scrimpubg.com
  scrippsnetworks-com-dot-gl494903049.wl.r.appspot.com
  script-analytics.com
-script.rentpayez.com
  scriptb.com
  scripting-boot245.ml
  scripting-net654.ml
@@ -262148,7 +243058,6 @@ sctec.xyz
  sctehonm.xyz
  sctiabanx.net
  sctiabanx.org
-sctiabanxwebk.tech
  sctiawebmexico.servepics.com
  sctionisvtion.com
  scty.cc
@@ -262219,7 +243128,6 @@ sdeck.org
  sdeck.ru
  sdeck.ru-paymente.ru
  sdeck.ru.com
-sdefensesheldhajar.us
  sdeg.cw5166d.cn
  sdegdf.xyz
  sdek.fun
@@ -262236,7 +243144,6 @@ sdf.lbfbqsx.cn
  sdf.phtskh.cn
  sdf35435345.site
  sdf43zsz.appspot.com
-sdf456.buzz
  sdf78rgworks.com
  sdfbgc.com
  sdfcn.de
@@ -262488,6 +243395,7 @@ sebastianehinger.de
  sebayu.com.my
  sebfdf.com
  sebherforth.com
+sebinsaji.github.io
  sebitarsek.cloudaccess.host
  seblbcnt.rogagot.com
  sebocultural.com.br
@@ -262518,6 +243426,7 @@ sec24h.com
  sec3-d4-ssl.com
  sec42.edu.mx
  sec77verif72auth.ddns.net
+secaccount.ddns.net
  secaire.net
  secam.ddns.net
  secb801.com
@@ -262562,7 +243471,6 @@ secteur_oveur.godaddysites.com
  section-auth.signed-in.myaccounts.squireeapip.com
  sectionalization.xyz
  sectionget.com
-sectoresprimerosservicios.com
  sectorrojectsvisi.cf
  secturity-tn.com
  secu-fr.serveftp.com
@@ -262608,7 +243516,6 @@ secur5i-paypal-intl.manage-submit.com
  secura-ex.000webhostapp.com
  securacnt-com.preview-domain.com
  securaex.000webhostapp.com
-securbancardml.webcindario.com
  securcbankofameriea.cloudaccess.host
  securd.xyz
  securdoctral.ga
@@ -262984,7 +243891,6 @@ secure-mailonlineaccount.duckdns.org
  secure-manage-customers-facebook.item0324238473234.com
  secure-manage-facebook-id-list.item738292233.com
  secure-manage.thejunglebookss.com
-secure-management.co.uk
  secure-managepageaccountconsultations.yamamotofujiwarashisth.com
  secure-marketplace-item.id4892011844.com
  secure-marv2.com
@@ -263050,10 +243956,12 @@ secure-online-halifax.com
  secure-online-halifaxmobileapp-systemupgradeapp.otticagrande.com
  secure-online-info.duckdns.org
  secure-online-payee-login.com
+secure-online-payees.com
  secure-onlinebanking-review-dashboards.ddnsfree.com
  secure-onlinehali.com
  secure-onlinehalifax.co.uk
  secure-onlinenatwest.com
+secure-onlinenewpayee.com
  secure-onlinesend.com
  secure-onlineservice.com
  secure-paiement236b9e3e.exhemplara.it
@@ -263071,7 +243979,6 @@ secure-payee-login-account.com
  secure-payee-login.com
  secure-payee-online-uk.com
  secure-payee-onlineaccount.com
-secure-payee-procedure.com
  secure-payee-security.com
  secure-payee-uk.com
  secure-payee-verify.live
@@ -263548,7 +244455,6 @@ secure.runescaepe.com
  secure.runescap.com-xrs.xyz
  secure.runescape.as-runs.com
  secure.runescape.com-abm.xyz
-secure.runescape.com-ad.ru
  secure.runescape.com-applet.ws
  secure.runescape.com-as.cc
  secure.runescape.com-au.ru
@@ -264119,7 +245025,6 @@ secure6-vrfychase.serveirc.com
  secure61.com
  secure6663.com
  secure7-chase.servverify.com
-secure7-morgan.xyz
  secure7-redirect.com
  secure7.account.authinverify.com
  secure7.controle.ldmsa.dashboard.applmac.lcloud.idmmacapp.com
@@ -264353,7 +245258,6 @@ securedatingonline.com
  securedattnetservermailupgrade.godaddysites.com
  securedattnetyahoomailserverup.com
  securedbdo.webstarterz.com
-securedchase.com
  securedchaseidserver.duckdns.org
  securedchaseupdate.xyz
  securedclient.info
@@ -264391,7 +245295,6 @@ securedhut3.freedynamicdns.net
  securedinfoid.com
  securedirect-paypal.serveirc.com
  securedlinks.services
-securedlloyd-user.com
  securedlloyds-alerts.com
  securedmanageaccnt-updt.maribertamasya.com
  securedmobile-logintoverify.webredirect.org
@@ -264423,6 +245326,7 @@ securef-chasebank-login.xyz
  securef.club
  securefacebook.club
  securefb24.000webhostapp.com
+securefbserv.art
  securefdks.com
  securefilesdatas35763.tk
  securefileshared.com
@@ -264430,6 +245334,7 @@ securefilestorage.net
  securefixes.com
  securegate04a-chase.theworkpc.com
  securegate05b-banking.dns05.com
+securegovuk-cvdgrants.com
  securehalifax-login.com
  securehalifax-portal.com
  securehalifax.com
@@ -264653,6 +245558,7 @@ securepayees-unregistered-devices.com
  securepayees.online
  securepayeeveri.com
  securepayment.click
+securepayment.icu
  securepaymentapp.myftp.org
  securepaymentpp.myftp.org
  securepayments-app.serveirc.com
@@ -264875,6 +245781,7 @@ security-device-deregistration.co.uk
  security-device-deregistration.com
  security-device.differcookie.net
  security-en-issuepayment.com
+security-error-devices.info
  security-failed-alert-402.azurewebsites.net
  security-fb2020.ydns.eu
  security-fineco.com
@@ -265556,26 +246463,7 @@ semprepresenteexpirando.club
  semprepresenteitaucard.online
  semprepresentemilhaspontos.club
  semprepresenteprestesaexpirar.club
-semsabca.co.0oiswbek.cc
-semsabca.co.1hsxdrqm.cc
-semsabca.co.3sikcntm.cc
-semsabca.co.8x55pcaw.cc
-semsabca.co.9okn2qvz.cc
-semsabca.co.azhsgkgo.cc
-semsabca.co.cfony3tz.cc
-semsabca.co.ckl2ojyd.cc
-semsabca.co.f1rc3ymy.cc
-semsabca.co.ko8h0mom.cc
-semsabca.co.krfj7cq4.cc
-semsabca.co.lanv3vii.cc
-semsabca.co.llnlqb2g.cc
-semsabca.co.mmu0sy9j.cc
-semsabca.co.oyhpeuld.cc
  semsabca.co.tw3ipn4m.cc
-semsabca.co.txiuoj5n.cc
-semsabca.co.urpnkeva.cc
-semsabca.co.yrabfb76.cc
-semsabca.co.zeo1xzon.cc
  semvice11.000webhostapp.com
  sen-jin.co.jp
  senadorarosedefreitas.com.br
@@ -265612,7 +246500,6 @@ sendmonneyaccptwebhose.000webhostapp.com
  sendoutcards.jamesmontgomerylaw.com
  sendtlgrf-com.preview-domain.com
  sendunsolicitedemails.com
-sendunsubscribe.com
  sendusshop.com
  sendv51128.buzz
  senergysafrica.com
@@ -265643,6 +246530,7 @@ senjataadandmffgratis.000webhostapp.com
  senka.com.tr
  senklube.com
  sennesgroup.com
+senpayonlyfirstlinux.com
  sensajans.me
  sensationestates.com
  senseapartments.com.au
@@ -265683,7 +246571,6 @@ seobizlink.com
  seobmxc.com
  seoday.de
  seoelectrician.com
-seoemail.com.au
  seogood.net
  seokuber.com
  seoljapan.com
@@ -265693,6 +246580,7 @@ seomnasghoongomnrton.com
  seonic.top
  seonostra.com
  seopoint.com
+seopresidentsummit2021.info
  seorating.by
  seoselfserve.com
  seosemajansi.com
@@ -265756,6 +246644,7 @@ seregaperm.beget.tech
  serena435464.xyz
  serenadeofsouls.com
  serene-jepsen-2fa287.netlify.app
+serene-visvesvaraya-4ad0c0.netlify.app
  serenesonny.com
  sereneviewmanor.com
  serengeticare.co.tz
@@ -265867,6 +246756,7 @@ server-idapple.com
  server-mailapp.servehalflife.com
  server-mdd7update.onrender.com
  server-payuser1.com
+server-pointdoc.s3.us-east-2.amazonaws.com
  server-ppteam.com
  server-premiumappid.servebeer.com
  server-quota000000010101.000webhostapp.com
@@ -266095,7 +246985,6 @@ service-asxnzwr.icu
  service-asxrnzw.icu
  service-asxwnrz.icu
  service-auth-memberupdate.relojesvillarreal.com
-service-authusr.online
  service-be-pay.is-slick.com
  service-billingsecurityamazon.com
  service-boosterr.com
@@ -267542,7 +248431,6 @@ sharonpeszka.com
  sharontour.id
  sharosebeautysalon.com
  sharp-almeida-aed7cc.netlify.app
-sharp-aryabhata-4de649.netlify.app
  sharp-bartik-bf03ef.netlify.app
  sharp-bartik-bf03ef.netlify.com
  sharp-clarke-e3e343.netlify.app
@@ -267658,6 +248546,7 @@ shelljs.com
  shellmanbluffga.com
  sheltercapsicum-old.com
  shelteredsparrow.org
+shelterexplode.com
  shelves.co.tz
  shema.co.il
  shemadecarpentry.net
@@ -267666,6 +248555,7 @@ shembefoundation.com
  shemzh.ddns.net
  shengeliya-art.com
  shengji.9-4.xyz
+shenglee-cranes.com
  shengqiangaoshou.com
  shengtupay.com
  shengxi.co
@@ -268041,6 +248931,7 @@ shoppinglife.it
  shoppings2.sslblindado.com
  shoppingtr.club
  shoppingvilla.xyz
+shoppstores.com
  shopquanaosile.000webhostapp.com
  shops-covid-19.rf.gd
  shopsabz.com
@@ -268372,7 +249263,6 @@ sicurezza-info-aggiorna.000webhostapp.com
  sicurezza-informatica-bpm.info
  sicurezza-intesa-app.com
  sicurezza-intesa-web.000webhostapp.com
-sicurezza-intesasanpaolo.club
  sicurezza-intesasanpaolo.info
  sicurezza-intesasanpaolo.life
  sicurezza-intesaweb-psd2.000webhostapp.com
@@ -268399,6 +249289,7 @@ sicurezzainfodati.000webhostapp.com
  sicurezzaintesasanpaolo.xyz
  sicurezzaintsa.com
  sicurezzampsotp.com
+sicurezzaprivati.info
  sicurezzapsd2.net
  sicurezzatelematica.com
  sicurezzatelematica.it
@@ -269200,6 +250091,7 @@ silkycow.pw
  silkywaynutraceuticals.com
  sillasderuedas.pe
  sillassantalucia.com
+silly-aryabhata-0db44e.netlify.app
  silly-brattain-5bc93b.netlify.app
  silly-fermi-cbfaf9.netlify.app
  silly-goldstine-f89503.netlify.app
@@ -269624,6 +250516,7 @@ site.securepages-help.my.id
  site.smprna77home01.xyz
  site.sysnetconseil.com
  site1.com.br
+site172s.blogspot.com
  site2appleidrecoverycentre.duckdns.org
  site9423623.92.webydo.com
  site9423773.92.webydo.com
@@ -269723,6 +250616,7 @@ sixthsensetravel.com
  siyaghasourccing.com
  siyahistanbul.com
  siyahkalemresim.com
+siyapo.cam
  siyays.com
  siyazenzelait.co.za
  siyinjichangjia.com
@@ -269866,7 +250760,6 @@ skinchel.fun
  skinchina.fun
  skinclaimmlbb.zyns.com
  skincrates.qpoe.com
-skincrawling.top
  skincs-spin.top
  skincsgo-device.xyz
  skinderby.fun
@@ -270378,7 +251271,6 @@ smarteconomy.rs
  smarteksystems.ca
  smarterautofinancing.net
  smartfarmsky.com
-smartfarmthailand.com
  smartfieldproperties.co.ke
  smartfitnessequipment.com.au
  smartflora.co.ke
@@ -270526,7 +251418,6 @@ smbc-card.0474a.cn
  smbc-card.06sz2.cn
  smbc-card.a8njq.cn
  smbc-card.aenbo.com
-smbc-card.amznx.buzz
  smbc-card.andersoncollege.com.cn
  smbc-card.aneszcc.cn
  smbc-card.b8qux.cn
@@ -270638,7 +251529,6 @@ smbc-card.priscillaonbroadway.com
  smbc-card.restaurant-lediabledesplaisirs.com
  smbc-card.sayjsm.cn
  smbc-card.scrcsj.com
-smbc-card.sdxfyzc.com
  smbc-card.secrtt.com
  smbc-card.shop
  smbc-card.sifugo.com
@@ -270692,7 +251582,6 @@ smbc-cardsa.buzz
  smbc-cardsa.xyz
  smbc-cardw.monster
  smbc-cardw.xyz
-smbc-cass.com
  smbc-cc.best
  smbc-ccrd.com.ckmairu.top
  smbc-cecd.com
@@ -270811,7 +251700,6 @@ smbccard-com.pw
  smbccard-com.vip
  smbccard-customerverify.xyz
  smbccard-info-com.top
-smbccard-infoc.pw
  smbccard-jp.monster
  smbccard-summitobank.xyz
  smbccard.buzz
@@ -270944,7 +251832,6 @@ smcc-card.uxcwo.com
  smcc-card.wcxsac.com
  smcc-card.wouasc.com
  smcc-card.xcooe.com
-smcc.ouewsc.com
  smccard.com
  smccycles.com
  smcibcrad-vefivy.xyz
@@ -270991,7 +251878,6 @@ smetlisteistorije.com
  smf.abmx.cn
  smfvnjw.ml
  smg-com-dot-gl494903049.wl.r.appspot.com
-smgtegbdm.xyz
  smh5682.com
  smhydro.com.pl
  smibccrad-verifiy.xyz
@@ -271169,6 +252055,7 @@ smtasia.co.th
  smtgo.ga
  smtp-softbank.com
  smtp.callsouth.net.nz
+smtp.comune.royal-eng.ps
  smtp.securewebemail.co
  smtp.securityupdatenotice.com
  smtp.sslport.work
@@ -271303,7 +252190,6 @@ snippetcards.com
  snipscell-ss.com
  snjcemhnkpwreluggzukczmshghnbuzssodk-dot-solar-vertex-285913.rj.r.appspot.com
  snjtradelink.com
-snkedfr.cam
  snlibrary.in
  snlobpcogolaydsqcxclgumqggxqtsgbthum-dot-cedar-code-289917.nn.r.appspot.com
  snlong.net
@@ -271351,6 +252237,7 @@ snoopy64.000webhostapp.com
  snoorkersnow.top
  snoozical.com
  snopsd.duckdns.org
+snoretrick.casa
  snortcnc.duckdns.org
  snovvflake.com
  snowagainfearfreezesagainagainitfeelslikeiceisinmyhands.space
@@ -271785,7 +252672,6 @@ solicitysolar.co.zw
  solidallianzemfb.com
  solidarietaumana.it
  solideck.com.br
-solidepflegeteam.com
  solidklin.com
  solidpex.pl
  solidplanningltd.com
@@ -271832,6 +252718,7 @@ solqsbblgrsganamkxetjxjadpydpgvjdzvr-dot-glegen303939423233.ue.r.appspot.com
  soltecnic.com
  solticit.com
  soltraghotels.com.ng
+solucaoonlinebr.date
  solucion-financas.tk
  solucionadorproblematicaweb-site.preview-domain.com
  solucionesdigitalesperuserv1.xyz
@@ -272235,8 +253122,6 @@ southyang-jp.top
  soutiennetflix0511.info
  soutsholesails.com
  souvenirsplace.com
-souvetfre-edi.firebaseapp.com
-souvetfre-edi.web.app
  sov-gcridcen.tk
  sov.lv
  sova.gg
@@ -272543,7 +253428,6 @@ spells4you24-7.co.za
  spenceleymarketing.com
  spencersssjjs.com
  spencerwdam.xyz
-spendseed.cloud
  spenmilumluthef.tk
  spenorintl.com
  spent.com.pl
@@ -272563,7 +253447,6 @@ spggtyamzzfzucyyzv.top
  spgk.awaykart.com
  spgroupeducation.com
  spherebusiness.net
-spheresquare.cloud
  spherewinner.ga
  spherical-door-277805.uc.r.appspot.com
  spheroidal-screwdri.000webhostapp.com
@@ -272660,6 +253543,7 @@ spinpubgseason13.com
  spinpubgyeah.giize.com
  spinpubgyuhu.giize.com
  spinreward.eventsluck.com
+spinroyal.jrx-eventz1.cf
  spins.giize.com
  spins.pubgcompany.com
  spins.pubgmobilereward.com
@@ -272691,7 +253575,6 @@ spiraller.com
  spireacademyhk.org
  spireid.com
  spiritassembly.000webhostapp.com
-spiritedelementaryalgorithms.lizcambage.repl.co
  spiritedfrigidvertex.angueluisreyama.repl.co
  spiritnsong.fr
  spiritofmambo.fr
@@ -272699,7 +253582,6 @@ spiritstand.com
  spiritualfoodshq.com
  spiritualramadan.icu
  spirituated.info
-spiritvein.cloud
  spiritwarriormama.com
  spirtnoe.org.ua
  spitefulpristinerectangle--five-nine.repl.co
@@ -272828,6 +253710,7 @@ spotifyregalo.000webhostapp.com
  spotifysubscription.fail
  spotifyverify.serveirc.com
  spotlfy-sign-in.d9ygh3iuhs.semuaakanshendyjancokpadawaktunya.com
+spotlfy.myftp.biz
  spotlightappearances.com
  spotmarka.ap0x.com
  spotmartordinv.000webhostapp.com
@@ -272851,6 +253734,7 @@ sprachwerk.at
  spravkabas.com
  sprawdzto.cf
  sprawdzto.ga
+sprawly-broom.000webhostapp.com
  sprayi.com
  spraysand.info
  sprayspill.co
@@ -272865,6 +253749,7 @@ spredtechnologies.com
  sprendouman.blogspot.com
  sprenkom.xyz
  spreonky.com
+spreoprako.info
  sprezeni-cjf.cz
  sprezzatura.fashion
  sprig.life
@@ -273031,6 +253916,7 @@ squarefoot.devzone.life
  squaregdsvenms.com
  squarehnscer.com
  squarehp6.com
+squaremailfor.com
  squaremanagementdisp.com
  squaremanagementdisp.live
  squaremnb.com
@@ -273254,7 +254140,6 @@ sruedlqzbdeglfvgmebwhsgfqz-dot-gleowayel400503.uc.r.appspot.com
  srushtiinstitutemncl.com
  srv-amazonservic9k.servebeer.com
  srv-applelckdservpa.serveirc.com
-srv-auth.web.app
  srv-cluster02.com.br
  srv-externaluserlogin-amazon.gleeze.com
  srv.wfsdragon.ru
@@ -273628,6 +254513,7 @@ stadtmisr.com
  staedtereiseromnet.batwoqiseller.top
  staedtereiseromnet.shaxiacenter.top
  staemcommimuntiy.ru
+staemcommunuty.com
  staemconmunilty.com
  staff-comunicazione.com
  staff-onlineruba.com
@@ -273939,7 +254825,6 @@ status.delivup.com
  status.mrddy.com
  status982.info
  statuscheck.xyz
-statusid.net
  statuty.cam
  statwindows.com
  staunchmachineryug.000webhostapp.com
@@ -274113,6 +254998,7 @@ steamcommunmity.online
  steamcommunnhity.ml
  steamcommunniiity.ru
  steamcommunnitty.tk
+steamcommunnity.co
  steamcommunnity.pp.ru
  steamcommunnityi.pp.ua
  steamcommunteil.ml
@@ -274648,7 +255534,8 @@ stoic-beaver-bff9db.netlify.app
  stoic-borg-bcc007.netlify.app
  stoic-galileo-1310e7.netlify.app
  stoic-golick-21cf37.netlify.app
-stoic-kepler-d80bba.netlify.app
+stoic-goodall-cd60cc.netlify.app
+stoic-haibt-f5b44f.netlify.app
  stoic-lamport-01777c.netlify.app
  stoic-leavitt-087474.netlify.app
  stoic-meitner-023f7c.netlify.app
@@ -275286,6 +256173,7 @@ subtractkilos.com
  subtriangular-maneu.000webhostapp.com
  subul.com.sa
  suburbanapprehensivefactor.figueroaads123.repl.co
+suburbancaringlibrary.adasdfff.repl.co
  suburbanindustries.net
  suburbanswag.info
  suburmart.com
@@ -275992,7 +256880,6 @@ superlatinradio.com
  superlifenig.com
  superliquidacaoagosto.com
  superlite.com.vn
-superload24.info
  superma.co
  supermainers.online
  supermanne.com
@@ -276510,6 +257397,7 @@ supportfacbook.instarkspa.com
  supportfbmexico.000webhostapp.com
  supportforcopyrighteam.com
  supportforhaptic.com
+supportform-ee.com
  supportforminstagram.com
  supportfr.ath.cx
  supportfrominstagram.com
@@ -276579,6 +257467,7 @@ supportprotect.pw
  supports-boi.com
  supports-confrimesu22.cf
  supports-confrimesu4.ml
+supports-copyrights.tk
  supports-gooogle.crystalonegroup.com.ng
  supports-helps01.000webhostapp.com
  supports-online.ddns.net
@@ -276605,6 +257494,7 @@ supportshelps.000webhostapp.com
  supportssystemsviolations12.ml
  supportsumba.nl
  supportt.magix.net
+supporttcopyright.com
  supportteam-bpiactionreupdate.duckdns.org
  supportteamlink.com
  supporttech281012.tk
@@ -276721,6 +257611,7 @@ surona.ca
  suroyalost.id
  surplusapples.com
  surplusfdr.cam
+surpriseplanner.com.bd
  surpule.com
  surrealism-beginner.000webhostapp.com
  surrel-data-login.cf
@@ -276840,7 +257731,6 @@ suspgercvrysrvce01.my.id
  suspicious-activity-paypal.vrfd-arz-sppt4.com
  suspicious-austin-cd8033.netlify.app
  suspicious-euclid-2b302b.netlify.app
-suspicious-euler-466569.netlify.app
  suspicious-login-attempt.com
  suspicious-online-payment.com
  suspiciousactivity.xyz
@@ -277135,12 +258025,10 @@ swipefools.com
  swipenearn.com
  swipenippy.com
  swipes.com
-swis-pos.questioncenter.monster
  swishbd.com
  swishier-purge.000webhostapp.com
  swisi-bosta.blogspot.com
  swiss-banque.com
-swiss-bosta-ch.blogspot.com
  swiss-bostaton.blogspot.com
  swiss-capitalinvest.com
  swiss-federal-railways.eu
@@ -277268,6 +258156,7 @@ sydvision.se
  sydw.cc
  syedfiberglass.com
  syelvdf.melidina.com
+syevscsvsgsvsv.us
  syewasje.com
  syf5jayhwyeg-8sfvylp1c.vercel.app
  sygges.kazkgi.cn
@@ -277296,6 +258185,7 @@ symanreni.mysecondarydns.com
  symbiogonerics.com
  symboats.xyz
  symbolistic-religio.000webhostapp.com
+symbolzero.monster
  symmerientry.xyz
  symmetrical-composi.000webhostapp.com
  symmetrymarketingsystems.com
@@ -277895,6 +258785,7 @@ takeoneproff.000webhostapp.com
  takeovermyblog.com
  takeovervnote.getting-playdem.xyz
  takeprofits.in
+takes-skin.tk
  takeshykurosavabest.com
  takeskins13.com
  taketheredone.top
@@ -278309,6 +259200,7 @@ tax-refund-entitled.com.nihatayshahed.ru
  tax-refund-hmrc-gov.com
  tax-refundform.com
  tax-refunds.fund
+tax-refundteamhelp.com
  tax-repayment.com
  tax-residence.net
  tax-return-form14.com
@@ -278612,6 +259504,7 @@ tdvcxwaqwfcoigfnkgbecreqxw.club
  tdvpprint.com
  tdwcocooiedpbiyudknttzjqhbvdjpbdfgru-dot-cedar-code-289917.nn.r.appspot.com
  tdxl.rogagot.com
+tdzugzydejbhdehi-dot-motast.nw.r.appspot.com
  tdzy.lawapass.com
  te-group.org
  teach-in-xiamen.alex-parr.com
@@ -278939,7 +259832,13 @@ tedqhswvyqkbdzvwxtclczxgmhqsboqrxlmv-dot-solar-vertex-285913.rj.r.appspot.com
  tedvankoleji.com
  tedwoodworking.org
  tedzey.info
+tee4-s1-names.com
+tee4-s10-names.com
+tee4-s11-names.com
+tee4-s12-names.com
  tee4-s14-names.com
+tee4-s2-names.com
+tee4-s3-names.com
  teeapitary.com
  teee-shop.com
  teeeggplantr.com
@@ -279199,6 +260098,7 @@ temproperties0133fde485f3a-realtygrouppage0134223-pfb204767.net
  temproperties3fde485f3a-realtygrouppage34223-pfb204767.net
  tempsite.review
  temptest123.reveance.nl
+temptingenchantedenvironment.josealbertoal21.repl.co
  temptmag.com
  temscsquare.com
  temsolinv.com
@@ -279282,6 +260182,7 @@ tepcian.utcc.ac.th
  tepcoti.com
  tepey.net
  tephillyeverafter.info
+tepid-gloves.000webhostapp.com
  tepingost.ug
  teploservis.info
  tepremoe.mypi.co
@@ -279699,6 +260600,7 @@ texet2.ug
  texhokot.online
  texicall.com
  texniko.gr
+texomacc-authnengine.ga
  texomaguardiangroup-doc-auth.cf
  texomaguardiangroup-web-inv.ml
  texpostavka.ru
@@ -279712,7 +260614,6 @@ textilesunrise.com
  textless-attacker.000webhostapp.com
  textomar.net
  textopol.free.fr
-textospeechkjshdui.us
  textrefwinfo.ru
  texture-manufacture.com
  textyle-vn.com
@@ -279726,6 +260627,7 @@ tez-tour.site
  tezhq.3utilities.com
  tezle.com
  tezony.com
+tezpgudnpuyohgkk-dot-motast.nw.r.appspot.com
  tezukaza66.000webhostapp.com
  tezzafashion.com
  tf-yahoomail-com.weebly.com
@@ -280089,6 +260991,7 @@ theclintonreport.com
  theclovergrp.com
  theclub5.com
  theclubms.com
+theclustermail.com
  thecoachwebsite.com
  thecoastaltimes.media
  thecolortheory.com
@@ -280486,7 +261389,6 @@ theonlinechase.com
  theonlygoodman.com
  theoqri.com
  theorized533az.pw
-theoryanalyst.cloud
  theorymusiconline.com
  theotherangle.ca
  theoutlet66mall.com
@@ -280649,6 +261551,7 @@ thesilverant.com
  thesimpleproject.org
  thesite.app
  theskilife.com
+theskippingtimecompany.co.za
  theskul.com
  theslidebolt.com
  thesmackleague.com
@@ -280822,7 +261725,6 @@ thirdwaychurch.com
  thirdworldcentre.org
  thirstiestgalapagostortoise.htmlpasta.com
  thirstinghopkins.com
-thirsty-haibt-c47260.netlify.app
  thirsty-one.netlify.app
  thirsty-one.netlify.com
  thirumarantech.com
@@ -281286,7 +262188,6 @@ ti.jandigitalstudios.com
  ti5n.andnolikeandtoo.ru
  tiabufomduy.ml
  tiagolincoln.com.br
-tiaiutosulweb.com
  tial-zo.com
  tialtcfmobxfjyrebtlykyvwmelorhzlublq-dot-cryptic-now-290917.ey.r.appspot.com
  tianangdep.com
@@ -281502,9 +262403,7 @@ timeline-info.000webhostapp.com
  timeline-jejhpgmyi.mstransport.ae
  timeline-jlfywgzhv.mstransport.ae
  timeline-klisgjefr.mstransport.ae
-timeline-lnutkymyo.mstransport.ae
  timeline-mlmpxypoj.mstransport.ae
-timeline-msnmppoxv.mstransport.ae
  timeline-nkkuptuwu.mstransport.ae
  timeline-ovqwpyxtq.mstransport.ae
  timeline-pxppmrlpo.mstransport.ae
@@ -281516,6 +262415,7 @@ timeline-rukhtktfk.mstransport.ae
  timeline-ryxvtxznq.mstransport.ae
  timeline-sxsrktzls.mstransport.ae
  timeline-tjtvollvq.mstransport.ae
+timeline-uointktsx.mstransport.ae
  timeline-uvtsigfps.mstransport.ae
  timeline-vnyukovzk.mstransport.ae
  timeline-vqzrtkqtp.mstransport.ae
@@ -281523,6 +262423,7 @@ timeline-vyqyysutq.mstransport.ae
  timeline-wkozyixtj.mstransport.ae
  timeline-wqnvpqtkt.mstransport.ae
  timeline-yiospfyye.mstransport.ae
+timeline-zmsmnxnun.mstransport.ae
  timelineinfotech.com
  timelinelimitless.000webhostapp.com
  timelinemaintenance.ae
@@ -281589,6 +262490,7 @@ timothycreighton.com
  timothyguyer.webcindario.com
  timothylcd.com
  timothyyuenic.com
+timoucha.com
  timp.com.br
  timpex.pl
  timplex.my
@@ -281965,6 +262867,7 @@ toasted.sa
  toastedelsosobl7a.com
  toba.com.au
  tobasafe.info
+tobetaniselma.ru
  tobias-erles.de
  tobiassammet.com
  tobis-segevent.de
@@ -282012,7 +262915,6 @@ todayvalues.com
  todcm.ddns.net
  todd.nobel-link.com
  toddfrank.com
-toddler-town.com
  toddlerpops.com
  toddmkirsch.com
  toddperez.com
@@ -282091,7 +262993,6 @@ tokomuda.com
  tokoobatmakassar.com
  tokoonlineterpecaya12.000webhostapp.com
  tokootomotifonline.xyz
-tokopediaph.dns04.com
  tokoperalatankantor.xyz
  tokorankoscr.000webhostapp.com
  tokosuplemenonline.xyz
@@ -282768,6 +263669,7 @@ tracker.co.tz
  tracker.torrentme.co.cc
  trackerspro.com
  tracking-cdek.ru
+tracking-globalservices.mikkellkhan.com
  tracking-parcel.free-h.net
  tracking-ups.scsce.com.au
  tracking.dinos.vn
@@ -283426,7 +264328,6 @@ tritoneaudio.com
  triumphglobalsolutions.icu
  triumphio.it
  triumphoption.com
-trivialfrog.cloud
  trivialomar.com
  trixi777.org
  trjmxoyxnffnfwmjrtrocczghs-dot-triple-upgrade-293822.rj.r.appspot.com
@@ -283477,7 +264378,6 @@ troubleshootservice.com
  troubletobyr.com
  trouptable.com
  trouserlanditd.com
-trouserthink.cloud
  troutanimations.com
  troutystech.com
  trouvetonhandisport.be
@@ -283605,9 +264505,7 @@ trustee-offshore.com
  trustfundoptions.net
  trustgiveaway.ml
  trustgroupreico.com
-trusting-clarke-f8bd7d.netlify.app
  trusting-lamport-4cdd7f.netlify.app
-trusting-mirzakhani-ba8394.netlify.app
  trusting-turing-3feefb.netlify.app
  trustingfalse.com
  trustingscratchytitles--five-nine.repl.co
@@ -283694,12 +264592,14 @@ tsad.goruli.com
  tsatest-812.tk
  tsatwg2bdst4.000webhostapp.com
  tsavo.ke
+tsb-banking-alerts.live
  tsb-online.auth5s.com
  tsb-online.payee-add-online.com
  tsb-security-issue.com
  tsb.new-loginattempt.com
  tsb.page
  tsb.uk-secure-deregisterdevice.com
+tsbalerts.com
  tsbfraud.com
  tsbmanagepayee.com
  tsbqgpsuez.duckdns.org
@@ -284047,7 +264947,6 @@ turkoman-affair.000webhostapp.com
  turksilahlikuvvetleridestek.com
  turkstore.net
  turkuazkirtasiye.com
-turkvideo.xyz
  turnaments12.ocry.com
  turnaround-projectcontrols.net
  turnaround-services.net
@@ -284411,7 +265310,6 @@ tyc1j.awaykart.com
  tycfsb.com
  tych.pe
  tycheware.com
-tycoonconcede.cloud
  tycoweb.com
  tycp133.com
  tyczquarere.tk
@@ -284894,6 +265792,7 @@ udeworld.com
  udhaiyamdhall.com
  udhirszzleqdprmiiirkathfyv-dot-gleowayel400503.uc.r.appspot.com
  udigitalhindi.in
+udigtdtmuhitqhys-dot-motast.nw.r.appspot.com
  udjbukhbvuaycrgzzjhkdcuatnsvhyjgrmeb-dot-solar-vertex-285913.rj.r.appspot.com
  udkhwhkbhkphmmxztq.top
  udliketosale.com
@@ -285067,7 +265966,6 @@ uiodghshop.com
  uipack.com
  uiqxqhapbkfftiwqjveidnyvqccmgakltbyp-dot-gl494903049.wl.r.appspot.com
  uirnssewi.com
-uirtyrt.work
  uisam.tw
  uisau.com
  uisfiuae.com
@@ -285503,6 +266401,7 @@ unauthorise-onlinepayment.com
  unauthorise-paymentonline.com
  unauthorised-attemptedpayment.com
  unauthorised-cancelpayment.com
+unauthorised-payee.support
  unauthorised-payment.com
  unauthorised-paymentcancel.com
  unauthorised-transaction.net
@@ -285629,7 +266528,6 @@ unexpected-login-ldappleacc.mogabisainimas.com
  unexpectedneighbors.com
  unexplainable-journ.000webhostapp.com
  unfairla.com
-unfamiliar-payee.com
  unferification.servebeer.com
  unfledged-appraisal.000webhostapp.com
  unfoldedscannere.com
@@ -285697,7 +266595,6 @@ uniconfrime33.cf
  unicorn-gifts.net
  unicorn-hacks.net
  unicorn-hairextensions.com
-unicorn-insulations.com.cn
  unicorndigital.vn
  unicorngloves.com
  unicornpretty.com
@@ -286040,7 +266937,6 @@ unripeillfatedapplicationserver--five-nine.repl.co
  unroofed-cuts.000webhostapp.com
  unrrwa.org
  unruffled-bardeen-460a6d.netlify.app
-unruffled-swanson-089636.netlify.app
  unsac.000webhostapp.com
  unsafe-paypal.com
  unsatable-plugs.000webhostapp.com
@@ -286101,7 +266997,6 @@ unshadowable-hangar.000webhostapp.com
  unshadowable-reside.000webhostapp.com
  unshrinking-custodi.000webhostapp.com
  unsion.tv
-unsitiuoasyrekj11.us
  unsolemn-silk.000webhostapp.com
  unsonsy-bandage.000webhostapp.com
  unsonsy-lubricant.000webhostapp.com
@@ -286121,7 +267016,6 @@ unsustained-membran.000webhostapp.com
  unsworn-patterns.000webhostapp.com
  unsydmngmthub.canberrahomedevagaency.com
  unsympathizing-insp.000webhostapp.com
-unsystematical-tabl.000webhostapp.com
  unsystematized-rest.000webhostapp.com
  untag-1881844764.eyeyeoptics.com
  untag-3710910180.eyeyeoptics.com
@@ -286610,7 +267504,6 @@ updateonline.uc.r.appspot.com
  updateonlineaccesaccount.weebly.com
  updateonlne-ukgovservice.com
  updatepay.xyz
-updatepayeeinfo.com
  updatepaym.com
  updatepayment-kr.serveirc.com
  updatepayment.site
@@ -286847,7 +267740,6 @@ upsara.com
  upscionline.com
  upsers.live
  upshatioax.com
-upsprotection.com.my
  upsquareds.com
  upstairsniece.com
  upstarttaught.com
@@ -286866,7 +267758,6 @@ upukj.tanglescanner.com
  upvaskithali.com
  upvwdgykasreh.top
  upward-oscillation.000webhostapp.com
-upwebuniversal.com
  upwokis.com
  upworkdesign.com
  upzimbra.weebly.com
@@ -287079,7 +267970,6 @@ usa-infos.com
  usa-jiaji.com
  usa-production.us
  usa-realtors.best
-usa-selling.com
  usa-sun983893202.webcindario.com
  usaa-com-inet-ent-logon.appspot.com
  usaa-reviewcenter.com
@@ -287134,7 +268024,6 @@ usbtqivaymdgkjyriaivueagmutbodpdfqoz-dot-gl494903049.wl.r.appspot.com
  usceoadobedocument.azureedge.net
  uschispieltcom.shaxiaauthority.top
  uscomponent.com
-uscrissey.fr
  uscryptorelief.com
  uscurrentlyattmails.weebly.com
  usd-gold.com
@@ -287269,7 +268158,6 @@ user-portal-id05.com
  user-portal-review.com
  user-portal-unlock.com
  user-rakuten.1y2.top
-user-rakuten.j1h.top
  user-rakuten.y1a.top
  user-re-inste.0823-bar.uk.boardmedia.ro
  user-resolution-panel.com
@@ -287789,7 +268677,6 @@ uyhhggf.weebly.com
  uyhqtddgfzxhdyxprpydxuwqkinqgwefwsiw-dot-solar-vertex-285913.rj.r.appspot.com
  uyhtlobrvtvcowzazqcbbuqbipflhehrwiau-dot-cryptic-now-290917.ey.r.appspot.com
  uyikjtn.eu
-uyirttp.cam
  uyl9so2ddlulwtrg4.com
  uyrsghb.goruli.com
  uyrt.hushenzhen.cn
@@ -288095,7 +268982,6 @@ validationsystem.creatorlink.net
  validebcpzonasegurabetaviaweb.com
  validlogin.top
  validservices.co
-validveteran.cloud
  valkindead.ru
  vallalkozo.hu
  vallejointernational.com
@@ -288151,6 +269037,7 @@ vamruzaugxkkecblfaikaxunfxddezuckrnx-dot-solar-vertex-285913.rj.r.appspot.com
  van-wettennl.nl
  van.info.vn
  van.photo-web.cc
+vanat.monster
  vanbaolu.com
  vanbrunwarecap.com
  vanbrusselservices.nl
@@ -288902,7 +269789,6 @@ veriffication-security-amazon-service-alert.giize.com
  verifiadinstagram.com
  verifica-accessi-al-tuo-conto.com
  verifica-accesso.info
-verifica-aces-ora.com
  verifica-anomalia-pin.com
  verifica-b-c-p-mensajeseguro-solousuarios.mariateles.com.br
  verifica-b-c-p-peru.colo-ch.com
@@ -288914,7 +269800,6 @@ verifica-conto.com
  verifica-dati-app.com
  verifica-dati-cliente.com
  verifica-dati-conto.com
-verifica-dati-login.com
  verifica-dati-psd2.duckdns.org
  verifica-dati-titolare.com
  verifica-datibnl.com
@@ -288964,6 +269849,12 @@ verificartbcponline.lalipos.com
  verificartbcpsmovil.cola-ge.com
  verificartbcpsonline.cub-rocv.com
  verificarvialbcpenlinea.est-bcps.com
+verificasi-facebooks.ga
+verificasih-facebooks.ga
+verificasihhfacebooks.ga
+verificasihhfacebooks.gq
+verificasihhfacebooks.ml
+verificasihhfacebooks.tk
  verificasosislogino.com
  verificasteya.zz.com.ve
  verificasucuenta.moonfruit.ml
@@ -289264,20 +270155,6 @@ verifikasifb20.webnode.com
  verifikasihh-pemblockiraan.cf
  verifikasiid761.weebly.com
  verifikasiifacebook2020.weebly.com
-verifikasiih-facebooks.cf
-verifikasiih-facebooks.ga
-verifikasiih-facebooks.ml
-verifikasiih-facebooks.tk
-verifikasiihh-facebooks.cf
-verifikasiihh-facebooks.ga
-verifikasiihh-facebooks.gq
-verifikasiihh-facebooks.ml
-verifikasiihh-facebooks.tk
-verifikasiihh-pemblockiiraann.cf
-verifikasiihh-pemblockiiraann.ga
-verifikasiihh-pemblockiiraann.gq
-verifikasiihh-pemblockiiraann.tk
-verifikasiihpemblockiiraann.ga
  verifikasikeamananfacebook.mrface.com
  verifikasiloginfacebookurl.cf
  verifikasiloginfacebookurl.ga
@@ -289413,6 +270290,7 @@ verify-myacc02a.serveftp.com
  verify-myaccount083.serveirc.com
  verify-myee-account.com
  verify-myeeaccount.com
+verify-mymobiledevice.com
  verify-mynewdevices.com
  verify-mypayment.com
  verify-mypp.com
@@ -289425,6 +270303,7 @@ verify-new-device.com
  verify-new-payee.com
  verify-newdevice.cc
  verify-newdevice.com
+verify-newdevice.link
  verify-newdevices.com
  verify-notice-wells.network
  verify-notice.network
@@ -289511,6 +270390,7 @@ verify.chase.billing.info.earningwhilehome.com
  verify.chase.billing.info.ektaxconsultants.com
  verify.chase.billing.info.igualdad.cl
  verify.ddns.net
+verify.device-uk-support.com
  verify.eemylogin.com
  verify.fb.unilorite.com
  verify.hmrctax-regain.com
@@ -289624,6 +270504,10 @@ verifyblueticksupports.ml
  verifyc.online
  verifycard.info
  verifycaredept.weebly.com
+verifycasi-facebooks.cf
+verifycasi-facebooks.ga
+verifycasi-facebooks.gq
+verifycasi-facebooks.ml
  verifycation-fb.ga
  verifycation-fb.ml
  verifycation-fb.tk
@@ -289666,7 +270550,6 @@ verifyinginstagram.com
  verifyingmainyahoo.weebly.com
  verifyingpaypalanti.gotdns.ch
  verifyinstagram-help.com
-verifyinstagram.com
  verifyinstagrm.com
  verifyitsyouapp.servehttp.com
  verifykey.services.amazon.co-jpsecurity.sdpbwj.com
@@ -289929,6 +270812,7 @@ vestibulecovers.club
  vestibulecovers.com
  vestibulecovert.com
  vestjyskbnk-dk-159.000webhostapp.com
+vestwoding.icu
  vet-equin.fr
  vet-growth.com
  vetapharma.fr
@@ -289940,6 +270824,7 @@ veteransrussian.ru
  veterinaryassistantschools.net
  vetiiccanmtwbhpidgnkbrtglqcajflralkh-dot-cedar-code-289917.nn.r.appspot.com
  vetmir58.ru
+vetridgoaskjdh.us
  vettentilari.xyz
  vetter-pharmainc.com
  veu.dojnh.com
@@ -290178,6 +271063,7 @@ vibnary.org
  vibqsmmbtledyuvmyidtzsflic-dot-gleowayel400503.uc.r.appspot.com
  vibrant-bardeen-767dad.netlify.app
  vibrant-haibt-463390.netlify.app
+vibrant-leavitt-524009.netlify.app
  vibrant-mayer-e4f9a8.netlify.app
  vibrant-rosalind-190e31.netlify.app
  vibrant-swartz-101699.netlify.app
@@ -290413,7 +271299,6 @@ vidiohotsampebasah.000webhostapp.com
  vidiojandasange.000webhostapp.com
  vidiokuuuu.000webhostapp.com
  vidiopornsgrup99.wikaba.com
-vidioteenterbaruhot.000webhostapp.com
  vidioterbaru.gleeze.com
  vidioterbaruviraldurasi19menit.hotgrup-wa22.ml
  vidiotmantapmantap.casacam.net
@@ -290518,7 +271403,6 @@ viewmyonline.co.uk
  viewmypayee.co.uk
  viewmypayees-online.com
  viewmyphotos.plantarinapoli.com
-viewmyrebate.com
  viewnepal.com
  viewonline-payees.com
  viewpayee.co.uk
@@ -290808,6 +271692,7 @@ viral-terbaru2020.ml
  viral-terbaru55.giize.com
  viral-terbaru782.giize.com
  viral.whatsapp-199352.ml
+viral18grup.fvfree.tk
  viralbali.000webhostapp.com
  viralbanget.ambil.org
  viralbokep-miripnagita.zyns.com
@@ -290846,6 +271731,7 @@ virgilio.it-ses.giize.com
  virgilio.it-ver.giize.com
  virgin-alerte.com
  virgin-billing-update.com
+virgin-billingerror.com
  virgin-billsupport.com
  virgin-dell.com
  virgin-directdebit.co.uk
@@ -290961,7 +271847,6 @@ virtueless-multipli.000webhostapp.com
  virtuosoagency.com
  virtuoushairline.org
  virtusurcubbcsupurtt.atwebpages.com
-virus-govclaim-accept.com
  viruscorona103.work
  viruscorona103.xyz
  virusdns.duckdns.org
@@ -291062,6 +271947,7 @@ visten23.ru
  vistratfonline.com
  vistrokijomegadyn.ml
  visu-all.ch
+visualbare.cyou
  visualblends.com
  visualeyestuscaloosa.com
  visualfirewall.com
@@ -291248,6 +272134,7 @@ vk-gerlsbaby.ru
  vk-golos2020.000webhostapp.com
  vk-golosa.kodeks.lviv.ua
  vk-golosovanie.ru
+vk-groop-baby.ru
  vk-group-2382.ru
  vk-group-28838.ru
  vk-group-3873.ru
@@ -291968,6 +272855,7 @@ vpsojhaul.com
  vpss-supportlogin.xyz
  vpsssupportit.xyz
  vpsupport.xyz
+vptbvwhbbnfcdlhf-dot-motast.nw.r.appspot.com
  vpu21.com.ua
  vputin.pk
  vpyjgqaeoghucsouctadhdlaomqaqyzwmymi-dot-glenxpecial3009493.ey.r.appspot.com
@@ -292592,6 +273480,7 @@ wagnerbandeira.com.br
  wagnergroupnet.nckiregister.gdn
  wagnersystemen.nl
  wagoatilby.com
+wagonheat.monster
  wagputrid.com
  wagroup-bokepindonew.tk
  wagroup-invited111.2waky.com
@@ -292852,6 +273741,7 @@ wardruz.ml
  ware.ru
  wareago.com
  warehouse-orders.com
+warehousehub.co
  waresustem.info
  waresustems.com
  waresystem.com
@@ -293109,6 +273999,7 @@ wbkac.goruli.com
  wbkmt.com
  wblrhte.shoesmogul.com
  wblwryyurfcianjjk.top
+wbmail.veunrifiuiededgehilko.club
  wbml-udt.weebly.com
  wbniodyjltjdynjscexiavvqwr-dot-gleowayel400503.uc.r.appspot.com
  wbr.ly
@@ -293503,6 +274394,7 @@ web99841050km-com.preview-domain.com
  webabout.gr
  webaccess.co.id
  webaddssdssd.000webhostapp.com
+webadministrators-actives-upgrad.glitch.me
  webadminz.000webhostapp.com
  webagosducato.info
  webaholics.ca
@@ -293651,6 +274543,8 @@ webdisk.blog.security-operations-center.de
  webdisk.bonitafurniture.icu
  webdisk.capofthemonth.icu
  webdisk.coronavirus-maps.com
+webdisk.dabwoodscarts.org
+webdisk.defigios.com
  webdisk.democraticvalues.icu
  webdisk.device-ref2082.com
  webdisk.doggonelonely.xyz
@@ -293662,7 +274556,7 @@ webdisk.fightingforfit.icu
  webdisk.freehealthstudy.icu
  webdisk.hali-payee-alert.com
  webdisk.harmonypads.top
-webdisk.hyperionanalytics.xyz
+webdisk.henryfloressantatecla.com
  webdisk.ios-suporte.live
  webdisk.jomolufarms.com
  webdisk.jp-woeifhwe89hf9.com
@@ -293681,6 +274575,7 @@ webdisk.pornsexz.com
  webdisk.ppklsywbwtqyiuasdiwhqa.com
  webdisk.premiercoininvest.com
  webdisk.propertysalesusa.icu
+webdisk.quaternity.finance
  webdisk.relativeaccesspayments.com
  webdisk.repairmyapple.servebeer.com
  webdisk.runtzdispensary.org
@@ -293688,8 +274583,10 @@ webdisk.silkflowerexperts.icu
  webdisk.simplesubtraction.xyz
  webdisk.sms.security-operations-center.de
  webdisk.soporte-appleid.com
+webdisk.stashdasher.com
  webdisk.support-panel.com
  webdisk.sweetdreamsfairy.icu
+webdisk.thepsychedelics.net
  webdisk.threemobile-secure.com
  webdisk.user-id9140.com
  webdisk.user-portal-secure.com
@@ -293760,7 +274657,6 @@ weblogin.infow-netflix.com
  weblogin.samazones.popkgaa.com
  webloginnavigator-dewebkonto.cloud
  weblogverification.com
-webloss-0ff-1c3.web.app
  weblube.com.my
  weblums.weebly.com
  webmadrasa.com
@@ -293831,7 +274727,8 @@ webmail.clinique-vaugneray.fr
  webmail.cometak2.com
  webmail.coronavirus-info.yj.fr
  webmail.cybersecure.co.za
-webmail.d-tv.tv
+webmail.dabwoodscarts.org
+webmail.defigios.com
  webmail.democraticvalues.icu
  webmail.device-ref2082.com
  webmail.documento-apple.com
@@ -293844,12 +274741,10 @@ webmail.fightingforfit.icu
  webmail.freehealthstudy.icu
  webmail.gift14.kozow.com
  webmail.gjared.com
-webmail.hali-payee-alert.com
  webmail.harmonypads.top
  webmail.hmrc-gov-uk.com
  webmail.home-verify-netfllx-com.gleeze.com
  webmail.hydropneuengg.com
-webmail.hyperionanalytics.xyz
  webmail.icloud-fmi-server.com
  webmail.icloud-sign-on.com
  webmail.iforgot.apple.com.ios-id.co
@@ -293875,7 +274770,6 @@ webmail.mx2.avis.ne.jp.mxscservser.club
  webmail.my3billing-secure.com
  webmail.mymanchesterescorts.xyz
  webmail.mymenuforlife.xyz
-webmail.n3tflx-billing.info
  webmail.nctv.com
  webmail.negativebetafund.icu
  webmail.newsupdateonly.xyz
@@ -293895,10 +274789,12 @@ webmail.proremontapple.ru
  webmail.pusathadiah.hollx-3.com
  webmail.relativeaccesspayments.com
  webmail.restoremyaccounts-paypal.giize.com
+webmail.runtzdispensary.org
  webmail.sauthsec.com
  webmail.secure-my3online.com
  webmail.secureauthnet.com
  webmail.secureauths.com
+webmail.securecauths.com
  webmail.secureiauth.com
  webmail.securemailauth.com
  webmail.securenauths.com
@@ -294157,9 +275053,9 @@ wedding.0101im.com
  wedding.com3825792.com
  wedding.com9237578921.com
  wedding8282.com
-weddingbudget.cloud
  weddingday-tkak.com
  weddingfables.co.in
+weddinggive.monster
  weddingphotographyjakarta.com
  weddingsbyknottydays.com
  weddingsbymoltensky.com
@@ -294255,7 +275151,6 @@ weiterbildungsparkcom.licumexico.gdn
  weixin.lefu.co
  weixin.vishou.net
  wejdzmy-masowo.eu
-wejgj234jg234.com
  wejhwhz29.asfsanh.com
  wekcopsn.top
  welasyia.com
@@ -294849,7 +275744,6 @@ wfg3.blissgood.ru
  wfgk.awaykart.com
  wfiufsyxgitg.top
  wfjmbf.vip
-wfkahoumzdybkiyc-dot-owaonk399399393.uk.r.appspot.com
  wflecdmsnydxkrekjjaxrnhvmp-dot-gleowayel400503.uc.r.appspot.com
  wfljzg.cn
  wfmw.onderhost.com
@@ -295760,6 +276654,7 @@ whcpanelwhm.com
  whdazmeheidmzcimoicpndnmabofrakkdsdm-dot-cryptic-now-290917.ey.r.appspot.com
  whdmdhj.com
  whdmdhj.zjgtcwzhs.com
+wheat-flicker-oregano.glitch.me
  wheatpredator.net
  wheatsheaftitchfield.co.uk
  wheelbrandrice.com
@@ -296068,6 +276963,7 @@ wildcard.cchos.network
  wildcard.cleanshoes.com.do
  wildcard.cleansol.lk
  wildcard.consultemerald.org
+wildcard.ctiaspire.com
  wildcard.curetrick.com
  wildcard.daimonsartstuff.com
  wildcard.danskiptv.shop
@@ -296181,7 +277077,6 @@ wilkinson.digital
  wilkinsongro.xyz
  wilkinsonriver.buzz
  wilkintree.com
-wilksjjshh3321.com
  wilkumhome.com
  willchurchill.tv
  willdep.com
@@ -296719,6 +277614,7 @@ wlmpromaxcom.shaxiaact.top
  wlorenzsas.com.co
  wlotuspro.com
  wlskdjfsa.000webhostapp.com
+wlsw.xmdzt.cn
  wltlmseejpvlslbqlfet-dot-gleowyel040493443434989.wl.r.appspot.com
  wlutsjlzsedr-qxslc0i8v.vercel.app
  wluxsleggrswdrzotdnkicqifx-dot-gleowayel400503.uc.r.appspot.com
@@ -296887,7 +277783,6 @@ wonand.co.kr
  wonder-tonic.com
  wonderfish-recipe2.com
  wonderful-davinci-1adc0f.netlify.app
-wonderful-montalcini-b7eed7.netlify.app
  wonderful-payne-0df6cd.netlify.app
  wonderful-stonebraker-b92d74.netlify.app
  wonderful.gr
@@ -297003,6 +277898,7 @@ workcampsnet.nckibrazil.gdn
  workclose2home.com
  workd.ru
  workedhome.com
+worker.patz6ebasclhiapaspsacp.workers.dev
  workerjob.su
  workermaninfor.com
  workermaninfor.net
@@ -297130,7 +278026,6 @@ wormann.dk
  wornbfydtecxoyaso.bounceme.net
  worotest.weebly.com
  worpjjsgkycb-ispi9o2p7.vercel.app
-worrysigh.cloud
  worsehoney.com
  worshiper255kq.pw
  worshiphubug.com
@@ -297171,7 +278066,6 @@ wowter.com
  wowwglass.com
  wowyoulol.000webhostapp.com
  woyaofeiting.com
-wozaidiaoni-amezon-co-jpan-network.buzz
  wozapple.com
  wozata.000webhostapp.com
  wozbtc.com
@@ -297314,7 +278208,6 @@ wrevjhfs.ru
  wrfmanbetx.com
  wrgrtbhouuahgftsukyltcuzcvqoidlsewzd-dot-offglen.uk.r.appspot.com
  wrh36470.webcindario.com
-wrigglekit.cloud
  wrigglyspend.com
  wrightindustrial.co.nz
  wrightsboutique.co.uk
@@ -298629,7 +279522,6 @@ xemphimsex.duckdns.org
  xemvideohay24h.000webhostapp.com
  xenbhzkpqeusyltelzkbskjlwavoixcviwhv-dot-cedar-code-289917.nn.r.appspot.com
  xenia-daybydayflorist.com
-xeniaelkelucia.ru
  xenicoln.ru
  xenicolnc.mskhost.pro
  xenicolnc.space
@@ -298788,6 +279680,7 @@ xiaolechen.com
  xiaoliyu.shop
  xiaoqiyu.cn
  xiaowang.work
+xiawang-arnazon-co-jpan-ioliveo.buzz
  xiazhai.tuizhong.com
  xibfinancial.com
  xicang.yfqzdfd.com
@@ -298871,6 +279764,7 @@ xixingseng.cn
  xiyuplastics.com
  xizativagina.com
  xj0n.svcoding.com
+xjabricnvhunwxmu-dot-mandax.oa.r.appspot.com
  xjackzhao.com
  xjbgmmiforqckzoexiqqlyjksu-dot-gleowayel400503.uc.r.appspot.com
  xjfopklicpxfdtllnxsiztlsbwjmoawqmrzz-dot-gl494903049.wl.r.appspot.com
@@ -299082,6 +279976,7 @@ xn--80adegn0adoige0a.xn--p1ai
  xn--80adg3b.net
  xn--80aeii0ablmr.xn--p1ai
  xn--80ag0afdbjias.xn--p1ai
+xn--80ag5agcn2c6c.xn--p1ai
  xn--80ajahcbcdpeycafhi6j5d.xn--p1ai
  xn--80ajcz5a1dp.xn--p1ai
  xn--80akackgdchp7bcf0au.xn--p1ai
@@ -299092,16 +279987,13 @@ xn--90aaab0gvau.xn--p1ai
  xn--90achbqoo0ahef9czcb.xn--p1ai
  xn--90afdnal1aqq.xn--p1ai
  xn--90avpa.xn--p1ai
-xn--90axbo2bcnix.xn--p1ai
  xn--accweb-muv-desjardns-s9c36d.com
  xn--acsso-pagseguro-cnb.com
  xn--altnoran-vkb.com.tr
  xn--articulosparacumpleaos-3ec.cl
  xn--avyfedera-yubm.org
-xn--b1aaosbx0he.xn--p1ai
  xn--b1aecj2ct7bn.xn--p1ai
  xn--b1agpzh0e.xn--80adxhks
-xn--b1ak8abh4bfw.xn--p1ai
  xn--b1alaggrfb0ah6h.xn--p1ai
  xn--b1amvejg.com
  xn--b1asjc5a0d.xn--p1ai
@@ -299131,10 +280023,8 @@ xn--bstchange-v4a.net
  xn--bstchange-vf7d.com
  xn--btchang-t8ag78w.net
  xn--btchange-4db49d.net
-xn--c1a6bcgek.xn--p1ai
  xn--c1acb1alz3c.xn--p1ai
  xn--c1aenimagdf8h.xn--p1ai
-xn--c1ag5dma.xn--p1ai
  xn--c1aifr3cd7b.xn--p1ai
  xn--c1ajbsbed5a5a.xn--p1acf
  xn--c1an8bie.xn--p1ai
@@ -299145,7 +280035,6 @@ xn--claimtxrebate-8db.com
  xn--clinicatraa-beb.com
  xn--cloud-9nc.com
  xn--covid19-gncelsalgnvakalar-nwc35l.com
-xn--d1aegm1avs6a.xn--p1ai
  xn--d1ahebikdfcgr7jsa.xn--p1ai
  xn--d1ajejfcbjhse2c.xn--p1acf
  xn--d1albnc.xn--p1ai
@@ -299164,7 +280053,6 @@ xn--elctrum-u8a.com
  xn--entrmpelung-kerpen-p6b.de
  xn--evdekalan20gbkapyor-v5c.com
  xn--exods-nva.io
-xn--f1acxrfthmo.xn--p1ai
  xn--facebok-dati-shb.com
  xn--faktygwat-xub.com.pl
  xn--faktygwat-xub.eu
@@ -299189,6 +280077,8 @@ xn--h1adekuf0eb.xn--p1ai
  xn--hlfx-login-h4ac8m.com
  xn--hravfall-9za.com
  xn--hypoverensbank-7lb.de
+xn--i1ac5cad.xn--p1ai
+xn--i1arlyy.xn--p1ai
  xn--iconiqcaptal-0fb.com
  xn--id-zb4axila5esc1e1f9bvhzd4a6fe.sehvcnx.com
  xn--insagram-tj0d.com
@@ -299241,6 +280131,7 @@ xn--mnqs96c9fa.biz
  xn--mpb--vos-cots-sdb7l.fr
  xn--mx-mail-service-vdc.de
  xn--mzn-plab3i.xn--c-1ga.jp.naoecnsixoeznasb.buzz
+xn--n1aksblsc.xn--p1ai
  xn--nckd7a7hnc8b8bd.net
  xn--netflx-7va.com.fjsld.cf
  xn--netfx-2saa44d.com
@@ -299354,7 +280245,6 @@ xnflgelastminute0vbcom.baerseventake.top
  xnfv.biogenicherb.com
  xngerstbau85abiz.shaxiacalendar.top
  xnglasdcherz2anet.shaxiapurpose.top
-xngmgzbdnjtdmzoyljembsvxzd-dot-owaonk399399393.uk.r.appspot.com
  xngmxijyxakgcutqlinxqhwbzi-dot-gleowayel400503.uc.r.appspot.com
  xnhc.onderhost.com
  xnholzaluminiumhaustrenvpcorg.shuiacarry.top
@@ -299893,7 +280783,6 @@ xzdfvg2322.pp.ua
  xzdh.lawapass.com
  xzender-industries.com
  xzfeupetuluydceixgngjwtmmhdzmqktmzeu-dot-cedar-code-289917.nn.r.appspot.com
-xzfree.ga
  xzg5662esd.appspot.com
  xzgcdbyvjszgrddlyunumxhrlowfqojukcym-dot-offglen.uk.r.appspot.com
  xzi0.cn
@@ -301055,6 +281944,7 @@ youboyulecheng.tavmo.com
  youbtube59920.hopto.org
  youchange.lookamazon.monster
  youcode.gq
+youdubasi.top
  youesta-71.gq
  youflyjet.fr
  yougeniusads.com
@@ -301200,6 +282090,8 @@ youstamptitle.club
  youstore21.com
  yousubmis.restartrakuten.xyz
  youtbook.xyz
+youthful-perlman-719009.netlify.app
+youthful-spence-ca0d09.netlify.app
  youthguarantee.org.cy
  youthindiaassociation.com
  youthplant.org
@@ -301222,7 +282114,6 @@ youtubedow4k.xyz
  youtubeismyartschool.com
  youtuber-grup97.tk
  youtuber.wa-gruops.tk
-youtubers99.whatsappp-grup73.gq
  youtubersfreefire.whatsappsh.cf
  youtuberss-groupswa.forumz.info
  youtuberty.com
@@ -301418,7 +282309,6 @@ ytwhe.xyz
  yty.topkorder.su
  ytytdywlwy.ga
  ytytufe.gikorip.net
-ytzzcccpvzyozymv-dot-owaonk399399393.uk.r.appspot.com
  yu-gu.com
  yu56tdfcxc.appspot.com
  yu7xcvdsc.appspot.com
@@ -301985,8 +282875,8 @@ zap620529-1.plesk10.zap-webspace.com
  zap620634-1.plesk13.zap-webspace.com
  zap627206-1.plesk10.zap-webspace.com
  zap628386-1.plesk10.zap-webspace.com
-zap637546-1.plesk11.zap-webspace.com
  zap637726-1.plesk12.zap-webspace.com
+zap637755-1.plesk10.zap-webspace.com
  zapaska.org
  zapatillasasicsofertas.es
  zapatoseccosoft.es
@@ -302389,7 +283279,6 @@ zgavovfyapevuxopwvxhgozreq-dot-gleowayel400503.uc.r.appspot.com
  zgbbtsvtjpedgaegau.top
  zgc.com.cn
  zgdiyydgmmkcsuzlyfehzhajvjhsldwhyjpr-dot-solar-vertex-285913.rj.r.appspot.com
-zgetyourmunny.info
  zgeuurpkqztwuusjpt.top
  zghshmw.com
  zgipsucwlpdyhxiwrbwopkprrizlgmhwpozs-dot-cryptic-now-290917.ey.r.appspot.com
@@ -303172,6 +284061,7 @@ zoomic.io
  zoomjoin.us
  zoomoption.com
  zoomorg302.z13.web.core.windows.net
+zoomorg3783.z13.web.core.windows.net
  zoomorg6839.z13.web.core.windows.net
  zoomoutletnz.top
  zoomprocessreset.azureedge.net
@@ -303233,6 +284123,7 @@ zptr.awaykart.com
  zpunldzixlwhpenoskdmzfjkswnctqurxnsd-dot-cedar-code-289917.nn.r.appspot.com
  zpveaodcsmw.top
  zpvmsftdi8tufgj3awetransfer.000webhostapp.com
+zpwqqweer-q.tk
  zpwvwpietvdtonrqrkacdcsdzz-dot-gloff849483.uk.r.appspot.com
  zpx-y.oujevais.com
  zpxagcfxoulshwsojqvwmlkvzunnmlxikcuw-dot-cedar-code-289917.nn.r.appspot.com
diff --git a/blacklists/malware/urls b/blacklists/malware/urls

index 48c51dfcb7617ca7bafda3d6add5411fabb5f50c..20b02b46a75bcc9d689d66118ed1403c26933bc4 100644 (file)
--- a/blacklists/malware/urls
+++ b/blacklists/malware/urls
@@ -1,34 +1,140 @@
  0i.is/7Tr9
  0i.is/CpAq
  0i.is/IqWc
-107.172.3.104/bins/Ares.arm5
-107.172.3.104/bins/Ares.arm6
-107.172.3.104/bins/Ares.arm7
-107.172.3.104/bins/Ares.m68k
-107.175.254.57/notabotnet/notabotnet.arm
-107.175.254.57/notabotnet/notabotnet.arm7
  121.186.3.204/.i
  123formbuilder.com/form-5559915/microsoft-team
  123formbuilder.com/form-5580797
+13.78.215.193/banks/Tangerine
+13.78.215.193/banks/Tangerine/
+13.78.215.193/banks/Tangerine/pin.php
+13.78.215.193/banks/Tangerine/questions.html
+137.220.175.233/ap/signin
+149.3.170.53/ed-hig/csrs.exe
  149.3.170.55/sd-lod/servises.exe
+162.241.126.53/Pandoras_Box/pandora.arm
+162.241.126.53/Pandoras_Box/pandora.arm5
+162.241.126.53/Pandoras_Box/pandora.arm6
+162.241.126.53/Pandoras_Box/pandora.arm7
+162.241.126.53/Pandoras_Box/pandora.m68k
+162.241.126.53/Pandoras_Box/pandora.mips
+162.241.126.53/Pandoras_Box/pandora.mpsl
+162.241.126.53/Pandoras_Box/pandora.ppc
+162.241.126.53/Pandoras_Box/pandora.sh4
+162.241.126.53/Pandoras_Box/pandora.x86
+168.119.240.243/bins/phantom.arm
+168.119.240.243/bins/phantom.arm7
+18.220.20.171/verify/session
+18.220.20.171/verify/session/signin.php
+186.33.122.36/+-O+/tmp/netgear;sh+netgear&curpath=/&currentsetting.htm=1
  187.131.55.167/.i
+190.213.177.39/.i
+190.98.53.16/.i
+193.239.147.245/bot.arm4
+193.239.147.245/bot.arm5
+193.239.147.245/bot.arm6
+193.239.147.245/bot.arm7
+193.239.147.245/bot.mips
+193.239.147.245/bot.mipsel
+193.239.147.245/bot.powerpc
+193.239.147.245/bot.superh
+193.239.147.245/bot.x86
+199.192.24.31/upload/4343/client32.bin
+199.192.24.31/upload/4343/client64.bin
+199.192.24.31/upload/4343/run.bin
  1drv.ms/xs/s
-59.99.143.169/+-O+/tmp/netgear;sh+netgear&curpath=/&currentsetting.htm=1
+213.149.182.113/.i
+216.118.237.253/ap/signin
+3.0.56.85/hkcmd/bins.exe
+3.120.247.48/hkcmd/555.exe
+37.46.150.158/a-r.m-4.YUMEKO
+37.46.150.158/a-r.m-5.YUMEKO
+37.46.150.158/a-r.m-6.YUMEKO
+37.46.150.158/a-r.m-7.YUMEKO
+37.46.150.158/i-5.8-6.YUMEKO
+37.46.150.158/m-6.8-k.YUMEKO
+37.46.150.158/m-i.p-s.YUMEKO
+37.46.150.158/m-p.s-l.YUMEKO
+37.46.150.158/p-p.c-.YUMEKO
+37.46.150.158/x-3.2-.YUMEKO
+37.49.230.14/gafdse.mips
+37.49.230.14/gafsde.mpsl
+37.49.230.14/gafsde.sh4
+37.49.230.14/sdfza.m68k
+37.49.230.14/yafsda.arm4
+37.49.230.14/yaksddfs.i586
+37.49.230.14/yakuza.ppc
+37.49.230.14/yasddfa.ppc
+37.49.230.14/ysdfd.x32
+39.80.121.6/+-O+-
+48bistro.com.vn/ieowghwz/5555555555.jpg
+4destates.co.uk/onedrive/
+51.89.115.83/a-r.m-4.ISIS
+51.89.115.83/a-r.m-5.ISIS
+51.89.115.83/a-r.m-6.ISIS
+51.89.115.83/a-r.m-7.ISIS
+51.89.115.83/i-5.8-6.ISIS
+51.89.115.83/m-6.8-k.ISIS
+51.89.115.83/m-i.p-s.ISIS
+51.89.115.83/m-p.s-l.ISIS
+51.89.115.83/p-p.c-.ISIS
+51.89.115.83/s-h.4-.ISIS
+51.89.115.83/x-3.2-.ISIS
+73.194.254.8/.i
+79.44.108.193/.i
  81.229.59.60/+-O+/tmp/netgear;sh+netgear&curpath=/&currentsetting.htm=1
+85.105.103.101/+-O+/tmp/netgear;sh+netgear&curpath=/&currentsetting.htm=1
  90.152.144.139/.i
+aajeevikasevakendra.com/plot1/amex_0auth/amex_auth
+aajeevikasevakendra.com/plot1/amex_0auth/amex_auth/active_apa.php
+aajeevikasevakendra.com/plot1/amex_0auth/amex_auth/automated_email.php
+aajeevikasevakendra.com/plot1/amex_0auth/amex_auth/email_sec.php
+aajeevikasevakendra.com/plot1/amex_0auth/amex_auth/index.php
  abre.ai/as0p
  abre.ai/bLoA
  abre.ai/caixacx
  abre.ai/seguranca-app
+accordadvertising.com/gywjfatsgpjb/923753.jpg
+acessoseguro-ib12.com/039585939595948489/classic
+acessoseguro-ib12.com/039585939595948489/classic/index.php
+agexbodot.me/office365/officefiles
+aggiorna-app-ora.com/beaq1042lhmz
+aggiorna-normativa-info.net/info
+agricolespasevhost134141.lowhost.ru/Agricole/
+agricolespasevhost134141.lowhost.ru/Agricole/bfa15f5ffb4b256
+agricolespasevhost134141.lowhost.ru/Agricole/bfa15f5ffb4b256/region.php
+ajanstrakya.com/wc/public_html/webmail/webmail
+ajanstrakya.com/wc/public_html/webmail/webmail/index.php
  allowcopy.com/open
  allowcopy.com/open/
+amazon-jp-tokyo.shop/pc/
+amazon-try-jp.site/signim/
+amazon-try-jp.site/signin/
+americanas-anonovo.redirectme.net/compre/tv/samsung
+americanas-anonovo.redirectme.net/compre/tv/samsung/carrinho.php
  ams3.digitaloceanspaces.com/ams1
  ams3.digitaloceanspaces.com/ams1/click.html
  ams3.digitaloceanspaces.com/newvm
  ams3.digitaloceanspaces.com/newvm/index.html
+anantararesorts.in/w/Inv/
  angelfire.com/games/gamez3
  angelfire.com/games/gamez3/facebook.htm
-basicsofcivilengineer.com/i45zm1h31.rar
+angels.edu.np/irs
+artheducation.com/css/noun/pro
+artheducation.com/css/noun/pro/9akp9o41s92jr4k4h3hn68hg.php
+batterybazaaronline.com/library/js/jp/
+batterybazaaronline.com/library/js/jp/8837fd617f25135ec606a143c8306ec0
+batterybazaaronline.com/library/js/jp/8837fd617f25135ec606a143c8306ec0/home.php
+batterybazaaronline.com/library/js/jp/961caa86e980f59c4a9361a80ead206c
+batterybazaaronline.com/library/js/jp/961caa86e980f59c4a9361a80ead206c/home.php
+batterybazaaronline.com/library/js/jp/aa05a96b065cb1fe8aecb7786188633f
+bda.ch/phpmv2/image.jpg
+bda.ch/phpmv2/image.jpg/
+bda.ch/phpmv2/image.jpg/ff04723483b9201/
+believable16442130.blob.core.windows.net/zilpah184585361121
+believable16442130.blob.core.windows.net/zilpah184585361121/login.html
+bencoside.temp.swtest.ru/33bcf80f97c005c31a475943c151a3
+bespoka.uk/mik/mfile
+bespoka.uk/mik/mfile/index.php
  biolinky.co/legendarycontract
  biolinky.co/luckyxspin
  biolinky.co/tencentmetro
@@ -159,6 +265,7 @@ bit.ly/2VA6GbT
  bit.ly/2VOcQEF
  bit.ly/2W9hG06
  bit.ly/2WDEVQ3
+bit.ly/2WuIfNb
  bit.ly/2X3TAEg
  bit.ly/2X4NEtT
  bit.ly/2XHxmbO
@@ -307,6 +414,7 @@ bit.ly/rbc975i
  bit.ly/token1bndig
  bit.ly/updatement-require
  bitbucket.org/clipdiary/clipdiary/downloads/clipdiary.exe
+bitbucket.org/cryptexxx/files/downloads/file.txt
  bitbucket.org/fiarbot/fairbot/downloads/fairbot.exe
  bitbucket.org/jessypinkman/bsplayer/downloads/BSPlayer.exe
  bitbucket.org/listary/listary/downloads/Listary.exe
@@ -316,10 +424,44 @@ bitly.com/3kXAhXj
  bitly.com/3oFHKMQ
  bitly.com/3p4HWWh
  bitly.com/PAYPAL-LOGIN-IL
+bloch-design.fr/auth/DHL_HOME/
+bloomb2b.com/financials/IRS
+bloomb2b.com/financials/IRS/verification.html
+bloomb2b.com/financials/IRS/verification1.html
+bobbybullen.com/jss/Priv/Priv8
+breadsmillwright.com/wellsfargo/https.wellsfargo.com.home/wells-fargo-security-update
+breadsmillwright.com/wellsfargo/https.wellsfargo.com.home/wells-fargo-security-update/login.php
+brunoallisonnutri.com.br/Solares/Sarver
+bugs.somosvoodoo.com/vendor/adodb/update/pay
+bugs.somosvoodoo.com/vendor/adodb/update/pay/billing.php
+bugs.somosvoodoo.com/vendor/adodb/update/pay/login.htm
+bugs.somosvoodoo.com/vendor/adodb/update/pay/payment.php
  cakeurl.com/sw3zY
+canonmonuments.com/bibdftevnfkskjfkj/amFtZXNAbGVnYWxzaGllbGQuY29t
  capesandbox.com/file/sample/2582/8729e52104ec08ca7002b217c42c3ec12262badbb3f11faaab1829eba505c3cb
+cardgiftbulk.com/fr-amazon-ct/
+ccb.somosvoodoo.com/fonts/misajour/8da554a65d916852c58254535d4d5abf/4c70f2d721637aa591a50b813f337fa9/
+cesterpaymentsvxcse.cso.gov.tt/feeds/
+changaosports.com/cfg
+changaosports.com/cfg/index.php
+cogitosoftware.in/p1sopys.zip
  conjurosdeamoryhechiceriaacacio.com/tjbdhdvi1.zip
  cpbild.co/c6d466d
+cpcalendars.dabwoodscarts.org/Apple.Login
+cpcalendars.dabwoodscarts.org/Apple.Login/
+cpcontacts.dabwoodscarts.org/Apple.Login
+cpcontacts.dabwoodscarts.org/Apple.Login/
+creditagricole10.gotdns.ch/C-Agricole/1e03774900107a7
+creditagricole10.gotdns.ch/C-Agricole/1e03774900107a7/region.php
+creditagricole10.gotdns.ch/C-Agricole/540956d15d3760e
+creditagricole10.gotdns.ch/C-Agricole/540956d15d3760e/region.php
+creditagricole10.hopto.org/C-Agricole/a53242f53798538
+creditagricole10.hopto.org/C-Agricole/a53242f53798538/region.php
+creditrepairstore.com/nnn/bo
+creditrepairstore.com/nnn/bo/image.htm
+criminalwill.com/fonts/icomoon/dhl-dhl/dh-1/DHL/a2ff2201c658b59a7d566776ad5d424c
+criminalwill.com/fonts/icomoon/dhl-dhl/dh-1/DHL/a2ff2201c658b59a7d566776ad5d424c/login/cc.php
+cutt.ly/LhG12l7
  cutt.ly/QiCMqtb
  cutt.ly/SsyhHnk
  cutt.ly/SyhM3BP
@@ -335,7 +477,21 @@ cutt.us/9WNKq
  cutt.us/X41CC
  cutt.us/rHqRx
  cyw.pe.kr/images/baba/Alibaba.com/Alibaba.com/Alibaba.co.uk/35c2f42de3a745af1c74bd8fc03250ad
+daydry.fr/ar-en/track/be402d093f43dd767b1447997f56f4fb
+daydry.fr/ar-en/track/be402d093f43dd767b1447997f56f4fb/
+daydry.fr/ar-en/track/be402d093f43dd767b1447997f56f4fb/garcia.php
+daydry.fr/ar-en/track/be402d093f43dd767b1447997f56f4fb/zlatan.php
+decisionireland.com/DocuSign/Authfile_php/
+decoracionest.com/js/jquery/plugins/cluetip/wa3rin
+decoracionest.com/js/jquery/plugins/cluetip/wa3rin/m
+decoracionest.com/js/jquery/plugins/cluetip/wa3rin/m/index.php
  deepakjain.net/f64yhqfk5.zip
+devaresources.com/postsaudi
+devaresources.com/postsaudi/
+devaresources.com/postsaudi/garcia.php
+devaresources.com/postsaudi/zlatan.php
+dhuwad.com/js/lib/ionos
+dhuwad.com/js/lib/ionos/index.php
  dlvr.it/RXVbg3
  docs.google.com/forms/d/1cftY9nPkgtssMgHl5uc070iUbDW-vRpa7sBpQQYOSCk/viewform
  docs.google.com/forms/d/1ubfTadXuGDGvTvNscAY0_f78KUm17eHjm5vf2Ltz6Hs/viewform
@@ -381,13 +537,51 @@ docs.google.com/forms/d/e/1FAIpQLSfgVWY26SZ_Aumb4Tj52fkdiZr979r97zbXoy45CT7ojbzU
  docs.google.com/forms/d/e/1FAIpQLSflOWOdPVSHQxAOf0Yu5HMfUUbV1VQp2ddfltTkAYApDSsUyg/viewform
  docs.google.com/forms/d/e/1FAIpQLSflxxuI_0dV49fhRtRiIo5E1uN2RBMGgMLQI-6qGDZVNV-ZVQ/viewform
  docs.google.com/forms/d/e/1FAIpQLSfw3glHBuhrFSF4kTOw1sa_BSsYr9NBQF4RhDYAv_g6xXgPoA/viewform
+doughgowbiz.co/vcgfvrtyjunhgbfvrtbynumjnhg/
+drcarmenmora.com/doc/info/dam
+drcarmenmora.com/doc/info/dam/index.html
+drchristianweber.com/.SunTrustOnline-Zelle/Online/login/Data/6r2gfb6sfh6b14s6w546bh541tsw64b1hsw/1
+drchristianweber.com/.SunTrustOnline-Zelle/Online/login/Data/6r2gfb6sfh6b14s6w546bh541tsw64b1hsw/1/
+drchristianweber.com/.SunTrustOnline-Zelle/Online/login/Data/6r2gfb6sfh6b14s6w546bh541tsw64b1hsw/1/1.html
+drchristianweber.com/.SunTrustOnline-Zelle/Online/login/Data/6r2gfb6sfh6b14s6w546bh541tsw64b1hsw/1/details.html
  drive.google.com/uc
  dropbox.com/l/AABy5Irzd_ji2DuiO-i5z8ZZ70_ZRnRBTLQ
  dropbox.com/l/AADF6y5O_I_uxzPM7EarhSzPUoBxa9VQXQ0
+drpeneurope.com/gb/cart
  dwnlds.co/ab3f360
-electrocardsystems.com/plugins/vmcustom/specification/specification/tmpl
-electrocardsystems.com/plugins/vmcustom/specification/specification/tmpl/R674L7LjbwF.php
+ee-accountupdates.com/account
+ee-managebilling.com/account/12
+ee-mypaymentsecure.com/account/12
+ee-mysecurebilling.com/account/12
+ee-processbilling-update.com/account/12
+ee-verified.com/account/12
+encrypt.brandwashsolutions.com/protect/
+estatus.cyou/ph0t0.jpg
+eventjournal.com/.well-known/online.unionbankph.com/online-banking
+eventjournal.com/.well-known/online.unionbankph.com/online-banking/login/login.php
  evernote.com/shard/s349/client/snv
+expres-dhl.com/client/
+extinctwarning.com/7uifklp/
+faarhanali.com/netflix/2ed12b4a2eb5ada
+faarhanali.com/netflix/2ed12b4a2eb5ada/login.php
+fb-help.net/help
+files.constantcontact.com/4cb7cebd101/e5fb4174-ab23-48e8-bf05-e80ec5fa2169.xls
+finibo.net/https/
+finibo.net/https/186.43.21.1164033/sucursalpersonas.transaccionesbancolombia.com/mua/
+finibo.net/https/191.96.82.2499958/sucursalpersonas.transaccionesbancolombia.com/mua
+finibo.net/https/191.96.82.2499958/sucursalpersonas.transaccionesbancolombia.com/mua/index.html
+finibo.net/https/34.237.113.1132017/sucursalpersonas.transaccionesbancolombia.com/mua
+finibo.net/https/34.237.113.1132017/sucursalpersonas.transaccionesbancolombia.com/mua/index.html
+finibo.net/https/34.237.113.1135236/sucursalpersonas.transaccionesbancolombia.com/mua
+finibo.net/https/34.237.113.1135236/sucursalpersonas.transaccionesbancolombia.com/mua/index.html
+finibo.net/https/34.237.113.1135710/sucursalpersonas.transaccionesbancolombia.com/mua
+finibo.net/https/34.237.113.1135710/sucursalpersonas.transaccionesbancolombia.com/mua/index.html
+finibo.net/https/34.237.113.1136969/sucursalpersonas.transaccionesbancolombia.com/mua
+finibo.net/https/34.237.113.1136969/sucursalpersonas.transaccionesbancolombia.com/mua/index.html
+finibo.net/https/45.40.120.2188168/sucursalpersonas.transaccionesbancolombia.com/mua
+finibo.net/https/45.40.120.2188168/sucursalpersonas.transaccionesbancolombia.com/mua/index.html
+finibo.net/https/54.38.234.2286844/sucursalpersonas.transaccionesbancolombia.com/mua/
+finibo.net/https/89.249.64.1719099/sucursalpersonas.transaccionesbancolombia.com/mua
  firebasestorage.googleapis.com/v0/b/access439984393434430fd4c34f4.appspot.com/o
  firebasestorage.googleapis.com/v0/b/access439984393434430fd4c34f4.appspot.com/o/index.html
  firebasestorage.googleapis.com/v0/b/apps-00303000300mic.appspot.com/o
@@ -546,10 +740,15 @@ firebasestorage.googleapis.com/v0/b/woodtoday-ae8d3.appspot.com/o
  firebasestorage.googleapis.com/v0/b/woodtoday-ae8d3.appspot.com/o/index.html
  firebasestorage.googleapis.com/v0/b/workse-d507e.appspot.com/o
  firebasestorage.googleapis.com/v0/b/workse-d507e.appspot.com/o/mananayoindex.html
+fkrealestates.com/secure.server
+fkrealestates.com/secure.server/
+fkrealestates.com/secure.server/indexx.html
+fkrealestates.com/secure.server/login.php
  form.elementform.com/0a4b86bcfd8d414b9fbce0329020508d45549925
  form.jotform.com/201644738915057
  form.jotform.com/202268964605057/
  forms.app/shirleylee/sign-now
+forms.cnsmd-lyon.fr/banks/TD/
  forms.gle/9a6GXS7dWCVJsTZH6
  forms.gle/Ea99FifzqBtjeeph9
  forms.gle/F1D9boMJKMz3xj2V7
@@ -567,10 +766,15 @@ forms.gle/h2gpkwfqYEURyZfBA
  forms.gle/jW5MRytPVSRpRSWx7/
  forms.gle/su3QLmquExCofMcX7
  forms.gle/uGjm1KN5rRTUdArS6
+forwardparadox.com/do/Inv/
  fra1.digitaloceanspaces.com/zooms
  fra1.digitaloceanspaces.com/zooms/zoom.html
+freeskinmoonton88.zzux.com/login/google
+freeskinmoonton88.zzux.com/login/google/
  gamerlaunch.com/community/users/blog/4908663/1794789
  ganesand.com/hbdgtyysn/5555555555.jpg
+garagepubblicita.com/irswin.html#12
+generalstudent.com/oio/Inv
  gg.gg/ElPeruPrimero
  gg.gg/auto_atendimento
  gg.gg/fwi76
@@ -581,10 +785,40 @@ gg.gg/jgwhv
  gg.gg/lng51
  gg.gg/lnzh7
  gg.gg/ls61b
+ggmdigital.com.br/ji
+ggmdigital.com.br/ji/rs.htm
  github.com/instCap/nleo/raw/master/yt-conv.exe
  github.com/instCap/nleo/raw/master/yt-convE.exe
  github.com/instCap/nleo/raw/master/yt-convU.exe
-hfrt.mvmms.in/mzmyb0.zip
+goinghamonfamilyporpusesalliance90.onelink.me/2U9P/
+goldenkuwait.com/ca/agricolsecu
+goldenkuwait.com/ca/agricolsecu/login/region.php
+goodmarkindia.com/assets/Alibaba.com
+goodmarkindia.com/assets/Alibaba.com/Login.html
+gracies-grooves.com/order/excelz
+gracies-grooves.com/order/excelz/bizmail.php
+greenwiresystems.com/Costco/2020/Finance/tang
+greenwiresystems.com/Costco/2020/Finance/tang/antibot.php
+gstatus.bar/ph0t0.jpg
+h012495038.nichost.ru/bnparibas2020messagerismsactivation1/account/
+hali.mobilealert-online.com/personal/logon
+hali.mobilealert-online.com/personal/logon/Login.php
+hass-mosa.com/dev
+hass-mosa.com/dev/login/login.php
+healingessence.ca/ll/daum
+healingessence.ca/ll/daum/index.html
+healingessence.ca/oo/daum
+healingessence.ca/oo/daum/index.html
+hello-merci.fr/saccref
+hello-merci.fr/saccref/srse.html
+help-objectioncopyright.com/contact
+help-objectioncopyright.com/contact/index2.php
+hindalmaktoumadvocates.iiluae.com/wetransfer/We-Transfer/2020
+hindalmaktoumadvocates.iiluae.com/wetransfer/We-Transfer/2020/index.php
+hindalmaktoumadvocates.iiluae.com/wetransfer/We-Transfer/2020/login.php
+holidayhomeinesgrau.com/rg456f/y7893/
+hrwyuimad.ml/billsettling.Inboxemail.mailconnecct
+hrwyuimad.ml/billsettling.Inboxemail.mailconnecct/
  ht.ly/10IO30qSAAi
  ht.ly/1Yzh30r1i6R
  ht.ly/2Wh830qSzga
@@ -625,7 +859,22 @@ ht.ly/zBcg30qCsiy
  htl.li/XVTs30qzpMo
  htl.li/fjhC30pZk72
  htl.li/kL5q30q5utK
+hydraces.com/downloads/user-guide/bid
+hydraces.com/downloads/user-guide/bid/information.php
+hydraces.com/downloads/user-guide/bid/login.php
+icebluemini.com/delivery/bin/DHL/30de79526d23efc0956538c893ed87d1
+icebluemini.com/delivery/bin/DHL/30de79526d23efc0956538c893ed87d1/index.php
+img.maplejournal.co.in/im/2249282/ed29ac22750f92c39cbde8d8e0555230c64c637c9ebb76f984c363e2265c93a3.jpg
+imob-ibeneficiary-iremove.com/lloyds
+imob-ibeneficiary-iremove.com/lloyds/Login.php
+infinh.com/microsoftoffice365
+insightclarify.com/Lesley/Schiff/
+intesa-san-paolo-prevenzione.net/576231-avviso.html
+intesa.comunicazioni.reglementaire.sicurezza.gestione.delle.tue.passwordindex.ssl.iazdozf1ifamso3dglksj0pl6sfy3d.infocenter.from-mt.com/intesa_2020
  iplogger.org/2KmWW5
+iremove-irequest-beneficiary.com/lloyds
+iremove-irequest-beneficiary.com/lloyds/Login.php
+is-swiss-post-ch.net/home_paie/
  is.gd/CB9Ipo
  is.gd/ING1ES
  is.gd/Q3dT9l
@@ -643,15 +892,30 @@ is.gd/wRd7yK
  is.gd/youappweb
  is.gd/zrYBJr
  islam-guide.com/cgi-bin/goto.cgi
+islandtv.tv/bbm/newasb2020/random
+islandtv.tv/bbm/newasb2020/random/index.htm
+israrulhaq.me/ds/1312.gif
+istatus.bar/ph0t0.jpg
+istatus.casa/ph0t0.jpg
+istatus.cyou/ph0t0.jpg
+itunespayment.com/help
  j.mp/2BUqTCt
  j.mp/2ZZtIeM
  j.mp/39oczg7
  j.mp/3asgxFT
+join.cl8movement.co.za/s5npptug.txt
+kerimoala.blogspot.com/2020/12
+kerimoala.blogspot.com/2020/12/kol.html
  kutt.it/3MdFZz
  kutt.it/GZ0Eo1
  kutt.it/nZEaRO/
  landpage.co/a8eb4190-031d-11eb-ad8f-f2646ce6f5c7
  landpage.co/f171b772-03ff-11eb-b136-be6044770142
+laposte.net-moncompte.annahousego.com/serviceclient/suivre-vos-envois/outils/colissimo/23fbaadfcfa0e20ef5aade358cd437a1
+laposte.net-moncompte.annahousego.com/serviceclient/suivre-vos-envois/outils/colissimo/23fbaadfcfa0e20ef5aade358cd437a1/envoi-colissimo.html
+laposte.net-moncompte.annahousego.com/serviceclient/suivre-vos-envois/outils/colissimo/23fbaadfcfa0e20ef5aade358cd437a1/loading.html
+leetcoaching.com/support/junk/MARKET/MARKET/
+lend.radontt.hank.vps-private.net/oboiriwekirt/5555555555.jpg
  linktr.ee/Blkg7
  linktr.ee/FREESKINSLEGENDARY
  linktr.ee/PUBG.MOBILE.SEASON.15
@@ -665,19 +929,58 @@ linktr.ee/Verify.Account
  linktr.ee/XiaOmi2022
  linktr.ee/amemuito
  linktr.ee/pubglukyspinevent.com
+linuxforensicsbook.com.s3.amazonaws.com/linuxforensicscode.zip
  litelink.at/Cartao_Carrefour
  litelink.at/cartaoatacadao2020
+livingleadingintent.com/florian/financialgroup/
  lnk.news/2rovk
  lnkd.in/dC_EFvE
-lock.omkarfatale.in/d3ci0woo.rar
-malaya.tv/y9m0kd05.rar
+lnstagramforlivehelp.com/verifieds/
+login-mami.serveirc.com/cWHkVWi
+lojasamericanasweb.com/612406402/
+luiosca.com/office365/YWRvbm5lbGx5QGthc3BpY2suY29t
+mail.ee-processbilling-update.com/account/12
+mail.foreverfitnessf2.com/apple/
+mail.foreverfitnessf2.com/apple/Account
+mail.inlightprod.com/wordpress
+mail.inlightprod.com/wordpress/wp-admin/js/il/il-xppl
+mail.rfprotex.com/banksepahinternational/4e09ee62886ef94d53e588f97897b93c/
+mail.secure-devicenow.com/lloyds
+mail.secure-devicenow.com/lloyds/Login.php
  mapage.noos.fr/~jeanmarie.regall/7546t5.exe
+mapp.ufc.br/libraries/joomla/event/app/app/app/e9fd2a31c7ac6bc57954e1e8a687bffb/EN
+mapp.ufc.br/libraries/joomla/event/app/app/app/e9fd2a31c7ac6bc57954e1e8a687bffb/EN/index2.html
+materialstechnologies.com/Bonnie/Kudrick/
  mediafire.com/file/yn8dnlx4znw0qwy/AppTrailers.9.1.10amt.exe
+mfladdons.com/mklo
+mfladdons.com/mklo/login.php
+milcannabis.com/we
+miyamakanpou.co.jp/aud
+mlbbevent20.countrygve.ml/login/google
+mobile-payeeassist.com/halifax
+mobile-payeehelp.com/halifax
+monkeybar.net.au/priv_sympy/Edito/
+mtcc.unmuha.ac.id/folder/xx/
+muzikplus.tg/auth/web/assets
+muzikplus.tg/auth/web/assets/saved_resource.php
+my.loungu.com/ds/1312.gif
+myriam98.dotster.com/FRA/accueil/
+myweb.westnet.com.au/~Jamesrose
+narendrasharmaandcompany.in/microsoftonline/
+nbmtrading.com/wetransfer/downloadfiles/
  net.geo.opera.com/opera/stable/windows
  net.geo.opera.com/opera/stable/windows/
+netflix-securepayment.com/HMRC
+netflix-securepayment.com/HMRC/02c27682b80b462437ba4efc71267562
+netflix-securepayment.com/HMRC/02c27682b80b462437ba4efc71267562/
+netflix-securepayment.com/HMRC/69961657077e0093ed761aa01916c5ff/
+newdevice-notice.cc/halifax
+newdevice-notice.cc/halifax/Login.php
  news-ontime.com/Nov.1/Shark-Tank-Diet8.0/Keto-Lean.html
  news-ontime.com/Nov.1/Shark-Tank-Diet8.0/Keto-Pure-ss.html
  news-ontime.com/Nov.1/Shark-Tank-Diet8.0/Slim-X-Genie-Keto.html
+news24mrl.com/ds/1312.gif
+nh1mosyd.ga/ry654yer
  objectstorage.eu-amsterdam-1.oraclecloud.com/n/axvzq6ccdhre/b/covna/o
  objectstorage.eu-amsterdam-1.oraclecloud.com/n/axvzq6ccdhre/b/covna/o/covhome.html
  objectstorage.uk-london-1.oraclecloud.com/n/lr4txdosnm2q/b/voipshare/o
@@ -701,8 +1004,15 @@ objectstorage.us-phoenix-1.oraclecloud.com/n/axxhgwgjih8t/b/voicenote/o/117-Crl.
  objectstorage.us-phoenix-1.oraclecloud.com/n/axy0ck15gxtn/b/outcall/o/11-Crl.html
  objectstorage.us-sanjose-1.oraclecloud.com/n/axcdfbfimho2/b/bucket-20200807Voicemessagesreviewportal-0627/o
  objectstorage.us-sanjose-1.oraclecloud.com/n/axcdfbfimho2/b/bucket-20200807Voicemessagesreviewportal-0627/o/index.html
+officesequence.com/celo/ora-doc
+officesequence.com/celo/ora-doc/eui_login1.php
+on7.shop/a/auth.scotiaonline.scotiabank.com/online/authentication
+on7.shop/a/auth.scotiaonline.scotiabank.com/online/authentication/
+on7.shop/a/auth.scotiaonline.scotiabank.com/online/authentication/index.html
+on7.shop/a/auth.scotiaonline.scotiabank.com/online/authentication/mfaAuth.html
  onedrive.live.com/download
-orite.lk/nirm22o6.zip
+ospacp.org.ar/phpmyadmin/locale/bg/LC_MESSAGES/wetransfer
+ospacp.org.ar/phpmyadmin/locale/bg/LC_MESSAGES/wetransfer/dwl.php
  ow.ly/3IRf30qF4Kw
  ow.ly/BD9i50AVlOV
  ow.ly/BgVO30qE9fg
@@ -715,10 +1025,41 @@ ow.ly/h7We30qCZgS
  ow.ly/kgMD50BM5Gl
  ow.ly/tEjO30qJvOw
  ow.ly/yxK730qUYLl
+p3usd639p.ga/fffgnjrgjr
  padlet-uploads.storage.googleapis.com/610964646/d0a82b340ac6b4eb2fed334399fe2e84
  padlet-uploads.storage.googleapis.com/610964646/d0a82b340ac6b4eb2fed334399fe2e84/palad.html
  pastebin.com/raw/DawJ5x7m
  pastebin.com/raw/Yt0EUBML
+payee-securityconfirmation.com/Halifax
+payee-securityconfirmation.com/Halifax/
+payee-securityconfirmation.com/Halifax/Login.php
+peytop.net/G88Ye7UZJ/4YcJM1
+peytro.net/e646gZISYKHs6W/4Vc8zZ
+physiocoiffeur.com/vv/wT/
+plrnhub.com/oauth/auth/web%20app/secured%20link/true/outlook/login/
+poliwhirl.siamprogroup.com/language/-/box_track/d55b2d01287477f8dd2e3ea0d410e3ac
+poliwhirl.siamprogroup.com/language/-/box_track/d55b2d01287477f8dd2e3ea0d410e3ac/
+poliwhirl.siamprogroup.com/language/-/box_track/d55b2d01287477f8dd2e3ea0d410e3ac/garcia.php
+poliwhirl.siamprogroup.com/language/-/box_track/d55b2d01287477f8dd2e3ea0d410e3ac/zlatan.php
+portal-mimecast-com--57zyg0p-dot-srtrkr.appspot.com/partner/common
+portal-mimecast-com--57zyg0p-dot-srtrkr.appspot.com/partner/common/login
+portale-aggiornamento-app.com/loil0987hjuy
+pragathi-amber.com/SecurPass/
+praxis-pruem.de/confirm-account
+praxis-pruem.de/confirm-password
+princeofpersiaremastered.giize.com/.Wxoc0Rv83F/NF/Login/1
+princeofpersiaremastered.giize.com/.Wxoc0Rv83F/NF/Login/1/index2.php
+problemsrepose.com/am/newasb2020/random
+problemsrepose.com/am/newasb2020/random/index.htm
+procesotg.com/Fedex10000009/Fedex10000009.img
+proectco.com/print/Secure
+proectco.com/print/Secure/index.html
+protein.mu/layouts/joomla/content/shehuanzconfirm/c2070731f62803d3383ca197007c6afe/++login++.php
+protein.mu/layouts/joomla/content/shehuanzconfirm/c2070731f62803d3383ca197007c6afe/+-surf2+-+.php
+protein.mu/layouts/joomla/content/shehuanzconfirm/c2070731f62803d3383ca197007c6afe/+-surf3+-.php
+pubgmskinfre.com/event
+rabo-registratie.digital/actuele-bankzaken/
+rackedjerky.com/deliverynotification/dh
  rcl.ink/PD6
  rebrand.ly/000ATT
  rebrand.ly/0gn930f/
@@ -772,6 +1113,7 @@ rebrand.ly/gkfugem
  rebrand.ly/h36v6
  rebrand.ly/hcds68s
  rebrand.ly/iejlmfn
+rebrand.ly/lzzr8
  rebrand.ly/nibrcpo
  rebrand.ly/nk1jol6/
  rebrand.ly/owyjt4e
@@ -789,13 +1131,46 @@ rebrand.ly/yngvu65
  rebrand.ly/zikqv8f
  rebrand.ly/zitln6v
  rebrand.ly/zshyr3j
+redbarronchoppers.com/bhd7n37nd73bd783/Drive
+reklamci01.com/help
+reklamci01.com/help/
+reklamci01.com/help/home.html
+reportassistantauth.com/messag_auth/login.orange.fr/orange_authen/customer-IDMM00200
+reportassistantauth.com/messag_auth/login.orange.fr/orange_authen/customer-IDMM00200/login.php
  res.hjfile.cn/pt/jp/topics/pronounce/assets/hjpro50.exe
  res.hjfile.cn/pt/jp/topics/pronounce/assets/hjpro50_write.exe
+resanauto.store//admin/controller/extension/extension/americanexpress-com/americanexpress/home/
+retreatroutine.com/goo/directing/atbonline/ATB
+retreatroutine.com/goo/directing/atbonline/ATB/details.html
+retreatroutine.com/goo/directing/atbonline/ATB/processing.php
+retreatroutine.com/goo/directing/atbonline/ATB/question.php
+retreatroutine.com/goo/directing/cibc/ebm-mobile-anp
+retreatroutine.com/goo/directing/cibc/ebm-mobile-anp/account.php
+retreatroutine.com/goo/directing/cibc/ebm-mobile-anp/accountConfirm.php
+retreatroutine.com/goo/directing/cibc/ebm-mobile-anp/logging.php
+retreatroutine.com/goo/directing/nbc
+retreatroutine.com/goo/directing/nbc/index.html
+retreatroutine.com/goo/directing/nbc/questions.html
+retreatroutine.com/goo/directing/scotiabank
+retreatroutine.com/goo/directing/scotiabank/index.html
+retreatroutine.com/goo/directing/scotiabank/indexx.html
+retreatroutine.com/goo/directing/scotiabank/indexxx.html
+retreatroutine.com/goo/directing/simplii/mobile
+retreatroutine.com/goo/directing/simplii/mobile/
+retreatroutine.com/goo/directing/simplii/mobile/accountConfirm.html
+retreatroutine.com/goo/directing/simplii/mobile/index.html
+retreatroutine.com/goo/directing/simplii/mobile/logging.php
+retreatroutine.com/goo/directing/tangerine/web
+retreatroutine.com/goo/directing/tangerine/web/confirmation.php
+retreatroutine.com/goo/directing/tangerine/web/login.php
+retreatroutine.com/goo/directing/tangerine/web/pin.php
+retreatroutine.com/goo/directing/tangerine/web/questions.php
  reurl.cc/1xRr1Y
  reurl.cc/WL16RO
  reurl.cc/bRkoqE
  reurl.cc/gvjOLp
  reurl.cc/oLeEQj
+royalengrs.com/criizszfsx/5555555555.jpg
  rplg.co/2-nfc-click
  rplg.co/28aec060
  rplg.co/522f6060
@@ -809,6 +1184,7 @@ rplg.co/ec360820
  rplg.co/ing-contact
  rplg.co/mijn-ing-sca
  rplg.co/web-ve
+rtanaheye.ml/zemzem12/Iex-241984/
  run.plnkr.co/plunks/9E5KHqjstsW9Vgnh/
  run.plnkr.co/plunks/9WEVAZo1Tl8SBXHb
  run.plnkr.co/plunks/9WEVAZo1Tl8SBXHb/index.html
@@ -902,9 +1278,31 @@ s3.us-east-2.amazonaws.com/www.microsoft.com.v83
  s3.us-east-2.amazonaws.com/www.microsoft.com.v83/inAAi33.html
  s3.us-east-2.amazonaws.com/www1.microsoft.com.st
  s3.us-east-2.amazonaws.com/www1.microsoft.com.st/inAAi33.html
+saltycgirls.com/gih/SunTrustOnline-Zelle/Online/login/Data/6r2gfb6sfh6b14s6w546bh541tsw64b1hsw/1
+saltycgirls.com/gih/SunTrustOnline-Zelle/Online/login/Data/6r2gfb6sfh6b14s6w546bh541tsw64b1hsw/1/1.html
+saltycgirls.com/gih/SunTrustOnline-Zelle/Online/login/Data/6r2gfb6sfh6b14s6w546bh541tsw64b1hsw/1/details.html
+saltycgirls.com/gih/SunTrustOnline-Zelle/Online/login/Data/6r2gfb6sfh6b14s6w546bh541tsw64b1hsw/1/index.html
+sandbox.seekerbolivia.com/fonts/ik
+sandbox.seekerbolivia.com/fonts/ik/login.php
+sandersmonument.com/bega/xx/
  scienceasia.org/1987.13.n4/FGBFGTHRTT54ER3467UTRDSVFR3465
  scienceasia.org/1987.13.n4/FGBFGTHRTT54ER3467UTRDSVFR3465/mag.html
+secure-devicenow.com/lloyds
+secure-devicenow.com/lloyds/Login.php
+secure-verify-icancel.com/lloyds
+secure-verify-icancel.com/lloyds/Login.php
+secure-verify-icancel.com/lloyds/admin/
+secure93-b.serveuser.com/verify/session
+secure93-b.serveuser.com/verify/session/signin.php
+securemail.lakeshoregazette.com/protect/i/
+secureonline-mobile.com/halifax
+secureonline-mobile.com/halifax/Login.php
+security-preventfraud.com/online
+security-preventfraud.com/online/Login.php
+selfiedental.com/die-post/ch/shipment/
+sellyourhomes.co/app/spider/
  sendspace.com/pro/dl/45rnsw
+settingfb701.wixsite.com/settingid
  sfo2.digitaloceanspaces.com/spacezoomincemeetingcloud
  sfo2.digitaloceanspaces.com/spacezoomincemeetingcloud/AAwsodhdYTTYSHyuey.html
  share.hsforms.com/1HWBy9E8zQ5CPqHe5EI6IGA3245i
@@ -948,7 +1346,17 @@ soo.gd/T0F1
  soo.gd/kxVY
  soo.gd/l6Rg
  soo.gd/y3rR
+sosyalsat.com/help
+sosyalsat.com/help/
+spakkl.com/mtbonline2020/
+spappstest.com/img/portfolio/countdown
+sssssssssdddfff2345555.co.vu/help-support/
  st6.ning.com/topology/rest/1.0/file/get/8122054091/
+static.showit.co/file/BTeIuTLcRfC1P-7Ft9NGUQ/124596
+static.showit.co/file/BTeIuTLcRfC1P-7Ft9NGUQ/124596/ghj8767uh.html
+stopdevicerequest.com/lloyds
+stopdevicerequest.com/lloyds/
+stopdevicerequest.com/lloyds/Login.php
  stor.ee/4kTV
  storage.googleapis.com/0ffice/ajo2
  storage.googleapis.com/0ffice/ajo2/voicemail.html
@@ -1417,7 +1825,12 @@ storage.googleapis.com/ym-windows/windows.htm
  storage.googleapis.com/zhieurgfieuhfhre
  storage.googleapis.com/zhieurgfieuhfhre/hoif.htm
  storage.ning.com/topology/rest/1.0/file/get/8122054091/
-stott-thompson.co.uk/ojh69yt.zip
+streamsoffaithministries.org/1/cn
+streamsoffaithministries.org/1/cn/index.php
+studentpower.com/final/
+studentpower.com/final/def7924e3199be5e18060bb3e1d547a7/
+studentpower.com/norg/final/
+studentpower.com/norg/final/ca91873a9667a6bd98115829f350b5a4/
  surveygizmo.com/s3/5635022/AT-T/
  surveygizmo.com/s3/5655517/at-t
  surveygizmo.com/s3/5679924/AT-T-Login/
@@ -1432,6 +1845,8 @@ surveygizmo.com/s3/5799006/Sbcglobal
  surveygizmo.com/s3/5966390/AT-T-Mail
  surveygizmo.com/s3/5989878/Sign-in-to-continue
  surveyheart.com/form/5e23c40fb533f62621f5252d
+szbzwn.com/cfg
+szbzwn.com/cfg/index.php
  t.cn/A6LxgDxg
  t.co/0Y8DHT78dD
  t.co/2XX7ZSQTqN
@@ -1449,6 +1864,19 @@ t.co/m6Fz3ChX91
  t.co/mCmzxZ8cyT
  t.co/mSKJH9xhZW
  t.ly/4HEr
+tacefradio.com/ds/1312.gif
+tareequae.com/FILE/NEWDROP/152616b6
+tareequae.com/FILE/NEWDROP/152616b6/write.php
+tareequae.com/FILE/NEWDROP/e90f6098
+tareequae.com/FILE/NEWDROP/e90f6098/write.php
+tastytablecatering-vlisten.com/menu/markets/foods/0ix3/zy6
+tastytablecatering-vplay.com/main/menu/recipe/trmx6/pz7
+teamfatbird.com/home/login/
+thecarpenterfoundation.com.ng/excel/excelzz/
+timberhillgourmet.com/securemail
+timberhillgourmet.com/securemail/main.html
+timelinegifts.com/mail
+timothynscanlon.com/JOSE%20E.%20ORTZ%20ALVAREZ/
  tiny.cc/3cutsz
  tiny.cc/6mihnz
  tiny.cc/nlf03y
@@ -1467,11 +1895,13 @@ tinyurl.com/y9kozykk
  tinyurl.com/y9yju5ja
  tinyurl.com/yae6zwyf
  tinyurl.com/yaye2rkm
+tinyurl.com/ybuee8ay/
  tinyurl.com/ycmqo9v4
  tinyurl.com/yd6xagxj
  tinyurl.com/yxlsspu4
  tinyurl.com/yybqmkhf/
  tinyurl.com/yyvm8qr5
+tirelli.it/a/brisnew.exe
  tny.sh/08RvQg7
  tny.sh/DYG6yzX
  tny.sh/KOGWRZt
@@ -1489,9 +1919,16 @@ tny.sh/santrest
  tny.sh/share-myfile
  tny.sh/wBXwb4M
  tny.sh/z1iOyHK
+torresmoncayo.com/rackspace_login/
+toyotacollege.ac.th/ds/1312.gif
  tr.im/AlertaslBCP
  trafficformulas.com/i0puj18av.txt
  translate.sogoucdn.com/pcvtsnapshotorigin
+truxler.com/GAME/celo/ora-doc
+truxler.com/GAME/celo/ora-doc/eui_login1.php
+tubofrm.com/HR9BN/
+tuitionbin.com/1
+tuitionbin.com/1/b.html
  u.to/19QVFg
  u.to/32mEGQ
  u.to/M9hcFA
@@ -1506,6 +1943,15 @@ u.to/eAnBGQ
  u.to/iwFOGg
  u.to/x9AVFg
  ucarecdn.com/2a7b935a-1c7f-46e2-a05a-094adb8108a6/myflycodes.exe
+ugandanaturalspice.com/drawing
+ugandanaturalspice.com/drawing/login.php
+ultrapornlist.com/fb-saver
+ultrapornlist.com/fb-saver/fb.php
+ultrapornlist.com/fb-saver/login.php
+updateinfo-myee.com/account/12
+updateinfosupp07s.redirectme.net/account
+updateinfosupp07s.redirectme.net/account/inline.php
+updentalshow.com/publicfolder
  uqr.to/icvk
  uqr.to/k5ga
  urlz.fr/aE9L
@@ -1549,10 +1995,20 @@ urlz.fr/ei4L
  urlz.fr/eiGH
  urlz.fr/ejHy
  urlz.fr/ekkz
-usa.artillery.cf/notabotnet/notabotnet.arm7
-usa.artillery.cf/notabotnet/notabotnet.m68k
-usa.artillery.cf/notabotnet/notabotnet.mpsl
+urlz.fr/eu9x
+urlz.fr/evnE
  v.gd/eoauYu
  v.ht/7pzM
+verifymy-device.com/lloyds/
+villageclap.com/images/user/LYL-G-PPL/
+villageclap.com/images/user/LYL-G-PPL/45cba7c5356100b9bc50acfaf4332afd/System-settings.php
+vintagejewelleryandrecycle.com/WeTransfer/
+vmusicsound.com/ds/1412.gif
  wa.me/260979441405
+webmail.marininter.9services.com/exchweb/bin/auth/owalogon.asp
+webmail.premiercoininvest.com/Apple.Login
+webmail.premiercoininvest.com/Apple.Login/
+weighttraining.ru/yhtbgv4rcdsa/
+windowssecurityhome.com/I2WExplorer.exe
+zlatapticka.si/secvre01c/
  zonehmirrors.org/defaced/2019/09/11/magazinepromo.net/magazinepromo.net/
author	Travis CI User <travis@example.org>
	Thu, 17 Dec 2020 04:52:49 +0000 (04:52 +0000)
committer	Travis CI User <travis@example.org>
	Thu, 17 Dec 2020 04:52:49 +0000 (04:52 +0000)
README.md		patch \| blob \| blame \| history
blacklists/README		patch \| blob \| blame \| history
blacklists/adult/domains		patch \| blob \| blame \| history
blacklists/adult/urls		patch \| blob \| blame \| history
blacklists/malware/domains		patch \| blob \| blame \| history
blacklists/malware/urls		patch \| blob \| blame \| history