Automatic blacklist update

author Travis CI User <travis@example.org>

Mon, 1 Feb 2021 05:25:44 +0000 (05:25 +0000)

committer Travis CI User <travis@example.org>

Mon, 1 Feb 2021 05:25:44 +0000 (05:25 +0000)
author Travis CI User <travis@example.org>
Mon, 1 Feb 2021 05:25:44 +0000 (05:25 +0000)
committer Travis CI User <travis@example.org>
Mon, 1 Feb 2021 05:25:44 +0000 (05:25 +0000)
diff --git a/README.md b/README.md

index a03983f2f31b0a46e96d04ca0cc2adcde3ef7956..39e9bf41693805632558aefc52b08124089b631e 100644 (file)
--- a/README.md
+++ b/README.md
@@ -6,7 +6,7 @@ __Note__: this repository is only intended to mirror lists, to modify/update the
  ## Lists
  | Name | Size | Description |
  |:-----|:-----|:------------|
-| [adult](blacklists/adult) | 2735055 | Some adult site from erotic to hard pornography |
+| [adult](blacklists/adult) | 2735448 | Some adult site from erotic to hard pornography |
  | [agressif](blacklists/agressif) | 385 | Some aggressive sites |
  | [arjel](blacklists/arjel) | 69 | ARJEL which is a french certification authority for gambling sites |
  | [associations_religieuses](blacklists/associations_religieuses) | 1 | religious_association |
@@ -38,7 +38,7 @@ __Note__: this repository is only intended to mirror lists, to modify/update the
  | [jobsearch](blacklists/jobsearch) | 386 | Site to looking for job |
  | [lingerie](blacklists/lingerie) | 83 | Sites for lingerie |
  | [liste_bu](blacklists/liste_bu) | 2881 | A french list for educational sites. VERY locally oriented. may help libraries |
-| [malware](blacklists/malware) | 292684 | Any website which deliver malware |
+| [malware](blacklists/malware) | 291156 | Any website which deliver malware |
  | [manga](blacklists/manga) | 779 | Any website related to manga, and cartoons |
  | [marketingware](blacklists/marketingware) | 28 | Very special marketing sites |
  | [mixed_adult](blacklists/mixed_adult) | 152 | Websites which contains adult sections unstructured |
diff --git a/blacklists/README b/blacklists/README

index 0239a37124560da6505787eac8174923dedaa0f2..0e8278bbb038e2f6fdcc18b9a3a3d9a024e614dc 100644 (file)
--- a/blacklists/README
+++ b/blacklists/README
@@ -41,7 +41,7 @@ adult.tar.gz          is a list of adult sites. They are based on
                                          Symon Aked
                                          Todd Sieland-Peterson
  
-Last version Saturday 30 January 2021 with 2664606 domains and 70449 urls : 11704 Kb.
+Last version Sunday 31 January 2021 with 2664848 domains and 70600 urls : 11708 Kb.
                         
  
  OTHER :
diff --git a/blacklists/adult/domains b/blacklists/adult/domains

index ab32154a009d25fa71ed20f0ce2d62ce97418bfb..f935c612307eb7376d88a5271112f2f3c15d6fb1 100644 (file)
--- a/blacklists/adult/domains
+++ b/blacklists/adult/domains
@@ -27471,6 +27471,7 @@
  1x2x3x.com
  1xasf23t2gdsgdsgsdg.duckdns.org
  1xbuofa1x.bankofamericaslpemr.com
+1xcrow.com
  1xpimp.com
  1xrayvision.com
  1xxlsex.de
@@ -131243,6 +131244,7 @@
  988991-dot-n-e-w-me-ss-age-po-rt-al.wl.r.appspot.com
  989822-dot-n-e-w-me-ss-age-po-rt-al.wl.r.appspot.com
  9898989hhjjkkjjkjkkj.000webhostapp.com
+9898zem.blogspot.com
  9899909.ru
  989coworking.com
  98fc40c5287be2095d2f2b2452c7a94b1ea06155.info
@@ -132015,6 +132017,7 @@
  9s2s.com
  9seobw.64gawstnor.blue
  9sex.com
+9sexstory.blogspot.com
  9sextube.com
  9sm.com
  9sunnyleonesexv.tumblr.com
@@ -150634,6 +150637,7 @@ adegadapinga.com.br
  adehuwnqpfiszika-dot-millinium.ey.r.appspot.com
  adeitarea.com
  adekit.md
+adel-sharp-bitch.blogspot.com
  adelahidalgo.com
  adelaidawuexuk.blogspot.ae
  adelaidawuexuk.blogspot.al
@@ -156869,6 +156873,7 @@ adulelibertin.myannuaire.com
  adulfilmstarsz.tumblr.com
  adulporn.com
  adulsexpictures.ucgalleries.com
+adult
  adult---movies.com
  adult--sex--club.sinoh.biz
  adult-01.com
@@ -165140,6 +165145,7 @@ adult21.com
  adult24.nl
  adult24.org
  adult247live.com
+adult2days.blogspot.com
  adult2wsibling2wsex.blogspot.ae
  adult2wsibling2wsex.blogspot.al
  adult2wsibling2wsex.blogspot.am
@@ -219970,6 +219976,7 @@ alonzoafnigzc.blogspot.sn
  alonzoafnigzc.blogspot.tw
  alonzoafnigzc.blogspot.ug
  aloofbeetrootr.com
+alopeciaclub.club
  alopics.com
  alopics.net
  aloporno.com
@@ -233839,6 +233846,7 @@ amateurfilm.tv
  amateurfilme.canalblog.com
  amateurfilme.ch
  amateurfilme.de
+amateurfilmeporno.com
  amateurfilming.com
  amateurfilmpjes.maakjestart.nl
  amateurfilmpjes.nl
@@ -258851,6 +258859,7 @@ anal-asians.com
  anal-asians.org
  anal-ass.com
  anal-assisthebeston.tumblr.com
+anal-babes.blogspot.com
  anal-bar.com
  anal-barbie-slut-porn-filth-centerfolds.nu
  anal-bdsm.tumblr.com
@@ -264082,6 +264091,7 @@ analsexfuckyeah.tumblr.com
  analsexgalleries.com
  analsexgallery.com
  analsexgay.org
+analsexgif.blogspot.com
  analsexgif.tumblr.com
  analsexgifs.com
  analsexgirl.com
@@ -266506,6 +266516,7 @@ anderson.be
  anderson.filmy.easy-amateurs.pl
  anderson.nue.online.fr
  anderson543.com
+andersonbellcatherine.blogspot.com
  andersondrives.buzz
  andersongilmour.co.uk
  andersonhaulinganddumping.com
@@ -276307,6 +276318,7 @@ animalzoofrance.com
  animalzooporn.me
  animalzoosex.250free.com
  animalzoosex.com
+animalzoosex.world
  animanga.com
  animanga.nu
  animanga270.tumblr.com
@@ -286842,6 +286854,7 @@ antillessexy.centerblog.net
  antilliaanse-sex.startspot.nl
  antillianen-naakt.startspot.nl
  antimisogynoir.com
+antinatalism.blogspot.com
  antinea-massage.com
  antinos.book.fr
  antinous6.tumblr.com
@@ -288636,6 +288649,7 @@ any6.com
  any600.narod.ru
  anya-ivy-pornhdvideos.tumblr.com
  anya-mistress.com
+anyaahot.blogspot.com
  anyaboobs.tumblr.com
  anyadam.buzz
  anyafox.com
@@ -299958,6 +299972,7 @@ arielsextoy.com
  arielwinter-abloom.nedrobin.net
  arielx.org
  arientalscapital.com
+arierjfxok201.blogspot.com
  aries-moonprincess.tumblr.com
  ariescub10.tumblr.com
  ariesflexo.com
@@ -313875,6 +313890,7 @@ asian-porno.tito.waw.pl
  asian-porno.tumblr.com
  asian-pornoconcurrent.startspot.nl
  asian-pornography-pics.com
+asian-pornography.blogspot.com
  asian-pornos.com
  asian-pornos.net
  asian-pornovideo.com
@@ -366318,6 +366334,7 @@ ballsmaniac.tumblr.com
  ballsnutsandbusts.tumblr.com
  ballsofshemales.tumblr.com
  ballsohard77.tumblr.com
+ballsondolls.com
  ballsout4boobies.tumblr.com
  ballsouttitsout.tumblr.com
  ballsteponline24.com
@@ -372166,6 +372183,7 @@ barbieblackmore.com
  barbieboobs.tumblr.com
  barbiecorrupted.tumblr.com
  barbiecummings.com
+barbieddolls.tumblr.com
  barbiedollbimbo.tumblr.com
  barbiedolllizzy.tumblr.com
  barbiefootgurl.com
@@ -376793,6 +376811,7 @@ batingbuds.blogspot.sk
  batingbuds.blogspot.sn
  batingbuds.blogspot.tw
  batingbuds.blogspot.ug
+batjanilarame.tumblr.com
  batka228.000webhostapp.com
  batkawaiicollectordreamland.tumblr.com
  batlesbo.tumblr.com
@@ -392115,6 +392134,7 @@ beautiful-37.blogspot.sk
  beautiful-37.blogspot.sn
  beautiful-37.blogspot.tw
  beautiful-37.blogspot.ug
+beautiful-53.blogspot.com
  beautiful-amalgam.tumblr.com
  beautiful-amatuer-mature-models-inlingerie-phidn.e-monsite.com
  beautiful-and-horny.blogspot.ae
@@ -393412,6 +393432,7 @@ beautifulblackmenfromphilly.tumblr.com
  beautifulblonde.co.uk
  beautifulblondes.com
  beautifulblow.tumblr.com
+beautifulblowjob.blogspot.com
  beautifulblowjobs.com
  beautifulblowjobs.net
  beautifulbodymen.blogspot.ae
@@ -432105,6 +432126,7 @@ big-tits-pics.com
  big-tits-porn-xxx.com
  big-tits-porn.com
  big-tits-porn.org
+big-tits-porno-news.blogspot.com
  big-tits-porno.com
  big-tits-red-lips.tumblr.com
  big-tits-round-ass.blogspot.ae
@@ -451492,6 +451514,7 @@ birdparty.blogspot.sn
  birdparty.blogspot.tw
  birdparty.blogspot.ug
  birds-and-the-beestings.tumblr.com
+birdsbees2.blogspot.com
  birdsdrivingcars.tumblr.com
  birdsex.com
  birdseyelaramie.com
@@ -464144,6 +464167,7 @@ blackmenfeet.tumblr.com
  blackmenhub.com
  blackmennude.tumblr.com
  blackmenporn.com
+blackmenvswhitesissy.blogspot.com
  blackmenwhiteboys.com
  blackmercilessly.blogspot.ae
  blackmercilessly.blogspot.al
@@ -470831,6 +470855,7 @@ blog-neilr1966things.tumblr.com
  blog-o-sexe.com
  blog-o-sexy.tumblr.com
  blog-of-boys-and-boys-with-boys.tumblr.com
+blog-oi12.blogspot.com
  blog-onevanillagiftcard.com
  blog-orgies.tumblr.com
  blog-photo-sexy.over-blog.com
@@ -477372,6 +477397,7 @@ blondedolly.nl
  blondedozen.nl
  blondedream.pics4search.com
  blondeduchess.tumblr.com
+blondee-wet-boob.blogspot.com
  blondeenchaleur.canalblog.com
  blondeescort.com
  blondeescorts.co.uk
@@ -483293,6 +483319,7 @@ blueballs.vsni.com
  blueballsxxx-deactivated2012113.tumblr.com
  blueballsxxx.tumblr.com
  blueballz.com
+blueballz77.blogspot.com
  bluebdsm.com
  bluebear4ever.tumblr.com
  bluebeardswife.tumblr.com
@@ -484370,6 +484397,7 @@ blumpkintube.com
  blunderfistogre.tumblr.com
  blundraq.com
  bluniq.com
+blunt-emily-wallpaper.blogspot.com
  blunt-sluts.tumblr.com
  bluntblowingbottom.tumblr.com
  bluntedbabygirlprincess.tumblr.com
@@ -488926,6 +488954,7 @@ boleyngirls.com
  bolgova-irina9yt1.tumblr.com
  bolha.xyz
  bolhi.icu
+bolichesfree.blogspot.com
  bolidar.dnset.com
  bolimusyrhtsom.com
  bolinga.com
@@ -489001,6 +489030,7 @@ boliviaaldesnudo.blogspot.sn
  boliviaaldesnudo.blogspot.tw
  boliviaaldesnudo.blogspot.ug
  boliviaki.com
+bolivianasdesnudas.blogspot.com
  bolivianoprojeto.azurewebsites.net
  boliviasamsonite.com
  boliviasex.blogspot.ae
@@ -489707,6 +489737,7 @@ bollywoodwatch.blogspot.sk
  bollywoodwatch.blogspot.sn
  bollywoodwatch.blogspot.tw
  bollywoodwatch.blogspot.ug
+bollywoodxxx.pro
  bollywoodxxxnation.zap3x.com
  bollyxxxwood.blogspot.ae
  bollyxxxwood.blogspot.al
@@ -496039,6 +496070,7 @@ boobiebar.blogspot.tw
  boobiebar.blogspot.ug
  boobiebattle.com
  boobieblog.com
+boobieblog.net
  boobiebondage.com
  boobiebucks.com
  boobiecam.com
@@ -499165,6 +499197,7 @@ boobsxxx.blogspot.ug
  boobsxxx.com
  boobsxxx.org
  boobsxxxfuck.com
+boobsxxxphotos.blogspot.com
  boobsxxxporn.com
  boobsxxxtube.com
  boobsy.com
@@ -505705,6 +505738,7 @@ boutiqueslingerie.fr
  boutiquessexy.com
  boutiquesxxx.com
  boutiquetoyou.com
+boutiquevente-article-erotique.blogspot.com
  boutiquevibro.com
  boutiquevibromasseurs.com
  boutiquex71.com
@@ -525525,6 +525559,7 @@ britishsexlinks.com
  britishsexmovies.com
  britishsexnetwork.co.uk
  britishsexpics.com
+britishsexshops-sextoys.blogspot.com
  britishsexsites.co.uk
  britishsexsluts.com
  britishsextube.com
@@ -528160,6 +528195,7 @@ brittneybbccumslut.tumblr.com
  brittneyjonesconfidential.com
  brittneyskye.com
  brittneyskyexxx.com
+brittneysmithfakes.tumblr.com
  brittneytame.tumblr.com
  brittny.com
  brittonaccounting-info.com
@@ -537530,6 +537566,7 @@ builtscort.com
  builttoconvert.com
  builtwright.net
  builyaho.000webhostapp.com
+buintheworld.blogspot.com
  buiok.freeyellow.com
  buirdly-partition.000webhostapp.com
  buisman.jouwpagina.nl
@@ -537722,6 +537759,7 @@ bukkake-facials.blogspot.sn
  bukkake-facials.blogspot.tw
  bukkake-facials.blogspot.ug
  bukkake-facials.com
+bukkake-female-choice-sex-2013.blogspot.com
  bukkake-fetish.blogspot.ae
  bukkake-fetish.blogspot.al
  bukkake-fetish.blogspot.am
@@ -556850,6 +556888,7 @@ calenytonadialogando.blogspot.ug
  caleromartinez.ug
  calettadelcanavese.com
  calexotics.com
+calfeeqw.blogspot.com
  calfignoramus.com
  calftoggi.com
  calftube.com
@@ -592883,6 +592922,7 @@ cateblanchettsexy.blogspot.sk
  cateblanchettsexy.blogspot.sn
  cateblanchettsexy.blogspot.tw
  cateblanchettsexy.blogspot.ug
+cateblanchetttopless.blogspot.com
  catedras.mabelthwaitesrey.com.ar
  categoriex.free.fr
  categorizedcunt.com
@@ -594857,6 +594897,7 @@ cauris-finance.com
  causalporno.tumblr.com
  causasdeamor.com
  causasysoluciones-online.preview-domain.com
+cause-for-hard-nipples.blogspot.com
  cause-masochism.go4wild.com
  cause-not-found.tumblr.com
  causeabyssx.blogspot.ae
@@ -601305,6 +601346,7 @@ celebritestar.com
  celebritesvideosx.free.fr
  celebritesx.com
  celebritewomennue.over-blog.com
+celebriti3s.blogspot.com
  celebritie.com
  celebritie.de
  celebrities-4u.com
@@ -630673,6 +630715,7 @@ chelseegrey.tumblr.com
  chelsex.ru
  chelsexual.tumblr.com
  chelsey-streicher.tumblr.com
+chelseyletterstoworld.blogspot.com
  chelseyminx.com
  chelseyspurs.buzz
  chelseywlkfst.blogspot.ae
@@ -632731,6 +632774,7 @@ chester-escort.co.uk
  chester-escorts.co.uk
  chester-me.tumblr.com
  chester4345634.xyz
+chestercamron2115.blogspot.com
  chesterfieldmassagellc.com
  chesterkennedy9563.blogspot.ae
  chesterkennedy9563.blogspot.al
@@ -635128,6 +635172,7 @@ chicasculeadas.blogspot.tw
  chicasculeadas.blogspot.ug
  chicasculonas.com
  chicasdangelo.com
+chicasde4mor.blogspot.com
  chicasdebarcelona.com
  chicasdecristal.blogspot.ae
  chicasdecristal.blogspot.al
@@ -666283,6 +666328,7 @@ cnlopaossiczxkbg-dot-millinium.ey.r.appspot.com
  cnlqlobal.com
  cnlruwgvztgfrtua-dot-millinium.ey.r.appspot.com
  cnluroggzbnfxupthajowrgoqk-dot-gloff849483.uk.r.appspot.com
+cnmecnncj.blogspot.com
  cnmfl.goruli.com
  cnml.com.br
  cnmodelos.com
@@ -697669,6 +697715,7 @@ cougar-looking4sex.tumblr.com
  cougar-lovelypix.tumblr.com
  cougar-lovers.tumblr.com
  cougar-milf-selfie.tumblr.com
+cougar-montargis.blogspot.com
  cougar-morepix.tumblr.com
  cougar-nue.centerblog.net
  cougar-omega.tumblr.com
@@ -711997,6 +712044,7 @@ cross-dress-or-die.tumblr.com
  cross-dress.co.uk
  cross-dress.com
  cross-dressing-furry.tumblr.com
+cross-dressing-stories-901.blogspot.com
  cross-obsession.com
  cross-ratio-influen.000webhostapp.com
  crossb45.mywire.org
@@ -739299,6 +739347,7 @@ d4ddysboi.tumblr.com
  d4ee77cf6fd465ae7ac664ab7052d2d1-dot-tomberera.appspot.com
  d4escorts.com
  d4f84d4ggdjdg948f2j8u4248jkhfhbsju88fhdsdfhsf.000webhostapp.com
+d4freew.blogspot.com
  d4k6alip91023x36uy7vn0w18s7ez5o92j8q.co
  d4rke57mund.tumblr.com
  d4rkn3t.blogspot.ae
@@ -744072,6 +744121,7 @@ dailynakedchicks.com
  dailynetwork.tumblr.com
  dailynetworks.com
  dailynewmedia.com
+dailynewmodels.tumblr.com
  dailynewsex.com
  dailynewsfeed.eu
  dailynewsmaxings.icu
@@ -748636,6 +748686,7 @@ danangclub88.com
  danangluxury.com
  danangxaydung.com
  dananightmare.tumblr.com
+danaplatompeg.blogspot.com
  danaplatonaked.blogspot.ae
  danaplatonaked.blogspot.al
  danaplatonaked.blogspot.am
@@ -758045,6 +758096,7 @@ date-cafe.de
  date-chat.net
  date-check.com
  date-crossdressers.com
+date-dick.blogspot.com
  date-exotic-strippers-strip-clubs-girls.com
  date-express.com
  date-in-click.com
@@ -758440,6 +758492,7 @@ dating-chat.nl
  dating-chubby-girls.tumblr.com
  dating-chubby.tumblr.com
  dating-devil.com
+dating-elite.blogspot.com
  dating-erotic-stories.imess.net
  dating-erotic-stories.undonet.com
  dating-extreem.nl
@@ -777085,6 +777138,7 @@ des-jeunes-salopes.com
  des-lesbiennes.com
  des-maries-a-croquer.imie-nantes.fr
  des-matures.com
+des-mots-en-equilibre.blogspot.com
  des-photos-gay.com
  des-photos-gratuites.com
  des-photos-sexe-gay.com
@@ -779208,6 +779262,7 @@ deshone768327.xyz
  deshpatro.com
  deshpatro.innkltd.com
  deshuipump.cn
+desi-815t.blogspot.com
  desi-amateurs.com
  desi-arab-scroll.tumblr.com
  desi-com.com
@@ -781860,6 +781915,7 @@ desireuse.free.fr
  desirewearlingerie.com
  desirewebcams.com
  desireworld.tumblr.com
+desirex7.blogspot.com
  desireyoumen.tumblr.com
  desiringarabs.tumblr.com
  desiringhands.com
@@ -799438,6 +799494,7 @@ dinahohl.tumblr.com
  dinakural.com
  dinald420.tumblr.com
  dinaloks.tumblr.com
+dinameyergallery.blogspot.com
  dinamicaclave3.webcindario.com
  dinamismogay.tumblr.com
  dinamita.com.ar
@@ -801497,6 +801554,7 @@ dirty-cummy-kisses.tumblr.com
  dirty-cumslut-exposed.tumblr.com
  dirty-cumwhore.tumblr.com
  dirty-curvy-n-horny.tumblr.com
+dirty-daddy-ashton.tumblr.com
  dirty-daddy-petite-daughter.tumblr.com
  dirty-daddygirl.tumblr.com
  dirty-dani.com
@@ -804331,6 +804389,7 @@ dirtygrannytube.com
  dirtygrass.tumblr.com
  dirtygurl78.tumblr.com
  dirtyguttermonkey79.tumblr.com
+dirtyguttersex.blogspot.com
  dirtyguyphonesex.com
  dirtyguypics.com
  dirtyguys.com
@@ -806043,6 +806102,7 @@ dirtyporn.blogspot.sk
  dirtyporn.blogspot.sn
  dirtyporn.blogspot.tw
  dirtyporn.blogspot.ug
+dirtyporn.cc
  dirtyporn.de
  dirtyporn.net
  dirtyporn.org
@@ -822881,6 +822941,7 @@ dontthinksohard.tumblr.com
  dontthinkstr8.tumblr.com
  donttouchmethereipoothere.tumblr.com
  donttouchmykeef.tumblr.com
+donttripas13.tumblr.com
  dontwakethekids.blogspot.ae
  dontwakethekids.blogspot.al
  dontwakethekids.blogspot.am
@@ -839579,6 +839640,7 @@ dungeonporn.com
  dungeons-and-dragons.com
  dungeonsex.com
  dungeonsexcams.com
+dungeonsexsblog.tumblr.com
  dungeonsexslaves.com
  dungeonsextoys.com
  dungeonsm.freeserve.co.uk
@@ -849784,6 +849846,7 @@ ebony1.com
  ebony1.nl
  ebony18.com
  ebony3x.com
+ebony46teen46slut.blogspot.com
  ebony4porn.com
  ebony4sex.com
  ebony4sex.tumblr.com
@@ -855757,6 +855820,7 @@ edwardreturns.tumblr.com
  edwardriche.ru
  edwardscissorhands420.tumblr.com
  edwardscontracting.co.uk
+edwardseternalkiss.blogspot.com
  edwardtec.tumblr.com
  edwardugel.com
  edware.tech
@@ -888538,6 +888602,7 @@ eros-escorts.co.uk
  eros-europe.com
  eros-expo.ru
  eros-factory.com
+eros-fantasy.blogspot.com
  eros-find.de
  eros-fire.over-blog.com
  eros-fucks-anteros.tumblr.com
@@ -889373,6 +889438,7 @@ erossiema.fortunecity.com
  erossimo.net
  erosskin.com
  erossprivategallery.tumblr.com
+erossquiver.tumblr.com
  erosstar.cz
  erosstar.de
  erosstation.com
@@ -895785,6 +895851,7 @@ eroticfairs.blogspot.tw
  eroticfairs.blogspot.ug
  eroticfandom.com
  eroticfandom.net
+eroticfanfic.tumblr.com
  eroticfanfiction.com
  eroticfantasia.com
  eroticfantasies-sexdreams.tumblr.com
@@ -896050,6 +896117,7 @@ eroticfuckwomanfreempegnudewank.blogspot.sk
  eroticfuckwomanfreempegnudewank.blogspot.sn
  eroticfuckwomanfreempegnudewank.blogspot.tw
  eroticfuckwomanfreempegnudewank.blogspot.ug
+eroticgal.blogspot.com
  eroticgallery.com
  eroticgallery.nl
  eroticgalleryscanner.blogspot.ae
@@ -896574,6 +896642,7 @@ eroticinblackwhite.blogspot.ug
  eroticinc.tumblr.com
  eroticindex.com
  eroticinducer.com
+eroticinenglish.blogspot.com
  eroticinfo.com
  eroticinformer.com
  eroticingermany.com
@@ -900186,6 +900255,7 @@ eroticvideo.cz
  eroticvideo.nu
  eroticvideo.se
  eroticvideo.spb.ru
+eroticvideobisexualsexp.blogspot.com
  eroticvideoblog.blogspot.ae
  eroticvideoblog.blogspot.al
  eroticvideoblog.blogspot.am
@@ -913696,6 +913766,7 @@ etalon.ir
  etalongay.com
  etalonjoe.canalblog.com
  etalonnympho29200.centerblog.net
+etampes.petitefee51.fr
  etandsexy.com
  etapeducul.com
  etapedusexe.com
@@ -918919,6 +918990,7 @@ evavesuve.over-blog.com
  evavirgin.com
  evavortex.com
  evavortex.tumblr.com
+evawecvishecasa.blogspot.com
  evazoekt.nl
  evblnd.blogspot.ae
  evblnd.blogspot.al
@@ -931508,6 +931580,7 @@ exquise.over-blog.com
  exquisemvinyl.free.fr
  exquisite-cougars.tumblr.com
  exquisite-domination.com
+exquisite-dyke-love.tumblr.com
  exquisite-manifesto.tumblr.com
  exquisite-porn.tumblr.com
  exquisite-twinks-deactivated201.tumblr.com
@@ -957076,6 +957149,7 @@ fckatranny.tumblr.com
  fckblog.tumblr.com
  fckboilove.tumblr.com
  fckbud.tumblr.com
+fckdfreak.blogspot.com
  fckedbytmblr.tumblr.com
  fckin-lesbianz.tumblr.com
  fckin2dabeat.tumblr.com
@@ -960573,6 +960647,7 @@ feliskedi.tumblr.com
  felisnox.com
  felissexxx.tumblr.com
  felitsatauekugeq.blogspot.com
+felitsiyaeupa.blogspot.com
  felix09719.tumblr.com
  felix1167.tumblr.com
  felix200us.tumblr.com
@@ -965647,6 +965722,7 @@ femdombooks.blogspot.sn
  femdombooks.blogspot.tw
  femdombooks.blogspot.ug
  femdomboom.com
+femdomboots.blogspot.com
  femdomboots.com
  femdombride.com
  femdombyphone.co.uk
@@ -974203,6 +974279,7 @@ fetish-wear.co.uk
  fetish-web.de
  fetish-webcams.com
  fetish-world.jp
+fetish-world.org
  fetish-world.tv
  fetish-x.info
  fetish-x.net
@@ -974498,6 +974575,7 @@ fetishbat.com
  fetishbattle.com
  fetishbazar.com
  fetishbazar.tumblr.com
+fetishbb.blogspot.com
  fetishbdsm.blogspot.ae
  fetishbdsm.blogspot.al
  fetishbdsm.blogspot.am
@@ -999330,6 +999408,7 @@ fontaine-de-jouvence.com
  fontanerianumar.com
  fontdrvhost.xyz
  fontelina.tumblr.com
+fontenay-le-comte.britmania.eu
  fontfontivantodorovlovefontfont.tumblr.com
  fontgmailu.temp.swtest.ru
  fonz1422.tumblr.com
@@ -1025291,6 +1025370,7 @@ free-porn-sex.miniville.fr
  free-porn-sex.net
  free-porn-sex.org
  free-porn-sex.us
+free-porn-sexy.blogspot.com
  free-porn-shop.com
  free-porn-show.com
  free-porn-signup.com
@@ -1031971,6 +1032051,7 @@ freeadultvideos.org
  freeadultvideos.reallifelog.com
  freeadultvivo.com
  freeadultvivos.com
+freeadultwankmovies.blogspot.com
  freeadultweb.com
  freeadultwebcam.com
  freeadultwebcam.net
@@ -1034350,6 +1034431,7 @@ freecam24.com
  freecam2cam.net
  freecam3x.com
  freecambay.com
+freecamboobs.blogspot.com
  freecamfinder.de
  freecamgirls.info
  freecamgirls247.com
@@ -1034440,6 +1034522,7 @@ freecamsex-x2.de
  freecamsex.co
  freecamsex.de
  freecamsexblog.com
+freecamsexindiaf.blogspot.com
  freecamsexlive.com
  freecamsexparty.com
  freecamsexposed.com
@@ -1035789,6 +1035872,7 @@ freeeadultchatroom.blogspot.sk
  freeeadultchatroom.blogspot.sn
  freeeadultchatroom.blogspot.tw
  freeeadultchatroom.blogspot.ug
+freeeatsfood.com
  freeebonyassporn.com
  freeebonyfuck.com
  freeebonyporn.net
@@ -1046160,6 +1046244,7 @@ freesex.bsd.st
  freesex.canalblog.com
  freesex.co.uk
  freesex.com
+freesex.com.ar
  freesex.com.au
  freesex.com.es
  freesex.com.mk
@@ -1046481,6 +1046566,7 @@ freesexcomics.com
  freesexcomics.net
  freesexcontact.nl
  freesexcontacts.com
+freesexcontactsid.blogspot.com
  freesexcontent.com
  freesexcontents.com
  freesexdata.com
@@ -1064008,6 +1064094,7 @@ fuckingpornstars.com
  fuckingporntube.com
  fuckingporntube.net
  fuckingpornvideos.com
+fuckingpornvideoswiqzr.blogspot.com
  fuckingpornworld.com
  fuckingpositivexd.tumblr.com
  fuckingpreggo.tumblr.com
@@ -1085303,6 +1085390,7 @@ garotasbundudas.blogspot.ug
  garotascentrooeste.com.br
  garotasdavan.com.br
  garotasdeprograma.com
+garotasdeprogramaemsp.blogspot.com
  garotasexpress.com.br
  garotasfloripa.net
  garotashot.blogspot.ae
@@ -1091008,6 +1091096,7 @@ gay-crime.com
  gay-cuck-sub.tumblr.com
  gay-cuckold-spain.tumblr.com
  gay-cuckold.tumblr.com
+gay-cucumbers.tumblr.com
  gay-cum-69.tumblr.com
  gay-cum-addiction.tumblr.com
  gay-cum-boy.tumblr.com
@@ -1097430,6 +1097519,7 @@ gay.org.uk
  gay.pagina.nu
  gay.pl
  gay.porno-inc.com
+gay.pornvids.fr
  gay.rencontresdansmaville.com
  gay.ru
  gay.sesso.free.fr
@@ -1118767,6 +1118857,7 @@ gaysmall.blogspot.sk
  gaysmall.blogspot.sn
  gaysmall.blogspot.tw
  gaysmall.blogspot.ug
+gaysmaster.blogspot.com
  gaysmax.com
  gaysmaximum.free.fr
  gaysmessenger.com
@@ -1130788,6 +1130879,7 @@ getthisriverflowing.tumblr.com
  gettiedandenjoy.tumblr.com
  gettikitunes.com
  gettily.com
+gettin-nasty.tumblr.com
  gettin-pussy-allday.tumblr.com
  gettin.net
  gettinbusy.tumblr.com
@@ -1141859,6 +1141951,7 @@ girls-porno.com
  girls-privat.de
  girls-privat.org
  girls-pubes.tumblr.com
+girls-pussy-cookie.blogspot.com
  girls-pussy-sex.com
  girls-pussy.com
  girls-pussy.net
@@ -1144764,6 +1144857,7 @@ girlslikegirls-thatsnothingnew.tumblr.com
  girlslikegirlsgetoverit.tumblr.com
  girlslikegjrls.tumblr.com
  girlslikeguns.tumblr.com
+girlslikepantyguys.blogspot.com
  girlslikepornalso.tumblr.com
  girlslikeporntoo.com
  girlslikesex2.tumblr.com
@@ -1147119,6 +1147213,7 @@ girlswatchingporno.tumblr.com
  girlswateringplants.tumblr.com
  girlsway.com
  girlsway.world
+girlswayfreshlesbiansex.blogspot.com
  girlswaynetwork.tumblr.com
  girlswearing.com
  girlsweb.co.uk
@@ -1148864,6 +1148959,7 @@ gixxer4682.tumblr.com
  gixxer82.tumblr.com
  gixxrboy750.tumblr.com
  gixydyx.co.cc
+giyar-iwlot-vidjo.blogspot.com
  giyktxgrrbqxnbmb-dot-millinium.ey.r.appspot.com
  giyzqnivwirwqwef-dot-millinium.ey.r.appspot.com
  giza88.com
@@ -1179959,6 +1180055,7 @@ guysandhomosexuals.tumblr.com
  guysandmom.com
  guysandpits.tumblr.com
  guysandpokemon.tumblr.com
+guysasleep.blogspot.com
  guysbikinibuyingguide.com
  guysboundandgagged.tumblr.com
  guysbuttsnmore.tumblr.com
@@ -1187694,6 +1187791,7 @@ hallofbabes.com
  hallofbeautyandsex.tumblr.com
  halloffameporn.com
  halloffamestars.com
+hallofgaytwinks.blogspot.com
  hallofnudes.tumblr.com
  hallofnylon.com
  hallofsextoys.com
@@ -1203768,6 +1203866,7 @@ hckqpguxsnmxxhvjnmfm.top
  hckrmytest.com
  hckymn33.tumblr.com
  hclips.com
+hclips.me
  hclips.net
  hcm.vietbaonam.com
  hcmbybhihbuchw.serveirc.com
@@ -1206606,6 +1206705,7 @@ heather-graham-nude.blogspot.sn
  heather-graham-nude.blogspot.tw
  heather-graham-nude.blogspot.ug
  heather-lee.com
+heather-mill.blogspot.com
  heather-nifty-mimosa.glitch.me
  heather-vandeven-hd720.tumblr.com
  heather.christensen.free.fr
@@ -1214719,6 +1214819,7 @@ hentaicd.prv.pl
  hentaicelebrities.com
  hentaicenter.de
  hentaicenter.tumblr.com
+hentaicentral1.blogspot.com
  hentaichamber.com
  hentaichannel.com
  hentaichef.com
@@ -1231681,6 +1231782,7 @@ hodrnwhdobfylvwj-dot-millinium.ey.r.appspot.com
  hodsex.com
  hoe-lee-fuc.tumblr.com
  hoe-lyjay.tumblr.com
+hoe-playground.tumblr.com
  hoe.com
  hoebags.com
  hoebetaalikmijnstudie.nl
@@ -1237129,6 +1237231,7 @@ homemgozando.com
  homemodels.canalblog.com
  homemoviepornamateurdownloadfreesamplefqq3.aceblog.fr
  homemoviesadult.com
+homemoviestube.cc
  homemoviestube.com
  homempelado.net
  homempraelaepraele.blogspot.ae
@@ -1275888,6 +1275991,7 @@ hoterotica.net
  hoterotica7.com
  hoteroticart.com
  hoteroticbabes.tumblr.com
+hoteroticcomics.blogspot.com
  hoteroticfantasies.tumblr.com
  hoteroticnudes.com
  hoteroticpussy.com
@@ -1281794,6 +1281898,7 @@ hotmilfbitch.com
  hotmilfcity.tumblr.com
  hotmilfclips.com
  hotmilfclub.com
+hotmilfhardcord.blogspot.com
  hotmilfhunter.com
  hotmilflyndsey.tumblr.com
  hotmilfmature.com
@@ -1298259,6 +1298364,7 @@ hpic.com
  hpiciyejkvmgvixh-dot-millinium.ey.r.appspot.com
  hpics.net
  hpindl.com
+hpivys.blogspot.com
  hpjabgwlityokwfm-dot-millinium.ey.r.appspot.com
  hpjav.tv
  hpjumemmvisykcwo-dot-millinium.ey.r.appspot.com
@@ -1299060,6 +1299166,7 @@ hqporner.net
  hqpornerx.com
  hqpornfilms.com
  hqpornfinder.com
+hqpornflicks.com
  hqpornforum.com
  hqporngalleries.com
  hqporngallery.com
@@ -1303126,6 +1303233,7 @@ humoui.com
  humour-and-wallpapers.com
  humour-blague.com
  humour-blague.net
+humour-jardin-blonde.blogspot.com
  humour-sexe.be
  humour-sexe.greatestjournal.com
  humour-sexe.perfecturl.com
@@ -1303823,6 +1303931,7 @@ hungturk.tumblr.com
  hungtxdudensf.tumblr.com
  hunguncutcumslut.tumblr.com
  hungupnow.tumblr.com
+hunguponfashion.blogspot.com
  hungwell845.tumblr.com
  hungyoungfun.tumblr.com
  hungyounggay.tumblr.com
@@ -1316338,6 +1316447,7 @@ iliketubes.com
  ilikeuontop.tumblr.com
  ilikewatchingporn.com
  ilikewhatilike-gaysexxx.tumblr.com
+ilikewomenpics.blogspot.com
  ilikewomensomuch.tumblr.com
  ilikeyoourdick.tumblr.com
  ilikeyoungboys.com
@@ -1323112,6 +1323222,7 @@ imthatgirlnikki.tumblr.com
  imthatgirlwhowillruinyourlife.tumblr.com
  imthatonefangirlmikay.tumblr.com
  imthatsexyguy2.tumblr.com
+imtheasssniffer.tumblr.com
  imthebestpussyeater.tumblr.com
  imthecaptain63.tumblr.com
  imthedaddyyouremyprincess.tumblr.com
@@ -1326709,6 +1326820,7 @@ indianbooty.com
  indianbootyhunters.com
  indianbuttmagic.com
  indiancallcentreescorts.com
+indiancallgirlz.blogspot.com
  indianceleb.com
  indiancelebrity.biz
  indiancelebstars.com
@@ -1337287,6 +1337399,7 @@ internationalsexmovies.com
  internationalsexperience.tumblr.com
  internationalsextoys.com
  internationalshemales.com
+internationalsissyboy.blogspot.com
  internationalstemcellcenter.com
  internationalwanker.com
  internationalyouthplatform.org
@@ -1338093,6 +1338206,7 @@ interracial-cuckold-sex.blogspot.tw
  interracial-cuckold-sex.blogspot.ug
  interracial-cuckold.biz
  interracial-cuckolds.org
+interracial-cumshot.blogspot.com
  interracial-cumshots.blogspot.ae
  interracial-cumshots.blogspot.al
  interracial-cumshots.blogspot.am
@@ -1360110,6 +1360224,7 @@ japanese-lesbian-porn25.blogspot.sn
  japanese-lesbian-porn25.blogspot.tw
  japanese-lesbian-porn25.blogspot.ug
  japanese-lesbians-sex.xprv.com
+japanese-lesbians.blogspot.com
  japanese-lips-marketa-brymova-tee.blogspot.ae
  japanese-lips-marketa-brymova-tee.blogspot.al
  japanese-lips-marketa-brymova-tee.blogspot.am
@@ -1368475,6 +1368590,7 @@ jen2love.tumblr.com
  jen2max.tumblr.com
  jen8678.tumblr.com
  jena-kay-ricci.com
+jena-malone.blogspot.com
  jenabush.com
  jenajameson.com
  jenajamesonpictures.imedia.nu
@@ -1392686,6 +1392802,7 @@ juliarobinson2856.blogspot.sk
  juliarobinson2856.blogspot.sn
  juliarobinson2856.blogspot.tw
  juliarobinson2856.blogspot.ug
+juliarobinson6038.blogspot.com
  julias-eroticoase.de
  juliaschultz.net
  juliasex.com
@@ -1392698,6 +1392815,7 @@ juliasupermodel.com
  juliatube.com
  juliawantsu.com
  juliax.over-blog.com
+juliaxjuju.blogspot.com
  julie-amatrice-sexe.com
  julie-andrew.blogspot.ae
  julie-andrew.blogspot.al
@@ -1413086,6 +1413204,7 @@ kenpell-tech.net
  kenryker.com
  kensabo.com
  kensgoldclub.com
+kenshindork.tumblr.com
  kensingtonfantasies.com
  kensingtonhotelsuites.com
  kensonsitepcrepair.com
@@ -1430256,6 +1430375,7 @@ konashion.blogspot.sn
  konashion.blogspot.tw
  konashion.blogspot.ug
  konasutra.com
+konata007.blogspot.com
  konawekepulauankab.id
  konbeg.blogspot.ae
  konbeg.blogspot.al
@@ -1435936,6 +1436056,7 @@ kusadam.com
  kusaifetish.tumblr.com
  kusaribe.tumblr.com
  kuschelgirl.de
+kuschelndefinition.blogspot.com
  kushaalgroup.com
  kushandkink.tumblr.com
  kushiro-neko.tumblr.com
@@ -1447039,6 +1447160,7 @@ lanasfantasies.com
  lanaslingerietease.com
  lanaspoppingpussy.tumblr.com
  lanaspornworld.com
+lanastripper.blogspot.com
  lanaviolethdvideos.tumblr.com
  lanavip.com
  lanawoods.tumblr.com
@@ -1449082,6 +1449204,7 @@ larusakademi.com
  larutadelsexo.webcindario.com
  larutamilenariadelatun.com
  larve.unblog.fr
+laryflint.blogspot.com
  larypics.com
  larzoulu.tumblr.com
  larzy36.tumblr.com
@@ -1470789,6 +1470912,7 @@ lesbian-tgp-128.blogspot.sk
  lesbian-tgp-128.blogspot.sn
  lesbian-tgp-128.blogspot.tw
  lesbian-tgp-128.blogspot.ug
+lesbian-tgp-pics1324.blogspot.com
  lesbian-tgp-pics1704.blogspot.ae
  lesbian-tgp-pics1704.blogspot.al
  lesbian-tgp-pics1704.blogspot.am
@@ -1474731,6 +1474855,7 @@ lesbiansatan.tumblr.com
  lesbiansatworktgp.com
  lesbiansblack.org
  lesbiansbordello.tumblr.com
+lesbiansca.tumblr.com
  lesbianscams.com
  lesbianscatgirls.net
  lesbianscatporn.org
@@ -1475813,6 +1475938,7 @@ lesbiansx.blogspot.tw
  lesbiansx.blogspot.ug
  lesbiansxxx.com
  lesbianszone.com
+lesbiantales.tumblr.com
  lesbiantalking.tumblr.com
  lesbianteen.net
  lesbianteencams.com
@@ -1481009,6 +1481135,7 @@ letsmeetforsex.com
  letsmeetup.com
  letsmg69.tumblr.com
  letsmilfstuff.tumblr.com
+letsmobileadultcamshows.tumblr.com
  letsmotiv.fr
  letsorgypornmind.tumblr.com
  letspagecom.chifanbob.top
@@ -1485416,6 +1485543,7 @@ lickmylegs.com
  lickmylilly.tumblr.com
  lickmylittleclit.tumblr.com
  lickmylovecrack.tumblr.com
+lickmypinkpussy.blogspot.com
  lickmyporn.com
  lickmypussyass.tumblr.com
  lickmypussyassplease.tumblr.com
@@ -1500798,6 +1500926,7 @@ live-webcam-sex.org
  live-webcam-sex.startje.com
  live-webcam-sex.startspin.nl
  live-webcam-sex.startspot.nl
+live-webcam-show.blogspot.com
  live-webcam.at
  live-webcam.com
  live-webcam.nl
@@ -1522918,6 +1523047,7 @@ loveislovegayok.tumblr.com
  loveisobedience-blog.tumblr.com
  loveisobedience.tumblr.com
  loveissex.com
+loveisstrangemovie.tumblr.com
  loveisthekey-tohappiness.tumblr.com
  loveisvulnerability.tumblr.com
  loveit-or-leaveit.com
@@ -1523192,6 +1523322,7 @@ lovely-inspiring.tumblr.com
  lovely-julia.com
  lovely-kink.tumblr.com
  lovely-ladies.de
+lovely-ladybastards.blogspot.com
  lovely-lesbian-love.tumblr.com
  lovely-lesbian-lovers.tumblr.com
  lovely-lily.net
@@ -1530591,6 +1530722,7 @@ lustmadeofvelvetskin.tumblr.com
  lustmagazine.nl
  lustmap.ch
  lustmassagen.de
+lustmassageparis.blogspot.com
  lustmaus.de
  lustmen.blogspot.ae
  lustmen.blogspot.al
@@ -1537734,6 +1537866,7 @@ madisonscotttube.com
  madisonsdirtysecrets.com
  madisonstjames.tumblr.com
  madisonsummers.com
+madisontvslut.tumblr.com
  madisonx.centerblog.net
  madisson.com
  madivarealty.com
@@ -1541237,6 +1541370,7 @@ magneticcom.nckibaseball.gdn
  magneticgirl-aroundtheworld.tumblr.com
  magneticimages.com
  magneting.cn
+magnetpip.com
  magnetporn.com
  magnetts.tumblr.com
  magnetworth.ch
@@ -1547895,6 +1548029,7 @@ malegspotexplorer.tumblr.com
  malehairylegsaresexy.tumblr.com
  malehardcock.tumblr.com
  malehardcocks.com
+malehardcoreporn.blogspot.com
  malehardlabour.tumblr.com
  malehastity.tumblr.com
  malehaven.com
@@ -1556436,6 +1556571,7 @@ margot-worldwide-escort.com
  margotinette.canalblog.com
  margotloveus.tumblr.com
  margottepsychotherapy.com
+margretloveday62-blog.tumblr.com
  margritje.canalblog.com
  marguerite586456.xyz
  marguspam.ddns.net
@@ -1561527,6 +1561663,7 @@ marta1mk.tumblr.com
  martababe.com
  martabombasexy.org
  martacumshard.tumblr.com
+martadrisingsun.blogspot.com
  martafriends.tumblr.com
  martahot.com
  martasdesk.com
@@ -1569610,6 +1569747,7 @@ mattsmyname89.tumblr.com
  mattsporn.com
  mattspornpics.com
  mattspussyblog.tumblr.com
+mattssmutshack.blogspot.com
  mattstaples.co.uk
  mattsterling.tv
  mattstevensmuscle.com
@@ -1571060,6 +1571198,7 @@ mature-lingerie-zav.blogspot.sk
  mature-lingerie-zav.blogspot.sn
  mature-lingerie-zav.blogspot.tw
  mature-lingerie-zav.blogspot.ug
+mature-lingerie.blogspot.com
  mature-lingerie.com
  mature-live-sex.com
  mature-looking4sex.tumblr.com
@@ -1577164,6 +1577303,7 @@ maturetwat.blogspot.tw
  maturetwat.blogspot.ug
  maturetybe.com
  matureu.com
+matureugasianugmilf.blogspot.com
  matureukmovies.com
  matureukpics.com
  matureukporn.com
@@ -1577349,6 +1577489,7 @@ maturewomenlive.com
  maturewomenlover79.tumblr.com
  maturewomennaked.com
  maturewomennude.com
+maturewomennudepics.com
  maturewomenonly.com
  maturewomenover40sexyolderladiesthumbs.com
  maturewomenpee.tumblr.com
@@ -1578541,6 +1578682,7 @@ max-thicke6969.tumblr.com
  max-vicious.tumblr.com
  max-video.nl
  max-videos.com
+max-vos.blogspot.com
  max-www.com
  max-x-porn.com
  max-xxx-pictures.xxxlivevideos.com
@@ -1591713,6 +1591855,7 @@ menaddiction.blogspot.sk
  menaddiction.blogspot.sn
  menaddiction.blogspot.tw
  menaddiction.blogspot.ug
+menadult.co
  menage-a-trois-sexe.com
  menageablog.blogspot.ae
  menageablog.blogspot.al
@@ -1600260,6 +1600403,7 @@ miakhalifafuck.tumblr.com
  miakhalifafucks.com
  miakhalifagirl.tumblr.com
  miakhalifagoddess.tumblr.com
+miakhalifanews.tumblr.com
  miakhalifaphotos.net
  miakhalifaporn.org
  miakimmy.com
@@ -1603836,6 +1603980,7 @@ miguelseychelles.com
  migueluchiha123423.tumblr.com
  miguerotic.tumblr.com
  mihaicta7701.tumblr.com
+mihaileremin3.blogspot.com
  mihanpajooh.com
  miharu23.tumblr.com
  mihiller62.tumblr.com
@@ -1630444,6 +1630589,7 @@ modestclouds.eu
  modestimboynati.xyz
  modestly-sexy.tumblr.com
  modestmanagement.com
+modesto-adult.blogspot.com
  modestworld.top
  modestyablaze.com
  modesuites.com
@@ -1634716,6 +1634862,7 @@ monabecedaire.blogspot.tw
  monabecedaire.blogspot.ug
  monabhabhi.com
  monablu.com
+monabricot-com-blog.tumblr.com
  monabricot-com.tumblr.com
  monabricot.blogspot.ae
  monabricot.blogspot.al
@@ -1643766,6 +1643913,7 @@ mothersontaboo.com
  mothersonvid.com
  mothersonvideos.com
  mothersonwincest.tumblr.com
+motherspanties-n-pussy.tumblr.com
  motherssextoys.com
  motherstaboo.com
  motherstits.com
@@ -1653194,6 +1653342,7 @@ mugiwara-jm.tumblr.com
  mugiya-pan.com
  mugol3123.tumblr.com
  mugpz.rogagot.com
+mugrbonita.blogspot.com
  mugshots.org
  mugsplace.com
  mugsyberger.com
@@ -1655977,6 +1656126,7 @@ mundosexy.com
  mundosexy.metropoli2000.com
  mundosexy.metropoliglobal.com
  mundoswinger.com
+mundoswtachira.blogspot.com
  mundotabs.com
  mundotetas.com
  mundotransexual.com
@@ -1671930,6 +1672080,7 @@ mymetanetchcf1a1dffdomain.no-k.fr
  mymgest.cl
  mymijnweb.com
  mymikesapartment.com
+mymilf-friend.blogspot.com
  mymilf.tumblr.com
  mymilfboobs.com
  mymilfboss.com
@@ -1675534,6 +1675685,7 @@ mysextv.tv
  mysexualadventures.com
  mysexualadventures.tumblr.com
  mysexualappetite.com
+mysexualautobiography.blogspot.com
  mysexualawakening22.tumblr.com
  mysexualbliss.com
  mysexualcorner.tumblr.com
@@ -1676225,6 +1676377,7 @@ mysexysites.com
  mysexysites.net
  mysexyslut.tumblr.com
  mysexyslutandme.tumblr.com
+mysexyspot.blogspot.com
  mysexystar.com
  mysexystash.tumblr.com
  mysexystore.de
@@ -1700292,6 +1700445,7 @@ naughtynatali.tumblr.com
  naughtynatalie.com
  naughtynati.com
  naughtynatiporn.com
+naughtynaughtyclaire.blogspot.com
  naughtynaughtygiffys.tumblr.com
  naughtynaughtyxxx.tumblr.com
  naughtyneighborblog.com
@@ -1701516,6 +1701670,7 @@ naughtysextalent.com
  naughtysextoys.com
  naughtysextoys.net
  naughtysextoyz.com
+naughtysexts.tumblr.com
  naughtysextube.com
  naughtysexualdesires.com
  naughtysexualstuff.tumblr.com
@@ -1714965,6 +1715120,7 @@ neymars-taco.tumblr.com
  neyosoul.tumblr.com
  neyrot.com
  nezanahuo.bestserviceo.su
+nezmouilles.be
  neznani2013.tumblr.com
  nezsmmjynxyunjxazu.top
  nezumi.float-zone.com
@@ -1728866,6 +1729022,7 @@ nopornhub.com
  nopornjustpretty.tumblr.com
  nopornlolitas.com
  nopornnoless.tumblr.com
+nopornnolifebisex.blogspot.com
  nopornnorthampton.org
  noporno.com
  noporno.home.pages.de
@@ -1738628,6 +1738785,7 @@ nude-sex-porn-pictures.com
  nude-sex-porn-porno.com
  nude-sex-porn.com
  nude-sex-pussy.com
+nude-sex-shows.blogspot.com
  nude-sex-spycam.tripod.com
  nude-sex-teen.com
  nude-sex-video.com
@@ -1741625,6 +1741783,7 @@ nudeczechcasting.net
  nudedaddy.tumblr.com
  nudedadus.tumblr.com
  nudedailyporn.com
+nudedailyrt.blogspot.com
  nudedancecoll.tumblr.com
  nudedancers.blogspot.ae
  nudedancers.blogspot.al
@@ -1767253,6 +1767412,7 @@ one-nipple-slut.tumblr.com
  one-of-a-kind-milf.tumblr.com
  one-of-them-sex-blogs.tumblr.com
  one-piece-differenc.000webhostapp.com
+one-piece-hentai-cod-blog.tumblr.com
  one-piece-swimsuit-girls-pics.tumblr.com
  one-pixel.studio
  one-porn.com
@@ -1768040,6 +1768200,7 @@ oneinabillion.co.uk
  oneinamelonlord.tumblr.com
  oneinsix.com
  oneisone-cert.weebly.com
+onejapanese.com
  onejav.com
  onejmd.com
  onekinkycouple.tumblr.com
@@ -1772527,6 +1772688,7 @@ onlydaddycan.tumblr.com
  onlydaddysbabygirl.tumblr.com
  onlydeepstuff.tumblr.com
  onlydeepthroats.tumblr.com
+onlydesivideos.com
  onlydickgirls.tumblr.com
  onlydickss.tumblr.com
  onlydickstuff.tumblr.com
@@ -1805752,6 +1805914,7 @@ partyslutlexi.tumblr.com
  partyslutplaytime.tumblr.com
  partysluts.dr.ag
  partysluts.tumblr.com
+partyslutteengirlfuckinghardcore.blogspot.com
  partysmokefuckr.tumblr.com
  partystrippers.com
  partyswingersex.com
@@ -1853827,6 +1853990,7 @@ playboy-bunny-tattoos.blogspot.ug
  playboy-centerfold.tumblr.com
  playboy-centerfolds.tumblr.com
  playboy-central-blog.tumblr.com
+playboy-collections.blogspot.com
  playboy-content-x.com
  playboy-cybergirls.com
  playboy-cybergirls.de
@@ -1860728,6 +1860892,7 @@ poisonedapplestories.com
  poisonedtemptations.tumblr.com
  poisonhost.nl
  poisonleg.com
+poisonousladycatty.blogspot.com
  poisonpetals.tumblr.com
  poisonpiquillok.com
  poisonsex.de
@@ -1864605,6 +1864770,7 @@ pormo.com
  pormowix.com
  pormstar.com
  pormugwnqaodybf.top
+porn
  porn-------photos.com
  porn------videos.com
  porn----gifs.tumblr.com
@@ -1894393,6 +1894559,7 @@ pornhardporn.com
  pornhardtube.com
  pornhardx.com
  pornharem.com
+pornharlot.net
  pornharlots.com
  pornharmony.com
  pornharry.com
@@ -1897882,6 +1898049,7 @@ pornmaze.tumblr.com
  pornmazine.com
  pornmb.com
  pornmc.com
+pornmd.biz
  pornmd.com
  pornmd.com.br
  pornmd.net
@@ -1918542,6 +1918710,7 @@ pornostar.virtuale.org
  pornostar.webgidsje.nl
  pornostar.xt5.de
  pornostar.zeitungskonzerne.com
+pornostar123fuckyou.tumblr.com
  pornostar2000.com
  pornostararchiv.de
  pornostarblog.net
@@ -1920057,6 +1920226,7 @@ pornotransexual.com.ar
  pornotransexuales.com
  pornotransexuel.com
  pornotransexuelle.com
+pornotransexuels.blogspot.com
  pornotransexxx.com
  pornotransgratis.net
  pornotransov.net
@@ -1932730,6 +1932900,7 @@ porntuba.ru
  porntube-amateur.eu
  porntube-best.com
  porntube-channel.com
+porntube-video.blogspot.com
  porntube-vip.com
  porntube-x.org
  porntube.100sextube.com
@@ -1934225,6 +1934396,7 @@ pornvideosforyou.blogspot.sn
  pornvideosforyou.blogspot.tw
  pornvideosforyou.blogspot.ug
  pornvideosfreedownloads.com
+pornvideosfuck.com
  pornvideosgifs.tumblr.com
  pornvideosgo.com
  pornvideosgonzo.com
@@ -1945791,6 +1945963,7 @@ prettyinpissedpanties.tumblr.com
  prettyinporn.com
  prettyjapanesexxx.com
  prettykakes.tumblr.com
+prettykatesurprise.blogspot.com
  prettykatsandtats.tumblr.com
  prettykikimora.tumblr.com
  prettykinkythings.tumblr.com
@@ -1977978,6 +1978151,7 @@ qukuaixuexi.com
  qukueevyhvqfgzvc-dot-millinium.ey.r.appspot.com
  qukxvqaupruiuyin-dot-millinium.ey.r.appspot.com
  qukz.000webhostapp.com
+qulibnay-vaginalcumshots.blogspot.com
  qulibnay-vaginalcumshotsashley.blogspot.ae
  qulibnay-vaginalcumshotsashley.blogspot.al
  qulibnay-vaginalcumshotsashley.blogspot.am
@@ -1994709,6 +1994883,7 @@ really-gay-yiff.tumblr.com
  really-good-porn.com
  really-horny-teens.tumblr.com
  really-nasty-pussy.tumblr.com
+really-ravishing.blogspot.com
  really-sex.com
  really-sexy.com
  really102.tumblr.com
@@ -2011410,6 +2011585,7 @@ retroporntv.com
  retropornvideo.com
  retropornvideos.com
  retropornvintage.com
+retropornxxx.com
  retropornz.com
  retropussy.tumblr.com
  retroraunch.com
@@ -2014239,6 +2014415,7 @@ richardlee0925.tumblr.com
  richardlicher.tumblr.com
  richardmann.tumblr.com
  richardmannscrib.com
+richardmannsworld.blogspot.com
  richardmasson.tumblr.com
  richardnailder.com
  richardnixxxon.tumblr.com
@@ -2017269,6 +2017446,7 @@ risette-translations.blogspot.ug
  riseupnext-appleid.servecounterstrike.com
  riseupnow.ch
  risex.de
+risexdatingsite.blogspot.com
  rishi99.com
  rishishwarfoundation.com
  rishishwarfoundation.org
@@ -2020742,6 +2020920,7 @@ rogene.tk
  roger-18.000webhostapp.com
  roger-communicationhelp.com
  rogercahill.com
+rogercarpenter.blogspot.com
  rogerceleb.com
  rogercorp.org
  rogerdirty.hpg.ig.com.br
@@ -2026666,6 +2026845,7 @@ rowanwoodsmut.tumblr.com
  rowashinh.com
  rowcock.tumblr.com
  rowdyburns235.tumblr.com
+rowdyrisasrodeo.blogspot.com
  rowena-bdsm-haarlem.nl
  rowena-bdsm.startbewijs.nl
  rowenasexfilms.nl
@@ -2027208,6 +2027388,7 @@ royalporntube.com
  royalpostcards.be
  royalqueennyc.com
  royalrussia.org
+royalseat.blogspot.com
  royalsecurityinc.com
  royalservice-eg.com
  royalsex.cjb.net
@@ -2052836,6 +2053017,7 @@ scat-mpeg-movies7427.blogspot.tw
  scat-mpeg-movies7427.blogspot.ug
  scat-mpegs.com
  scat-oasis.net
+scat-pee4381.blogspot.com
  scat-piss-free.com
  scat-play.com
  scat-porn-tube.com
@@ -2056198,6 +2056380,7 @@ schssluts.blogspot.sk
  schssluts.blogspot.sn
  schssluts.blogspot.tw
  schssluts.blogspot.ug
+schubbydms.blogspot.com
  schuelerda.hypermart.net
  schuelerinnensex.de
  schuhe-und-mehr.de
@@ -2062669,6 +2062852,7 @@ secretslutnextdoor.tumblr.com
  secretsluts.com
  secretslutwife.com
  secretslutwife.tumblr.com
+secretsmith33365.blogspot.com
  secretsofablackslut.tumblr.com
  secretsofacamboy.tumblr.com
  secretsofadirtygirl.blogspot.ae
@@ -2078310,6 +2078494,7 @@ sewlouhadaklghayeb.info
  sewmbyifazzmynrelsdkupliuvbofqnqykai-dot-cedar-code-289917.nn.r.appspot.com
  sewstereo.com
  sewumcbcrao.top
+sex
  sex-------photos.com
  sex---ads.tumblr.com
  sex---bilder.de
@@ -2079389,6 +2079574,7 @@ sex-an-den-geilsten-orten.de
  sex-an.com
  sex-anaal-neuken.startspot.nl
  sex-anaal.startspot.nl
+sex-anal-b1.blogspot.com
  sex-anal-dk.com
  sex-anal-gratuit.com
  sex-anal-oral.com
@@ -2112006,6 +2112192,7 @@ sexe-video-photo.net
  sexe-video-porno-france.com
  sexe-video-porno.com
  sexe-video-porno.net
+sexe-video-salope.blogspot.com
  sexe-video-salope.fr
  sexe-video-sexe.com
  sexe-video-sexe.fr
@@ -2120144,6 +2120331,7 @@ sexgidsnederland.nl
  sexgierig-1.de
  sexgierig.com
  sexgierig.nl
+sexgierki.blogspot.com
  sexgierki.pl
  sexgif-net.tumblr.com
  sexgif.com
@@ -2127631,6 +2127819,7 @@ sexleaders.nl
  sexleague.com
  sexleak.com
  sexleather.nl
+sexlebrity.blogspot.com
  sexlect.com
  sexlection.com
  sexlectric.com
@@ -2141220,6 +2141409,7 @@ sexparks.com
  sexparlor.com
  sexparlors.com
  sexparties-uncovered.com
+sexparties.co
  sexparties.de
  sexparties69.tumblr.com
  sexpartiesuk.co.uk
@@ -2159035,6 +2159225,7 @@ sexualrampage.com
  sexualrapportmodeling.com
  sexualrapture.tumblr.com
  sexualreading.com
+sexualrealities.blogspot.com
  sexualreality.com
  sexualreawakening.com
  sexualreblogger.tumblr.com
@@ -2159215,6 +2159406,7 @@ sexualsideofme.tumblr.com
  sexualsideshow.com
  sexualsins.com
  sexualsissysatinsensation.tumblr.com
+sexualsite1.blogspot.com
  sexualskin.com
  sexualslave.net
  sexualslave4blkcock.tumblr.com
@@ -2162113,6 +2162305,7 @@ sexwithmature.net
  sexwithme.com
  sexwithme.net
  sexwithme141.tumblr.com
+sexwithme99.blogspot.com
  sexwithmebitch.tumblr.com
  sexwithmegan.com
  sexwithmeinparadise.tumblr.com
@@ -2164181,6 +2164374,7 @@ sexxxhost.com
  sexxxhosting.com
  sexxxhosting.com.com
  sexxxhosts.com
+sexxxhot999.blogspot.com
  sexxxhounds.com
  sexxxhouse.de
  sexxxhouse.net
@@ -2169710,6 +2169904,7 @@ sexy-fetish-pics.com
  sexy-fetish.com
  sexy-fetishiste-femme.kekette.com
  sexy-fickspiele.de
+sexy-figures.tumblr.com
  sexy-files.com
  sexy-files.net
  sexy-filipinas.com
@@ -2189705,6 +2189900,7 @@ sexydreams.nl
  sexydreams.ru
  sexydreams.tumblr.com
  sexydreams3d.com
+sexydreamserotic.blogspot.com
  sexydreamshop.com
  sexydreamstudent.tumblr.com
  sexydress00012.canalblog.com
@@ -2222381,6 +2222577,7 @@ sfshfkfaf.co.vu
  sfsurflessons.com
  sftbe-bnc.firebaseapp.com
  sftereza.ro
+sftermsthslfres.blogspot.com
  sftonsil.com
  sftp.usin.com
  sftx512.tumblr.com
@@ -2243181,6 +2243378,7 @@ silverpornblogs.com
  silverpornmovie.com
  silverporno.com
  silverporntube.com
+silverrose69.tumblr.com
  silverroyce.tumblr.com
  silversilence1.tumblr.com
  silversinema.com
@@ -2274527,6 +2274725,7 @@ sneezefaceless.ch
  sneezefetishforum.org
  sneezwort.libsyn.com
  sneezy-position.000webhostapp.com
+sneferus.blogspot.com
  snehaescorts.com
  snehafafat.com
  snehbandhsohar.org
@@ -2287359,6 +2287558,7 @@ southland-ryder.tumblr.com
  southlanddental.com.au
  southlandinternet.com
  southlondonescorts.com
+southmallu.blogspot.com
  southmasalablog.blogspot.ae
  southmasalablog.blogspot.al
  southmasalablog.blogspot.am
@@ -2333482,6 +2333682,7 @@ super-sexy-high-heels.com
  super-sexy-tanlines.tumblr.com
  super-sexy.de
  super-shemale.narod.ru
+super-shogun.blogspot.com
  super-sites.com
  super-sites.net
  super-size-babes.tumblr.com
@@ -2334833,6 +2335034,7 @@ superfag226.tumblr.com
  superfakestars.tumblr.com
  superfamosas.com
  superfantasies.com
+superfantastictrannyblog.blogspot.com
  superfapper.com
  superfashiongirl.com
  superfastspeedno1.top
@@ -2340754,6 +2340956,7 @@ swallowgaycum.blogspot.sk
  swallowgaycum.blogspot.sn
  swallowgaycum.blogspot.tw
  swallowgaycum.blogspot.ug
+swallowing-cock.blogspot.com
  swallowing-cum.net
  swallowingslut.tumblr.com
  swallowingsluts.com
@@ -2373572,6 +2373775,7 @@ teenhqsex.com
  teenhub.mobi
  teenhub.pw
  teenhub.tumblr.com
+teenhubss.blogspot.com
  teenhubxxx.com
  teenhucow.tumblr.com
  teenhunny.com
@@ -2383258,6 +2383462,7 @@ telecharger-films-gratuit.com
  telecharger-films-porno.com
  telecharger-gay.com
  telecharger-hentai.com
+telecharger-jeu-pc-adulte.blogspot.com
  telecharger-jeux.org
  telecharger-porno-gratuit.com
  telecharger-porno-video.com
@@ -2394514,6 +2394719,7 @@ thatbluesblog.blogspot.ug
  thatboieli.tumblr.com
  thatboyismine.com
  thatboysass.tumblr.com
+thatbrightboy.tumblr.com
  thatcarolinadarlin.tumblr.com
  thatcelebrity.eu
  thatcheatingbitch.tumblr.com
@@ -2400309,6 +2400515,7 @@ theaestheticengineer.tumblr.com
  theaffairposts.tumblr.com
  theaffiliateincome.com
  theafricanchild.tumblr.com
+theafrozenofgardening.blogspot.com
  theagencyinc.com
  theaggressivefemale-deactivated.tumblr.com
  theagressivefangirl.tumblr.com
@@ -2431896,6 +2432103,7 @@ thoko.co.ke
  thokomo.com
  tholle.co.za
  tholouniturcure.info
+tholrturboe.blogspot.com
  thoma-andreas.de
  thomas-berlin.tumblr.com
  thomas-hospital.de
@@ -2462554,6 +2462762,7 @@ tranny-magazine.blogspot.ug
  tranny-masters.com
  tranny-movies1.com
  tranny-ocean.com
+tranny-orgies.blogspot.com
  tranny-orgies.com
  tranny-paradise.blogspot.ae
  tranny-paradise.blogspot.al
@@ -2471186,6 +2471395,7 @@ travesti.canalblog.com
  travesti.tv
  travestidelyon.centerblog.net
  travestie-belle-bite.allmyblog.com
+travestie-sex.blogspot.com
  travestie-sexe.blogspot.ae
  travestie-sexe.blogspot.al
  travestie-sexe.blogspot.am
@@ -2488699,6 +2488909,7 @@ twinkxxxguys.blogspot.sn
  twinkxxxguys.blogspot.tw
  twinkxxxguys.blogspot.ug
  twinkxxxporn.com
+twinkybf.com
  twinkyboy.net
  twinkycockboi69.tumblr.com
  twinkyfeet.com
@@ -2495926,6 +2496137,7 @@ ultrafaghole.tumblr.com
  ultrafamilynet.augerqisafety.top
  ultrafappers.com
  ultrafarmsex.com
+ultrafbtfetish.tumblr.com
  ultrafeel.tv
  ultrafellation.com
  ultrafetishphotos.tumblr.com
@@ -2503072,6 +2503284,7 @@ unrulydude.tumblr.com
  unsac.000webhostapp.com
  unsafe-paypal.com
  unsafe-sex.tumblr.com
+unsafechoot.blogspot.com
  unsafesex.com
  unsatable-plugs.000webhostapp.com
  unsatablesatyr.tumblr.com
@@ -2505337,6 +2505550,7 @@ upshortsbabes4.tumblr.com
  upshortskirts.com
  upsidedown360.tumblr.com
  upsiswet.tumblr.com
+upskirt-amateurs.blogspot.com
  upskirt-and-pantie-voyeur.blogspot.ae
  upskirt-and-pantie-voyeur.blogspot.al
  upskirt-and-pantie-voyeur.blogspot.am
@@ -2510010,6 +2510224,7 @@ utopic-design.fr
  utopisland.com
  utopixia.com
  utorrentpro.com
+utporn.com
  utqovnxo1.co.cc
  utraaa.000webhostapp.com
  utrackafrica.com
@@ -2530103,6 +2530318,7 @@ videoporn.free.fr
  videoporn.name
  videoporn.net
  videoporn.pp.ru
+videoporn4k.com
  videopornarchive.com
  videopornazzi.net
  videopornbay.com
@@ -2535273,6 +2535489,7 @@ videospequenosdesexo.blogspot.ug
  videosphotosporno.com
  videospilladas.org
  videospipe.com
+videospleasure.blogspot.com
  videosplek.coms.nl
  videosporn.fr
  videosporn.net
@@ -2535888,6 +2536105,7 @@ videosrobados.com
  videossado.com
  videosservicos.com.br
  videossex.be
+videossex.co
  videossex.net
  videossex.org
  videossexe.biz
@@ -2539803,6 +2540021,7 @@ villyfeefilm1909.blogspot.tw
  villyfeefilm1909.blogspot.ug
  vilmasundari.com
  vilog.nl
+vilokosovealy.blogspot.com
  vilvammatrimony.com
  vim-sexual-stimulation.com
  vim.xwa.mybluehost.me
@@ -2544040,6 +2544259,7 @@ virtualsexspy.com
  virtualsexstore.net
  virtualsexstories.com
  virtualsextv.de
+virtualsexvideo.blogspot.com
  virtualsexy.com
  virtualsexy.com.br
  virtualsexy.net
@@ -2562573,6 +2562793,7 @@ web-porn-world.com
  web-porn.com
  web-porn.net
  web-pornstars.com
+web-prowler.blogspot.com
  web-reactiveacc0unt.idealseries.info
  web-rechungbetrag-domain.de
  web-registrosonasegvrabnonline1.club
@@ -2565360,6 +2565581,7 @@ webcam-sexy.org
  webcam-sexy.tv
  webcam-sexy.webcindario.com
  webcam-shemales.nl
+webcam-show-porn.blogspot.com
  webcam-show.fr
  webcam-showgirls.com
  webcam-site.startspot.nl
@@ -2567740,6 +2567962,7 @@ webcamhookers.nl
  webcamhookers.startspot.nl
  webcamhorizon.nl
  webcamhotgirls.tumblr.com
+webcamhotgratuit.blogspot.com
  webcamhotsex.com
  webcamhuge.com
  webcamhuis.eu
@@ -2608648,6 +2608871,7 @@ xc7x.ru
  xcaahbqmmgobrlumnqsmljkjvw-dot-gleowayel400503.uc.r.appspot.com
  xcabin.net
  xcafe.com
+xcafe.mobi
  xcalaban.tumblr.com
  xcalibur709-pantsdown.blogspot.ae
  xcalibur709-pantsdown.blogspot.al
@@ -2613823,6 +2614047,7 @@ xnxx13.net
  xnxx2.pro
  xnxx2.wikaba.com
  xnxx2008.canalblog.com
+xnxx2013chatonline.blogspot.com
  xnxx202o.000webhostapp.com
  xnxx2o2o.000webhostapp.com
  xnxx2porn.com
@@ -2613980,6 +2614205,7 @@ xnxxpornsexmovies.com
  xnxxpussy.pro
  xnxxrate.com
  xnxxsetup-appleverify.com.yeahbaby.me
+xnxxsex24.blogspot.com
  xnxxsexclips.com
  xnxxsexmovies.com
  xnxxsexporn.com
@@ -2619497,6 +2619723,7 @@ xutazudmqafdqemtbq.top
  xutjja.tumblr.com
  xuvi.com
  xuvyda38.skyrock.com
+xuxa-ilarie.blogspot.com
  xuxusujenes.eu
  xuyatk.goruli.com
  xuyi.winmail01.cn
@@ -2619700,6 +2619927,7 @@ xvideoporno.nelweb.it
  xvideoporno.org
  xvideoporno.tv
  xvideopornoamadoras.com
+xvideos-all.blogspot.com
  xvideos-amateur.com
  xvideos-br.com
  xvideos-cdn.com
@@ -2620445,6 +2620673,7 @@ xvids4me.blogspot.sn
  xvids4me.blogspot.tw
  xvids4me.blogspot.ug
  xvidsca1.youngporno.site
+xvidshub.com
  xvidsporn.com
  xvidx.com
  xvidz.info
@@ -2622106,6 +2622335,7 @@ xxwl.kuaiyunds.com
  xxwmnzhsnilkiinxiyjhluexxpznktroelvc-dot-cryptic-now-290917.ey.r.appspot.com
  xxwoman.com
  xxwuorwqahcabzcdimogletunxiozcdopoje-dot-cryptic-now-290917.ey.r.appspot.com
+xxx
  xxx--------porno.com
  xxx------sex.com
  xxx---me---xxx.vip-blog.com
@@ -2626361,6 +2626591,7 @@ xxx-slash.tumblr.com
  xxx-slut.com
  xxx-sluthunter-xxx.tumblr.com
  xxx-sluts-porn.com
+xxx-sluts.blogspot.com
  xxx-sluts.com
  xxx-slutty-mistress.tumblr.com
  xxx-sm.com
@@ -2627041,6 +2627272,7 @@ xxx.syrianbread.com
  xxx.tonsmovies.net
  xxx.top-100.pl
  xxx.toplista.pl
+xxx.tubedare.net
  xxx.tumblr.com
  xxx.tv
  xxx.us
@@ -2628113,6 +2628345,7 @@ xxxasian.tv
  xxxasianclips.com
  xxxasiandesire.com
  xxxasiandesire.wtf.la
+xxxasianenterprise.blogspot.com
  xxxasianfuck.com
  xxxasiangays.com
  xxxasiangirl.com
@@ -2630906,6 +2631139,7 @@ xxxgirlslive.com
  xxxgirlsonline.com
  xxxgirlspics.com
  xxxgirlspw.tumblr.com
+xxxgirlssex.blogspot.com
  xxxgirlsvids.tumblr.com
  xxxgirlsxxx.com
  xxxgirlteens.com
@@ -2635591,6 +2635825,7 @@ xxxsex4adult.com
  xxxsex4play.com
  xxxsex4u.com
  xxxsex66.com
+xxxsex69.blogspot.com
  xxxsex69.com
  xxxsex8.com
  xxxsex99.com
@@ -2638123,6 +2638358,7 @@ xxy.su
  xxyaoifanaticxxx.tumblr.com
  xxylpt.com
  xxyou-fucked-me-upxx.tumblr.com
+xxypics.blogspot.com
  xxyporn.com
  xxysex.de
  xxzoek.nl
@@ -2639586,6 +2639822,7 @@ yarnel2.tumblr.com
  yarnik.com
  yarnshf.000webhostapp.com
  yaroslava5hg9.tumblr.com
+yaroslavaqetusu.blogspot.com
  yaroslavdimitriev.000webhostapp.com
  yarrakporno.com
  yarta-71.tk
@@ -2652185,6 +2652422,7 @@ yournaughtyneighbor.com
  yournaughtyvideos.com
  yournewporn.com
  yournextdoorwhore.com
+yournextpornsite.com
  yournextpornstar.com
  yournextreminder.tumblr.com
  yourniplover.tumblr.com
@@ -2653957,6 +2654195,7 @@ ytuijhvbcxczxz.azurewebsites.net
  ytunein.com
  ytuongviet.com.vn
  yturdsgfdfg.com
+ytusabescomomesiento.blogspot.com
  ytwea.xyz
  ytwhe.xyz
  yty.topkorder.su
@@ -2658364,6 +2658603,7 @@ zhcy.jaysbrand.com
  zhd5.addroits.com
  zhedxaqhiuxfvkgrhgncuevytclmumioprbs-dot-solar-vertex-285913.rj.r.appspot.com
  zheliyouyy.com
+zhelvatihsbevipa.blogspot.com
  zheman.com
  zhenazhena.tumblr.com
  zhengping.winmail01.cn
@@ -2662358,6 +2662598,7 @@ zooporn.net
  zooporn.nl
  zooporn.org
  zooporn.us
+zooporn.video
  zooporn365.com
  zoopornart.com
  zoopornblog.com
@@ -2663775,6 +2664016,7 @@ zune-porn-movies.blogspot.sk
  zune-porn-movies.blogspot.sn
  zune-porn-movies.blogspot.tw
  zune-porn-movies.blogspot.ug
+zungeimpofkkin.blogspot.com
  zunifetishes.weebly.com
  zunifetishesdirect.com
  zunifetishoutlet.com
diff --git a/blacklists/adult/urls b/blacklists/adult/urls

index 5c0d7803dcd3293451ad0609380d9f81bbc2a10a..c6db05c120b1506a6646d54b3345b57861424e15 100644 (file)
--- a/blacklists/adult/urls
+++ b/blacklists/adult/urls
@@ -23,6 +23,7 @@
  01-fond-ecran.com/mangas-hentais-39/
  01019freenet.de/gay.escort.germany
  029.us/money
+042sexmaniac.blogspot.com/2016
  0443.com/ad8
  0443.com/jpaff/hh08/jm113
  0443.com/jpaff/hh08/jm119
@@ -102,6 +103,7 @@
  100films.0r.fr/girlnd.asx
  100freegaytwink-blog.tumblr.com/post/132634934144/gay-house-share-london-flip-fuck-gay
  100freegaytwink-blog.tumblr.com/post/132698332149/gay-swathe-washington-dc-secretd-sex-toys-gay
+100freegaytwink-blog.tumblr.com/post/132836852324/twink-massage-pics-hard-dick-knows-how-gay
  100freegaytwink-blog.tumblr.com/post/132845777854/donna-summer-song-hard-cock-media-video-free
  100freegaytwink-blog.tumblr.com/post/132905493979/yaoi-gay-son-goku-untrammelled-gay-suck-cock
  100megsfree3.com/min/
@@ -120,6 +122,7 @@
  101sites.info/rns/b-search/c-PORN%20CLEARANCE%20sohh%20124
  1025kiss.com/the-10-sluttiest-celebs-of-2011-pics/
  1069theq.com/anal-gay-adult-sex-naked
+1080pxnxx.com/en/video/1426482545995260772
  10agers.com/23
  10agers.com/24
  10agers.com/25
@@ -1593,6 +1596,7 @@
  210801.com/down/XXX
  210801.com/down/xxx
  210801.com/popup/xxx/gay
+21092002z.tumblr.com/following/page/2
  211.10.2.203/deaeruchart
  211.100.4.208/new/sexedu
  212.10.15.19/erotik
@@ -1838,6 +1842,7 @@
  246.ne.jp/~hiro-t/toko/paradise/sam/phot
  247.libero.it/focus/32159932/1/sesso-a-tre-regalo-di-compleanno-di-danielle-chavez-playmate-al-fidanzato
  247.libero.it/rfocus/24317650/1/sesso-nell-albergo-sul-corso-di-salerno-condannati-portiere-e-maitresse
+24aechicago.blogspot.com/2012
  24h.to/kssex
  24hbanner.com/wp-includes/Text/Diff
  24hourdating.co.uk/date/p/adult-dating/20p40
@@ -2529,7 +2534,6 @@
  92q.com/3659332/sex-session-penis-vagina-talking
  976musique.org/je-suis-un-pervers-voyeur-et-ma-voisine-est-nympho
  98.to/sexten
-9898zem.blogspot.com/2016
  99-672.tumblr.com/post/31197126789/sexyoutdoorphotos-femmes-candides-une-fille
  999.com.cn/public/sex
  999.com.cn/sex
@@ -2583,7 +2587,6 @@
  9reyes.net/passwords-de-porno/
  9reyes.net/videos-y-o-peliculas-porno/
  9rules.com/relationships/notes/2323
-9sexstory.blogspot.com/2011
  a-acompanhantes-travestis.blogspot.com/2020/03
  a-box-o-jills.tumblr.com/post/115966272095/onegirlinalltheworld-im-one-of-the-worst
  a-bruisedheart.tumblr.com/post/35966356293/perverse-lesbian-girls-follow-me-perverse
@@ -2975,7 +2978,6 @@ addictedtomeg.com/porno
  addikted.net/2008/05/un-mec-portait-un-t-shirt-blowjob-is-better-than-no-job-dans-la-gare-il-etait-allemand-abruti
  addrr.com/toonology/index.html
  adeex.us/personals
-adel-sharp-bitch.blogspot.com/2008
  adelaide.backpage.com/Datelines/shemale-hotties-wanna-have-a-great-time
  adelaide.backpage.com/Domination
  adelaide.cracker.com.au/Domination
@@ -3054,6 +3056,7 @@ adoption-chien.vivastreet.fr/adoption-animal+seine-et-marne/show_pics1909141
  adorablefetish.com/0108DeenaDuos
  adorablefetish.com/0109ShylaStyles
  adorecam.net/archives
+adoremedaddy.blogspot.com/2019
  adoroleitematerno.blogspot.com/2011
  ados.fr/about
  ados.fr/sexo
@@ -3105,6 +3108,7 @@ adult-dir.info/kinky/1
  adult-dir.info/teens/6
  adult-frei.blogspot.com/2010
  adult-planet.org/cassidey-and-maitresse-madeline-get-off-the-dick-a-lesbian-bdsm-fantasy
+adult-spanking-giw.blogspot.com/2009/11
  adult-toile-fabric.blogspot.com/2010/12
  adult-top-list.com/asian-exxxtasy
  adult-university.searchmole.co.uk/search
@@ -3126,6 +3130,7 @@ adultflashvideos.blogspot.com/2015/01
  adultfundating.co.uk/exchange
  adultgallerydlshzp.blogspot.com/2020/11
  adultgallerydlshzp.blogspot.com/2020/12
+adultgallerygijpt.blogspot.com/2020
  adultgalleryokvpr.blogspot.com/2020/12
  adultgallerywcoxa.blogspot.com/2020
  adulthotnewsxxx.blogspot.com/2016
@@ -3324,6 +3329,7 @@ aidz.net/advertising_partner/3fakes/member_area
  aif.emsai.net/rating
  aigallerysubmitter.com/info.php5
  aigs.biz/info.php5
+ailananata.tumblr.com/following/page/4
  ailurophile12.tumblr.com/post/128463293793/lezzysxxycandi-nsfw-dirty-blondes-lesbian
  aimless-conversations.net/sex
  aimmm.org/adultsites
@@ -3344,6 +3350,7 @@ airmp3.net/search/eminem/mp3
  airpirateecosplay.tumblr.com/post/122838780163/reblog-if-youre-gay-lesbian-bisexual
  airpurifiers-report.com/wordpress/archives/11
  airpurifiers-report.com/wordpress/archives/17
+aissellesdhommes.blogspot.com/2020/12
  aj1.com/gaylinks
  aj1.com/gaytv
  aj1.com/hypersex
@@ -3416,6 +3423,7 @@ alesandroantonio.blogspot.com/2008/10
  aleskot.tumblr.com/post/77309980759/10-things-you-thought-you-knew-about-porn-prepare
  alessandra.net/jade/post
  alessandra.net/soho/thumbs
+aletaoceanpics.blogspot.com/2016/03
  alevism.net/cams
  alevism.net/movies
  alex-in-wonderland.com/GirlsWithGuns/Pictures
@@ -3831,6 +3839,7 @@ amara.org/videos/tdFcBd1irTzM/info/hot-sexy-girl-horny-babe-striptease-stripping
  amasxstuff.tumblr.com/post/76730248711/hqhomeclips-hot-amateur-babe-fucked-hard-in-the
  amateur-pornostar.com/so-schaffst-du-es-garantiert-sex-zu-haben
  amateur-sex-female-choice-sex-2013.blogspot.com/2014
+amateur-sex-female-choice-sex-2013.blogspot.com/2014/12
  amateurangelsfan.tumblr.com/post/127905075020/more-hot-amateur-girls-httpsextlocalscom
  amateurcorn.tumblr.com/post/617774238810701824/how-sexy-is-that
  amateurfun.net/payc
@@ -4099,6 +4108,7 @@ amno.org/wallpapers/celebrites-femmes
  amno.org/wallpapers/erotic-art
  amoerman.blogspot.com/2020
  amoosewritesfanfic.tumblr.com/post/190217688990/18-sadistic-female-reader-x-submissive-shoto
+amoosewritesfanfic.tumblr.com/post/190575188739/prompt-1-stockings-18
  amoosewritesfanfic.tumblr.com/post/190704903618/prompt-8-masturbationphone-sex-18-keigo
  amor.yfree.org/amateur-contactos-sexo-a4
  amor.yfree.org/citas-contactos-fotos-sexo-a4
@@ -4135,6 +4145,7 @@ anaalgenomen.nl/mov
  anabundanceofporn.tumblr.com/post/129320679236/bestamateursex-sasha-grey-via-rnsfw
  anafor.ru/pics/erotic/
  anais.at/ecspay4it/private-livesex
+anal-gape2552.blogspot.com/2002/12
  analcult.net/post/129503464341/dildo-in-her-ass-finger-in-her-pussy
  analgapandmore.tumblr.com/post/109925705376/hatefuckingforbeginners-youre-thinking-the-law
  analisfunnyworld.tumblr.com/post/92144387556/dirty-sex
@@ -4608,6 +4619,7 @@ annegeddesbaby.com/shop/catalogue
  annehathawayweb.com/hathaway-disturbed-by-sex-fetish-research
  annesophiezanaro.tumblr.com/post/86344150555/superb-lesbian-brunette-in-a-awesome-butt-sex
  annie-keenan-boobs-and-bloomers-te.blogspot.com/2011
+annie-keenan-boobs-and-bloomers-te.blogspot.com/2011/05
  annie-keenan-boobs-and-bloomers-te.blogspot.com/2012
  annieassplay.tumblr.com/post/134153331099
  annnsexy.com/a2
@@ -4778,7 +4790,6 @@ antigame.on.ufanet.ru/shemale
  antiguaobserver.com/your-sexual-health-the-refractory-period-sex-and-aging
  antimatter.com/access1
  antimega.textdriven.com/antimega/2004/08/21/exhibitionists-and-voyeurs
-antinatalism.blogspot.com/2010/06
  antiporn-activist.tumblr.com/post/76493053277/pornographers-are-not-your-friends-part-2
  antipornography.org/home.html
  antiquariato-video.com/patricia7975
@@ -4835,7 +4846,6 @@ anxa.psychologie.pourelles.orange.fr/rencontres-amour
  anxiety.blogitdaily.com/dina3535
  anxietywrap.com/images/_vti_cnf
  any21.com/celeb/
-anyaahot.blogspot.com/2018/12
  anyboard.net/suggest/
  anybunny.tv/movie
  anybunny.tv/search
@@ -5251,6 +5261,7 @@ arexiii.tumblr.com/post/117118647607/damnsexyfoodie-submissions-welcomed-enjoy
  areyoudaman.biz/qa12ws-3ed4rf/0p9o8i7u_osk6y5t4r3e2w1qbbww
  argen-ladd.tumblr.com/post
  argent-rapide.com/sexe
+argenteuil-garce.blogspot.com/2016/02
  argentinawarez.com/fotos-porno/
  argentinawarez.com/hentai-gratis/
  argentinawarez.com/pass-xxx/
@@ -5276,6 +5287,7 @@ ark-light50.tumblr.com/post/167229318422/names-2
  ark-light50.tumblr.com/post/167357344947/on-beeg
  ark-light50.tumblr.com/post/169301136922/zziowin-luna-x-doctor
  ark-light50.tumblr.com/post/171005240647/darlene-delanie-amaro-free-hd-porn-video
+ark-light50.tumblr.com/post/178592158117/tubezx-plumperpass-secret-creaming
  ark-light50.tumblr.com/post/178592288942/victoria-secret-videos-photos-at-plumper-pass
  ark-net.ne.jp/in
  arkan81.tumblr.com/post/109294578550/0h-n0-a-negro-fucked-my-daugter-fluffy-erotic
@@ -5290,6 +5302,7 @@ arkangeles.org/web/foro/ohchicas/
  arkangeles.org/web/foro/peliculas-videos-xxx/
  arkidangelz.tumblr.com/post/116607303115/so-sexy
  arkwomenlover79.tumblr.com/post/155042420040/milfcrew-click-here-to-fuck-a-desperate-milf
+arlenasbookreviews-arlenadean.blogspot.com/2012
  armani.com/fr/emporioarmani/femme/lingerie/culottes
  armoireauxepices.bbactif.com/t123-l-erotisme-en-mots
  armoireauxepices.bbactif.com/t283-erotisme-vs-relation-d-s-vs-sm-and-co
@@ -5430,6 +5443,7 @@ articles.timesofindia.indiatimes.com/2012-05-16/man-woman/30551508_1_health-bene
  articles.timesofindia.indiatimes.com/2013-04-03/man-woman/30565576_1_breasts-woman-much-women
  articlesbase.com/sexuality-articles
  articulosdelbdsm.blogspot.com/2015
+articulosdelbdsm.blogspot.com/2015/03
  artificeclothing.com/em/shop/Scripts/default.asp
  artinude.wix.com/erotic-mature
  artinude.wix.com/eroticart-beauty
@@ -5889,6 +5903,7 @@ avaaddamsdillonharperbibijones.tumblr.com/post/126421029478/magnificentgiannamic
  avaaddamsdillonharperbibijones.tumblr.com/post/128454832113/magnificentgiannamichaels-upskirt-voyeur
  avacowan.com/user/default.php
  avadiaeocornomanso.blogspot.com/2013/12
+avadiaeocornomanso.blogspot.com/2014
  avadiaeocornomanso.blogspot.com/2014/11
  avadianneday.com/adult-categories/baby
  availableimages.com/celebs
@@ -6075,6 +6090,7 @@ babeszone.dk/news.php
  babetko.sk/user/view_page.php
  babewalker.com/category/ask-babe
  babgindonesia.blogspot.com/2019
+babgindonesia.blogspot.com/2019/07
  babi-xo.imeem.com/music/nT3IZqps/i_wanna_fuck_you_dirty
  babki.no.sapo.pt/voyeur
  babki.zyns.com/mature
@@ -6165,7 +6181,6 @@ ballpain.blogspot.com/2013
  ballpain.blogspot.com/2016/01
  ballsdeepnme75.tumblr.com/post/139215331582/xbwolfe2559-flint-michigan-cum-get-me
  ballsinside.tumblr.com/post/106271382468/hairy-is-sexy
-ballsondolls.com/bbw-femboy-exposing-her-cute-body
  ballz.ababa.net/brooklyn
  balotine.blog.elle.fr/2006/11/03/bonjour-tout-le-monde
  balsamik.fr/lingerie/culotte-shorty-string
@@ -6626,7 +6641,6 @@ beautiesplace.com/carla_pivonski
  beautiful-biglabia.tumblr.com/post/111078708113/celebs-who-started-as-porn-stars-katy-perry
  beautiful-nude-body.blogspot.com/2019/11
  beautiful-nude-body.blogspot.com/2020/04
-beautifulblowjob.blogspot.com/2015/08
  beautifulclipart.com/rank
  beautifulhollywoodbabes.blogspot.com/search
  beautifullchicks.tumblr.com/archive
@@ -6789,6 +6803,7 @@ bentaylor0.tumblr.com/post/70598692941/ultimategayporn-fuck-yeah-what-a-great-cu
  bepro.nl/warez
  berarde.com/hebergement/documents/Dispomeubles_000.xls
  beratporn.blogspot.com/2019
+beratporn.blogspot.com/2019/07
  beriqlusconi60.org/porn
  beriqlusconi60.org/porno
  berlin235.server4free.de/erotik-toplistcom
@@ -6961,6 +6976,7 @@ bfi.org.uk/news-opinion/news-bfi/lists/10-great-erotic-british-films
  bfn.dribble-sponge.co.uk/james7218
  bfriends.brigitte.de/foren/erotik/
  bft.nu/exit_trafik/
+bfullsex.blogspot.com/2019
  bg.wordpress.com/tag/centerfold
  bgbain.fr/dansksex-6ac92
  bgp.he.net/dns/sexswap2000.com
@@ -7139,10 +7155,10 @@ biosexi.com/9
  bioxit.com/sexy-et-charme
  bipolar-sunshine-says-bite-me.tumblr.com/post/108253704396
  bipolar-sunshine-says-bite-me.tumblr.com/post/109999450481/analcult-brunette-getting-fucked-by-a-thick-cock
+biqle.life/video
  bird-of-paradise.eu/je-cherche-couple-gay-irapuato
  birds-have-teeth.tumblr.com/post/613539486486462464/i-just-wanna-praise-and-dirty-izuku-and-watch-him
  birds-have-teeth.tumblr.com/post/616873220980850688/spanking-deku-like-he-was-being-a-bratty-sub-so
-birdsbees2.blogspot.com/2019
  birdsnest.com.au/womens/shop-by/bodyshape/big-boobs/outfits
  birmingham.backpage.com/Strippers/party-strippers-rush-parties-sexy-lesbian-strip-show-with-toys-877-442-0345
  birmingham.vivastreet.co.uk/dating+birmingham
@@ -7326,7 +7342,6 @@ blackmack1977.tumblr.com/post/120095321827
  blackmailbdsm.blogspot.com/2011/04
  blackmandlatinf.tumblr.com/post/128332337868/my-wife-is-freaky-and-enjoys-licking-my-ass
  blackmenrevenge.tumblr.com/post
-blackmenvswhitesissy.blogspot.com/2015
  blacknlusty.com/black197
  blacknoir01.tumblr.com/post/133907441110/destroywhiteboys-nigger-cocks-cant-be
  blackorder.com/modules/forum/
@@ -7490,7 +7505,6 @@ blog-grannies.tumblr.com/grannies.xxx
  blog-imgs-44.fc2.com/p/i/l/pillow3000
  blog-mutuelle1.tumblr.com/post/1621242005/sodomie-baise-avec-des-pucelles-en-manque-qui-se
  blog-network.de/erotik
-blog-oi12.blogspot.com/2008/01
  blog-sexe-gratuit.com/films-porno
  blog-trendy.letudiant.fr/qu-est-ce-que-j-en-sexe/2013/06
  blog-trendy.letudiant.fr/qu-est-ce-que-j-en-sexe/2014
@@ -8713,7 +8727,6 @@ blue.tricorn.net/shopper/sdel1.x
  blue11.jp/40
  blue4x.fr/videos-gays
  blue4x.fr/webmasters
-blueballz77.blogspot.com/2014
  bluedevil33065.tumblr.com/page/13
  bluedot.us/users/Callisto
  bluedot.us/users/PeterIngred
@@ -8741,7 +8754,6 @@ blueskies4u2.tumblr.com/post/61401241066/nopicturesofyou-hot-amateur
  blueskyman2012.tumblr.com/post/145781535877
  bluespacecaribbean.org/blogs/2015/09/page
  bluesvm.net/blog/articles/2006/08/01/project_jangakye
-blunt-emily-wallpaper.blogspot.com/2008
  blur.fsn.net/house
  blur.fsn.net/warez
  blurayseks.com/porno-video/87386/sik-sexs-izle
@@ -8885,6 +8897,7 @@ bodysale.net/galleries
  bodysportsinfo.com/cont/sex/mos
  bodysportsinfo.com/sex
  bodyswap3.blogspot.com/2012/06
+bodyswapcaps.com/2017/03/16/moms-massive-breasts
  bof.hu/sajt/sajt00
  bofes1000.blogspot.com/2018/01
  boga69.bo.funpic.de/Forum/portal.php
@@ -8941,9 +8954,7 @@ bolha.com/spolna-moc
  bolha.com/tenga-za-moske
  bolha.com/vagine-masturbatorji
  bolha.com/zensko-perilo-oblacila
-bolichesfree.blogspot.com/2013/05
  boliviagay.com/modules/news/
-bolivianasdesnudas.blogspot.com/2013
  boliviay.com/adultos.php
  boliviay.com/bolivia-bolivia/amateur-adultos/
  boliviay.com/bolivia-bolivia/fotos-artistas-modelos/
@@ -9173,7 +9184,6 @@ boobgoober.tumblr.com/post/155693900150/masturbatrixmethodologies-a-couple-of-am
  booblepoo.org/1/index.html
  boobs-and-more.blogspot.com/2011/06
  boobssnbooty.blogspot.com/2013/06
-boobsxxxphotos.blogspot.com/2018
  boogger.cn/mature-chubby-milfs-movies-free
  boogie-dvd.com/adult
  book.6cc.idv.tw/a101
@@ -9319,7 +9329,6 @@ bourges.kijiji.fr/c-Rencontres-Rencontre-occasionnelle-Couple-Femme-dominatrice-
  bourgoinjallieu.fr/uploads/Document/80/WEB_CHEMIN_870_1171369095.doc
  boutique.orange.fr/tv/bouquet-adulte
  boutiqueadameteve.com/jouet-adulte-sexuel-ou-erotique-pour-femme
-boutiquevente-article-erotique.blogspot.com/2011
  bouvinskincare.se/bdsm-elements-at-christy-mack-porn-the-with/
  bovaria.tumblr.com/post/133968376967/relieving-the-stress
  boveckanin.si/files/backup
@@ -9444,6 +9453,7 @@ boyssexvideos-blog.tumblr.com/post/142320643773/alliance-soulja-boy
  boyssexvideos-blog.tumblr.com/post/142320796088/piczo-family-twink
  boyssexvideos-blog.tumblr.com/post/142320876553/free-gay-maleporn-yideos-online
  boyssexvideos-blog.tumblr.com/post/142321273473/gay-blogs-no-spyware-no-adware
+boyssexvideos-blog.tumblr.com/post/142321749873/gay-cock-penis-dick
  boyssexvideos-blog.tumblr.com/post/142321766608/condensed-coal-black-relations-gay
  boyssexvideos-blog.tumblr.com/post/142321993683/pictures-gay-rope
  boyssexvideos-blog.tumblr.com/post/142322011603/unchained-gay-wrestling-vids
@@ -9455,8 +9465,10 @@ boyssexvideos-blog.tumblr.com/post/142323572163/individual-gay-leather
  boyssexvideos-blog.tumblr.com/post/142380291078/pic-post-twinks-free
  boyssexvideos-blog.tumblr.com/post/142380738363/thailand-tag-results-gay
  boyssexvideos-blog.tumblr.com/post/142380938268/young-gay-boy-sex-story
+boyssexvideos-blog.tumblr.com/post/142381028928/featuring-gay-toons
  boyssexvideos-blog.tumblr.com/post/142381309883/gay-leather-slave-master
  boyssexvideos-blog.tumblr.com/post/142381468253/twink-access-gay-porn
+boyssexvideos-blog.tumblr.com/post/142381538778/gay-tube-good-gay-tube-hunk
  boyssexvideos-blog.tumblr.com/post/142381622468/following-requests-homosexual-rights
  boyssexvideos-blog.tumblr.com/post/142381850208/filipino-homo-blogs
  boyssexvideos-blog.tumblr.com/post/142381919743/hot-nasty-gay-sex-stories
@@ -9548,6 +9560,7 @@ breitbart.com/london/2015/12/12/girls-as-young-as-12-made-available-for-sex-with
  breitbart.com/london/2016/01/08/nude-female-cologne-protest-we-are-not-fair-game-even-when-we-are-naked
  breitenbush.com/gallery
  breitling-orbiter.ch/cd/charme
+brendasongimdb.blogspot.com/2008/02
  brenhinesblog.tumblr.com/post/119706676261/my-breast-cum-video-cumshot-tit-pearlneckless
  bresil.org/images/stories/ambassade-documents/le-bresil/economie/le-bresil-economie-conjoncture-balance.xls
  bresil.org/images/stories/ambassade-documents/le-bresil/symboles-nationaux/le-bresil-hino-nacional-letra-vb.doc
@@ -9591,7 +9604,6 @@ bristolbloke38.tumblr.com/post/116279979765/chavs-whores-sluts-slags-local-prost
  british-female-orgy-swingers-2013.blogspot.com/2014/12
  britishbulldogs.net/eva
  britishfilth.tumblr.com/post/72359178197/roommates-its-my-first-night-living-with-a-male
-britishsexshops-sextoys.blogspot.com/2010
  britlascivious.tumblr.com/archive
  britneyrose.com/cam
  britneyspy.com/images
@@ -9775,8 +9787,6 @@ bugmenot.com/view/id.adultcheck.com
  bugthrust.com/hp/3
  bugthrust.com/hp/6
  buhuchetaudit.ru/packsmegacp/amateur
-buintheworld.blogspot.com/2014
-buintheworld.blogspot.com/2020
  buitengewoonconcept.nl/story
  bukisa.com/videos/178657_how-to-masturbate-as-a-woman
  bukkake-gang-bang.de/de/
@@ -9873,8 +9883,10 @@ bustle.com/articles/73059-what-are-the-best-sex-toys-for-female-orgasm-12-vibrat
  bustle.com/articles/81479-how-to-pay-attention-to-nipples-during-sex-because-its-time-for-a-pleasure-revolution
  bustle.com/p/11-best-sex-toys-for-group-sex-18755319
  busty-femme-fatale.tumblr.com/eroticawritings
+busty6kbabes6kfucking.blogspot.com/2009
  bustyasians.site/archive
  bustyteen23.tumblr.com/post/125824500745/braces-mouth-fetish
+bustyxuteenxubabes.blogspot.com/2008
  butch720.tumblr.com/post/131224931360/drive-thru-pussy-pleasure
  butchie4ever.tumblr.com/post/124847963823/damn-this-shit-got-my-dick-hard-like-a-brick
  butchnraunchy.com/post/137761853268/taboobrotherhood-watch-the-gang-from-treasure
@@ -10095,7 +10107,6 @@ calais-germain.com/documents-word/livre_bon_de_commande.doc
  calasech.ch/Photos
  calcio-d.info/crissymoran
  caleida.com/users/edcmnb
-calfeeqw.blogspot.com/2009/11
  calgary.backpage.com/TranssexualEscorts
  calgary.en.craigslist.ca/cas
  calgary.fr.craigslist.ca/cas
@@ -10655,7 +10666,6 @@ celebrites-inter.com/page/index.php?cat=
  celebrites.fr/gal/photos
  celebrites.sfr.aol.fr/article/VIDEO---Christina-Ricci-en-petite/189770
  celebrites.sfr.aol.fr/categorie/sexy
-celebriti3s.blogspot.com/2012
  celebrities.insidepulse.com/2010/05/12/lawrence-taylor-denies-rape-says-it-was-just-masturbation
  celebrities.netscape.com/story/2006/09/07/angelina-jolie-was-a-dominatrix-says-former-lesbian-partner
  celebrities.netscape.com/story/2006/09/19/jennifer-garner-near-panty-slip-photo
@@ -11080,7 +11090,6 @@ chefyugioh.site.voila.fr/index.jhtml
  chegg.com/gallery
  chelmetal.ru/adv/deal3
  chelseakinne.tumblr.com/post/238748533/men-suck-at-eating-pussy-not-because-they-dont
-chelseyletterstoworld.blogspot.com/2010/01
  chemart.org/images/smiley/adult/ass
  chemart.org/images/smiley/adult/lesbian
  cheneycowles.org/videos
@@ -11800,7 +11809,6 @@ chicago.craigslist.org/msr
  chicago.craigslist.org/nwi/m4m
  chicago.craigslist.org/wcl/cas
  chicagonow.com/kinky-dominatrix/2013/02/adult-bookstore
-chicasde4mor.blogspot.com/2013/02
  chicheux.ch/2007/12/20/sextape-de-laure-manaudu-nue
  chicken-invaders-3-easter-2013.blogspot.com/2017
  chicks-dating.tumblr.com/post/132402699119/tnt-chicks-do-you-want-see-erotical-pictures-of
@@ -12381,6 +12389,7 @@ clover.h555.net/u/mickey/FNyRCAzwof51xKdaJXh0
  clover.h555.net/u/overdrive/JZt3j54RpYeiTwyfso0S
  clovia.com/buy-online/collections/bestseller-styles/sexy/
  clovia.com/buy-online/panties
+clownishk.blogspot.com/2008
  clpw.net/eroticards
  clpw.net/lifemate
  clpw.net/queercards
@@ -12536,6 +12545,7 @@ cocklover5798.tumblr.com/post/149596967459/nohoslut-fucking-hot-throat-fucking
  cocklovingmama.tumblr.com/post/154730675125/inseminatemywife-nudesnporn-you-dont-get-the
  cocknpussyporn-blog.tumblr.com/page/2
  cockringsvibrator.blogspot.com/2017/11
+cockringsvibrator.blogspot.com/2018/06
  cockringsvibrator.blogspot.com/2018/11
  cocksucker-karofsky.tumblr.com/page/56
  cocksures.rifes.co/image
@@ -12673,6 +12683,7 @@ collinson.fr/Jokepage/
  collon.tv/enter.php
  colmeia.blog.br/category/adulto/
  colocation.vivastreet.fr/annonces-colocation/show_pics4698610
+colombianporn2019.blogspot.com/2018
  colombiay.com/adultos.php
  colombiay.com/colombia-colombia/amateur-adultos/
  colombiay.com/colombia-colombia/fotos-artistas-modelos/
@@ -12770,6 +12781,7 @@ comics-pics-free.com/hot-anime-pictures-of-the-simpsons
  comics.ru/erotic
  comicscartoon-blog.tumblr.com/page
  comicscartoon-blog.tumblr.com/post
+comicscartoon-blog.tumblr.com/post/29433675620/womenfree-hardcore-cartoon-sex
  comicvine.com/myvine/fujimdodmtn/about-me
  comicvine.com/myvine/ipsdckqeccl/about-me
  comicvine.com/myvine/qgftfgbkggj/about-me
@@ -12940,6 +12952,7 @@ conmedia.com/error
  connect.in.com/playboy-yoga-video/
  connect.to/justine
  connecting4fun.com/rate
+conneriesamerindiennes.blogspot.com/2011
  conneriesamerindiennes.blogspot.com/2011/12
  connotea.org/user/katamlaki/tag/cumshot
  cono13.com/freeTITO
@@ -13039,6 +13052,7 @@ coolpage.harisen.jp/amateur
  coolparadise.online.fr/style.css
  coolpics.h1.ru/freesexpics4
  coolpics.h16.ru/flash
+coolporntube.me/res/throat_huge_labia
  coolreviews.idlegames.com/free
  coolreviews.t28.net/free
  coolshemale.com/fr/panties
@@ -13623,6 +13637,7 @@ cum-bus.com/bus2/020
  cum-bus.com/bus2/021
  cum-bus.com/bus2/024
  cum-faces.tumblr.com/post/84149163926/mr-yummys-cummy-girls-the-mr-yummy-tumblrs
+cum-hentai.blogspot.com/2005/02
  cum-on-pics-bent-over-girl-muscle.blogspot.com/2011
  cum-on-pics-bent-over-girl-muscle.blogspot.com/2011/07
  cum-on-pics-bent-over-girl-muscle.blogspot.com/2011/12
@@ -13712,6 +13727,7 @@ curioussubjourney.tumblr.com/post/101980948117/cocksucking-adventures-and-annual
  curiouswinekitten-deactivated20.tumblr.com/post/135478376408/i-have-been-a-bad-girl-on-this-braless-friday-i
  curl.in/catalogue/cumshot
  curl.in/catalogue/interracial
+curlytrouble.tumblr.com/following
  curlytrouble.tumblr.com/page/4
  curqqgm.serppages.com/site/www.pornstargals.com
  current.com/groups/boobies
@@ -13938,6 +13954,7 @@ cyberpass.net/~hserve
  cyberpass.net/~udk
  cyberquebec.ca/gourmande
  cyberrat.tumblr.com/post/91038352282/sorry-to-bother-you-but-could-you-post-your-prompts
+cyberrat.tumblr.com/post/91038352282/sorry-to-bother-you-but-could-you-post-your-prompts/amp
  cybersolidaires.org/prostitution/
  cybersolidaires.typepad.com/direct/forum_xxx
  cyberspc.mb.ca/~mknight/images2
@@ -13981,6 +13998,7 @@ cyxpress.com/cgi-bin/redirect.cgi/2
  cyxpress.com/cgi-bin/redirect.cgi/3
  czadowo.com/kobiety
  czechcenterfolds.com/blog
+czechvr.blogspot.com/2018/09
  d-410.com/410paper/wallpaper_2
  d-d.de/members
  d-evil.net/category/voll-porno/
@@ -14017,7 +14035,6 @@ d3.dir.ac2.yahoo.com/Society_and_Culture/Sexuality/Adult_Movies
  d3m0nchild.tumblr.com/post/44100468194/very-sexy
  d3nn1sh.tumblr.com/following
  d430422.dn24.directnichosting.com/bboobs/super3/69g
-d4freew.blogspot.com/2010
  d4nk.com/webmaster_resources
  d95design.com/tgp
  d9store.com/stores/adultdvds
@@ -14206,6 +14223,7 @@ dahquest.com/hosesex
  dai709.tumblr.com/post/100501615784/trin76-breast-hold-cum-naked-nipples-penis
  daily-erection.tumblr.com/post/147450603067
  daily.gay.com/lifestyle
+dailyanalsexstories.blogspot.com/2009/02
  dailyanime4you.com/Gallery_101
  dailyanime4you.com/Gallery_514
  dailybigmovies.com/80
@@ -16976,6 +16994,7 @@ dakori69.tumblr.com/post
  dakotacom.net/~tucoan/pics
  dakshahinternational.com/elena3558
  dalavera.50megs.com/superporno
+dale-guitar-tablature-misirlou.blogspot.com/2010/09
  daler.ru/wallpapers/girls
  daletoon.tumblr.com/post/74593070986/masturbatia-mature-chubby-housewife-in-lingerie
  daletoon.tumblr.com/post/74593160863/masturbatia-sexy-mature-wife-in-purple-lingerie
@@ -17113,7 +17132,6 @@ datesomebody.com/0307/04/
  datesomebody.com/0307/05
  datesomebody.com/0307/06/
  datesomebody.com/1007/rrealm/01
-dating-elite.blogspot.com/2009
  dating-gold.com/category/white-girls-dating-black-guys
  dating-internet.nl/tag/sex-dating/
  dating.about.com/od/bdsmpersonals
@@ -17430,6 +17448,7 @@ deezer.com/track/63590556
  deezer.com/us/tl/tl/tl/track/14051062
  deezer.com/us/tl/track/14051062
  deezer.com/us/track/14051062
+deeznuts4011980.tumblr.com/following
  deface.hu/sex/
  deface.hu/teen/
  deface.hu/zooszex/
@@ -18232,6 +18251,7 @@ denversnaughtyprincess.tumblr.com/post/155456376658/naughty-sexual-blog-so-fucki
  denversnaughtyprincess.tumblr.com/post/155510880988/mmm-so-many-cocks-so-much-cum
  deonysex.tumblr.com/following
  depaqueteapaquete.blogspot.com/2011
+depaqueteapaquete.blogspot.com/2011/04
  depaqueteapaquete.blogspot.com/2012
  depaso.exblog.jp/3427427
  depic-us.tumblr.com/post/
@@ -18258,7 +18278,6 @@ derpranger.org/Sex-Contacts-Une-Petite-Salope-En
  derpranger.org/adult-dating-une-baise-sous-la-douche
  ders79.tumblr.com/post/107120445268/thats-pussy-is-asking-for-a-dick-to-say-hello
  dertimener.ifrance.com/redwine
-des-mots-en-equilibre.blogspot.com/2016
  des0late-girl.tumblr.com/post/112027870186/a-good-girl-is-always-excited-to-get-to-suck-her
  desarrollodragon.com/hentai/videos/webcams
  descargaporsms.net/chistes/
@@ -18266,13 +18285,13 @@ descargar-mp3-gratis.betwizardpro.com/go/klite-codec/
  descargargratisfull.com/descargar-gratis/porno-videos-xxx
  descargasmessenger.com/1/n
  desdeunalineademipalma.blogspot.com/2013
+desdeunalineademipalma.blogspot.com/2013/09
  desencyclopedie.org/wiki/Cat%C3%A9gorie:Sexe
  desencyclopedie.wikia.com/wiki/Cat%C3%A9gorie:Sexe
  deseosescortselite.tumblr.com/post/155402589618/anal-sex-hard-cumshot-deep-throat-deseos
  desertdollar.com/default.asp?Btag=PPC_DDC
  desgraphics.com/backroomfacials
  desgraphics.com/boobsquad
-desi-815t.blogspot.com/2008
  desibaba.ws/free-porn-movies/
  desibateen.blogspot.com/2012/10
  desibeauts.tumblr.com/post/131923859296/radika4bbc-xxx-videos-pakistani-chick-selfshot
@@ -18675,6 +18694,7 @@ diid.xoompages.com/greenleaf/790737
  dijon.kijiji.fr/c-Rencontres-Homme-cherche-homme-un-mec-poilu-W0QQAdIdZ25919854
  dijon.kijiji.fr/c-Rencontres-Rencontre-occasionnelle-Homme-cherche-homme-un-mec-poilu-W0QQAdIdZ25919854
  dikkemaatjes.nl/wordpress/
+dildo-cam-1172.blogspot.com/2005/02
  dildo-generator.com/3d-printed-custom-toys/
  dildosformen.blogspot.com/p
  dildowife.tumblr.com/post
@@ -20016,6 +20036,7 @@ drlauraberman.com/great-sex
  drlauraberman.com/sexual-health/sexual-desire/male-orgasm-facts
  drlauraberman.com/sexual-health/sexual-dysfunction/tips-to-help-stop-premature-ejaculation
  drlauraberman.com/sexual-health/your-body/clitoris-pain-q-a
+drlohit.tumblr.com/post/64278619127/100-sex-tips
  drmickeysmith.tumblr.com/post
  drogisterij.net/index.php?partnercode=207
  droitetinternet.com/personaladsphotos
@@ -20313,7 +20334,6 @@ dumbsluttyangel.tumblr.com/post/86581172522
  dumbsluttyangel.tumblr.com/post/96032216017
  dumbsluttyangel.tumblr.com/post/99630291782
  dundeeleagues.ca/amateur
-dungeonsexsblog.tumblr.com/page/3
  duno.com/asian
  dupa.net.pl/tag-filmiku/sex_kamerki
  dupasoi7.home.mindspring.com/faq
@@ -20517,6 +20537,7 @@ e53.org/themartianwhore
  e76.com.tw/service
  eag-net.com/midian
  eager.to/fuck
+eagleandsparrow.blogspot.com/2012
  eaid.com/man
  ealta.eu/site-de-q-escort-girl-mont
  eamore.com.pl/bdsm_i_fetysz
@@ -20773,7 +20794,6 @@ ebony-blowjob-melons-cum-covered.blogspot.com/2012/03
  ebony-luxury.tumblr.com/post/115562232996/we-have-a-treat-for-all-porn-lovers-out-there
  ebony-rachets-nsfw.tumblr.com/post/115680114399/for-more-black-ebony-pussy-xxx-check-out
  ebony.com/love-sex/shades-of-black-bdsm-482
-ebony46teen46slut.blogspot.com/2009
  ebook-diffusion.com/escort-girl/
  ebook-romance.info/romance-erotique/
  ebook-romance.info/romance-erotique/call-me-bitch-t1-a-6-de-emma-green/
@@ -20810,6 +20830,7 @@ econjobrumors.com/topic/check-out-this-ucla-chick-racist-ever/page/3
  econoline71.tumblr.com/post/132295463864/z4kcumncock-cum-wow-mmmm
  economist.com/news/leaders/21666614-free-pornography-ever-more-plentiful-online-right-response-involves-better-sex
  ecorapter.tumblr.com/following
+ecorapter.tumblr.com/following/page/14
  ecostar.biz/007/rb/01
  ecranlarge.com/films/news/932198-50-nuances-de-grey-jamie-dornan-bondage-et-cravate-sur-la-nouvelle-affiche
  ecranlarge.com/films/news/949717-xxx-3-vin-diesel-invite-les-actrices-de-vampire-diaries-et-orange-is-the-new-black
@@ -21338,6 +21359,7 @@ emustar.com/telecharger/telechargement_blagues
  emwritesfootball.tumblr.com/post/625327597819133952/threesomes-2-6-marcus-rashford-and-benjamin
  en-amp.erkiss.club/search/testicles
  en-la-penumbra.blogspot.com/2013
+en-navelstories.blogspot.com/2015/06
  en.alisaverner.com/gallery/erotic
  en.allexperts.com/q/Deal-Sex-Problems-861/2008
  en.allexperts.com/q/Female-Masturbation-3327
@@ -21350,6 +21372,7 @@ en.bab.la/dictionary/english-french/blowjob
  en.bab.la/dictionary/english-french/fuck-me
  en.bab.la/dictionary/english-french/fucked
  en.dicios.com/fren
+en.erkiss.club/search/adult
  en.fooooo.com/w/1e1c7ee2f03dac57db6855d88a02408b
  en.gravatar.com/wilddesireserotica.json
  en.gravatar.com/wilddesireserotica.vcf
@@ -21642,6 +21665,7 @@ envy.nu/cute
  envy.nu/kojika
  envy.nu/plpro
  envycamacho.com/post/106292242974/deansurvived-at-17-i-was-a-depressed-teenager
+enwik.tumblr.com/following
  eole-lingerie.com/50-panty
  eonline.com/celebrities
  eonline.com/fr/news/641400/lol-rihanna-caught-checking-out-nicki-minaj-s-boobs-bitch-betta-gimme-those-titties
@@ -21757,7 +21781,6 @@ erosisntpleasure.tumblr.com/post/47505034565/just-beautiful
  erosisntpleasure.tumblr.com/post/60324505000
  erosmind.tumblr.com/post
  erossa.com/banner
-erossquiver.tumblr.com/post/102676646450/jason-has-like-a-porn-star-size-dick-and-nico-is
  erot.org/menu
  erotic-beauty.over-blog.com/2015/10
  erotic-comics-1032.blogspot.com/2005/02
@@ -21768,13 +21791,11 @@ eroticalibrary.blogspot.com/2011
  eroticartgayblogs-blog.tumblr.com/post/123680813040/blog-masturbation-gay
  eroticartgayblogs-blog.tumblr.com/post/123680852395/homosexual-hung-cop
  eroticartgayblogs-blog.tumblr.com/post/123765373290/homo-dragon-blowjobs
+eroticartgayblogs-blog.tumblr.com/post/123766984810/public-boys-sex-pic
+eroticartgayblogs-blog.tumblr.com/post/123845947230/gay-twink-ejaculation-gay
  eroticartgayblogs-blog.tumblr.com/post/123934067910/menvsboys-mature-meat
-eroticfanfic.tumblr.com/post/611027630445215744/basic-instinct-threesome
-eroticgal.blogspot.com/2006
-eroticinenglish.blogspot.com/2012
  eroticismhooterscalendar.blogspot.com/2009
  eroticmassagchensexextrem.blogspot.com/2018
-eroticvideobisexualsexp.blogspot.com/2009
  erotik-web.via.t-online.de/schneefickchen
  erotik.infostore.org/info
  erotikossindiasmos.blogspot.com/2011
@@ -22098,7 +22119,6 @@ evalongoriaforum.com/shout
  evanescencerain.net/mp3/xxx
  evangelicanua.blogspot.com/2011
  evasiveangles.tumblr.com/page/39
-evawecvishecasa.blogspot.com/2011/03
  evedecandaulie.fr/sex-interracial-1-the-queen-of-spades/
  evedecandaulie.fr/sex-interracial-2-bbc-world/
  evedecandaulie.fr/tag/interracial-adult-sex/
@@ -22907,6 +22927,7 @@ fakeplastictits.tumblr.com/post/41772839153/striptease-bar-hot-sexy-young-naked-
  fakeposters.com/posters/fuck/
  fakes-nia.blogspot.com/2012
  fakes-nia.blogspot.com/2015
+fakes-nia.blogspot.com/2015/10
  fakesnudes.blogspot.com/2015
  fakingitfanfiction.tumblr.com/post/83999548483/only-you-karmy-smut-one-shot
  fakyr.com/2005/06/20/bianca-beauchamp-2
@@ -23056,6 +23077,7 @@ fappeninglnuke.blogspot.com/2015/01
  faproulette.co/10925/exhibitionist-puppy-play
  faproulette.co/1729/cum-slut-challenge
  fapsville.tumblr.com/post/119859508993/fuzzygangbang-xxx-sissy-shemale-lesbian-sex
+fapvidhd.pro/fr/searching
  faqfarm.com/Q/How_do_females_masturbate
  farizzzzz.tumblr.com/post/134643354555/matthieubi75-cock7777-cum-cumshot-wank
  fas.quelle.fr/boutique.s.espace_beaute.c.accessoire_sexy_et_autres
@@ -23197,6 +23219,7 @@ fatlossfactormax.com/kristabel-
  fatlossfactormax.com/rouge-suicide-girl-emma
  fatlossfactormax.com/sutatta-udomsilp-
  fatmobil.com/blog
+fatshittingmovies.blogspot.com/2014
  fatshittingmovies.blogspot.com/2014/12
  fatsouthernhedonist.tumblr.com/post/90890507492/just-shaved-my-pussy-for-tonights-gangbang-wish
  fatyumbbw.tumblr.com/post/126050256641/trixxx1000-virgo-peridot
@@ -23228,6 +23251,7 @@ favstore.net/sirmaximus
  favstore.net/spermomax
  faxfire-blog.tumblr.com/post/109569186053/blonde-teen-braces-cum-facial
  faxinfo.com.br/eroticos/
+faye-reagan-ass-amature-vagina-vint.blogspot.com/2011/09
  fayl.uh.cu/Documentos/Articulos/LORCA.DOC
  faylinngroupfucking.tumblr.com/post/110547240043/gangbang-triple-penetration
  fayno-cash.com/nude-art-babes
@@ -23239,7 +23263,6 @@ fblog.fr/mrine01
  fbn.com.au/sexguess
  fca-commerce-associe.fr/data/document/Liste%20adh%C3%A9rents.xls
  fccdn.followerscounter.com/widget/sweetperfectionissexy/tiny
-fckdfreak.blogspot.com/2008
  fdf.wietz.dk/aurelie6268
  fe7ato.org/porn
  fearlessrecords.com/graphicpress/images/img
@@ -24021,7 +24044,6 @@ feirrari.org/porno
  feliciasroom.blogspot.com/2012/06
  felicity-art.com/images/man-boob/
  felicity-art.com/images01/doors
-felitsiyaeupa.blogspot.com/2011
  felixlatexx.blogspot.com/2011
  felposito.wix.com/frank-elposito
  female-choice-sex-latin-bdsm-2013.blogspot.com/2014
@@ -24045,13 +24067,12 @@ femdom-movies.blogspot.com/2005
  femdom-strapon-fisting.com/en/videos
  femdom-video.blogspot.com/2005
  femdomalt.blogspot.com/2012/05
-femdomboots.blogspot.com/2010
-femdomboots.blogspot.com/2012
  femdomempire.net/femdom
  femdoming.com/fiction/dominant-female-roommate-panties
  femdomqueendom.tumblr.com/post/135435470010/smothermeplease-horny-hotties-near-you-are
  femdomsissyslave.tumblr.com/following/page/5
  femdomstrapon.blogspot.com/2015
+femdomwd.blogspot.com/2020
  femina.fr/Sexo/Erotisme/Erotisme-votre-plus-belle-experience
  femina.fr/Sexo/Notre-expert-sexo
  femina.fr/Sexo/Sexualite/10-questions-de-femmes-sur-la-sexualite-masculine/Les-secrets-d-une-fellation-reussie
@@ -24175,7 +24196,9 @@ fetish-sex-groupsex-2013.blogspot.com/2018
  fetish-sex-outdoor-porn-2013.blogspot.com/2014
  fetishalias.com/getfree/61xx_2007
  fetishfantasies3.tumblr.com/post
+fetishgoddesssamantha.blogspot.com/2016
  fetishkingdom.net/mf.php
+fetishlover123.tumblr.com/likes
  fetishmadam.com/117
  fetishsexon.com/movie
  fetishsexon.com/watch_top/OGUtMTMzMy0xMzg0ODU0OA
@@ -26364,7 +26387,6 @@ free-on-the-web.com/cgi-local
  free-online-video.net/s/EROTYKA
  free-pagerank.com/adulte
  free-pics.wz.cz/b
-free-porn-sexy.blogspot.com/2011/01
  free-shemale-movies-nad.blogspot.com/2010/07
  free-shemale-porn.blogspot.com/2005
  free-si.hinet.hr/xxxsite/gallerys
@@ -26588,10 +26610,12 @@ freeflight.cockpit.be/samael
  freeflights.net/le69
  freeflights.net/libertinage
  freefotolog.net/sexo__lindo
+freefuckbuddymoblecredits.blogspot.com/2013
  freefullsex.blogspot.com/2011
  freefun.cz/online-hry-zdarma/eroticke
  freegallery.worldispnetwork.com/06
  freegay.fun/searches
+freegay.fun/searches/malenal
  freegayasianpics.com/feed
  freegayecards.net/blog
  freegaymanmovie-blog.tumblr.com/post/122897824821/big-haiy-dude-men
@@ -26941,6 +26965,7 @@ freshasianmovies.com/free_asian/04/aug/27
  freshcotton.com/default_frame.asp?sessionid=41C650DB18EB40BA99BB0EB24A8CD576&sid=&ifr=&page=
  freshcotton.com/default_frame.asp?sessionid=AECC10F33FBB4D6BB8F1EEA45533E238&sid=&ifr=&page=
  freshfiles.net/files/stacy
+freshladygardener.tumblr.com/following
  freshperv1.tumblr.com/post/100512862802/mrmrswoodman-sophie-dee-blowjob-titty-fuck
  freshwomen.com/cproot/1537
  freunde-sloweniens.de/wp/author/admin/page/74
@@ -27050,6 +27075,7 @@ fuckingsexywoman-blog.tumblr.com/post/130302259944/mid-sixteenth-century-nice-tu
  fuckingslutwomanvideos.tumblr.com/post/164304462373/kocakurtus-gangbang-more-hot-fucking-slut
  fuckingyoungpeople-blog.tumblr.com/post/129880207502/novel-follows-high-teens-junior-dirty-white
  fuckmefillmethrillme.tumblr.com/post/129930960142/i-dont-want-to-have-sex-i-want-you-to-fuck
+fucknstein.com/best-erection-porn-pics
  fuckpussy.vip/en/throat
  fuckswomenssex-blog.tumblr.com/page/3
  fuckswomenssex-blog.tumblr.com/post/126544095351/english-teenager-deep-throat-blowjob
@@ -27704,7 +27730,6 @@ garennes.com/As2
  garfield.digitalexpressions.nu/diary/monacosexe/monaco%20sexe
  gargula183.tumblr.com/post/101269248735/wanwan7-bondage-breasts-elf-kikurage-nipples
  gariber.net/adult
-garotasdeprogramaemsp.blogspot.com/2016/10
  garotos.tumblr.com/post/3875470693/smooth-james-hot-shaved-blowjob
  garret.ru/intim
  garter-stocking-tease.tumblr.com/post/138118489496/stocking-shot-tease-check-out-lingeriefemmes
@@ -27778,6 +27803,7 @@ gayamazinglyclubs.tumblr.com/post/130650353893/twink-black-twink-boy-black-twink
  gayandlesbian.aol.com/blogiframe
  gayarmenia.agla.info/index.php?l=EN&sr=0
  gayathleticguy34.tumblr.com/post/617237045019082752/muscular-top-throatfucking-cell-mate-williams-bay
+gaybdsmfiction.blogspot.com/2013
  gaybdsmfiction.blogspot.com/2013/07
  gaybeachaction.tumblr.com/post/157097647039/hot-gay-sex-chat-httpxxxcamboyscom
  gaybedfantasy21.tumblr.com/post/173846747421/you-have-nowhere-to-run-bitch-report-handjob-gay
@@ -27791,6 +27817,7 @@ gaycalgary.com/Magazine.aspx?id=64&article=700
  gaychristianz-blog.tumblr.com/post/142658059392/blowjob-hunk-threesome
  gaychristianz-blog.tumblr.com/post/142658368512/first-boys-kiss-on-film
  gaychristianz-blog.tumblr.com/post/142658624402/practising-safe-twink-sex
+gaychristianz-blog.tumblr.com/post/142658776032/gay-adult-website-reviews
  gaychristianz-blog.tumblr.com/post/142659511277/boys-male-twin-models
  gaychristianz-blog.tumblr.com/post/142659992467/register-of-japanese-movies-close-by-gay-guys
  gaychristianz-blog.tumblr.com/post/142660128422/gay-black-mans-cock
@@ -27893,6 +27920,8 @@ gaysofla.com/content/view/380/53
  gaystarhotel71.tumblr.com/post/630711990255534080/big-peewee-roomservice-attendant-has-to-please
  gaystars.org/model/jennifer-emerson/curvy-nude-body
  gaystudvids.tumblr.com/post/130366956097/at-liberty-teen-dating-gay-dating-gay-anal-sex
+gaysvidsgalleries-blog.tumblr.com/post/124702211490/free-twink-gay-boy-movie
+gaysvidsgalleries-blog.tumblr.com/post/124877463640/free-gay-porn-seo-company
  gaytail.com/2019/11/21
  gaytail.com/2019/11/21/twink-pussy-cum
  gaytimes.co.uk/gtstore
@@ -27902,6 +27931,7 @@ gayunderwearpics.com/mf.php
  gayvancouver.net/crossen/
  gayvancouver.net/images
  gayvancouver.net/interactive/
+gayvideobest20.tumblr.com/post/619963022807629824/free-interesting-homo-smut-sheridan-unique
  gayvideotube.blogspot.com/2012
  gazcelebs.com/maria_sharapova
  gazedamazed.tumblr.com/post/137799004953/lesbianstouch-sexy-hot-lesbians-photos-here
@@ -28354,6 +28384,7 @@ giclart.com/romantique
  gicuroky33.tumblr.com/post/73744313821/annette-dawn-videos
  gidiferroblog.altervista.org/sesso-quello-orale-rende-le-donne-allegre
  gieferolehymy1436.blogspot.com/2012/08
+gieferolehymy1436.blogspot.com/2012/12
  gieferolehymy1436.blogspot.com/2013/01
  gieferolehymy1436.blogspot.com/2013/05
  gieferolehymy1436.blogspot.com/2013/06
@@ -28477,7 +28508,6 @@ girlsnmotors.co.uk/babes
  girlsofday.com/index.shtml
  girlsrimming.org/xfsearch/name
  girlssecretgames.blogspot.com/2011/05
-girlswayfreshlesbiansex.blogspot.com/2017
  girlswithmuscle.com/567169
  girlswithmuscle.com/636687
  girlswithmuscle.com/pictures/teresa
@@ -29708,6 +29738,7 @@ guysbigfeetlongtoes.tumblr.com/post/137239235853/theeporndog-you-see-him-clenchi
  guysinspeedos.tumblr.com/post/138153747874/gay-sex-chat-httpbitly1nj2t3s
  guyspeak.com/blog/sex/how-long-should-a-blowjob-take
  guyspeak.com/tag/boobs
+guyswithmussscle-blog.tumblr.com/post/127828920329/gay-men-kissing-com
  guyswithmussscle-blog.tumblr.com/post/127987019989/gay-twinks-boys-gay-sex-free-pics
  guyswithmussscle-blog.tumblr.com/post/127987971544/young-queer-skin-pics
  guyswithmussscle.tumblr.com/post/127828134444/premier-period-gay-moving-picture
@@ -29723,6 +29754,7 @@ guyswithmussscle.tumblr.com/post/128145527119/sex-boy-gay-video
  guyswithmussscle.tumblr.com/post/128145606779/ebony-gay-duration
  guyswithmussscle.tumblr.com/post/128147659729/nude-gay-fat-boys
  guyswithmussscle.tumblr.com/post/128148576584/tube-frat-gay-porn-gay
+guyyonvanovj.blogspot.com/2008/08
  gvsmedia.com/video-2/MZpRsIZqdw0/milf-milfs-teen-teens-BIG-TITS-TIT-HUGE-BOOBS-BOOB-CUM-FACIAL-FACE-BLOW-JOB
  gvsmedia.com/video-2/f3v7wRhtYBw/Hot-Porn-USA-Hardcore-Lesbians-Licking-and-Kissing-Sex-naked-women
  gw2haven.pl/fr/videos154581
@@ -29759,6 +29791,7 @@ gyuaja.infogami.com/blog
  gzumetria43.org/pokemon-porn
  h.webring.com/t/XXX-Amateur
  h0esvck.tumblr.com/post/184817245961/bts-walk-in-on-catch-you-masturbating
+h0esvck.tumblr.com/post/185460818066/bts-reaction-to-fucking-having-threesome-with-you
  h0esvck.tumblr.com/post/190357266271/hellooo-i-found-your-blog-today-and-its
  h0esvck.tumblr.com/post/190371045751/bts-reaction-to-wanting-to-fuck-the
  h0esvck.tumblr.com/post/611773463482466304/a-bts-reaction-to-creampie-maybe
@@ -30209,6 +30242,7 @@ hdkingtube.com/ps/66850/tied-strapon-rape
  hdmovieswatch.net/online/erotic
  hdmovieswatch.net/sunny-leone-18-adult-sex-watch-movie-online
  hdmusictvlive.blogspot.com/2017
+hdnubilessex.com/category/Facesitting
  hdpornclips.tv/pl/3some
  hdpornhits.com/diamond-foxxx-doctor-feet-fucker-2015-hd
  hdporntime.fysyjy.com/mature-whore-is-doing-everything-he-can-to-fuck
@@ -30482,14 +30516,16 @@ hentaibedta.net/video-afternoon-exhibitionists-tomoko-chizuru-hentai-movie-colle
  hentaibrasil.net/category/playboy-e-sexy/
  hentaibrasil.net/playboy-e-sexy-de-maio/
  hentaibros.com/anime/hip-brothel-cum-in-the-whore
-hentaicentral1.blogspot.com/2013/08
  hentaifuntime2.tumblr.com/post/69989587067/ghetto-hentai-elf-with-huge-boobs-gangbang-by
+hentaigames4life.blogspot.com/2019
  hentaigames4life.blogspot.com/2019/03
  hentaigames4life.blogspot.com/2019/11
+hentaigames4life.blogspot.com/2019/12
  hentaigames4life.blogspot.com/2020
  hentaigames4life.blogspot.com/2021
  hentaigvs.blogspot.com/2017/11
  hentailovers2012.tumblr.com/post/108075313412/as-may-continued-to-fuck-the-android-it-started
+hentaimovie.tv/beautiful-hentai-movie-woman-magic-hot-spring-porn
  hentaimovie.tv/hentai-movie-big-boobs-girl-momoka
  hentaiocean.tumblr.com/post/86367572990/eroticneko-breast-sucking-request
  hentaionthego.tumblr.com/post
@@ -30559,6 +30595,7 @@ herresalongen.com/gallery
  hershyj.tripod.com/cartoons/adult
  hertemple.com/goddessdarkbonita/
  hertexasdaddy.tumblr.com/post/96042048112/she-looked-around-at-the-small-arsenal-of-toys-he
+hertzr.blogspot.com/2010
  hesab.net/swish/effect/tmp
  hesse11und.dk/natalia8315
  hesselholdt.dk/playmate
@@ -30780,8 +30817,10 @@ highschoolpornfan-blog.tumblr.com/post/129744586181/virgin-sex-charges-cbs-sacra
  highschoolpornfan-blog.tumblr.com/post/129745655196/arent-teaching-youngs-hard-woman-youthful
  highschoolpornfan-blog.tumblr.com/post/129746230121/couples-sexy-teen-teen-photo-young-girls
  highschoolpornfan-blog.tumblr.com/post/129811257446/bteen-sex-comedies-nthat-play-schoolgirl-movie
+highschoolpornfan-blog.tumblr.com/post/129812533296/cutie-girls-credibility-stories-sexy-school
  highschoolpornz-blog.tumblr.com/post/128144959906/porn-sex-collegegirl
  highschoolpornz-blog.tumblr.com/post/128226779946/teen-dramas-first/amp
+highschoolpornz-blog.tumblr.com/post/128369412301/pale-collegegirl-man-named
  highschoolpornz-blog.tumblr.com/post/128443868416/dating-violence-among-young
  hightproducts.com/product/high-t-black-hardcore
  higle9902.unblog.fr/2011/02/12/erotic-sexy-lingerie-love-bad-girl-surgery352
@@ -31821,7 +31860,6 @@ homemadeselfshhotnsfwcan391.tumblr.com/post/131500128399/nakedgirlstoplessblog-n
  homemadevideos24.com/en/homemade/ii7272607e7e7570711a10/Japanese
  homemadevideos24.com/en/homemade/ii7272607e7e7570751e1e
  homemadevideos24.com/fr/homemade
-homemoviestube.cc/film
  homemsubmisso1981.tumblr.com/post/24957431867/showmeyouriphone-cleavage-alert-brandi
  homepage.altavista.com/fgirlsuk
  homepage.eznet.net/~patches
@@ -31994,6 +32032,7 @@ honeymoons.about.com/od/womensexpositions
  hongfire.com/forum/100559-bisexual-hentai
  honolulu.craigslist.org/m4w
  honolulupulse.com/events/kailua-student-named-december-playmate
+hoodclip.tumblr.com/following
  hoodoo12.tumblr.com/post/623521869323173888/heated-clone-orgy-33
  hoodstars.com/tags/mercedes
  hoodyman-ssbbw-addiction-forever.tumblr.com/post/143304490308/hotbbwrachel-wanna-get-a-horny-bbw-pussy
@@ -32007,6 +32046,7 @@ hopefulteengirls-blog.tumblr.com/post/124280413628/sex-pussy-teen
  hopelessloversub.tumblr.com/post/106979172990/dirtygirlzincontrol-keep-your-hands-behind-your
  hopesandfears.com/hopes/now/question/216345-what-s-the-difference-between-erotic-and-pornographic
  horae.dti.ne.jp/~nextwave/
+horansqueen.tumblr.com/post/177545871221/a-smut-where-harry-wakes-you-up-with-oral-sex
  hormiga.org/fondosescritorio/wallpapers/Famosos
  hornedsdguy.tumblr.com/post/123797716997/holy-fuck-i-want-to-feel-you-deep-in-my-hole
  hornet.com/stories/pedophiles-are-mostly-heterosexual
@@ -32134,6 +32174,7 @@ hot97.com/news/morning-show/porn-stars-sara-jay-gianna-michaels-breaks-down-work
  hotactresslisaann.blogspot.com/2011/03
  hotaddict.tumblr.com/page/60
  hotamericano.blogspot.com/2013
+hotamericano.blogspot.com/2013/01
  hotandexposed.tumblr.com/post/57823116238/actor-ian-parks-naked-and-hard
  hotasiangirls.info/blog
  hotassgirlfriendgetsacreampie.blogspot.com/2013/06
@@ -32164,7 +32205,6 @@ hotdot38.tumblr.com/post/117381345643/girls-who-love-masturbation-girls-who-love
  hotelmaco.spar.ge/melida3544
  hotelsiar.com/a-up-they-prostitute-patrons-adult-webcam-chat-of/
  hotelysia18.com/fsm/06
-hoteroticcomics.blogspot.com/search/label/Blowjob
  hotfemmeofficial.tumblr.com/post/98810844400/only-porn-models-photos-xxx-lingerie
  hotfilme.net/home.php?revenda=
  hotfreegraphics.com/topgraphics/
@@ -32210,7 +32250,6 @@ hotmax.pl/dana_shemale
  hotmax.pl/sexi_bitch166
  hotmax.pl/shemale_monika
  hotmax.pl/shemale_warsaw
-hotmilfhardcord.blogspot.com/2013
  hotmodelvideos.piczo.com/?cr=5&rfm=y
  hotmoms247.tumblr.com/post/128781256465/fuck-a-horny-milf-tonight-httpbitly1kivvdi
  hotmovies.linux-dude.com/download
@@ -32235,6 +32274,7 @@ hotsites411.com/Entertainment/Adult
  hotspymovs.com/video/ws672178124f1
  hotstuffxxxxzz.tumblr.com/following/page/10
  hottest-stuff.tumblr.com/post/41648576289/blonde-teen-fucked-good
+hottestdivas.blogspot.com/2012/05
  hottestebonybabes.blogspot.com/2012/07
  hottestville.tumblr.com/archive
  hottienselfshot.tumblr.com/post/33626540222
@@ -32261,6 +32301,7 @@ hotxxxadultvideos.tumblr.com/./petits-films-sodomie-030-
  hotxxxadultvideos.tumblr.com/post/164924173888/petits-films-sodomie-030-visitez-go-to
  hotxxxpornwatch-blog-blog.tumblr.com/post/120063717959/tight-virgin-pussy-fuckrf-hard-big-cock
  hotxxxyoungnude-blog-blog.tumblr.com/post/119807735505/free-teen-porno-15-years
+hotxxxyoungnude-blog-blog.tumblr.com/post/119892701680/pics-of-teeny-girls-getting-cum-on-there-face
  houseofdarkpassion.blogspot.com/2010/03
  houseofdavid.ws/images/uploaded
  houseofnylon.tumblr.com/post/139314901790/pantyhosefetishpics-more-pantyhose-photos
@@ -32287,12 +32328,12 @@ how-to-reduce-body-weight.weight-loss-central.org/home
  how-to-reduce-body-weight.weight-loss-central.org/sex--Supplement-
  how-to-reduce-body-weight.weight-loss-central.org/weight
  howaboutwe.com/date-report/how-pornified-is-your-sex-life
+howdowegethome.tumblr.com/post/68729665510/ex-pornstars-on-the-porn-industry
  howinninn.fishingdiaries.com/2007/12/30/bikini-free-picture-sexy-free-barros-gabriela-pic-picture-sex
  howiwantmygirl.tumblr.com/post/152533783156/oldmanmires-amateurteennaked-stiffskvngr
  howtobeapublicspeakingsuperstar.com/review/tag/cybersex
  howtogermany.com/pages/css/6
  hpgloja.ig.com.br/estylusexshop/
-hpivys.blogspot.com/2014
  hpporn.blogspot.com/2019/05
  hppoudlard.forumactif.org/t90-real-mature-wife-amatuer
  hpps.com/jcom
@@ -32309,6 +32350,7 @@ hqhole.pro/fr/search/scat-kiss-lesban
  hqhole.pro/pl/search
  hqmonkey.myserver.org/interracial
  hqphotography.com/wordpress
+hqporner.rocks/hq/alley-baggett-nude
  hqsexe.com/sexefrance
  hqsites.dnip.net/bang-boat
  hqteens.fast-stars.com/nubiles/selena/1
@@ -32453,7 +32495,6 @@ humorsphere.com/sms
  humour-et-rire.com/humoursexy/
  humour-funny.mylinea.com/humour_sexy
  humour-funny.mylinea.com/video_humour
-humour-jardin-blonde.blogspot.com/2011/12
  humour-westindies.org/zone_x
  humour.bz/images
  humour.com/videos
@@ -32473,10 +32514,10 @@ hungblkmaster76.tumblr.com/post/109437744902/kneel-before-your-king
  hungcalf.com/t4054-in-what-kind-of-fucked-up-world-would-that-be-allowed-to-happen-pv-yona
  hungeuropeans.tumblr.com/post/48458501361/bigdicknickb-english-amateur-horse-cock
  hungguyshungry.tumblr.com/following
+hunghottranny.blogspot.com/search/label
  hungnhorny.tumblr.com/post/111559925308/dumbworthlessfucktoys-wanted-daddy-all-day
  hungry-and-horny.tumblr.com/post/113922939788/bondage-and-ice-cream
  hungrytermite.tumblr.com/post/106791672897/ucanb1too-first-lesbian-fff-pt-2-fucking-hot
-hunguponfashion.blogspot.com/2011
  hunkcraver.com/muscle/Vascular_10_hon
  hunkcraver.com/muscle/Vascular_24_sood
  hunkcraver.com/muscle/lq_07_4lagn
@@ -32604,6 +32645,7 @@ i191.photobucket.com/albums/z158/adelineandhazel/celebs
  i2e2.com/camerondiaz
  i3log.com/adult-trade-rss.xml
  i61.photobucket.com/videos/search/sex
+i88d3.blogspot.com/2007/10
  iaa-bg.org/alyssa-lovelace
  iac3.eu/ftp-put-turque-sexy-site-gratuit-de-libertinage-tchat-adult-plans-q-gratuit-aubervilliers
  iafrica.com/loveandsex/sexadvice/qna
@@ -33640,6 +33682,7 @@ ift.tt/1gIo31R
  ift.tt/1hGJhz8
  ift.tt/1hKdsWi
  ift.tt/1hN7K61
+ift.tt/1hOwClL
  ift.tt/1hV83Lf
  ift.tt/1hY5vwo
  ift.tt/1hgsaDw
@@ -33854,6 +33897,7 @@ ift.tt/21epBoB
  ift.tt/223fx29
  ift.tt/2Nsk38B
  ift.tt/2OypPWX
+ift.tt/2RBUva7
  ift.tt/2oe3BAr
  ift.tt/2rK7ZXO
  ift.tt/2w6GADs
@@ -33963,7 +34007,6 @@ ilfattoquotidiano.it/2013/11/06/georgie-e-licia-non-erano-santarelle-il-sesso-ce
  ilfattoquotidiano.it/2013/11/06/georgie-e-licia-non-erano-santarelle-il-sesso-censurato-nei-cartoon/768441/
  ilga-lac.org/en/international-lesbian-gay-bisexual-trans-and-intersex-association-for-latin-america-and-the-caribbean
  ilike.com/artist/Horny
-ilikewomenpics.blogspot.com/2010
  ilimitado.us/category/conteudo-adulto/
  ilkcm.tumblr.com/post
  illegalfight.com/fight
@@ -34413,6 +34456,7 @@ imgur.com/user/bustyblonde
  imhornyboy69.tumblr.com/post/129511928471/shefinallyfuckedhim-milfsearcher
  imhornyboy69.tumblr.com/post/129512428651/shefinallyfuckedhim-imhornyboy69
  imineo.com/adulte
+imineo.com/adulte/porno-hetero
  imineo.com/cinema-fictions/cinema/adulte/fetichisme-sm
  imineo.com/cinema-fictions/erotique
  imineo.com/fiction/charme
@@ -34455,6 +34499,7 @@ imvanntastic.tumblr.com/post/9198938488/joroxoutloud-fuckingjayy-chyeaahitssean
  imvu.com/rooms/mon-putain-de-bordel-penthouse
  in.truveo.com/bitches-tight-pussy-nailed-by-huge-rod/id/1035299019
  in.webcounter.cc/%2d%2d%2d%2d
+in35.com/videos
  inappropriate-gentleman.tumblr.com/post/99766324192/lets-get-naked-and-let-our-tongues-have-some-fun
  inbedwithyou.com/videosales/
  inblogs.net/swingers-alt-sex-blog
@@ -34465,6 +34510,7 @@ incestlover30.tumblr.com/post/95196024798/nude-shoutouts-my-ejaculation-video-en
  incestperversion.tumblr.com/post/93865442567/i-just-shot-cum-up-and-onto-my-face-jerking-to
  incestperversion.tumblr.com/post/93865442567/i-just-shot-cum-up-and-onto-my-face-jerking-to-your
  incestrapestories.paginas.sapo.pt/zoo
+incestshortstory.blogspot.com/2017/05
  inch.com/~snack/ginger
  incidentalhotwife.blogspot.com/2015
  inclusivechurch.net/forum/db/femdom-tgp
@@ -34872,7 +34918,6 @@ internalpathways.blogspot.com/2012/10
  international-transport-autos.com/adult-porn-xxx-videos-femmes-du-cul-la-courneuve
  international-transport-autos.com/sex-erotic-xxx-femme-partouze-epinay-sur-seine
  international-transport-autos.com/shaved-pussy-annonces-rencontre-sex-saint-sebastien-sur-loire
-internationalsissyboy.blogspot.com/2010
  internationalweb.sk/005
  internationalweb.sk/012
  internet-club.com/usa/karogers
@@ -35360,6 +35405,7 @@ janesehxy.tumblr.com/post/28213634544/studentparties-sex-porn-teen-gorgeous-blon
  janette289.ifrance.com/bite
  janewinther.com/buy-an-essay-now
  janine-trans86.tumblr.com/post/139789931307/shemalelover124-big-dick-bitches
+jankuit.nl/wordpress/2015/09
  jannesta.tumblr.com/post/112863970096/megatubeporn-mature-tube-porn-xxx-milf-sex
  jannina.com/erotismo
  jannonce.be/annonce/erotique/
@@ -35382,7 +35428,6 @@ japan-sogo.net/shop/ranking/adult
  japanator.com/deals-to-write-home-about-tokyopop-sale-at-borders-4425.phtml
  japanbukkakevideos.blogspot.com/2020
  japanese-bondage-bbw-2013.blogspot.com/2017/11
-japanese-lesbians.blogspot.com/2005
  japanese-panty.com/pantybusters
  japaneseteengirlsgetfucked.blogspot.com/2017/05
  japanporns.pro/en/xvideos/Throatfucking.xhtml
@@ -35671,12 +35716,14 @@ jiggypics.net/jiggypicssa133
  jiggypics.net/jiggypicssa145
  jiggypics.net/jiggypicssa148
  jiggypics.net/jiggypicssa151
+jihoonluvclub.tumblr.com/post/181735598797/fallen-m
  jihoonluvclub.tumblr.com/post/182700348257/addend-m
  jiiaii.com/profiles/blogs/dead-celebrities-2009
  jilatjilbab.blogspot.com/2019
  jilbabkebelet.blogspot.com/2019
  jilbablesbi.blogspot.com/2019/06
  jimendos.ifrance.com/images
+jiminiemochisexybabe.tumblr.com/post/629171603015696384/pretty-puppy-pjm
  jiminsasscracck.tumblr.com/post/163469478873/bts-reaction-to-receiving-a-great-handjobblowjob
  jimmyfury.tumblr.com/post/110523980854/penis-penis-penis-dick-dick-penis-cum-sex-cum
  jimmyr.com/blog
@@ -35707,6 +35754,7 @@ jira.public.thoughtworks.org/browse/CC-515
  jislover.tumblr.com/post/139735837839/swingingcouplesporn-swinger-sex-personals
  jitterbug.com/spank
  jiveturkeys.com/bob/bob1
+jizzbunker.net/de
  jizzfarm.com/fr/search/sunny-lone-new-porno
  jizzmovies.tumblr.com/post/93523746388/http-www-butchercocks-com-you-gotta-fuck
  jizzoncam.com/videos/808/lusycandy-huge-natural-boobs-double-penetration-webcam-masturbation
@@ -35833,6 +35881,7 @@ jokes4all.net/funpics/sex
  jokes4all.net/games/genres/erotic
  jokes4all.net/jokes/sex
  jokesinthemail.com/sex-jokes
+joko-subianto.blogspot.com/2014
  joko-subianto.blogspot.com/2014/10
  jokovino.tumblr.com/post/66668661082/xsmokingfetish-hot-smoking-slut-fetish-sex-mate
  jolting.net/cam
@@ -36538,6 +36587,7 @@ killer-symbol.tumblr.com/post/118126950372/hentaifairytailgratuit-il-gangbang-ce
  kilty3753.tumblr.com/post/151517898373/kilty3753-watched-mi-abuelo-para-q-lavarse-de-la
  kimalama.tumblr.com/following/page/4
  kimbellaxoxo.tumblr.com/post/134307781918/come-make-my-shemale-pussystick-squirt
+kimcilasia.blogspot.com/2013/01
  kimdarby.free-site-host.com/sybian-b8a
  kimkardashiangalleries.blogspot.com/2011/03
  kimmykimkimkimkimkim3.tumblr.com/page/7
@@ -36587,6 +36637,7 @@ kingstubepornhots.blogspot.com/2011/08
  kingstubepornhots.blogspot.com/2011/09
  kingstubepornhots.blogspot.com/2011/10
  kingstubepornhots.blogspot.com/2012/01
+kingstubepornhots.blogspot.com/2012/03
  kingstubepornhots.blogspot.com/2012/04
  kingsuckjin.tumblr.com/post/632277789421305856/wait-your-turn/amp
  kingvirgo09.tumblr.com/post/134849210368/gay-tumblr-instant-messagefollow-train
@@ -36758,6 +36809,7 @@ kinkydeliciousness.tumblr.com/post/127200182949/straponfemdomnbj-bondage-hot-and
  kinkygaga.tumblr.com/post/79104373684/strip-tease-for-you-click-here-for-the-video
  kinkyhornytwink.tumblr.com/post/110667518118/bate-orade-submit-your-pics-masturbate-with-me
  kinkyinga.tumblr.com/post/99438495004/bondageandwsslave84-dirtyzdog-dirty-dawgs
+kinkylesbos.blogspot.com/2016/08
  kinkylovescarface87.tumblr.com/post/130272100710/kinky-bdsm-scat-fuck-facial
  kinkymagnus.tumblr.com/post/625670342510346240/magnus-breaking-the-record-for-pandemonium-for
  kinkynerdyblackguy.tumblr.com/post/147659698595/mysexyanimegirl-reblog-if-you-love-sexy-anime
@@ -36973,7 +37025,6 @@ kolhorn.eu/plan-nichons-aube-cul-gros-fran
  kolumbus.fi/cancerr/
  kolumbus.fi/cancerr/porn
  konachan.com/post/show/209407/ass_grab-bed-benimura_karu-blush-breasts-censored-
-konata007.blogspot.com/2011/04
  konbini.com/fr/entertainment-2/video-erotisme-manipulation-cinema/
  konbini.com/fr/inspiration-2/intimite-jessie-andrews-pornstar
  konbini.com/fr/tendances-2/adult-magazine-erotique-pour-tous/
@@ -37183,6 +37234,7 @@ kwmap.com/pages
  ky-nsfws-sanders-sides.tumblr.com/post/189170180322/kinktober-22-masturbation-everyone-fucking/amp
  kyelewis.info/go/guestbook
  kyliekash.com/potd/Non_Nude
+kyluxhardkinks.tumblr.com/kinks
  kynkiss.com/fr
  kyoto-inet.or.jp/people/photos/nudes
  kyoto-inet.or.jp/people/ytam0609
@@ -37205,6 +37257,7 @@ l1dc110e.789mb.com/porno-movie-archive-anal-butt-fuck-thumb
  la-courneuve.wannonce.com/rencontres-adultes-85/
  la-kings.com/britneyspears/
  la-mere-au-foyer-nympho-marocaine.blogspot.com/2013
+la-mere-au-foyer-nympho-marocaine.blogspot.com/2013/09
  la-nasa.com/videos-porno/
  la-niche.top-forum.net/t1114-la-petite-culotte
  la.backpage.com/Domination/sexy-petiteand-kinky-sensual-sadist-ms-vanessa-lux
@@ -37268,6 +37321,7 @@ lady-bakuhoe.tumblr.com/post/188556901889/kinktober-day-twenty-four-rimming-dabi
  lady-bakuhoe.tumblr.com/post/190575671839/the-thought-of-straddling-kiri-to-suck-on-his-cock
  lady-claire-bdsm-lesbian-nude-sports.blogspot.com/2011/06
  lady-claire-bdsm-lesbian-nude-sports.blogspot.com/2011/07
+lady-claire-bdsm-lesbian-nude-sports.blogspot.com/2011/08
  lady-claire-bdsm-lesbian-nude-sports.blogspot.com/2012/04
  ladyapocalypsexxx.blogspot.com/2021
  ladyboyloversinc.tumblr.com/post/143123881734/live-shemale-chat-httpxxxtrannycamscom
@@ -37472,6 +37526,7 @@ laughfactory.com/jokes/sex-jokes
  laughmason.tumblr.com/post/133438423490/i-was-feeling-pretty-bootylicious-after-my-workout
  laurasneckbite.tumblr.com/post/46752090302/vagina-clitoris-penis-sex-sex-sex-fuck-me
  lauravalerieporn.blogspot.com/2009/01
+laurengaybello.tumblr.com/post/87052714787/no-business-like-show-business
  laurengaybello.tumblr.com/post/87052714787/no-business-like-show-business/amp
  laurentletadic.tumblr.com/post/129204076278/el-homoerotismo-de-gregory-prescott
  lava.net/~cicerale
@@ -37485,6 +37540,7 @@ lavieenrosebcn.com/fr/blog/recits-erotiques/
  lavieenrouge.blog.elle.fr/2006/04/10/le-petit-chaperon-rouge-une-sale-histoire-2
  lavishavenue.com/category/babes/
  lavishavenue.com/collect/girls/
+lavishedinjimin.tumblr.com/post/188315991277/could-i-request-where-rms-been-teasing-you-all
  lavishedinjimin.tumblr.com/post/622856838700007424/face-sitting-demon-jk-with-horns-like-a-steering
  lavishedinjimin.tumblr.com/post/624316205412564992/overstimulation-and-clit-torture-with-jk-maybe
  lavishedinjimin.tumblr.com/post/624631580960456704/mutual-masturbation-with-tae-but-ends-up-fucking
@@ -37506,6 +37562,7 @@ lazydillonharpercollector.tumblr.com/post/131928576336/dangerousqueenwhispers-je
  lazydillonharpercollector.tumblr.com/post/132014654846/dangerousqueenwhispers-jesse-jane-riley-steele
  lazydomme.blogspot.com/2011
  lazygeisha.com/2007/02/20/whore
+lazyninjas.tumblr.com/post/143225445855/call-me-miss-fox-megan-fox
  lazyquest.com/galleries/
  lazyquest.com/galleries/001
  lazyquest.com/galleries/002
@@ -37784,7 +37841,6 @@ lesbeehive.com/2015/04/29/
  lesbeehive.com/2015/04/29/new-zoe-kravitz-editorials-2/
  lesbeehive.com/category/erotica/
  lesbgirls.com/exitpaged
-lesbian-tgp-pics1324.blogspot.com/2005/01
  lesbianbutterfly.com/favicon.ico
  lesbiandgayy.tumblr.com/./meet-lesbian-bisexual-and-quee
  lesbiandgayy.tumblr.com/post/168215607390/meet-lesbian-bisexual-and-queer-people
@@ -37909,6 +37965,7 @@ lexode.com/videos/tag/1909-facon-sex
  lexode.fr/galerie
  lexpress.fr/styles/sexo/
  leyi.com/hotsex
+lezarceleurs.blogspot.com/2015/01
  lezbian-world.org/pornpunish
  lezbo22-deactivated20130108.tumblr.com/post/38715197640/passionate-lesbian-sexyumm
  lezdreamer69.tumblr.com/post/144695179102/jackieseroticlesbiandream-kinky-femdom
@@ -38592,6 +38649,7 @@ looksmart.com/whitespc/bettersex
  lookup.com/homepages/62385
  loonyboi.com/gillis
  loooch.k-beta.net/global/2011-01/479-scat
+loooooooooooomook.blogspot.com/2020/07
  loop.com/~iambhall
  loop.com/~ideal/private/blondes
  loose-weight.weight-loss-central.org/Anna-Nicole-weight-loss
@@ -38766,6 +38824,7 @@ lovefilm.com/browse/film/adult
  lovefilm.com/visitor/browse_contributor/62634
  loveforum.net/archive
  lovefutabu.tumblr.com/post
+lovehatemysme.tumblr.com/post/614582573968015360/zen-x-mc-pure-smut-zen-would-be-lying-if-he
  lovehoney-com-au.tumblr.com/lovehoneyau
  lovehoney-com.tumblr.com/lovehoneycom
  loveinextasis.tumblr.com/post/125400938848/mildwildporn-visit-our-100-free-sex-chat
@@ -38773,6 +38832,7 @@ loveinparadise.com/bph1
  loveinparadise.com/df
  loveinterracial-deactivated2014.tumblr.com/post/68915059212/mrmandingodick-that-intense-relationship-sex
  loveiscolour.tumblr.com/post/56597364714/exoticwomenofcolor-ana-foxxx
+loveislattes.tumblr.com/post/631310080681328640/behind-closeddoors-wilfordfemreaderdark-smut
  lovekicked.tumblr.com/archive
  lovelabiaz.tumblr.com/post/137618473314/sexy-nude-horney-which-one-do-you-think
  loveletters.tribe.net/thread/fce72385-b146-4bf2-9d2e-0dfa6ac7142d
@@ -38909,6 +38969,7 @@ lucrablog.com/bomecs/
  lucrablog.com/sexy-coquin
  lucsoum.tumblr.com/following
  lucsoum.tumblr.com/post/173258972516/comment-je-suis-en-train-de-devenir-la-petite-pute
+lucsoum.tumblr.com/post/174518592081/hot-young-girls-with-strapons-live-on-webcam-adult
  lucyfelthouse.co.uk/mid-week-tease
  lucywardiswatchingyou.tumblr.com/post/110100529990/five-nudes-at-freddies
  lucywardiswatchingyou.tumblr.com/post/71133898622/xxmistys-christmas-jade-harley-nudestuck-model
@@ -38927,6 +38988,7 @@ lulu.com/shop/xdm/adult-nude-photo-book-busty-xxx-all-stars-brooke-haven-vol-2
  lulu.com/spotlight/sexysluggers
  luluattentionwhore.tumblr.com/post/138790562598/my-first-no-nude-reblogjust-fucking-hot
  lulz.ru/g/
+lumen74.tumblr.com/following/page/12
  lumen74.tumblr.com/following/page/13
  lumendatabase.org/notices/21172959
  lumendatabase.org/notices/21304088
@@ -38985,6 +39047,7 @@ luscious-gems.com/silvia2808
  lusomoney.com/members
  lust20.tumblr.com/post/92011040496/so-fucking-hot
  lustfuldevils.tumblr.com/post/175619950321/wonhoreader-genre-smut-warnings-oral/amp
+lustfuldevils.tumblr.com/post/187091387641/bts-reaction-their-so-having-a-large-butt-and
  lusting-after-tomorrow.tumblr.com/post/137143384476/sweetsluttyangel-life-is-too-short-to-pretend
  lustre.be/anggun8484
  lusty--bubs.tumblr.com/post/118388266127/rocker-gangbang
@@ -39513,6 +39576,7 @@ makemycell.webcristiano.org/2008/01/05/free-eva-big-brother-from-krystal-pic-boo
  makemylemonade.com/diy-culottes
  makeoneq.blogspot.com/2011
  makeoneq.blogspot.com/2012
+makeoneq.blogspot.com/2012/10
  makeoneq.blogspot.com/2013
  makesyouwet-wet.tumblr.com/post/108665928750/brutal-bdsm-double-penetration-gangbang
  makethatkittenpurr.tumblr.com/post/79847347018/forgot-to-post-this-yesterday-oops
@@ -39521,6 +39585,7 @@ makingcontact.net.au/joomla/templates/rhuk_solarflare_ii/.rhyk
  makorrahentai.tumblr.com/post/111668190453/xseimoneredx-makorra-i-want-your-sex-im-not
  maksylmyheart.tumblr.com/post/90391364658/morning-part-3-pure-smut
  maktoobblog.com/sexywomen-world
+malachsoldblog.blogspot.com/2007/05/happy-mothers-day
  malayfuck.net/lucah/amature-rimjob
  malayfuck.net/lucah/grose-busen
  malayfuck.net/lucah/grosse-busen-milch-saugen-youpornhardcore-com
@@ -39538,7 +39603,6 @@ malearmpits.tumblr.com/post/75492147529/title-hard-brit-lads-harley-everett-and-
  malechastityjournal.com/2015/11/25
  malefirst.co.uk/lifestyle-fashion
  malegenitalmodsgalore.tumblr.com/post/146667114233/malegenitalmodsgalore-bdsm-cbt-scrotum
-malehardcoreporn.blogspot.com/2012
  malehotnessguys.tumblr.com/page/24
  malehotnessguys.tumblr.com/page/46
  malehotnessguys.tumblr.com/page/47
@@ -39552,6 +39616,7 @@ malehotnessguys.tumblr.com/post/116782890720/nude-free-twink-teens
  malehotnessguys.tumblr.com/post/116868740235/hairy-gay-bear-fuck
  malehotnessguys.tumblr.com/post/116868893085/gay-hot-men-naked-sexy
  malehotnessguys.tumblr.com/post/116869285280/gay-male-escorts-rocky-dallas
+malehotnessguys.tumblr.com/post/116869792610/boy-model-links
  malehotnessguys.tumblr.com/post/116871115940/chubby-gay-midget-sex
  malehotnessguys.tumblr.com/post/116871140455/gay-male-escorts-marion-ohio
  malehotnessguys.tumblr.com/post/116872380830/gay-sex-gay-dad
@@ -39773,7 +39838,6 @@ marcus1366.tumblr.com/post/130746037100/veryhot-sexyeyes-blowjob-smoking-horny-h
  mare-ylover.tumblr.com/post/115689591595/to-men-who-fantasize-about-women-having-sex-with
  marelibri.com/t/main/3291928-erotique
  marfmellow.com/post
-margretloveday62-blog.tumblr.com/lesbians-scissoring-video
  mari.dip.ghks.de/bdsm
  mari.dip.ghks.de/cartoon
  mari.dip.ghks.de/gay
@@ -39882,6 +39946,7 @@ mashtxns-babygirl.tumblr.com/post/91499515978/my-older-boyfriend-ashton-irwin-sm
  mashtxns-babygirl.tumblr.com/post/93743666823/tour-bus-fun-5sos-gang-bang-requested
  mashupvidz.com/2014
  masi-music.com/film-82a53-amateur-zoophilie
+masivegayorgy-blog.tumblr.com/post/126953376155/gay-boy-up-the-ass
  masivegayorgy-blog.tumblr.com/post/127035147450/boom-tube-gay-next
  masks.site.voila.fr/sexy_russian_girl
  masoberlin.tumblr.com/post/108358612587/gay-bdsm-world-kinky-gay-bondage-live-on-webcam
@@ -39959,15 +40024,16 @@ mattymacc.tumblr.com/post/131897572470/hotgaymales-getting-nude-outside-and-some
  maturbationation.tumblr.com/post/119679871374/sensual-sexxx-fckinglikerabbits-i-swear-this
  mature-bot.com/hq/posing
  mature-fuck-young-chubby-pussy-mastur.blogspot.com/2011/10
+mature-older.blogspot.com/2011
  mature-stockings-hax-blog.tumblr.com/post/12376174411/leading-news-about-stockings-mature
  mature-stockings-hax-blog.tumblr.com/post/12385320149/stockings-mature-latest-news
  mature.dyndns.org/mature
  maturebubble.com/gallery/hot-and-horny-mom
+maturecams.com/landing/templates
  maturefishka.org/index.php
  maturelover69.tumblr.com/post/99259347855/bbwgothcumsex-anal-closeup-here-is-the-free-hq
  maturen2.tumblr.com/post/109361226998/beachbatorfucker-cocksucker-sucking-me-during
  maturestunners.tumblr.com/post/71954909801/hotmaturepic-babes-lingerie-erotic-pics
-matureugasianugmilf.blogspot.com/2009/01
  maturewhisper.tumblr.com/post/9206624262/lingerie-milf-handjob-ejaculation
  maturewomansexwebcam.blogspot.com/2013
  maturezootube.fun/fr/bestiality/best/1
@@ -39984,7 +40050,6 @@ mavieamoureusedemarde.blogspot.fr/2013
  maviedefemme.com/amour-et-sexualite/erotisme-et-sexualite/astuces/les-regles-dor-pour-reussir-un-striptease
  max-boot.com/hips
  max-emule.com/sexe
-max-vos.blogspot.com/2015
  max.hi-ho.ne.jp/creampie
  max.hi-ho.ne.jp/hotaru/panty
  maxalbums.com/mp3/photos/artist/bizarre-sex-trio
@@ -41562,6 +41627,7 @@ memeijuana.tumblr.com/post/101770893108/seedy-when-adults-say-teenagers-are-too-
  memekindoporn.blogspot.com/2019
  memepool.com/Subject/Sex
  memes.com/img/15561
+memories-of-howdy.blogspot.com/2020
  memphisshowoff.tumblr.com/post/140442403526/not-that-is-cock-control
  men.gr/53/eleni
  men.netscape.com/story/2007/08/17/are-chicks-with-shaved-hair-sexy-the-mena-suvari-case-pic-poll
@@ -41871,6 +41937,7 @@ midwestmandy.net/galleries
  midwestwhiteboyneedsblksluts.tumblr.com/post
  mienfoks.blogspot.com/2008
  mientrassigasaliendoelsol.blogspot.com/2013
+miesissycumslut.tumblr.com/following
  mifleshlight.com/tienda/
  mifleshlight.com/tienda/default.php?ref=1246
  mightydarktiger2.tumblr.com/post/137268461455/fuck-i-could-really-go-for-a-blowjob-right-about
@@ -41880,7 +41947,6 @@ migits-penis.blogspot.com/2011
  migromantic.blogspot.com/2011
  miguelfr.iquebec.com/archives
  miguelsancho.com/bdsm-stories-to-fit-all-users
-mihaileremin3.blogspot.com/2013/12
  mijneigenfavorieten.nl/bizarsex
  mijneigenfavorieten.nl/pornolinker
  mijneigenfavorieten.nl/sexinholland
@@ -41918,6 +41984,7 @@ milfsaffair.com/index.php?skin=189&i=1
  milfspussies.tumblr.com/post/110658005300/random-sex-chat-fun-milf-pussies
  milfspussies.tumblr.com/post/111068692130/random-sex-chat-fun-milf-pussies
  milfsxporn.com/q/bigcock
+milijay.blogspot.com/2011
  milindriki.com/gratis/gratixxx/index.htm
  milkiss2.com/avnewworld
  milkteen.com/ba
@@ -42058,6 +42125,7 @@ mipagina.euskaltel.es/oscar33/
  miportal.es/temasexy/
  mirage.kky.vslib.cz/~zich/pictures
  mirandahooker.blogspot.com/2012
+mirandahooker.blogspot.com/2012/12
  mirandahooker.blogspot.com/2013/01
  miravia.com/images/images/New/rape
  miravia.com/images/images/New/zoo
@@ -42562,7 +42630,9 @@ mm-sexy-models.blogspot.com/2012
  mm.iit.uni-miskolc.hu/data/ladies
  mmamania.com/2014/11/1/7141989/ufc-pic-arianny-celeste-flaunts-deep-cuts-and-sexy-butts-for-halloween
  mmanews.com/war-machine-using-christy-macks-porn-career-as-sexual-assault-defense
+mmf-bisexual.blogspot.com/2005
  mmf-porn.blogspot.com/2005
+mmf-porn.blogspot.com/2005/02
  mmf.static.net/groupsex
  mmfbisexualpornfreefetis.blogspot.com/2009
  mmiriww.blogspot.com/2014/10
@@ -42681,7 +42751,6 @@ modern-relationships-deactivate.tumblr.com/post/35754718746/sexy-lesbian-threeso
  modern-relationships-deactivate.tumblr.com/post/35754733554/lesbian-gif-sex-gifs
  moderngays.com/just45-27hardcore
  modernhumorist.com/mh/0205/free
-modesto-adult.blogspot.com/2008
  modesto.fr.craigslist.org/tlg
  modifiedstreetcars.com/girl_images/
  modifiedstreetcars.com/girl_thumbs/
@@ -42731,6 +42800,7 @@ momolecoq.com/gallery
  momolecoq.com/les-photos-les-plus-sexy-de-christina-aguilera-1771
  momomo1966.exblog.jp/2434993
  momroleplay.com/tag
+momsextube.pro/en/search/sex-erotyka-free
  momsneedblack.tumblr.com/post/117746193313/sissy-hypno-collected-works
  mon-actu.com/actu/recherche/683
  mon-poeme.fr/exemple-lettre-erotique
@@ -42739,7 +42809,6 @@ mon-web.eu/html/modules/Wallpaper/cat/starsfemme
  mon.cc/f/3QNxMTM
  mon.cc/f/3gNxMTM
  mon.cc/f/3wNxMTM
-monabricot-com-blog.tumblr.com/post/6432182444/sex-video-perso-sex-sexy
  monbestseller.com/auteur/liste/erotique
  monblogz.fr/femme-sexy
  mondaymag.com/adult/
@@ -42796,6 +42865,7 @@ monpyjama.info/pagex
  monroman.com/romans/erotisme/contes-pour-adultes
  monsecretdalcove.blogspot.com/2015/09
  monsecretdalcove.blogspot.com/2016
+monsecretdalcove.blogspot.com/2016/08
  monsieurlam.com/2008/02/27/sex-toy-jai-teste-pour-vous
  monsieurlam.com/2009/04/30/ou-quil-est-le-cu-cul-ou-quelle-est-la-te-tete
  monsieurlam.com/2009/07/10/monts-et-merveilles
@@ -42991,6 +43061,7 @@ mood.fr/Sexo/Dico-sexo
  mood.fr/Sexo/Lecons-erotiques
  moohoney.com/wwayw.com/
  moonfleet1.tumblr.com/post/62433721707/dominationsex-girl-picture-deepthroat
+moonflowerrukachan.blogspot.com/2013/02
  moonienico.tumblr.com/post/619079270534447105/m1551n6y0ump4-domreader-x-subbaekhyun
  moonienico.tumblr.com/post/619323244712001536/a-lazy-morning
  moonlight.inter.net/pictures
@@ -43216,6 +43287,8 @@ moviesxxxporn-blog.tumblr.com/post/127274969184/underweight-virgin-girls-live-we
  movieteensex-blog.tumblr.com/page/2
  movieteensex-blog.tumblr.com/page/3
  movieteensex-blog.tumblr.com/post/124370028318/hustler-barely-legal-youthful-sluts
+movieteensex-blog.tumblr.com/post/124445290393/daddys-naughty-cutie
+movieteensex-blog.tumblr.com/post/124447665073/pre-maiden-kiddy-nudist-free-pics
  movieteensex-blog.tumblr.com/post/124619150638/teenybopper-girl-finger-masterbating
  movieteensex-blog.tumblr.com/post/124704537683/free-video-of-teenager-girls-giving-head
  movieteensex-blog.tumblr.com/post/124794945393/target-schoolgirl-girls-dress-summer
@@ -43272,6 +43345,7 @@ mpgsites.com/sites
  mplik.ru/pub/images/erotica
  mport.hu/page5.html
  mport.hu/pornofilm
+mqitdn.blogspot.com/2009/04
  mr--awkward.tumblr.com/OneShot
  mr-alwayshorny.tumblr.com/post/158131600991/cum-cum-and-know-i-made-you-my-fucking-bitch-cum
  mr-beazy.tumblr.com/post/102092318306/afro-orgasm-strip-masturbate-cum-sleep-xxx
@@ -43376,7 +43450,6 @@ muenster.de/~singap/g2
  muenster.de/~singap/gl
  muenster.de/~singap/homepages
  muffett.com/images/pics
-mugrbonita.blogspot.com/2012/10
  mujweb.atlas.cz/www/lesboerotica/
  mujweb.atlas.cz/www/sweetlesbians/
  mujweb.cz/web/thorin
@@ -43784,7 +43857,6 @@ mundoimg.com/categorias.php?categoria=adultos
  mundoimg.com/imagenes/adultos/
  mundopt.com/dir/sociedade/amor-sexo/
  mundos.biz/fotos-de-mujeres-hermosas/
-mundoswtachira.blogspot.com/2014/07
  munimulchen.cl/movie
  murasnyk.com.ua/FlyAd/Show
  murka.lamer.la/celebs
@@ -44166,7 +44238,6 @@ mymap.in/1s
  mymap.in/1t
  mymesseduplife75.tumblr.com/post/126067925002/omgshemalegirl-hot-shemale-pics
  mymesseduplife75.tumblr.com/post/127680668932/deliciousthick-these-plump-sexy-babes-have-huge
-mymilf-friend.blogspot.com/search
  mymilfblog.tumblr.com/post/109193599418/hotbabespubesshowing-more-hot-hairy-muffs-my
  mymillionpornlive.com/fr/
  mymischiefmanaged.tumblr.com/page/32
@@ -44226,6 +44297,7 @@ myscus.tumblr.com/post/109178275398/gransex-hot-milfs-in-girdles-horny-mature
  mysearch.com.au/related/adult
  mysecond-life.com/blog
  mysexyhero.blogspot.com/2017/03
+mysexyusegstring.blogspot.com/2018/06
  myshopping.com.au/PT--225_Adult_Products
  myshopping.com.au/PT--325_Adult_DVD_Video_Anna_Malle__fs_56466_e__
  myshopping.com.au/PT--325_Adult_DVD_Video_Bondage_Anna_Malle__fs_17602_56466_e__
@@ -44451,6 +44523,7 @@ myvidster.com/video/19055743/latino_guy_handles_black_dick_-_XVIDEOSCOM
  myvidster.com/video/19109406/Sex-hungry_gay_lovers_from_the_Past_-_xHamstercom
  myvidster.com/video/21956466
  myvidster.com/video/2290196
+myvidster.com/video/233305706/Mate_licks_gfrsquos_pussy_as_my_mate_fucks_her
  myvidster.com/video/28000123/homosexual_Scouts_boning_In_The_Forest_at_Ice_Gay_Tube
  myvidster.com/video/28652797
  myvidster.com/video/31150578/horny_monks_bareback
@@ -44544,6 +44617,7 @@ n01.tonsite.biz/pe
  na-dwa-baty.pl/in.php
  nacamacomrafa.blogspot.com/.
  nacamacomrafa.blogspot.com/2015/09
+nackedgirls2014.blogspot.com/2014
  nacpac.org/images/tmp/631
  nacujiolas.ibelgique.com/images
  nadda.ca/dlx
@@ -44595,6 +44669,7 @@ nakedgaymenz-blog.tumblr.com/post/142323402192/a1-gay-free-pics
  nakedgaymenz-blog.tumblr.com/post/142323574837/masters-fucking-dude-slaves-galleries
  nakedgaymenz-blog.tumblr.com/post/142323733967/if-we-were-gay-sonic-version
  nakedgaymenz-blog.tumblr.com/post/142380487172/homosexual-latino-galleries-boys
+nakedgaymenz-blog.tumblr.com/post/142380846877/video-de-boys-nue-gratuit
  nakedgaymenz-blog.tumblr.com/post/142380846877/video-de-boys-nue-gratuit/amp
  nakedgaymenz-blog.tumblr.com/post/142381125822/boy-links-gay-sex
  nakedgaymenz-blog.tumblr.com/post/142381174442/cumshot-facial-boys
@@ -44647,6 +44722,7 @@ nakedpornfreesmokingfetishpic.blogspot.com/2009
  nakedprofane.blogspot.com/2012
  nakedred.tumblr.com/post/142228069153/xxxfamilyfun-i-knew-something-had-to-be-wrong
  nakedsablemegapussyliberationpo.blogspot.com/2009
+nakedsablemegapussyliberationpo.blogspot.com/2009/08
  nakedteengirlz-blog.tumblr.com/post/118650740955/vestal-teen-takes
  nakiepople.tumblr.com/post/110689382863/bigbushguy-femmes-poilues-sexe-chatte-poilue
  nakiepople.tumblr.com/post/132932446333/femmes-poilues-sexe-poilu-femme-poilue
@@ -44759,7 +44835,6 @@ naughtydinner.tumblr.com/post/130942778659/ada-sanchez-mia-khalifapart-1
  naughtyflavours.tumblr.com/post/37372294955
  naughtyjulie.tumblr.com/post/103716207911/a-little-ass-fingering-in-the-hotel-lobby-is-good
  naughtylittlenikki.wordpress.com/2013/01/11
-naughtynaughtyclaire.blogspot.com/2013
  naughtypenguin.tumblr.com/post/36122386040/perverse-lesbian-girls-follow-me-perverse
  naughtyrachel-xx.blogspot.com/2013/02
  naughtyscribblegirls.blogspot.com/2019
@@ -44774,6 +44849,7 @@ naughtyteengirlsme-blog.tumblr.com/post/125474359975/cyber-sex-youngest-chatroom
  naughtyteengirlsme-blog.tumblr.com/post/125474513540/topless-maiden-russian-photos
  naughtyteengirlsme-blog.tumblr.com/post/125474552625/teens-short-shorts-pictures
  naughtyteengirlsme-blog.tumblr.com/post/125474571170/xxx-dvd-adult-dvd-porn-video-virgin-sex-movie
+naughtyteengirlsme-blog.tumblr.com/post/125474590370/sultry-brunette-school-in-stockings-and-boots
  naughtyteengirlsme-blog.tumblr.com/post/125474629610/farm-girls-studentgirl
  naughtyteengirlsme-blog.tumblr.com/post/125474708120/lady-white-hair-girl-with-big-tits
  naughtyteengirlsme-blog.tumblr.com/post/125474726655/naughty-lady-hardcore
@@ -44795,6 +44871,7 @@ nauticom.net/www/collavo/adultsonly
  nav.webring.com/cgi-bin/navcgi?ring=gaybondage;list
  nav.webring.org/cgi-bin/navcgi?ring=gaybondage;list
  navego.com.ar/lgp
+navifashioncraze.blogspot.com/2013
  navigation-sex.com/category/bestiality
  navy724.tumblr.com/post/162023610065/bellako321-q-chocho-sit-on-my-face-please
  navydude05.tumblr.com/post/135054441489/blackboypussyforwhitecock-this-sexy-as-fuck
@@ -45081,6 +45158,7 @@ new-tranny-videos.com/category_with_shemales
  new-xxxmovies.com/fr/tag-xxx/femboy
  new-xxxmovies.com/niche/iq726a607e7a7f70731d19
  new-xxxmovies.com/tag-xxx/hidden
+new-xxxmovies.com/tag-xxx/nymphomaniac
  new-xxxmovies.com/xxx-girl
  new2it69.tumblr.com/post/145270522892/ocswingers-adulteratedtidalwave
  newb1231.wix.com/yoshickonoyume
@@ -45853,6 +45931,7 @@ nudeshetero.blogspot.com/2017/01
  nudesit.blogspot.com/2015
  nudestbeachtheinductionfreeli.blogspot.com/2009
  nudevista.best/nude
+nudevista.best/nude/teen
  nudewomenpooping.blogspot.com/2014
  nudewomenpooping.blogspot.com/2015
  nudistbeachboys.tumblr.com/post/98079548938/check-out-nudist-beach-boys-for-more-sexy-nude
@@ -45865,7 +45944,10 @@ nudografia.pl/Mniej_konwencjonalne_rozbierane_sceny_erotyczne
  nuesalaplage.tumblr.com/post/93665808605/babes4me-hot-babes-lovely-nude-lusty-babe
  nuesalaplage.tumblr.com/post/93667248953/babes4me-hot-babes-lovely-nude-lusty-babe
  nuesenchaussettes.megabb.com/t10-petite-culottes-bien-odorantes-et-souillees
+nughtycambabes.blogspot.com/2017
+nughtycambabes.blogspot.com/2017/04
  nuisettes.com/accueil.php?cat=nuisettes
+nulesbiansex.com/blowjob
  nulesbiansex.com/deep-throat
  nulesbiansex.com/panties
  null.ru/zzz/asmodey
@@ -46162,6 +46244,7 @@ okmagazine.com/photos/lindsay-lohan-naked-photos-instagram-nude-pictures
  okmagazine.com/photos/top-beach-bodies-of-2015-check-out-the-best-boobs-and-butts
  okonet.com.pl/~dora
  okoninjah.tumblr.com/post/159106146976/i-like-eating-pussy-i-like-fucking-i-love-it-in
+oladelima.blogspot.com/2011
  olapcouncil.org/amatuer_incest
  olapcouncil.org/bondage_rape
  olapcouncil.org/gangbang_rape
@@ -46286,6 +46369,8 @@ onashortleash.tumblr.com/post/132676490248/collared-sluts-on-the-leash-xpost-fro
  onashortleash.tumblr.com/post/132676504413/collared-sluts-not-too-secure-but-she-wont
  onceuponacollar.tumblr.com/masterlist
  onceuponatimeinthenight.tumblr.com/post/92042246474/bdsmbondage-lesbian-dominatrix-is-turned-her
+oncnfgirls.blogspot.com/2010
+oncnfgirls.blogspot.com/2010/03
  ond.vein.hu/~buba/girls
  ondinedlove.tumblr.com/post/103231975221/quand-jy-mets-les-doigts
  ondira.de/telefonsex
@@ -46356,7 +46441,6 @@ only-apartments.com/news/oriental-bondage/
  only-movie.net/galleries/teens15
  only-passionate-girlfriends-here.tumblr.com/archive
  onlybestpics.net/other/bb
-onlydesivideos.com/mov/24803
  onlydudes.tv/fr/category/ass-to-mouth
  onlydudes.tv/fr/search/nipple
  onlyfree.com/pure/hot/vmcrr11
@@ -46691,6 +46775,7 @@ ouix.com/videos
  our-lovely-bodies.tumblr.com/post/91710777159/we-fucked-good-and-wanted-to-share-with-you-all
  ourbodiesourselves.org/2012/01/lesbian-and-bisexual-women-with-breast-cancer-history-sought-for-study
  ourfarmsite.com/web/horses/indigo
+ourlivelifeblog.tumblr.com/post/181212470005/dick-too-big
  ourmakemeyours.tumblr.com/post/122708362324/cumwithfriends-amateur-hitachi-play-and
  ourmedia.org/node/453767
  ourmedia.org/node/453770
@@ -46868,6 +46953,7 @@ ozonelife.org/galleries
  ozzyboy78.tumblr.com/post/137010857852/xxxaussieplaycouple-xxxaussieplaycouple-omg
  p-holes.co.cc/search.php
  p-planing.kir.jp/adultshop
+p-xxxtube.blogspot.com/2015/06
  p-zone.tumblr.com/post/117765866724/openaked-sesso-anale
  p.vadorcdn.com/sellpage/id=5275981
  p097.ezboard.com/bblowjobporn
@@ -47100,6 +47186,8 @@ paintedfemales.tumblr.com/post/132477387078/bodypainting20-calligraphy-on-girls
  pair.com/geeky/
  paisdelocos.com/adultos
  pakiinstantsexchat.blogspot.com/2013/06
+pakistanhotladypornofilmsbig.blogspot.com/2009
+pakistanhotladypornofilmsbig.blogspot.com/2009/08
  palaispassion.blogspot.com/2012/02
  palanganismoexacerbado.com/.
  palanganismoexacerbado.com/curly-hair
@@ -47148,6 +47236,7 @@ palungjit.com/club/skoryte
  palungjit.com/club/vikolertan
  palungjit.com/club/vinertuol
  pamela-anderson-rob.tumblr.com/page/2
+pamerbokep.blogspot.com/2019
  pamf.org/teen/abc/sex
  pamf.org/teen/health/malehealth
  pamf.org/teen/sex
@@ -48711,6 +48800,7 @@ personales.vivastreet.net/encuentros-sexuales
  personales.vivastreet.net/escorts-masajistas
  personales.ya.com/best/tune/
  personales.ya.com/cbc/
+personalkinks00.tumblr.com/likes
  personals.aol.com/demo/gay-lesbian-love-dating
  personals.aol.com/gay-lesbian-love-dating
  personals.netscape.com/story/2007/04/24/hardcore-asian-shemale-pictures-making-the-best-of-tranny-sex
@@ -49352,6 +49442,7 @@ planetamasajes.cl/masaje-tantrico
  planetawebcam.com/webcam
  planete-smiley.com/index_fichiers/francaisebaise
  planetfun.com/members/realaudio
+planetjav.blogspot.com/2016/03
  planetk.net/gal/karla-spice/gal4
  planetk.net/gal/os/2
  planetnana.co.il/davaiewe
@@ -49717,6 +49808,7 @@ porn800.me/tags/family-sex-fun
  pornaddictedfemale.tumblr.com/addict
  pornaga.com/page/anna-
  pornanderotic.blogvis.com/2009/01/07/nude-woman-having-sex
+pornbegins.com/virtual-sex-impregnation-girl-next-door-brunette-pov-ellie-idol
  pornbeurette.com/arab-girl-tits-and-solo-masturbation-afgan-whorehouses
  pornbeurette.com/asiansexpornocom-hot-arab-girlfriend-blowjob-and-anal-sex
  pornbeurette.com/levrette-gros-qejaculation
@@ -49728,6 +49820,7 @@ pornbizarreteen-blog.tumblr.com/post/117284788319/domestic-young-victim-violence
  pornbizarreteen-blog.tumblr.com/post/117285372274/pretty-glamour-girls-getting-fucked
  pornbizarreteen.tumblr.com/post/117287374964/adolescent-prostitute-girl
  pornbizarreteen.tumblr.com/post/117372596594/juicy-teen-pussygirls
+pornbl.com/categories
  pornblagger.tumblr.com/page/2
  pornbold.blogspot.com/2017
  pornbold.blogspot.com/2020
@@ -49760,11 +49853,13 @@ pornik.net/cat/group-sex
  pornismywife.tumblr.com/post/149080652427/nghhhh-jerking-off-in-the-bathroom-at-work
  pornisthezeitgeist.blogspot.com/2013
  pornlolhd.com/video/1152338/couple-amateur-fellation-et-sexe-sous-la-douche
+pornlove98.blogspot.com/2017
  pornlust.eu/tag
  pornmaniac.tv/fr/tag
  pornmaster.cc/hd/1/amrecan-sex-xxxxxxx/sex-swing-rimming-for-horny-lesbians
  pornmaster.cc/hd/126/www-bhanupriya
  pornmatex.blogspot.com/2020
+pornmoviedl.blogspot.com/2013
  pornmovs.space/fr/go
  pornnewstoday.com/pnt/
  pornnewstoday.com/pnt/2012/11/28/is-kink-com-using-christmas-to-nudge-pornstar-skin-diamond-into-beastiality
@@ -49777,6 +49872,7 @@ porno-video-mamashi-2013.blogspot.com/2014/12
  porno.supply/xxx
  porno4169.rssing.com/chan-73774745/all_p1.html
  pornoamadortorrent.blogspot.com/2013/06
+pornobabble.blogspot.com/2007/04
  pornobestsite.biz/Gymnastsfullhd
  pornobigos.com/filmiki/erotyka-fest-pe
  pornobigos.com/filmiki/piper-fawn-masturbuje-si
@@ -49810,6 +49906,7 @@ pornoizlesik.com/Sex_Toys.cfm
  pornoizlesik.com/Web_Cam_Sex.cfm
  pornolioland.blogspot.com/2014
  pornoonline.com.pl/temat/301/Kanaly-erotyczne-ktore-sa-najlepsze-Opinie-recenzje-uwagi
+pornopandapartouze.blogspot.com/2014/03
  pornosekss3.xyz/category/mature-porno-2
  pornoseyrethdxxx.blogspot.com/2017
  pornostars-tube.com/videos/star
@@ -49840,14 +49937,16 @@ pornstarsdigest.com/category/asian-chinese-and-japanese-pornstars
  pornstarsdigest.com/category/male-pornstars
  porntb.com/albums/4231/sophie-dee-shaved-pussy
  pornteenfemale-blog.tumblr.com/post/120972694424/money-online-teeny-surveys-for-nsw-people
+pornteenfemale-blog.tumblr.com/post/120972740889/pictures-of-youth-blonde-girl-fingering-then
  pornteenfemale-blog.tumblr.com/post/121059122329/free-teeny-blowjob-sample
  pornteenfemale-blog.tumblr.com/post/121059776444/lady-fingering-in-shower
+pornteenfemale-blog.tumblr.com/post/121145427529/young-titans-raven-porn-xxx
  pornteenfemale-blog.tumblr.com/post/121148243899/pussy-schoolgirl-shorts
  porntiime.blogspot.com/p
  porntube-alonalon.blogspot.com/2011/04
  porntube-alonalon.blogspot.com/2011/08
-porntube-video.blogspot.com/2013/10
  porntubesesbra.blogspot.com/2020/12
+porntubevid.blogspot.com/2013/02
  porntubex.org/fx/sasha-grey-scat-rape
  pornushka.blogsome.com/2009/01/12/adult-sex-free-porn-clips
  pornushka.blogsome.com/2009/01/12/big-dick-sex-videos-samples-online
@@ -49862,15 +49961,18 @@ pornvideo.expert/french-young-schoolgirl-rough-anal-fucked-in-nature
  pornvideo.expert/kendra-sunderland-passionate-sex-on-a-beach
  pornvideo.expert/massage-rooms-oil-soaked-sensual-blonde-czech-ffm-threesome
  pornvideo.expert/skinny-teen-trouble-fuck-with-close-holes
+pornvidio.net/watch/2387385/mia-khalifa-deep-throat-arab
  pornvids.fr/video/29Qjw_hot-fran
  pornvids.fr/video/29dED_sissy-petit-ami-donne-pipe-de-strapon
  pornvids.fr/video/2zaYY_torsad
+pornvids.fr/video/4LewJ_gros-seins-femme-fait-le-lit
  pornvids.fr/video/9x0Dd_mature-pipe-b
  pornvids.fr/video/JEpK5_brunette-petite-amie-de-cuisine-de-strip-tease
  pornvids.fr/video/JN8Rm_hot-brunette-femdom-face-sitting-esclave
  pornvids.fr/video/RdenY_stocking-fetish-et-bite-
  pornvids.fr/video/erqj9_brandin-rackley-et-kylee-nash-teenie-bikini-squad
  pornvids.fr/video/gprWd_lusty-couple-throatfuck
+pornvids.fr/video/kWnAO_euro-hot-vid
  pornvids.fr/video/kYrb6_naughty-college-teen-aime-masterbating-sa-chatte-sur-la-came
  pornvids.fr/video/yQNmp_vintage-fran
  pornvids.fr/video/ymGWv_sexe-en-groupe-le-plaisir-de-style-vintage-de
@@ -50235,6 +50337,7 @@ privatemobile.nl/nl/index.php
  privateplaces.com/fabios
  privateplaces.com/raaca
  privateplaces.com/val
+privatepornfree.com/tag/Nipple
  privateroom.com/~jeanny
  privatexclips.blogspot.com/2015
  privecontact.nl/?pi=gaychatten.nl
@@ -50562,6 +50665,7 @@ publicboysporn.tumblr.com/post/120811705559/hitchhiker-gay-site
  publicboysporn.tumblr.com/post/120820768849/ft-lauderdale-gay-male-entenment-patch
  publicboysporn.tumblr.com/post/120821502974/new-panty-homo-thai-escort
  publiclyindecent.tumblr.com/post/20680861066/i-want-bdsm-like-that-naked-girls-on-the
+publicsexchatroom.blogspot.com/2013/06
  publishers.clickbooth.com/ad/124447/CD97834
  publispain.com/bikinimania
  publispain.com/chicas
@@ -50768,6 +50872,7 @@ pussyfree-whiteboi-4-life.tumblr.com/./black69cock69milf-sexy-
  pussyfree-whiteboi-4-life.tumblr.com/post/163020863157/black69cock69milf-sexy-brandi-love-blacked
  pussylickingood.com/tag/cumshots
  pussylover147.tumblr.com/post/153273386733/lezzysxxycandi-nsfw-ultra-hot-lesbian-milf
+pussysexlifesexhardsexdildo.blogspot.com/2009/08
  pussyspace.net/vid-1527820-hot_babe_kelly_divine_threesome_or_group_nikki_sexx_nicki_hunter_bobbi_starr
  pussyspace.net/vid-2908288-mia-khalifa-hot-cum-shot-compilation-add-her-snapchat-hotmarypierce
  pussyview.net/res/mpeg-redpimentnet-fetish-reference-sexecom-salope-arabenet-usa
@@ -51066,8 +51171,11 @@ quora.com/How-do-pornstars-get-their-pussy-and-ass-shaved-so-nicely
  quora.com/I-like-to-watch-transsexuals-in-porn-to-masturbate-Does-that-make-me-bisexual
  quora.com/I-only-masturbate-to-gay-porn-or-images-of-hot-guys-Am-I-considered-bisexual
  quora.com/If-I-am-attracted-to-transgender-women-does-that-make-me-gay
+quora.com/Is-masturbating-without-watching-porn-a-sin-in-Christianity
+quora.com/Is-pedophilia-a-sexual-orientation-like-homosexuality-or-a-fetish
  quora.com/What-are-the-male-equivalents-of-whore-slut-ho-bitch-skank-tramp-and-hooker
  quora.com/What-do-teenage-boys-wish-teenage-girls-knew
+quora.com/What-does-it-mean-if-a-boy-has-a-sex-dream-about-a-girl
  quora.com/What-is-it-like-to-give-a-blowjob
  quora.com/When-giving-a-blowjob-should-a-woman-blow-or-suck-more-often
  quora.com/Who-is-the-better-porn-star-Sunny-Leone-or-Brandi-Love
@@ -51332,6 +51440,8 @@ raintrek.co.uk/kex
  raintrek.co.uk/new/
  rajwap.biz/porn/beautiful-blonde-women-in-lingerie-strap-on-fucking
  rajwap.biz/porn/mia-khalifa-suck-cock
+rajwap.biz/porn/mosaic-bukkake-asian-playboy-bunny
+rajwap.me/trends/mia-khalifa-group-sex
  rajwap.me/trends/mia-khalifa-group-sex-video
  rajwap.me/trends/sunny-leone-vagina
  rajwap.mx/s
@@ -51414,6 +51524,7 @@ rapeculturerealities.tumblr.com/post/57178932100/trigger-warning-ex-pornstars-on
  rapefantasiesandprettybows-deac.tumblr.com/post/101876465109/cumshots-fired-i-really-want-a-fox-tail
  rapeponies.tumblr.com/post/127468492705
  rapethenewsecretary.tumblr.com/post/87339589353/3holes4you-i-love-getting-fucked-in-disgusting
+rapevideos.blogspot.com/2006/04
  raphz613.tumblr.com/post/121979122949/deepthroatyousuck-amateur-tranny-xxx-blowjob
  raphz613.tumblr.com/post/122481582524/deepthroatyousuck-gangbang-amateur-lesbi-fuck
  raphz613.tumblr.com/post/122481648534/deepthroatyousuck-anal-sex-teens-sex-blowjob
@@ -51704,6 +51815,7 @@ rbro3.virtserver.com/warezx
  rbtchart.com/vin-diesel-pictures
  rbytes.net/software/stripshow-screensaver-review
  rcalembo.tumblr.com/post/118014893242/lenin66-texxxas210-nice-black-uncut-cock
+rcdeag.tumblr.com/post/186218561973/know-your-place-cuckold
  rcip.com/jrf
  rct79.tumblr.com/post/110931702493/kinkygayporn-all-porn-is-tagged-into-over-50
  rdeluca.dragonfire.net/pfmov.avi
@@ -51755,6 +51867,7 @@ realharcore-site.com/lkjhgfrety
  realharcore-site.com/wedsdvghg
  realhardcorephotos.com/teen_actions_568s
  realhardcorephotos.com/teen_actions_868g
+realhomemadespyporn.blogspot.com/2013/06
  realhomemadewomen.tumblr.com/post/71314434711
  realhomemadewomen.tumblr.com/post/81941669908/porn4thewworld-post-your-wife-and-see-milf
  realhotpics.tumblr.com/post/33213861963/follow-me-at-masturbationation-com-deki
@@ -51771,6 +51884,8 @@ realitytea.com/2015/09/06/josh-duggars-mistress-details-violent-sexual-affair/
  realkink.tumblr.com/post/118744701433/avalynevans-my-pussy-needs-to-be-fucked-and
  really-cute-asians-beauties.tumblr.com/post/38097501083/amateur-asian-upskirt
  reallybored.net/videos/College-Girl-Shaved-While-Passed-Out
+reallyfreewebcamnude.blogspot.com/2013
+reallygrosssvsssthoughts.tumblr.com/post/187933324594/shen-yuan-spanking-shen-jiu-so-hard-he-see-stars
  reallyhardporn.tumblr.com/post/127348735340/plakaten-til-den-nye-amerikanske-virgin-flick-sex
  reallyhardporn.tumblr.com/post/127351151395/free-hd-young-slut-old-dick
  reallyhardporn.tumblr.com/post/127518539835/virgin-girl-fatally
@@ -51816,6 +51931,7 @@ recetas-de-cocina.net/s/canal-cocina
  recetasdcocina.com/entrar
  recintomoxo.net/foro/hentai/
  recintomoxo.net/foro/yaoi/
+recits-erotiques-gays.blogspot.com/2019
  recklessdesires.com/post/134725559880/recklessdesireblog-anjelica-from-all-fine-girls
  recklessdesires.com/tagged/lesbian
  reclaimsexualhealth.com/Education-Resources/Pornography
@@ -51841,8 +51957,10 @@ recwebcam.com/sexxymystery-2016-10-19-140641_cbd9aca94.html
  recwebcam.com/youstinah-2016-10-21-190545_fbac16d25.html
  recycon.tumblr.com/page/2
  red-lite.com/god
+red-tube-trans.blogspot.com/2013
  red-zone.neostrada.pl/Lovely-Blond-Teen/1
  red6.com/xs
+redbled.com/hottest-deepthroat-pornstars
  redbled.com/top-10-asian-pornstars-still-active-2017
  redbled.com/upskirt-pussy-pics-gifs
  redbookmag.com/archive/love-sex/positions-toys-techniques
@@ -53356,7 +53474,6 @@ retroloops.blogspot.com/2012/04
  retromissile.deviantart.com/art/Bagget-you-dumb-p-fuck-531616295
  retronudism.tumblr.com/post/126084100236
  retronudism.tumblr.com/post/139539931242
-retropornxxx.com/striptease/all/date/2
  retrostillalive.canalblog.com/archives/2011/10/29/20373842.html
  retrounion.com/rlxxx0079/today
  retrouver-ami.vivastreet.fr/annonces-retrouver-ami/recherche-amitie-avec-personne-transexuelle
@@ -53470,8 +53587,6 @@ ricardo1981popper.tumblr.com/following
  richard1518.tumblr.com/likes
  richardavery.disqus.com/latest.rss
  richardgre.blog.lemonde.fr/2006/04/20/2006_04_le_baiser
-richardmannsworld.blogspot.com/2016
-richardmannsworld.blogspot.com/2016/12
  richardsramblings.com/2007/03/dominican-republic-prostitution
  richie66.com/sexverhaal
  richyshameless.com/2008/03/31/angelina-jolie-has-diabetes
@@ -53517,6 +53632,7 @@ ringtone-logo-game.com/9-000/uk_en/home/1/index.html?chc=uk
  ringtoner-logoer-spill.com/9-000/no_no/hjem/1/index.html?chc=no
  ringtonesextreme.com/us/index.php
  rio-olympics123.blogspot.com/2017
+rio-olympics123.blogspot.com/2017/09
  rip-productions.org/forum/
  ripecherry.net/ggf01tc
  ripecherry.net/mab16mb/
@@ -53526,7 +53642,6 @@ ripecherry.net/tl03awc
  ripoffpress.com/categories/softcore-adult-titles
  riptorn92.tumblr.com/following/page/10
  rirediaporama.ifrance.com/diaporama-a-la-con
-risexdatingsite.blogspot.com/2013
  risingmaster.com/the-best-way-to-masturbate
  risingtensions.tumblr.com/post/158475487620/emergentseaslays-banned/amp
  risorseonline.org/celebrita-2
@@ -53693,6 +53808,7 @@ rolfekanefsky.com/moodboobs/
  rollin-in.tumblr.com/post/98907861677/swagglemaggles-lesbian-goddesss-fuck-fuck
  rollingstone.com/culture/features/pam-and-tommy-the-untold-story-of-the-worlds-most-infamous-sex-tape-20141222
  rollingstone.com/politics/story/_
+rolltide022.tumblr.com/likes/page/3
  rollyo.com/.com-ass-tight
  rollyo.com/123-Amatuer-Nude121
  rollyo.com/123-Amatuer-Nude495
@@ -54226,6 +54342,7 @@ samenspenden.net/old
  samesites.com/www/adultrevenueservice.com
  sametmax.com/les-abreviations-dans-le-domaine-adulte-vous-connaissez/
  samiam.org/~badboys
+samleje.blogspot.com/2007
  sammiedanielshdvideos.tumblr.com/post
  sammyslutcunt-deactivated201501.tumblr.com/post/108947451306/oh-fuck-you-you-little-fucking-darling-squeeze
  sammysperm.tumblr.com/post/149586822842/gigglefuck-red-is-sexy-r
@@ -54479,13 +54596,13 @@ scarichiamo.it/desk/moss
  scarla.co.uk/search
  scarletkittykat.tumblr.com/post/33625422947/darkerthandaylight-niceandquite-sexy-dick
  scat-beauty.tumblr.com/post/104848225882/sextaboo-scat-blowjob
-scat-pee4381.blogspot.com/2003
  scatboys.com/post/138371057720/yellowandsctaddict-scatinface-fucking
  scatfetiche.blogspot.com/2011/07
  scatgaybrasil.blogspot.com/2017/07
  scatlover666.tumblr.com/post/148539053562/dirtygayit-alleater-xxxtreme-pervert-gay
  scatloverparadise.tumblr.com/post/109280646038/horny-and-honest
  scatmansk.tumblr.com/post/62713807751/hotxxxhardcoresex-babes-gangbang-erotic-pics
+scatpornflix.com/videos/vintage-scat-threesome-with-shit-licking-off-slaves-body-xxx-porn-video
  scc.net/~debauch/
  scciusa.com/ass
  sccsi.com/arch
@@ -54767,7 +54884,6 @@ secretlittleslut4u.tumblr.com/post/148739375822
  secretlolitoy.tumblr.com/post
  secretsecretary.tumblr.com/post/13882882008/zaxxy-makesmypussywet-oh-fuck-yes-whoa
  secretslice.tumblr.com/post/110598017619/jake-bass-blowing-perhaps-the-most-beautiful
-secretsmith33365.blogspot.com/2007
  secretstory-fr.com/2008/09/01/alice-ne-veut-pas-parler-sexe-avec-matthias
  secretsunderneaththeseclothes.tumblr.com/post/68022192767/lesbianwomen-naked-blonde-penthouse-girl
  secretsydney.info/burwood/adult-erotic-8-railway-st-burwood/
@@ -54781,6 +54897,7 @@ sedapmalam23.tumblr.com/post/123128871953/best-klau-dpt-yg-suka-blowjob
  sedo.de/parken/strumpfhose.tv
  seduceandkeep.com/tips-for-better-sex
  seducem.blogspot.com/search/label
+seducem.blogspot.com/search/label/BDSM
  seductionbykamal.com/fellation-comment-la-faire
  seductionscience.com/lounge/threads/safe-sex-techniques-and-stds-stis.8484/
  seductive-mirror-girls.tumblr.com/post/135286517795/visit-my-blog-for-more-sexy-pics-and-follow-me
@@ -55002,7 +55119,6 @@ sevndeadlysins.com/mom
  sevndeadlysins.com/wetdreams
  sewerrat.eu/rat
  sewumo18.soup.io/post/357650061
-sex-anal-b1.blogspot.com/2009
  sex-crimes.laws.com/prostitution
  sex-denial-games.tumblr.com/page/3
  sex-gigoma.blogspot.com/2013/12
@@ -55067,7 +55183,6 @@ sexdreamsdepot.com/ntblove65843
  sexe-adulte.blogspot.com/2012/10
  sexe-hot-in-life.skyblog.com/includenbcomment.js
  sexe-lady.skyblog.com/includenbcomment.js
-sexe-video-salope.blogspot.com/2013
  sexe.wearableimages.com/bondagexsexe-gratuitx
  sexe.wearableimages.com/fellationxsexe-gratuitx
  sexe.wearableimages.com/masturbationxsexe-gratuitx
@@ -55108,6 +55223,7 @@ sexocaseiroxxx.blogspot.com/2013/10
  sexolandia123.tumblr.com/post/135443962683/gen3tuckin-jackieseroticlesbiandream
  sexomir.com/video/f2h5068812w
  sexonwebmarchbareswhich.blogspot.com/2009
+sexopornhubxnxx.blogspot.com/2020
  sexosecrets.tumblr.com/post/167397132380/mobile-masterlist-smut
  sexotanga.com/xxx/
  sexoybdsmrelatos.blogspot.com/2012/04
@@ -55121,6 +55237,7 @@ sexpornx.com/indian-adult-cartoon-penthouse-tv-hd1-16
  sexpornx.com/indian-handjob-adult-penthouse-tv-hd1-17
  sexpornx.com/latina-world-adult-playboy-naughty-dorm-girls-get-crazy-2
  sexportal.com.ua/en
+sexpozisyonu.blogspot.com/2015/02
  sexshop-midt.dk/shop/default.asp
  sexshop-midt.dk/shop/frontpage.html
  sexshop.wirtua.net/PartnerDefault.asp?PartnerID=33
@@ -55140,6 +55257,7 @@ sextshots.pixub.com/post/109930316829/submit-sextshots
  sextshots.pixub.com/post/112536947635/submit-sextshots
  sextube8.blogspot.com/2011/05
  sextubehardcoreyoung-blog.tumblr.com/post/120482223195/pussy-young-threesome-three-white
+sextubehardcoreyoung-blog.tumblr.com/post/120485608515/hymen-blaster-glamour-fuck/amp
  sextubehardcoreyoung-blog.tumblr.com/post/120565561585/free-pussy-trailers
  sextubehardcoreyoung-blog.tumblr.com/post/120566344820/teenybopper-hairy-opened-pussy
  sexual-temptations.com/uncategorized/7036
@@ -55155,15 +55273,14 @@ sexualityandu.ca/en/sexual-health/what_is_masturbation
  sexualityandu.ca/fr/parents/talking_to_your_child_about_sexuality/masturbation
  sexualityandu.ca/fr/sexual-health/what_is_masturbation
  sexualityandu.ca/sexual-health
-sexualrealities.blogspot.com/2011/05
-sexualsite1.blogspot.com/2010
+sexualpsychology.com.au/female-sexual-health-and-sexuality
  sexualtrance.com/?tid=sexualtrance.com
  sexvideoskit.com/fr/in-video-category
  sexvideoskit.com/fr/tag/big
  sexvideoskit.com/in-video-category
+sexvideoskit.com/in-video-category/Sex
  sexvideosss.blogspot.com/2013
  sexwithinmarriage.com/clitoral-slapping
-sexwithme99.blogspot.com/2015
  sexwithromance.blogspot.com/2013/03
  sexx1988.tumblr.com/post/156748367054/mustardcum-geechhhxxx-jayla-foxx-my-favorite
  sexxx0nthebeach.skyblog.com/includenbcomment.js
@@ -55177,6 +55294,7 @@ sexy-filmtreff.de/erotikauktion
  sexy-fun-logos.moobil.com/servicemobile
  sexy-girls-naked-erotic-black-and-wh.blogspot.com/2011/08
  sexy-girls-naked-erotic-black-and-wh.blogspot.com/2012/01
+sexy-girls-naked-erotic-black-and-wh.blogspot.com/2012/04
  sexy-hot-celebrities-free-video.blogspot.com/2011
  sexy-hot-celebrities-free-video.blogspot.com/2015/03
  sexy-lady-ss.skyblog.com/includenbcomment.js
@@ -55193,7 +55311,7 @@ sexyactor.blogspot.com/2009
  sexyasouhait.com/dirty-whore-swallowed-eight-cumshots
  sexyblack-escortegirl.blogspot.com/2011/02
  sexycharito.blogspot.com/2010/05
-sexydreamserotic.blogspot.com/2013
+sexyedithtaylor.blogspot.com/2020/12
  sexyeighteen.blogspot.com/2014/03
  sexyeroticajangt.blogspot.com/2020
  sexyeyez.com/video/cepten-porno-izle
@@ -55297,6 +55415,7 @@ sfwhentai.tumblr.com/post/176193332227/sfw-oppai-hentai-gaming-porn-art-of-big-t
  sg.dir.yahoo.com/Society_and_Culture/Sexuality/Adult_Movies
  sg.theasianparent.com/50-sex-positions-for-couples/
  sgbabeswatcher.tumblr.com/post/138250648204/highendtherapist-pretty-local-girl-sex-in-hotel
+sgbitchyslut.tumblr.com/page/2
  sgbitchyslut.tumblr.com/post
  sglawl.tumblr.com/likes
  sgtkink.tumblr.com/post/109046543446/sexy
@@ -55388,18 +55507,21 @@ shemale-fucking.info/fr/latex-cutie-loves-a-big-boner-to-quickie-8333
  shemale-gay-porn.blogspot.com/2013/01
  shemale-outdoor-party-2013.blogspot.com/2014/12
  shemale-strokers.blogspot.com/2005
+shemale-tubes-heaven.blogspot.com/search
  shemale.pornvids.fr/video/5NWdd_transexuelle-hooker-
  shemale.pornvids.fr/video/6ajDq_velue-joue-avec-un-
  shemale.pornvids.fr/video/7bqO4_face-sitting-tgirl-cumshot
  shemale.pornvids.fr/video/AZPMz_femboy-salope-serr
  shemale.pornvids.fr/video/B3qM0_tgirl-baise-salopes-chatte
  shemale.pornvids.fr/video/DewXq_gay-crossdresser-donne-une-tr
+shemale.pornvids.fr/video/Yx68B_de-beaux-cheveux-courts-femboy-d
  shemale.pornvids.fr/video/kdraW_transexuelle-punk-dernier-dani-daniels-punit-son-esclave-de-sexe-tgirl-eva-lin
  shemale.pornvids.fr/video/pEpGp_femboy-salope-minables-ladyboygold
  shemale.pornvids.fr/video/r1ann_mignon-tgirl-obtient-rimjob
  shemale.pornvids.fr/video/z64Q1_rada-en-penthouse-piquer-play-ladyboygold
  shemalecam.com/landing/templates
  shemalecams.pro/cute-shemale-webcam-tubes
+sheoncams.blogspot.com/2016
  shepenis.tumblr.com/post/123756756456/hookup-with-a-shemale-tonight
  sherbrooke.kijiji.ca/c-rencontres-aventures-Transexuel-recherche-W0QQAdIdZ100860616
  sherbrooke.kijiji.ca/c-rencontres-aventures-cherche-maitresse-dominatrice-sur-sherbrooke-W0QQAdIdZ53455514
@@ -55807,6 +55929,7 @@ sighbroken.tumblr.com/post/103798033276/do-you-ever-just-stop-and-think-wow-what
  sigmanusjsu.com/images/avatars/gallery
  signup.nu/members
  sikclips.com/vid509_Two_Beautiful_and_Sexy_Girls_Kissing
+siksenneolur.blogspot.com/2015
  silent-tight-and-still.tumblr.com/post/64139298432/busty-bondage-babe-hot-bigtits-bigboobs
  silent.inmyhead.net/whores
  silently-screaming.org/twinkle
@@ -55880,6 +56003,7 @@ sinart.asso.fr/en/petites-culottes-chaudes-et-mouillees-la-chatte-aux-tresors-fa
  sinatrablue134.tumblr.com/post/149239912509
  sinbad.net/~mikec
  sindystroker.tumblr.com/archive
+sinexpress-dating.blogspot.com/2020/08
  sinfullvibes.tumblr.com/post/123784432628/send-me-nudes-when-you-get-home-so-i-know-youre
  sing365.com/music/lyric.nsf/Def-Dick-lyrics-Bone-Thugs-N-Harmony/7A1CE742BD30E38B48256C92000BF87B
  sing365.com/music/lyric.nsf/Sugababes-lyrics/65C1275F286BD813482569EB0015C762
@@ -55911,6 +56035,7 @@ sirtem.fr/adult
  siscomunica.com.br/us/Jcix
  siserone.co.uk/maronah/
  sisi.pl/bieliznaerotyczna/szukaj-anais-gorgeous--yammy/id/9845
+sisseefagg.blogspot.com/2013
  sisseefagg.blogspot.com/2013/07
  sissis-cam.de/viewpage.php?page_id=48
  sissy-boi-slave.tumblr.com/post/130365503702/triple-shemale-trannyfucksguy-shemale-bdsm
@@ -55940,6 +56065,7 @@ sissydew.tumblr.com/following
  sissydream666.tumblr.com/following
  sissyesp19.tumblr.com/following/page/3
  sissyfans.tumblr.com/post/132878693812/fuckyeahfriendlyfire-girlslovebigcocks
+sissyfemprincess.blogspot.com/2016/07
  sissygurl2.tumblr.com/post
  sissyhusband.tumblr.com/post/35276865873/panty-slave
  sissyjamie23.tumblr.com/post/130786472986/kinkytexascouple-centexcpl38
@@ -56095,6 +56221,7 @@ sixyoungpeople-blog.tumblr.com/post/120812991903/live-teenager-cam
  sizegeneticspeniextender.com/how-to-make-your-dick-bigger
  sizor.com/swimware
  sizvideos.com/post/131024700660/im-bisexual-but-im-not-full-video
+sj743.tumblr.com/following/page/14
  sjharvey.com/sites/
  sjmmdk.tumblr.com/page/3
  sk1069.tumblr.com/post/103104062789/menandsports-gay-fucking-sodomy-enculer-gay
@@ -56486,6 +56613,7 @@ skyrock.com/safety/
  skyscraper.fortunecity.com/rsi/411
  skyul.egloos.com/2196021
  skyvlog.net/sexy
+skzdarklove.tumblr.com/post/185554191712/hiii-can-i-have-a-3racha-foursome-or-a-mirror-sex
  sl-mmd.de/erotikbilder
  sl-mmd.de/erotikkontakte
  sl55amg.dnip.net/shemale
@@ -56528,6 +56656,7 @@ sleazylezzies.com/tt
  sleazylezzies.com/xx
  sledujutelku.cz/porn
  sleeping-ass-ebony-babe-dog-porn.blogspot.com/2011/05
+sleeping-ass-ebony-babe-dog-porn.blogspot.com/2011/06
  sleeping-ass-ebony-babe-dog-porn.blogspot.com/2011/10
  sleeping-ass-ebony-babe-dog-porn.blogspot.com/2011/12
  sleeping-ass-ebony-babe-dog-porn.blogspot.com/2012/03
@@ -56631,6 +56760,7 @@ smg-zwlj.net.cn/clipart_gratuit_metier
  smg-zwlj.net.cn/matter_belle_fesse
  smg-zwlj.net.cn/sex_granny_old
  smile-4eva.blogspot.com/2019
+smile-4eva.blogspot.com/2019/12
  smileandactnice.com/life
  smileandactnice.com/sex
  smilefaster-deactivated20150617.tumblr.com/post/121492966057/sucking-dick-is-like-driving-a-car
@@ -56697,7 +56827,6 @@ snarkygossip.com/category/boobies
  snarkypants.com/witchybitch
  snatexia.tumblr.com/following/page/2
  sneakoscope.forumzarbi.com/t260-arthur-we-fucked-up-bigger-and-better-than-any-generation-that-came-before-us
-sneferus.blogspot.com/2014/09
  sniffi.ng/post/134300772530/naotakunn-i-cant-believe-this-i-cant-fucking
  sniffi.ng/post/137766741620/wee-revolutionary-petitetimidgay-if-there
  sniffi.ng/post/138026252500/drag0n-spell-antisemitic-bye-im-fucking
@@ -57239,7 +57368,9 @@ squirtbossing.tumblr.com/post/118627962444/purosexblog-amateur-mature-milf-mastu
  squirter-tranny-lover-deactivat.tumblr.com/post/135681795084/tsvlux-venus-fucking-her-man-and-cumming-damn
  squirtingpics.pw/3876597
  squirtsx.blogspot.com/search/label
+squirtsx.blogspot.com/search/label/big-cock
  squish.us.to/forced
+squizzybeanexe.tumblr.com/post/632241139338051584/kinktober-day-17-cybersexnudes
  sr.wordpress.com/tag/bikini-babes
  sr7.xoom.com/jakoo
  sraksalmeigo69.blogspot.com/2014
@@ -57597,6 +57728,7 @@ steveeray.com/bikini
  steveh1977.tumblr.com/following
  stevenrogerstv.tumblr.com/post/39349005263/transsexuals-transvestites-shemales-i-love
  stevenrogerstv.tumblr.com/post/43672341352/transsexuals-transvestites-shemales-i-love
+steverobert0731.blogspot.com/2004/10
  steverogersisavirgin.tumblr.com/post/107192394103/beingsillyandgay-lesbian-goddesss-you-know
  stevestuff2.tumblr.com/post/116107068652/hot-chicks-no-cocks-beautiful-women-some-curvy
  stevieblaccluvsbbc.tumblr.com/post/118100720658/soulstar2012-interracial-bondage-is-so-fucking
@@ -57701,6 +57833,7 @@ stores.shop.befr.ebay.be/Feihoff-adult-erotics
  stores.shop.ebay.fr/SexyStreet007
  stores.shop.ebay.fr/SexyStreet007__W0QQ_armrsZ1
  stores.storefrontnow.com/showroomb
+stories-malenudegallery.blogspot.com/2006/08
  stories.etowns.org/free
  stories.servemp3.com/free
  storiesofadreamer.blogspot.com/2010/03
@@ -57743,6 +57876,7 @@ strasbourg.vivastreet.fr/annonces-rencontre-lesbienne
  strassite.com/adriana
  stream-film.com/sexe
  stream-of-hentai-anime.blogspot.com/2011
+stream-of-hentai-anime.blogspot.com/2011/03
  stream5.ipercast.net/louisdemirabert.vista/003/002/003-002-096-felina_clip_sexe_moi.wmv
  streaming-film-porno.info/tags/video-sex-cunnilingus
  streamingandvod.com/sex-streaming-vod-adulte
@@ -57768,6 +57902,7 @@ stripchatcams.com/livesex
  stripclubdirectoryeroticasex.blogspot.com/2009/08
  striplvapp.com/collections/all
  stripperclaradantas.blogspot.com/2015/01
+striptease-mature-dating-2013.blogspot.com/2014/12
  stripteasecams.net/category
  stripteasfreeeroticpictureofnake.blogspot.com/2009
  stripvideohornynymphosgothics.blogspot.com/2009
@@ -58071,6 +58206,7 @@ sunfishclass.org/newyork/archives/1999
  sunflower.com/~rlhume
  sungayantao.tumblr.com/post
  sunny97ass.blogspot.com/2008
+sunnyleone25.blogspot.com/2015
  sunnyleonebabe.tumblr.com/page/2
  sunpoint.net/~miina2002/listat/postituslista.html
  sunsandandu2.tumblr.com/post/117541883721/mysweetlove3-blowjob-ass-gangbang-3some
@@ -58081,10 +58217,8 @@ sunsteam.com/directory/Entertainment/Adult
  suomifutis.net/firnal/shemalepics
  supaero.fr/images/filles
  super-azerty.tumblr.com/post/60422260188/gros-appetit-pour-les-queues-bbc-la-salope-blonde
+super-cute-asian-girls.blogspot.com/2013/09
  super-propositions.com/young
-super-shogun.blogspot.com/2010/06
-super-shogun.blogspot.com/2013
-super-shogun.blogspot.com/2015/12
  super-sister.tumblr.com/post/128974704925/nerd-of-tits-and-wine-oops-claire-kent
  super-video-porno-2013.blogspot.com/2014/12
  super.win.or.jp/~juan/images/adult
@@ -58111,7 +58245,6 @@ superedv.de/banner/1
  superedv.de/fotoalbum
  superela.com/2014/06/23/6-dicas-de-como-realizar-fantasias-eroticas/
  superelisa.vq.net/router/superelisa/cosesexy
-superfantastictrannyblog.blogspot.com/2011
  superfemdomonline.com/spons/xgal121
  superfinebabes.com/emmazajickova_petitesauna
  supergadism.blogspot.com/2012/12
@@ -58220,7 +58353,6 @@ sw-town.com/maiko
  sw4rmed-deactivated20150131.tumblr.com/post/76891227081/sex-ink-metal-xxx
  swagglemaggles.tumblr.com/post/98272079474/lesbian-goddesss-fuck-fuck-fuck-fuck-that
  swallowdeez.tumblr.com/post
-swallowing-cock.blogspot.com/2007
  swanblood.tumblr.com/post/16110374261/content-sex-discussion-of-fetishes
  swanswanhummingbird.tumblr.com/post/109922235670/sexymilesladies-erotic-sexy-fun-archive
  swe-gaming.com/joe9733
@@ -58535,6 +58667,7 @@ ta.wordpress.com/tag/bikini-babes
  ta.wordpress.com/tag/centerfold
  tab.co.uk/2014/11/20/dear-girls-hate-boobs
  tabasqueno.com/Elinks
+tabbymother.blogspot.com/2011/04
  tabbymother.blogspot.com/2011/06
  tabletwinkel.net/img/2015/08/28/sara-jay-vids
  tabli.ca/1000-nudes-historia-fotografii-erotycznej-a8cf
@@ -59140,6 +59273,7 @@ teemix.aufeminin.com/w/star/n76214
  teemos-dirty-little-secret.tumblr.com/post/146529437384/reblog-if-you-want-smut-in-your-inbox
  teen-anger-control.searchmole.co.uk/search
  teen-blonde-ass-eliza-dushku-nude-bl.blogspot.com/2011/07
+teen-blonde-ass-eliza-dushku-nude-bl.blogspot.com/2011/09
  teen-blonde-ass-eliza-dushku-nude-bl.blogspot.com/2012/05
  teen-model-young.com/staci-lemonrock
  teen-naturist-pics4049.blogspot.com/2005
@@ -59147,6 +59281,7 @@ teen-shemales.blogspot.com/2005/02
  teen.com/bella-thorne-ariana-grande-emma-stone-2011-redhead-pink-hair-celebrities-photos
  teen.seo-admin.info/adult_2
  teenadviceexpert-blog.tumblr.com/post/117032247927/orgasm-sexy-young-free-pics
+teenadviceexpert-blog.tumblr.com/post/117644494737/free-hardcore-young-pink-galleries
  teenadviceonline.org/archive
  teenageboredom.com/kristinafey/2645-1ret
  teenagebritishgirls-blog.tumblr.com/post/121713969517/fucking-youngest-daughter-mpeg
@@ -59234,6 +59369,7 @@ teens18plus.net/love-57
  teensay.co.uk/avatars
  teensay.co.uk/films
  teensex-tubes.com/fr/teen-tag/threesome
+teensexset.com/catalog/8e237e607a7b7b6b691f1b1c
  teensholland.com/pure
  teenslinks.info/teen
  teenstyleporn.blogspot.com/2019/06
@@ -59250,6 +59386,7 @@ teenxxx-free.com/fr/category
  teenxxx-free.com/tag/foot
  teenxxx-tube.com/fr
  teenxxxmoviesporn-blog.tumblr.com/post/119402967738/sexe-live-young-webcam
+teenxxxmoviesporn-blog.tumblr.com/post/119403632083/young-girlies-naken-in-girl-video-or-photos
  teenxxxpost.com/search
  teeny.promotiongalleries.com/galleries/1
  teenybopperthumbs.com/hun/march/allsite
@@ -60710,6 +60847,7 @@ themetapicture.com/not-yet-little-asian
  themidwifeisin.com/post/138243138880/so-having-sex-with-a-condom-tends-to-hurt-me-but
  themightychin.com/chins_babes
  themistressadler.tumblr.com/post/106363079281/my-first-time-being-a-cock-whore-for-mistress
+themistresstaha.blogspot.com/2012
  themistresstaha.blogspot.com/2012/11
  themlmrescueteam.com/the-lesbian-midget
  themoteur.com/top
@@ -60761,12 +60899,14 @@ thepoeticsir.tumblr.com/post/147287659764/nods
  thepost.f2s.com/tgp
  theprovocateur.wordpress.com/2007
  thepublicexhibitionist.tumblr.com/post/134594780961/voyeurhuborg-amateur-upskirts-nipslips
+theradicalscrivener.tumblr.com/post/160123878880/bull-milk
  therapypijatpasutriwanita.blogspot.com/2012
  there-4-you.com/tomhanks
  therealbobbybrown.tumblr.com/archive
  therealchaseylain.com/sara-jay-loves-to-fuck-girl-on-girl-2-2
  therealshadman.tumblr.com/post/155802710327/do-you-accept-nudes-from-hot-teenage-girls
  theredshtick.com/2016/01/19/murphy-law-firm-hires-milf-adult-film-star-lisa-ann-as-spokeswoman/
+thereluctantdomm.tumblr.com/page/2
  theressehope.tumblr.com/post/133039614827/tips-for-vaginal-health-proper-pussy-maintenance
  therichest.com/celebnetworth/celeb/adult-actresses/sara-jay-net-worth/
  therichest.com/expensive-lifestyle/entertainment/10-sexy-penthouse-pets-that-became-overnight-celebrities/
@@ -60997,6 +61137,7 @@ thisisphotobomb.com/tag/vacation
  thisisphotobomb.com/tag/wtf
  thisisphotobomb.com/vote
  thisisrapeculture.tumblr.com/post/54852823056/ex-pornstars-on-the-porn-industry
+thisisthehardestthing.tumblr.com/post/627169460470562817/18
  thisizgame.ning.com/profiles/blogs/amatuer-black-bbw-9937
  thisizgame.ning.com/profiles/blogs/amatuer-busty-beauty-3114
  thisizgame.ning.com/profiles/blogs/amatuer-naked-porn-1113
@@ -61574,12 +61715,14 @@ threonine.net/xtina
  thrillist.com/travel/nation/adult-vacations-erotic-resorts-around-the-world
  throat-it-boy.com/post/56558360002/luvscock2muchs-audition-went-very-well-want-to
  throatdestructor.com/movies/29
+throatfuckedwhores.com/video/a-call-girl-served-her-client-with-her-deep-throat
  throatguy10-deactivated20150621.tumblr.com/post/119206159025/daddyintdot-anonysxxx-hoodlessdick
  throatguy10.tumblr.com/post/119206159025/daddyintdot-anonysxxx-hoodlessdick
  throatmistress.tumblr.com/post/184335184116/free-adult-web-cam-girls
  throatmistress.tumblr.com/post/184407479936/free-live-sex-chat-webcam-girls
  throatmyface-deactivated2015020.tumblr.com/post/76318879694/whore-degrader-gag-you-fucking-whore
  throatwork.tumblr.com/post/68968386524/deepthroat-frenzy-since-the-very-popular
+throughhairyteen-blog.tumblr.com/post/142210259262/mylust-british-nasty-collegegirl
  throwawaysfordays.tumblr.com/following
  throwingshade.tumblr.com/post/2516639314/hotttt-i-love-getting-my-nipples-sucked
  throwmeaway.com/delusional/riotgirls
@@ -62093,6 +62236,7 @@ tonos.julala.com/mx_es/14_Tonos_polifonicos/3002_Top_ventas
  tonpetitlook.com/fr/2014/10/20/le-cas-jacqueline-laurent-auger-ou-les-dangers-de-la-tendance-soft-sexu
  tonshaftmonrack.blogspot.com/2010/03
  tonyaharding.com/messages/MESSAGES.CFM
+tonyastrokum.blogspot.com/2015
  tonyfra.ifrance.com/archives
  tonypierce.com/2002/4/anna
  toobig.net/azzjack
@@ -62304,6 +62448,7 @@ toppersworld.com/gina
  toppixxx.com/611904-enter-julesjordan-com-gallery-bustypassion-3-3-6-0-8834-0-0-0
  topratedteen.tumblr.com/post/116859353122/free-close-up-pics-of-hairy-teen-cunts
  topratedteen.tumblr.com/post/116860091427/seattle-youngest-escorts
+topratedteen.tumblr.com/post/116860313152/maiden-hitchhikers-sluts
  topratedteen.tumblr.com/post/116860425392/free-teen-bald-virgin-pussy
  topratedteen.tumblr.com/post/116863646267/paul-lady-songs
  topratedteen.tumblr.com/post/116951484412/russians-amateur-xxx
@@ -62779,6 +62924,7 @@ toyloverboi.tumblr.com/post
  toys.easyforum.fr/t3455-ptites-culottes
  toysforman.tumblr.com/post/115808041389/guy-fisting-men-for-sex
  toysforman.tumblr.com/post/115808114224/young-gay-teens-fucking-first-time
+toysforman.tumblr.com/post/115810511814/site-perso-gay-exhib
  toysforman.tumblr.com/post/115810953464/little-homosexual-guys-in-sex
  toysforman.tumblr.com/post/115811607829/fucking-gay-roasting/amp
  toysforman.tumblr.com/post/115812780974/gay-male-fisting-other-men
@@ -62898,6 +63044,7 @@ travelingstudentblog.tumblr.com/post/156773016770/tittiefucker9999-women-on-face
  travelingstudentblog.tumblr.com/post/156981102500/jody-garret-of-az-says-his-and-ready-to-fuck-she
  travestie.org/nl/
  travestis-amateurs.blogspot.com/2013
+travestis-nice.blogspot.com/2013
  travestisexxxy.blogspot.com/2015
  travis405ou.tumblr.com/following/page/2
  traxsource.com/track/2067339/sesso-orale-darpas-having-hard-blowjob-repaint
@@ -63071,9 +63218,11 @@ truveo.com/Teen-Cumshot-Compilatio/id/2727531000
  truveo.com/WebCam-msn-strip-show-perso/id/3049113525
  truveo.com/porn-adult-hot-babe-xxx-movie-hot-girl/id/2238754504
  truveo.com/porn-fake-film-xxx-hot-scene-model-hard-sexy-sexe/id/1024226708
+truyenhen18.blogspot.com/search/label/Bestiality
  trweb.com/adult
  try-net.or.jp/~xxxxxxxx/eva
  tryangle.fr/l-erotisme-de-la-couche-culotte
+tryfist.net/tag
  tryggspace.net/pix/Pointy
  tryusfree.com/hotlove
  ts-prensa.blogspot.com/2019/11
@@ -63089,6 +63238,7 @@ ts7.images.live.com/videos/thumbnail.aspx
  ts8.images.live.com/videos/thumbnail.aspx
  ts9.images.live.com/videos/thumbnail.aspx
  tsbmag.com/2010/06/08/how-to-ejaculate-like-a-porn-star/
+tsdominatrix.blogspot.com/2017/11
  tse-tse.it/la-top-milf-wifey-e-le-sue-mega-tettone/
  tsfandl.tumblr.com/post/142122025534
  tshirtwatch.com/blog/2006/05/18/adriana-lima-a-sexy-virgin-in-a-t-shirt
@@ -63153,6 +63303,7 @@ tube-porn.ust-tsylma.ru/2014/09/27/mexican-babe-in-skimpy-thongs-posing-topless-
  tube-porn.ust-tsylma.ru/category
  tube.com/porn
  tube.uhostfull.com/pichunter
+tube300.me/tags/sophie-dee-scat
  tube4world.com/en/collection
  tubecul.net/video/2518/deux-lesbiennes-salope-chatte-poilue-se-gouine
  tubecul.net/video/2793/sexe-brutal-et-sodomie-extreme-pour-salope
@@ -63176,9 +63327,11 @@ tubenn.com/nikki-benz-dani-daniels-in-2-chicks-same-time
  tuberhirismaulidha.blogspot.com/2012/10
  tubesfan.com/search/stripshow
  tubespecials.com/xxx
+tubeteen18.com/hd/ass-licking
  tubev.pro/categories
  tubev.pro/video/323937/motherfucker-hot-ass-brooke-ha
  tubexxxone.com/en/oneddir/dW0tMjQ4LTEzNjMzODMz
+tubexxxone.com/en/oneddir/dW0tMjQ4LTEzNjMzODMz/Foot-fetish-obscene-mom
  tubexxxone.com/en/tagone/obscene
  tudobusca.com/tudosexo/
  tudoquecdzinhagosta.blogspot.com/2017/09
@@ -63908,7 +64061,6 @@ twinkshavemorefun.tumblr.com/post/108791935663/http-twinkshavemorefun-tumblr-com
  twinkshavemorefun.tumblr.com/post/110139279306/http-twinkshavemorefun-tumblr-com-for-more
  twinkshavemorefun.tumblr.com/post/110249463222/http-twinkshavemorefun-tumblr-com-for-more
  twinkshavemorefun.tumblr.com/post/112358661107/http-twinkshavemorefun-tumblr-com-for-more
-twinkybf.com/page
  twisted-world-of-mine-deactivat.tumblr.com/post/121423372501/amateur-lesbian-college-babes-making-out-in-the
  twistofpayne.tumblr.com/post/47756793498/the-tease-part-ii-harry-styles-dirty-one-shot
  twistofpayne.tumblr.com/post/75006442274/fame-harry-styles-smut
@@ -64117,6 +64269,7 @@ uhegorno.blog.pl/gangbang-na-pomoscie-opowiadanie-erotyczne/
  uhq83943.tumblr.com/post/103549758157/under-the-table-fun
  uimpi.net/nsfw/
  uiry.blogspot.com/2018
+ujjwollamichhane.blogspot.com/2019
  uk-shopping-warehouse.co.uk/Teen_Modeling_Photo
  uk-x.com/sites-cd
  uk.askmen.com/celebs/women/actress
@@ -64158,6 +64311,7 @@ ukoku.net/pr0n
  ukpigguy.tumblr.com/post/111454452632/slamfuckme-salute
  ukpreopts.com/transmistress
  ukpreopts.com/tsmiapreop
+ukquickiesnews.blogspot.com/2011/08
  uktelephone.gldir.com/chat
  ukvideosets.com/mature278102
  ukvideosets.com/mature45611
@@ -65066,6 +65220,7 @@ vdot2pics.net/blog
  vecnawrites.tumblr.com/post/184362092981/vecnawrites-vecnawrites-vecnawrites
  vecnawrites.tumblr.com/post/185172507676/enableranal-sex-in-all-the-gender-scenarios-cis
  vecnawrites.tumblr.com/post/187451361776/non-futa-white-rose-anal-giving-ruby-ruby
+vecnawrites.tumblr.com/post/636304612856561665/joan-decided-she-would-participate-in-nnn-while
  veenus.lt/lesbietes
  vefernandes.tumblr.com/page/2
  vegas.com/traveltips/best-las-vegas-adult-shows
@@ -65478,6 +65633,7 @@ videos-droles.com/videos/84/ole_ole
  videos-milf.com/milf-category/anal
  videos-people.com/q/chloe-vevrier
  videos-trans-gratuit.blogspot.com/2013/08
+videos-trans-gratuit.blogspot.com/2013/10
  videos-x-trans.blogspot.com/2013/08
  videos.com.es/busqueda/1/strict/viewCount/sexo
  videos.com.es/busqueda/1/strict/viewCount/xxx
@@ -65511,7 +65667,6 @@ videosexo.info/PinkBits
  videosgratisxxxjay.blogspot.com/2016/02
  videosnicegay.blogspot.com/2012
  videosparadise.com/firsttime_anal/ariana_anal_028
-videospleasure.blogspot.com/2020/03
  videosurf.com/jenna-jameson-15476
  videosurf.com/videos/Strip
  videotwister.com/groupsex/1/02
@@ -65615,7 +65770,6 @@ villagevoice.com/blogs/dirtypornos
  villaguay.net/show
  villariit.iitalia.com/archives
  vilniuscitytour.eu/lakshmi3817
-vilokosovealy.blogspot.com/2011
  vimeo.com/43831919
  vimeo.com/98467133
  vimeo.com/belladominatrix
@@ -65689,6 +65843,7 @@ virallook.com/ujnq14
  viralwomen.com/post/fifty_shades_gets_bondage_all_wrong_this_girl_nails_it
  virb.com/afzal
  virginradiolb.com/top-5-most-beautiful-brunettes
+virginsexpics.blogspot.com/2013/08
  virginsextube.com/pl/cat/123/erotic
  virgula.com.br/virgulagirl/
  virgula.com.br/virgulagirl_v2/
@@ -65830,6 +65985,7 @@ voici.fr/news-people/photos-star/classement-les-30-femmes-les-plus-sexy-du-monde
  voici.fr/news-people/photos-star/photos-euro-2016-la-selection-des-femmes-de-joueurs-les-plus-sexy-597397
  voici.fr/page/tag/Sexy
  voici.fr/page/tag/Strip-tease
+voidblues.blogspot.com/2019/01
  voiladubai.ae/languages/fr-ca
  vol.it/mirror/femmes
  vol.it/mirror4/en/www.eeb.ele.tue.nl/mpeg/r_rated
@@ -65920,6 +66076,7 @@ voyeurfreeindainsexfreebig.blogspot.com/2009
  voyeurreality.com/voyeur320
  voyeurreality.com/voyeur324
  voyeurspyporn.com/en/voyeur-niche/Anal.jsp
+voyeurspyporn.com/en/voyeur-niche/Ass
  voyeurspyporn.com/en/voyeur-niche/Exhibitionists.jsp
  voyeurverde.blogspot.com/2015
  voyeurverde.blogspot.com/2017
@@ -66506,8 +66663,6 @@ web-malin.net/adulte
  web-nord.com/sexhomeparty
  web-of-wonders.com/wiw
  web-of-wonders.com/wow/hof
-web-prowler.blogspot.com/2014
-web-prowler.blogspot.com/2019
  web-ref.net/pipe
  web-serve.net/~gaypix
  web-serve.net/~sage
@@ -68199,11 +68354,13 @@ wetrack.it/xposed/a/35/e/4
  wetrack.it/xposed/a/80/e/4
  wetselfies.tumblr.com/post/121670103858/nude-selfies
  wetter24-deactivated20140218.tumblr.com/post/50036805977/gayvidsonly-myfavoritekinks-piss-scenes
+wettingboys-blog.tumblr.com/post/142813192771/richs-gay-club-in-houston
  wettingboys-blog.tumblr.com/post/142813251531/gay-sex-cum-hot-muscle-jock-frat
  wettingboys-blog.tumblr.com/post/142813270156/boys-oral-sex-barely-legal-pics
  wettingboys-blog.tumblr.com/post/142813301526/gay-celebrity-sex-stories
  wettingboys-blog.tumblr.com/post/142813360161/boy-sex-stories-no-avs-no-membership
  wettingboys-blog.tumblr.com/post/142814034641/peliculas-gay-en-vcd
+wettingboys-blog.tumblr.com/post/142814197531/gay-boys-in-consistent-toying-ass-hardcore
  wettingboys-blog.tumblr.com/post/142814515416/gay-porn-movies-thumbnails
  wettingboys-blog.tumblr.com/post/142814722046/latino-porn-gay
  wettingboys-blog.tumblr.com/post/142815438456/woolly-dude-gets-enormous-kneading
@@ -68623,6 +68780,7 @@ womanspankingman.com/call-girl-thionville-plan-q-quimper-port-de-bassens-jolis-p
  womantribune.com/giving-mindblowing-blow-job
  womantribute.tumblr.com/post/118631837496
  women-xcpl.blogspot.com/2008
+women-xcpl.blogspot.com/2008/06
  women.indiatimes.com/quickiearticleshow/1233265.cms
  women.netscape.com/story/2007/07/10/sweet-krissy-gallery
  women.netscape.com/story/2007/07/23/a-friendly-and-horny-girl-who-love-sex-so-much
@@ -69325,6 +69483,7 @@ xano501.tumblr.com/post/164667852640/your-really-good-at-drawing-huge-boobs-and-
  xantesisopx.info/Elmhurst.FLD/
  xaphan.canalblog.com/archives/2010
  xapoutsve.tumblr.com/post/117353888200/tokyo-hot-mature-teen-sado
+xarab2020.blogspot.com/2020/07
  xarj.net/2007/photos-alicia-sexy-girl
  xasa.com/directorio/mozilla/Top/Adult/Image_Galleries
  xasa.com/directorio/search/Upskirts
@@ -69480,6 +69639,7 @@ xnxnx742.blogspot.com/2016/07
  xnxx-sex-videos.com/video/17159711
  xnxx.pornvl.net/video9834919/kinky_sophie_dee_strapon_fucks_her_girlfriends_pussy_
  xnxx.tubekek.com/search
+xnxx.tubekek.com/video-10q60c8/panty_face_fuck_freaks
  xnxx.tubekek.com/video-bmbovef
  xnxx.tubekek.com/video-cc8it97/teen_private_whore_house_20
  xnxx.tubekek.com/video-k09uzb0
@@ -69488,7 +69648,6 @@ xnxx.tubekek.com/video-t9bnxed/erotic_centerfold_turns_into_mad_bitch_and_shags_
  xnxx.tubekek.com/video-u1vpjd7
  xnxx.tubekek.com/video-x7hnna2/22/cyber_sex
  xnxx.tubekek.com/video-xzmlf76
-xnxx2013chatonline.blogspot.com/2013/06
  xnxx4porn.com/search/latex-anal-fisting/13
  xnxxbox.com/xvideos-lucky-guy-gets-stripshow-and-blowjob-from-three-czech-teens-13-min
  xnxxcao.com/video2361902/prostitute_cuffed_in_cell_in_bondage_sex
@@ -69539,6 +69698,7 @@ xpornxx18.blogspot.com/2019
  xposedzone.tumblr.com/post/133477278892/follow-xposedzone-for-more-girls-naked-in-public
  xposewife-deactivated20160711.tumblr.com/post/138219950223/next-door-sluts-punk-rock-girl-fucking
  xprimevideos.com/09blonde
+xprivate.club/jynx-maze-natural-tits-sloppy-cocksuckers
  xrapid.com/karla
  xrapid.com/sweet
  xrated.no/site/modules/myalbum/
@@ -69582,7 +69742,6 @@ xtubex.tumblr.com/post/103758273857/bondage-hentai-coed-gangbang-and-splash-cum
  xuguangxue.tumblr.com/post/46710449552/sexy-anal-teen-anal-penetration-the-first
  xunocomun.tumblr.com/post/110456874989/sexy-pictures-at-my-tumblr-blog
  xuvana.cw.cm/chat
-xuxa-ilarie.blogspot.com/2008/01
  xv8r.com/./active-elite-female-college-student-intellectual-
  xvideo.mx/se
  xvideos.wapka.cc/amateur-channels/lana_lava
@@ -69599,6 +69758,7 @@ xvideos.wapka.cc/video6138614/jynx_maze_et_roxi_texas_deuxieme_partie
  xvideos.wapka.cc/video8906776
  xvideos17.com/videos/rough-throat-fucking-foursome-GjXJ
  xvideos2.rocks/video
+xvideos2in.com/video
  xvideosfeed.blogspot.com/2016
  xvideosok.com/en/video/1426482545966120480
  xvideosonline.org/french-slut-pipe-en-voiture-et-baise-en-avion
@@ -69636,21 +69796,7 @@ xxvalkyrie.tumblr.com/post/138358107812
  xxvalkyrie.tumblr.com/post/138388230022
  xxx-erotic-stories.blogspot.com/2008
  xxx-erotic-stories.blogspot.com/2010
-xxx-sluts.blogspot.com/2015/05
  xxx.pornpeel.com/853084
-xxx.tubedare.net/search
-xxx.tubedare.net/search/hits
-xxx.tubedare.net/search/kinky
-xxx.tubedare.net/search/prostitution
-xxx.tubedare.net/video-a525t5e/30/sexy_hot_babe_striptease_adults_only
-xxx.tubedare.net/video-hoc6110
-xxx.tubedare.net/video-ipjsj33/12/young_girl_with_big_boobs_strip_show
-xxx.tubedare.net/video-j42flfa
-xxx.tubedare.net/video-l9bz344/interracial_blowjob_and_deepthroat_group_sex
-xxx.tubedare.net/video-pdhrh19/obscene_facesitting_amateur
-xxx.tubedare.net/video-qc1hlfb/25/obscene_home_porn_smothering_video
-xxx.tubedare.net/video-s8oq322
-xxx.tubedare.net/video-upzdz03/lisa_ann_masturbation_and_orgasm_on_webcam
  xxxanal.org/category
  xxxanalmovies.net/category/group-sex
  xxxasianphotos.com/facial
@@ -69663,7 +69809,6 @@ xxxftw666.tumblr.com/post/118425821925/biggangbanglover-group-fuck-photos-videos
  xxxfuckvideo.blogspot.com/2018
  xxxgif.info/doggystyle-hardcore-fucking-of-her-pretty-pussy
  xxxgif.info/make-her-come
-xxxgirlssex.blogspot.com/2008
  xxxgranny.tumblr.com/post/149336105334/nude-grannies-matures-pussy
  xxxhd.pl/Twardy-penis-rznie-dwie-gorace-cipki-hd
  xxxkinkywiqxxx.blogspot.com/2012/10
@@ -69675,7 +69820,6 @@ xxxmilftube.top/category/blowjob
  xxxpicbd.blogspot.com/p
  xxxpornvideos.cam/fr/panties
  xxxpretty.com/category
-xxxsex69.blogspot.com/2016
  xxxsexe91xxx.tumblr.com/post/107232040780/sluty-anal-wife-dpdoug-timea-bella
  xxxsexzoo.com/videos/hot-japan-bondage-zoophilia-porn-for-a-hot-woman
  xxxsexzoo.com/videos/severe-adult-xxx-zoophilia-along-amateur-female
@@ -69685,14 +69829,15 @@ xxxtubebbw.com/en/bbw-tape/Public
  xxxtubegain.com/en/category-of-xxx/aWktNTc0LTM0Nw
  xxxtubeon.com/clips-free
  xxxvideojdzfl.blogspot.com/2020/12
+xxxvideou.blogspot.com/2019
  xxxvideou.blogspot.com/2019/12
  xxxvideou.blogspot.com/2020
  xxxwetstory.com/asian
+xxxxhardcore.blogspot.com/2012/03
  xxxxjenniferdu76xxxx.skyrock.mobi/related_blogs
  xxxxmpegfreepornnudefemaleph.blogspot.com/2009
  xxxxporn.mobi/xxx/108411/khalifa-alia-sex-neket
  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx.com/buy/adult/movie/sex
-xxypics.blogspot.com/2019/08
  xybidy67.soup.io/post/355414133
  xydexx.com/inflatable
  xyevo.com/tits
@@ -69904,6 +70049,7 @@ young-kat.net/galleries/039
  young-kat.net/galleries/10
  young-shemales-fuck-face-bend-ov.blogspot.com/2011/06
  young-shemales-fuck-face-bend-ov.blogspot.com/2011/10
+young-shemales-fuck-face-bend-ov.blogspot.com/2012/03
  young-webcam-video.blogspot.com/2018
  young-webcam-video.blogspot.com/2018/05
  young.scot/information/identity/questions-you-might-be-asked-if-you-come-out-as-lesbian-gay-or-bisexual
@@ -70021,6 +70167,7 @@ youthtranny.tumblr.com/post
  youtorrent.com/tag/illegal-preteen-sex
  youtube-online-storage.com/porn
  youtube-storage-movies.com/porn/
+youtube-tendances.blogspot.com/2019/08
  youtube.com/embed/0watgaqmgga
  youtube.com/embed/afpa3nsukw8
  youtube.com/embed/bcd2iyhvjx0
@@ -70085,6 +70232,7 @@ yulover.com/candygirl/29
  yummyboogersuger.tumblr.com/post/57866877077/urbliss-urbliss-lesbian-panties-amateur
  yummyrem.tumblr.com/post/51225060816/eroticunlimited-big-breasted-blond-kicks-tiny
  yumoto.exblog.jp/267005
+yumpics.blogspot.com/2014/08
  yumpics.blogspot.com/2014/09
  yunaproject.com/hardcore-or-softcore-which-do-your-prefer
  yungflower17.tumblr.com/post/129405505218/teen-talks-dirty-while-fucking-her-pussy-with-a
@@ -70399,10 +70547,12 @@ ztabros66.info/portale-del-sesso
  ztropical.com/images/kfit/38
  ztube.org/arab-girl-mia-khalifa-fucked-by-a-dog-zoophilia
  ztube.org/artoofzoo-zoofilia-with-zooofart-dog
+ztube.org/asian-licking-dog-anal-in-animal-sex
  ztube.org/lady-k9-ariel-porno-next-door-private
  ztube.org/pervert-slut-zoophilia-anal-dogporn
  ztube.org/tag/blonde
  ztube.org/tag/zoofilia
+ztube.org/videos/bestiality-porn
  zuccaweb.it/Tabatha-Cash
  zuccaweb.it/blowjob
  zuccaweb.it/dildo
@@ -70427,6 +70577,7 @@ zuzaa.com/gallery
  zv-magazine.be/sfw
  zv-magazine.be/user
  zverevaippahynu.blogspot.com/2011
+zverevaippahynu.blogspot.com/2011/02
  zvezd.ru/inostr
  zvornik.bbfr.net/t18-zoophilie-extrait-gratuit-xxx-vieille-cochonne-nue-photo-amateur-de-femme-vestiaire
  zvraceny.cz/video/59477-bizarre-ejaculation-sado-sexual-nipple-torture-practises/
diff --git a/blacklists/malware/domains b/blacklists/malware/domains

index 427fa89a14ce1da4ec2ebcf667b60696345bbd6a..253b10fefb0d0023ed2ee038ef7d446452d48772 100644 (file)
--- a/blacklists/malware/domains
+++ b/blacklists/malware/domains
@@ -483,16 +483,16 @@
  1.0.133.89
  1.0.151.57
  1.0.152.100
-1.0.153.186
-1.0.153.8
+1.0.153.113
  1.0.153.92
  1.0.154.212
  1.0.156.173
  1.0.158.242
  1.0.159.229
+1.0.160.119
  1.0.160.36
  1.0.161.102
-1.0.161.165
+1.0.161.178
  1.0.161.66
  1.0.162.18
  1.0.162.217
@@ -510,39 +510,34 @@
  1.0.183.249
  1.0.183.25
  1.0.184.94
-1.0.185.239
  1.0.185.82
  1.0.187.122
+1.0.190.183
  1.0.190.45
  1.0.208.211
  1.0.212.136
-1.0.212.81
  1.0.213.219
  1.0.213.24
  1.0.213.40
-1.0.214.244
  1.0.220.3
  1.0.220.98
  1.0.224.112
-1.0.227.211
  1.0.231.185
  1.0.232.183
+1.0.238.54
  1.0.240.94
  1.0.255.224
  1.0.255.243
  1.1.131.251
  1.1.138.168
+1.1.154.230
  1.1.160.73
  1.1.161.184
  1.1.161.244
  1.1.162.213
-1.1.165.57
-1.1.187.34
-1.1.202.45
  1.1.223.69
  1.1.223.95
  1.1.225.182
-1.1.226.123
  1.1.227.163
  1.1.228.99
  1.1.233.240
@@ -560,6 +555,7 @@
  1.10.165.49
  1.10.171.36
  1.10.180.38
+1.10.182.212
  1.10.186.114
  1.10.186.167
  1.10.186.35
@@ -567,39 +563,33 @@
  1.10.187.149
  1.10.187.237
  1.10.187.92
-1.10.188.132
  1.10.188.140
  1.10.188.202
  1.10.188.5
+1.10.188.52
+1.10.188.78
  1.10.188.93
  1.10.189.107
+1.10.189.126
  1.10.189.133
  1.10.189.156
  1.10.189.84
-1.10.229.231
-1.10.232.83
-1.10.239.138
+1.10.238.238
  1.10.242.190
  1.10.246.179
-1.10.248.147
-1.10.248.244
  1.11.201.18
  1.119.131.102
  1.119.153.110
  1.119.166.234
  1.122.234.70
  1.122.64.110
-1.129.20.95
-1.129.27.254
  1.136.110.148
  1.157.192.174
  1.159.22.75
-1.160.100.177
  1.164.140.145
  1.164.97.194
  1.165.181.69
  1.165.182.50
-1.168.216.132
  1.170.183.146
  1.171.195.111
  1.17110.com
@@ -614,11 +604,11 @@
  1.175.78.213
  1.175.81.105
  1.175.89.134
-1.175.93.35
  1.176.254.225
  1.179.130.201
  1.179.137.10
  1.179.144.181
+1.179.144.41
  1.179.147.5
  1.179.148.9
  1.179.172.45
@@ -630,15 +620,13 @@
  1.179.185.50
  1.179.186.174
  1.179.186.69
-1.179.196.109
  1.179.196.65
  1.179.198.226
  1.179.201.153
  1.179.246.244
  1.180.217.139
+1.186.111.150
  1.186.242.12
-1.186.248.136
-1.186.37.103
  1.186.38.60
  1.186.40.157
  1.186.40.177
@@ -646,41 +634,38 @@
  1.186.40.9
  1.186.57.150
  1.186.63.133
-1.189.196.47
+1.191.100.67
  1.193.160.164
  1.196.152.217
  1.198.72.233
-1.199.192.166
  1.199.195.45
+1.199.30.87
+1.2.132.190
  1.2.136.96
  1.2.153.211
  1.2.169.101
  1.2.169.49
  1.2.169.8
  1.2.169.81
-1.2.171.224
  1.2.180.189
  1.2.192.103
-1.2.194.102
  1.2.194.243
  1.2.195.159
  1.2.195.181
  1.2.195.188
+1.2.196.203
  1.2.197.6
-1.2.198.111
  1.2.198.249
  1.2.199.17
+1.2.199.84
  1.2.202.40
  1.2.203.190
  1.2.203.244
  1.2.203.31
  1.2.203.32
-1.2.204.40
  1.2.204.56
-1.2.205.223
  1.2.206.238
  1.2.211.187
-1.2.221.25
  1.2.221.36
  1.2.223.22
  1.20.100.111
@@ -688,6 +673,7 @@
  1.20.100.227
  1.20.100.45
  1.20.101.103
+1.20.101.114
  1.20.101.149
  1.20.101.221
  1.20.101.62
@@ -698,8 +684,7 @@
  1.20.137.82
  1.20.156.220
  1.20.156.226
-1.20.166.29
-1.20.169.156
+1.20.156.230
  1.20.169.206
  1.20.175.61
  1.20.178.145
@@ -707,16 +692,12 @@
  1.20.181.198
  1.20.202.13
  1.20.202.137
-1.20.203.157
  1.20.203.212
  1.20.207.166
  1.20.207.169
  1.20.207.188
  1.20.207.243
-1.20.207.99
  1.20.217.192
-1.20.217.221
-1.20.217.52
  1.20.217.78
  1.20.218.137
  1.20.220.79
@@ -724,10 +705,8 @@
  1.20.227.220
  1.20.227.66
  1.20.229.67
-1.20.233.188
-1.20.235.199
+1.20.234.170
  1.20.241.42
-1.20.81.101
  1.20.96.156
  1.20.96.158
  1.20.96.164
@@ -741,11 +720,11 @@
  1.20.98.66
  1.20.99.122
  1.20.99.44
+1.202.76.206
  1.202.76.226
  1.202.77.210
  1.204.173.253
  1.204.64.87
-1.204.69.8
  1.209.110.87
  1.209.171.34
  1.209.229.179
@@ -760,13 +739,14 @@
  1.215.138.84
  1.215.162.195
  1.217.24.139
-1.22.196.12
-1.22.8.188
+1.217.8.250
+1.22.166.249
  1.220.145.45
  1.220.185.149
  1.220.89.178
  1.220.9.68
  1.220.90.53
+1.221.147.163
  1.221.173.148
  1.221.254.82
  1.222.170.43
@@ -778,13 +758,14 @@
  1.222.43.19
  1.222.44.52
  1.223.248.99
+1.225.101.152
  1.225.40.156
  1.225.81.206
  1.226.84.243
  1.227.57.126
  1.229.165.34
  1.229.224.78
-1.23.183.197
+1.23.76.24
  1.230.213.123
  1.232.247.3
  1.233.163.193
@@ -792,11 +773,10 @@
  1.234.23.177
  1.234.4.69
  1.234.51.108
-1.234.58.149
+1.234.58.166
  1.234.58.193
  1.234.58.236
  1.235.192.218
-1.245.241.62
  1.245.4.163
  1.245.47.108
  1.245.61.144
@@ -881,37 +861,35 @@
  1.253.1.4
  1.254.152.220
  1.254.154.42
-1.254.250.52
  1.255.226.37
  1.26.131.93
-1.27.228.230
-1.29.113.180
  1.30.215.144
-1.30.218.89
-1.32.44.16
  1.32.46.20
  1.32.47.53
  1.32.59.217
  1.34.136.15
  1.36.210.62
+1.36.65.191
  1.36.88.200
  1.38.221.28
-1.4.130.100
  1.4.135.231
  1.4.146.232
+1.4.146.96
+1.4.157.34
  1.4.157.35
  1.4.160.61
+1.4.170.223
  1.4.174.192
  1.4.187.160
-1.4.187.211
  1.4.191.73
+1.4.198.13
  1.4.198.14
-1.4.198.20
+1.4.198.170
  1.4.198.230
  1.4.198.4
  1.4.198.47
  1.4.198.48
-1.4.198.52
+1.4.198.53
  1.4.198.62
  1.4.243.14
  1.4.248.139
@@ -919,8 +897,9 @@
  1.4.253.31
  1.42.201.180
  1.4buyuklergazete.com
+1.52.123.235
+1.52.156.21
  1.52.168.135
-1.52.23.122
  1.52.51.7
  1.52.86.154
  1.53.137.12
@@ -928,42 +907,43 @@
  1.53.137.220
  1.53.137.84
  1.53.137.92
-1.53.142.102
-1.53.180.47
-1.53.190.106
+1.53.154.31
  1.53.206.149
  1.54.117.174
  1.54.201.35
  1.54.208.131
  1.55.165.141
-1.55.195.71
  1.55.215.30
  1.55.223.95
  1.55.241.4
+1.55.242.172
+1.55.250.181
  1.55.51.64
  1.56.207.130
+1.56.214.165
  1.6.10.90
  1.6.135.164
  1.6.182.218
  1.6.233.253
-1.60.118.55
  1.62.89.184
  1.63.226.147
-1.64.87.148
  1.69.205.173
  1.69.243.225bin.sh
  1.69.248.56
-1.71.128.18
  1.71.142.183
  1.71.143.177
  1.80.148.227
  1.80.150.13
  1.80.150.76
  1.80.153.220
+1.80.164.27
+1.80.165.130
+1.80.174.197
  1.80.184.12
  1.80.55.134
+1.83.114.132
  1.83.54.182
-1.83.55.155
+1.83.55.147
  1.85.0.98
  1.85.13.236
  1.85.17.20
@@ -990,13 +970,13 @@
  10.4buyuklergazete.com
  100-365.net
  100-diamond.000webhostapp.com
-100.0.220.63
+100.0.15.8
  100.1.149.223
  100.111.231.2.static.cdnserver.in
  100.12.36.75
-100.14.113.117
  100.14.59.165
  100.14.9.2
+100.15.81.199
  100.16.171.7
  100.16.222.53
  100.16.255.31
@@ -1005,12 +985,14 @@
  100.2.0.58
  100.2.182.206
  100.2.182.31
+100.2.20.82
  100.2.202.125
  100.2.238.88
  100.2.243.233
  100.24.216.83
  100.25.185.145
  100.25.217.29
+100.25.3.5
  100.25.60.57
  100.26.143.89
  100.26.180.70
@@ -1021,7 +1003,7 @@
  100.32.29.134
  100.34.17.227
  100.35.47.77
-100.36.140.60
+100.36.134.236
  100.36.76.248
  100.37.254.90
  100.38.148.84
@@ -1040,6 +1022,7 @@
  100.43.85.18
  100.43.85.19
  100.43.85.20
+100.6.114.70
  100.6.23.40
  100.7.116.12
  100.7.3.44
@@ -1072,6 +1055,7 @@
  100milesmanhattan.com
  100stuff.site
  101-carats.com
+101.0.105.98
  101.0.34.117
  101.0.34.189
  101.0.34.202
@@ -1091,8 +1075,10 @@
  101.0.54.165
  101.0.54.184
  101.0.54.21
+101.0.54.22
  101.0.54.229
  101.0.54.57
+101.0.54.84
  101.0.54.90
  101.0.81.153
  101.100.146.147
@@ -1101,24 +1087,27 @@
  101.101.217.165
  101.108.107.36
  101.108.113.233
-101.108.117.113
+101.108.116.35
  101.108.118.88
+101.108.121.106
  101.108.123.252
  101.108.124.243
  101.108.124.70
  101.108.130.145
+101.108.131.242
+101.108.131.92
+101.108.133.137
  101.108.135.13
  101.108.135.73
  101.108.145.106
+101.108.152.138
  101.108.154.197
  101.108.155.102
  101.108.166.93
-101.108.176.170
  101.108.177.43
  101.108.178.231
  101.108.180.193
  101.108.182.201
-101.108.183.165
  101.108.183.182
  101.108.184.164
  101.108.184.222
@@ -1128,7 +1117,6 @@
  101.108.189.1
  101.108.192.20
  101.108.192.245
-101.108.192.96
  101.108.193.51
  101.108.195.38
  101.108.196.178
@@ -1136,7 +1124,7 @@
  101.108.196.232
  101.108.196.85
  101.108.197.123
-101.108.197.126
+101.108.197.198
  101.108.197.244
  101.108.197.76
  101.108.199.164
@@ -1147,21 +1135,17 @@
  101.108.28.41
  101.108.31.31
  101.108.32.208
+101.108.37.202
  101.108.53.194
  101.108.61.106
-101.108.61.119
  101.108.71.147
  101.108.93.12
  101.108.93.164
-101.108.93.68
  101.109.109.63
  101.109.124.222
  101.109.13.49
-101.109.131.147
  101.109.134.38
-101.109.138.103
  101.109.143.71
-101.109.147.41
  101.109.151.207
  101.109.153.160
  101.109.154.190
@@ -1173,11 +1157,11 @@
  101.109.177.14
  101.109.177.238
  101.109.180.72
-101.109.181.139
  101.109.184.193
  101.109.20.112
  101.109.210.48
  101.109.239.113
+101.109.24.211
  101.109.24.213
  101.109.245.200
  101.109.247.173
@@ -1196,15 +1180,13 @@
  101.109.35.124
  101.109.37.107
  101.109.41.137
+101.109.43.231
  101.109.46.111
  101.109.49.111
-101.109.67.107
-101.109.70.127
  101.109.70.33
  101.109.83.194
  101.112.160.71
  101.127.232.199
-101.128.117.43
  101.132.149.193
  101.132.182.76
  101.132.33.79
@@ -1213,10 +1195,8 @@
  101.132.43.162
  101.132.72.117
  101.133.226.119
-101.133.235.75
  101.165.169.151
  101.166.192.44
-101.166.85.252
  101.173.40.161
  101.177.1.164
  101.178.223.39
@@ -1225,9 +1205,6 @@
  101.198.186.254
  101.20.110.104
  101.20.136.171
-101.20.171.255
-101.20.171.61
-101.20.244.126
  101.20.35.78
  101.200.124.44
  101.200.160.24
@@ -1237,11 +1214,15 @@
  101.200.57.240
  101.201.62.45
  101.203.174.175
+101.205.120.102
  101.206.162.156
  101.206.162.178
  101.206.162.249
+101.224.252.12
  101.226.21.105
  101.226.253.162
+101.227.251.235
+101.227.34.23
  101.227.5.66
  101.227.67.35
  101.227.82.60
@@ -1251,7 +1232,6 @@
  101.228.34.153
  101.229.100.143
  101.229.100.236
-101.229.147.118
  101.230.248.162
  101.230.248.163
  101.230.248.164
@@ -1265,10 +1245,7 @@
  101.236.60.31
  101.25.112.240
  101.25.117.141
-101.25.29.40
-101.25.99.61
  101.251.197.238
-101.251.198.115
  101.251.207.228
  101.251.219.100
  101.251.219.115
@@ -1286,8 +1263,6 @@
  101.255.125.57
  101.255.125.59
  101.255.140.101
-101.255.149.2
-101.255.171.218
  101.255.40.18
  101.255.52.210
  101.255.55.10
@@ -1304,11 +1279,7 @@
  101.255.9.10
  101.255.94.130
  101.26.71.19
-101.26.88.95
-101.26.94.145
-101.28.48.219
  101.30.106.196
-101.30.61.34
  101.32.10.15
  101.32.11.194
  101.32.11.54
@@ -1325,10 +1296,11 @@
  101.32.178.46
  101.32.181.140
  101.32.181.199
-101.32.181.50
  101.32.182.55
  101.32.182.62
  101.32.183.189
+101.32.184.141
+101.32.184.162
  101.32.187.120
  101.32.187.45
  101.32.188.89
@@ -1348,11 +1320,11 @@
  101.32.21.206
  101.32.211.212
  101.32.213.171
-101.32.218.82
  101.32.22.56
  101.32.242.16
  101.32.243.161
  101.32.26.159
+101.32.29.100
  101.32.33.145
  101.32.34.76
  101.32.36.242
@@ -1371,6 +1343,7 @@
  101.33.116.189
  101.33.117.207
  101.33.117.60
+101.33.118.188
  101.33.118.203
  101.33.118.32
  101.33.122.243
@@ -1382,10 +1355,8 @@
  101.33.124.208
  101.33.124.250
  101.33.124.69
-101.33.125.127
  101.33.125.136
  101.33.127.133
-101.33.127.224
  101.33.127.66
  101.36.105.167
  101.36.109.214
@@ -1396,7 +1367,9 @@
  101.36.118.33
  101.36.118.82
  101.36.122.11
+101.36.122.184
  101.36.124.151
+101.36.124.82
  101.36.125.50
  101.36.126.24
  101.36.126.34
@@ -1408,13 +1381,14 @@
  101.36.178.48
  101.36.179.145
  101.36.181.142
+101.36.181.158
  101.37.118.54
+101.37.161.61
  101.37.33.19
  101.4.130.234
  101.4.136.34
  101.4.62.36
  101.50.1.2
-101.50.99.51
  101.51.105.202
  101.51.105.249
  101.51.106.70
@@ -1422,7 +1396,7 @@
  101.51.121.203
  101.51.121.29
  101.51.121.35
-101.51.14.199
+101.51.141.106
  101.51.141.11
  101.51.141.118
  101.51.141.122
@@ -1432,12 +1406,12 @@
  101.51.141.81
  101.51.144.75
  101.51.157.194
-101.51.158.32
  101.51.159.253
  101.51.16.87
  101.51.160.4
+101.51.161.167
+101.51.171.58
  101.51.171.97
-101.51.212.118
  101.51.218.209
  101.51.219.156
  101.51.22.117
@@ -1445,40 +1419,34 @@
  101.51.235.127
  101.51.24.134
  101.51.241.89
-101.51.242.130
  101.51.33.228
-101.51.41.81
  101.51.43.143
  101.51.48.241
  101.51.52.231
  101.51.59.242
+101.51.64.25
  101.51.65.242
  101.51.65.247
  101.51.66.23
  101.51.67.196
-101.51.70.41
+101.51.68.238
  101.51.71.3
  101.51.86.28
  101.6.64.76
-101.64.116.52
  101.64.117.49
  101.64.136.9
-101.64.137.222
  101.64.156.58
  101.64.157.103
  101.64.157.146
-101.64.157.239
  101.65.128.150
-101.65.129.116
  101.65.160.13
-101.66.80.23
  101.67.215.7
  101.67.241.95
  101.67.243.158
-101.69.119.31
  101.69.200.162
  101.69.240.94
  101.69.247.6
+101.7.7.160
  101.70.15.84
  101.70.52.105
  101.71.28.72
@@ -1486,9 +1454,7 @@
  101.71.51.192
  101.72.33.145
  101.73.145.214
-101.73.20.114
  101.78.15.54
-101.78.3.29
  101.78.9.237
  101.79.167.114
  101.79.5.58
@@ -1503,10 +1469,11 @@
  101.91.178.122
  101.91.199.49
  101.91.238.43
-101.93.107.120
  101.95.86.34
+101.96.113.50
  101.98.149.170
  101.98.167.205
+101.98.43.59
  101.99.14.49
  101.99.14.54
  101.99.20.59
@@ -1533,21 +1500,20 @@
  101gowrie.com
  101jo.com
  101login-screens.weebly.com
-102.105.96.206
-102.114.227.89
-102.114.25.84
+102.114.138.54
+102.114.3.133
  102.114.46.70
  102.114.9.57
  102.118.114.6
-102.118.205.2
+102.118.206.99
  102.129.175.128
  102.129.175.155
  102.129.199.111
+102.129.199.69
  102.129.199.83
  102.129.249.232
  102.129.36.189
  102.129.79.10
-102.130.112.193
  102.130.119.99
  102.130.120.91
  102.130.64.30
@@ -1560,26 +1526,34 @@
  102.134.176.12
  102.134.176.124
  102.134.176.15
+102.134.176.34
+102.134.176.73
  102.134.176.94
  102.134.176.96
  102.134.180.75
  102.137.241.7
+102.140.175.179
+102.141.116.3
+102.141.116.33
  102.141.121.13
  102.141.121.14
  102.141.197.17
  102.141.48.145
-102.152.144.154
+102.152.131.86
+102.152.26.230
  102.152.39.150
  102.152.39.34
-102.152.53.144
+102.152.61.48
+102.160.38.219
+102.164.0.132
  102.164.108.43
  102.164.202.199
  102.164.210.125
  102.164.248.235
+102.165.135.14
  102.165.30.29
  102.165.30.33
-102.165.30.41
-102.165.30.49
+102.165.30.5
  102.165.52.62
  102.165.54.170
  102.165.54.171
@@ -1593,11 +1567,13 @@
  102.176.160.84
  102.176.161.114
  102.176.162.24
+102.176.179.22
  102.176.180.22
  102.176.180.6
  102.176.180.62
  102.176.189.7
  102.176.197.253
+102.176.81.99
  102.177.105.34
  102.177.141.1
  102.177.141.105
@@ -1607,15 +1583,15 @@
  102.177.142.1
  102.177.147.1
  102.177.160.1
+102.177.161.1
  102.182.204.96
-102.186.30.230
-102.222.181.80
+102.222.168.4
  102.223.73.187
  102.23.221.1
  102.23.242.15
  102.244.120.10
+102.32.132.120
  102.33.21.34
-102.33.21.36
  102.36.164.141
  102.37.10.45
  102.37.43.139
@@ -1625,27 +1601,27 @@
  102.38.50.228
  102.38.50.62
  102.38.50.65
-102.39.181.60
+102.45.105.56
  102.45.138.94
  102.45.220.174
-102.51.5.106
-102.53.11.65
  102.53.4.42
  102.53.4.85
+102.64.120.118
+102.64.120.228
  102.64.122.244
  102.64.122.40
+102.64.123.146
  102.64.33.134
-102.64.33.143
  102.64.33.147
+102.65.16.54
  102.65.190.112
  102.65.20.43
  102.65.20.91
  102.65.89.16
-102.67.19.132
+102.66.61.197
  102.67.23.131
  102.67.68.1
  102.67.69.211
-102.67.69.217
  102.67.73.1
  102.67.74.1
  102.68.134.14
@@ -1662,9 +1638,11 @@
  103.1.237.174
  103.1.93.184
  103.1.93.59
+103.1.94.117
  103.1.94.139
  103.1.94.78
  103.10.133.169
+103.10.133.41
  103.10.133.81
  103.10.157.9
  103.10.168.240
@@ -1673,6 +1651,8 @@
  103.10.228.221
  103.10.23.161
  103.10.3.104
+103.10.54.17
+103.10.54.81
  103.10.56.190
  103.10.59.73
  103.10.81.172
@@ -1684,12 +1664,14 @@
  103.100.209.152
  103.100.209.24
  103.100.210.101
+103.100.210.116
  103.100.210.207
  103.100.211.77
  103.100.83.253
  103.101.161.33
  103.101.162.209
  103.101.174.145
+103.101.199.174
  103.101.233.13
  103.101.52.48
  103.102.14.185
@@ -1702,7 +1684,7 @@
  103.102.87.90
  103.102.90.30
  103.103.128.88
-103.103.42.253
+103.103.174.215
  103.103.52.40
  103.103.71.8
  103.104.124.33
@@ -1711,14 +1693,11 @@
  103.104.213.118
  103.104.215.234
  103.104.227.154
-103.104.231.11
  103.104.248.248
  103.104.61.102
  103.105.130.136
  103.105.142.132
  103.105.195.230
-103.105.196.32
-103.105.208.66
  103.105.209.26
  103.105.212.106
  103.105.236.1
@@ -1738,6 +1717,7 @@
  103.105.67.146
  103.105.70.9
  103.106.112.11
+103.106.136.146
  103.106.148.209
  103.106.158.252
  103.106.192.245
@@ -1748,7 +1728,6 @@
  103.106.237.182
  103.106.242.200
  103.106.242.206
-103.106.250.34
  103.106.28.78
  103.106.32.1
  103.106.32.105
@@ -1782,6 +1761,7 @@
  103.107.160.169
  103.107.161.54
  103.107.17.205
+103.107.182.17
  103.107.68.1
  103.107.68.109
  103.107.68.129
@@ -1839,7 +1819,6 @@
  103.107.94.49
  103.107.94.53
  103.107.94.57
-103.107.94.61
  103.107.94.65
  103.107.94.85
  103.107.94.89
@@ -1849,6 +1828,7 @@
  103.108.187.4
  103.108.228.42
  103.108.58.212
+103.108.59.162
  103.108.75.153
  103.108.87.133
  103.108.87.161
@@ -1863,7 +1843,6 @@
  103.109.160.58
  103.109.180.20
  103.109.182.193
-103.109.194.210
  103.109.209.15
  103.109.217.250
  103.109.3.1
@@ -1880,7 +1859,9 @@
  103.109.56.241
  103.109.56.249
  103.109.56.97
+103.109.57.1
  103.109.57.13
+103.109.57.161
  103.109.57.17
  103.109.57.233
  103.109.57.237
@@ -1912,6 +1893,7 @@
  103.110.109.65
  103.110.109.89
  103.110.109.9
+103.110.115.101
  103.110.124.21
  103.110.126.111
  103.110.160.198
@@ -1943,7 +1925,6 @@
  103.111.83.122
  103.112.0.125
  103.112.0.128
-103.112.0.57
  103.112.204.190
  103.112.212.133
  103.112.212.30
@@ -1968,9 +1949,9 @@
  103.112.63.33
  103.112.65.136
  103.112.86.174
+103.112.9.1
  103.113.104.176
  103.113.104.225
-103.113.104.43
  103.113.106.178
  103.113.106.226
  103.113.106.227
@@ -1991,14 +1972,16 @@
  103.113.3.74
  103.113.67.32
  103.114.0.3
+103.114.10.234
  103.114.104.35
+103.114.104.62
  103.114.105.83
  103.114.106.11
  103.114.107.149
  103.114.107.249
-103.114.161.195
-103.114.161.196
  103.114.192.57
+103.114.221.16
+103.114.247.30
  103.114.61.150
  103.114.97.1
  103.114.97.74
@@ -2018,8 +2001,7 @@
  103.115.119.250
  103.115.119.254
  103.115.14.1
-103.115.164.99
-103.115.202.38
+103.115.195.84
  103.115.252.129
  103.115.252.26
  103.115.252.30
@@ -2041,14 +2023,14 @@
  103.116.47.92
  103.116.57.64
  103.116.78.103
-103.117.103.213
  103.117.108.106
  103.117.108.154
  103.117.108.247
  103.117.108.30
  103.117.146.210
  103.117.146.98
-103.117.152.41
+103.117.148.5
+103.117.152.60
  103.117.152.75
  103.117.153.220
  103.117.180.48
@@ -2058,9 +2040,9 @@
  103.117.233.59
  103.118.169.85
  103.118.76.54
-103.119.101.129
  103.119.116.26
  103.119.144.206
+103.119.2.28
  103.119.229.130
  103.119.244.10
  103.119.92.107
@@ -2102,20 +2084,21 @@
  103.12.246.77
  103.12.246.81
  103.12.246.97
-103.12.31.75
-103.120.135.218
  103.120.168.3
-103.120.179.28
-103.120.185.90
-103.120.189.34
  103.120.223.27
+103.120.251.150
+103.120.31.178
+103.121.154.169
+103.121.154.57
+103.121.175.50
+103.121.18.7
  103.121.215.208
  103.121.215.211
  103.121.224.11
  103.121.42.229
  103.122.104.134
  103.122.105.242
-103.122.177.12
+103.122.202.2
  103.122.246.24
  103.122.66.184
  103.122.66.200
@@ -2128,26 +2111,27 @@
  103.123.170.67
  103.123.224.198
  103.123.229.106
+103.123.231.202
  103.123.235.158
  103.123.235.40
  103.123.246.66
  103.123.25.80
  103.123.65.186
+103.123.71.162
  103.124.104.118
  103.124.136.77
  103.124.137.173
  103.124.147.22
+103.124.173.252
  103.124.173.33
  103.124.175.139
-103.124.205.142
  103.124.94.169
  103.124.95.136
  103.124.95.223
  103.125.106.2
  103.125.117.202
  103.125.128.45
-103.125.151.4
-103.125.151.5
+103.125.162.83
  103.125.170.22
  103.125.176.2
  103.125.189.202
@@ -2155,32 +2139,29 @@
  103.125.189.59
  103.125.191.106
  103.125.191.123
-103.125.191.136
+103.125.191.153
  103.125.191.233
  103.125.191.4
  103.125.191.69
  103.125.191.78
  103.125.218.107
+103.125.28.129
  103.125.39.54
  103.125.43.12
  103.125.43.53
-103.125.56.74
  103.126.100.13
  103.126.100.18
  103.126.100.31
  103.126.218.69
  103.126.218.70
-103.126.49.30
  103.127.108.96
-103.127.124.117
  103.127.157.210
  103.127.185.133
  103.127.206.109
  103.127.41.103
  103.127.57.162
-103.129.115.2
+103.127.72.103
  103.129.13.45
-103.129.192.196
  103.129.194.1
  103.129.195.48
  103.129.197.185
@@ -2190,14 +2171,14 @@
  103.129.223.136
  103.129.223.98
  103.13.132.206
-103.13.185.34
  103.13.229.170
  103.13.240.38
-103.13.88.90
  103.130.112.133
+103.130.115.36
  103.130.173.110
  103.130.184.211
  103.130.184.234
+103.130.195.188
  103.130.196.154
  103.130.209.251
  103.130.214.25
@@ -2212,11 +2193,14 @@
  103.131.52.4
  103.131.80.2
  103.132.244.191
+103.133.105.123
  103.133.105.194
+103.133.107.172
  103.133.109.40
  103.133.110.62
  103.133.223.122
  103.133.56.68
+103.133.78.26
  103.133.82.125
  103.134.177.163
  103.134.200.26
@@ -2228,10 +2212,13 @@
  103.135.174.130
  103.135.174.132
  103.135.174.134
+103.135.174.14
  103.135.174.142
  103.135.174.225
  103.135.174.229
  103.135.207.3
+103.135.248.197
+103.135.33.74
  103.136.40.50
  103.136.40.88
  103.136.82.50
@@ -2243,6 +2230,7 @@
  103.137.124.2
  103.137.124.20
  103.137.126.2
+103.137.16.167
  103.137.250.46
  103.137.6.226
  103.137.66.1
@@ -2257,13 +2245,13 @@
  103.138.14.59
  103.138.175.1
  103.138.192.51
+103.138.192.63
  103.138.212.218
  103.138.212.242
  103.138.213.129
  103.138.226.115
-103.138.4.136
+103.138.4.128
  103.138.4.153
-103.138.4.56
  103.138.4.58
  103.138.4.98
  103.138.5.146
@@ -2294,11 +2282,12 @@
  103.14.38.186
  103.14.38.188
  103.14.45.98
-103.140.104.212
+103.14.72.236
  103.140.131.26
  103.140.189.167
  103.140.235.90
  103.140.238.246
+103.140.30.178
  103.140.66.5
  103.140.82.1
  103.140.83.101
@@ -2317,7 +2306,9 @@
  103.140.83.93
  103.140.83.94
  103.141.108.142
+103.141.108.161
  103.141.108.185
+103.141.136.201
  103.141.138.114
  103.141.138.119
  103.141.138.133
@@ -2327,7 +2318,6 @@
  103.141.142.47
  103.141.177.91
  103.141.52.234
-103.141.97.57
  103.142.111.146
  103.142.164.37
  103.142.164.38
@@ -2375,39 +2365,36 @@
  103.143.235.37
  103.143.235.45
  103.143.77.102
-103.143.77.104
  103.143.77.124
+103.143.77.130
  103.143.77.22
  103.143.77.233
  103.143.77.75
  103.143.77.89
  103.143.84.72
-103.144.102.12
  103.144.146.226
  103.144.146.52
  103.144.146.67
  103.144.147.226
  103.144.180.2
  103.144.213.13
-103.144.82.250
+103.144.42.113
  103.145.12.11
  103.145.12.91
  103.145.190.138
  103.145.252.23
  103.145.254.221
-103.145.255.142
  103.145.67.246
  103.145.8.146
  103.146.100.130
-103.146.100.29
  103.146.110.22
  103.146.176.124
  103.146.182.94
-103.146.184.228
  103.146.31.52
  103.147.10.222
  103.147.222.243
  103.147.3.153
+103.147.3.254
  103.147.4.82
  103.147.5.67
  103.148.195.11
@@ -2424,14 +2411,15 @@
  103.148.195.51
  103.148.195.52
  103.148.210.110
-103.148.79.114
+103.148.25.45
+103.148.79.107
  103.148.79.120
  103.149.12.183
  103.149.158.0
  103.149.158.9
-103.149.196.158
-103.149.203.21
+103.149.162.138
  103.149.248.57
+103.149.60.5
  103.15.140.140
  103.15.226.14
  103.15.242.210
@@ -2442,62 +2430,51 @@
  103.15.245.238
  103.15.251.75
  103.15.251.76
-103.15.40.202
  103.15.83.83
-103.150.112.234
+103.150.142.49
  103.150.215.101
  103.150.215.115
  103.150.218.30
-103.150.238.215
  103.150.238.216
  103.150.238.221
  103.150.239.25
  103.150.68.124
-103.151.122.165
  103.151.123.208
  103.151.124.247
-103.151.124.97
  103.151.130.253
  103.151.176.21
  103.151.182.6
-103.151.188.159
  103.151.43.104
+103.151.47.213
  103.152.199.178
  103.152.221.178
  103.152.242.19
  103.152.242.51
  103.152.43.165
  103.152.5.2
-103.152.5.70
  103.152.79.138
+103.153.182.31
  103.153.182.59
  103.153.183.215
  103.153.183.57
-103.153.183.86
  103.153.92.137
+103.154.235.163
  103.154.9.66
+103.154.9.67
  103.154.9.68
  103.155.162.236
  103.155.166.250
-103.155.72.137
-103.155.72.86
  103.155.92.28
  103.155.92.72
  103.155.93.241
-103.156.145.139
-103.156.145.145
-103.156.145.155
-103.156.145.157
-103.156.145.192
-103.156.145.205
-103.156.145.215
-103.156.145.229
-103.156.224.14
  103.156.90.37
+103.156.91.20
  103.156.92.189
+103.157.116.199
  103.157.186.163
  103.157.220.197
  103.157.225.48
+103.157.25.2
  103.157.25.3
  103.157.25.4
  103.157.25.5
@@ -2508,6 +2485,8 @@
  103.16.131.157
  103.16.132.195
  103.16.132.210
+103.16.132.51
+103.16.145.21
  103.16.199.165
  103.16.202.187
  103.16.228.20
@@ -2530,6 +2509,7 @@
  103.18.179.212
  103.18.77.46
  103.19.141.144
+103.19.142.194
  103.19.229.150
  103.19.252.130
  103.19.252.210
@@ -2586,6 +2566,7 @@
  103.197.48.98
  103.197.75.1
  103.197.93.2
+103.198.114.4
  103.198.192.14
  103.198.34.164
  103.199.110.42
@@ -2634,7 +2615,9 @@
  103.199.159.246
  103.199.16.37
  103.199.16.50
+103.199.18.37
  103.199.19.134
+103.199.234.250
  103.199.84.42
  103.199.97.129
  103.199.97.161
@@ -2642,13 +2625,12 @@
  103.199.97.33
  103.199.97.5
  103.199.97.9
-103.2.134.222
-103.2.135.10
  103.2.181.70
  103.20.166.167
  103.20.188.94
  103.20.189.126
  103.20.191.242
+103.20.3.212
  103.20.33.185
  103.200.116.12
  103.200.133.49
@@ -2656,7 +2638,6 @@
  103.200.135.228
  103.200.135.229
  103.200.135.230
-103.200.30.12
  103.200.37.31
  103.200.40.194
  103.200.95.82
@@ -2668,12 +2649,9 @@
  103.204.109.178
  103.204.111.137
  103.204.166.206
-103.204.52.66
  103.204.54.50
-103.204.70.11
  103.205.128.129
  103.205.128.7
-103.205.128.81
  103.205.130.10
  103.205.130.16
  103.205.130.18
@@ -2688,7 +2666,7 @@
  103.205.130.212
  103.205.130.214
  103.205.130.216
-103.205.130.219
+103.205.130.218
  103.205.130.220
  103.205.130.222
  103.205.130.226
@@ -2705,12 +2683,11 @@
  103.205.130.27
  103.205.130.28
  103.205.130.3
-103.205.130.30
  103.205.130.34
  103.205.130.37
+103.205.130.38
  103.205.130.4
  103.205.130.40
-103.205.130.46
  103.205.130.48
  103.205.130.50
  103.205.130.55
@@ -2741,6 +2718,7 @@
  103.205.7.83
  103.205.7.84
  103.206.105.193
+103.206.112.195
  103.206.128.137
  103.206.130.201
  103.206.131.213
@@ -2756,7 +2734,6 @@
  103.207.11.10
  103.207.11.6
  103.207.156.207
-103.207.170.134
  103.207.37.133
  103.207.37.184
  103.207.37.189
@@ -2765,15 +2742,12 @@
  103.207.38.215
  103.207.38.31
  103.207.39.131
-103.207.42.75
-103.207.7.57
  103.207.96.21
  103.207.96.225
  103.207.96.226
  103.207.97.33
  103.208.120.125
  103.208.137.57
-103.208.152.184
  103.208.152.34
  103.208.200.114
  103.208.200.222
@@ -2803,6 +2777,7 @@
  103.21.40.35
  103.21.53.11
  103.21.58.156
+103.21.59.9
  103.210.120.40
  103.210.142.54
  103.210.236.19
@@ -2811,14 +2786,13 @@
  103.210.236.73
  103.210.237.13
  103.210.237.40
-103.210.239.35
  103.210.29.113
  103.210.29.193
  103.210.31.49
  103.210.72.72
-103.210.86.185
  103.211.11.1
  103.211.11.13
+103.211.11.233
  103.211.11.37
  103.211.11.41
  103.211.11.49
@@ -2848,13 +2822,14 @@
  103.211.8.161
  103.211.8.165
  103.211.8.173
+103.211.8.177
  103.211.8.181
  103.211.8.185
  103.211.8.189
  103.211.8.193
  103.211.8.201
  103.211.8.205
-103.211.8.209
+103.211.8.213
  103.211.8.221
  103.211.8.225
  103.211.8.229
@@ -2862,7 +2837,6 @@
  103.211.8.33
  103.211.8.37
  103.211.8.53
-103.211.8.57
  103.211.8.61
  103.211.8.65
  103.211.8.69
@@ -2873,11 +2847,10 @@
  103.211.8.89
  103.211.8.93
  103.211.8.97
-103.212.120.87
-103.212.121.95
  103.212.128.152
  103.212.128.228
  103.212.128.253
+103.212.140.148
  103.212.211.2
  103.212.211.4
  103.212.222.13
@@ -2910,6 +2883,7 @@
  103.212.94.253
  103.213.240.29
  103.213.245.102
+103.213.245.120
  103.213.245.169
  103.213.248.45
  103.213.31.244
@@ -2924,7 +2898,6 @@
  103.214.55.34
  103.214.55.6
  103.214.6.199
-103.214.60.43
  103.214.61.175
  103.214.61.41
  103.214.65.230
@@ -2936,6 +2909,7 @@
  103.215.177.153
  103.215.177.211
  103.215.177.231
+103.215.201.186
  103.215.223.99
  103.215.236.2
  103.215.80.182
@@ -2948,7 +2922,6 @@
  103.216.218.207
  103.216.239.202
  103.216.48.83
-103.216.69.207
  103.216.82.146
  103.216.82.153
  103.216.82.18
@@ -2960,11 +2933,13 @@
  103.216.82.42
  103.217.111.19
  103.217.119.75
+103.217.121.115
  103.217.121.124
  103.217.121.14
  103.217.121.143
  103.217.121.151
  103.217.121.158
+103.217.121.173
  103.217.121.179
  103.217.121.181
  103.217.121.186
@@ -2976,37 +2951,44 @@
  103.217.121.37
  103.217.121.53
  103.217.121.57
+103.217.121.69
  103.217.121.74
  103.217.121.79
  103.217.121.87
  103.217.121.97
  103.217.123.0
+103.217.123.107
  103.217.123.113
  103.217.123.114
  103.217.123.189
+103.217.123.209
  103.217.123.214
-103.217.123.220
  103.217.123.231
+103.217.123.58
  103.217.123.84
  103.217.133.76
-103.217.152.207
+103.217.153.169
+103.217.154.137
  103.217.173.210
+103.217.178.106
+103.217.213.125
  103.217.213.129
  103.217.213.145
-103.217.242.40
+103.217.217.25
  103.218.2.188
  103.218.240.75
  103.218.26.169
  103.219.112.48
  103.219.112.63
-103.219.147.2
+103.219.147.28
+103.219.162.241
  103.219.187.55
  103.219.187.56
  103.219.207.118
+103.219.208.77
  103.219.212.87
-103.219.40.245
-103.219.60.167
  103.22.144.67
+103.22.172.49
  103.22.248.59
  103.22.251.45
  103.220.204.101
@@ -3026,7 +3008,6 @@
  103.220.7.13
  103.221.220.21
  103.221.222.30
-103.221.232.107
  103.221.232.15
  103.221.232.171
  103.221.232.203
@@ -3058,6 +3039,7 @@
  103.224.185.208
  103.224.185.4
  103.224.185.48
+103.224.188.27
  103.224.195.41
  103.224.203.40
  103.224.241.45
@@ -3074,11 +3056,9 @@
  103.224.83.71
  103.224.83.91
  103.225.103.5
-103.225.139.230
  103.225.206.22
  103.225.212.13
  103.225.212.14
-103.225.22.118
  103.225.228.1
  103.225.228.101
  103.225.228.105
@@ -3118,7 +3098,6 @@
  103.226.250.79
  103.226.49.138
  103.226.51.80
-103.226.93.26
  103.227.145.6
  103.227.147.142
  103.227.176.23
@@ -3133,7 +3112,9 @@
  103.228.119.129
  103.228.119.137
  103.228.142.237
+103.228.143.71
  103.228.152.25
+103.228.47.89
  103.228.53.155
  103.228.71.39
  103.229.124.198
@@ -3143,6 +3124,7 @@
  103.229.200.1
  103.229.200.125
  103.229.45.170
+103.229.72.207
  103.229.73.17
  103.229.84.117
  103.229.85.205
@@ -3163,13 +3145,13 @@
  103.23.102.1
  103.23.102.129
  103.23.102.245
-103.23.119.3
-103.23.119.43
+103.23.119.53
  103.23.119.57
  103.23.119.60
  103.23.119.61
  103.23.124.66
  103.23.124.94
+103.23.127.200
  103.23.127.218
  103.23.154.184
  103.23.21.127
@@ -3186,9 +3168,10 @@
  103.231.253.20
  103.231.40.144
  103.231.44.187
+103.231.46.197
+103.231.46.66
  103.231.88.10
  103.232.104.227
-103.232.107.132
  103.232.120.109
  103.232.121.152
  103.232.25.71
@@ -3198,6 +3181,7 @@
  103.232.64.228
  103.232.64.73
  103.232.65.78
+103.232.66.164
  103.232.67.180
  103.233.0.121
  103.233.0.18
@@ -3228,14 +3212,15 @@
  103.234.254.10
  103.234.254.164
  103.234.94.45
+103.235.1.224
  103.235.164.110
-103.235.165.8
  103.235.170.162
  103.235.198.60
  103.235.199.46
  103.235.199.9
  103.235.227.60
  103.235.230.196
+103.235.232.218
  103.236.114.38
  103.236.160.129
  103.236.160.38
@@ -3258,6 +3243,7 @@
  103.236.253.28
  103.237.144.150
  103.237.145.182
+103.237.147.16
  103.237.56.16
  103.238.14.242
  103.238.224.138
@@ -3268,8 +3254,6 @@
  103.238.231.60
  103.238.69.144
  103.238.69.169
-103.238.69.194
-103.238.69.228
  103.239.147.129
  103.239.19.142
  103.239.252.234
@@ -3278,17 +3262,12 @@
  103.239.254.70
  103.239.255.170
  103.239.55.73
-103.24.110.89
-103.24.135.243
  103.24.230.86
  103.240.100.106
  103.240.100.214
-103.240.102.33
-103.240.140.146
  103.240.160.21
  103.240.161.101
  103.240.161.108
-103.240.161.109
  103.240.168.138
  103.240.170.191
  103.240.206.196
@@ -3313,6 +3292,7 @@
  103.240.77.98
  103.240.79.150
  103.240.79.160
+103.241.141.188
  103.241.141.234
  103.241.178.10
  103.241.204.225
@@ -3339,12 +3319,11 @@
  103.242.132.33
  103.242.14.68
  103.242.14.8
+103.242.15.37
  103.242.166.5
  103.242.168.14
-103.242.196.31
  103.242.3.134
  103.242.45.68
-103.242.47.229
  103.242.56.122
  103.242.66.56
  103.242.72.7
@@ -3372,8 +3351,8 @@
  103.244.111.196
  103.244.177.250
  103.244.205.146
-103.244.205.94
  103.244.206.74
+103.244.38.126
  103.244.4.66
  103.245.153.70
  103.245.19.30
@@ -3431,15 +3410,15 @@
  103.249.28.87
  103.249.31.189
  103.249.77.2
-103.249.83.66
  103.249.83.84
  103.25.0.202
  103.25.120.138
  103.25.121.153
  103.25.122.41
  103.25.130.114
+103.25.134.141
+103.25.134.192
  103.25.21.34
-103.25.250.235
  103.25.3.82
  103.25.45.38
  103.25.84.233
@@ -3459,8 +3438,6 @@
  103.250.69.233
  103.250.69.94
  103.250.71.33
-103.251.176.22
-103.251.176.243
  103.251.189.129
  103.251.190.6
  103.251.214.167
@@ -3491,8 +3468,8 @@
  103.251.223.13
  103.251.225.10
  103.251.225.16
+103.251.245.82
  103.251.57.23
-103.251.82.191
  103.251.83.14
  103.252.117.100
  103.252.12.223
@@ -3500,10 +3477,9 @@
  103.252.16.224
  103.252.168.75
  103.252.17.146
+103.252.170.48
  103.252.35.170
-103.252.5.228
  103.252.6.77
-103.253.105.34
  103.253.113.54
  103.253.115.183
  103.253.14.43
@@ -3532,7 +3508,6 @@
  103.255.237.203
  103.255.237.7
  103.255.53.98
-103.255.6.117
  103.255.6.89
  103.26.111.229
  103.26.136.173
@@ -3547,8 +3522,6 @@
  103.27.236.10
  103.27.239.185
  103.27.239.216
-103.27.32.42
-103.27.34.48
  103.27.4.161
  103.27.60.222
  103.27.61.222
@@ -3565,6 +3538,7 @@
  103.28.149.180
  103.28.149.201
  103.28.149.72
+103.28.36.185
  103.28.37.131
  103.28.52.93
  103.28.56.214
@@ -3574,7 +3548,6 @@
  103.28.84.81
  103.28.86.241
  103.29.117.129
-103.29.151.146
  103.29.156.142
  103.29.184.251
  103.29.69.57
@@ -3584,6 +3557,7 @@
  103.3.222.131
  103.3.46.213
  103.3.46.92
+103.3.82.220
  103.30.0.249
  103.30.0.5
  103.30.151.17
@@ -3591,6 +3565,7 @@
  103.30.188.130
  103.30.40.248
  103.30.92.91
+103.30.93.171
  103.31.109.173
  103.31.109.180
  103.31.109.186
@@ -3607,14 +3582,14 @@
  103.31.225.200
  103.31.227.183
  103.31.227.24
+103.31.232.173
  103.31.232.93
  103.31.250.122
  103.31.250.197
  103.31.250.204
-103.31.251.17
  103.31.251.25
-103.31.251.58
  103.31.45.174
+103.31.47.58
  103.31.53.2
  103.31.84.122
  103.35.108.145
@@ -3625,10 +3600,13 @@
  103.35.111.101
  103.35.111.102
  103.35.171.178
+103.35.171.209
+103.35.171.218
  103.35.74.74
  103.36.10.5
  103.36.100.248
  103.36.101.8
+103.36.11.130
  103.36.11.161
  103.36.11.162
  103.36.11.163
@@ -3639,7 +3617,6 @@
  103.36.11.243
  103.36.11.248
  103.36.124.158
-103.36.124.165
  103.36.125.162
  103.36.126.14
  103.36.35.135
@@ -3670,13 +3647,13 @@
  103.38.25.218
  103.38.4.130
  103.38.67.13
-103.38.83.14
  103.39.131.88
  103.39.213.170
  103.39.220.205
  103.39.235.166
  103.39.236.213
  103.39.29.101
+103.4.145.237
  103.4.146.220
  103.4.147.82
  103.4.164.205
@@ -3697,7 +3674,6 @@
  103.40.240.244
  103.40.241.21
  103.40.242.32
-103.40.244.146
  103.40.248.117
  103.40.248.203
  103.40.249.242
@@ -3756,6 +3732,7 @@
  103.44.218.93
  103.44.23.104
  103.44.240.204
+103.44.245.18
  103.44.246.33
  103.44.248.252
  103.44.253.18
@@ -3771,6 +3748,7 @@
  103.45.103.207
  103.45.103.80
  103.45.105.120
+103.45.107.149
  103.45.108.130
  103.45.111.35
  103.45.112.197
@@ -3790,11 +3768,9 @@
  103.45.185.14
  103.45.190.6
  103.45.251.8
-103.45.65.36
-103.45.65.42
-103.45.65.76
  103.46.128.41
  103.46.128.43
+103.46.203.127
  103.46.210.134
  103.46.234.129
  103.46.239.133
@@ -3802,6 +3778,7 @@
  103.47.104.230
  103.47.104.236
  103.47.104.238
+103.47.104.247
  103.47.104.248
  103.47.104.249
  103.47.104.250
@@ -3812,8 +3789,10 @@
  103.47.217.214
  103.47.217.225
  103.47.218.76
+103.47.219.176
+103.47.65.80
  103.47.66.154
-103.47.82.188
+103.47.82.234
  103.47.92.33
  103.47.93.113
  103.47.93.193
@@ -3822,6 +3801,9 @@
  103.47.93.200
  103.47.93.208
  103.47.93.224
+103.47.93.232
+103.47.93.235
+103.47.93.236
  103.47.93.240
  103.47.93.248
  103.47.93.253
@@ -3833,6 +3815,7 @@
  103.48.181.189
  103.48.183.113
  103.48.186.125
+103.48.186.127
  103.48.186.134
  103.48.186.163
  103.48.192.48
@@ -3844,12 +3827,12 @@
  103.49.28.64
  103.49.53.129
  103.5.125.21
+103.5.132.5
+103.5.134.163
  103.50.148.129
-103.50.148.5
  103.50.150.225
+103.50.150.47
  103.50.162.156
-103.50.163.234
-103.50.168.193
  103.50.170.117
  103.50.170.121
  103.50.170.137
@@ -3882,14 +3865,8 @@
  103.51.46.255
  103.51.46.4
  103.51.47.9
-103.52.135.200
-103.52.135.201
-103.52.135.202
-103.52.135.203
-103.52.135.206
-103.52.135.207
-103.52.135.220
  103.52.135.8
+103.52.137.130
  103.52.171.165
  103.52.209.41
  103.52.209.81
@@ -3911,8 +3888,10 @@
  103.53.231.144
  103.53.27.1
  103.53.76.82
+103.54.101.127
  103.54.101.28
  103.54.134.190
+103.54.141.111
  103.54.148.26
  103.54.148.50
  103.54.148.54
@@ -3932,6 +3911,7 @@
  103.55.144.243
  103.55.144.70
  103.55.24.37
+103.55.33.21
  103.55.36.28
  103.56.113.172
  103.56.113.232
@@ -3942,6 +3922,7 @@
  103.56.205.114
  103.56.207.230
  103.56.235.186
+103.56.43.225
  103.57.120.249
  103.57.121.10
  103.57.123.1
@@ -3951,6 +3932,7 @@
  103.57.201.91
  103.57.220.28
  103.57.222.230
+103.57.254.49
  103.57.70.248
  103.57.71.137
  103.57.74.254
@@ -3976,10 +3958,11 @@
  103.57.83.192
  103.57.83.224
  103.57.85.244
-103.58.117.244
+103.57.85.246
  103.58.16.106
  103.58.16.254
  103.58.17.246
+103.58.65.143
  103.58.65.219
  103.58.66.204
  103.58.66.21
@@ -4028,6 +4011,7 @@
  103.65.182.26
  103.65.237.243
  103.65.238.115
+103.66.112.122
  103.66.176.45
  103.66.176.81
  103.66.177.169
@@ -4053,12 +4037,13 @@
  103.66.79.120
  103.66.79.148
  103.66.79.27
+103.66.79.34
  103.66.79.37
-103.67.152.230
  103.67.16.6
  103.67.17.1
  103.67.235.10
  103.67.235.104
+103.67.235.12
  103.67.235.8
  103.68.0.114
  103.68.0.188
@@ -4074,7 +4059,6 @@
  103.69.120.140
  103.69.120.141
  103.69.121.194
-103.69.121.211
  103.69.121.218
  103.69.124.247
  103.69.194.114
@@ -4095,8 +4079,9 @@
  103.69.216.154
  103.69.220.11
  103.69.224.57
-103.69.45.202
  103.69.9.63
+103.7.41.210
+103.70.128.23
  103.70.130.26
  103.70.140.194
  103.70.140.198
@@ -4115,6 +4100,7 @@
  103.70.206.65
  103.70.206.9
  103.70.220.145
+103.70.5.82
  103.70.77.18
  103.71.252.18
  103.71.46.139
@@ -4126,12 +4112,14 @@
  103.73.101.18
  103.73.102.130
  103.73.152.24bin.sh
-103.73.160.144
+103.73.154.8
  103.73.161.123
  103.73.162.156
  103.73.183.15
  103.73.183.173
+103.73.183.33
  103.73.183.7
+103.73.238.10
  103.73.35.38
  103.73.65.116
  103.73.65.213
@@ -4148,11 +4136,9 @@
  103.74.227.177
  103.74.244.244
  103.74.245.23
-103.74.68.86
  103.74.70.142
  103.74.70.97
  103.75.1.198
-103.75.125.99
  103.75.148.103
  103.75.148.17
  103.75.148.203
@@ -4166,15 +4152,16 @@
  103.75.180.229
  103.75.180.242
  103.75.190.11
+103.75.197.68
  103.75.208.53
  103.75.217.122
-103.75.218.18
  103.75.225.101
  103.75.225.37
  103.75.225.45
  103.75.226.25
  103.75.27.86
  103.75.33.195
+103.75.34.121
  103.75.34.219
  103.76.143.116
  103.76.148.239
@@ -4210,20 +4197,19 @@
  103.76.253.150
  103.76.253.156
  103.76.253.162
-103.76.44.155
  103.76.80.202
  103.76.85.149
  103.77.159.59
  103.77.16.133
+103.77.16.174
+103.77.160.72
+103.77.188.33
  103.77.189.126
  103.77.20.1
  103.77.207.150
  103.77.23.137
  103.77.23.202
  103.77.23.241
-103.77.235.35
-103.77.43.212
-103.77.43.219
  103.77.49.194
  103.77.8.149
  103.78.133.219
@@ -4231,16 +4217,13 @@
  103.78.143.4
  103.78.150.32
  103.78.151.117
-103.78.154.20
  103.78.16.194
  103.78.164.201
  103.78.165.130
  103.78.165.131
  103.78.165.132
-103.78.180.221
  103.78.180.74
  103.78.181.129
-103.78.183.4
  103.78.210.205
  103.78.213.226
  103.78.213.73
@@ -4262,21 +4245,20 @@
  103.78.37.102
  103.78.37.98
  103.78.38.34
-103.78.52.130
+103.78.80.170
  103.78.81.227
  103.78.82.154
  103.79.117.5
  103.79.141.158
-103.79.155.42
  103.79.169.129
  103.79.169.137
  103.79.169.145
  103.79.169.153
-103.79.171.181
  103.79.171.182
  103.79.176.31
  103.79.74.26
  103.79.74.3
+103.79.90.72
  103.8.115.27
  103.8.119.166
  103.8.119.17
@@ -4285,22 +4267,22 @@
  103.8.27.10
  103.8.59.1
  103.8.59.9
-103.80.142.251
  103.80.24.32
  103.80.25.18
  103.80.36.34
  103.80.38.82
  103.80.38.83
  103.80.51.61
+103.80.60.248
  103.80.70.254
  103.80.83.161
-103.81.1.55
  103.81.104.141
  103.81.104.242
  103.81.104.38
  103.81.104.89
  103.81.104.93
  103.81.114.182
+103.81.153.133
  103.81.170.160
  103.81.38.181
  103.82.11.209
@@ -4310,6 +4292,7 @@
  103.82.145.110
  103.82.145.111
  103.82.146.154
+103.82.159.122
  103.82.208.121
  103.82.223.139
  103.82.233.2
@@ -4318,11 +4301,13 @@
  103.82.54.154
  103.82.54.88
  103.82.55.64
+103.82.67.100
  103.82.67.167
  103.82.8.189
  103.82.8.193
  103.82.8.197
  103.82.8.201
+103.82.81.172
  103.82.81.18
  103.82.98.151
  103.83.109.228
@@ -4351,12 +4336,14 @@
  103.83.185.1
  103.83.185.193
  103.83.205.57
+103.83.244.195
  103.83.79.69
  103.83.81.152
  103.83.95.82
  103.84.131.14
  103.84.134.1
  103.84.134.9
+103.84.187.20
  103.84.238.3
  103.84.240.157
  103.84.241.244
@@ -4397,7 +4384,7 @@
  103.86.153.82
  103.86.155.102
  103.86.155.78
-103.86.160.91
+103.86.16.137
  103.86.160.93
  103.86.161.245
  103.86.180.10
@@ -4413,27 +4400,25 @@
  103.86.86.71
  103.87.113.127
  103.87.160.177
-103.87.168.171
+103.87.168.157
  103.87.168.210
  103.87.168.211
+103.87.168.213
  103.87.168.220
  103.87.168.30
-103.87.169.188
-103.87.169.242
-103.87.169.25
+103.87.169.231
  103.87.169.76
+103.87.170.103
  103.87.170.108
  103.87.170.110
-103.87.170.112
  103.87.170.114
  103.87.170.123
  103.87.170.233
  103.87.170.24
  103.87.170.88
  103.87.170.90
-103.87.170.92
  103.87.170.98
-103.87.171.226
+103.87.171.241
  103.87.174.54
  103.87.206.101
  103.87.206.249
@@ -4445,12 +4430,10 @@
  103.87.236.114
  103.87.236.150
  103.87.236.46
-103.87.237.114
  103.87.25.106
  103.87.25.193
  103.87.251.146
  103.87.26.125
-103.87.27.122
  103.87.31.169
  103.87.48.1
  103.87.48.45
@@ -4469,8 +4452,8 @@
  103.89.252.123
  103.89.254.138
  103.89.88.39
+103.89.89.55
  103.89.90.208
-103.89.90.42
  103.89.91.205
  103.9.113.90
  103.9.114.118
@@ -4479,24 +4462,13 @@
  103.9.115.38
  103.9.124.210
  103.9.134.114
-103.9.159.87
  103.9.174.70
  103.9.188.229
-103.9.188.23
  103.9.191.40
  103.9.227.210
  103.9.79.132
-103.90.145.196
-103.90.160.81
-103.90.162.104
-103.90.162.118
-103.90.162.120
-103.90.163.199
-103.90.163.206
-103.90.163.75
-103.90.163.84
-103.90.163.87
-103.90.163.89
+103.90.160.141
+103.90.160.142
  103.90.190.54
  103.90.200.226
  103.90.201.70
@@ -4507,7 +4479,6 @@
  103.91.128.182
  103.91.128.34
  103.91.130.1
-103.91.141.164
  103.91.17.136
  103.91.17.147
  103.91.210.187
@@ -4516,6 +4487,7 @@
  103.91.245.12bin.sh
  103.91.245.13bin.sh
  103.91.245.14
+103.91.245.23
  103.91.245.27
  103.91.245.27bin.sh
  103.91.245.3
@@ -4542,17 +4514,16 @@
  103.92.25.95
  103.92.26.252
  103.92.29.114
-103.92.40.246
  103.93.17.149
  103.93.180.102
+103.93.181.10
  103.93.220.182
  103.93.37.25
  103.94.0.178
  103.94.121.27
  103.94.125.254
  103.94.133.94
-103.94.139.14
-103.94.139.31
+103.94.135.163
  103.94.16.129
  103.94.2.35
  103.94.3.123
@@ -4571,27 +4542,26 @@
  103.95.98.90
  103.95.99.229
  103.96.220.115
+103.96.37.81
  103.96.73.160
  103.96.73.208
  103.96.96.114
  103.97.100.15
+103.97.124.200
  103.97.124.53
  103.97.125.174
-103.97.139.170
+103.97.139.129
  103.97.164.98
  103.97.179.141
  103.97.240.193
  103.97.240.217
  103.97.240.225
-103.97.240.241
  103.97.243.113
  103.97.243.129
-103.97.243.177
-103.97.243.241
-103.97.243.81
  103.97.3.164
  103.97.3.83
  103.97.6.230
+103.97.92.107
  103.98.120.89
  103.98.123.24
  103.98.128.51
@@ -4599,7 +4569,10 @@
  103.98.152.79
  103.98.176.188
  103.98.19.22
+103.98.63.45
  103.99.1.31
+103.99.1.5
+103.99.149.250
  103.99.168.100
  103.99.168.130
  103.99.168.140
@@ -4610,12 +4583,11 @@
  103.99.176.32
  103.99.177.247
  103.99.189.33
-103.99.196.253
  103.99.207.151
  103.99.244.70
  103.99.251.189
  103.99.3.205
-103.99.3.216
+103.99.3.225
  103.99.9.198
  1030408.servicesndt1.club
  103298943.snapchatprime.com
@@ -4634,21 +4606,21 @@
  104.128.93.238
  104.128.95.31
  104.129.131.148
+104.129.131.99
  104.129.15.149
  104.129.171.121
-104.129.18.147
  104.129.184.232
  104.129.194.103
  104.129.194.243
  104.129.194.75
  104.129.196.126
+104.129.196.178
  104.129.196.187
  104.129.198.145
  104.129.199.36
  104.129.200.127
  104.129.24.114
  104.129.255.119
-104.129.255.158
  104.129.255.172
  104.129.255.178
  104.129.255.240
@@ -4657,7 +4629,6 @@
  104.129.255.92
  104.129.4.186
  104.129.41.166
-104.129.46.36
  104.129.5.188
  104.129.61.39
  104.129.9.166
@@ -4703,6 +4674,7 @@
  104.131.112.141
  104.131.112.4
  104.131.112.44
+104.131.112.74
  104.131.114.87
  104.131.115.14
  104.131.12.181
@@ -4724,12 +4696,10 @@
  104.131.16.119
  104.131.16.214
  104.131.160.67
-104.131.161.95
  104.131.162.164
  104.131.164.93
  104.131.165.39
  104.131.166.12
-104.131.170.46
  104.131.172.115
  104.131.173.23
  104.131.174.220
@@ -4737,7 +4707,6 @@
  104.131.175.91
  104.131.176.180
  104.131.178.207
-104.131.179.220
  104.131.180.54
  104.131.181.4
  104.131.184.60
@@ -4789,8 +4758,8 @@
  104.131.46.160
  104.131.46.166
  104.131.48.26
-104.131.51.209
  104.131.55.236
+104.131.56.137
  104.131.56.33
  104.131.57.95
  104.131.58.110
@@ -4853,33 +4822,30 @@
  104.140.18.106
  104.140.188.6
  104.140.208.190
-104.140.208.40
  104.140.242.35
  104.140.242.72
  104.140.245.66
+104.140.73.60
  104.140.83.119
  104.140.83.193
  104.140.83.22
-104.140.83.230
-104.140.83.252
  104.143.14.92
  104.143.2.195
+104.143.83.242
  104.144.1.254
  104.144.110.144
  104.144.112.106
  104.144.112.121
-104.144.112.126
-104.144.112.178
  104.144.112.182
  104.144.112.190
  104.144.112.197
  104.144.112.221
  104.144.112.97
  104.144.116.218
+104.144.153.242
  104.144.155.228
  104.144.157.28
  104.144.159.193
-104.144.163.198
  104.144.167.109
  104.144.17.137
  104.144.171.147
@@ -4897,6 +4863,7 @@
  104.144.191.18
  104.144.191.230
  104.144.196.102
+104.144.199.4
  104.144.20.146
  104.144.201.91
  104.144.202.128
@@ -4905,32 +4872,31 @@
  104.144.207.207
  104.144.207.229
  104.144.208.141
-104.144.210.118
+104.144.210.117
  104.144.210.138
  104.144.210.183
-104.144.210.185
+104.144.210.240
  104.144.210.244
  104.144.210.28
  104.144.210.8
  104.144.213.102
  104.144.213.103
-104.144.213.105
  104.144.215.49
  104.144.22.135
  104.144.22.142
  104.144.22.194
  104.144.22.251
-104.144.220.15
-104.144.220.16
  104.144.220.20
-104.144.220.8
  104.144.229.204
  104.144.236.48
  104.144.236.61
-104.144.249.7
  104.144.251.70
  104.144.254.26
+104.144.28.133
  104.144.28.155
+104.144.28.157
+104.144.28.165
+104.144.51.104
  104.144.53.237
  104.144.6.20
  104.144.6.24
@@ -4940,7 +4906,6 @@
  104.144.83.103
  104.144.83.106
  104.144.83.146
-104.144.83.30
  104.144.91.110
  104.145.225.68
  104.145.225.69
@@ -5001,16 +4966,18 @@
  104.149.140.74
  104.149.213.18
  104.149.50.108
-104.152.111.218
  104.152.168.29
-104.152.186.21
  104.152.187.114
  104.152.191.110
+104.152.52.10
+104.152.52.14
  104.152.52.70
+104.152.52.71
+104.152.58.164
+104.152.59.1
  104.153.101.197
  104.153.102.152
  104.153.103.134
-104.154.147.52
  104.154.156.5
  104.154.203.62
  104.154.236.234
@@ -5026,7 +4993,6 @@
  104.154.35.55
  104.154.64.14
  104.154.66.242
-104.154.67.72
  104.154.80.163
  104.155.109.229
  104.155.112.21
@@ -5046,7 +5012,6 @@
  104.155.227.128
  104.155.71.104
  104.155.87.142
-104.156.0.46
  104.156.227.60
  104.156.227.84
  104.156.230.231
@@ -5061,7 +5026,7 @@
  104.160.11.93
  104.160.11.94
  104.160.11.95
-104.160.14.116
+104.160.14.117
  104.160.14.128
  104.160.14.210
  104.160.14.92
@@ -5069,8 +5034,10 @@
  104.160.15.136
  104.160.15.137
  104.160.15.159
+104.160.15.38
  104.160.15.63
  104.160.17.109
+104.160.17.11
  104.160.17.111
  104.160.17.113
  104.160.17.114
@@ -5107,6 +5074,7 @@
  104.168.102.178
  104.168.115.171
  104.168.115.177
+104.168.115.178
  104.168.115.187
  104.168.115.189
  104.168.135.4
@@ -5139,15 +5107,14 @@
  104.168.243.113
  104.168.243.209
  104.168.25.183
+104.168.254.176
  104.168.30.147
  104.168.30.156
  104.168.44.166
-104.168.51.131
  104.168.51.132
  104.168.51.140
+104.168.51.157
  104.168.52.171
-104.168.6.174
-104.168.65.162
  104.168.65.222
  104.168.7.244
  104.168.75.197
@@ -5240,7 +5207,6 @@
  104.197.139.104
  104.197.173.169
  104.197.181.70
-104.197.184.104
  104.197.20.225
  104.197.202.178
  104.197.216.242
@@ -5320,13 +5286,11 @@
  104.200.67.27
  104.200.67.57
  104.200.78.166
-104.205.157.84
  104.206.128.30
  104.206.128.50
+104.206.203.241
  104.206.252.66
  104.206.252.71
-104.206.50.10
-104.206.50.12
  104.206.50.13
  104.206.50.14
  104.206.50.15
@@ -5334,7 +5298,6 @@
  104.206.50.17
  104.206.50.18
  104.206.50.19
-104.206.50.2
  104.206.50.20
  104.206.50.21
  104.206.50.22
@@ -5345,7 +5308,6 @@
  104.206.50.27
  104.206.50.28
  104.206.50.29
-104.206.50.3
  104.206.50.30
  104.206.50.31
  104.206.50.32
@@ -5354,7 +5316,6 @@
  104.206.50.37
  104.206.50.38
  104.206.50.39
-104.206.50.4
  104.206.50.40
  104.206.50.41
  104.206.50.42
@@ -5362,10 +5323,48 @@
  104.206.50.44
  104.206.50.45
  104.206.50.46
-104.206.50.5
-104.206.50.6
-104.206.50.8
-104.206.50.9
+104.206.50.47
+104.206.50.48
+104.206.50.49
+104.206.50.50
+104.206.50.51
+104.206.50.52
+104.206.50.53
+104.206.50.54
+104.206.50.55
+104.206.50.56
+104.206.50.57
+104.206.50.58
+104.206.50.59
+104.206.50.60
+104.206.50.61
+104.206.50.62
+104.206.50.63
+104.206.50.64
+104.206.50.65
+104.206.50.66
+104.206.50.67
+104.206.50.68
+104.206.50.69
+104.206.50.70
+104.206.50.71
+104.206.50.72
+104.206.50.73
+104.206.50.74
+104.206.50.75
+104.206.50.76
+104.206.50.77
+104.206.50.78
+104.206.50.79
+104.206.50.80
+104.206.50.81
+104.206.50.82
+104.206.50.83
+104.206.50.84
+104.206.50.85
+104.206.50.86
+104.206.50.87
+104.206.50.88
  104.206.81.14
  104.206.96.58
  104.207.129.179
@@ -5386,7 +5385,6 @@
  104.208.32.156
  104.208.38.202
  104.209.183.160
-104.209.246.177
  104.209.248.48
  104.209.34.100
  104.210.213.35
@@ -5394,21 +5392,23 @@
  104.210.58.78
  104.210.59.93
  104.211.158.124
+104.211.16.167
  104.211.16.26
  104.211.164.221
  104.211.18.235
  104.211.27.49
  104.211.28.157
  104.211.29.53
-104.211.29.96
  104.211.30.116
  104.211.34.53
  104.211.49.188
  104.211.57.3
  104.211.77.169
  104.211.8.210
+104.214.118.241
  104.214.51.93
  104.214.59.120
+104.215.103.3
  104.215.124.156
  104.215.15.26
  104.215.152.162
@@ -5445,6 +5445,8 @@
  104.223.33.84
  104.223.36.228
  104.223.38.83
+104.223.52.70
+104.223.54.146
  104.223.93.198
  104.224.139.137
  104.224.140.215
@@ -5466,7 +5468,6 @@
  104.225.154.136
  104.225.155.67
  104.225.158.162
-104.225.161.3
  104.225.173.42
  104.225.187.44
  104.225.233.10
@@ -5475,6 +5476,8 @@
  104.227.112.189
  104.227.112.240
  104.227.124.147
+104.227.124.186
+104.227.124.213
  104.227.124.221
  104.227.13.112
  104.227.146.123
@@ -5483,8 +5486,8 @@
  104.227.168.130
  104.227.169.9
  104.227.175.34
+104.227.185.188
  104.227.187.166
-104.227.187.182
  104.227.190.213
  104.227.190.219
  104.227.20.21
@@ -5496,22 +5499,23 @@
  104.227.254.136
  104.227.254.146
  104.227.255.104
-104.227.255.2
-104.227.32.90
  104.227.4.200
-104.227.4.202
  104.227.4.206
+104.227.4.219
+104.227.4.232
  104.227.4.234
  104.227.49.246
  104.227.56.139
  104.227.57.94
  104.227.63.58
+104.227.72.153
  104.227.76.40
  104.227.77.177
  104.227.77.185
  104.227.77.188
  104.227.77.201
  104.227.77.204
+104.227.77.212
  104.227.77.219
  104.230.217.102
  104.232.103.226
@@ -5538,7 +5542,6 @@
  104.236.116.168
  104.236.117.221
  104.236.118.20
-104.236.118.6
  104.236.120.31
  104.236.121.248
  104.236.122.214
@@ -5589,7 +5592,6 @@
  104.236.200.181
  104.236.201.168
  104.236.203.25
-104.236.203.29
  104.236.205.123
  104.236.207.1
  104.236.207.117
@@ -5652,13 +5654,16 @@
  104.236.39.24
  104.236.39.38
  104.236.4.161
+104.236.4.175
  104.236.40.85
  104.236.41.119
+104.236.41.231
  104.236.43.172
  104.236.43.56
  104.236.45.171
  104.236.46.212
  104.236.47.100
+104.236.47.73
  104.236.48.174
  104.236.48.178
  104.236.49.107
@@ -5707,7 +5712,6 @@
  104.237.121.67
  104.237.129.105
  104.237.130.171
-104.237.132.169
  104.237.138.78
  104.237.139.99
  104.237.140.220
@@ -5770,7 +5774,6 @@
  104.238.220.196
  104.238.220.199
  104.238.220.24
-104.238.220.94
  104.238.223.126
  104.238.235.186
  104.238.44.103
@@ -5790,6 +5793,7 @@
  104.239.173.237
  104.239.175.211
  104.239.229.181
+104.241.227.113
  104.243.129.210
  104.243.129.94
  104.243.16.125
@@ -5861,7 +5865,6 @@
  104.244.79.211
  104.244.79.43
  104.245.125.251
-104.245.144.58
  104.245.145.41
  104.245.228.65
  104.245.41.113
@@ -5878,13 +5881,14 @@
  104.248.114.137
  104.248.114.67
  104.248.115.231
-104.248.115.246
  104.248.116.140
  104.248.118.63
  104.248.122.140
  104.248.122.79
  104.248.123.197
  104.248.123.76
+104.248.124.121
+104.248.126.99
  104.248.129.112
  104.248.129.226
  104.248.129.91
@@ -5905,7 +5909,6 @@
  104.248.142.140
  104.248.143.105
  104.248.143.83
-104.248.145.11
  104.248.145.89
  104.248.146.199
  104.248.147.105
@@ -5941,7 +5944,7 @@
  104.248.192.182
  104.248.192.249
  104.248.193.0
-104.248.193.78
+104.248.194.130
  104.248.196.198
  104.248.196.233
  104.248.196.244
@@ -5953,6 +5956,7 @@
  104.248.200.145
  104.248.200.235
  104.248.202.160
+104.248.204.226
  104.248.205.225
  104.248.205.24
  104.248.205.253
@@ -5979,6 +5983,7 @@
  104.248.241.234
  104.248.244.119
  104.248.245.250
+104.248.246.94
  104.248.248.126
  104.248.248.77
  104.248.249.47
@@ -6021,6 +6026,7 @@
  104.248.55.220
  104.248.57.27
  104.248.59.156
+104.248.59.7
  104.248.6.235
  104.248.60.35
  104.248.61.192
@@ -6038,11 +6044,9 @@
  104.248.73.101
  104.248.75.224
  104.248.76.28
-104.248.79.138
  104.248.88.112
  104.248.90.45
  104.248.94.72
-104.249.63.34
  104.250.102.143
  104.250.102.145
  104.250.102.146
@@ -6099,17 +6103,19 @@
  104.254.92.218
  104.254.92.242
  104.254.92.53
+104.254.92.54
  104.254.92.61
+104.254.93.67
  104.254.95.158
  104.255.173.24
  104.255.65.207
  104.32.136.154
  104.32.43.13
+104.33.78.45
  104.35.13.161
  104.36.182.197
  104.36.71.132
  104.37.104.44
-104.37.186.38
  104.37.187.23
  104.37.212.5
  104.37.212.67
@@ -6152,6 +6158,7 @@
  104.50.201.209
  104.53.220.173
  104.54.203.174
+104.54.74.223
  104.57.20.130
  104.6.161.145
  104.60.247.230
@@ -6165,65 +6172,70 @@
  104722155613106546.002.sh.cn
  105.101.86.13
  105.103.160.197
-105.103.201.113
  105.105.162.145
  105.107.36.211
  105.108.115.4
  105.112.1.166
  105.112.10.244
+105.112.112.226
+105.112.144.181
+105.112.156.36
  105.112.25.1
  105.112.91.234
  105.154.151.250
  105.154.191.59
  105.155.159.11
-105.156.87.229
+105.156.226.56
+105.156.94.239
+105.157.108.143
+105.157.215.86
  105.158.91.157
  105.159.149.193
  105.159.194.58
-105.159.253.46
-105.162.40.142
+105.162.44.226
  105.163.1.173
+105.163.1.221
+105.163.209.164
+105.163.53.78
  105.174.38.250
  105.178.104.181
  105.184.173.107
  105.184.253.170
-105.184.253.56
-105.185.177.76
+105.184.253.44
+105.186.68.249
  105.187.233.22
  105.208.44.183
-105.209.180.19
  105.209.235.113
  105.209.239.55
  105.21.40.54
  105.212.56.107
  105.213.101.202
  105.213.103.103
-105.213.123.200
+105.213.113.229
  105.213.126.116
  105.213.82.167
  105.213.97.206
  105.226.178.136
  105.226.188.16
-105.227.167.212
-105.229.20.19
  105.229.22.206
  105.233.34.9
  105.235.106.59
-105.235.134.163
  105.235.197.150
  105.235.197.162
  105.235.201.234
  105.235.201.78
  105.235.201.86
  105.235.205.90
+105.235.71.132
  105.236.93.198
+105.245.100.173
  105.247.101.41
-105.247.103.123
  105.247.148.210
  105.247.152.34
  105.247.158.94
  105.247.244.235
  105.247.28.74
+105.247.67.115
  105.255.222.42
  105.27.116.46
  105.27.143.190
@@ -6233,21 +6245,21 @@
  105.29.64.133
  105.29.64.195
  105.29.67.20
-105.30.250.109
+105.66.1.202
+105.67.131.254
+105.67.132.87
  105.73.83.18
  105.96.11.65
-105.96.13.17
-105.96.3.198
+105.98.142.193
+105.98.244.7
  1051a2e8-48cf-4f98-988c-b1aa7ec7e290.htmlcomponentservice.com
  1052068-dot-n-e-w-me-ss-age-po-rt-al.wl.r.appspot.com
  106-365.net
  106.0.38.73
-106.0.57.144
  106.0.57.147
-106.0.59.201
  106.104.151.142
-106.104.166.45
  106.104.193.155
+106.105.197.246
  106.109.112.zoom-lab.com
  106.110.104.29
  106.110.105.60
@@ -6290,7 +6302,7 @@
  106.111.55.123
  106.111.85.197
  106.113.125.66
-106.116.16.77
+106.115.188.247
  106.12.10.54
  106.12.102.202
  106.12.102.210
@@ -6309,7 +6321,9 @@
  106.12.115.110
  106.12.115.169
  106.12.116.133
+106.12.116.75
  106.12.118.184
+106.12.118.54
  106.12.119.242
  106.12.119.8
  106.12.122.100
@@ -6346,9 +6360,10 @@
  106.12.172.48
  106.12.173.47
  106.12.174.182
+106.12.174.197
  106.12.180.52
+106.12.183.239
  106.12.185.16
-106.12.192.240
  106.12.193.217
  106.12.194.154
  106.12.195.70
@@ -6375,13 +6390,13 @@
  106.12.217.78
  106.12.218.171
  106.12.218.202
-106.12.219.184
  106.12.220.109
  106.12.220.84
  106.12.221.83
  106.12.24.182
  106.12.241.8
  106.12.28.76
+106.12.28.78
  106.12.31.186
  106.12.38.109
  106.12.45.214
@@ -6402,16 +6417,19 @@
  106.123.60.134
  106.124.129.115
  106.124.130.114
+106.124.131.194
  106.124.131.214
  106.124.131.70
  106.124.132.105
-106.124.135.232
+106.124.137.103
  106.124.137.130
  106.124.139.161
  106.124.140.36
  106.124.141.108
+106.124.142.64
  106.124.188.160
  106.124.205.42
+106.124.249.206
  106.125.139.76
  106.127.178.188
  106.13.1.239
@@ -6419,12 +6437,10 @@
  106.13.100.103
  106.13.102.197
  106.13.102.83
-106.13.103.158
  106.13.104.41
+106.13.112.221
  106.13.113.91
  106.13.115.28
-106.13.123.29
-106.13.123.73
  106.13.124.215
  106.13.125.248
  106.13.126.15
@@ -6432,7 +6448,6 @@
  106.13.130.17
  106.13.131.132
  106.13.137.195
-106.13.137.49
  106.13.139.79
  106.13.140.138
  106.13.142.161
@@ -6451,8 +6466,6 @@
  106.13.19.92
  106.13.195.32
  106.13.196.51
-106.13.196.54
-106.13.196.66
  106.13.197.35
  106.13.202.191
  106.13.203.240
@@ -6467,6 +6480,7 @@
  106.13.215.207
  106.13.215.215
  106.13.215.90
+106.13.215.94
  106.13.216.115
  106.13.217.10
  106.13.217.124
@@ -6474,10 +6488,9 @@
  106.13.221.213
  106.13.222.160
  106.13.222.42
-106.13.223.163
  106.13.228.207
+106.13.229.254
  106.13.232.61
-106.13.245.17
  106.13.25.242
  106.13.26.62
  106.13.27.134
@@ -6499,6 +6512,7 @@
  106.13.40.23
  106.13.42.140
  106.13.45.120
+106.13.45.243
  106.13.46.123
  106.13.46.235
  106.13.47.10
@@ -6532,6 +6546,7 @@
  106.13.79.113
  106.13.8.193
  106.13.8.46
+106.13.80.96
  106.13.81.54
  106.13.82.231
  106.13.83.202
@@ -6546,7 +6561,6 @@
  106.13.9.244
  106.13.9.29
  106.13.90.60
-106.13.93.250
  106.13.93.60
  106.13.93.92
  106.13.94.131
@@ -6557,10 +6571,10 @@
  106.13.98.94
  106.13.99.107
  106.14.1.209
-106.14.13.172
  106.14.135.136
  106.14.157.198
  106.14.163.216
+106.14.171.136
  106.14.188.79
  106.14.224.228
  106.14.241.0
@@ -6581,7 +6595,6 @@
  106.185.48.84
  106.186.112.160
  106.186.122.96
-106.186.235.1
  106.186.30.11
  106.187.35.148
  106.187.35.173
@@ -6591,40 +6604,35 @@
  106.187.49.249
  106.187.51.204
  106.187.99.130
-106.193.86.204
  106.198.129.153
  106.198.194.249
  106.2.207.106
+106.200.236.92
  106.200.73.228
  106.200.73.234
  106.201.160.224
  106.201.193.54
-106.201.217.204
-106.204.198.147
  106.206.3.43
  106.206.41.156
+106.206.47.234
  106.206.62.92
  106.206.71.226
-106.210.172.244
-106.211.79.18
-106.212.244.107
  106.213.185.210
  106.214.13.84
  106.214.170.23
+106.215.150.141
  106.217.84.20
+106.225.135.120
  106.240.131.5
  106.240.86.211
  106.240.89.60
-106.241.33.158
  106.241.54.211
  106.242.20.219
  106.242.35.34
  106.242.5.206
-106.242.86.221
  106.243.144.238
  106.243.87.162
  106.244.77.149
-106.245.160.140
  106.245.183.58
  106.245.183.60
  106.245.197.234
@@ -6648,11 +6656,12 @@
  106.37.72.234
  106.38.112.196
  106.38.121.162
+106.38.158.131
  106.38.205.205
  106.39.63.53
  106.46.169.193
-106.46.5.160
  106.51.106.161
+106.51.111.220
  106.51.164.41
  106.51.2.158
  106.51.2.56
@@ -6662,13 +6671,13 @@
  106.51.3.214
  106.51.36.64
  106.51.48.117
+106.51.51.170
  106.51.63.3
  106.51.72.221
  106.51.73.204
  106.51.76.223
  106.51.78.18
  106.51.80.198
-106.51.80.86
  106.51.81.136
  106.51.85.115
  106.51.85.16
@@ -6690,7 +6699,6 @@
  106.52.128.100
  106.52.128.121
  106.52.130.172
-106.52.132.186
  106.52.133.87
  106.52.135.118
  106.52.135.44
@@ -6710,14 +6718,12 @@
  106.52.152.75
  106.52.162.140
  106.52.166.154
-106.52.166.245
  106.52.167.107
  106.52.177.213
  106.52.178.166
  106.52.181.236
  106.52.184.143
  106.52.196.163
-106.52.197.126
  106.52.198.174
  106.52.20.112
  106.52.200.171
@@ -6745,7 +6751,6 @@
  106.52.30.184
  106.52.33.78
  106.52.38.242
-106.52.48.30
  106.52.52.114
  106.52.52.52
  106.52.53.206
@@ -6756,7 +6761,6 @@
  106.52.62.56
  106.52.63.246
  106.52.63.37
-106.52.63.61
  106.52.64.125
  106.52.64.203
  106.52.69.167
@@ -6775,6 +6779,7 @@
  106.53.110.251
  106.53.112.52
  106.53.114.5
+106.53.115.29
  106.53.117.149
  106.53.117.74
  106.53.119.143
@@ -6799,7 +6804,6 @@
  106.53.219.247
  106.53.220.198
  106.53.220.55
-106.53.222.24
  106.53.227.104
  106.53.227.141
  106.53.229.213
@@ -6812,6 +6816,7 @@
  106.53.237.190
  106.53.237.30
  106.53.238.111
+106.53.238.97
  106.53.239.180
  106.53.239.200
  106.53.239.28
@@ -6827,7 +6832,6 @@
  106.53.61.167
  106.53.63.248
  106.53.81.17
-106.53.82.107
  106.53.88.144
  106.53.9.163
  106.53.91.250
@@ -6835,7 +6839,6 @@
  106.54.101.141
  106.54.104.8
  106.54.105.9
-106.54.108.8
  106.54.112.173
  106.54.117.51
  106.54.126.152
@@ -6850,7 +6853,6 @@
  106.54.171.167
  106.54.174.159
  106.54.182.137
-106.54.182.32
  106.54.183.246
  106.54.184.180
  106.54.188.101
@@ -6866,9 +6868,7 @@
  106.54.253.9
  106.54.32.21
  106.54.44.202
-106.54.48.208
  106.54.48.241
-106.54.57.113
  106.54.57.203
  106.54.64.26
  106.54.65.139
@@ -6893,7 +6893,6 @@
  106.54.92.214
  106.54.93.84
  106.54.94.167
-106.54.95.76
  106.54.96.55
  106.54.98.89
  106.55.12.217
@@ -6921,6 +6920,7 @@
  106.55.168.232
  106.55.170.47
  106.55.171.77
+106.55.18.86
  106.55.236.107
  106.55.236.71
  106.55.239.33
@@ -6949,15 +6949,21 @@
  106.55.49.141
  106.55.54.23
  106.55.58.118
+106.55.59.64
  106.55.9.52
  106.55.93.246
  106.55.94.189
+106.57.7.40
  106.58.169.162
  106.58.178.14
+106.58.179.215
  106.58.179.217
+106.58.185.232
+106.58.215.201
  106.66.3.226
  106.66.36.49
  106.68.158.60
+106.69.210.91
  106.7.124.146
  106.72.36.96
  106.72.39.130
@@ -6992,7 +6998,6 @@
  106.75.163.101
  106.75.165.225
  106.75.167.133
-106.75.169.106
  106.75.169.24
  106.75.174.6
  106.75.174.87
@@ -7027,7 +7032,6 @@
  106.75.251.169
  106.75.253.112
  106.75.254.114
-106.75.254.204
  106.75.26.64
  106.75.29.102
  106.75.29.239
@@ -7041,22 +7045,22 @@
  106.75.66.70
  106.75.67.6
  106.75.71.244
+106.75.74.29
  106.75.8.12
  106.75.8.186
  106.75.9.141
  106.75.91.171
  106.75.92.94
  106.75.99.14
-106.76.13.238
  106.76.86.84
  106.76.95.170
  106.8.208.1
  106.8.208.102
-106.8.208.11
  106.8.208.152
  106.8.208.182
  106.8.208.190
  106.8.208.21
+106.8.208.240
  106.8.208.31
  106.8.209.178
  106.8.209.194
@@ -7064,6 +7068,7 @@
  106.8.209.33
  106.8.209.5
  106.8.209.67
+106.8.210.1
  106.8.210.143
  106.8.210.15
  106.8.210.159
@@ -7075,6 +7080,7 @@
  106.8.212.89
  106.8.213.159
  106.8.213.168
+106.8.213.220
  106.8.213.43
  106.8.215.138
  106.8.215.167
@@ -7087,6 +7093,7 @@
  106.8.216.152
  106.8.216.197
  106.8.216.27
+106.8.217.122
  106.8.217.142
  106.8.217.151
  106.8.217.208
@@ -7137,12 +7144,14 @@
  106b.com
  107.0.135.4
  107.11.115.68
+107.12.82.124
  107.13.116.112
  107.13.140.129
  107.13.141.32
  107.13.176.58
  107.131.21.243
  107.132.88.42
+107.138.214.44
  107.143.246.110
  107.143.249.158
  107.147.178.243
@@ -7163,7 +7172,6 @@
  107.150.58.196
  107.150.60.26
  107.150.64.115
-107.150.64.241
  107.150.84.28
  107.150.89.121
  107.150.89.124
@@ -7172,17 +7180,9 @@
  107.150.89.66
  107.151.152.210
  107.151.190.19
-107.151.190.20
  107.151.190.21
  107.151.190.22
-107.151.190.23
-107.151.190.24
-107.151.190.25
  107.151.190.26
-107.151.190.27
-107.151.190.28
-107.151.190.29
-107.151.190.30
  107.151.197.16
  107.151.218.131
  107.151.231.108
@@ -7195,12 +7195,12 @@
  107.152.151.35
  107.152.151.41
  107.152.151.75
-107.152.157.8
  107.152.163.166
  107.152.171.165
  107.152.173.92
  107.152.174.127
  107.152.177.47
+107.152.188.238
  107.152.189.190
  107.152.196.168
  107.152.201.20
@@ -7213,22 +7213,22 @@
  107.152.239.28
  107.152.239.35
  107.152.239.43
-107.152.239.62
+107.152.239.63
  107.152.241.92
  107.152.243.153
  107.152.243.228
  107.152.243.248
  107.152.243.249
  107.152.243.253
-107.152.243.59
  107.152.243.81
+107.152.246.44
  107.152.247.150
  107.152.247.158
  107.152.247.215
  107.152.247.224
+107.152.247.227
  107.152.247.230
  107.152.247.233
-107.152.249.50
  107.152.251.96
  107.152.252.28
  107.152.255.190
@@ -7236,14 +7236,13 @@
  107.152.255.223
  107.152.255.242
  107.152.255.250
-107.152.32.80
  107.155.132.187
  107.155.160.204
  107.155.162.15
  107.155.48.36
  107.155.65.34
  107.155.69.26
-107.158.104.51
+107.158.104.76
  107.158.154.111
  107.158.154.121
  107.158.154.126
@@ -7254,6 +7253,7 @@
  107.158.154.99
  107.158.202.140
  107.158.202.20
+107.158.202.220
  107.158.202.228
  107.158.202.234
  107.158.202.237
@@ -7269,11 +7269,11 @@
  107.158.85.208
  107.158.85.234
  107.158.85.55
-107.158.86.192
  107.158.9.141
  107.158.9.211
+107.158.9.63
+107.158.92.119
  107.158.93.121
-107.158.93.137
  107.158.93.138
  107.158.93.241
  107.159.93.103
@@ -7281,9 +7281,12 @@
  107.160.249.14
  107.160.249.6
  107.160.249.8
+107.161.179.138
  107.161.84.107
  107.161.84.124
  107.161.84.21
+107.161.84.210
+107.161.84.23
  107.161.84.45
  107.161.84.91
  107.165.127.99
@@ -7294,9 +7297,11 @@
  107.167.183.41
  107.167.188.95
  107.167.190.172
+107.167.2.132
  107.167.2.78
  107.167.2.81
  107.167.23.66
+107.167.244.51
  107.167.64.4
  107.167.98.190
  107.170.10.239
@@ -7304,6 +7309,7 @@
  107.170.102.171
  107.170.104.125
  107.170.108.22
+107.170.109.27
  107.170.113.190
  107.170.122.252
  107.170.129.218
@@ -7376,22 +7382,19 @@
  107.170.99.119
  107.171.251.16
  107.172.100.204
-107.172.110.199
  107.172.13.68
  107.172.131.188
  107.172.131.201
  107.172.132.201
+107.172.139.236
  107.172.139.244
  107.172.140.127
  107.172.142.122
-107.172.146.81
  107.172.148.128
  107.172.148.133
  107.172.148.166
  107.172.148.174
  107.172.150.21
-107.172.150.45
-107.172.150.56
  107.172.150.88
  107.172.156.153
  107.172.156.224
@@ -7401,6 +7404,7 @@
  107.172.197.101
  107.172.197.166
  107.172.198.146
+107.172.205.45
  107.172.22.132
  107.172.22.136
  107.172.221.106
@@ -7409,31 +7413,34 @@
  107.172.227.90
  107.172.228.103
  107.172.228.35
+107.172.228.57
  107.172.228.72
  107.172.228.78
+107.172.229.121
  107.172.229.5
  107.172.229.57
  107.172.230.195
  107.172.235.154
  107.172.238.104
  107.172.238.8
+107.172.246.77
+107.172.246.78
+107.172.246.81
  107.172.248.168
-107.172.255.63
  107.172.29.108
  107.172.3.146
  107.172.30.12
  107.172.39.27
  107.172.43.152
-107.172.43.217
  107.172.43.242
  107.172.5.116
  107.172.51.253
-107.172.52.175
  107.172.64.151
  107.172.65.227
  107.172.65.231
  107.172.66.211
  107.172.66.244
+107.172.67.133
  107.172.71.82
  107.172.82.134
  107.172.89.15
@@ -7442,6 +7449,7 @@
  107.172.94.137
  107.172.97.34
  107.173.122.10
+107.173.129.101
  107.173.135.157
  107.173.141.130
  107.173.149.104
@@ -7450,15 +7458,12 @@
  107.173.171.123
  107.173.176.100
  107.173.176.172
-107.173.178.141
  107.173.178.149
  107.173.182.173
  107.173.192.37
-107.173.192.41
  107.173.192.56
  107.173.194.241
  107.173.2.6
-107.173.201.186
  107.173.201.244
  107.173.204.16
  107.173.209.238
@@ -7468,7 +7473,6 @@
  107.173.219.51
  107.173.222.153
  107.173.230.175
-107.173.230.217
  107.173.230.219
  107.173.230.220
  107.173.233.12
@@ -7476,22 +7480,21 @@
  107.173.24.139
  107.173.241.231
  107.173.241.253
+107.173.248.102
  107.173.248.112
-107.173.248.119
  107.173.248.141
  107.173.248.151
-107.173.248.246
  107.173.248.32
  107.173.248.52
  107.173.251.100
  107.173.27.180
+107.173.28.34
  107.173.28.55
  107.173.34.130
  107.173.48.253
  107.173.49.10
-107.173.49.26
-107.173.50.207
  107.173.50.213
+107.173.50.222
  107.173.51.246
  107.173.67.131
  107.173.68.127
@@ -7516,16 +7519,17 @@
  107.174.149.195
  107.174.149.224
  107.174.149.88
-107.174.150.45
  107.174.150.57
  107.174.204.122
  107.174.205.104
+107.174.205.28
  107.174.206.110
  107.174.206.147
  107.174.224.150
-107.174.224.169
  107.174.233.248
  107.174.239.219
+107.174.239.226
+107.174.239.237
  107.174.24.12
  107.174.240.42
  107.174.244.102
@@ -7534,7 +7538,6 @@
  107.174.250.122
  107.174.255.62
  107.174.26.181
-107.174.33.130
  107.174.33.139
  107.174.33.153
  107.174.39.102
@@ -7544,23 +7547,22 @@
  107.175.0.13
  107.175.110.253
  107.175.113.101
-107.175.129.122
  107.175.13.35
+107.175.13.95
  107.175.146.85
  107.175.150.73
  107.175.150.83
  107.175.151.74
  107.175.151.94
-107.175.153.212
  107.175.153.222
  107.175.153.223
  107.175.153.245
  107.175.154.129
  107.175.155.196
-107.175.156.144
  107.175.158.110
  107.175.158.210
  107.175.158.68
+107.175.158.88
  107.175.184.197
  107.175.184.3
  107.175.189.235
@@ -7569,6 +7571,7 @@
  107.175.194.25
  107.175.197.150
  107.175.197.164
+107.175.224.144
  107.175.224.177
  107.175.224.188
  107.175.236.254
@@ -7586,14 +7589,13 @@
  107.175.44.89
  107.175.61.32
  107.175.61.58
-107.175.62.163
  107.175.64.101
  107.175.64.188
  107.175.65.251
-107.175.67.188
  107.175.68.249
  107.175.69.166
  107.175.72.120
+107.175.74.152
  107.175.75.60
  107.175.75.62
  107.175.77.56
@@ -7610,16 +7612,17 @@
  107.178.75.114
  107.178.91.53
  107.178.98.66
-107.179.58.88
  107.179.95.6
  107.179.96.11
  107.180.100.223
  107.180.100.224
  107.180.102.143
  107.180.103.185
+107.180.104.71
  107.180.106.60
  107.180.108.32
  107.180.108.7
+107.180.111.12
  107.180.111.13
  107.180.111.21
  107.180.120.35
@@ -7629,14 +7632,19 @@
  107.180.120.52
  107.180.120.55
  107.180.120.61
+107.180.120.66
  107.180.120.67
  107.180.120.69
  107.180.121.26
  107.180.122.10
+107.180.122.17
+107.180.122.20
+107.180.122.60
  107.180.122.7
  107.180.239.203
  107.180.44.78
  107.180.72.207
+107.180.72.237
  107.180.72.246
  107.180.73.164
  107.180.73.192
@@ -7656,7 +7664,6 @@
  107.181.187.141
  107.181.189.34
  107.181.189.37
-107.181.189.45
  107.181.246.211
  107.181.58.56
  107.182.16.25
@@ -7710,6 +7717,7 @@
  107.191.33.82
  107.191.45.65
  107.191.49.16
+107.191.50.50
  107.191.51.136
  107.191.61.187
  107.191.63.217
@@ -7747,7 +7755,6 @@
  107.22.91.113
  107.220.199.71
  107.222.10.97
-107.223.161.13
  107.23.116.84
  107.23.14.203
  107.23.189.203
@@ -7857,22 +7864,25 @@
  108.12.213.236
  108.15.44.30
  108.16.0.72
-108.160.130.18
  108.160.138.55
  108.160.141.213
-108.161.129.14
+108.161.128.64
  108.161.131.10
+108.161.133.130
  108.161.134.112
-108.162.11.58
-108.162.219.24
+108.162.219.20
+108.162.219.224
+108.162.219.46
  108.162.219.74
  108.162.229.139
-108.162.229.26
+108.162.229.236
  108.162.229.35
  108.162.245.119
  108.162.245.83
  108.162.246.36
  108.162.246.54
+108.162.28.6
+108.162.8.219
  108.163.250.106
  108.165.192.14
  108.166.194.71
@@ -7883,6 +7893,7 @@
  108.168.131.106
  108.168.247.250
  108.169.166.42
+108.17.22.70
  108.17.24.222
  108.170.31.68
  108.170.31.69
@@ -7896,6 +7907,7 @@
  108.171.132.164
  108.171.216.194
  108.171.94.90
+108.172.167.18
  108.172.246.109
  108.173.64.161
  108.174.153.215
@@ -7914,7 +7926,6 @@
  108.178.75.172
  108.179.219.114
  108.179.54.171
-108.18.131.20
  108.183.77.12
  108.185.97.172
  108.186.6.161
@@ -7923,7 +7934,7 @@
  108.190.109.107
  108.190.190.48
  108.191.2.72
-108.195.190.242
+108.2.205.10
  108.20.175.197
  108.20.186.210
  108.20.207.31
@@ -7945,8 +7956,10 @@
  108.31.18.221
  108.31.26.131
  108.33.213.8
+108.34.178.165
  108.35.101.86
  108.36.253.227
+108.4.110.148
  108.4.207.148
  108.41.188.197
  108.41.2.202
@@ -7963,11 +7976,9 @@
  108.53.88.101
  108.56.134.33
  108.58.123.210
-108.59.0.39
  108.59.192.147
  108.59.8.80
  108.6.140.26
-108.60.219.24
  108.61.119.36
  108.61.123.69
  108.61.123.70
@@ -7982,7 +7993,6 @@
  108.61.164.177
  108.61.166.161
  108.61.166.50
-108.61.167.152
  108.61.171.82
  108.61.174.9
  108.61.181.114
@@ -8000,6 +8010,7 @@
  108.61.224.74
  108.61.229.7
  108.61.229.76
+108.61.242.155
  108.61.245.219
  108.61.246.246
  108.61.250.213
@@ -10059,9 +10070,9 @@
  108.62.82.189
  108.62.96.36
  108.67.148.87
+108.70.77.148
  108.72.209.30
  108.78.162.234
-108.87.94.140
  108.9.195.212
  1080wallpapers.xyz
  1081-https.com
@@ -10075,8 +10086,6 @@
  109.102.228.130
  109.102.254.170
  109.103.55.145
-109.104.118.194
-109.104.118.197
  109.104.118.205
  109.104.151.10
  109.104.164.105
@@ -10087,25 +10096,24 @@
  109.105.205.230
  109.105.205.232
  109.106.139.225
-109.108.136.103
  109.108.87.136
  109.108.88.156
-109.110.199.137
+109.11.193.220
  109.110.52.77
  109.110.73.106
  109.110.81.90
  109.111.130.133
+109.111.146.121
  109.111.237.38
  109.115.62.166
  109.116.245.80
  109.116.41.238
  109.116.7.179
+109.116.7.240
  109.117.250.76
  109.117.53.230
  109.118.109.210
-109.118.113.226
  109.118.96.249
-109.118.98.35
  109.12.99.127
  109.120.141.160
  109.120.141.220
@@ -10125,14 +10133,15 @@
  109.123.66.206
  109.124.65.86
  109.125.128.53
-109.125.130.123
  109.125.136.233
-109.128.161.8
+109.125.138.44
+109.127.82.2
+109.129.39.42
  109.133.28.158
  109.134.232.81
  109.144.21.161
+109.145.147.89
  109.145.190.110
-109.146.170.113
  109.148.140.120
  109.149.109.209
  109.149.177.137
@@ -10140,6 +10149,7 @@
  109.155.126.183
  109.160.20.203
  109.160.55.202
+109.160.62.62
  109.160.88.135
  109.160.97.49
  109.162.121.181
@@ -10148,10 +10158,12 @@
  109.163.234.5
  109.164.113.55
  109.164.231.240
+109.164.5.33
+109.166.137.91
+109.166.138.173
  109.166.213.12
  109.166.89.91
  109.167.132.201
-109.167.133.227
  109.167.134.253
  109.167.200.10
  109.167.207.72
@@ -10174,7 +10186,6 @@
  109.170.97.146
  109.172.57.250
  109.172.57.64
-109.173.116.185
  109.173.207.145
  109.173.41.43
  109.173.41.95
@@ -10182,24 +10193,23 @@
  109.174.19.134
  109.175.10.239
  109.175.56.203
+109.175.97.137
  109.183.189.238
  109.183.251.77
-109.184.182.170
  109.184.188.117
  109.184.206.115
  109.184.218.150
  109.185.141.61
-109.185.159.147
  109.185.180.87
  109.185.44.56
  109.186.228.62
-109.187.39.83
  109.188.132.86
  109.188.69.113
  109.188.79.159
  109.188.86.168
  109.188.95.148
  109.189.227.101
+109.191.164.146
  109.191.203.153
  109.192.75.21
  109.193.134.138
@@ -10216,9 +10226,7 @@
  109.195.194.79
  109.195.215.210
  109.195.23.223
-109.195.234.167
  109.195.38.201
-109.196.127.35
  109.196.172.197
  109.196.254.52
  109.196.68.236
@@ -10226,12 +10234,14 @@
  109.197.194.157
  109.197.93.133
  109.198.191.22
+109.199.133.161
  109.199.164.195
  109.199.177.21
  109.199.241.148
  109.200.132.161
  109.200.156.102
  109.200.156.2
+109.200.229.204
  109.200.24.116
  109.200.24.97
  109.200.24.98
@@ -10248,18 +10258,20 @@
  109.202.17.4
  109.205.115.234
  109.206.168.240
-109.206.246.149
  109.206.246.94
  109.207.102.183
+109.207.202.8
  109.207.46.111
  109.207.79.248
-109.207.99.207
  109.208.205.40
  109.21.2.25
+109.21.2.47
+109.210.73.147
  109.210.97.157
  109.215.254.226
  109.215.90.55
  109.219.187.84
+109.221.193.222
  109.221.9.129
  109.224.1.210
  109.224.12.170
@@ -10281,12 +10293,10 @@
  109.227.0.205
  109.227.199.25
  109.227.4.108
-109.227.4.230
-109.227.5.25
+109.227.68.7
  109.228.12.92
  109.228.168.80
  109.228.21.246
-109.228.48.129
  109.228.50.121
  109.228.53.116
  109.228.57.242
@@ -10303,6 +10313,7 @@
  109.230.245.229
  109.230.251.8
  109.231.194.188
+109.231.21.43
  109.232.106.236
  109.232.109.58
  109.233.212.105
@@ -10319,12 +10330,12 @@
  109.236.105.40
  109.236.137.88
  109.236.213.1
-109.236.52.86
-109.236.63.195
+109.236.52.80
  109.236.81.124
  109.236.81.138
  109.236.81.159
  109.236.82.125
+109.236.86.116
  109.236.86.17
  109.236.88.13
  109.236.88.245
@@ -10336,12 +10347,18 @@
  109.237.214.77
  109.237.26.218
  109.237.92.138
+109.237.96.152
  109.237.96.154
  109.237.96.155
+109.237.96.156
+109.237.96.157
  109.237.96.16
  109.237.96.160
  109.237.96.161
+109.237.96.162
  109.237.96.17
+109.237.96.18
+109.237.96.23
  109.237.96.24
  109.237.96.25
  109.238.11.95
@@ -10362,10 +10379,10 @@
  109.24.144.155
  109.241.164.89
  109.241.203.171
+109.244.102.28
  109.244.105.42
  109.244.35.46
  109.244.35.48
-109.244.97.187
  109.244.97.210
  109.244.99.17
  109.244.99.6
@@ -10376,6 +10393,7 @@
  109.245.239.125
  109.245.241.89
  109.245.242.105
+109.246.112.28
  109.247.106.144
  109.248.11.91
  109.248.14.110
@@ -10383,43 +10401,38 @@
  109.248.14.33
  109.248.14.90
  109.248.142.105
-109.248.142.197
  109.248.142.240
-109.248.143.111
-109.248.143.131
+109.248.142.99
  109.248.147.150
-109.248.148.253
  109.248.148.57
  109.248.149.28
  109.248.149.95
  109.248.149.96
  109.248.15.112
-109.248.15.141
+109.248.167.155
  109.248.175.204
  109.248.176.238
  109.248.200.191
-109.248.203.139
  109.248.206.13
+109.248.49.183
  109.248.62.207
  109.248.9.32
-109.250.135.242
+109.250.143.252
  109.251.252.123
  109.251.55.235
  109.251.76.229
  109.252.108.237
+109.252.116.83
  109.252.123.74
  109.252.126.74
  109.252.2.50
  109.252.202.140
+109.252.228.158
  109.252.255.162
-109.254.35.13
  109.254.6.40
  109.255.152.153
-109.255.170.221
  109.31.234.155
-109.40.65.140
  109.40.66.72
-109.51.230.53
  109.61.10.121
  109.61.112.10
  109.61.112.33
@@ -10428,13 +10441,11 @@
  109.61.14.0
  109.61.2.166
  109.62.224.142
-109.63.184.54
  109.64.229.66
  109.64.231.189
  109.68.189.22
  109.68.212.165
  109.69.0.69
-109.69.1.178
  109.69.1.212
  109.69.1.234
  109.69.10.116
@@ -10497,6 +10508,7 @@
  109.73.76.39
  109.73.78.82
  109.73.99.253
+109.74.10.112
  109.74.130.129
  109.74.136.78
  109.74.142.138
@@ -10517,7 +10529,10 @@
  109.75.43.17
  109.75.45.34
  109.76.184.112
-109.76.27.47
+109.76.187.224
+109.76.72.247
+109.76.77.33
+109.79.54.238
  109.80.128.210
  109.86.121.118
  109.86.134.93
@@ -10528,7 +10543,6 @@
  109.86.219.161
  109.86.219.179
  109.86.219.4
-109.86.224.182
  109.86.225.146
  109.86.226.133
  109.86.244.225
@@ -10539,12 +10553,13 @@
  109.87.143.67
  109.87.183.226
  109.87.78.144
+109.88.88.246
+109.89.111.122
  109.9.175.65
  109.90.104.232
  109.90.2.70
  109.90.59.133
  109.92.131.90
-109.92.141.118
  109.92.142.106
  109.92.17.115
  109.92.189.7
@@ -10553,14 +10568,19 @@
  109.92.205.35
  109.92.222.102
  109.92.222.170
-109.93.179.235
  109.93.236.27
+109.93.32.45
+109.93.72.104
  109.94.115.108
+109.94.172.131
  109.94.172.43
  109.94.182.128
  109.94.182.9
  109.94.220.160
+109.95.177.82
  109.95.255.82
+109.96.112.98
+109.96.26.48
  109.96.66.75
  109.99.146.210
  109.99.37.97
@@ -10610,16 +10630,17 @@
  110.136.105.45
  110.136.129.228
  110.136.188.201
+110.136.217.141
  110.136.241.180
  110.136.247.104
+110.137.101.1
+110.137.112.75
  110.137.36.125
  110.137.77.8
-110.138.10.244
+110.138.150.132
  110.138.150.71
-110.138.150.91
  110.138.203.243
  110.138.218.224
-110.139.1.160
  110.139.128.232
  110.139.162.111
  110.139.206.102
@@ -10636,13 +10657,13 @@
  110.145.77.103
  110.153.66.128
  110.153.72.123
-110.153.9.210
  110.154.150.247
  110.154.175.68
  110.154.208.185
  110.154.224.184
  110.154.250.225
  110.155.167.245
+110.155.219.86
  110.155.54.100
  110.155.56.16
  110.155.57.100
@@ -10657,6 +10678,7 @@
  110.16.95.6
  110.164.101.129
  110.164.126.99
+110.164.163.54
  110.164.64.243
  110.164.76.59
  110.164.86.203
@@ -10665,10 +10687,7 @@
  110.165.19.77
  110.166.80.105
  110.167.30.50
-110.168.171.41
  110.169.137.205
-110.169.33.130
-110.169.42.85
  110.169.68.70
  110.169.70.204
  110.17.41.183
@@ -10682,7 +10701,6 @@
  110.171.154.126
  110.171.226.67
  110.172.101.138
-110.172.101.141
  110.172.147.35
  110.172.160.42
  110.172.162.216
@@ -10693,15 +10711,15 @@
  110.172.191.142
  110.173.58.162
  110.173.59.42
-110.174.144.138
+110.174.111.199
  110.174.148.117
  110.174.223.95
  110.174.96.220
  110.175.118.246
-110.175.128.62
-110.175.146.103
+110.175.135.46
  110.175.183.5
  110.175.48.129
+110.177.104.53
  110.177.12.230
  110.177.3.152
  110.179.14.69
@@ -10717,32 +10735,32 @@
  110.182.107.42
  110.182.62.68
  110.183.108.189
-110.185.106.91
  110.185.125.117
  110.185.147.217
  110.185.170.135
  110.185.174.154
  110.188.23.57
  110.188.70.99
-110.191.210.94
+110.189.152.86
+110.191.167.186
  110.191.212.248
  110.224.137.70
  110.224.138.249
+110.224.166.207
+110.224.170.9
  110.224.173.85
-110.225.207.60
  110.227.118.199
+110.227.135.115
  110.227.232.30
  110.228.196.199
  110.228.219.153
  110.228.91.170
-110.230.233.20
+110.232.248.38
  110.232.249.179
  110.232.249.205
  110.232.249.226
  110.232.252.145
  110.232.252.207
-110.232.255.50
-110.232.66.162
  110.232.74.55
  110.232.76.39
  110.232.76.94
@@ -10755,25 +10773,14 @@
  110.235.249.162
  110.235.250.71
  110.240.205.93
-110.240.229.67
  110.243.178.147
  110.243.21.44
  110.243.24.153
  110.244.24.72
-110.244.242.230
  110.244.97.221
  110.247.16.64
-110.248.227.181
-110.248.243.143
-110.250.43.103
-110.251.11.220
  110.251.132.10
-110.251.5.169
-110.253.124.93
-110.253.229.58
-110.253.237.246
  110.253.48.64
-110.255.126.185
  110.255.95.62
  110.32.29.185
  110.34.166.35
@@ -10783,21 +10790,19 @@
  110.35.156.191
  110.35.221.15
  110.35.223.92
+110.35.225.12
  110.35.234.192
  110.35.235.57
  110.35.29.85
  110.35.43.14
-110.36.218.22
  110.36.221.82
-110.36.225.58
  110.36.226.118
+110.36.226.198
  110.36.228.157
-110.36.232.46
+110.36.233.146
  110.36.234.146
  110.36.235.118
-110.36.238.218
-110.36.239.234
-110.37.200.239
+110.36.237.10
  110.37.216.118
  110.37.224.243
  110.37.226.83
@@ -10805,16 +10810,16 @@
  110.38.7.172
  110.38.7.174
  110.38.7.197
-110.39.146.98
  110.39.160.132
  110.39.160.38
  110.39.162.2
  110.39.174.58
-110.39.187.110
+110.39.184.146
  110.4.27.27
  110.4.45.150
  110.42.10.141
  110.43.241.63
+110.43.34.170
  110.43.49.112
  110.43.52.158
  110.43.52.211
@@ -10823,8 +10828,8 @@
  110.44.113.2
  110.44.117.26
  110.44.118.8
+110.44.122.214
  110.44.123.116
-110.44.124.220
  110.44.126.149
  110.44.126.235
  110.45.139.12
@@ -10840,6 +10845,7 @@
  110.49.11.50
  110.49.127.85
  110.49.127.88
+110.49.146.59
  110.49.167.189
  110.49.47.242
  110.5.102.238
@@ -10879,12 +10885,11 @@
  110.77.137.213
  110.77.138.12
  110.77.145.159
-110.77.148.247
  110.77.149.227
+110.77.154.211
  110.77.154.36
  110.77.159.208
  110.77.159.73
-110.77.163.116
  110.77.164.42
  110.77.165.173
  110.77.171.35
@@ -10894,6 +10899,7 @@
  110.77.184.135
  110.77.184.154
  110.77.184.186
+110.77.184.197
  110.77.184.31
  110.77.184.85
  110.77.189.93
@@ -10907,9 +10913,9 @@
  110.77.217.158
  110.77.217.166
  110.77.217.177
-110.77.217.216
-110.77.218.95
+110.77.217.236
  110.77.226.221
+110.77.232.174
  110.77.232.176
  110.77.232.184
  110.77.232.219
@@ -10923,6 +10929,7 @@
  110.77.240.174
  110.77.241.185
  110.77.242.165
+110.77.244.109
  110.77.248.28
  110.77.250.185
  110.78.136.45
@@ -10942,18 +10949,16 @@
  110.78.146.4
  110.78.147.191
  110.78.147.197
-110.78.147.47
  110.78.148.126
  110.78.148.150
  110.78.148.204
  110.78.148.221
  110.78.149.13
+110.78.149.152
  110.78.149.18
  110.78.149.190
-110.78.149.195
-110.78.149.237
  110.78.149.48
-110.78.149.74
+110.78.149.54
  110.78.151.29
  110.78.152.117
  110.78.152.129
@@ -10974,7 +10979,6 @@
  110.78.179.188
  110.78.184.14
  110.78.186.116
-110.78.186.126
  110.78.186.146
  110.78.186.148
  110.78.186.166
@@ -10984,27 +10988,22 @@
  110.78.186.31
  110.78.186.91
  110.78.20.62
-110.78.208.28
  110.8.67.146
  110.8.71.166
  110.8.84.231
  110.80.36.202
  110.80.46.90
  110.81.179.43
-110.82.166.250
  110.82.166.48
-110.83.135.10
  110.85.99.220
  110.86.175.75
  110.86.177.127
-110.86.182.164
  110.88.160.233
  110.93.13.182
  110.93.13.190
  110.93.13.33
  110.93.14.8
  110.93.214.37
-110.93.246.171
  110.93.246.222
  110.93.87.254
  111.0.124.232
@@ -11013,7 +11012,6 @@
  111.0.80.195
  111.1.165.12
  111.108.18.89
-111.11.102.172
  111.118.104.86
  111.118.105.57
  111.118.117.93
@@ -11029,18 +11027,17 @@
  111.118.65.24
  111.118.88.61
  111.118.96.2
-111.119.177.24
  111.119.178.175
  111.119.187.14
-111.119.187.40
+111.119.187.29
  111.119.187.52
  111.119.187.63
  111.119.210.10
  111.119.233.65
-111.119.236.42
  111.119.245.114
  111.12.52.219
  111.123.64.229
+111.125.244.210
  111.125.70.22
  111.125.87.199
  111.125.88.186
@@ -11057,8 +11054,6 @@
  111.161.74.113
  111.161.74.117
  111.161.74.118
-111.161.74.125
-111.162.224.114
  111.165.242.26
  111.165.9.204
  111.166.128.219
@@ -11070,8 +11065,10 @@
  111.172.167.137
  111.173.223.244
  111.175.186.150
+111.175.187.138
  111.176.46.94
-111.177.192.44
+111.177.192.59
+111.177.192.75
  111.177.21.178
  111.177.22.4
  111.177.22.5
@@ -11080,12 +11077,12 @@
  111.182.236.65
  111.182.237.131
  111.185.177.85
+111.185.23.84
  111.185.4.94
  111.185.49.223
  111.186.57.17
  111.186.58.181
  111.19.157.70
-111.19.198.4
  111.196.123.143
  111.198.29.247
  111.198.48.204
@@ -11093,20 +11090,14 @@
  111.200.216.72
  111.200.52.194
  111.201.66.132
-111.202.106.13
  111.202.106.14
  111.202.106.5
  111.202.106.6
-111.202.130.168
-111.202.190.0
-111.202.190.10
-111.202.190.14
  111.204.176.209
  111.204.204.72
  111.204.244.192
  111.205.14.12
  111.205.6.222
-111.206.16.235
  111.206.198.31
  111.206.221.23
  111.206.221.40
@@ -11116,19 +11107,19 @@
  111.21.99.227
  111.22.120.137
  111.220.71.156
-111.221.44.203
  111.222.16.148
  111.223.3.83
  111.224.160.9
  111.224.162.111
-111.224.167.169
  111.225.93.40
+111.227.146.99
  111.229.1.180
  111.229.101.155
  111.229.109.26
  111.229.110.107
  111.229.110.148
  111.229.113.64
+111.229.116.167
  111.229.118.46
  111.229.123.124
  111.229.123.86
@@ -11200,7 +11191,6 @@
  111.229.44.68
  111.229.48.141
  111.229.50.25
-111.229.63.21
  111.229.64.120
  111.229.65.253
  111.229.67.3
@@ -11221,7 +11211,6 @@
  111.23.58.253
  111.230.104.169
  111.230.105.142
-111.230.135.188
  111.230.136.231
  111.230.141.155
  111.230.157.123
@@ -11250,6 +11239,7 @@
  111.230.241.110
  111.230.25.75
  111.230.29.17
+111.230.56.118
  111.230.73.133
  111.230.90.144
  111.230.92.241
@@ -11275,10 +11265,9 @@
  111.231.202.118
  111.231.206.166
  111.231.215.244
+111.231.223.88
  111.231.226.216
-111.231.241.201
  111.231.52.108
-111.231.54.212
  111.231.54.33
  111.231.55.75
  111.231.59.18
@@ -11288,7 +11277,6 @@
  111.231.71.53
  111.231.75.5
  111.231.75.83
-111.231.76.214
  111.231.77.115
  111.231.79.227
  111.231.88.39
@@ -11310,6 +11298,7 @@
  111.26.165.80
  111.30.107.154
  111.30.11.58
+111.30.114.22
  111.31cf4fdae.com
  111.33.112.172
  111.38.10.161
@@ -11404,16 +11393,13 @@
  111.43.223.80
  111.47.18.22
  111.48.132.225
-111.50.82.24
  111.53.13.253
  111.57.0.90
-111.61.122.78
  111.65.255.131
  111.67.12.221
  111.67.192.149
  111.67.193.163
  111.67.193.67
-111.67.193.97
  111.67.194.199
  111.67.194.36
  111.67.194.41
@@ -11423,6 +11409,7 @@
  111.67.197.156
  111.67.198.184
  111.67.198.214
+111.67.199.130
  111.67.199.142
  111.67.199.85
  111.67.20.202
@@ -11430,6 +11417,7 @@
  111.67.200.179
  111.67.201.13
  111.67.202.104
+111.67.202.234
  111.67.203.82
  111.67.204.137
  111.67.204.199
@@ -11455,23 +11443,25 @@
  111.68.2.58
  111.68.27.38
  111.68.46.68
+111.68.96.36
  111.68.98.152
  111.69.49.124
  111.73.45.204
  111.73.46.99
  111.74.11.82
  111.75.149.221
-111.75.190.6
+111.75.223.17
  111.76.127.1
  111.76.140.116
  111.77.250.65
  111.79.45.186
+111.8.122.227
  111.8.57.61
  111.85.96.173
  111.88.172.221
-111.88.226.37
+111.88.231.80
+111.88.247.142
  111.88.249.25
-111.88.43.25
  111.88.68.255
  111.90.133.10
  111.90.138.208
@@ -11503,13 +11493,11 @@
  111.90.151.81
  111.90.156.60
  111.90.158.103
-111.90.158.159
  111.90.159.120
  111.90.177.130
  111.90.187.94
  111.90.190.52
  111.91.161.51
-111.92.104.177
  111.92.164.238
  111.92.164.245
  111.92.164.246
@@ -11532,7 +11520,6 @@
  111.92.80.49
  111.92.80.59
  111.92.80.62
-111.92.80.70
  111.92.81.110
  111.92.81.13
  111.92.81.187
@@ -11548,16 +11535,21 @@
  111.93.200.50
  111.93.205.186
  111.93.214.67
+111.93.235.74
  111.93.24.98
  111.93.30.66
  111.93.38.226
  111.93.53.62
  111.93.58.18
  111.93.71.219
+111.94.37.143
+111.94.44.146
  111.94.51.141
  111.95.108.234
  111.95.141.34
+111.95.185.166
  111.95.203.73
+111.95.214.94
  111.zc6555.com
  111.zc8333.com
  111361112586123.002.sh.cn
@@ -11577,6 +11569,7 @@
  112.111.31.199
  112.112.18.146
  112.112.7.202
+112.116.101.89
  112.116.155.205
  112.119.173.237
  112.119.179.221
@@ -11596,7 +11589,6 @@
  112.125.89.61
  112.126.65.178
  112.132.0.7
-112.132.130.183
  112.132.144.159
  112.132.144.221
  112.132.144.243
@@ -11607,12 +11599,13 @@
  112.133.195.55
  112.133.219.171
  112.133.230.89
+112.133.232.74
+112.133.244.170
  112.133.245.181
  112.133.26.29
  112.134.70.134
-112.135.194.103
-112.135.253.195
  112.135.3.80
+112.137.132.89
  112.137.164.101
  112.14.158.86
  112.14.47.6
@@ -11621,14 +11614,13 @@
  112.145.215.200
  112.146.109.225
  112.15.50.218
-112.151.170.214
+112.150.238.236
  112.158.127.39
  112.16.211.200
  112.16.97.234
  112.160.228.146bin.sh
  112.160.238.138
  112.160.60.84
-112.161.172.211
  112.161.211.65
  112.161.241.200
  112.162.112.56
@@ -11645,10 +11637,9 @@
  112.165.209.225
  112.165.209.227
  112.165.75.57
-112.165.89.170
  112.166.133.216
  112.166.159.199
-112.166.221.151
+112.167.165.139
  112.168.0.84bin.sh
  112.17.104.45
  112.17.106.99
@@ -11688,30 +11679,25 @@
  112.172.88.190
  112.175.137.20
  112.175.184.36
+112.175.184.68
  112.175.232.169
  112.184.134.76
+112.184.214.127
  112.185.114.225
  112.186.17.231
  112.186.78.13
  112.187.6.59
-112.19.174.226
  112.192.159.136
  112.192.159.4
-112.193.144.126
-112.193.146.225
  112.196.1.75
  112.196.16.50
-112.196.163.172
  112.196.163.33
  112.196.26.203
  112.196.43.202
  112.196.54.35
-112.196.59.146
-112.196.72.188
  112.196.74.82
  112.196.76.140
-112.196.9.88
-112.197.118.28
+112.197.181.139
  112.198.103.183
  112.198.15.5
  112.198.27.40
@@ -11722,12 +11708,10 @@
  112.199.65.118
  112.199.76.44
  112.199.98.42
-112.2.52.115
-112.200.110.130
  112.200.174.103
  112.200.198.182
-112.200.200.55
  112.200.201.164
+112.200.205.200
  112.201.176.54
  112.201.91.20
  112.202.160.210
@@ -11749,9 +11733,7 @@
  112.21.191.10
  112.21.191.244
  112.210.59.106
-112.211.130.99
  112.211.132.242
-112.211.217.13
  112.211.85.172
  112.213.124.220
  112.213.179.18
@@ -11772,7 +11754,6 @@
  112.218.127.140
  112.218.231.43
  112.218.245.11
-112.218.53.179
  112.218.66.90
  112.218.73.138
  112.219.201.124
@@ -11782,7 +11763,6 @@
  112.222.61.180
  112.225.186.20
  112.225.204.1
-112.225.226.91
  112.225.29.179
  112.225.33.145
  112.225.38.249
@@ -11790,7 +11770,6 @@
  112.225.57.154
  112.225.73.162
  112.225.81.178
-112.225.83.63
  112.225.87.22
  112.226.116.82bin.sh
  112.226.122.28
@@ -11809,28 +11788,21 @@
  112.226.80.198
  112.228.11.40
  112.228.178.129
-112.228.229.83
  112.229.188.86
  112.230.87.213
  112.231.185.227
  112.233.61.230bin.sh
  112.233.88.214
-112.233.90.58
-112.234.194.23
-112.234.195.89
  112.234.198.115
  112.235.210.15
  112.235.234.75
  112.235.43.50
  112.237.105.199
-112.237.105.36
-112.237.124.69
  112.237.127.98bin.sh
  112.237.136.133
  112.237.140.181
  112.237.168.32
  112.237.17.226bin.sh
-112.237.182.97
  112.237.210.126
  112.237.210.126bin.sh
  112.237.216.146
@@ -11845,76 +11817,50 @@
  112.238.12.199
  112.238.13.28
  112.238.135.78
-112.238.14.107
-112.238.148.91
  112.238.150.137
  112.238.152.67
  112.238.16.209
  112.238.174.240
-112.238.18.66
-112.238.190.28
  112.238.216.117
-112.238.22.22
  112.238.222.216
  112.238.230.190
-112.238.231.126
  112.238.29.24
  112.238.63.223
-112.239.115.195
  112.239.20.131
  112.239.20.24
  112.240.173.23
-112.240.177.74
  112.240.178.165
-112.240.183.193
+112.240.183.31
  112.240.183.69
  112.240.183.94
  112.242.1.245bin.sh
-112.242.117.66
  112.242.119.70bin.sh
  112.242.129.242
  112.242.129.242bin.sh
-112.242.144.4
-112.242.144.72
  112.242.163.6
-112.242.191.222
  112.242.241.18
-112.242.241.25
-112.242.37.226
  112.242.41.208
  112.242.53.15
  112.242.58.230
  112.242.62.171
  112.242.76.95
-112.242.80.2
  112.243.167.181
-112.244.0.7
-112.244.161.224
  112.245.108.219
  112.245.115.241
  112.245.162.48
-112.245.209.145
-112.245.235.93
  112.245.51.48
  112.246.16.56
  112.246.160.53
-112.246.162.10
-112.246.162.50
  112.246.23.135
  112.246.35.254
  112.246.42.101
-112.247.100.58
  112.247.158.19
  112.247.174.45
  112.247.191.75bin.sh
  112.247.210.121
-112.247.237.11
-112.247.251.238
+112.247.247.199
  112.247.44.51
-112.247.46.47
-112.247.59.42
  112.247.80.248
-112.247.82.27
  112.247.83.243
  112.247.87.225
  112.248.102.109
@@ -11923,11 +11869,10 @@
  112.248.112.139
  112.248.115.154
  112.248.115.180
-112.248.12.125
  112.248.12.177
  112.248.12.206
+112.248.12.22
  112.248.125.144
-112.248.13.170
  112.248.13.225
  112.248.13.55
  112.248.169.138bin.sh
@@ -11935,31 +11880,21 @@
  112.248.195.208
  112.248.212.95
  112.248.47.171
-112.248.63.88
  112.248.8.51
  112.248.8.54
  112.248.85.54
+112.248.97.201
  112.249.114.118
  112.249.207.89
-112.249.232.239
  112.249.239.249
  112.249.34.188
  112.249.44.140
  112.249.6.180
  112.249.61.143
  112.249.64.120
-112.249.68.235
-112.249.7.128
  112.249.79.230
  112.249.82.57
-112.250.187.128
  112.251.219.229
-112.251.221.45
-112.251.35.96
-112.252.122.52
-112.252.142.223
-112.252.148.133
-112.252.199.225
  112.252.213.72
  112.252.221.244
  112.252.74.188
@@ -11967,7 +11902,6 @@
  112.254.177.210
  112.254.180.220
  112.254.201.248
-112.254.32.243
  112.254.68.30
  112.254.94.5
  112.255.130.20
@@ -11977,13 +11911,13 @@
  112.255.32.166
  112.255.35.70
  112.255.72.130
-112.255.8.235
  112.255.83.242
  112.255.92.233
  112.255.93.3
  112.26.113.106
  112.26.160.67
  112.26.169.105
+112.26.169.108
  112.26.44.112
  112.27.115.8
  112.27.121.163
@@ -12088,9 +12022,9 @@
  112.27.91.236
  112.27.91.241
  112.27.91.247
-112.28.104.177
  112.28.209.79
  112.28.209.80
+112.28.38.31
  112.28.98.52
  112.28.98.61
  112.28.98.69
@@ -12111,6 +12045,7 @@
  112.30.1.164
  112.30.1.168bin.sh
  112.30.1.177
+112.30.1.178
  112.30.1.179
  112.30.1.181
  112.30.1.188
@@ -12204,8 +12139,10 @@
  112.30.4.68
  112.30.4.68bin.sh
  112.30.4.69
+112.30.4.70
  112.30.4.73
  112.30.4.78
+112.30.4.84
  112.30.4.90
  112.30.4.90bin.sh
  112.30.97.184
@@ -12226,14 +12163,17 @@
  112.53.227.66
  112.53.68.114
  112.6.132.95
+112.64.32.118
  112.64.33.38
+112.64.52.252
  112.64.52.87
  112.64.67.35
  112.64.67.36
  112.64.67.37
  112.65.125.190
  112.65.63.62
-112.66.254.26
+112.67.169.66
+112.67.176.102
  112.67.184.112
  112.67.252.27
  112.72.133.118
@@ -12249,10 +12189,9 @@
  112.72.195.47
  112.72.245.132
  112.74.203.41
-112.74.30.95
+112.74.43.100
  112.74.44.120
  112.78.0.37
-112.78.1.134
  112.78.1.240
  112.78.132.30
  112.78.134.154
@@ -12266,10 +12205,7 @@
  112.78.15.3
  112.78.15.5
  112.78.160.109
-112.78.160.110
-112.78.160.206
  112.78.160.210
-112.78.160.245
  112.78.160.32
  112.78.160.7
  112.78.162.156
@@ -12282,8 +12218,11 @@
  112.78.166.137
  112.78.166.197
  112.78.166.251
+112.78.166.55
+112.78.166.86
  112.78.167.230
-112.78.167.234
+112.78.167.45
+112.78.169.98
  112.78.170.27
  112.78.186.110
  112.78.188.194
@@ -12293,29 +12232,22 @@
  112.78.43.58
  112.78.44.142
  112.78.44.229
+112.78.47.218
  112.78.8.133
  112.80.215.101
  112.80.238.37
-112.80.24.44
-112.81.102.82
-112.81.210.19
  112.81.24.144
-112.82.138.66
  112.82.142.161
-112.82.142.25
-112.82.148.101
-112.82.172.4
  112.82.18.255
  112.82.198.79
  112.82.218.4
-112.83.99.176
-112.84.178.146
  112.84.21.184
  112.85.42.110
  112.85.42.119
  112.85.42.120
  112.85.42.122
  112.85.42.13
+112.85.42.143
  112.85.42.151
  112.85.42.172
  112.85.42.174
@@ -12340,7 +12272,6 @@
  112.86.252.154
  112.87.136.109
  112.9.158.247
-112.90.145.103
  112.91.109.103
  112.91.135.184
  112.91.145.58
@@ -12348,7 +12279,6 @@
  112.94.101.174
  112.94.224.249
  112.94.5.2
-112.94.96.213
  112.94.96.37
  112.94.96.51
  112.94.97.40
@@ -12369,19 +12299,21 @@
  113.1.52.213
  113.10.154.11
  113.100.70.57
-113.102.128.101
-113.102.128.124
-113.102.35.222
+113.102.251.250
+113.102.35.218
+113.103.224.138
  113.103.57.113
  113.104.251.28
  113.105.174.4
  113.105.180.62
+113.105.191.5
  113.105.247.21
  113.105.94.66
  113.106.111.50
  113.106.9.248
  113.107.244.124
  113.108.195.242
+113.109.216.16
  113.109.76.234
  113.11.110.46
  113.11.136.28
@@ -12396,66 +12328,54 @@
  113.11.35.52
  113.11.35.54
  113.11.64.62
-113.110.165.147
  113.110.165.88
  113.110.167.115
  113.110.167.137
  113.110.200.205
+113.111.229.233
  113.111.230.64
-113.111.80.103
-113.113.124.225
  113.113.81.174
-113.116.104.127
-113.116.129.181
-113.116.131.74
  113.116.156.236
-113.116.159.29
-113.116.204.146
-113.116.245.210
  113.116.246.204
  113.116.34.31
-113.116.6.220
+113.116.48.197
+113.116.56.47
  113.116.88.237
-113.116.89.225
-113.118.122.183
  113.118.13.101
-113.118.14.20
+113.118.15.62
  113.118.44.245
  113.118.86.236
-113.119.164.109
-113.119.196.27
+113.119.197.93
  113.12.64.58
  113.120.142.241
  113.120.33.230
  113.120.33.35
-113.120.61.189
-113.121.188.93
+113.121.22.23
  113.121.241.94
-113.121.46.8
+113.121.39.124
  113.124.84.51
  113.125.21.66
  113.128.15.170
-113.128.56.148
+113.128.246.50
  113.130.126.154
  113.130.68.58
+113.132.10.237
  113.133.170.196
  113.133.176.204
  113.133.224.68
-113.134.14.107
  113.134.240.218
+113.137.234.214
  113.14.111.246
  113.140.11.6
  113.140.48.82
  113.140.80.174
  113.141.165.235
  113.141.169.192
-113.141.70.199
+113.141.70.243
  113.142.58.155
-113.145.168.250
  113.15.205.127
  113.160.102.105
  113.160.112.201
-113.160.12.134
  113.160.130.116
  113.160.131.53
  113.160.142.10
@@ -12467,17 +12387,15 @@
  113.160.180.109
  113.160.184.60
  113.160.188.21
-113.160.198.217
-113.160.20.42
-113.160.202.185
+113.160.206.36
  113.160.206.37
-113.160.208.114
-113.160.208.15
+113.160.210.115
+113.160.214.25
  113.160.219.210
-113.160.221.108
  113.160.234.147
  113.160.234.160
  113.160.234.21
+113.160.234.212
  113.160.235.49
  113.160.245.89
  113.160.247.115
@@ -12485,6 +12403,7 @@
  113.160.247.189
  113.160.248.80
  113.160.251.43
+113.160.37.36
  113.160.58.230
  113.160.96.0
  113.160.98.123
@@ -12493,7 +12412,6 @@
  113.161.129.13
  113.161.132.29
  113.161.148.81
-113.161.151.29
  113.161.160.174
  113.161.176.235
  113.161.176.83
@@ -12501,18 +12419,16 @@
  113.161.207.105
  113.161.207.99
  113.161.210.203
-113.161.212.23
-113.161.220.55
  113.161.237.248
+113.161.239.29
+113.161.248.98
  113.161.37.216
  113.161.39.18
  113.161.39.209
  113.161.43.81
  113.161.45.89
-113.161.50.231
  113.161.52.89
  113.161.53.147
-113.161.55.228
  113.161.58.249
  113.161.62.31
  113.161.68.146
@@ -12524,75 +12440,83 @@
  113.161.92.91
  113.161.94.155
  113.162.101.73
+113.162.189.201
  113.162.232.255
  113.162.36.247
  113.162.53.125
  113.162.55.10
  113.162.66.15
+113.162.84.115
+113.163.13.55
  113.163.157.250
-113.163.202.22
-113.163.221.222
  113.164.79.127
  113.164.79.177
  113.165.122.210
-113.165.189.158
  113.165.229.218
  113.167.137.44
+113.167.218.179
  113.168.106.126
  113.168.5.245
+113.169.195.50
  113.169.42.170
  113.170.128.242
  113.170.221.199
  113.172.105.223
  113.172.139.113
  113.172.180.51
+113.172.191.177
  113.172.202.84
-113.172.223.47
  113.172.77.33
+113.173.167.90
  113.173.191.219
  113.173.198.91
-113.174.246.185
-113.174.26.182
+113.173.89.147
  113.175.134.34
  113.175.251.206
-113.176.118.54
  113.176.195.145
  113.176.58.77
  113.176.88.10
  113.176.88.18
  113.176.89.116
  113.177.185.199
+113.177.225.236
+113.177.239.100
  113.177.27.217
+113.178.34.242
+113.178.38.82
  113.178.56.181
-113.180.115.1
-113.180.229.136
-113.180.58.24
  113.181.20.41
+113.181.252.140
  113.181.26.60
  113.182.73.40
  113.182.79.77
  113.183.100.52
  113.183.114.179
  113.183.199.54
+113.183.96.163
  113.184.237.108
  113.184.58.239
  113.185.0.13
+113.185.19.134
  113.186.180.15
-113.186.19.88
  113.186.31.119
  113.186.95.254
  113.187.113.215
  113.188.101.28
+113.190.106.41
+113.190.123.58
  113.190.181.117
  113.190.189.100
+113.190.226.203
+113.190.227.77
  113.190.233.83
-113.190.234.34
  113.190.235.173
  113.190.235.39
  113.190.252.2
  113.190.252.217
  113.190.254.165
  113.190.254.245
+113.190.254.74
  113.190.255.158
  113.190.36.2
  113.190.40.199
@@ -12600,12 +12524,12 @@
  113.191.219.206
  113.193.200.2
  113.193.240.109
-113.194.128.81
-113.194.130.64
+113.193.246.53
+113.194.137.41
  113.194.30.175
  113.195.153.138
+113.195.163.17
  113.195.165.157
-113.195.165.77
  113.195.207.146
  113.20.108.40
  113.20.108.5
@@ -12615,6 +12539,7 @@
  113.203.199.227
  113.203.236.211
  113.203.238.130
+113.204.205.66
  113.205.138.153
  113.205.51.241
  113.206.196.43
@@ -12625,6 +12550,8 @@
  113.21.123.213
  113.21.231.98
  113.21.70.127
+113.210.111.166
+113.210.114.102
  113.212.162.155
  113.212.68.49
  113.212.69.0
@@ -13140,10 +13067,9 @@
  113.212.70.98
  113.212.70.99
  113.214.13.1
-113.214.28.246
  113.215.181.54
  113.218.168.197
-113.219.122.194
+113.219.200.7
  113.219.201.155
  113.22.146.5
  113.22.4.10
@@ -13154,24 +13080,29 @@
  113.229.114.221
  113.229.81.108
  113.23.144.50
-113.23.54.34
-113.231.41.37
+113.23.42.141
+113.231.40.121
  113.231.42.36
+113.231.46.62
  113.233.130.111
-113.237.130.78
-113.237.197.229
  113.237.248.231
+113.237.250.254
+113.237.252.180
  113.237.253.109
+113.237.253.253
  113.237.253.30
+113.237.254.97
  113.237.255.50
-113.237.255.80
  113.238.142.208
  113.24.57.84
  113.24.59.151
  113.240.184.183
  113.240.186.132
+113.240.238.170
+113.240.238.219
  113.243.130.13
  113.244.136.0
+113.245.185.27
  113.245.191.254
  113.246.243.65
  113.246.51.197
@@ -13180,10 +13111,11 @@
  113.247.250.238
  113.248.192.30
  113.249.197.33
-113.249.199.14
+113.249.198.110
  113.25.117.189
  113.252.222.73
  113.254.178.224
+113.254.89.177
  113.30.141.46
  113.30.66.24
  113.30.66.5
@@ -13193,6 +13125,7 @@
  113.31.104.8
  113.31.104.89
  113.31.105.250
+113.31.105.91
  113.31.107.34
  113.31.107.85
  113.31.109.63
@@ -13217,27 +13150,27 @@
  113.31.148.18
  113.31.152.36
  113.31.153.157
-113.36.142.98
  113.41.194.235
  113.52.122.6
  113.52.135.125
  113.53.107.11
  113.53.118.158
  113.53.121.31
-113.53.15.50
  113.53.150.166
  113.53.152.96
  113.53.154.32
+113.53.174.73
  113.53.180.69
  113.53.194.24
  113.53.21.236
  113.53.21.70
+113.53.22.188
+113.53.222.2
  113.53.223.100
  113.53.230.200
  113.53.231.198
  113.53.238.195
  113.53.247.221
-113.53.247.222
  113.53.255.222
  113.53.29.163
  113.53.29.218
@@ -13248,13 +13181,15 @@
  113.53.43.138
  113.53.47.192
  113.53.53.155
+113.53.60.107
  113.53.60.16
  113.53.60.224
+113.53.61.127
  113.53.61.214
  113.53.61.235
  113.53.61.78
-113.53.81.56
  113.53.82.157
+113.53.83.157
  113.53.83.210
  113.53.83.212
  113.53.89.73
@@ -13278,52 +13213,53 @@
  113.59.191.47
  113.59.224.130
  113.59.224.170
+113.60.202.175
  113.61.66.94
  113.65.108.121
-113.65.206.133
+113.65.108.33
+113.65.111.169
+113.65.205.221
  113.65.208.159
  113.65.21.108
  113.65.229.103
-113.65.229.67
+113.65.229.43
+113.65.67.164
  113.65.67.202
  113.66.124.152
-113.66.124.18
  113.66.41.128
  113.67.75.147
  113.68.142.196
  113.69.204.15
  113.69.204.220
-113.7.62.71
+113.72.122.209
  113.72.25.247
  113.74.26.114
  113.77.240.199
-113.81.232.8
-113.81.233.245
-113.81.9.249
+113.81.147.169
  113.87.130.254
  113.87.144.16
  113.87.145.248
  113.87.147.127
-113.87.165.143
-113.87.174.121
-113.87.91.127
-113.88.104.136
+113.87.181.137
+113.88.105.145
+113.88.107.32
  113.88.142.101
  113.88.165.120
-113.88.208.207
-113.88.38.171
-113.88.87.244
+113.88.208.241
+113.88.87.220
  113.89.245.151
-113.89.33.59
+113.89.32.20
+113.89.33.181
  113.89.35.69
-113.9.135.218
+113.89.52.208
  113.9.233.14
  113.90.177.238
  113.90.208.203
  113.90.208.239
  113.90.208.77
+113.90.211.192
  113.90.245.165
-113.92.197.181
+113.91.53.9
  113.93.224.56
  113.96.154.17
  113.96.154.24
@@ -13333,13 +13269,10 @@
  113.96.83.20
  113.96.83.25
  113.98.193.58
-113.98.62.154
  1133ko2.us-south.cf.appdomain.cloud
  1139.31cf4fdae.com
  114-results-realestate-properties-in-your-city.estate
-114.100.116.85
-114.101.250.177
-114.102.180.99
+114.100.117.178
  114.103.137.220
  114.103.87.100
  114.104.159.233
@@ -13357,8 +13290,8 @@
  114.110.21.50
  114.110.21.54
  114.112.161.155
-114.112.69.102
  114.112.70.150
+114.112.81.10
  114.113.225.121
  114.113.237.67
  114.113.238.11
@@ -13381,16 +13314,18 @@
  114.141.168.123
  114.141.196.221
  114.141.49.149
-114.141.52.251
  114.142.173.39
  114.143.100.102
  114.143.118.242
  114.143.230.186
  114.143.25.156
  114.173.201.110
+114.176.203.113
  114.179.127.48
  114.179.13.180
+114.191.186.28
  114.198.41.186
+114.199.112.138
  114.199.113.38
  114.199.113.78
  114.199.116.9
@@ -13398,26 +13333,33 @@
  114.199.159.159
  114.199.215.31
  114.201.54.70
+114.202.139.173
  114.204.218.154
  114.206.60.98
  114.207.139.203
  114.215.103.83
  114.215.184.51
+114.216.107.209
+114.216.164.174
+114.216.17.156
  114.216.17.245
-114.216.206.43
+114.216.49.163
  114.216.49.6
-114.217.105.222
-114.217.106.216
+114.218.121.243
+114.218.122.27
  114.218.217.235
+114.218.86.167
  114.219.116.116
  114.219.127.116
-114.219.154.119
-114.219.157.97
  114.219.18.147
+114.219.27.32
+114.219.27.63
  114.219.64.206
+114.220.101.202
+114.220.132.147
+114.220.164.206
  114.220.17.25
  114.220.26.198
-114.220.74.62
  114.221.86.115
  114.223.121.90
  114.223.48.158
@@ -13437,6 +13379,7 @@
  114.226.26.52
  114.226.26.61
  114.226.26.86
+114.226.35.35
  114.226.80.165
  114.226.81.133
  114.226.82.119
@@ -13453,7 +13396,6 @@
  114.227.111.45
  114.227.159.190
  114.227.159.30
-114.227.171.94
  114.227.26.138
  114.227.28.178
  114.227.30.70
@@ -13474,7 +13416,6 @@
  114.228.30.181
  114.228.31.101
  114.228.31.19
-114.228.54.111
  114.228.57.156
  114.228.63.106
  114.228.74.112
@@ -13493,7 +13434,13 @@
  114.23.254.130
  114.230.177.137
  114.230.177.227
+114.231.110.178
+114.231.111.29
  114.231.243.176
+114.231.42.86
+114.231.45.93
+114.231.46.251
+114.231.8.19
  114.232.176.199
  114.233.123.152
  114.233.153.177
@@ -13574,6 +13521,7 @@
  114.235.43.250
  114.235.5.102
  114.235.52.136
+114.235.57.15
  114.235.57.32
  114.235.7.118
  114.235.81.53
@@ -13585,7 +13533,6 @@
  114.236.20.161
  114.236.23.186
  114.237.134.156
-114.237.209.119
  114.238.167.163
  114.238.171.204
  114.238.212.247
@@ -13638,21 +13585,17 @@
  114.242.245.32
  114.242.68.28
  114.245.243.18
-114.246.34.145
  114.247.79.179
  114.247.84.127
-114.247.84.143
-114.247.84.147
+114.247.84.160
  114.247.84.161
  114.247.84.166
  114.247.84.171
-114.247.84.22
-114.247.84.241
+114.247.84.239
  114.247.84.246
  114.247.84.38
-114.247.84.41
+114.249.115.128
  114.25.133.159
-114.250.149.214
  114.27.160.69
  114.29.237.161
  114.29.237.99
@@ -13669,8 +13612,6 @@
  114.31.5.154
  114.32.205.167
  114.32.236.99
-114.32.31.1
-114.32.31.146
  114.32.89.199
  114.32.93.245
  114.33.206.143
@@ -13683,7 +13624,6 @@
  114.35.237.73
  114.35.44.253
  114.37.134.112
-114.37.134.213
  114.37.173.103
  114.37.173.123
  114.37.220.186
@@ -13700,14 +13640,17 @@
  114.45.101.18
  114.47.227.212
  114.47.71.79
+114.5.105.235
+114.5.129.174
+114.5.146.126
  114.5.195.226
  114.5.21.206
+114.5.211.21
  114.5.24.14
  114.5.35.98
  114.5.64.49
  114.5.98.30
  114.5.99.66
-114.55.171.1
  114.57.185.12
  114.57.189.130
  114.6.176.180
@@ -13741,7 +13684,6 @@
  114.67.253.227
  114.67.254.244
  114.67.68.255
-114.67.69.0
  114.67.72.164
  114.67.77.148
  114.67.77.150
@@ -13778,6 +13720,7 @@
  114.69.243.25
  114.69.243.253
  114.69.243.29
+114.69.243.5
  114.69.243.57
  114.69.243.65
  114.69.243.81
@@ -13786,7 +13729,6 @@
  114.69.244.210
  114.69.244.238
  114.69.244.66
-114.69.245.73
  114.69.249.161
  114.69.249.194
  114.69.32.65
@@ -13795,48 +13737,48 @@
  114.7.162.198
  114.7.162.6
  114.7.162.98
-114.7.165.150
  114.7.192.254
  114.7.194.132
  114.7.202.171
  114.7.96.177
  114.7.96.178
  114.7.97.193
+114.74.184.109
  114.77.56.186
-114.79.164.131
-114.79.188.185
+114.79.137.39
  114.80.156.113
-114.80.157.205
  114.80.96.138
+114.82.121.185
  114.84.212.242
  114.84.31.218
  114.86.88.138
  114.87.232.237
  114.88.182.89
  114.88.92.236
+114.93.37.186
  114.95.158.41
-114.98.231.143
-114.98.236.124
-114.99.10.23
+114.98.162.86
  114.99.10.238
-114.99.13.68
  114.99.130.109
  114.99.130.198
  114.99.130.224
  114.99.130.245
  114.99.131.229
  114.99.131.29
-114.99.14.105
-114.99.14.143
-114.99.16.231
+114.99.20.251
+114.99.21.1
+114.99.22.118
+114.99.3.85
+114.99.4.223
  114.99.5.48
-114.99.63.220
+114.99.9.241
  1147.org
  114oldest.com
  115.100.249.238
  115.111.91.67
  115.113.156.66
  115.124.102.10
+115.124.64.126
  115.124.64.234
  115.124.64.33
  115.124.66.82
@@ -13861,16 +13803,16 @@
  115.127.78.138
  115.127.92.179
  115.133.12.166
-115.133.243.120
  115.133.55.73
  115.134.128.90
  115.134.130.53
-115.134.151.149
+115.134.181.203
  115.134.184.104
  115.134.194.190
-115.134.237.192
  115.134.44.42
+115.134.58.173
  115.135.154.242
+115.135.237.142
  115.135.30.9
  115.135.93.107
  115.137.112.89
@@ -13880,13 +13822,8 @@
  115.144.238.94
  115.144.69.105
  115.146.122.237
-115.148.100.214
-115.148.72.216
-115.148.72.56
+115.146.184.150
  115.149.138.108
-115.150.106.8
-115.150.22.163
-115.150.22.236
  115.150.59.162
  115.159.0.160
  115.159.102.123
@@ -13896,9 +13833,10 @@
  115.159.112.66
  115.159.113.142
  115.159.114.146
+115.159.115.69
  115.159.117.250
-115.159.117.88
  115.159.118.95
+115.159.120.142
  115.159.120.232
  115.159.123.146
  115.159.124.199
@@ -13909,7 +13847,6 @@
  115.159.147.151
  115.159.149.106
  115.159.150.172
-115.159.151.171
  115.159.155.33
  115.159.157.126
  115.159.157.154
@@ -13922,7 +13859,6 @@
  115.159.199.238
  115.159.200.183
  115.159.201.15
-115.159.205.225
  115.159.206.101
  115.159.206.137
  115.159.208.207
@@ -13935,6 +13871,7 @@
  115.159.214.208
  115.159.216.109
  115.159.226.89
+115.159.23.54
  115.159.24.96
  115.159.25.60
  115.159.3.211
@@ -13947,9 +13884,9 @@
  115.159.44.135
  115.159.47.78
  115.159.48.34
-115.159.5.58
  115.159.56.151
  115.159.58.171
+115.159.62.220
  115.159.65.146
  115.159.65.25
  115.159.66.188
@@ -13957,6 +13894,8 @@
  115.159.67.200
  115.159.71.95
  115.159.76.52
+115.159.82.216
+115.159.83.182
  115.159.85.147
  115.159.90.137
  115.159.90.184
@@ -13967,35 +13906,32 @@
  115.160.242.62
  115.160.51.31
  115.164.201.95
-115.164.84.171
  115.165.135.210
  115.166.128.230
  115.167.65.238
  115.171.238.92
  115.171.238.92bin.sh
  115.178.103.226
+115.178.255.151
  115.178.98.62
  115.182.105.68
-115.186.147.208
-115.187.37.199
-115.187.40.156
+115.186.77.102
  115.187.45.172
-115.187.88.82
  115.195.214.241
-115.196.21.128
+115.196.239.150
  115.197.173.196
  115.197.83.141
  115.198.37.149
+115.20.236.75
  115.201.117.186
  115.201.37.74
  115.201.42.185
  115.201.47.10
-115.201.55.144
+115.201.47.172
  115.202.237.182
-115.202.87.191
  115.206.40.187
  115.206.60.63
-115.207.159.36
+115.207.170.249
  115.207.199.11
  115.207.9.109
  115.208.102.203
@@ -14006,17 +13942,21 @@
  115.208.22.147
  115.208.50.106
  115.208.81.156
+115.209.181.15
  115.21.224.117
  115.216.218.218
  115.216.26.149
+115.218.117.16
  115.22.82.128
  115.220.1.204
-115.220.157.20
  115.220.4.84
  115.220.59.32
  115.221.11.25
+115.221.15.170
  115.224.88.245
  115.226.151.6
+115.226.153.57
+115.227.237.10
  115.227.246.216
  115.229.249.129
  115.23.196.182
@@ -14038,6 +13978,7 @@
  115.236.67.42
  115.236.8.253
  115.236.89.211
+115.236.9.246
  115.238.37.132
  115.238.38.10
  115.238.61.222
@@ -14045,12 +13986,10 @@
  115.238.65.122
  115.238.75.13
  115.238.97.2
-115.239.161.134
  115.239.202.98
  115.239.226.46
  115.239.227.106
  115.239.76.67
-115.239.79.189
  115.241.1.66
  115.241.1.85
  115.243.116.202
@@ -14064,8 +14003,6 @@
  115.29.7.45
  115.38.178.51
  115.4.56.5
-115.42.121.222
-115.42.123.26
  115.42.127.133
  115.42.151.75
  115.42.32.106
@@ -14073,55 +14010,34 @@
  115.44.108.114
  115.45.104.103
  115.47.53.34
-115.48.132.113
-115.48.133.240
-115.48.147.72
-115.48.149.252
-115.48.180.233
-115.48.182.249
-115.48.188.10
-115.48.201.61
  115.48.46.61
-115.48.86.142
  115.49.210.221
  115.49.215.114
  115.49.227.139
-115.49.37.117
  115.49.37.204bin.sh
  115.49.72.68
  115.49.78.108
-115.49.79.203
  115.49.96.91
  115.49.97.55
  115.50.0.131
-115.50.128.33
  115.50.158.179
+115.50.162.20
  115.50.165.64
  115.50.187.9
-115.50.203.67
  115.50.219.28
-115.50.226.186
  115.50.247.130
-115.50.44.19
  115.50.56.92
-115.50.63.172
-115.50.72.150
-115.50.75.186
  115.50.92.156
  115.51.108.24
  115.51.110.122
-115.51.19.28
  115.51.47.80
  115.52.12.28
-115.52.17.159
  115.52.58.160
-115.53.226.169
+115.53.234.250
  115.54.129.10
  115.54.183.113
-115.54.198.41
  115.54.214.163
-115.54.239.241
-115.54.70.23
+115.54.77.138
  115.55.130.195
  115.55.130.55
  115.55.131.30
@@ -14132,7 +14048,6 @@
  115.55.149.197
  115.55.149.253
  115.55.150.245
-115.55.153.80
  115.55.153.83
  115.55.154.201
  115.55.156.206
@@ -14141,52 +14056,33 @@
  115.55.159.46
  115.55.159.76
  115.55.161.184
-115.55.177.28
-115.55.182.172
  115.55.202.175
  115.55.208.186
-115.55.242.81
  115.55.32.190
  115.55.41.246
  115.55.90.41
  115.56.114.233
  115.56.128.237
  115.56.129.141
-115.56.130.75
  115.56.130.85
  115.56.131.111
  115.56.131.72
  115.56.132.235
-115.56.134.247
  115.56.135.103bin.sh
  115.56.135.247
-115.56.136.22
-115.56.136.245
  115.56.137.47
-115.56.138.138
-115.56.138.249
  115.56.140.64
-115.56.141.87
-115.56.142.140
-115.56.142.66
  115.56.143.125
  115.56.143.13
-115.56.143.51
  115.56.146.213
  115.56.147.73
-115.56.153.206
  115.56.153.210bin.sh
-115.56.158.78
+115.56.159.146
  115.56.161.84
-115.56.178.159
-115.56.180.139
-115.56.181.204
  115.56.181.237
  115.56.182.87
  115.56.189.174
-115.56.191.28
  115.56.24.68
-115.56.24.92
  115.58.132.230
  115.58.132.6
  115.58.133.121
@@ -14194,56 +14090,36 @@
  115.58.141.145
  115.58.2.34
  115.58.209.70
-115.58.21.251
-115.58.4.122
-115.58.68.145
-115.59.164.168
-115.59.18.137
-115.59.193.178
  115.59.199.35
-115.59.202.88
  115.59.223.241
  115.59.230.79
  115.59.255.40
  115.59.76.195
  115.59.82.114
  115.60.201.21
+115.60.56.83
+115.60.62.153
+115.60.62.98
  115.61.10.132
  115.61.102.167
-115.61.103.60
-115.61.108.196
-115.61.110.213
-115.61.113.103
-115.61.114.44
-115.61.117.248
-115.61.118.77
  115.61.121.109
  115.61.137.57
  115.61.144.220
-115.61.187.154
  115.61.98.191
  115.62.134.206
  115.62.144.135
-115.62.144.234
-115.62.184.122
-115.63.134.112
  115.63.139.114
-115.63.148.75
-115.63.161.66
-115.63.183.92
  115.63.186.148
  115.63.189.176
  115.63.19.124
-115.63.36.253
-115.63.53.166
-115.66.110.249
+115.64.6.14
  115.66.180.253
  115.66.219.106
  115.68.109.9
  115.68.177.78
  115.68.182.197
-115.68.190.124
  115.68.2.144
+115.68.226.124
  115.68.232.221
  115.68.232.45
  115.68.49.169
@@ -14255,6 +14131,7 @@
  115.70.110.4
  115.70.122.100
  115.70.133.4
+115.70.147.199
  115.70.193.142
  115.70.208.17
  115.70.28.209
@@ -14262,26 +14139,29 @@
  115.71.237.56
  115.71.238.18
  115.71.239.208
+115.71.64.108
  115.72.129.67
  115.72.133.106
  115.72.133.213
+115.72.76.90
+115.72.80.127
  115.73.170.163
+115.73.210.213
  115.73.213.182
  115.73.213.31
  115.73.215.192
  115.73.35.105
-115.74.100.11
  115.74.17.157
-115.74.192.95
  115.74.217.2
+115.74.224.135
  115.75.1.184
  115.75.153.9
  115.75.154.248
  115.75.181.168
+115.75.211.0
  115.75.34.141
  115.75.60.151
  115.75.88.125
-115.75.88.151
  115.76.162.74
  115.76.164.44
  115.76.164.51
@@ -14294,52 +14174,42 @@
  115.76.173.130
  115.76.175.18
  115.76.175.191
+115.76.2.249
  115.76.50.105
  115.77.116.39
  115.77.187.194
-115.77.187.240
  115.77.188.228
  115.77.191.180
-115.77.28.140
-115.78.0.11
  115.78.1.222
-115.78.10.78
  115.78.126.92
-115.78.131.164
+115.78.131.73
  115.78.161.106
  115.78.225.232
  115.78.232.202
-115.78.238.164
-115.78.4.219
  115.78.9.145
  115.78.95.253
  115.78.96.99
  115.79.116.186
-115.79.137.56
-115.79.140.140
  115.79.195.246
-115.79.199.238
  115.79.208.56
  115.79.214.162
-115.79.219.195
  115.79.220.245
  115.79.220.47
  115.79.254.22
  115.79.35.110
  115.79.4.151
-115.79.54.34
-115.79.75.21
  115.79.80.195
  115.79.82.205
-115.79.86.127
  115.84.101.78
  115.84.112.138
  115.84.117.222
  115.84.121.30
  115.84.178.112
  115.84.235.77
+115.84.91.183
  115.84.91.211
  115.84.91.38
+115.84.92.133
  115.84.92.149
  115.84.92.198
  115.84.92.214
@@ -14347,6 +14217,7 @@
  115.84.92.51
  115.84.92.66
  115.84.96.40
+115.84.99.182
  115.84.99.3
  115.85.43.170
  115.85.53.91
@@ -14356,7 +14227,7 @@
  115.85.86.234
  115.85.86.235
  115.87.98.17
-115.87.99.103
+115.88.133.148
  115.88.138.251
  115.88.240.91
  115.88.60.251
@@ -14372,18 +14243,16 @@
  115.94.207.99
  115.95.173.174
  115.96.135.5
-115.97.234.135
  115.97.248.20
  115.97.31.199
-115.97.64.40
  115.97.83.137
+115.97.93.245
  115.98.0.71
  115.98.71.54
  115.99.115.105
  115.99.14.202
  115.99.148.82
  115.99.191.95
-115.99.226.224
  11515-dot-phonic-obelisk-274214.uk.r.appspot.com
  1152crump.com
  115video.com
@@ -14398,21 +14267,17 @@
  116.1.180.22
  116.100.121.12
  116.101.231.124
-116.102.173.194
  116.102.207.145
  116.102.246.157
-116.102.251.245
  116.103.131.197
  116.103.210.14
  116.103.242.236
  116.104.245.202
-116.104.66.25
  116.105.209.62
  116.105.210.84
  116.105.212.78
  116.105.213.98
  116.105.215.251
-116.105.216.83
  116.105.218.106
  116.105.218.253
  116.105.22.197
@@ -14428,9 +14293,10 @@
  116.106.19.152
  116.106.19.247
  116.106.38.67
-116.106.48.210
  116.108.12.204
+116.108.206.16
  116.109.110.147
+116.109.13.22
  116.110.100.208
  116.110.114.81
  116.110.144.68
@@ -14449,15 +14315,15 @@
  116.110.85.113
  116.110.93.52
  116.110.94.236
+116.111.168.118
+116.111.18.56
  116.111.219.152
  116.112.30.108
-116.112.92.5
  116.113.17.210
  116.113.180.183
  116.113.182.206
  116.114.19.204
  116.114.19.211
-116.114.30.62
  116.114.95.100
  116.114.95.104
  116.114.95.108
@@ -14511,7 +14377,6 @@
  116.116.109.84
  116.116fddw.top
  116.12.180.236
-116.12.194.243
  116.12.50.133
  116.12.51.206
  116.12.52.141
@@ -14521,6 +14386,7 @@
  116.122.158.207
  116.122.36.61
  116.122.38.203
+116.124.109.151
  116.124.219.2
  116.124.233.101
  116.125.120.88
@@ -14533,16 +14399,13 @@
  116.131.212.180
  116.132.221.30
  116.132.47.50
-116.138.146.91
-116.139.151.134
+116.14.127.88
  116.14.148.129
+116.14.194.244
  116.14.46.58
  116.14.5.223
  116.14.61.160
-116.14.68.85
-116.149.118.222
  116.149.119.209
-116.149.169.119
  116.149.195.56bin.sh
  116.149.201.215bin.sh
  116.149.240.210
@@ -14552,9 +14415,7 @@
  116.149.243.161
  116.149.247.125
  116.149.247.146
-116.15.150.144
  116.15.189.70
-116.15.5.204
  116.154.20.15
  116.177.178.206
  116.177.179.202
@@ -14567,20 +14428,18 @@
  116.179.149.121
  116.179.32.153
  116.179.32.204
+116.179.32.205
  116.179.32.232
-116.179.32.31
  116.179.32.36
-116.179.32.41
  116.179.32.46
-116.179.32.79
  116.179.32.96
  116.193.142.224
  116.193.172.237
  116.193.216.209
  116.193.218.18
+116.193.221.220
  116.193.76.112
  116.196.101.168
-116.196.119.146
  116.196.69.144
  116.196.82.45
  116.196.85.150
@@ -14603,8 +14462,6 @@
  116.199.172.213
  116.199.172.29
  116.199.174.1
-116.2.166.6
-116.2.40.134
  116.2.64.96
  116.202.0.237
  116.202.10.123
@@ -14638,7 +14495,6 @@
  116.203.128.117
  116.203.143.6
  116.203.144.63
-116.203.147.190
  116.203.147.199
  116.203.151.175
  116.203.152.66
@@ -14647,6 +14503,7 @@
  116.203.200.229
  116.203.203.28
  116.203.205.103
+116.203.208.213
  116.203.211.9
  116.203.221.74
  116.203.230.250
@@ -14660,9 +14517,10 @@
  116.203.47.157
  116.203.60.216
  116.203.61.61
+116.203.71.118
  116.203.75.230
-116.203.9.247
  116.203.92.131
+116.204.181.192
  116.206.151.6
  116.206.177.50
  116.206.233.10
@@ -14683,18 +14541,16 @@
  116.21.244.30
  116.212.131.174
  116.212.152.30
-116.212.155.227
  116.212.66.214
  116.213.52.200
  116.213.52.252
  116.213.52.253
-116.22.28.123
  116.22.29.39
-116.22.49.159
-116.22.49.39
  116.22.51.76
  116.22.75.89
+116.226.171.111
  116.226.171.78
+116.226.243.45
  116.228.114.182
  116.228.196.210
  116.228.233.91
@@ -14703,15 +14559,16 @@
  116.231.35.17
  116.232.151.47
  116.232.31.11
+116.232.5.11
  116.232.81.158
  116.233.111.157
+116.233.209.68
  116.233.21.177
  116.233.87.190
  116.234.93.136
  116.236.243.130
  116.236.55.10
  116.236.60.114
-116.236.74.78
  116.236.91.34
  116.237.116.205
  116.237.139.23
@@ -14720,13 +14577,13 @@
  116.238.33.160
  116.239.27.145
  116.239.4.130
-116.24.56.41
-116.24.58.130
-116.24.65.88
+116.24.64.32
+116.24.65.212
  116.24.66.70
+116.24.67.38
  116.240.199.84
-116.246.19.2
  116.247.81.99
+116.25.227.162
  116.251.12.150
  116.251.211.12
  116.252.80.181
@@ -14734,6 +14591,7 @@
  116.254.124.110
  116.255.10.118
  116.255.129.3
+116.255.156.229
  116.255.163.100
  116.255.175.72
  116.255.207.231
@@ -14743,13 +14601,12 @@
  116.26.113.138
  116.26.114.6
  116.26.229.35
-116.26.73.42
  116.27.149.212
  116.43.244.112
  116.48.136.128
+116.48.232.124
  116.49.242.133
  116.52.1.211
-116.52.144.172
  116.52.9.220
  116.52.98.50
  116.54.31.118
@@ -14760,6 +14617,7 @@
  116.58.227.40
  116.58.232.110
  116.58.232.152
+116.58.232.157
  116.58.232.207
  116.58.232.219
  116.58.232.241
@@ -14770,7 +14628,6 @@
  116.58.235.18
  116.58.235.69
  116.58.239.120
-116.58.247.102
  116.58.247.118
  116.58.247.234
  116.58.247.244
@@ -14783,11 +14640,11 @@
  116.58.247.85
  116.58.251.85
  116.58.254.176
-116.58.254.21
  116.58.254.40
  116.58.43.35
  116.58.78.254
  116.58.9.10
+116.59.25.189
  116.59.25.190
  116.59.25.192
  116.59.25.196
@@ -14797,9 +14654,11 @@
  116.6.18.115
  116.6.192.200
  116.6.84.60
+116.62.102.247
  116.62.11.138
  116.62.133.112
  116.62.229.19
+116.62.51.6
  116.62.58.18
  116.66.191.161
  116.66.191.217
@@ -14815,6 +14674,8 @@
  116.68.194.61
  116.68.196.209
  116.68.207.233
+116.68.254.122
+116.68.254.94
  116.68.96.10
  116.68.96.129
  116.68.96.130
@@ -14825,12 +14686,12 @@
  116.68.96.62
  116.68.96.90
  116.68.97.102
-116.68.97.128
  116.68.97.171
  116.68.97.172
  116.68.97.20
  116.68.98.129
  116.68.98.168
+116.68.98.184
  116.68.98.207
  116.68.98.33
  116.68.98.80
@@ -14839,6 +14700,8 @@
  116.68.99.163
  116.68.99.218
  116.68.99.82
+116.7.11.11
+116.7.11.225
  116.71.243.172
  116.72.0.99
  116.72.133.129
@@ -14848,19 +14711,20 @@
  116.73.66.179
  116.74.112.79
  116.74.17.255
-116.74.178.167
  116.74.223.188
  116.74.51.122
  116.75.103.58
  116.75.117.40bin.sh
+116.75.167.62
+116.75.196.216
  116.75.34.61
-116.76.240.151
  116.85.13.82
  116.85.26.21
  116.85.38.29
  116.85.41.190
  116.85.46.54
  116.85.66.176
+116.85.70.114
  116.85.71.133
  116.86.166.199
  116.89.17.246
@@ -14876,7 +14740,6 @@
  116.92.213.114
  116.92.219.162
  116.94.131.109
-116.97.163.69
  116.97.215.102
  116.97.53.76
  116.97.71.249
@@ -14890,13 +14753,14 @@
  116.98.171.61
  116.98.174.124
  116.98.175.252
+116.99.42.158
  116151147136715.002.sh.cn
  1164e4989ededf518a4.yolasite.com
  1169732-dot-phonic-obelisk-274214.uk.r.appspot.com
-117.0.187.150
  117.0.23.142
  117.1.153.251
  117.1.16.131
+117.10.232.19
  117.102.102.155
  117.102.104.44
  117.102.107.154
@@ -14910,34 +14774,34 @@
  117.102.127.130
  117.102.16.22
  117.102.224.38
-117.102.70.3
  117.102.77.2
  117.102.77.204
  117.102.82.42
  117.102.82.43
  117.102.82.44
  117.102.82.46
-117.102.84.142
+117.102.85.162
  117.102.86.174
  117.102.87.138
+117.102.94.148
  117.102.97.162
  117.103.5.186
  117.103.6.238
+117.103.68.86
  117.103.86.62
  117.104.181.164
  117.107.193.98
  117.107.213.244
-117.107.213.246
  117.107.213.251
  117.11.228.132
  117.114.138.246
  117.119.83.121
-117.12.52.164
  117.12.67.73
  117.120.7.93
  117.121.202.44
  117.121.204.80
  117.121.215.101
+117.121.227.82
  117.123.171.105
  117.123.58.217
  117.127.16.205
@@ -14959,7 +14823,6 @@
  117.141.253.80
  117.141.6.222
  117.144.189.69
-117.146.48.172
  117.149.10.58
  117.149.20.18
  117.155.115.90
@@ -14967,7 +14830,6 @@
  117.157.24.3
  117.158.107.107
  117.158.151.7
-117.158.198.130
  117.158.208.68
  117.158.62.70
  117.158.65.219
@@ -14977,41 +14839,39 @@
  117.169.16.206
  117.172.253.135
  117.172.79.4
-117.173.67.119
  117.176.195.87
  117.18.4.157
  117.18.5.133
  117.18.65.22
+117.180.221.5
  117.184.169.94
  117.186.244.210
  117.186.247.34
  117.186.96.54
+117.187.141.223
  117.192.116.161
-117.192.227.62
-117.192.36.105
-117.192.46.40
-117.192.51.63
+117.192.227.140
  117.192.8.86
-117.193.162.210
  117.193.77.254
-117.194.148.240
-117.194.149.168
-117.194.159.186
-117.194.161.17
-117.194.165.43
-117.194.181.157
+117.194.129.246
+117.194.161.136
+117.194.164.151
+117.194.166.69
+117.194.245.182
+117.195.189.139
  117.195.240.9
-117.196.138.61
+117.196.131.209
  117.196.228.229
  117.196.229.176
-117.196.234.163
  117.196.235.106
  117.196.236.56
  117.196.237.22
  117.196.237.92
  117.196.239.128
  117.196.239.165
+117.196.48.206
  117.196.50.168
+117.196.51.205
  117.196.9.86
  117.197.102.195
  117.197.118.141
@@ -15027,31 +14887,38 @@
  117.197.62.244
  117.198.218.70
  117.198.97.220
+117.2.1.227
+117.2.1.234
+117.2.1.240
  117.2.120.221
  117.2.133.106
  117.2.139.117
  117.2.142.64
  117.2.144.249
  117.2.165.12
-117.2.165.159
+117.2.166.22
  117.2.22.85
  117.2.92.195
  117.20.192.45
  117.20.202.61
  117.20.204.5
+117.20.207.53
  117.20.230.39
  117.20.56.203
  117.200.48.82
  117.200.48.94
-117.200.73.79
  117.201.226.45
  117.201.228.221
+117.201.228.82
+117.201.246.49
  117.202.20.66
  117.202.20.68
  117.202.20.70
-117.202.64.38
-117.202.68.103
-117.202.71.236
+117.202.67.141
+117.202.68.211
+117.202.69.155
+117.202.70.147
+117.202.71.214
  117.202.8.55
  117.204.252.122
  117.204.252.223
@@ -15059,7 +14926,6 @@
  117.204.253.240
  117.204.253.89
  117.204.254.153
-117.204.255.73
  117.205.13.189
  117.206.149.225
  117.206.152.182
@@ -15068,11 +14934,8 @@
  117.206.159.20
  117.206.83.142
  117.207.149.225
-117.208.1.225
-117.208.1.31
-117.208.120.89
+117.208.135.151
  117.210.144.80
-117.210.181.85
  117.210.209.147
  117.210.210.199
  117.211.126.11
@@ -15081,44 +14944,34 @@
  117.211.160.32
  117.211.166.168
  117.211.192.70
+117.211.44.175
+117.212.144.138
  117.212.146.114
+117.212.194.71
  117.212.89.125
-117.213.114.180
  117.213.119.103
+117.213.202.5
  117.213.240.156
-117.213.40.248
-117.213.41.28
-117.213.45.105
-117.213.45.146
-117.213.47.154
+117.213.41.114
+117.213.43.145
+117.213.46.158
  117.214.123.217
  117.214.4.217
-117.215.136.149
-117.215.209.54
  117.215.224.138
-117.215.249.242
  117.215.71.67
-117.217.171.246
+117.216.72.75
+117.217.194.26
  117.217.69.3
  117.218.245.194
  117.22.144.21
-117.22.76.92
-117.22.77.229
  117.220.15.119
  117.220.171.105
  117.220.171.209
  117.220.171.246
-117.220.203.36
  117.220.220.112
-117.222.161.188
-117.222.161.245
-117.222.162.216
-117.222.164.105
-117.222.164.226
-117.222.166.127
-117.222.166.172
-117.222.168.58
-117.222.170.52
+117.222.167.47
+117.222.171.39
+117.222.172.81
  117.222.61.200
  117.222.62.222
  117.223.25.51
@@ -15128,17 +14981,15 @@
  117.239.153.219
  117.239.209.24
  117.239.226.81
-117.239.226.85
  117.239.240.202
  117.239.39.51
  117.239.79.246
-117.240.166.51
  117.240.238.230
  117.240.28.81
  117.240.59.115
  117.241.170.49
  117.241.248.188
-117.241.65.104
+117.241.64.189
  117.241.67.241
  117.241.98.1
  117.242.147.101
@@ -15150,108 +15001,100 @@
  117.242.188.82
  117.242.188.84
  117.242.188.86
-117.242.208.198
-117.242.208.204
-117.242.209.128
+117.242.209.214
  117.242.210.154
  117.242.211.82
  117.242.36.173
  117.242.38.163
  117.242.39.208
  117.247.179.136
+117.247.200.24
+117.247.201.28
+117.247.202.177
  117.247.203.214
-117.247.205.40
-117.247.206.241
-117.247.207.134
-117.247.211.73
+117.247.207.198
+117.247.207.244
  117.247.236.51
  117.247.238.10
  117.247.86.58
  117.248.162.157
  117.248.248.19
-117.248.62.101
  117.25.145.151
  117.25.154.164
  117.251.200.50
  117.251.56.44
-117.251.59.32
+117.251.57.126
+117.251.58.201
+117.251.58.41
+117.251.59.54
+117.251.63.106
  117.252.16.12
  117.252.208.13
  117.252.209.32
  117.252.210.254
-117.252.212.166
  117.252.212.253
  117.252.214.154
  117.252.214.67
  117.252.216.47
  117.252.217.144
-117.252.221.10
  117.252.221.63
  117.252.222.29
  117.252.223.233
  117.252.27.186
  117.252.64.78
-117.252.65.156
  117.252.65.210
  117.252.66.20
  117.252.66.209
  117.252.66.95
-117.252.67.128
  117.252.68.92
+117.252.70.229
  117.252.71.200
-117.253.140.107
  117.253.175.52
  117.253.232.181
  117.254.186.98
  117.254.56.62
  117.254.57.106
+117.254.59.1
  117.254.59.40
+117.254.86.42
  117.255.220.201
  117.26.105.26
-117.26.110.59
  117.26.179.26
+117.26.231.200
  117.26.241.93
+117.26.76.136
  117.26.88.25
  117.26.88.38
  117.27.139.39
  117.27.147.135
-117.28.157.207
+117.27.88.61
  117.28.251.178
  117.28.254.143
  117.3.100.178
-117.3.151.156
-117.3.170.243
  117.33.225.111
-117.33.6.67
  117.34.105.233
  117.34.109.218
  117.34.117.155
-117.34.99.31
  117.35.109.122
  117.35.118.42
  117.4.107.199
  117.4.113.14
-117.4.115.212
  117.4.122.171
  117.4.136.11
  117.4.139.62
  117.4.145.16
-117.4.165.21
-117.4.176.180
  117.4.241.135
  117.4.243.116
  117.40.159.249
  117.40.195.2
+117.40.199.89
  117.40.91.118
-117.41.38.18
  117.42.141.192
  117.44.60.39
  117.48.234.141
  117.5.136.42
  117.5.136.85
-117.5.146.140
  117.5.147.174
-117.5.160.239
  117.50.1.141
  117.50.110.19
  117.50.118.171
@@ -15271,13 +15114,11 @@
  117.50.25.153
  117.50.3.175
  117.50.31.176
-117.50.34.131
  117.50.36.137
  117.50.36.250
+117.50.4.106
  117.50.42.55
-117.50.43.204
  117.50.45.241
-117.50.49.57
  117.50.55.132
  117.50.60.36
  117.50.63.120
@@ -15289,13 +15130,12 @@
  117.50.65.238
  117.50.82.6
  117.50.88.9
+117.50.9.112
  117.50.92.209
  117.50.92.35
  117.50.97.244
-117.50.98.209
  117.51.137.82
  117.51.140.220
-117.51.140.252
  117.51.142.47
  117.51.150.202
  117.51.157.210
@@ -15304,7 +15144,6 @@
  117.52.96.99
  117.53.45.125
  117.54.112.22
-117.54.12.99
  117.54.13.174
  117.54.130.66
  117.54.200.134
@@ -15317,31 +15156,31 @@
  117.55.209.126
  117.55.232.193
  117.55.241.179
-117.55.241.61
+117.57.63.10
  117.58.240.177
  117.58.245.114
  117.58.245.66
  117.58.247.20
  117.6.128.250
-117.6.132.1
+117.6.133.159
  117.6.161.118
  117.6.165.250
  117.6.196.195
-117.6.241.62
  117.6.79.105
  117.6.86.134
  117.6.99.108
-117.60.152.62
+117.60.187.193
  117.60.187.94
  117.60.20.136
  117.60.204.195
+117.60.212.119
  117.60.239.70
  117.60.25.22
  117.60.8.16
  117.60.8.52
  117.60.8.70
-117.61.16.195
  117.62.89.163
+117.63.134.164
  117.63.136.142
  117.63.156.234
  117.63.158.101
@@ -15351,25 +15190,16 @@
  117.63.195.220
  117.63.223.200
  117.63.242.60
+117.63.248.198
  117.63.250.181
-117.63.251.110
  117.63.252.68
-117.63.252.7
  117.63.252.77
  117.63.253.215
-117.63.254.87
-117.63.255.109
  117.63.51.128
-117.64.225.57
-117.65.1.114
-117.65.1.118
-117.68.195.185
-117.69.188.203
-117.69.231.125
-117.69.231.151
-117.7.221.82
+117.64.146.35
+117.64.152.196
+117.65.1.22
  117.7.236.110
-117.7.52.55
  117.74.120.224
  117.74.121.65
  117.74.122.114
@@ -15377,36 +15207,34 @@
  117.74.45.247
  117.74.98.18
  117.76.1.113
+117.78.11.15
  117.79.132.166
  117.79.80.90
  117.79.80.93
  117.79.80.94
  117.80.116.213
  117.80.147.217
-117.80.167.20
-117.80.176.77
+117.80.167.118
+117.80.167.27
  117.80.212.113
  117.80.224.192
  117.80.225.245
  117.80.3.170
-117.81.139.73
-117.81.151.16
  117.81.151.44
  117.81.207.141
  117.81.242.138
-117.81.64.52
-117.82.37.234
+117.82.254.127
  117.82.37.38
+117.82.70.69
+117.82.79.157
  117.83.122.37
-117.83.81.126
  117.83.81.145
-117.83.81.28
+117.83.83.235
  117.84.114.39
  117.84.146.251
  117.84.173.184
-117.84.59.64
-117.84.90.41
-117.84.91.126
+117.84.59.93
+117.84.91.140
  117.85.89.213
  117.86.212.189
  117.86.24.209
@@ -15415,6 +15243,7 @@
  117.87.131.192
  117.87.132.39
  117.87.135.201
+117.87.166.130
  117.87.167.100
  117.87.170.216
  117.87.170.57
@@ -15435,8 +15264,10 @@
  117.87.72.142
  117.88.151.152
  117.88.173.4
+117.89.102.127
  117.89.131.169
  117.89.90.62
+117.9.136.103
  117.90.119.186
  117.90.119.63
  117.90.128.14
@@ -15446,11 +15277,11 @@
  117.90.20.196
  117.90.21.59
  117.90.254.53
-117.90.4.102
  117.90.75.236
  117.90.89.195
  117.90.89.95
  117.90.94.211
+117.92.203.200
  117.92.45.234
  117.93.114.188
  117.93.118.225
@@ -15468,7 +15299,6 @@
  117.94.50.123
  117.95.132.49
  117.95.160.220
-117.95.168.211
  117.95.173.102
  117.95.173.117
  117.95.173.64
@@ -15487,20 +15317,23 @@
  117.95.233.139
  117.95.32.19
  117.95.83.122
-117.96.200.193
-117.98.191.34
-117.99.81.32
+117.96.197.205
  117.ip-51-178-82.eu
  11716-45741.ws4.pph-server.de
  1171j.projectsbit.org
  1177857-dot-n-e-w-me-ss-age-po-rt-al.wl.r.appspot.com
  117cbf81fba6f4aaa4363ed99db7fce674427f2d.info
  118.100.134.71
-118.100.134.8
  118.101.125.64
+118.101.153.139
  118.101.192.62
  118.101.192.81
+118.101.245.222
+118.101.36.12
+118.101.66.203
  118.102.168.199
+118.103.136.63
+118.103.236.117
  118.103.253.35
  118.107.12.23
  118.107.14.227
@@ -15512,9 +15345,10 @@
  118.113.87.89
  118.113.95.60
  118.114.164.246
-118.116.107.247
-118.116.108.29
-118.116.108.48
+118.116.105.177
+118.116.105.25
+118.116.106.168
+118.116.106.9
  118.116.8.215
  118.120.145.eliterv.ca
  118.121.57.64
@@ -15523,6 +15357,7 @@
  118.122.118.189
  118.122.38.61
  118.122.73.137
+118.122.77.193
  118.122.77.22
  118.123.11.175
  118.123.244.100
@@ -15532,11 +15367,8 @@
  118.126.100.131
  118.126.105.207
  118.126.109.155
-118.126.116.101
  118.126.117.168
  118.126.65.74
-118.126.82.220
-118.126.90.104
  118.126.90.89
  118.126.97.108
  118.126.97.184
@@ -15563,7 +15395,6 @@
  118.145.4.109
  118.145.8.50
  118.151.210.242
-118.156.88.132
  118.160.230.91
  118.160.84.81
  118.161.159.142
@@ -15574,25 +15405,19 @@
  118.163.13.200
  118.163.40.56
  118.163.47.37
-118.163.65.59
-118.163.68.115
  118.163.74.160
-118.163.74.161
  118.163.80.67
  118.163.91.125
-118.163.91.247
  118.163.97.19
-118.168.10.58
  118.168.9.38
-118.169.241.131
  118.169.40.146
  118.169.44.151
+118.169.87.185
  118.169.87.95
  118.169.90.79
  118.17.46.169
  118.171.136.250
  118.171.139.9
-118.172.0.165
  118.172.124.116
  118.172.124.35
  118.172.135.51
@@ -15600,8 +15425,8 @@
  118.172.145.103
  118.172.147.135
  118.172.159.223
-118.172.163.253
  118.172.17.189
+118.172.17.231
  118.172.181.147
  118.172.185.158
  118.172.191.36
@@ -15609,11 +15434,11 @@
  118.172.201.32
  118.172.201.49
  118.172.201.5
+118.172.201.80
  118.172.201.89
  118.172.215.17
  118.172.217.42
  118.172.228.150
-118.172.239.110
  118.172.28.4
  118.172.41.120
  118.172.44.175
@@ -15626,6 +15451,7 @@
  118.172.58.225
  118.172.58.38
  118.172.59.43
+118.172.60.41
  118.172.74.253
  118.172.83.49
  118.172.97.120
@@ -15638,14 +15464,12 @@
  118.173.149.130
  118.173.156.191
  118.173.158.168
-118.173.159.141
-118.173.162.136
-118.173.164.72
  118.173.180.9
  118.173.183.108
-118.173.184.235
  118.173.197.241
  118.173.210.221
+118.173.213.53
+118.173.213.90
  118.173.217.217
  118.173.219.25
  118.173.223.81
@@ -15663,18 +15487,21 @@
  118.173.233.37
  118.173.233.39
  118.173.233.80
-118.173.235.129
+118.173.64.134
+118.173.72.183
  118.174.121.101
  118.174.130.5
  118.174.156.49
-118.174.162.5
  118.174.172.13
  118.174.175.204
  118.174.188.81
  118.174.189.92
+118.174.196.112
  118.174.196.130
  118.174.196.250
  118.174.196.86
+118.174.202.48
+118.174.204.16
  118.174.209.119
  118.174.209.96
  118.174.211.220
@@ -15686,7 +15513,6 @@
  118.174.219.203
  118.174.219.21
  118.174.219.220
-118.174.219.60
  118.174.219.66
  118.174.219.69
  118.174.220.14
@@ -15724,12 +15550,10 @@
  118.175.207.205
  118.175.207.84
  118.175.229.9
-118.175.235.109
  118.175.235.129
  118.175.235.251
  118.175.235.3
  118.175.236.208
-118.175.242.68
  118.175.244.111
  118.175.30.205
  118.175.7.114
@@ -15751,13 +15575,12 @@
  118.178.143.209
  118.178.20.28
  118.179.102.210
-118.179.121.203
  118.179.168.190
  118.179.168.202
+118.179.173.253
  118.179.200.131
  118.179.208.162
  118.179.55.190
-118.179.60.62
  118.180.48.4
  118.180.63.84
  118.181.226.166
@@ -15771,6 +15594,7 @@
  118.185.130.194
  118.185.131.177
  118.185.159.137
+118.185.208.3
  118.185.38.153
  118.186.227.161
  118.188.20.229
@@ -15780,7 +15604,6 @@
  118.19.126.68
  118.190.2.195
  118.190.204.209
-118.190.60.24
  118.193.151.250
  118.193.151.253
  118.193.151.51
@@ -15807,13 +15630,12 @@
  118.193.41.84
  118.193.42.99
  118.193.45.149
+118.193.45.28
  118.193.47.131
  118.193.58.125
-118.200.225.155
  118.200.233.232
  118.200.233.57
  118.200.237.7
-118.200.26.234
  118.200.41.3
  118.202.255.141
  118.208.221.92
@@ -15827,7 +15649,6 @@
  118.213.176.234
  118.217.183.234
  118.217.216.132
-118.219.114.141
  118.219.254.105
  118.220.255.156
  118.221.200.196
@@ -15836,18 +15657,17 @@
  118.233.221.162
  118.233.63.194
  118.233.63.194bin.sh
-118.233.65.93
-118.236.182.168
  118.24.1.9
  118.24.100.198
  118.24.101.196
+118.24.101.35
  118.24.102.189
  118.24.104.38
  118.24.104.55
  118.24.106.210
-118.24.106.33
  118.24.107.179
  118.24.108.239
+118.24.108.75
  118.24.109.221
  118.24.109.222
  118.24.114.205
@@ -15855,12 +15675,10 @@
  118.24.115.74
  118.24.118.97
  118.24.119.36
-118.24.119.45
  118.24.12.102
  118.24.123.136
  118.24.123.34
  118.24.124.59
-118.24.125.81
  118.24.126.55
  118.24.128.112
  118.24.13.153
@@ -15886,8 +15704,6 @@
  118.24.202.34
  118.24.208.24
  118.24.211.170
-118.24.212.114
-118.24.214.45
  118.24.219.30
  118.24.219.84
  118.24.22.5
@@ -15928,7 +15744,6 @@
  118.24.97.147
  118.241.9.15
  118.243.22.87
-118.243.222.122
  118.249.206.100
  118.249.56.206
  118.25.1.48
@@ -15938,7 +15753,6 @@
  118.25.11.153
  118.25.11.8
  118.25.111.131
-118.25.12.187
  118.25.125.187
  118.25.129.131
  118.25.133.121
@@ -15948,13 +15762,10 @@
  118.25.144.105
  118.25.144.49
  118.25.155.104
-118.25.182.118
  118.25.182.61
  118.25.184.174
  118.25.192.122
  118.25.195.237
-118.25.195.244
-118.25.196.31
  118.25.2.109
  118.25.2.60
  118.25.21.149
@@ -15973,7 +15784,6 @@
  118.25.27.67
  118.25.3.65
  118.25.35.202
-118.25.39.110
  118.25.44.66
  118.25.47.17
  118.25.48.241
@@ -15997,11 +15807,11 @@
  118.250.0.166
  118.250.49.91
  118.255.57.210
-118.26.165.41
  118.26.65.146
  118.27.1.40
  118.27.103.153
  118.27.109.218
+118.27.109.64
  118.27.11.126
  118.27.110.122
  118.27.113.79
@@ -16049,6 +15859,7 @@
  118.27.80.233
  118.27.80.234
  118.27.9.23
+118.31.110.45
  118.31.164.48
  118.31.187.234
  118.31.52.208
@@ -16074,19 +15885,18 @@
  118.42.206.206
  118.42.233.90
  118.43.114.17
-118.44.163.171
  118.45.190.163
  118.45.190.167
  118.47.161.102
-118.5.218.189
  118.67.201.40
  118.67.216.94
  118.67.217.41
  118.67.249.115
-118.68.165.46
-118.68.231.250
+118.68.186.164
+118.68.37.100
  118.69.128.181
  118.69.161.67
+118.69.173.199
  118.69.183.237
  118.69.186.170
  118.69.195.215
@@ -16094,64 +15904,52 @@
  118.69.225.124
  118.69.226.194
  118.69.228.63
-118.69.233.138
  118.69.50.154
  118.69.56.68
  118.69.61.212
+118.69.61.254
  118.69.63.217
  118.69.68.186
-118.69.82.233
-118.70.109.119
  118.70.109.152
  118.70.12.171
  118.70.128.136
  118.70.129.93
-118.70.151.157
+118.70.165.84
  118.70.169.210
  118.70.170.120
  118.70.171.49
-118.70.176.200
  118.70.180.189
  118.70.183.188
-118.70.184.13
  118.70.196.124
  118.70.21.132
  118.70.213.14
  118.70.220.116
  118.70.233.163
  118.70.233.206
+118.70.67.161
  118.70.72.103
-118.70.80.170
+118.70.81.186
  118.70.81.207
  118.71.120.218
-118.71.169.180
  118.71.244.226
  118.71.253.20
  118.75.119.214
  118.75.184.240
  118.75.190.221
-118.75.193.128
  118.75.46.196
  118.75.48.151
-118.75.60.124
-118.75.68.141
  118.76.143.108
  118.79.145.69
  118.79.146.100
  118.79.146.190
  118.79.146.212
-118.79.163.147
-118.79.163.206
-118.79.217.110
-118.79.220.45
+118.79.178.134
  118.79.226.198
-118.79.236.32
  118.79.237.9
  118.79.238.200
  118.79.4.250
  118.79.57.139
  118.79.58.128
-118.79.61.232
  118.79.74.237
  118.79.75.183
  118.81.81.171
@@ -16169,7 +15967,6 @@
  118.89.157.234
  118.89.160.141
  118.89.162.187
-118.89.163.105
  118.89.164.55
  118.89.167.33
  118.89.173.215
@@ -16197,14 +15994,15 @@
  118.89.52.173
  118.89.61.51
  118.89.65.15
-118.89.66.102
  118.89.78.206
  118.89.91.134
  118.91.175.210
  118.91.228.30
+118.92.112.214
  118.92.41.104
  118.93.57.249
  118.96.244.2
+118.96.55.145
  118.97.100.83
  118.97.107.65
  118.97.108.18
@@ -16221,7 +16019,6 @@
  118.97.204.93
  118.97.221.211
  118.97.224.2
-118.97.23.108
  118.97.235.234
  118.97.237.171
  118.97.247.186
@@ -16240,39 +16037,38 @@
  118.98.233.226
  118.98.90.22
  118.98.96.184
-118.99.100.108
  118.99.100.109
+118.99.100.17
+118.99.100.194
+118.99.100.244
  118.99.103.131
  118.99.104.144
  118.99.104.15
-118.99.104.156
  118.99.104.158
-118.99.104.7
  118.99.108.60
  118.99.109.25
+118.99.109.34
  118.99.109.94
  118.99.118.15
  118.99.122.11
  118.99.122.153
+118.99.122.173
  118.99.122.221
  118.99.122.34
  118.99.122.35
  118.99.122.45
  118.99.122.5
-118.99.122.94
  118.99.28.130
+118.99.65.168
  118.99.65.170
  118.99.65.172
-118.99.65.174
  118.99.65.176
  118.99.65.182
  118.99.65.188
-118.99.67.186
  118.99.67.86
  118.99.83.32
  118.99.88.107
  118.99.90.130
-118.99.94.220
  118.99.94.254
  118.99.94.91
  118.99.95.137
@@ -16280,6 +16076,7 @@
  118.99.95.186
  118.99.95.86
  118.99.98.199
+118.99.98.24
  118.99.99.27
  1184-ulster-plume.com
  1187consulting.com
@@ -16288,7 +16085,6 @@
  119-18-62-120.cprapid.com
  119.1.209.98
  119.10.114.137
-119.10.116.177
  119.10.177.2
  119.10.177.5
  119.10.177.90
@@ -16303,45 +16099,41 @@
  119.110.204.62
  119.110.205.66
  119.110.96.195
-119.113.255.245
-119.115.0.6
-119.115.1.235
  119.115.128.2
  119.115.18.175
-119.115.18.195
-119.115.20.161
  119.115.21.204
+119.115.24.8
  119.115.25.159
-119.115.26.162
-119.115.28.243
  119.115.30.174
-119.115.30.22
-119.115.4.68
+119.115.31.0
+119.115.4.6
  119.115.5.75
-119.117.25.41
+119.115.7.142
+119.115.7.230
+119.117.25.76
  119.117.29.11
  119.121.6.127
  119.122.113.100
+119.122.90.215
  119.123.0.184
-119.123.102.194
+119.123.100.72
  119.123.127.30
  119.123.175.179
  119.123.176.129
-119.123.209.184
  119.123.216.96
-119.123.217.207
-119.123.217.248
  119.123.219.176
+119.123.222.146
  119.123.227.151
-119.123.238.177
-119.123.238.233
  119.123.244.77
+119.123.72.39
  119.125.129.86
  119.126.157.231
-119.126.157.5
+119.126.24.243
+119.126.25.45
  119.130.165.143
-119.135.101.13
  119.136.112.51
+119.136.196.156
+119.136.90.198
  119.146.131.247
  119.146.223.48
  119.147.137.79
@@ -16355,18 +16147,19 @@
  119.15.89.106
  119.15.93.38
  119.15.95.158
+119.152.56.128
+119.152.60.32
+119.152.62.95
+119.153.139.5
  119.153.45.167
  119.155.138.229
-119.155.239.45
+119.155.138.230
  119.155.53.38
-119.157.241.23
  119.159.150.176
  119.160.172.201
  119.160.218.110
  119.160.66.31
  119.161.137.20
-119.162.166.253
-119.162.207.34
  119.162.65.162
  119.162.65.247
  119.163.196.146
@@ -16377,7 +16170,6 @@
  119.164.89.226
  119.165.107.65
  119.165.135.100
-119.165.15.15
  119.165.165.210
  119.165.201.170
  119.165.226.221
@@ -16388,10 +16180,7 @@
  119.166.123.13
  119.166.145.234
  119.166.154.237
-119.166.164.51
  119.166.169.115
-119.166.170.241
-119.166.19.254
  119.166.196.21
  119.166.226.110
  119.166.247.214bin.sh
@@ -16403,35 +16192,29 @@
  119.167.18.7
  119.167.2.49
  119.167.21.135
-119.167.26.225
  119.167.31.210
  119.167.41.123
  119.167.44.96
  119.17.142.230
+119.17.151.226
  119.17.151.61
+119.17.221.61
  119.176.0.121
  119.176.202.206
  119.176.95.121
-119.178.144.102
-119.178.155.49
  119.178.178.79
-119.178.202.229
-119.178.222.235
  119.178.223.40
  119.178.240.159
  119.178.246.244
  119.179.119.79
  119.179.150.233
-119.179.153.191
-119.179.155.190
  119.179.165.18
  119.179.170.212
  119.179.18.206
-119.179.208.163
-119.179.223.116
  119.179.240.167
+119.179.240.233
  119.179.240.9
-119.179.247.96
+119.179.247.64
  119.18.146.139
  119.18.147.125
  119.18.147.81
@@ -16466,72 +16249,49 @@
  119.180.108.79
  119.180.134.107
  119.180.204.103
-119.180.241.61
  119.180.32.217
-119.180.5.228
  119.180.54.118
  119.180.57.115
  119.181.53.224
  119.181.54.70
  119.182.60.251
  119.182.67.204
-119.182.69.58
-119.183.103.185
  119.183.123.28
  119.183.14.177
  119.183.18.102
  119.183.46.127
  119.183.47.246
  119.183.47.246bin.sh
-119.183.5.48
  119.183.54.121
  119.183.7.242
-119.184.14.112
-119.184.154.129
-119.184.4.122
  119.184.48.147bin.sh
  119.184.53.56
  119.185.149.74
  119.185.153.86
  119.185.155.1
-119.185.34.47
-119.186.12.78
  119.186.15.123
-119.186.226.183
  119.186.46.241
-119.187.105.177
-119.187.105.31
  119.187.129.48
  119.187.146.163
  119.187.205.80
-119.187.234.75
  119.187.235.23
-119.187.236.225
-119.187.236.84
  119.187.239.228
  119.187.29.196
  119.187.63.132
  119.187.74.180
  119.187.77.195
+119.188.116.69
  119.188.241.186
  119.188.3.66
  119.189.129.35
-119.189.167.145
  119.189.181.172
-119.189.199.222
  119.189.201.50bin.sh
  119.189.207.105
-119.189.207.75
  119.189.221.157
-119.190.125.199
  119.190.144.131
-119.190.155.134
  119.190.180.197
-119.190.191.46
-119.190.204.189
  119.190.216.70
  119.190.240.25
-119.190.244.216
  119.190.247.205
  119.190.64.150
  119.191.177.243
@@ -16541,9 +16301,8 @@
  119.191.200.208
  119.191.206.251
  119.191.207.68
-119.191.229.239
-119.192.141.109
  119.193.152.87
+119.193.209.98
  119.193.33.206
  119.194.214.43
  119.194.240.249
@@ -16553,17 +16312,17 @@
  119.195.9.174
  119.195.9.174bin.sh
  119.196.115.20
-119.196.148.156
  119.196.216.112
  119.196.216.112bin.sh
-119.196.245.62
  119.196.99.80bin.sh
  119.197.143.204
  119.197.175.60
  119.197.176.105
  119.197.176.241
  119.197.66.173
+119.197.84.239
  119.198.43.18
+119.198.57.168
  119.198.87.162
  119.199.155.17bin.sh
  119.199.156.76
@@ -16583,10 +16342,10 @@
  119.200.186.168
  119.200.30.137
  119.200.33.222
-119.200.73.32
  119.201.68.12
  119.202.76.160
  119.204.96.131
+119.205.6.189
  119.205.95.101
  119.206.255.171
  119.206.62.129
@@ -16609,26 +16368,23 @@
  119.235.30.89
  119.235.48.177
  119.235.48.34
-119.235.49.61
  119.235.49.81
  119.235.50.26
  119.235.50.8
  119.235.51.241
  119.235.54.45
+119.236.65.163
  119.237.6.135
-119.242.92.124
  119.243.95.62
  119.245.138.143
  119.246.154.102
  119.246.156.63
  119.246.39.250
-119.247.161.177
  119.249.16.203
  119.249.17.101
-119.250.239.244
-119.251.106.204
  119.251.177.128
  119.252.143.6
+119.252.160.165
  119.252.169.173
  119.254.155.187
  119.254.155.39
@@ -16637,7 +16393,6 @@
  119.27.165.49
  119.27.166.193
  119.27.167.61
-119.27.172.62
  119.27.173.25
  119.27.174.181
  119.27.179.51
@@ -16653,6 +16408,7 @@
  119.28.113.246
  119.28.128.121
  119.28.128.79
+119.28.130.167
  119.28.132.211
  119.28.136.26
  119.28.137.106
@@ -16664,7 +16420,6 @@
  119.28.156.31
  119.28.159.34
  119.28.16.131
-119.28.160.192
  119.28.163.72
  119.28.164.144
  119.28.164.149
@@ -16695,12 +16450,12 @@
  119.28.4.87
  119.28.44.92
  119.28.46.187
-119.28.47.109
  119.28.49.192
  119.28.5.109
  119.28.5.17
  119.28.5.66
  119.28.5.69
+119.28.5.72
  119.28.51.32
  119.28.54.131
  119.28.55.223
@@ -16710,6 +16465,7 @@
  119.28.61.162
  119.28.61.72
  119.28.65.231
+119.28.68.78
  119.28.7.224
  119.28.71.231
  119.28.72.244
@@ -16732,7 +16488,6 @@
  119.28.93.152
  119.29.0.60
  119.29.1.141
-119.29.1.163
  119.29.102.152
  119.29.11.213
  119.29.110.249
@@ -16753,6 +16508,7 @@
  119.29.151.107
  119.29.155.214
  119.29.158.241
+119.29.159.20
  119.29.16.190
  119.29.160.205
  119.29.161.236
@@ -16761,11 +16517,13 @@
  119.29.167.254
  119.29.168.187
  119.29.17.204
+119.29.170.202
  119.29.170.235
  119.29.171.249
  119.29.173.247
  119.29.174.91
  119.29.177.222
+119.29.18.112
  119.29.18.39
  119.29.18.76
  119.29.180.74
@@ -16821,12 +16579,11 @@
  119.29.87.251
  119.29.91.153
  119.29.91.228
-119.29.91.38
-119.29.93.25
  119.29.98.53
  119.3.203.174
  119.3.208.236
  119.3.237.67
+119.39.18.237
  119.39.54.6
  119.4.225.31
  119.4.229.15
@@ -16837,17 +16594,20 @@
  119.40.83.250
  119.40.92.17
  119.41.170.248
-119.41.196.204
-119.41.202.123
+119.41.193.46
+119.41.205.204
  119.41.236.180
-119.41.236.32
+119.42.108.196
+119.42.114.123
+119.42.115.19
  119.42.115.64
+119.42.117.4
  119.42.121.111
  119.42.121.134
  119.42.121.174
+119.42.121.181
  119.42.121.21
  119.42.121.234
-119.42.121.239
  119.42.121.61
  119.42.121.69
  119.42.121.76
@@ -16855,13 +16615,15 @@
  119.42.122.105
  119.42.122.109
  119.42.122.113
-119.42.122.122
  119.42.122.127
  119.42.122.133
+119.42.122.137
+119.42.122.151
  119.42.122.153
  119.42.122.17
  119.42.122.198
  119.42.122.204
+119.42.122.217
  119.42.122.236
  119.42.122.38
  119.42.122.47
@@ -16870,12 +16632,12 @@
  119.42.122.81
  119.42.123.117
  119.42.123.122
+119.42.123.127
  119.42.123.131
  119.42.123.132
-119.42.123.143
+119.42.123.146
  119.42.123.150
  119.42.123.183
-119.42.123.184
  119.42.123.192
  119.42.123.220
  119.42.123.228
@@ -16883,7 +16645,7 @@
  119.42.123.253
  119.42.123.32
  119.42.123.72
-119.42.123.77
+119.42.123.81
  119.42.126.191
  119.42.144.162
  119.42.161.254
@@ -16895,7 +16657,6 @@
  119.42.176.46
  119.42.178.6
  119.42.67.126
-119.42.67.158
  119.42.67.177
  119.42.67.20
  119.42.67.215
@@ -16904,14 +16665,14 @@
  119.42.67.73
  119.42.67.76
  119.42.70.186
+119.42.70.247
  119.42.70.254
-119.42.70.6
  119.42.70.61
+119.42.72.181
  119.42.72.251
-119.42.73.16
+119.42.73.226
  119.42.73.78
  119.42.79.139
-119.42.80.120
  119.42.80.152
  119.42.80.158
  119.42.80.162
@@ -16921,10 +16682,12 @@
  119.42.80.25
  119.42.80.38
  119.42.80.45
+119.42.80.56
+119.42.80.76
+119.42.80.79
  119.42.86.153
  119.42.86.254
  119.42.86.52
-119.42.88.240
  119.42.95.106
  119.42.96.43
  119.42.99.125
@@ -16965,7 +16728,7 @@
  119.45.149.173
  119.45.15.27
  119.45.154.156
-119.45.156.93
+119.45.156.190
  119.45.157.238
  119.45.159.172
  119.45.159.220
@@ -16979,15 +16742,14 @@
  119.45.175.143
  119.45.176.133
  119.45.177.202
-119.45.177.219
  119.45.178.112
  119.45.178.210
  119.45.181.168
  119.45.183.194
  119.45.183.209
  119.45.184.182
+119.45.184.52
  119.45.185.224
-119.45.186.155
  119.45.186.186
  119.45.186.49
  119.45.187.183
@@ -17010,11 +16772,11 @@
  119.45.195.57
  119.45.199.177
  119.45.199.200
+119.45.201.244
  119.45.202.43
  119.45.203.170
  119.45.206.237
  119.45.206.254
-119.45.207.191
  119.45.208.191
  119.45.208.92
  119.45.209.222
@@ -17060,7 +16822,6 @@
  119.45.246.61
  119.45.248.137
  119.45.250.197
-119.45.250.223
  119.45.252.106
  119.45.254.116
  119.45.254.159
@@ -17079,6 +16840,7 @@
  119.45.41.248
  119.45.42.241
  119.45.43.139
+119.45.43.28
  119.45.43.61
  119.45.43.86
  119.45.45.185
@@ -17112,7 +16874,7 @@
  119.45.63.87
  119.45.8.125
  119.45.9.65
-119.46.2.243
+119.46.2.242
  119.46.2.244
  119.46.2.246
  119.46.2.249
@@ -17139,12 +16901,10 @@
  119.56.199.35
  119.56.238.145
  119.56.239.38
-119.57.117.248
  119.57.117.249
  119.57.162.18
  119.57.17.20
  119.57.247.86
-119.59.103.119
  119.59.116.21
  119.59.121.163
  119.59.124.163
@@ -17171,13 +16931,14 @@
  119.76.190.126
  119.77.105.115
  119.8.34.6
+119.8.8.237
  119.81.115.90
  119.81.115.92
  119.81.184.27
  119.81.80.58
-119.82.135.244
  119.82.141.18
  119.82.242.58
+119.82.245.162
  119.82.249.4
  119.82.251.250
  119.82.252.1
@@ -17196,8 +16957,7 @@
  119.84.128.40
  119.84.8.43
  119.86.145.140
-119.86.18.205
-119.86.19.64
+119.86.150.207
  119.88.176.134
  119.9.110.100
  119.9.110.234
@@ -17213,7 +16973,6 @@
  119.9.72.162
  119.9.74.76
  119.9.75.6
-119.92.138.162
  119.92.243.101
  119.92.72.169
  119.92.77.17
@@ -17221,7 +16980,6 @@
  119.93.123.229
  119.93.128.46
  119.93.129.34
-119.93.131.165
  119.93.148.103
  119.93.175.133
  119.93.213.231
@@ -17229,16 +16987,19 @@
  119.93.235.205
  119.93.52.24
  119.93.90.155
+119.94.100.183
  119.94.166.6
  119.95.76.22
  119.96.118.100
  119.96.131.17
-119.96.158.238
+119.96.134.76
  119.96.171.162
  119.96.172.152
+119.96.175.184
  119.96.175.244
  119.96.178.132
  119.96.192.249
+119.96.193.238
  119.96.200.248
  119.96.213.68
  119.96.227.154
@@ -17286,18 +17047,19 @@
  12.179.46.6
  12.182.181.129
  12.183.171.36
-12.186.163.3
  12.186.206.84
  12.188.54.30
  12.189.124.50
  12.191.193.202
  12.192.33.18
+12.199.218.242
  12.20.165.35
  12.215.14.204
  12.218.209.130
  12.219.211.130
  12.229.155.122
  12.229.215.19
+12.229.217.226
  12.231.109.141
  12.232.141.28
  12.232.141.29
@@ -17309,13 +17071,14 @@
  12.53.219.68
  12.89.124.138
  120.0.218.125
-120.12.129.104
+120.1.65.64
  120.12.149.242
  120.131.1.97
  120.131.14.125
  120.131.3.191
  120.131.3.91
  120.131.9.167
+120.132.103.67
  120.132.105.211
  120.132.106.211
  120.132.12.162
@@ -17336,7 +17099,6 @@
  120.138.19.16
  120.142.173.160
  120.142.222.22
-120.142.88.222
  120.144.161.12
  120.148.59.93
  120.150.216.161
@@ -17345,15 +17107,13 @@
  120.150.60.189
  120.151.90.157
  120.155.25.147
-120.155.72.14
  120.155.88.8
  120.157.105.208
  120.157.105.208bin.sh
  120.17.187.30
+120.188.36.194
  120.188.83.80
  120.193.155.140
-120.193.179.86
-120.193.225.237
  120.193.91.177
  120.193.91.177bin.sh
  120.193.91.178
@@ -17394,7 +17154,7 @@
  120.193.91.233
  120.193.93.227
  120.194.83.99
-120.195.23.27
+120.195.40.210
  120.195.65.124
  120.196.182.41
  120.196.182.41bin.sh
@@ -17438,7 +17198,6 @@
  120.221.160.3
  120.224.129.4
  120.224.223.66
-120.229.72.140
  120.232.150.110
  120.232.175.244
  120.234.138.100
@@ -17456,29 +17215,17 @@
  120.236.255.120
  120.237.118.139
  120.237.156.248
-120.239.196.0
-120.239.196.111
-120.239.196.14
-120.239.196.17
-120.239.196.19
-120.239.196.23
-120.239.196.27
-120.239.196.3
-120.239.196.4
-120.239.196.52
-120.239.196.58
-120.239.196.59
-120.239.196.74
-120.239.196.80
-120.239.196.85
-120.239.196.87
-120.239.196.99
+120.239.196.22
+120.239.196.42
+120.239.196.5
+120.239.196.65
+120.239.196.69
  120.24.148.204
  120.24.155.11
  120.24.40.26
  120.24.70.214
  120.240.95.154
-120.244.127.3
+120.240.95.157
  120.246.124.254
  120.25.156.28
  120.25.231.102
@@ -17494,14 +17241,18 @@
  120.26.53.205
  120.26.66.53
  120.27.114.140
+120.27.133.211
  120.27.153.72
+120.27.239.245
+120.27.253.138
+120.27.94.253
  120.28.109.188
  120.28.110.61
  120.28.196.200
  120.28.201.50
+120.28.227.5
  120.28.36.59
  120.28.45.202
-120.28.45.45
  120.28.90.188
  120.29.125.240
  120.29.158.158
@@ -17511,13 +17262,15 @@
  120.31.71.238
  120.33.137.113
  120.34.164.7
+120.34.17.194
  120.35.26.129
+120.38.46.81
  120.38.5.219
-120.4.148.94
-120.4.157.4
  120.40.130.70
  120.43.128.99
+120.48.1.167
  120.48.12.238
+120.48.12.77
  120.48.13.82
  120.48.16.20
  120.48.16.217
@@ -17529,6 +17282,7 @@
  120.48.21.157
  120.48.21.252
  120.48.21.80
+120.48.22.116
  120.48.22.137
  120.48.23.46
  120.48.25.100
@@ -17542,7 +17296,6 @@
  120.48.31.121
  120.48.31.123
  120.48.31.140
-120.48.31.193
  120.48.31.80
  120.48.4.5
  120.48.7.156
@@ -17563,17 +17316,17 @@
  120.52.93.191
  120.52.93.223
  120.53.0.176
-120.53.1.97
  120.53.10.17
  120.53.10.40
  120.53.108.58
  120.53.118.140
-120.53.121.167
  120.53.121.178
  120.53.122.208
+120.53.122.66
  120.53.2.190
  120.53.21.151
  120.53.21.174
+120.53.222.157
  120.53.223.186
  120.53.223.202
  120.53.225.81
@@ -17590,7 +17343,6 @@
  120.53.240.203
  120.53.243.163
  120.53.244.247
-120.53.247.204
  120.53.251.82
  120.53.27.188
  120.53.28.165
@@ -17601,13 +17353,10 @@
  120.57.33.11
  120.57.96.224
  120.59.16.52
-120.6.150.170
  120.6.151.191
  120.6.186.201
  120.6.191.231
-120.6.209.177
  120.6.233.250
-120.6.240.130
  120.6.4.196
  120.6.4.64
  120.63.135.40
@@ -17621,7 +17370,6 @@
  120.69.88.106
  120.69.89.50
  120.7.115.0
-120.7.163.249
  120.7.192.80
  120.7.224.2
  120.70.100.13
@@ -17629,20 +17377,23 @@
  120.70.102.16
  120.70.102.239
  120.70.98.132
+120.70.98.195
  120.71.13.11
  120.71.145.166
  120.71.145.189
-120.71.145.209
-120.71.146.45
+120.71.145.254
+120.71.146.217
  120.71.147.115
+120.71.147.93
  120.71.7.203
+120.74.20.225
  120.76.219.77
+120.76.244.212
+120.76.251.205
  120.77.145.154
  120.77.253.219
  120.77.36.28
  120.78.144.149
-120.78.168.214
-120.78.186.9
  120.78.2.215
  120.78.4.233
  120.78.67.152
@@ -17657,15 +17408,13 @@
  120.79.218.202
  120.79.222.140
  120.79.226.20
+120.79.254.57
  120.79.48.236
-120.79.53.218
  120.79.92.64
  120.8.111.160
  120.82.116.30
  120.82.116.6
  120.82.117.168
-120.83.107.78
-120.84.9.60
  120.85.112.176
  120.85.112.243
  120.85.112.49
@@ -17673,15 +17422,17 @@
  120.85.113.127
  120.85.116.14
  120.85.117.192
+120.85.167.146
+120.85.173.121
  120.85.91.134
  120.85.91.172
+120.85.92.181
  120.85.93.26
  120.85.93.34
  120.85.94.151
  120.88.165.53
  120.88.46.226
  120.89.74.73
-120.9.139.110
  120.92.10.24
  120.92.109.67
  120.92.11.9
@@ -17741,11 +17492,11 @@
  121.101.214.54
  121.102.98.35
  121.105.215.185
+121.11.110.200
  121.11.98.127
  121.111.247.200
  121.119.179.133
-121.119.75.179
-121.12.80.140
+121.12.209.83
  121.120.80.170
  121.121.149.168
  121.121.56.241
@@ -17770,7 +17521,7 @@
  121.130.29.11
  121.130.29.21
  121.131.193.143
-121.132.111.247
+121.131.97.136
  121.132.215.233
  121.132.251.243
  121.134.159.21
@@ -17784,7 +17535,6 @@
  121.135.237.32
  121.136.176.71
  121.136.180.124
-121.137.103.81
  121.137.138.140
  121.139.172.133
  121.139.172.4
@@ -17793,9 +17543,12 @@
  121.139.204.101
  121.139.218.165
  121.139.69.202
+121.14.150.116
  121.140.0.70
  121.140.118.26
+121.141.125.213
  121.141.34.205
+121.141.52.15
  121.142.57.233
  121.142.87.218
  121.143.159.232
@@ -17804,6 +17557,7 @@
  121.144.185.39
  121.148.170.225
  121.148.244.119
+121.149.104.142
  121.149.121.199bin.sh
  121.15.142.137
  121.15.2.178
@@ -17825,6 +17579,7 @@
  121.155.156.93bin.sh
  121.155.247.168
  121.156.126.101
+121.157.34.63
  121.157.82.202
  121.159.101.230
  121.159.53.15
@@ -17832,26 +17587,24 @@
  121.159.95.49
  121.16.144.186
  121.160.164.83
-121.160.43.196
  121.161.20.13
  121.161.20.97
  121.161.35.243
-121.163.48.44
+121.161.9.56
  121.163.94.158
-121.164.212.211
  121.165.140.242
  121.165.225.81
  121.165.73.157
  121.167.147.172
+121.167.7.141
  121.168.185.22
-121.168.38.75
  121.168.8.232
  121.169.110.121
  121.169.110.121bin.sh
  121.169.222.192
  121.17.100.154
  121.17.210.114
-121.170.188.119
+121.170.126.54
  121.170.19.103
  121.170.8.145
  121.171.166.170
@@ -17865,28 +17618,28 @@
  121.177.236.148
  121.178.193.2
  121.178.231.89
+121.178.247.49
  121.179.41.48
-121.18.137.2
  121.18.88.186
  121.180.106.112
  121.180.106.112bin.sh
-121.180.151.59
  121.182.142.213
  121.183.75.145
  121.184.131.249
  121.184.19.115
+121.184.20.170
+121.184.232.195
  121.186.193.6
  121.188.43.201
  121.189.111.104bin.sh
  121.190.102.21
  121.190.192.77
-121.190.90.64
  121.191.47.134
  121.196.12.93
  121.196.147.20
  121.196.155.249
+121.196.157.135
  121.196.33.118
-121.196.44.230
  121.196.59.48
  121.199.9.251
  121.20.202.25
@@ -17894,7 +17647,6 @@
  121.200.48.98
  121.201.121.195
  121.201.124.176
-121.201.124.251
  121.201.125.98
  121.201.26.46
  121.201.45.212
@@ -17908,8 +17660,12 @@
  121.201.93.66
  121.201.94.17
  121.201.95.106
+121.201.95.17
  121.201.95.66
+121.201.97.104
+121.201.97.105
  121.203.221.85
+121.204.107.133
  121.204.134.41
  121.204.148.63
  121.204.164.89
@@ -17920,10 +17676,11 @@
  121.208.84.203
  121.21.92.217
  121.211.20.23
+121.211.201.98
  121.215.45.82
  121.222.102.237
+121.224.241.92
  121.224.77.121
-121.224.82.237
  121.225.24.18
  121.226.131.122
  121.226.131.146
@@ -17945,13 +17702,15 @@
  121.226.85.10
  121.226.94.109
  121.227.153.232
-121.227.252.224
+121.227.216.97
+121.227.236.95
  121.227.31.13
-121.229.19.200
+121.227.89.47
+121.228.89.251
  121.229.20.84
  121.229.55.245
  121.229.62.94
-121.23.235.168
+121.229.63.151
  121.23.88.92
  121.230.155.64
  121.230.211.141
@@ -17965,10 +17724,9 @@
  121.231.101.42
  121.231.102.55
  121.231.11.67
-121.231.13.195
  121.231.164.108
-121.231.8.1
  121.231.83.134
+121.231.9.253
  121.232.148.133
  121.232.179.201
  121.232.39.129bin.sh
@@ -17989,7 +17747,7 @@
  121.233.15.177
  121.233.16.42
  121.233.17.27
-121.233.18.185
+121.233.18.97
  121.233.19.170
  121.233.21.123
  121.233.3.207
@@ -17999,26 +17757,27 @@
  121.233.73.82
  121.234.244.186
  121.234.46.5
-121.235.146.76
+121.235.146.59
+121.235.147.114
+121.235.195.27
  121.235.46.19
  121.236.175.251
  121.236.58.120
+121.237.140.151
  121.237.225.11bin.sh
  121.238.187.203
+121.239.170.148
  121.239.203.27
  121.239.22.25
-121.239.8.151
+121.239.8.143
  121.240.212.2
  121.241.244.92
  121.241.90.242
  121.242.232.157
  121.244.147.176
-121.244.213.182
  121.245.174.107
-121.25.140.225
  121.25.148.55
  121.25.204.174
-121.25.62.163
  121.25.78.196
  121.254.153.195
  121.254.172.27
@@ -18030,6 +17789,8 @@
  121.30.208.197
  121.30.41.41
  121.32.150.82
+121.32.49.144
+121.32.50.228
  121.32.88.181
  121.33.220.158
  121.33.237.102
@@ -18042,6 +17803,8 @@
  121.4.108.157
  121.4.111.232
  121.4.112.248
+121.4.114.46
+121.4.115.2
  121.4.12.6
  121.4.120.131
  121.4.121.128
@@ -18053,12 +17816,13 @@
  121.4.125.93
  121.4.13.16
  121.4.133.10
-121.4.136.65
  121.4.138.185
  121.4.146.164
+121.4.173.250
  121.4.176.113
  121.4.189.112
  121.4.192.114
+121.4.195.133
  121.4.196.9
  121.4.201.201
  121.4.201.38
@@ -18068,7 +17832,6 @@
  121.4.220.175
  121.4.26.93
  121.4.29.160
-121.4.30.187
  121.4.30.232
  121.4.31.168
  121.4.31.241
@@ -18092,25 +17855,25 @@
  121.4.46.37
  121.4.46.5
  121.4.47.140
-121.4.48.221
-121.4.49.146
  121.4.49.180
  121.4.49.216
  121.4.50.217
  121.4.51.142
  121.4.51.174
+121.4.51.7
  121.4.52.144
  121.4.53.226
  121.4.54.111
  121.4.54.117
-121.4.55.205
  121.4.56.32
  121.4.56.34
  121.4.58.20
  121.4.59.90
  121.4.61.150
+121.4.61.38
  121.4.61.64
  121.4.61.65
+121.4.66.32
  121.4.67.224
  121.4.68.147
  121.4.68.192
@@ -18140,38 +17903,35 @@
  121.4.97.211
  121.4.99.174
  121.40.105.124
-121.40.105.78
  121.40.128.99
  121.40.141.226
  121.40.162.239
  121.40.203.142
  121.40.51.48
  121.40.66.129
-121.41.24.64
-121.42.38.56
  121.42.8.157
  121.42.9.57
  121.43.153.120
  121.43.163.43
  121.43.186.155
  121.43.189.248
-121.45.81.77
+121.46.24.108
  121.46.244.194
  121.46.26.126
  121.46.26.17
  121.46.4.194
  121.48.165.2
+121.5.19.14
  121.5.19.193
  121.5.26.106
  121.5.3.212
-121.5.31.43
  121.5.36.65
  121.5.50.79
  121.5.55.30
  121.5.55.53
  121.5.57.208
  121.5.57.54
-121.5.58.19
+121.5.60.185
  121.5.60.195
  121.5.61.96
  121.5.62.146
@@ -18180,16 +17940,15 @@
  121.5.64.249
  121.5.66.217
  121.5.66.62
+121.5.68.249
  121.5.68.96
  121.5.70.57
  121.5.71.75
  121.5.72.122
  121.5.72.228
-121.5.9.203
  121.52.132.186
  121.52.154.36
  121.52.154.98
-121.52.159.141
  121.52.66.102
  121.54.164.151
  121.54.168.251
@@ -18200,11 +17959,10 @@
  121.55.117.24
  121.58.195.140
  121.58.212.108
-121.58.236.11
  121.58.243.202
  121.58.243.204
+121.58.244.89
  121.58.246.247
-121.6.157.198
  121.6.197.13
  121.6.219.179
  121.61.102.201
@@ -18217,7 +17975,6 @@
  121.61.72.170
  121.61.78.91
  121.61.99.128
-121.62.219.167
  121.63.82.89
  121.63.82.89bin.sh
  121.65.173.82
@@ -18227,7 +17984,10 @@
  121.66.35.37
  121.67.246.152
  121.69.44.6
+121.69.96.249
  121.7.33.161
+121.74.66.67
+121.75.138.13
  121.75.218.237
  121.78.116.203
  121.78.116.209
@@ -18237,14 +17997,12 @@
  121.78.236.175
  121.78.60.134
  121.8.146.99
-121.8.28.34
  121.88.4.141
  121.88.4.74
  121.89.193.102
  121.89.194.147
  121.9.252.250
  121.94.25.152
-121.96.41.242
  121.98.205.102
  121.99.28.126
  121008.yolasite.com
@@ -18261,19 +18019,18 @@
  122.102.43.82
  122.109.101.160
  122.11.148.38
+122.11.169.35
  122.114.111.220
  122.114.149.176
  122.114.154.58
  122.114.166.8
  122.114.177.150
-122.114.177.164
+122.114.223.66
  122.114.228.98
  122.114.246.149
-122.114.254.33
  122.114.37.11
  122.114.4.186
  122.114.4.187
-122.114.5.135
  122.114.5.37
  122.114.65.210
  122.114.70.12
@@ -18288,6 +18045,7 @@
  122.115.51.155
  122.116.104.129
  122.116.104.238
+122.116.123.203
  122.116.233.207
  122.116.41.237
  122.116.90.171
@@ -18303,13 +18061,11 @@
  122.14.209.13
  122.14.209.40
  122.14.210.163
-122.14.217.58
  122.14.222.202
  122.14.250.28
-122.142.236.67
+122.141.177.112
  122.144.212.144
  122.144.221.149
-122.144.4.106
  122.146.196.217
  122.15.131.65
  122.15.82.90
@@ -18326,11 +18082,14 @@
  122.152.52.94
  122.152.55.71
  122.153.212.195
+122.154.113.133
  122.154.141.244
  122.154.142.74
  122.154.148.234
  122.154.151.202
+122.154.162.2
  122.154.251.22
+122.154.253.129
  122.154.42.38
  122.154.56.18
  122.154.57.100
@@ -18348,23 +18107,28 @@
  122.155.223.59
  122.155.223.9
  122.155.7.117
+122.155.7.196
  122.155.9.169
  122.156.219.212
  122.16.180.244
  122.160.112.27
  122.160.147.53
  122.160.167.170
-122.160.31.101
+122.160.45.216
  122.160.61.100
  122.160.99.22
  122.161.194.250
  122.161.196.254
-122.162.137.248
-122.162.240.181
-122.163.176.17
+122.163.111.22
+122.163.118.189
+122.163.242.145
+122.164.179.157
+122.164.215.49
+122.164.218.153
  122.164.228.33
  122.165.149.75
  122.165.194.191
+122.165.197.103
  122.165.20.209
  122.165.206.136
  122.165.207.151
@@ -18372,6 +18136,7 @@
  122.166.192.97
  122.166.216.212
  122.166.237.117
+122.167.43.52
  122.168.178.60
  122.169.114.254
  122.169.9.126
@@ -18380,17 +18145,17 @@
  122.170.4.50
  122.170.5.123
  122.170.71.33
+122.171.226.55
+122.173.57.168
  122.174.12.93
-122.174.181.141
-122.174.236.171
-122.174.54.70
+122.174.233.242
  122.175.197.166
-122.175.47.71
  122.176.101.76
+122.176.122.231
  122.176.169.143
  122.176.21.39
+122.176.249.188
  122.176.28.104
-122.176.34.6
  122.176.49.139
  122.176.55.24
  122.176.56.5
@@ -18399,27 +18164,29 @@
  122.176.87.177
  122.177.43.26
  122.178.115.118
+122.178.2.98
  122.180.246.91
  122.180.254.6
-122.180.48.29
  122.181.16.134
  122.183.139.104
-122.183.164.12
  122.191.189.91
-122.193.178.233
+122.192.206.215
  122.193.233.172
-122.193.58.188
  122.194.192.247
+122.194.229.120
  122.194.229.122
+122.194.229.37
  122.194.229.54
  122.194.229.59
  122.194.44.48
-122.194.75.234
  122.195.134.68
  122.199.112.43
  122.199.140.158
  122.199.24.75
+122.199.26.230
  122.199.72.23
+122.199.72.51
+122.2.110.197
  122.200.144.132
  122.200.144.249
  122.200.144.42
@@ -18458,15 +18225,12 @@
  122.202.53.65
  122.205.143.89
  122.221.52.143
-122.224.167.154
-122.224.179.58
  122.224.240.106
  122.224.240.99
  122.224.65.197
  122.224.65.202
  122.224.94.188
  122.225.107.15
-122.225.112.22
  122.225.139.180
  122.225.18.194
  122.225.218.234
@@ -18485,14 +18249,18 @@
  122.228.246.205
  122.230.132.209
  122.230.133.47
+122.230.147.45
+122.230.158.133
  122.230.70.119
  122.231.25.216
  122.231.47.237
+122.233.149.2
  122.233.242.133
  122.234.77.121
  122.236.192.162
+122.236.70.36
  122.237.60.217
-122.243.159.8
+122.247.188.237
  122.247.191.124
  122.247.52.168
  122.247.9.96
@@ -18504,12 +18272,14 @@
  122.248.38.4
  122.248.45.35
  122.248.46.26
+122.249.93.35
  122.252.225.100
  122.252.225.115
  122.252.225.165
  122.252.229.3
  122.252.250.22
  122.254.29.37
+122.254.88.9
  122.254.89.250
  122.3.145.89
  122.3.255.114
@@ -18518,10 +18288,9 @@
  122.4.249.171
  122.47.89.188
  122.50.5.148
-122.50.5.98
  122.51.100.145
-122.51.101.136
  122.51.103.120
+122.51.116.112
  122.51.125.104
  122.51.125.231
  122.51.125.71
@@ -18529,7 +18298,6 @@
  122.51.137.21
  122.51.147.169
  122.51.147.194
-122.51.147.221
  122.51.149.86
  122.51.15.197
  122.51.154.84
@@ -18544,7 +18312,6 @@
  122.51.202.93
  122.51.204.45
  122.51.208.128
-122.51.208.60
  122.51.209.252
  122.51.211.131
  122.51.214.230
@@ -18569,6 +18336,7 @@
  122.51.32.91
  122.51.36.254
  122.51.41.36
+122.51.41.63
  122.51.52.109
  122.51.52.154
  122.51.53.50
@@ -18578,7 +18346,6 @@
  122.51.64.150
  122.51.68.7
  122.51.69.116
-122.51.72.249
  122.51.73.241
  122.51.77.182
  122.51.81.247
@@ -18595,7 +18362,6 @@
  122.52.183.184
  122.52.183.184bin.sh
  122.53.152.40
-122.53.176.250
  122.53.35.58
  122.53.86.120
  122.54.119.182
@@ -18609,6 +18375,8 @@
  122.55.195.2
  122.55.202.100
  122.58.118.224
+122.60.195.174
+122.60.93.214
  122.9.67.134
  122.97.162.201
  122.97.179.131
@@ -18624,7 +18392,6 @@
  123.1.189.70
  123.10.129.234
  123.10.130.193
-123.10.143.235
  123.10.153.139
  123.10.157.219
  123.10.159.123
@@ -18636,7 +18403,6 @@
  123.10.213.244
  123.10.28.162
  123.10.52.160
-123.10.91.52
  123.103.242.12
  123.108.189.102
  123.108.200.102
@@ -18644,13 +18410,10 @@
  123.108.201.91
  123.108.249.82
  123.108.252.170
-123.11.12.79
  123.11.13.233
-123.11.171.109
-123.11.173.236
+123.11.177.93
  123.11.193.137
  123.11.195.214
-123.11.203.187
  123.11.235.95
  123.11.4.81
  123.11.6.39
@@ -18661,6 +18424,7 @@
  123.11.9.175
  123.110.11.185
  123.110.124.238
+123.110.139.154
  123.110.182.187
  123.110.185.95
  123.110.95.163
@@ -18671,28 +18435,25 @@
  123.118.176.61
  123.118.191.254
  123.118.76.18
-123.12.100.226
  123.12.181.91
  123.12.196.134
  123.12.197.46
  123.12.221.108
-123.12.225.155
  123.12.229.211
  123.12.231.175
  123.12.233.247
  123.12.243.129
  123.12.26.141
-123.12.30.26
  123.12.65.254
  123.122.119.82
-123.122.160.104
+123.122.160.157
  123.122.160.2
-123.122.160.225
+123.122.161.150
  123.122.161.207
  123.122.162.173
-123.122.162.177
-123.122.162.228
  123.122.163.107
+123.122.163.133
+123.122.163.252
  123.122.232.190
  123.124.66.20
  123.125.194.150
@@ -18704,7 +18465,6 @@
  123.128.133.231
  123.128.136.48
  123.128.168.94
-123.128.17.220
  123.128.180.98
  123.128.221.216
  123.128.226.140
@@ -18713,10 +18473,8 @@
  123.128.245.251
  123.128.245.251bin.sh
  123.128.94.220
-123.129.107.216
  123.129.130.188
  123.129.166.147
-123.129.41.68
  123.129.6.25
  123.129.60.134
  123.129.85.148
@@ -18724,6 +18482,7 @@
  123.129.93.210
  123.13.120.172
  123.13.14.133
+123.13.166.5
  123.13.182.16
  123.13.22.7
  123.13.27.197
@@ -18732,39 +18491,37 @@
  123.13.57.113
  123.13.58.95
  123.13.59.120
+123.13.60.195
+123.13.61.202
  123.13.61.43
-123.13.61.70
-123.13.62.32
  123.13.62.96
-123.13.63.148
  123.130.0.231
  123.130.112.6
  123.130.112.86
  123.130.166.151
  123.130.166.249
  123.130.178.94
-123.130.188.102
  123.130.19.225
  123.130.216.147
  123.130.236.87
-123.130.39.119
  123.130.58.14
  123.130.92.27
  123.130.94.147
  123.131.165.105
-123.131.200.148
  123.132.129.11
  123.132.133.34
  123.132.157.4
  123.132.174.126
-123.132.216.105
  123.132.227.30
+123.132.232.198
  123.132.232.254
  123.132.248.154
  123.132.65.76
  123.133.147.228
  123.133.168.134
-123.133.197.227
+123.133.197.119
+123.133.198.126
+123.133.204.159
  123.133.67.2
  123.134.16.254
  123.134.204.236
@@ -18779,18 +18536,15 @@
  123.139.56.148
  123.139.56.238
  123.14.104.224
-123.14.166.15
  123.14.173.33
  123.14.199.130
-123.14.34.173
+123.14.233.233
  123.14.38.70
-123.14.49.13
-123.14.49.38
+123.14.5.115
  123.14.74.248
  123.140.114.196
  123.140.114.252
  123.140.250.171
-123.141.26.253
  123.142.41.244
  123.142.6.107
  123.143.203.194
@@ -18804,35 +18558,29 @@
  123.150.9.74
  123.150.94.82
  123.152.114.180
-123.152.42.196
  123.152.63.119
  123.154.156.170
  123.154.25.32
-123.154.62.209
  123.154.95.216
-123.155.106.210
  123.155.120.60
-123.156.201.196
  123.157.219.83
  123.158.48.232
  123.159.139.81
-123.159.51.112
-123.159.69.64
  123.159.70.163
-123.16.137.168
  123.16.15.201
  123.16.188.2
-123.16.216.234
  123.16.248.128
  123.160.10.54
  123.163.122.122
  123.163.97.210
  123.164.108.177
+123.164.84.128
  123.169.102.82
  123.169.103.130
-123.169.37.63
  123.169.96.133
  123.17.12.248
+123.17.78.124
+123.170.115.47
  123.170.221.178
  123.171.5.112
  123.173.71.19
@@ -18842,7 +18590,6 @@
  123.177.19.13
  123.178.150.230
  123.18.206.22
-123.18.57.56
  123.180.140.101
  123.181.235.123
  123.182.143.222
@@ -18852,12 +18599,11 @@
  123.183.172.85
  123.188.252.34
  123.188.255.52
+123.188.255.60
  123.189.2.226
  123.19.129.66
  123.19.183.127
  123.19.94.33
-123.190.135.136
-123.191.38.5
  123.192.101.163bin.sh
  123.192.64.68
  123.193.24.121
@@ -18865,10 +18611,10 @@
  123.194.52.79
  123.195.160.154
  123.195.184.77
+123.195.57.247
  123.195.60.250
  123.195.99.9
  123.20.171.52
-123.20.18.83
  123.200.11.230
  123.200.143.234
  123.200.15.218
@@ -18883,7 +18629,6 @@
  123.201.165.121
  123.201.178.131
  123.201.24.38
-123.201.50.103
  123.201.55.1
  123.201.55.9
  123.202.163.232
@@ -18896,17 +18641,16 @@
  123.206.13.139
  123.206.15.204
  123.206.17.141
+123.206.174.21
  123.206.183.186
  123.206.188.77
  123.206.216.65
  123.206.219.211
  123.206.228.179
-123.206.23.158
  123.206.232.235
  123.206.255.181
  123.206.26.133
  123.206.31.61
-123.206.33.56
  123.206.38.253
  123.206.41.68
  123.206.50.168
@@ -18935,10 +18679,10 @@
  123.207.151.66
  123.207.187.57
  123.207.188.111
-123.207.188.95
  123.207.19.105
  123.207.198.127
  123.207.218.163
+123.207.218.168
  123.207.22.39
  123.207.221.66
  123.207.222.213
@@ -18962,13 +18706,13 @@
  123.207.92.254
  123.207.94.252
  123.207.95.121
-123.207.97.250
+123.207.99.184
  123.208.200.185
  123.209.202.47
  123.209.93.122
  123.21.132.243
+123.21.16.209
  123.21.168.89
-123.21.173.1
  123.21.244.148
  123.212.124.25
  123.212.29.154
@@ -18978,34 +18722,27 @@
  123.220.251.190
  123.222.204.192
  123.231.106.30
-123.231.107.47
-123.231.121.129
+123.231.111.243
  123.231.121.38
-123.231.124.16
+123.231.124.31
  123.231.125.175
  123.231.160.98
  123.231.230.58
  123.231.254.82
  123.231.65.170
  123.232.100.2
-123.232.127.134
  123.232.170.69
  123.232.27.237
  123.232.42.210
  123.233.185.116
-123.234.112.149
  123.234.124.66
  123.234.124.66bin.sh
  123.234.131.230
-123.234.147.193
  123.234.184.57
  123.234.191.51
-123.234.228.85
  123.234.250.15
  123.234.45.126
-123.235.114.182
  123.235.120.142
-123.235.151.157
  123.235.173.94
  123.235.176.55
  123.235.178.184
@@ -19015,7 +18752,6 @@
  123.235.241.128
  123.235.247.118
  123.235.254.223
-123.235.69.77
  123.236.91.45
  123.24.118.33
  123.24.205.125
@@ -19025,20 +18761,22 @@
  123.241.140.20
  123.242.179.10
  123.244.144.65
-123.245.58.152
+123.245.10.48
+123.245.58.181
  123.245.58.235
+123.245.6.168
  123.249.26.47
  123.25.1.66
-123.25.115.183
  123.25.116.228
  123.25.117.119
-123.25.121.107
  123.25.21.144
-123.25.37.129
+123.25.30.201
  123.252.173.162
  123.252.188.186
  123.252.218.62
+123.253.126.40
  123.253.127.79
+123.253.221.74
  123.253.36.99
  123.253.96.154
  123.253.97.118
@@ -19048,7 +18786,11 @@
  123.26.104.83
  123.26.161.62
  123.26.177.140
+123.27.168.28
+123.27.198.151
  123.27.3.246
+123.28.187.226
+123.28.6.179
  123.30.109.21
  123.30.111.19
  123.30.127.139
@@ -19062,6 +18804,7 @@
  123.30.191.186
  123.30.211.6
  123.30.236.149
+123.30.238.187
  123.30.249.49
  123.31.12.113
  123.31.31.12
@@ -19069,22 +18812,22 @@
  123.31.41.31
  123.31.43.121
  123.31.45.49
-123.4.200.102
-123.4.243.228
  123.4.249.127
  123.4.54.219
  123.4.65.213
  123.4.69.229
  123.4.83.114
+123.4.85.65
  123.4.85.69
  123.4.87.146
  123.4.89.243
  123.4.91.169
+123.4.91.40
  123.4.92.227
  123.49.41.129
  123.49.59.150
-123.5.138.170
  123.5.149.180
+123.5.177.82
  123.50.145.89
  123.51.152.54
  123.51.168.240
@@ -19097,19 +18840,20 @@
  123.56.12.117
  123.56.129.67
  123.56.185.43
-123.56.226.102
  123.56.230.82
+123.56.3.249
  123.56.41.101
  123.56.41.15
  123.57.150.34
+123.57.189.127
  123.57.27.201
  123.57.45.231
  123.57.61.38
  123.57.72.201
  123.58.109.42
-123.58.212.34
  123.58.4.233
  123.58.5.243
+123.58.5.36
  123.58.55.162
  123.58.7.223
  123.59.1.83
@@ -19120,6 +18864,7 @@
  123.59.120.251
  123.59.194.227
  123.59.195.173
+123.59.196.122
  123.59.209.197
  123.59.210.198
  123.59.210.240
@@ -19134,27 +18879,15 @@
  123.63.242.115
  123.63.54.229
  123.7.32.65
-123.7.63.169
-123.7.63.49
-123.8.130.238
  123.8.132.120
-123.8.173.107
  123.8.189.177
-123.8.19.153
  123.8.190.0
  123.8.190.236
  123.9.111.220
  123.9.177.30
  123.9.181.216
-123.9.199.21
-123.9.200.12
-123.9.202.16
  123.9.204.224
-123.9.207.193
-123.9.243.56
-123.9.245.140
-123.9.83.93
-123.97.132.64
+123.9.253.50
  123.97.154.113
  123.ltscr.cn
  123123123112312323.000webhostapp.com
@@ -19200,7 +18933,6 @@
  124.105.34.149
  124.105.55.176
  124.106.127.86
-124.107.165.170
  124.107.185.189
  124.109.1.146
  124.109.1.207
@@ -19212,8 +18944,7 @@
  124.109.50.213
  124.109.52.72
  124.111.53.213
-124.113.217.216
-124.113.228.221
+124.113.217.49
  124.114.141.46
  124.115.146.99
  124.115.205.246
@@ -19231,35 +18962,35 @@
  124.119.139.245
  124.119.63.243
  124.120.187.152
-124.120.46.157
+124.120.75.51
  124.120.86.162
  124.120.86.93
  124.121.177.141
  124.121.177.233
  124.121.177.76
  124.121.177.90
-124.121.182.145
  124.121.182.185
  124.121.19.134
  124.121.19.144
  124.121.19.36
  124.121.193.81
  124.121.2.136
+124.121.2.246
  124.121.205.8
-124.122.101.108
+124.122.10.98
  124.122.103.39
  124.122.12.89
  124.122.120.17
+124.122.224.88
  124.122.227.63
  124.122.37.246
  124.122.45.123
  124.122.47.205
-124.122.55.202
  124.123.165.230
  124.123.175.77
  124.123.77.175
  124.124.197.72
-124.126.140.14
+124.126.140.193
  124.126.140.249
  124.126.18.130
  124.127.42.42
@@ -19272,36 +19003,24 @@
  124.129.161.32
  124.129.204.155
  124.129.207.173
-124.129.244.227
-124.129.42.135
  124.129.59.57
  124.13.20.40
+124.13.35.218
  124.13.46.209
  124.130.164.91
-124.130.28.8
  124.130.40.162
-124.130.57.57
  124.131.109.149
-124.131.117.51
-124.131.131.147
  124.131.131.184
-124.131.131.35
  124.131.135.61
  124.131.139.201
  124.131.149.131
-124.131.150.24
-124.131.151.135
  124.131.152.148
-124.131.2.217
  124.131.239.254
-124.131.26.238
  124.131.51.163
-124.133.230.74
+124.133.240.218
  124.133.252.204
  124.133.34.186
  124.133.9.122
-124.135.1.194
-124.135.11.47
  124.135.165.168
  124.135.42.214
  124.135.5.0
@@ -19312,13 +19031,13 @@
  124.140.114.158
  124.141.1.24
  124.148.92.243
+124.149.39.137
  124.149.52.14
-124.149.52.214
  124.150.132.74
  124.150.175.133
  124.150.236.51
  124.152.109.123
-124.152.118.194
+124.152.118.131
  124.152.57.24
  124.152.76.174
  124.152.76.180
@@ -19336,7 +19055,6 @@
  124.156.135.242
  124.156.138.112
  124.156.139.91
-124.156.140.21
  124.156.143.60
  124.156.148.119
  124.156.149.43
@@ -19371,16 +19089,13 @@
  124.158.179.222
  124.158.183.184
  124.158.7.170
-124.158.88.56
  124.16.71.252
  124.160.126.238
  124.160.83.138
  124.160.96.242
  124.160.96.249
  124.163.131.196
-124.163.134.113
  124.163.144.140
-124.163.146.116
  124.163.191.135
  124.163.96.71
  124.165.123.7
@@ -19388,7 +19103,6 @@
  124.167.248.230
  124.169.53.140
  124.17.10.2
-124.170.1.29
  124.170.162.21
  124.170.217.160
  124.170.61.185
@@ -19421,11 +19135,9 @@
  124.217.230.195
  124.217.242.70
  124.217.249.34
-124.219.176.139
  124.225.66.198
  124.226.218.205
  124.226.219.166
-124.226.233.115
  124.227.115.39
  124.228.170.194
  124.229.25.21
@@ -19436,12 +19148,10 @@
  124.232.163.10
  124.234.220.222
  124.234.240.103
-124.234.6.107
  124.235.155.109
  124.235.171.114
  124.235.206.59
  124.235.216.239
-124.236.22.12
  124.238.113.126
  124.238.56.102
  124.238.56.112
@@ -19461,6 +19171,7 @@
  124.238.59.208
  124.238.59.217
  124.238.59.231
+124.238.59.80
  124.238.60.139
  124.238.61.126
  124.238.61.213
@@ -19481,9 +19192,9 @@
  124.248.177.106
  124.248.177.126
  124.248.177.14
+124.248.177.197
  124.248.177.203
  124.248.177.40
-124.248.189.176
  124.248.189.68
  124.248.190.215
  124.248.191.38
@@ -19494,21 +19205,19 @@
  124.251.110.147
  124.251.110.148
  124.251.23.153
+124.251.69.116
  124.253.204.157
  124.255.20.163
  124.28.218.130
  124.29.200.210
  124.29.200.215
  124.29.200.46
-124.29.212.121
  124.29.216.47
  124.29.236.163
-124.29.238.40
  124.35.94.234
  124.40.244.254
  124.40.248.202
  124.40.251.74
-124.40.255.186
  124.41.193.38
  124.41.211.110
  124.41.211.188
@@ -19526,29 +19235,30 @@
  124.41.240.199
  124.41.240.203
  124.41.240.66
+124.41.241.49
  124.41.243.22
  124.41.243.67
  124.41.243.72
  124.41.248.55
  124.42.68.14
+124.43.13.117
  124.43.177.160
-124.43.5.130
  124.43.9.184
  124.43.93.218
  124.45.106.173
  124.49.100.254
  124.5.74.161bin.sh
  124.5.92.20
-124.50.73.93
  124.51.247.48
+124.56.160.155
  124.6.0.4
  124.6.153.84
  124.61.214.44
-124.62.228.145
  124.65.117.38
+124.65.130.86
+124.65.142.62
  124.65.144.38
  124.65.158.254
-124.65.181.78
  124.65.8.209
  124.65.99.130
  124.66.49.34
@@ -19563,6 +19273,7 @@
  124.67.89.70
  124.67.89.74
  124.67.89.76
+124.7.132.100
  124.74.248.218
  124.75.27.100
  124.75.27.102
@@ -19574,10 +19285,11 @@
  124.81.239.170
  124.82.119.11
  124.82.222.209
+124.82.6.130
  124.89.218.25
  124.89.220.36
+124.89.9.189
  124.89.9.204
-124.89.9.233
  124.9.79.244
  124.90.36.152
  124.90.49.107
@@ -19585,17 +19297,14 @@
  124.91.132.236
  124.91.133.220
  124.91.134.195
-124.91.138.38
  124.91.186.192
  124.91.186.192bin.sh
-124.91.22.151
-124.91.225.117
  124.91.226.216
  124.91.236.96
  124.91.6.249
  124.93.201.59
  124.93.222.211
-124.94.23.79
+124.95.129.83
  124.95.143.135
  124.cpanel.realwebsitesite.com
  1241.31cf4fdae.com
@@ -19604,39 +19313,37 @@
  125.0.215.60
  125.104.231.209
  125.104.252.53
+125.105.80.4
+125.106.197.109
+125.109.194.241
  125.117.97.166
  125.120.149.124
  125.120.237.87
-125.122.169.110
-125.123.120.42
+125.123.124.87
  125.123.239.2
+125.123.69.129
  125.124.117.226
-125.124.120.123
  125.124.160.236
  125.124.215.222
  125.124.30.186
  125.124.44.135
  125.124.59.64
  125.124.69.65
-125.124.72.157
  125.124.77.104
  125.125.116.242
  125.126.254.180
  125.126.84.109
  125.126.86.109
  125.128.163.100
-125.128.225.3
+125.128.197.195
  125.131.73.90
  125.132.218.97
  125.134.140.175
-125.134.169.130
  125.134.191.228
-125.134.203.250
  125.134.55.83
  125.134.92.170
  125.135.221.94
  125.137.11.141
-125.137.18.111
  125.137.191.115
  125.138.129.101
  125.139.190.46
@@ -19671,33 +19378,36 @@
  125.141.63.90
  125.141.91.138
  125.142.211.237
-125.142.5.105
+125.142.5.136
  125.143.140.126
  125.143.3.230
  125.143.50.113
  125.16.134.218
-125.16.176.58
  125.16.217.170
  125.160.17.200
+125.160.184.255
+125.160.193.74
  125.160.195.248
  125.160.207.65
  125.160.213.234
+125.160.226.168
  125.160.226.31
  125.160.228.188
  125.160.56.134
+125.160.65.52
  125.160.65.89
-125.161.129.151
+125.161.128.2
+125.161.128.201
  125.161.129.217
  125.161.136.146
-125.161.137.111
  125.161.138.235
-125.161.139.79
+125.161.139.177
+125.161.139.30
  125.161.31.225
  125.161.65.27
  125.162.120.80
  125.162.136.217
-125.162.220.254
-125.162.87.59
+125.162.213.249
  125.163.100.45
  125.163.118.80
  125.163.147.240
@@ -19705,38 +19415,33 @@
  125.163.163.88
  125.163.249.135
  125.163.30.185
-125.163.61.30
  125.163.8.33
-125.164.105.240
  125.164.140.78
  125.164.57.129
  125.164.83.252
-125.164.97.105
+125.165.100.211
  125.165.101.150
  125.165.104.21
  125.165.105.194
+125.165.108.88
  125.165.179.254
-125.165.99.249
-125.166.119.67
  125.166.146.148
-125.166.2.27
  125.166.203.83
-125.166.224.66
  125.166.4.199
+125.167.115.54
  125.167.116.38
+125.167.118.110
  125.167.132.165
  125.167.32.158
  125.167.52.78
-125.167.56.202
  125.167.60.58
-125.167.63.77
  125.168.10.234
  125.168.145.66bin.sh
  125.17.115.94
  125.178.227.57
  125.178.75.73
+125.18.143.98
  125.18.20.150
-125.19.153.156
  125.19.99.90
  125.198.22.58
  125.20.32.22
@@ -19755,7 +19460,6 @@
  125.21.123.234
  125.21.43.82
  125.21.54.26
-125.211.133.124
  125.212.156.213
  125.212.156.54
  125.212.193.1
@@ -19768,11 +19472,11 @@
  125.212.224.103
  125.212.225.167
  125.212.227.4
-125.212.229.50
  125.212.233.50
  125.212.241.131
  125.212.251.45
  125.213.150.219
+125.215.164.86
  125.215.205.180
  125.215.207.40
  125.22.246.216
@@ -19786,36 +19490,33 @@
  125.227.69.217
  125.23.240.146
  125.235.234.108
+125.235.236.255
  125.236.215.133
  125.236.232.228
-125.237.44.191
  125.24.1.16
  125.24.1.74
-125.24.11.92
  125.24.112.61
  125.24.115.172
  125.24.119.38
  125.24.12.158
-125.24.12.93
  125.24.124.34
  125.24.131.14
+125.24.15.68
  125.24.236.230
  125.24.3.127
  125.24.3.80
+125.24.40.103
+125.24.44.133
  125.24.5.89
  125.24.6.240
  125.24.6.7
  125.24.68.253
-125.24.7.159
  125.24.7.220
-125.24.8.78
-125.24.85.37
  125.24.91.120
  125.240.27.103
  125.245.165.135
  125.247.211.3
  125.248.150.84
-125.25.0.116
  125.25.114.166
  125.25.124.238
  125.25.165.17
@@ -19823,11 +19524,9 @@
  125.25.165.88
  125.25.165.91
  125.25.165.97
-125.25.167.185
  125.25.184.10
  125.25.184.14
  125.25.187.225
-125.25.197.78
  125.25.203.140
  125.25.238.7
  125.25.24.97
@@ -19835,12 +19534,10 @@
  125.25.246.209
  125.25.28.29
  125.25.41.126
-125.25.63.245
  125.25.71.175
  125.25.78.19
  125.25.80.86
  125.25.82.204
-125.251.116.4
  125.251.133.3
  125.251.136.194
  125.251.147.194
@@ -19852,23 +19549,23 @@
  125.26.100.113
  125.26.104.236
  125.26.108.170
+125.26.110.124
  125.26.113.2
  125.26.122.124
  125.26.135.191
+125.26.15.67
  125.26.15.68
  125.26.165.17
  125.26.165.244
  125.26.169.63
+125.26.179.111
  125.26.183.167
  125.26.183.223
-125.26.183.54
  125.26.186.244
-125.26.195.50
  125.26.202.91
  125.26.246.86
  125.26.7.124
  125.26.7.83
-125.26.80.230
  125.26.97.158
  125.26.99.185
  125.26.99.186
@@ -19879,10 +19576,9 @@
  125.27.10.243
  125.27.10.84
  125.27.115.69
-125.27.126.36
-125.27.127.59
  125.27.136.91
  125.27.14.230
+125.27.143.84
  125.27.186.238
  125.27.205.232
  125.27.22.161
@@ -19890,7 +19586,6 @@
  125.27.238.3
  125.27.24.30
  125.27.240.241
-125.27.240.26
  125.27.243.202
  125.27.251.124
  125.27.251.171
@@ -19902,114 +19597,70 @@
  125.27.251.79
  125.27.251.87
  125.27.48.227
-125.27.51.53
-125.27.56.100
  125.27.57.230
  125.27.89.151
  125.31.40.138
  125.33.226.142
-125.34.240.29
  125.34.240.33
  125.35.227.106
  125.35.92.130
-125.36.114.219
  125.36.208.161
-125.36.214.70
-125.40.1.179
  125.40.113.83
  125.40.114.24
-125.40.145.172
-125.40.34.42
  125.40.73.220
  125.40.75.47
  125.40.91.15
  125.41.1.44
  125.41.109.123
  125.41.13.34
-125.41.204.208
  125.41.204.217
  125.41.205.24bin.sh
  125.41.215.56
  125.41.224.147
-125.41.7.175
-125.41.77.148
  125.41.80.120
  125.41.97.114
  125.42.121.170
  125.42.121.67
-125.42.123.210
-125.42.124.212
-125.42.125.131
  125.42.192.48
  125.42.239.99
  125.42.42.75
  125.42.90.144
-125.43.112.244
  125.43.113.1
-125.43.113.53
-125.43.127.1
-125.43.190.51
-125.43.35.158
-125.43.38.205
  125.43.50.22
-125.43.7.43
+125.43.61.134
  125.43.93.226
-125.44.14.235
  125.44.194.40
-125.44.213.4
-125.44.215.155
  125.44.231.212
  125.44.247.182
  125.44.8.248
-125.44.9.198
-125.45.153.2
  125.45.179.132
  125.45.186.236bin.sh
  125.45.25.13
  125.45.67.112bin.sh
-125.45.67.97
  125.45.77.161
  125.45.78.176
  125.45.79.125
  125.46.163.117
-125.46.185.118
-125.46.185.127
-125.46.196.207
-125.46.196.220
  125.46.197.224
-125.46.202.242
-125.46.244.98
-125.46.247.103
  125.46.78.50
  125.46.81.106
  125.46.82.34
  125.46.86.134
-125.47.106.83
  125.47.196.201
-125.47.199.136
  125.47.204.174
  125.47.211.71
  125.47.226.219
-125.47.234.205
-125.47.242.108
-125.47.243.177
  125.47.245.184
-125.47.249.236
-125.47.250.122
  125.47.55.90
-125.47.61.164
  125.47.65.10
  125.47.65.136
  125.47.74.248
-125.47.75.174
  125.47.85.43
-125.47.86.87
  125.47.90.241
  125.47.91.188
  125.5.180.84
  125.5.184.218
  125.5.215.20
-125.57.214.79
  125.60.148.184
  125.62.198.65
  125.62.213.18
@@ -20017,7 +19668,6 @@
  125.64.16.40
  125.64.54.23
  125.64.94.139
-125.64.94.143
  125.65.112.161
  125.65.112.168
  125.65.77.120
@@ -20030,24 +19680,27 @@
  125.69.71.33
  125.69.90.148
  125.70.244.4
-125.70.253.149
  125.74.238.42
  125.74.28.200
  125.74.55.161
-125.76.212.142
+125.76.163.33
+125.76.212.191
  125.76.230.10
+125.77.165.10
  125.77.22.106
+125.77.23.30
  125.77.25.123
  125.84.217.97
  125.85.13.40
  125.88.169.233
-125.89.7.76
  125.91.109.200
  125.91.126.92
  125.94.117.128
  125.94.236.109
  125.94.236.14
  125.94.67.142
+125.95.190.166
+125.95.232.255
  125.99.100.193
  125.99.110.158
  125.99.120.166
@@ -20070,9 +19723,7 @@
  126.145.224.154
  126.15.109.101
  126.26.199.53
-126.34.147.146
  126.4.98.212
-126.66.79.72
  126.90.59.69
  126bus.cn
  126f7b50-bfe6-4649-a622-42cb62c2a8d5.htmlcomponentservice.com
@@ -20089,7 +19740,6 @@
  128.1.223.244
  128.1.223.245
  128.1.223.246
-128.1.87.5
  128.106.136.18
  128.106.166.8
  128.106.195.126
@@ -20105,8 +19755,8 @@
  128.121.17.154
  128.121.17.155
  128.124.208.94
-128.124.9.15
-128.127.186.87
+128.127.14.160
+128.134.178.1
  128.134.58.164
  128.136.35.30
  128.14.11.107
@@ -20115,12 +19765,13 @@
  128.14.11.110
  128.14.133.58
  128.14.134.170
-128.14.141.110
  128.14.16.156
  128.14.16.233
  128.14.163.92
  128.14.163.94
  128.14.178.94
+128.14.209.242
+128.14.209.250
  128.14.3.110
  128.14.3.84
  128.14.30.178
@@ -20141,12 +19792,12 @@
  128.177.105.224
  128.177.105.225
  128.187.32.223
-128.193.254.44
+128.197.128.236
+128.197.189.187
  128.199.0.70
  128.199.1.140
  128.199.1.184
  128.199.10.155
-128.199.100.171
  128.199.101.113
  128.199.101.35
  128.199.102.242
@@ -20160,13 +19811,12 @@
  128.199.109.128
  128.199.11.82
  128.199.11.84
-128.199.110.201
  128.199.110.226
  128.199.114.22
  128.199.115.175
-128.199.115.180
  128.199.116.139
  128.199.117.43
+128.199.118.165
  128.199.12.141
  128.199.120.132
  128.199.121.185
@@ -20179,6 +19829,7 @@
  128.199.127.0
  128.199.127.15
  128.199.127.154
+128.199.127.191
  128.199.127.217
  128.199.128.169
  128.199.128.186
@@ -20213,26 +19864,28 @@
  128.199.148.20
  128.199.149.111
  128.199.15.205
+128.199.150.133
  128.199.150.71
  128.199.151.172
  128.199.151.198
  128.199.152.105
+128.199.152.154
  128.199.152.57
  128.199.154.189
  128.199.156.159
  128.199.156.25
  128.199.158.182
  128.199.16.236
-128.199.161.153
+128.199.162.108
  128.199.162.224
  128.199.163.94
-128.199.164.46
  128.199.165.98
  128.199.167.161
  128.199.167.163
  128.199.167.218
  128.199.168.172
  128.199.168.35
+128.199.170.159
  128.199.170.33
  128.199.171.106
  128.199.171.183
@@ -20251,7 +19904,6 @@
  128.199.180.123
  128.199.180.80
  128.199.182.19
-128.199.182.51
  128.199.184.167
  128.199.184.177
  128.199.185.42
@@ -20276,7 +19928,6 @@
  128.199.206.90
  128.199.208.93
  128.199.21.230
-128.199.210.138
  128.199.211.68
  128.199.212.194
  128.199.212.225
@@ -20288,7 +19939,6 @@
  128.199.218.126
  128.199.219.186
  128.199.220.70
-128.199.221.152
  128.199.221.231
  128.199.222.224
  128.199.223.178
@@ -20308,7 +19958,6 @@
  128.199.239.9
  128.199.240.120
  128.199.241.165
-128.199.242.201
  128.199.243.186
  128.199.243.226
  128.199.244.150
@@ -20317,6 +19966,7 @@
  128.199.248.200
  128.199.248.35
  128.199.249.142
+128.199.249.213
  128.199.249.246
  128.199.249.43
  128.199.25.223
@@ -20324,6 +19974,8 @@
  128.199.253.208
  128.199.254.188
  128.199.254.45
+128.199.254.46
+128.199.26.0
  128.199.26.242
  128.199.26.250
  128.199.26.61
@@ -20352,16 +20004,15 @@
  128.199.49.191
  128.199.5.111
  128.199.50.213
-128.199.51.115
  128.199.51.183
  128.199.52.158
+128.199.52.213
  128.199.52.4
-128.199.53.53
  128.199.55.169
  128.199.55.181
  128.199.55.244
  128.199.58.60
-128.199.6.188
+128.199.59.175
  128.199.6.24
  128.199.61.212
  128.199.61.84
@@ -20386,7 +20037,7 @@
  128.199.87.167
  128.199.87.28
  128.199.88.23
-128.199.89.150
+128.199.89.136
  128.199.90.55
  128.199.92.162
  128.199.93.4
@@ -20396,15 +20047,18 @@
  128.199.95.93
  128.199.96.1
  128.199.98.15
+128.199.98.233
  128.199.99.204
  128.201.100.84
  128.201.161.2
  128.201.76.184
+128.201.77.94
  128.201.81.160
  128.201.81.163
  128.201.82.87
  128.201.96.199
  128.204.207.215
+128.204.242.123
  128.241.54.188
  128.244.119.135
  128.244.119.161
@@ -20412,6 +20066,7 @@
  128.31.0.13
  128.59.10.116
  128.65.126.240
+128.65.51.84
  128.65.52.161
  128.70.137.103
  128.71.144.200
@@ -20423,12 +20078,12 @@
  128.92.203.42
  128.98.26.242
  128988158812897-dot-fix-file-upstream.appspot.com
-129.0.76.118
  129.10.65.146
  129.102.9.6
  129.121.177.81
  129.122.16.156
  129.122.177.168
+129.122.202.198
  129.122.30.14
  129.126.102.10
  129.126.102.14
@@ -20443,13 +20098,12 @@
  129.144.183.81
  129.144.32.149
  129.144.9.93
-129.145.193.194
-129.146.112.125
+129.146.120.47
  129.146.122.232
  129.146.160.14
  129.146.171.254
+129.146.242.39
  129.146.246.249
-129.146.249.135
  129.146.250.102
  129.146.253.35
  129.146.68.124
@@ -20514,8 +20168,10 @@
  129.204.82.4
  129.204.89.159
  129.205.112.253
+129.205.113.195
  129.205.138.194
  129.205.161.127
+129.205.161.16
  129.205.161.237
  129.205.201.133
  129.205.201.239
@@ -20549,6 +20205,7 @@
  129.211.174.106
  129.211.18.180
  129.211.185.246
+129.211.187.159
  129.211.188.162
  129.211.189.231
  129.211.191.185
@@ -20573,12 +20230,14 @@
  129.211.79.208
  129.211.84.224
  129.211.91.170
-129.211.94.145
  129.211.94.30
  129.211.99.254
  129.213.117.100
  129.213.118.125
+129.213.129.58
  129.213.145.100
+129.213.145.171
+129.213.146.57
  129.213.15.42
  129.213.161.37
  129.213.165.255
@@ -20587,11 +20246,14 @@
  129.213.203.59
  129.213.21.173
  129.213.213.245
+129.213.31.48
  129.213.76.238
  129.22.143.241
  129.226.11.73
  129.226.112.41
  129.226.12.233
+129.226.120.152
+129.226.123.251
  129.226.125.10
  129.226.134.163
  129.226.138.179
@@ -20600,14 +20262,15 @@
  129.226.150.149
  129.226.153.90
  129.226.157.108
+129.226.161.32
  129.226.164.49
  129.226.165.250
  129.226.165.90
  129.226.166.46
+129.226.169.113
  129.226.170.36
  129.226.170.65
-129.226.174.57
-129.226.185.201
+129.226.175.158
  129.226.188.130
  129.226.193.114
  129.226.193.66
@@ -20623,7 +20286,6 @@
  129.226.73.12
  129.226.76.90
  129.226.77.190
-129.227.129.169
  129.232.208.51
  129.232.208.54
  129.232.208.55
@@ -20632,7 +20294,6 @@
  129.28.113.46
  129.28.12.228
  129.28.141.140
-129.28.142.81
  129.28.154.240
  129.28.155.113
  129.28.157.148
@@ -20704,6 +20365,7 @@
  13.115.95.157
  13.124.143.186
  13.124.176.17
+13.124.199.36
  13.124.217.71
  13.124.222.242
  13.124.238.252
@@ -20745,14 +20407,12 @@
  13.211.157.229
  13.211.79.130
  13.212.1.17
-13.212.103.140
  13.212.11.223
  13.212.141.79
  13.212.167.50
  13.212.173.234
  13.212.182.30
  13.212.206.115
-13.212.208.232
  13.212.217.254
  13.212.221.8
  13.212.25.58
@@ -20776,6 +20436,7 @@
  13.229.125.117
  13.229.126.201
  13.229.128.192
+13.229.129.176
  13.229.129.207
  13.229.130.235
  13.229.133.26
@@ -20924,12 +20585,12 @@
  13.57.250.92
  13.57.51.100
  13.57.96.35
+13.58.122.0
  13.58.134.165
  13.58.152.3
  13.58.196.60
  13.58.2.126
  13.58.210.235
-13.58.237.57
  13.58.241.222
  13.58.255.228
  13.58.30.119
@@ -21007,7 +20668,6 @@
  13.66.167.123
  13.66.18.39
  13.66.185.182
-13.66.210.3
  13.66.217.251
  13.66.243.4
  13.66.248.91
@@ -21015,6 +20675,7 @@
  13.66.255.220
  13.66.28.137
  13.66.39.248
+13.66.8.23
  13.67.106.218
  13.67.236.36
  13.67.56.139
@@ -21024,16 +20685,11 @@
  13.68.225.165
  13.68.229.202
  13.68.249.191
-13.69.136.34
-13.69.137.44
-13.69.139.25
-13.69.143.137
  13.69.153.185
  13.69.50.143
  13.71.136.69
  13.71.2.244
  13.71.46.226
-13.71.5.118
  13.71.68.160
  13.72.77.29
  13.72.80.225
@@ -21044,6 +20700,10 @@
  13.73.16.134
  13.73.23.121
  13.74.157.69
+13.74.170.63
+13.74.171.127
+13.74.171.33
+13.74.171.58
  13.74.178.7
  13.74.180.130
  13.74.46.65
@@ -21061,7 +20721,6 @@
  13.76.242.146
  13.76.246.8
  13.76.34.31
-13.76.38.173
  13.76.91.32
  13.77.144.86
  13.77.168.213
@@ -21072,25 +20731,30 @@
  13.77.210.119
  13.77.215.72
  13.78.126.105
+13.78.132.59
  13.78.189.149
  13.78.190.103
  13.78.236.203
  13.78.237.115
-13.78.9.246
+13.79.16.35
+13.79.16.83
  13.79.160.121
+13.79.17.188
  13.79.190.55
+13.79.22.224
+13.79.22.99
+13.79.225.74
+13.79.23.155
+13.79.24.211
  13.79.242.9
+13.79.26.142
  13.79.6.157
  13.80.102.70
  13.80.104.33
  13.80.123.101
  13.80.147.35
  13.80.67.162
-13.81.24.230
-13.81.41.249
-13.81.43.104
  13.81.6.165
-13.82.0.138
  13.82.102.20
  13.82.105.123
  13.82.147.112
@@ -21134,11 +20798,15 @@
  13.89.36.235
  13.90.101.160
  13.90.140.180
+13.90.144.226
+13.90.144.229
+13.90.148.180
+13.90.148.56
+13.90.150.167
  13.90.197.127
  13.90.208.238
  13.90.26.128
  13.90.38.253
-13.90.95.243
  13.90.98.107
  13.90.98.3
  13.91.41.140
@@ -21165,15 +20833,12 @@
  13.93.87.165
  13.94.119.209
  13.94.200.157
+13.94.61.208
  13.95.130.2
  130.0.219.242
  130.0.234.16
-130.105.168.72
  130.105.197.224
-130.105.243.149
-130.105.248.159
-130.105.248.208
-130.105.248.25
+130.105.50.184
  130.111.10.87
  130.149.80.199
  130.149.80.221
@@ -21183,8 +20848,6 @@
  130.180.99.26
  130.185.109.17
  130.185.123.21
-130.185.126.223
-130.185.127.223
  130.185.152.148
  130.185.152.155
  130.185.152.2
@@ -21204,7 +20867,6 @@
  130.185.157.80
  130.185.157.92
  130.185.159.134
-130.185.159.151
  130.185.159.162
  130.185.159.223
  130.185.159.231
@@ -21245,6 +20907,7 @@
  130.255.159.133
  130.255.189.66
  130.255.189.68
+130.255.44.41
  130.51.200.132
  130.61.100.68
  130.61.113.65
@@ -21255,6 +20918,7 @@
  130.61.227.100
  130.61.233.14
  130.61.255.187
+130.61.255.76
  130.61.30.186
  130.61.33.94
  130.61.36.89
@@ -21280,9 +20944,11 @@
  131.0.246.154
  131.0.246.157
  131.0.246.158
+131.0.86.130
  131.0.87.225
  131.100.132.14
  131.100.137.152
+131.100.148.147
  131.100.238.9
  131.100.239.122
  131.100.239.21
@@ -21291,8 +20957,8 @@
  131.100.239.94
  131.108.116.92
  131.108.118.103
-131.108.118.27
  131.108.16.133
+131.108.216.11
  131.108.45.72
  131.108.45.78
  131.108.80.193
@@ -21308,7 +20974,6 @@
  131.161.10.206
  131.161.10.232
  131.161.107.105
-131.161.108.161
  131.161.108.209
  131.161.11.198
  131.161.11.215
@@ -21336,7 +21001,6 @@
  131.196.141.105
  131.196.141.11
  131.196.141.132
-131.196.141.137
  131.196.141.151
  131.196.141.153
  131.196.141.159
@@ -21344,8 +21008,7 @@
  131.196.141.173
  131.196.141.187
  131.196.141.197
-131.196.141.236
-131.196.141.244
+131.196.141.217
  131.196.141.248
  131.196.141.31
  131.196.141.37
@@ -21354,13 +21017,14 @@
  131.196.141.64
  131.196.141.69
  131.196.141.81
-131.196.141.84
+131.196.141.85
  131.196.141.89
  131.196.141.93
  131.196.143.120
  131.196.143.134
  131.196.143.138
  131.196.143.153
+131.196.143.154
  131.196.143.168
  131.196.143.184
  131.196.143.191
@@ -21368,20 +21032,19 @@
  131.196.143.221
  131.196.143.230
  131.196.143.27
-131.196.143.32
  131.196.143.44
  131.196.143.46
  131.196.143.60
  131.196.143.63
-131.196.143.72
+131.196.143.66
  131.196.143.8
-131.196.143.98
-131.196.219.90
+131.196.143.81
  131.196.253.95
  131.196.4.226
  131.196.86.34
  131.196.87.198
-131.196.94.26
+131.196.95.176
+131.221.13.107
  131.221.165.53
  131.221.167.16
  131.221.173.40
@@ -21396,19 +21059,16 @@
  131.221.217.174
  131.221.217.176
  131.221.252.175
-131.221.253.104
  131.221.254.255
  131.221.42.94
  131.221.64.152
  131.221.73.86
-131.221.80.129
-131.255.202.137
+131.255.202.73
  131.255.212.114
  131.255.32.45
  131.255.32.69
  131.255.4.96
  131.72.139.150
-131.72.201.88
  131.72.205.98
  131.94.129.191
  13123431043915105561.002.sh.cn
@@ -21416,41 +21076,42 @@
  1314520bet.com
  1314huadian.com
  131987449-518886016577583774.preview.editmysite.com
-132.145.111.129
  132.145.128.157
  132.145.154.95
  132.145.159.137
-132.145.165.79
  132.145.168.92
-132.145.203.69
-132.145.206.12
+132.145.188.126
  132.145.210.51
  132.145.212.133
  132.145.242.131
+132.145.30.158
+132.148.104.129
  132.148.104.133
  132.148.104.135
  132.148.104.136
+132.148.104.149
  132.148.104.29
  132.148.105.139
+132.148.106.7
+132.148.120.37
  132.148.121.32
  132.148.134.226
  132.148.141.147
  132.148.144.101
+132.148.151.190
  132.148.153.156
  132.148.154.8
  132.148.159.44
  132.148.165.94
  132.148.166.225
  132.148.17.38
+132.148.197.208
  132.148.22.79
-132.148.23.100
  132.148.28.20
  132.148.37.253
  132.148.42.109
  132.148.91.227
  132.148.99.126
-132.154.148.174
-132.157.129.169
  132.232.1.155
  132.232.10.144
  132.232.108.149
@@ -21478,6 +21139,7 @@
  132.232.32.203
  132.232.33.160
  132.232.35.108
+132.232.35.65
  132.232.35.70
  132.232.37.219
  132.232.38.147
@@ -21490,7 +21152,9 @@
  132.232.47.59
  132.232.49.143
  132.232.50.152
+132.232.53.85
  132.232.57.135
+132.232.59.247
  132.232.59.78
  132.232.6.207
  132.232.60.183
@@ -21542,14 +21206,12 @@
  133.130.124.174
  133.130.124.231
  133.130.127.253
-133.130.55.94
  133.130.91.37
  133.130.97.166
  133.167.100.251
  133.167.105.83
  133.167.95.209
  133.18.66.114
-133.186.162.41
  133.205.118.202
  133.208.23.52
  133.242.155.85
@@ -21563,10 +21225,13 @@
  1337gang.ddns.net
  133gvb.com
  134.0.10.177
+134.0.101.85
  134.0.115.57
  134.0.119.149
  134.0.119.176
+134.0.204.190
  134.0.63.134
+134.101.199.13
  134.102.228.73
  134.119.179.146
  134.119.189.121
@@ -21579,10 +21244,12 @@
  134.122.100.130
  134.122.103.69
  134.122.103.82
+134.122.11.246
  134.122.11.47
  134.122.111.15
  134.122.112.132
  134.122.113.222
+134.122.113.81
  134.122.115.191
  134.122.117.77
  134.122.118.167
@@ -21597,6 +21264,7 @@
  134.122.15.36
  134.122.17.13
  134.122.17.146
+134.122.17.178
  134.122.17.251
  134.122.177.32
  134.122.177.53
@@ -21618,7 +21286,7 @@
  134.122.38.58
  134.122.40.106
  134.122.40.31
-134.122.43.105
+134.122.42.167
  134.122.44.197
  134.122.44.93
  134.122.46.215
@@ -21634,20 +21302,17 @@
  134.122.72.221
  134.122.72.53
  134.122.77.215
-134.122.78.89
+134.122.80.217
  134.122.81.145
  134.122.87.117
  134.122.9.108
  134.122.9.180
  134.122.90.113
  134.122.90.115
-134.122.94.113
  134.122.94.183
  134.122.95.167
  134.169.32.26
  134.17.128.171
-134.17.210.24
-134.17.26.116
  134.17.26.161
  134.17.5.55
  134.17.94.150
@@ -21659,6 +21324,7 @@
  134.175.13.243
  134.175.13.51
  134.175.130.52
+134.175.133.109
  134.175.136.207
  134.175.137.69
  134.175.146.231
@@ -21685,15 +21351,14 @@
  134.175.28.62
  134.175.32.235
  134.175.37.159
-134.175.55.42
  134.175.59.225
  134.175.64.60
  134.175.70.122
  134.175.85.103
+134.175.89.31
  134.175.90.111
  134.175.93.231
  134.19.146.45
-134.19.179.147
  134.19.254.2
  134.208.10.111
  134.209.100.103
@@ -21720,6 +21385,7 @@
  134.209.127.128
  134.209.144.106
  134.209.146.100
+134.209.147.203
  134.209.148.107
  134.209.149.43
  134.209.150.87
@@ -21734,7 +21400,6 @@
  134.209.163.219
  134.209.164.184
  134.209.172.2
-134.209.176.202
  134.209.178.93
  134.209.179.57
  134.209.181.49
@@ -21764,7 +21429,6 @@
  134.209.227.182
  134.209.228.253
  134.209.23.58
-134.209.234.130
  134.209.234.186
  134.209.236.154
  134.209.236.185
@@ -21773,9 +21437,9 @@
  134.209.241.217
  134.209.241.227
  134.209.241.87
-134.209.247.16
  134.209.248.200
  134.209.248.41
+134.209.250.11
  134.209.254.186
  134.209.30.141
  134.209.36.254
@@ -21796,6 +21460,7 @@
  134.209.81.185
  134.209.82.166
  134.209.83.193
+134.209.83.43
  134.209.84.223
  134.209.85.106
  134.209.85.26
@@ -21804,6 +21469,7 @@
  134.209.93.51
  134.209.93.91
  134.209.94.132
+134.209.94.30
  134.209.96.131
  134.209.97.199
  134.209.98.180
@@ -21818,7 +21484,6 @@
  134.236.0.241
  134.236.0.243
  134.236.0.34
-134.236.116.176
  134.236.16.14
  134.236.16.234
  134.236.2.140
@@ -21846,11 +21511,12 @@
  134.249.165.49
  134.249.167.184
  134.249.173.43
-134.249.198.135
+134.249.198.194
  134.249.198.213
  134.249.199.116
  134.249.199.128
-134.249.199.16
+134.249.199.160
+134.249.199.17
  134.249.199.228
  134.249.245.223
  134.249.53.96
@@ -21862,7 +21528,6 @@
  134.35.0.45
  134.35.113.182
  134.35.117.108
-134.35.163.22
  134.35.205.101
  134.35.212.5
  134.35.222.80
@@ -21881,15 +21546,13 @@
  134.93.54.61
  13453765871837679316.googlegroups.com
  134d384annuyy.000webhostapp.com
-135.0.15.16
  135.125.10.145
  135.125.137.236
  135.125.139.230
-135.125.140.11
-135.125.141.79
+135.125.141.129
+135.125.142.211
  135.125.20.71
  135.125.24.240
-135.125.91.32
  135.148.2.77
  135.148.2.82
  135.148.2.94
@@ -22013,6 +21676,7 @@
  135.181.1.135
  135.181.109.128
  135.181.109.130
+135.181.109.133
  135.181.109.135
  135.181.109.189
  135.181.109.196
@@ -22037,6 +21701,7 @@
  135.181.182.56
  135.181.19.21
  135.181.192.205
+135.181.195.150
  135.181.197.116
  135.181.242.50
  135.181.41.129
@@ -22045,17 +21710,17 @@
  135.181.43.48
  135.181.49.56
  135.181.5.233
+135.181.88.154
  135.181.92.33
+135.19.52.184
  135.19.9.91
  135.23.117.89
  135.23.203.70
-135.23.228.90
  135.23.67.54
  1356657.servicesgsp1.club
  135athome.com
  136.1.1.165
  136.1.1.173
-136.143.190.106
  136.143.43.222
  136.144.174.206
  136.144.174.208
@@ -22063,6 +21728,7 @@
  136.144.185.223
  136.144.191.173
  136.144.206.45
+136.144.210.153
  136.144.215.219
  136.144.216.138
  136.144.227.64
@@ -22072,17 +21738,18 @@
  136.144.250.90
  136.144.54.195
  136.145.1.16
-136.158.29.39
  136.158.32.110
  136.158.32.233
+136.158.32.92
  136.158.33.54
+136.158.34.12
  136.158.34.141
  136.169.169.185
  136.169.169.203
  136.169.194.113
+136.169.210.149
  136.169.224.150
  136.169.224.97
-136.185.56.115
  136.2.1.104
  136.2.1.164
  136.2.1.169
@@ -22094,13 +21761,16 @@
  136.228.131.104
  136.228.160.250
  136.228.161.27
+136.228.161.66
  136.228.161.67
  136.228.168.53
  136.232.124.14
+136.232.160.178
  136.232.199.210
  136.232.209.70
  136.232.226.202
  136.232.236.6
+136.232.29.206
  136.232.53.166
  136.233.23.226
  136.233.25.125
@@ -22129,7 +21799,6 @@
  136.243.174.119
  136.243.176.210
  136.243.201.249
-136.243.201.88
  136.243.203.184
  136.243.204.72
  136.243.21.253
@@ -22137,9 +21806,9 @@
  136.243.36.83
  136.243.36.93
  136.243.36.99
+136.243.38.39
  136.243.4.204
  136.243.4.68
-136.243.41.212
  136.243.42.156
  136.243.47.172
  136.243.47.220
@@ -22167,7 +21836,6 @@
  136.244.77.163
  136.244.99.133
  136.25.131.81
-136.26.156.161
  136.32.164.64
  136.32.20.188
  136.32.230.54
@@ -22209,6 +21877,7 @@
  137.116.129.17
  137.116.133.111
  137.116.144.63
+137.116.252.247
  137.116.84.38
  137.117.110.171
  137.117.168.216
@@ -22216,10 +21885,12 @@
  137.117.21.137
  137.117.212.72
  137.117.226.185
+137.119.105.66
  137.119.36.33
  137.119.52.140
  137.119.55.25
  137.135.101.9
+137.135.205.152
  137.175.13.129
  137.175.13.130
  137.175.13.65
@@ -22228,10 +21899,9 @@
  137.175.29.34
  137.175.30.220
  137.175.9.65
-137.186.222.112
  137.220.137.51
+137.220.163.71
  137.220.175.190
-137.220.175.64
  137.220.178.33
  137.220.232.221
  137.220.233.54
@@ -22246,6 +21916,7 @@
  137.59.187.107
  137.59.187.126
  137.59.19.132
+137.59.230.252
  137.59.243.42
  137.59.253.52
  137.59.50.225
@@ -22258,7 +21929,6 @@
  137.74.118.26
  137.74.119.116
  137.74.119.50
-137.74.130.174
  137.74.137.211
  137.74.148.93
  137.74.168.174
@@ -22289,9 +21959,8 @@
  137.74.64.237
  137.74.77.15
  137.74.80.246
-137.74.82.35
-137.74.82.45
  137.74.85.74
+137.97.107.63
  13741.url.snwxn.com
  137645-securecheck-pp.icu
  138.0.102.246
@@ -22302,15 +21971,18 @@
  138.0.230.2
  138.0.230.49
  138.0.231.66
+138.0.254.130
+138.100.155.159
  138.117.143.226
+138.117.182.130
+138.117.182.176
  138.117.37.244
-138.117.78.75
  138.117.85.17
  138.117.85.97
  138.118.213.213
  138.118.224.36
+138.118.31.46
  138.121.105.196
-138.121.113.164
  138.121.113.182
  138.121.128.19
  138.121.128.34
@@ -22320,7 +21992,6 @@
  138.121.245.93
  138.121.32.133
  138.121.32.182
-138.121.73.54
  138.122.105.118
  138.122.108.87
  138.122.143.40
@@ -22329,24 +22000,29 @@
  138.122.192.199
  138.122.192.210
  138.122.192.22
+138.122.192.246
+138.122.222.165
  138.122.240.1
-138.122.39.237
+138.122.38.142
+138.122.38.55
  138.122.7.25
  138.122.7.33
-138.122.8.159
  138.122.8.49
+138.122.98.143
  138.124.183.214
  138.128.0.236
  138.128.1.176
  138.128.1.187
  138.128.1.191
-138.128.1.249
+138.128.1.240
  138.128.1.250
+138.128.10.207
  138.128.11.136
  138.128.11.138
-138.128.11.29
+138.128.11.177
+138.128.11.59
  138.128.11.70
-138.128.11.76
+138.128.110.91
  138.128.111.217
  138.128.127.112
  138.128.13.251
@@ -22366,38 +22042,37 @@
  138.128.242.121
  138.128.3.20
  138.128.30.139
-138.128.30.216
  138.128.4.111
  138.128.44.189
  138.128.45.103
-138.128.45.104
  138.128.45.109
  138.128.5.61
+138.128.51.240
  138.128.52.107
  138.128.59.184
-138.128.61.129
  138.128.69.61
-138.128.84.131
  138.128.84.138
  138.128.84.151
  138.128.84.153
  138.128.84.157
  138.128.84.158
  138.128.84.159
+138.128.89.59
  138.134.102.16
  138.185.193.33
+138.185.194.3
  138.185.56.166
  138.186.122.105
-138.186.138.192
+138.186.138.146
  138.186.138.204
  138.186.138.250
  138.186.138.31
-138.186.138.43
  138.186.138.46
  138.186.138.60
-138.186.138.65
  138.186.165.181
+138.186.196.148
  138.186.4.153
+138.186.55.141
  138.19.115.117
  138.197.10.226
  138.197.101.210
@@ -22423,7 +22098,6 @@
  138.197.13.47
  138.197.130.102
  138.197.130.138
-138.197.131.66
  138.197.132.117
  138.197.132.55
  138.197.135.102
@@ -22431,10 +22105,10 @@
  138.197.136.68
  138.197.137.31
  138.197.14.28
+138.197.14.92
  138.197.140.163
  138.197.141.158
  138.197.141.162
-138.197.142.249
  138.197.142.81
  138.197.145.133
  138.197.146.121
@@ -22444,7 +22118,6 @@
  138.197.149.107
  138.197.149.119
  138.197.149.97
-138.197.15.19
  138.197.15.250
  138.197.15.40
  138.197.150.132
@@ -22456,7 +22129,6 @@
  138.197.153.4
  138.197.157.206
  138.197.157.80
-138.197.159.143
  138.197.159.227
  138.197.161.118
  138.197.161.96
@@ -22571,12 +22243,11 @@
  138.199.14.135
  138.199.14.136
  138.199.14.137
-138.199.14.142
+138.199.14.143
  138.199.14.145
  138.199.18.113
  138.199.18.187
  138.199.18.77
-138.199.27.211
  138.199.30.142
  138.201.101.22
  138.201.106.88
@@ -22590,6 +22261,7 @@
  138.201.206.35
  138.201.207.220
  138.201.215.163
+138.201.220.156
  138.201.23.232
  138.201.240.238
  138.201.252.11
@@ -22600,7 +22272,9 @@
  138.201.34.135
  138.201.34.82
  138.201.35.218
+138.201.35.79
  138.201.36.109
+138.201.38.115
  138.201.44.27
  138.201.44.8
  138.201.52.218
@@ -22612,19 +22286,24 @@
  138.201.57.133
  138.201.58.141
  138.201.72.117
+138.201.89.179
  138.201.92.208
  138.204.100.70
  138.204.127.1
  138.204.140.199
+138.204.143.203
+138.204.143.80
+138.204.143.81
  138.204.143.82
-138.204.143.84
+138.204.143.83
  138.204.143.85
  138.204.171.108
  138.204.179.162
  138.204.185.98
  138.204.195.185
-138.204.59.166
+138.204.25.31
  138.204.78.248
+138.207.154.32
  138.210.192.120
  138.210.193.11
  138.210.193.84
@@ -22637,23 +22316,28 @@
  138.219.223.166
  138.219.236.4
  138.219.98.148
+138.229.106.230
  138.229.109.162
+138.229.111.244
+138.229.114.30
  138.229.234.41
  138.229.26.42
  138.238.248.233
  138.255.0.27
  138.255.148.35
  138.255.207.124
+138.255.207.157
  138.255.227.17
  138.255.227.2
  138.255.227.5
  138.255.227.9
  138.255.240.66
+138.255.32.65
+138.255.35.230
  138.36.158.61
-138.36.2.182
+138.36.201.103
  138.36.22.108
  138.36.3.180
-138.36.3.4
  138.36.40.54
  138.36.41.116
  138.36.98.107
@@ -22688,6 +22372,7 @@
  138.68.129.23
  138.68.129.62
  138.68.131.204
+138.68.134.78
  138.68.137.147
  138.68.137.177
  138.68.138.89
@@ -22733,15 +22418,12 @@
  138.68.227.57
  138.68.23.64
  138.68.231.196
-138.68.232.19
-138.68.233.112
  138.68.234.185
  138.68.234.74
  138.68.236.111
  138.68.236.147
  138.68.236.50
  138.68.237.102
-138.68.238.242
  138.68.239.219
  138.68.24.249
  138.68.24.88
@@ -22749,7 +22431,6 @@
  138.68.242.68
  138.68.244.244
  138.68.244.82
-138.68.245.250
  138.68.245.255
  138.68.247.194
  138.68.250.106
@@ -22812,7 +22493,6 @@
  138.68.84.249
  138.68.87.218
  138.68.87.65
-138.68.88.11
  138.68.88.243
  138.68.88.246
  138.68.89.69
@@ -22829,7 +22509,6 @@
  138.68.97.8
  138.68.98.102
  138.68.99.110
-138.68.99.131
  138.91.120.191
  138.91.145.18
  138.91.159.185
@@ -22847,7 +22526,6 @@
  138.94.218.108
  138.94.218.212
  138.94.218.73
-138.94.255.227
  138.94.49.70
  138.94.58.11
  138.97.0.210
@@ -22880,13 +22558,13 @@
  138.97.60.140
  138.97.60.141
  138.97.64.20
+138.97.92.212
  138.97.92.65
-138.97.93.248
-138.97.93.86
-138.97.93.9
-138.97.94.240
+138.97.93.91
  138.97.94.65
+138.99.216.141
  138.99.224.223
+138.99.247.132
  138.99.6.177
  138.99.6.198
  138.99.7.29
@@ -22900,10 +22578,13 @@
  13871234567.mer.lstest.siquality.com
  139.0.10.183
  139.0.115.44
+139.0.124.183
+139.0.15.218
  139.0.22.50
  139.0.24.187
  139.0.54.168
  139.0.6.36
+139.0.6.46
  139.0.77.165
  139.129.206.8
  139.129.230.217
@@ -22911,7 +22592,9 @@
  139.130.228.72
  139.130.233.254
  139.130.242.43
+139.138.212.121
  139.153.255.107
+139.155.10.97
  139.155.11.173
  139.155.11.230
  139.155.127.59
@@ -22920,6 +22603,7 @@
  139.155.17.18
  139.155.17.233
  139.155.17.74
+139.155.172.190
  139.155.174.181
  139.155.175.148
  139.155.175.230
@@ -22928,7 +22612,6 @@
  139.155.181.145
  139.155.181.27
  139.155.182.156
-139.155.2.15
  139.155.2.183
  139.155.2.190
  139.155.2.218
@@ -22938,23 +22621,25 @@
  139.155.225.13
  139.155.226.188
  139.155.229.38
+139.155.23.147
  139.155.23.172
  139.155.231.29
-139.155.236.207
+139.155.232.231
  139.155.236.78
  139.155.236.88
  139.155.237.8
  139.155.238.47
+139.155.239.207
  139.155.24.139
  139.155.240.73
-139.155.242.183
+139.155.242.50
  139.155.243.48
  139.155.243.80
  139.155.247.50
  139.155.248.142
  139.155.248.228
+139.155.249.13
  139.155.251.145
-139.155.254.25
  139.155.254.64
  139.155.26.47
  139.155.29.40
@@ -22965,6 +22650,7 @@
  139.155.39.22
  139.155.42.189
  139.155.46.147
+139.155.5.118
  139.155.5.247
  139.155.5.75
  139.155.54.93
@@ -22980,10 +22666,13 @@
  139.155.77.44
  139.155.79.7
  139.155.84.160
+139.155.85.171
  139.155.86.214
-139.155.87.149
+139.155.87.225
+139.155.88.128
  139.155.88.85
  139.155.89.13
+139.155.89.150
  139.155.90.129
  139.159.1.1
  139.159.1.129
@@ -23011,7 +22700,6 @@
  139.162.121.170
  139.162.122.33
  139.162.124.224
-139.162.124.249
  139.162.127.185
  139.162.128.239
  139.162.13.177
@@ -23029,7 +22717,6 @@
  139.162.162.104
  139.162.164.153
  139.162.164.90
-139.162.169.50
  139.162.17.152
  139.162.171.76
  139.162.174.82
@@ -23084,9 +22771,11 @@
  139.162.56.8
  139.162.57.114
  139.162.60.124
+139.162.63.39
  139.162.7.42
  139.162.70.46
  139.162.71.110
+139.162.72.13
  139.162.75.112
  139.162.75.91
  139.162.76.176
@@ -23113,14 +22802,12 @@
  139.170.180.147
  139.170.180.78
  139.170.231.168
+139.170.8.131
  139.178.69.251
  139.180.128.190
-139.180.136.169
  139.180.143.8
  139.180.147.144
  139.180.147.93
-139.180.154.253
-139.180.165.197
  139.180.173.188
  139.180.185.6
  139.180.193.170
@@ -23135,21 +22822,22 @@
  139.180.214.151
  139.180.220.15
  139.180.220.179
+139.180.224.161
  139.180.224.233
  139.180.225.53
+139.180.225.82
  139.180.226.87
  139.180.229.61
+139.180.230.223
  139.186.122.124
  139.186.122.17
  139.186.122.214
-139.186.132.63
  139.186.132.77
  139.186.136.121
  139.186.136.85
  139.186.141.11
  139.186.143.194
  139.186.155.116
-139.186.155.253
  139.186.161.167
  139.186.165.246
  139.186.171.130
@@ -23165,14 +22853,16 @@
  139.186.77.46
  139.186.78.122
  139.186.82.39
-139.192.125.228
  139.193.151.58
  139.194.162.113
-139.196.202.131
+139.196.16.8
+139.196.253.185
+139.198.116.25
+139.198.120.226
  139.198.121.63
  139.198.122.116
+139.198.122.19
  139.198.122.76
-139.198.125.248
  139.198.126.22
  139.198.17.31
  139.198.176.198
@@ -23200,11 +22890,11 @@
  139.199.189.158
  139.199.200.182
  139.199.22.202
-139.199.223.208
  139.199.228.133
  139.199.23.233
  139.199.25.110
  139.199.29.155
+139.199.32.22
  139.199.32.57
  139.199.35.168
  139.199.4.191
@@ -23218,12 +22908,12 @@
  139.199.80.75
  139.199.87.1
  139.201.215.67
-139.210.243.37
  139.210.98.218
  139.213.220.70
  139.215.208.125
-139.215.217.180
+139.215.217.181
  139.217.115.144
+139.217.115.62
  139.217.119.86
  139.217.129.158
  139.217.134.138
@@ -23270,10 +22960,11 @@
  139.219.9.146
  139.219.9.60
  139.224.210.214
+139.224.211.123
  139.224.72.224
-139.224.81.41
+139.226.34.199
  139.227.201.157
-139.255.11.147
+139.255.11.188
  139.255.116.122
  139.255.131.165
  139.255.17.58
@@ -23292,11 +22983,9 @@
  139.255.58.94
  139.255.69.149
  139.255.86.189
-139.255.87.213
  139.255.91.122
  139.255.94.122
  139.255.94.123
-139.28.219.244
  139.28.222.85
  139.28.38.80
  139.47.135.215
@@ -23304,14 +22993,15 @@
  139.5.101.203
  139.5.132.105
  139.5.145.154
-139.5.151.78
  139.5.159.37
  139.5.16.174
  139.5.177.10
  139.5.177.73
+139.5.218.126
  139.5.237.163
-139.5.26.224
  139.5.29.97
+139.5.71.46
+139.5.71.80
  139.5.75.3
  139.59.1.159
  139.59.1.162
@@ -23330,13 +23020,13 @@
  139.59.107.34
  139.59.108.233
  139.59.108.41
+139.59.108.89
  139.59.109.146
  139.59.109.223
  139.59.11.101
  139.59.11.154
  139.59.11.82
  139.59.111.188
-139.59.112.146
  139.59.112.158
  139.59.112.44
  139.59.112.58
@@ -23353,12 +23043,10 @@
  139.59.12.197
  139.59.12.63
  139.59.12.65
-139.59.121.221
  139.59.121.225
  139.59.122.188
  139.59.123.104
  139.59.123.2
-139.59.123.235
  139.59.125.61
  139.59.127.178
  139.59.128.39
@@ -23431,7 +23119,6 @@
  139.59.212.98
  139.59.213.25
  139.59.215.185
-139.59.215.241
  139.59.22.194
  139.59.22.201
  139.59.225.255
@@ -23441,7 +23128,7 @@
  139.59.228.20
  139.59.229.141
  139.59.230.202
-139.59.231.169
+139.59.233.147
  139.59.233.36
  139.59.234.147
  139.59.234.48
@@ -23458,7 +23145,6 @@
  139.59.243.181
  139.59.244.237
  139.59.244.238
-139.59.245.17
  139.59.247.235
  139.59.248.126
  139.59.248.243
@@ -23468,7 +23154,6 @@
  139.59.251.156
  139.59.251.222
  139.59.253.117
-139.59.253.210
  139.59.255.101
  139.59.255.97
  139.59.26.39
@@ -23479,6 +23164,7 @@
  139.59.31.173
  139.59.31.28
  139.59.32.156
+139.59.34.226
  139.59.35.52
  139.59.37.245
  139.59.38.252
@@ -23501,6 +23187,7 @@
  139.59.47.247
  139.59.56.121
  139.59.56.149
+139.59.57.169
  139.59.57.2
  139.59.57.39
  139.59.59.187
@@ -23512,7 +23199,6 @@
  139.59.61.77
  139.59.62.222
  139.59.65.77
-139.59.66.145
  139.59.66.248
  139.59.66.79
  139.59.67.118
@@ -23529,8 +23215,6 @@
  139.59.70.72
  139.59.72.96
  139.59.73.64
-139.59.75.162
-139.59.78.248
  139.59.79.207
  139.59.79.56
  139.59.80.147
@@ -23548,6 +23232,7 @@
  139.59.92.53
  139.59.92.87
  139.59.94.33
+139.59.95.162
  139.59.95.250
  139.59.96.50
  139.59.99.11
@@ -23575,14 +23260,15 @@
  139.99.133.150
  139.99.133.189
  139.99.133.226
+139.99.134.112
  139.99.148.4
+139.99.155.158
  139.99.155.187
  139.99.156.128
  139.99.158.11
  139.99.172.11
  139.99.176.63
  139.99.180.74
-139.99.185.81
  139.99.196.183
  139.99.20.49
  139.99.20.51
@@ -23594,7 +23280,6 @@
  139.99.237.135
  139.99.237.60
  139.99.239.230
-139.99.248.195
  139.99.26.68
  139.99.37.27
  139.99.40.151
@@ -23631,13 +23316,11 @@
  13r.lg.ua
  13stages.com
  13suntrust4.7m.pl
-14.0.18.201
-14.0.18.254
  14.102.113.39
  14.102.121.156
+14.102.122.50
  14.102.150.246
  14.102.154.66
-14.102.30.157
  14.102.39.33
  14.102.40.169
  14.102.41.253
@@ -23657,10 +23340,9 @@
  14.102.97.204
  14.11.128.0
  14.116.149.110
+14.116.155.195
  14.116.155.53
  14.118.212.141
-14.118.214.55
-14.120.35.139
  14.128.33.3
  14.128.9.199
  14.128.9.202
@@ -23673,11 +23355,11 @@
  14.128.9.48
  14.128.9.51
  14.128.9.53
-14.136.104.38
  14.136.192.222
  14.136.201.82
  14.136.204.41
  14.136.5.140
+14.136.60.73
  14.138.109.129
  14.138.109.133
  14.138.139.91bin.sh
@@ -23689,38 +23371,39 @@
  14.139.239.22
  14.139.244.116
  14.139.56.14
-14.139.57.195
  14.140.244.64
  14.140.95.157
  14.141.175.107
-14.141.232.124
  14.141.61.171
  14.141.73.10
  14.141.93.162
  14.142.128.237
  14.142.143.138
+14.142.189.6
+14.142.19.238
  14.142.20.142
  14.143.137.18
  14.143.3.30
  14.146.95.68
  14.152.101.53
-14.153.79.23
-14.154.30.138
-14.154.31.31
+14.152.95.91
+14.155.221.123
  14.155.221.44
  14.156.201.80
-14.160.224.54
  14.160.23.139
  14.160.25.250
+14.160.38.18
  14.160.70.178
  14.160.93.230
  14.161.0.62
-14.161.1.128
+14.161.13.79
  14.161.14.44
  14.161.22.255
  14.161.22.85
+14.161.24.171
  14.161.29.242
  14.161.30.236
+14.161.39.235
  14.161.43.183
  14.161.44.120
  14.161.45.187
@@ -23732,76 +23415,80 @@
  14.161.48.201
  14.161.48.4
  14.161.50.104
-14.161.50.23
  14.161.6.201
-14.162.136.147
  14.162.144.102
  14.162.145.182
  14.162.146.128
-14.162.146.216
  14.162.146.31
  14.162.146.38
-14.162.167.216
-14.162.171.221
-14.162.222.247
-14.163.12.30
+14.162.163.178
+14.162.60.191
+14.163.124.216
  14.163.249.24
  14.165.164.42
  14.165.185.60
  14.165.187.233
  14.165.207.61
-14.166.6.86
  14.167.113.121
-14.167.16.108
-14.167.92.236
+14.167.177.147
+14.168.61.29
  14.169.152.6
+14.169.174.67
+14.169.187.118
  14.169.215.58
+14.169.222.146
  14.169.236.33
-14.17.114.29
+14.169.249.116
+14.169.56.68
  14.17.114.65
+14.171.149.249
+14.171.163.113
+14.171.219.195
  14.172.33.115
+14.174.209.72
  14.174.55.174
+14.175.22.88
  14.176.168.170
-14.177.146.143
  14.177.156.159
-14.177.220.214
  14.177.230.27
-14.177.232.93
  14.177.235.178
+14.177.235.243
  14.177.66.248
  14.177.69.17
-14.178.138.246
+14.177.83.60
  14.178.31.182
  14.178.39.68
  14.179.187.49
  14.179.224.67
  14.179.78.219
  14.18.144.234
-14.180.253.160
-14.183.193.209
+14.181.227.155
+14.181.71.77
  14.185.61.97
  14.185.75.76
  14.185.95.87
  14.186.170.4
+14.186.212.85
  14.186.237.237
  14.186.239.111
+14.186.41.237
  14.186.50.78
-14.186.62.70
  14.187.150.77
+14.187.54.253
  14.188.208.138
+14.188.21.96
  14.188.30.156
  14.188.49.204
  14.189.198.194
-14.189.235.86
  14.189.39.219
+14.190.124.227
  14.190.200.107
+14.190.38.48
  14.191.175.31
  14.191.18.10
-14.191.70.24
-14.191.87.4
-14.191.92.215
  14.192.10.189
  14.192.192.17
+14.192.212.204
  14.192.213.169
  14.192.248.5
  14.192.31.17
@@ -23816,6 +23503,7 @@
  14.202.250.110
  14.203.57.50
  14.204.145.108
+14.204.20.35
  14.204.5.250
  14.207.125.162
  14.207.127.163
@@ -23825,12 +23513,10 @@
  14.207.153.206
  14.207.177.21
  14.207.178.61
+14.207.179.90
  14.207.182.87
  14.207.203.53
-14.207.204.183
-14.207.21.31
  14.207.23.83
-14.207.30.249
  14.207.36.110
  14.207.36.50
  14.207.50.167
@@ -23839,9 +23525,7 @@
  14.207.59.166
  14.207.73.45
  14.207.76.121
-14.207.8.35
  14.21.42.158
-14.211.2.242
  14.212.249.100
  14.213.136.17
  14.213.138.194
@@ -23852,6 +23536,7 @@
  14.215.166.18
  14.215.166.25
  14.215.237.205
+14.219.236.21
  14.219.237.90
  14.221.97.232
  14.225.17.9
@@ -23872,10 +23557,6 @@
  14.23.170.234
  14.23.44.10
  14.230.253.146
-14.231.110.106
-14.231.173.82
-14.232.152.158
-14.232.152.66
  14.232.155.202
  14.232.155.45
  14.232.160.197
@@ -23887,34 +23568,36 @@
  14.232.214.184
  14.232.244.96
  14.232.245.245
-14.232.42.59
  14.232.99.42
  14.233.12.221
  14.233.138.195
-14.233.186.178
+14.233.188.146
  14.234.120.242
+14.234.127.120
  14.234.74.126
-14.236.15.20
-14.237.144.252
-14.238.1.202
+14.235.21.242
+14.238.170.171
  14.239.103.236
-14.239.18.97
+14.239.26.235
  14.239.74.99
  14.240.250.212
  14.240.78.4
  14.241.142.119
  14.241.209.27
  14.241.226.240
+14.241.226.91
+14.241.234.67
  14.241.236.73
  14.241.238.27
  14.241.239.2
  14.241.239.89
-14.241.240.0
-14.241.244.139
  14.241.245.179
  14.241.252.19
  14.241.38.109
  14.241.91.96
+14.242.71.119
+14.243.123.104
+14.243.21.235
  14.243.225.159
  14.244.215.32
  14.244.24.204
@@ -23924,48 +23607,45 @@
  14.245.186.73
  14.245.205.115
  14.245.81.123
-14.245.95.156
-14.246.178.111
  14.247.17.201
+14.248.121.62
  14.248.137.211
-14.248.144.143
  14.248.155.2
  14.248.72.21
+14.248.82.19
  14.248.83.2
-14.249.53.238
-14.250.17.149
-14.251.159.93
+14.249.2.66
+14.251.93.54
+14.252.143.94
  14.252.170.203
-14.253.130.98
  14.253.228.5
  14.253.57.18
-14.254.54.109
+14.254.18.91
+14.254.224.189
+14.254.240.33
  14.254.87.195
  14.29.126.53
  14.29.162.139
  14.29.184.45
  14.29.247.69
-14.29.249.7
  14.29.254.239
  14.29.64.91
  14.32.164.26
-14.33.45.230
  14.33.77.170
-14.34.110.33
+14.35.23.165
  14.36.52.211
  14.37.160.130
  14.37.43.23
-14.37.55.165
  14.38.231.114
  14.40.102.160bin.sh
  14.40.23.66
  14.42.131.21
-14.42.144.52
  14.42.155.140
+14.42.53.134
  14.42.89.179
+14.43.139.117
  14.43.139.13
  14.43.191.134
-14.44.12.71
  14.45.11.198
  14.46.12.180
  14.46.12.180bin.sh
@@ -23974,7 +23654,6 @@
  14.46.98.250
  14.47.124.192
  14.48.96.34
-14.49.126.121
  14.49.37.103
  14.49.37.250
  14.50.240.77
@@ -23982,13 +23661,13 @@
  14.51.6.13bin.sh
  14.52.178.230
  14.52.249.27
+14.53.234.49
  14.54.148.146
  14.54.16.206
  14.55.129.168
  14.56.180.103
  14.63.1.108
  14.63.160.219
-14.63.162.167
  14.63.162.98
  14.63.165.206
  14.63.168.68
@@ -24002,10 +23681,7 @@
  14.63.68.207
  14.63.9.114
  14.80.204.79
-14.9.128.160
-14.91.62.163
  14.97.1.154
-14.98.112.142
  14.98.4.82
  14.98.82.230
  14.99.117.194
@@ -24013,7 +23689,6 @@
  14.99.140.82
  14.99.154.242
  14.99.176.210
-14.99.233.222
  14.99.81.218
  14.ip-51-178-42.eu
  140-365.net
@@ -24033,9 +23708,11 @@
  140.143.136.103
  140.143.136.41
  140.143.136.89
+140.143.139.81
  140.143.14.232
  140.143.14.71
  140.143.144.140
+140.143.147.16
  140.143.152.200
  140.143.155.17
  140.143.167.250
@@ -24045,7 +23722,6 @@
  140.143.187.21
  140.143.187.54
  140.143.189.29
-140.143.19.214
  140.143.19.237
  140.143.19.50
  140.143.193.52
@@ -24082,7 +23758,6 @@
  140.143.249.234
  140.143.251.239
  140.143.28.158
-140.143.30.191
  140.143.31.202
  140.143.31.73
  140.143.32.232
@@ -24094,10 +23769,7 @@
  140.143.46.240
  140.143.5.181
  140.143.56.61
-140.143.57.159
  140.143.57.195
-140.143.57.203
-140.143.57.32
  140.143.88.110
  140.143.9.175
  140.143.90.154
@@ -24108,7 +23780,6 @@
  140.190.21.8
  140.203.155.11
  140.206.118.82
-140.206.157.242
  140.206.223.29
  140.206.242.34
  140.206.72.238
@@ -24118,20 +23789,16 @@
  140.207.232.13
  140.207.232.28
  140.207.96.235
+140.210.91.34
  140.210.92.148
  140.210.92.82
  140.213.179.250
+140.213.33.48
  140.227.127.173
-140.227.163.22
-140.227.198.88
-140.227.199.112
+140.227.166.248
  140.227.200.248
-140.227.200.250
-140.227.202.238
-140.227.205.216
+140.227.211.122
  140.227.212.184
-140.227.212.57
-140.227.236.123
  140.237.12.41
  140.237.255.239
  140.238.14.170
@@ -24139,22 +23806,19 @@
  140.238.177.23
  140.238.177.83
  140.238.188.191
+140.238.227.187
  140.238.229.179
  140.238.240.36
  140.238.244.154
  140.238.49.143
  140.238.69.224
  140.238.96.22
-140.240.114.43
-140.240.38.247
  140.240.81.70
  140.249.17.94
  140.249.19.110
  140.249.193.85
  140.249.205.149
-140.249.213.243
  140.249.48.49
-140.255.142.216
  140.78.60.4
  140.82.28.35
  140.82.32.116
@@ -24172,62 +23836,42 @@
  14079.url.snwxn.com
  140bd7dca2f0a46e46c62254903e7589-dot-dbenitonline.ey.r.appspot.com
  140teakwood.com
-141.0.11.243
-141.0.11.250
-141.0.11.253
-141.0.12.41
-141.0.13.236
-141.0.8.24
-141.0.8.96
-141.101.104.149
-141.101.104.165
-141.101.104.187
-141.101.104.191
-141.101.104.28
-141.101.105.140
-141.101.105.213
+141.101.104.197
+141.101.104.221
  141.101.105.24
  141.101.107.138
-141.101.107.164
-141.101.69.145
-141.101.76.210
-141.101.77.134
-141.101.77.158
-141.101.77.172
+141.101.69.19
+141.101.69.49
+141.101.76.18
+141.101.76.40
+141.101.76.94
  141.101.8.36
  141.101.98.108
  141.101.98.128
-141.101.98.136
-141.101.98.176
-141.101.98.188
  141.101.98.30
-141.101.98.52
-141.101.99.117
-141.101.99.163
-141.101.99.39
-141.101.99.61
+141.101.99.149
+141.101.99.20
  141.105.132.43
  141.105.65.254
  141.105.65.99
  141.105.68.25
  141.105.69.69
  141.108.255.109
-141.134.106.82
  141.135.2.95
+141.136.90.7
  141.138.136.175
  141.138.32.172
  141.138.46.183
  141.151.238.103
  141.154.76.46
  141.164.56.244
-141.164.90.99
  141.193.115.2
  141.223.5.11
  141.223.82.131
  141.223.82.138
  141.223.82.61
  141.226.122.122
-141.226.151.32
+141.226.162.96
  141.226.9.44
  141.239.148.100
  141.255.146.43
@@ -24240,14 +23884,16 @@
  141.255.155.71
  141.255.157.130
  141.255.166.190
+141.255.83.36
  141.8.143.138
  141.8.143.163
  141.8.143.191
  141.8.143.193
  141.8.143.205
  141.8.143.228
-141.8.224.29
-141.8.225.190
+141.8.224.169
+141.8.224.194
+141.8.225.223
  141.8.55.249bin.sh
  141.89.97.31
  141.98.10.0
@@ -24266,10 +23912,12 @@
  141.98.100.78
  141.98.100.86
  141.98.100.93
-141.98.103.140
+141.98.102.235
+141.98.103.22
  141.98.103.39
  141.98.252.163
  141.98.252.168
+141.98.252.169
  141.98.255.143
  141.98.80.100
  141.98.80.101
@@ -24300,7 +23948,6 @@
  142.0.135.1
  142.0.135.2
  142.0.138.34
-142.105.151.124
  142.11.194.209
  142.11.195.117
  142.11.195.135
@@ -24349,7 +23996,9 @@
  142.112.212.166
  142.112.81.183
  142.113.242.241
+142.114.208.141
  142.118.170.95
+142.126.123.118
  142.126.166.36
  142.126.189.53
  142.126.213.173
@@ -24360,6 +24009,7 @@
  142.165.133.55
  142.169.145.97
  142.179.224.4
+142.190.12.250
  142.190.28.198
  142.202.191.182
  142.202.205.28
@@ -24370,16 +24020,15 @@
  142.4.16.20
  142.4.197.12
  142.4.197.80
+142.4.204.122
  142.4.209.205
  142.4.211.170
  142.4.212.121
-142.4.214.151
  142.4.215.194
  142.4.223.125
  142.4.223.249
  142.4.23.62
  142.4.26.59
-142.4.4.229
  142.4.6.57
  142.4.9.189
  142.44.133.80
@@ -24411,8 +24060,8 @@
  142.44.246.156
  142.44.247.154
  142.44.247.57
-142.44.247.60
  142.47.219.175
+142.47.219.176
  142.47.96.16
  142.54.161.10
  142.54.164.58
@@ -24439,7 +24088,6 @@
  142.91.62.232
  142.91.62.251
  142.93.0.252
-142.93.1.168
  142.93.100.171
  142.93.101.111
  142.93.101.148
@@ -24457,6 +24105,7 @@
  142.93.11.169
  142.93.11.193
  142.93.112.194
+142.93.112.222
  142.93.112.49
  142.93.113.143
  142.93.113.159
@@ -24477,10 +24126,10 @@
  142.93.137.184
  142.93.138.116
  142.93.143.85
-142.93.145.85
  142.93.146.198
  142.93.147.210
  142.93.148.250
+142.93.151.119
  142.93.152.19
  142.93.159.172
  142.93.160.101
@@ -24489,6 +24138,7 @@
  142.93.171.37
  142.93.172.70
  142.93.178.254
+142.93.179.72
  142.93.179.74
  142.93.18.203
  142.93.181.21
@@ -24499,13 +24149,11 @@
  142.93.188.38
  142.93.191.107
  142.93.191.96
-142.93.193.198
  142.93.194.76
  142.93.195.157
  142.93.196.13
  142.93.197.100
  142.93.197.12
-142.93.197.186
  142.93.198.209
  142.93.200.9
  142.93.201.1
@@ -24519,6 +24167,7 @@
  142.93.208.24
  142.93.21.188
  142.93.210.229
+142.93.211.192
  142.93.211.36
  142.93.212.10
  142.93.212.91
@@ -24527,6 +24176,8 @@
  142.93.215.19
  142.93.215.211
  142.93.216.97
+142.93.218.225
+142.93.221.175
  142.93.222.121
  142.93.223.118
  142.93.223.152
@@ -24534,6 +24185,7 @@
  142.93.225.68
  142.93.228.111
  142.93.23.235
+142.93.231.137
  142.93.235.47
  142.93.236.246
  142.93.239.251
@@ -24550,10 +24202,10 @@
  142.93.245.242
  142.93.245.246
  142.93.245.253
+142.93.247.104
  142.93.248.50
  142.93.250.60
  142.93.251.1
-142.93.253.189
  142.93.255.200
  142.93.3.119
  142.93.30.86
@@ -24572,9 +24224,11 @@
  142.93.45.249
  142.93.45.250
  142.93.49.148
+142.93.49.150
  142.93.50.179
  142.93.50.47
  142.93.52.3
+142.93.56.57
  142.93.57.255
  142.93.58.103
  142.93.58.113
@@ -24610,19 +24264,18 @@
  142.93.98.195
  142.ip-164-132-197.eu
  1423-thurman.com
-143.0.177.189
  143.0.177.198
  143.0.178.142
  143.0.179.55
+143.0.36.58
  143.0.85.206
  143.0.87.101
  143.110.128.19
-143.110.137.82
-143.110.144.139
-143.110.146.52
  143.110.147.13
  143.110.151.242
  143.110.153.150
+143.110.153.192
+143.110.153.37
  143.110.157.115
  143.110.157.215
  143.110.158.176
@@ -24645,6 +24298,7 @@
  143.110.190.26
  143.110.208.158
  143.110.210.25
+143.110.214.214
  143.110.216.174
  143.110.216.20
  143.110.224.56
@@ -24668,7 +24322,6 @@
  143.110.252.124
  143.110.252.127
  143.110.253.196
-143.110.255.26
  143.125.235.2
  143.137.125.74
  143.137.125.82
@@ -24682,7 +24335,6 @@
  143.159.73.171
  143.176.224.104
  143.178.100.54
-143.178.139.0
  143.178.39.248
  143.178.44.93
  143.178.57.3
@@ -24691,44 +24343,38 @@
  143.202.136.55
  143.202.154.37
  143.202.160.10
+143.202.178.141
  143.202.189.217
  143.202.226.149
  143.202.226.151
  143.202.226.21
+143.202.226.242
  143.202.227.106
  143.202.227.127
  143.202.227.191
  143.202.227.34
  143.202.227.4
-143.202.78.71
  143.202.97.193
+143.208.193.161
  143.208.236.204
-143.208.248.135
-143.208.249.223
  143.208.71.174
  143.225.81.253
-143.244.39.158
  143.244.39.208
  143.244.39.220
-143.244.40.222
-143.244.41.42
+143.244.40.41
  143.244.41.59
  143.244.43.151
  143.244.43.91
-143.244.51.84
  143.244.54.16
  143.244.54.160
-143.244.54.36
  143.244.54.86
  143.244.56.227
  143.244.57.105
-143.244.57.113
+143.244.57.109
  143.244.57.115
  143.244.57.123
-143.244.57.155
  143.244.57.74
  143.248.144.60
-143.248.194.113
  143.255.108.173
  143.255.111.32
  143.255.128.38
@@ -24742,7 +24388,7 @@
  143.255.52.195
  143.255.52.198
  143.255.52.67
-143.255.54.245
+143.255.54.244
  143.255.86.242
  143.59.208.91
  143.89.60.134
@@ -24754,6 +24400,7 @@
  143.92.51.14
  143.92.51.20
  143.92.51.26
+143.92.51.33
  143.92.51.87
  143.92.51.90
  143.92.51.91
@@ -24764,6 +24411,7 @@
  143.95.156.174
  144.121.29.100
  144.123.160.137
+144.123.160.145
  144.123.160.165
  144.123.5.178
  144.126.197.136
@@ -24791,7 +24439,6 @@
  144.163.92.28
  144.168.138.70
  144.168.164.26
-144.168.166.204
  144.168.202.119
  144.168.202.125
  144.168.202.15
@@ -24871,18 +24518,13 @@
  144.217.105.118
  144.217.105.209
  144.217.117.146
-144.217.117.22
  144.217.12.237
  144.217.12.95
  144.217.128.227
-144.217.129.123
-144.217.129.132
-144.217.129.143
-144.217.129.146
-144.217.129.148
  144.217.13.109
  144.217.13.183
  144.217.13.40
+144.217.14.197
  144.217.145.161
  144.217.145.167
  144.217.146.173
@@ -24894,6 +24536,7 @@
  144.217.162.255
  144.217.165.100
  144.217.165.143
+144.217.183.134
  144.217.190.197
  144.217.190.215
  144.217.191.227
@@ -24905,7 +24548,6 @@
  144.217.245.243
  144.217.252.18
  144.217.29.74
-144.217.32.16
  144.217.50.88
  144.217.54.7
  144.217.60.211
@@ -24966,6 +24608,7 @@
  144.48.9.207
  144.64.59.185
  144.7.116.1
+144.7.116.27
  144.76.1.155
  144.76.1.20
  144.76.100.21
@@ -24988,9 +24631,11 @@
  144.76.138.23
  144.76.15.232
  144.76.15.240
+144.76.152.70
  144.76.156.185
  144.76.158.79
  144.76.16.52
+144.76.162.205
  144.76.162.37
  144.76.163.213
  144.76.164.43
@@ -25027,6 +24672,7 @@
  144.76.45.132
  144.76.56.36
  144.76.58.227
+144.76.59.47
  144.76.60.163
  144.76.60.200
  144.76.61.21
@@ -25037,12 +24683,14 @@
  144.76.64.79
  144.76.67.215
  144.76.71.116
+144.76.71.176
  144.76.73.3
  144.76.75.28
  144.76.76.109
  144.76.78.232
  144.76.79.153
  144.76.8.132
+144.76.8.98
  144.76.80.151
  144.76.81.185
  144.76.81.194
@@ -25051,6 +24699,7 @@
  144.76.82.166
  144.76.9.243
  144.76.92.36
+144.76.92.50
  144.76.93.214
  144.76.93.46
  144.76.98.163
@@ -25060,18 +24709,17 @@
  144.91.104.155
  144.91.110.244
  144.91.111.114
+144.91.115.46
  144.91.116.126
  144.91.116.146
  144.91.116.44
  144.91.117.153
  144.91.120.44
  144.91.121.51
-144.91.125.183
  144.91.66.137
  144.91.67.109
  144.91.67.228
  144.91.69.193
-144.91.70.164
  144.91.70.224
  144.91.73.41
  144.91.80.213
@@ -25111,8 +24759,6 @@
  145.239.176.47
  145.239.184.38
  145.239.188.142
-145.239.19.186
-145.239.205.26
  145.239.209.0
  145.239.21.235
  145.239.211.242
@@ -25126,7 +24772,6 @@
  145.239.252.230
  145.239.254.226
  145.239.28.197
-145.239.29.217
  145.239.31.157
  145.239.35.192
  145.239.41.151
@@ -25164,6 +24809,7 @@
  145.249.107.19
  145.249.107.35
  145.249.153.223
+145.249.245.223
  145.249.246.106
  145.253.118.157
  145.253.133.50
@@ -25183,7 +24829,6 @@
  1451.31cf4fdae.com
  1455signinservice.com
  14577.000webhostapp.com
-146.0.228.30
  146.0.36.43
  146.0.36.52
  146.0.43.105
@@ -25202,9 +24847,9 @@
  146.0.78.51
  146.115.130.46
  146.115.48.98
-146.120.175.254
  146.120.197.77
  146.120.215.106
+146.120.244.64
  146.135.3.8
  146.135.33.226
  146.135.41.194
@@ -25216,7 +24861,6 @@
  146.148.22.0
  146.148.34.127
  146.148.53.217
-146.148.60.173
  146.148.62.138
  146.148.74.142
  146.148.81.93
@@ -25226,8 +24870,6 @@
  146.148.90.200
  146.148.94.196
  146.158.130.171
-146.158.16.71
-146.158.214.53
  146.158.4.134
  146.164.54.5
  146.168.111.70
@@ -25279,7 +24921,6 @@
  146.185.172.229
  146.185.180.57
  146.185.182.59
-146.185.200.104
  146.185.200.105
  146.185.200.106
  146.185.200.122
@@ -25287,6 +24928,8 @@
  146.185.200.133
  146.185.200.134
  146.185.200.136
+146.185.200.145
+146.185.200.146
  146.185.200.147
  146.185.200.148
  146.185.200.153
@@ -25314,7 +24957,6 @@
  146.185.200.230
  146.185.200.233
  146.185.200.25
-146.185.200.30
  146.185.200.33
  146.185.200.44
  146.185.200.61
@@ -25322,9 +24964,10 @@
  146.185.200.81
  146.185.200.99
  146.185.201.115
+146.185.201.82
  146.185.201.84
-146.185.202.207
  146.185.202.211
+146.185.202.76
  146.185.203.34
  146.185.203.69
  146.185.203.70
@@ -25339,12 +24982,12 @@
  146.196.33.169
  146.196.52.200
  146.196.55.156
-146.196.60.58
  146.196.63.192
  146.196.63.66
  146.196.63.89
  146.196.67.88
  146.196.98.202
+146.196.99.250
  146.20.103.191
  146.20.103.208
  146.20.110.77
@@ -25372,7 +25015,6 @@
  146.56.206.116
  146.56.216.83
  146.56.219.98
-146.56.221.75
  146.56.222.82
  146.56.226.92
  146.56.229.128
@@ -25398,9 +25040,11 @@
  146.59.158.228
  146.59.159.162
  146.59.16.121
+146.59.16.203
  146.59.17.99
+146.59.193.158
  146.59.196.252
-146.59.203.78
+146.59.199.43
  146.59.225.194
  146.59.225.195
  146.59.225.221
@@ -25409,7 +25053,6 @@
  146.59.236.232
  146.59.3.125
  146.59.3.161
-146.59.3.182
  146.66.194.20
  146.71.112.18
  146.71.77.244
@@ -25418,6 +25061,7 @@
  146.71.79.230
  146.83.216.186
  146.83.222.25
+146.88.240.4
  1469-squid.com
  147.114.226.194
  147.135.1.79
@@ -25434,7 +25078,6 @@
  147.135.135.111
  147.135.136.241
  147.135.136.53
-147.135.143.46
  147.135.147.28
  147.135.153.152
  147.135.156.72
@@ -25443,6 +25086,8 @@
  147.135.173.134
  147.135.173.235
  147.135.173.238
+147.135.20.224
+147.135.20.229
  147.135.203.181
  147.135.207.246
  147.135.211.59
@@ -25454,39 +25099,33 @@
  147.135.39.240
  147.135.6.179
  147.135.76.206
-147.135.79.86
  147.139.134.59
  147.139.135.160
  147.139.138.116
  147.139.160.218
  147.139.163.83
+147.139.166.130
+147.139.167.155
  147.139.168.106
  147.139.168.137
  147.139.168.215
  147.139.169.213
  147.139.172.122
+147.139.174.29
  147.139.177.71
  147.139.180.46
-147.139.181.138
  147.139.181.53
  147.139.182.9
  147.139.184.149
  147.139.189.77
  147.139.192.26
-147.139.195.117
  147.139.29.173
-147.139.30.243
  147.139.31.203
  147.139.31.22
-147.139.32.95
-147.139.33.16
-147.139.34.79
  147.139.37.49
  147.139.4.177
-147.139.40.48
  147.139.5.254
  147.139.6.198
-147.139.6.41
  147.139.6.68
  147.139.6.81
  147.147.231.166
@@ -25498,18 +25137,18 @@
  147.27.70.36
  147.30.82.136
  147.32.117.195
-147.75.114.170
  147.75.118.236
+147.75.118.239
  147.75.124.130
  147.78.65.253
  147.83.195.55
  147.83.72.199
  147.91.111.130
+147.91.111.133
  1475a390633025231.temporary.link
  1477304571.storage.googleapis.com
  148.0.237.76
  148.0.40.231
-148.101.169.71
  148.102.22.76
  148.103.51.2
  148.103.9.41
@@ -25522,8 +25161,8 @@
  148.163.65.162
  148.170.212.44
  148.202.223.222
+148.204.63.209
  148.204.63.249
-148.215.30.116
  148.217.94.54
  148.222.44.20
  148.223.120.122
@@ -25540,8 +25179,6 @@
  148.243.72.112
  148.244.221.148
  148.245.13.21
-148.245.79.114
-148.245.79.115
  148.251.105.254
  148.251.110.53
  148.251.110.54
@@ -25563,6 +25200,7 @@
  148.251.2.82
  148.251.205.45
  148.251.208.48
+148.251.212.129
  148.251.22.104
  148.251.22.209
  148.251.233.162
@@ -25587,8 +25225,7 @@
  148.251.84.22
  148.251.87.112
  148.255.117.29
-148.255.32.77
-148.3.247.160
+148.63.141.80
  148.63.215.173
  148.66.129.194
  148.66.132.190
@@ -25612,6 +25249,7 @@
  148.66.57.202
  148.66.58.138
  148.66.63.202
+148.67.187.124
  148.69.222.213
  148.70.100.119
  148.70.102.225
@@ -25626,7 +25264,6 @@
  148.70.149.39
  148.70.152.56
  148.70.153.21
-148.70.154.166
  148.70.178.70
  148.70.185.36
  148.70.195.242
@@ -25641,13 +25278,13 @@
  148.70.31.188
  148.70.33.136
  148.70.38.183
-148.70.53.219
  148.70.70.55
  148.70.76.237
  148.70.77.116
  148.70.84.202
+148.70.89.212
+148.71.91.250
  148.72.105.246
-148.72.108.218
  148.72.160.176
  148.72.170.171
  148.72.202.188
@@ -25666,6 +25303,7 @@
  148.72.232.107
  148.72.232.125
  148.72.232.128
+148.72.232.133
  148.72.232.141
  148.72.232.154
  148.72.232.35
@@ -25685,23 +25323,22 @@
  149.115.56.169
  149.129.101.217
  149.129.102.110
-149.129.106.113
  149.129.118.133
-149.129.129.91
+149.129.130.134
  149.129.136.55
-149.129.137.193
  149.129.139.95
  149.129.173.204
  149.129.174.48
-149.129.176.46
  149.129.181.53
  149.129.182.216
  149.129.184.49
+149.129.186.98
  149.129.188.225
  149.129.190.133
  149.129.191.88
  149.129.220.95
  149.129.222.49
+149.129.222.54
  149.129.222.60
  149.129.226.135
  149.129.227.63
@@ -25710,30 +25347,28 @@
  149.129.234.168
  149.129.236.66
  149.129.237.83
+149.129.240.8
  149.129.242.144
+149.129.244.23
  149.129.244.83
+149.129.245.133
+149.129.246.222
  149.129.246.35
  149.129.248.95
-149.129.249.105
  149.129.251.152
  149.129.251.229
  149.129.252.182
  149.129.254.65
  149.129.255.180
-149.129.34.80
-149.129.36.10
+149.129.32.227
  149.129.48.241
-149.129.54.136
  149.129.56.121
  149.129.57.134
  149.129.57.246
-149.129.59.96
  149.129.61.164
-149.129.62.226
  149.129.69.210
  149.129.90.72
  149.129.95.189
-149.129.97.102
  149.167.99.190
  149.172.44.233
  149.20.241.11
@@ -25763,7 +25398,6 @@
  149.202.19.93
  149.202.190.73
  149.202.192.164
-149.202.195.106
  149.202.200.42
  149.202.201.119
  149.202.206.206
@@ -25800,7 +25434,6 @@
  149.202.87.175
  149.202.89.125
  149.202.93.136
-149.202.99.18
  149.210.143.165
  149.210.155.74
  149.210.160.125
@@ -25815,19 +25448,17 @@
  149.248.8.73
  149.248.9.85
  149.255.154.62
-149.255.210.18
  149.255.36.133
  149.255.36.156
-149.255.59.10
+149.255.59.14
  149.255.60.161
-149.255.60.167
+149.255.62.61
  149.255.62.89
  149.28.112.35
  149.28.113.236
  149.28.117.43
  149.28.118.60
  149.28.129.59
-149.28.130.171
  149.28.132.214
  149.28.132.27
  149.28.137.189
@@ -25859,6 +25490,7 @@
  149.28.39.130
  149.28.43.92
  149.28.46.48
+149.28.52.85
  149.28.54.28
  149.28.57.128
  149.28.58.44
@@ -25874,6 +25506,7 @@
  149.3.110.195
  149.3.124.112
  149.3.124.17
+149.3.124.194
  149.3.124.31
  149.3.124.38
  149.3.170.197
@@ -25907,6 +25540,7 @@
  149.56.133.137
  149.56.133.146
  149.56.134.106
+149.56.14.34
  149.56.141.170
  149.56.147.33
  149.56.151.196
@@ -25915,6 +25549,7 @@
  149.56.19.4
  149.56.192.110
  149.56.202.35
+149.56.205.74
  149.56.22.52
  149.56.223.104
  149.56.223.241
@@ -25925,7 +25560,6 @@
  149.56.31.218
  149.56.38.93
  149.56.41.33
-149.56.43.106
  149.56.44.101
  149.56.44.47
  149.56.47.75
@@ -25938,11 +25572,10 @@
  149.62.172.62
  149.62.173.247
  149.62.41.187
-149.71.33.181
  149.71.33.45
  149.72.139.182
-149.72.198.96
-149.72.242.87
+149.72.91.236
+149.72.91.245
  149.74.120.231
  149.81.153.3
  149.81.157.0
@@ -25993,7 +25626,6 @@
  15.188.90.29
  15.206.146.144
  15.206.84.150
-15.207.100.181
  15.207.108.70
  15.207.111.189
  15.207.116.17
@@ -26010,6 +25642,7 @@
  15.237.106.19
  15.237.117.105
  15.237.122.75
+15.237.143.255
  15.237.37.136
  15.237.51.173
  15.4buyuklergazete.com
@@ -26068,14 +25701,15 @@
  150.129.182.164
  150.129.201.30
  150.129.207.72
+150.129.207.75
  150.129.250.28
  150.129.52.74
  150.129.54.111
  150.129.55.121
-150.129.62.128
  150.129.8.10
  150.129.8.32
  150.129.8.7
+150.131.192.215
  150.136.116.126
  150.136.12.28
  150.136.127.89
@@ -26094,20 +25728,19 @@
  150.136.246.125
  150.136.248.42
  150.136.31.34
-150.136.37.217
  150.136.40.83
-150.136.45.46
+150.136.43.67
  150.136.62.105
  150.138.106.174
  150.138.118.252
  150.138.178.18
  150.138.253.71
-150.138.253.72
  150.138.253.73
  150.139.210.20
  150.158.106.129
  150.158.110.112
  150.158.110.142
+150.158.110.27
  150.158.112.154
  150.158.113.106
  150.158.114.97
@@ -26163,8 +25796,8 @@
  150.187.5.100
  150.223.13.155
  150.238.224.237
-150.238.79.79
  150.242.14.126
+150.242.14.129
  150.242.182.98
  150.242.219.5
  150.242.24.152
@@ -26185,7 +25818,6 @@
  150.95.152.96
  150.95.153.82
  150.95.156.45
-150.95.175.155
  150.95.177.195
  150.95.177.30
  150.95.180.105
@@ -26255,9 +25887,8 @@
  151.115.62.212
  151.124.247.200
  151.13.11.231
-151.16.130.78
  151.16.51.170
-151.177.55.66
+151.177.163.87
  151.182.44.17
  151.192.146.239
  151.196.45.109
@@ -26267,7 +25898,10 @@
  151.21.25.125
  151.217.31.131
  151.226.56.87
+151.227.79.216
  151.228.114.115
+151.234.33.41
+151.236.175.213
  151.236.193.195
  151.236.218.195
  151.236.38.234
@@ -26275,7 +25909,6 @@
  151.236.59.246
  151.236.60.57
  151.237.177.251
-151.237.179.151
  151.237.179.42
  151.237.180.21
  151.237.180.24
@@ -26286,53 +25919,52 @@
  151.237.189.246
  151.237.36.220
  151.237.80.166
-151.247.244.199
  151.248.114.191
  151.248.116.116
  151.248.116.75
+151.248.126.32
  151.248.157.162
  151.248.168.243
  151.248.63.172
  151.248.63.232
+151.248.63.243
  151.248.63.87
-151.25.79.95
-151.251.4.31
  151.253.125.136
  151.253.125.137
  151.253.128.234
+151.26.239.158
  151.27.234.155
  151.31.95.207
-151.34.136.46
-151.34.198.112
+151.33.143.79
+151.34.168.159
  151.34.205.22
-151.34.81.81
-151.34.94.165
  151.36.34.194
  151.36.62.86
  151.36.67.0
-151.38.75.253
-151.38.86.112
-151.40.192.170
+151.38.168.236
+151.38.194.46
+151.38.220.27
+151.40.30.31
  151.41.170.30
  151.42.253.255
-151.44.11.72
  151.46.48.164
  151.46.56.202
  151.48.178.239
+151.49.205.95
  151.50.97.232
  151.51.121.187
-151.54.127.27
+151.51.140.82
  151.55.117.0
  151.55.84.241
-151.62.10.149
+151.57.166.114
+151.57.169.206
  151.62.133.224
+151.62.27.225
  151.62.29.168
  151.62.32.182
-151.62.73.67
+151.62.69.33
  151.64.209.157
-151.68.133.73
  151.69.170.146
-151.69.206.10
  151.70.64.197
  151.76.192.38
  151.80.100.80
@@ -26380,6 +26012,7 @@
  151.80.19.210
  151.80.194.190
  151.80.195.190
+151.80.196.163
  151.80.197.192
  151.80.198.243
  151.80.198.255
@@ -26400,6 +26033,7 @@
  151.80.40.72
  151.80.41.169
  151.80.41.64
+151.80.42.72
  151.80.44.115
  151.80.44.163
  151.80.46.19
@@ -26422,7 +26056,8 @@
  151.80.9.153
  151.80.96.140
  151.80.99.2
-151.84.122.105
+151.82.41.135
+151.95.135.178
  151.rs
  151051-dot-n-e-w-me-ss-age-po-rt-al.wl.r.appspot.com
  151114327519139.002.sh.cn
@@ -26431,7 +26066,6 @@
  152.0.4.193
  152.114.1.50
  152.115.191.196
-152.136.101.207
  152.136.101.65
  152.136.104.227
  152.136.107.190
@@ -26442,6 +26076,7 @@
  152.136.114.118
  152.136.116.72
  152.136.122.172
+152.136.125.127
  152.136.125.31
  152.136.125.49
  152.136.128.30
@@ -26449,10 +26084,12 @@
  152.136.131.242
  152.136.131.68
  152.136.133.109
+152.136.133.117
  152.136.134.77
  152.136.137.130
  152.136.138.231
  152.136.139.211
+152.136.141.231
  152.136.145.200
  152.136.145.235
  152.136.149.160
@@ -26461,11 +26098,11 @@
  152.136.17.25
  152.136.179.135
  152.136.183.147
+152.136.184.12
  152.136.184.156
  152.136.187.161
  152.136.19.170
  152.136.195.211
-152.136.196.155
  152.136.203.208
  152.136.204.118
  152.136.204.182
@@ -26490,8 +26127,6 @@
  152.136.25.133
  152.136.252.237
  152.136.254.204
-152.136.29.104
-152.136.34.209
  152.136.41.189
  152.136.43.147
  152.136.54.176
@@ -26500,15 +26135,17 @@
  152.136.97.217
  152.136.98.165
  152.136.98.80
-152.165.38.171
  152.168.115.218
  152.168.198.221
+152.168.217.64
+152.168.230.130
  152.168.79.196
  152.169.106.145
  152.169.132.194
  152.169.169.235
  152.169.204.66
  152.169.22.67
+152.169.229.67
  152.169.32.143
  152.170.144.179
  152.170.66.244
@@ -26529,13 +26166,13 @@
  152.231.68.18
  152.231.89.226
  152.231.93.130
-152.242.78.67
+152.249.244.169
  152.250.165.189
  152.26.66.140
  152.30.238.184
+152.32.112.155
  152.32.112.199
  152.32.128.103
-152.32.128.40
  152.32.129.119
  152.32.129.40
  152.32.130.121
@@ -26550,6 +26187,7 @@
  152.32.172.162
  152.32.173.36
  152.32.186.206
+152.32.190.160
  152.32.190.172
  152.32.201.49
  152.32.209.98
@@ -26559,7 +26197,6 @@
  152.32.214.84
  152.32.215.75
  152.32.222.239
-152.32.226.205
  152.32.239.166
  152.32.240.177
  152.32.243.114
@@ -26571,6 +26208,7 @@
  152.32.99.169
  152.44.135.18
  152.57.210.118
+152.57.90.50
  152.67.0.123
  152.67.1.245
  152.67.16.49
@@ -26579,6 +26217,8 @@
  152.67.188.191
  152.67.188.75
  152.67.224.67
+152.67.233.235
+152.67.233.62
  152.67.24.187
  152.67.25.98
  152.67.35.185
@@ -26588,14 +26228,12 @@
  152.89.162.39
  152.89.239.104
  152.89.239.115
-152.89.239.120
  152.89.239.197
  152.89.239.85
  152.89.245.248
  152.89.62.59
  152asyabahis.com
  153.0.225.56
-153.101.146.183
  153.101.29.178
  153.101.37.132
  153.101.57.34
@@ -26626,9 +26264,7 @@
  153.183.25.24
  153.19.105.97
  153.19.33.231
-153.19.70.33
  153.228.254.113
-153.246.145.238
  153.3.118.131
  153.3.124.100
  153.3.124.101
@@ -26638,7 +26274,6 @@
  153.3.37.6
  153.3.39.83
  153.3.45.8
-153.3.97.127
  153.3.99.51
  153.3.99.51bin.sh
  153.34.214.210
@@ -26648,14 +26283,15 @@
  153.34.67.119bin.sh
  153.35.110.21
  153.35.93.175
-153.36.112.104
  153.36.134.186
  153.36.134.88
  153.36.14.49
  153.36.169.227
  153.36.19.36
  153.36.23.219
+153.36.233.60
  153.37.181.92
+153.92.0.26
  153.92.127.168
  153.92.4.153
  153.92.93.114
@@ -26663,10 +26299,14 @@
  153284594738391.statictab.com
  15333291-5189-4750-a96c-2f9deb7920f7.htmlcomponentservice.com
  153884c0b3f5e35925a6a8b37e6eccb3-dot-maintance-online-pass.ey.r.appspot.com
+154.0.15.166
  154.0.168.252
+154.0.170.103
  154.0.175.203
  154.0.8.2
+154.103.39.32
  154.113.1.142
+154.113.100.34
  154.113.16.226
  154.117.143.126
  154.117.154.86
@@ -26676,13 +26316,14 @@
  154.117.176.102
  154.118.52.216
  154.119.79.254
-154.12.162.29
  154.120.133.190
  154.120.227.206
  154.120.232.182
+154.120.65.198
+154.120.97.32
  154.124.113.255
  154.124.202.71
-154.124.217.118
+154.124.224.150
  154.126.32.138
  154.127.113.242
  154.127.120.18
@@ -26692,6 +26333,7 @@
  154.127.52.102
  154.127.82.66
  154.127.89.100
+154.16.10.248
  154.16.113.203
  154.16.136.119
  154.16.137.132
@@ -26711,27 +26353,22 @@
  154.16.46.172
  154.16.48.215
  154.16.49.148
-154.16.50.223
-154.16.52.216
  154.16.53.2
  154.16.55.20
  154.16.55.28
  154.16.55.79
  154.16.56.220
-154.16.62.135
  154.16.69.103
  154.16.69.31
  154.16.70.152
  154.16.84.179
  154.16.86.188
-154.160.11.99
-154.160.7.217
  154.160.73.154
  154.160.74.186
-154.160.74.91
-154.176.144.71
-154.178.111.157
-154.181.185.106
+154.178.248.253
+154.178.27.193
+154.178.45.148
+154.178.74.214
  154.198.2.4
  154.20.227.115
  154.202.3.44
@@ -26742,7 +26379,10 @@
  154.209.4.76
  154.209.5.156
  154.209.69.123
+154.21.23.172
+154.211.12.167
  154.211.14.244
+154.213.19.2
  154.213.22.34
  154.213.58.193
  154.213.58.194
@@ -26998,22 +26638,26 @@
  154.221.19.204
  154.221.20.14
  154.221.21.119
+154.221.21.44
  154.221.21.94
  154.221.22.234
  154.221.25.187
  154.221.26.69
+154.221.27.251
  154.221.27.252
+154.221.28.73
  154.221.30.33
  154.221.81.198
  154.223.189.86
  154.232.45.195
  154.236.168.187
+154.238.187.35
  154.238.60.129
  154.239.165.212
  154.239.183.48
  154.239.204.244
-154.239.238.26
  154.27.78.81
+154.3.251.149
  154.3.40.111
  154.3.40.211
  154.34.24.212
@@ -27022,6 +26666,7 @@
  154.57.3.132
  154.58.23.3bin.sh
  154.61.227.8
+154.61.227.9
  154.65.14.19
  154.66.107.148
  154.66.107.189
@@ -27035,9 +26680,7 @@
  154.66.241.27
  154.66.245.47
  154.67.123.189
-154.67.128.72
  154.67.143.229
-154.67.232.141
  154.70.158.97
  154.70.208.66
  154.70.236.33
@@ -27045,10 +26688,11 @@
  154.70.236.36
  154.70.32.103
  154.72.154.74
-154.72.160.13
+154.72.168.56
  154.72.187.26
  154.72.192.26
  154.72.197.106
+154.72.199.202
  154.72.199.38
  154.72.201.190
  154.72.202.6
@@ -27056,7 +26700,6 @@
  154.72.204.122
  154.72.204.78
  154.72.21.96
-154.72.25.129
  154.72.48.214
  154.72.63.84
  154.72.87.166
@@ -27084,8 +26727,10 @@
  154.79.244.62
  154.79.244.66
  154.79.246.178
+154.79.248.124
  154.79.250.100
  154.79.252.214
+154.79.252.70
  154.79.254.112
  154.79.254.136
  154.79.254.152
@@ -27093,7 +26738,6 @@
  154.79.254.164
  154.79.254.170
  154.79.254.176
-154.79.254.178
  154.79.254.206
  154.8.136.57
  154.8.137.54
@@ -27127,12 +26771,14 @@
  154.83.15.91
  154.83.17.77
  154.83.17.97
+154.85.189.174
  154.85.48.199
  154.85.48.8
  154.85.50.239
  154.85.55.166
  154.85.58.45
  154.85.63.225
+154.9.128.91
  154.90.14.41
  154.91.144.44
  154.91.2.187
@@ -27147,6 +26793,7 @@
  155.0.181.254
  155.0.202.254
  155.133.131.208
+155.133.28.11
  155.133.83.1
  155.133.83.109
  155.133.83.117
@@ -27158,10 +26805,8 @@
  155.138.147.151
  155.138.160.156
  155.138.160.98
-155.138.164.14
  155.138.197.254
  155.138.217.118
-155.138.221.19
  155.138.222.174
  155.138.224.233
  155.138.234.174
@@ -27170,7 +26815,7 @@
  155.186.0.121
  155.186.9.160
  155.230.25.100
-155.235.128.55
+155.235.128.4
  155.235.128.9
  155.254.28.168
  155.254.35.8
@@ -27182,20 +26827,20 @@
  155.93.109.218
  155.94.129.148
  155.94.131.150
+155.94.141.86
  155.94.145.193
  155.94.156.150
  155.94.166.23
-155.94.178.96
  155.94.194.105
  155.94.224.207
  155.94.240.231
-155.94.240.79
  155.94.67.7
  155.94.89.2
  155.ip-51-161-9.net
  1552477-dot-n-e-w-me-ss-age-po-rt-al.wl.r.appspot.com
  155361.streeteone.com
  15565556239457741.us-south.cf.appdomain.cloud
+156.0.213.17
  156.0.229.194
  156.146.34.65
  156.146.35.2
@@ -27204,24 +26849,20 @@
  156.146.36.110
  156.146.37.43
  156.146.37.57
+156.146.37.73
  156.146.51.128
  156.146.51.20
+156.146.55.222
  156.146.57.38
  156.146.59.76
+156.146.63.102
  156.155.163.232
  156.17.36.188
  156.19.19.90
-156.193.129.132
-156.202.225.129
-156.203.200.221
  156.204.201.135
-156.204.99.14
-156.205.250.242
  156.212.108.176
-156.215.94.148
  156.219.87.189
  156.220.253.28
-156.222.176.52
  156.223.27.113
  156.234.193.161
  156.234.201.139
@@ -27241,7 +26882,6 @@
  156.253.5.120
  156.255.213.198
  156.34.231.124
-156.38.91.121
  156.54.148.152
  156.67.106.36
  156.67.115.5
@@ -27253,11 +26893,9 @@
  156.96.118.179
  156.96.118.48
  156.96.118.58
+156.96.128.247
  156.96.150.5
  156.96.151.236
-156.96.155.227
-156.96.155.239
-156.96.155.248
  156.96.157.99
  156.96.48.136
  156.96.48.220
@@ -27268,6 +26906,7 @@
  157.0.134.164
  157.100.230.82
  157.119.117.22
+157.119.177.243
  157.119.186.174
  157.119.207.36
  157.119.222.180
@@ -27287,7 +26926,6 @@
  157.131.200.187
  157.138.20.22
  157.147.119.184
-157.147.76.151
  157.175.40.136
  157.175.40.167
  157.175.43.181
@@ -27314,7 +26952,6 @@
  157.230.100.112
  157.230.100.192
  157.230.106.184
-157.230.109.166
  157.230.109.55
  157.230.109.64
  157.230.111.209
@@ -27322,7 +26959,6 @@
  157.230.115.139
  157.230.115.150
  157.230.116.65
-157.230.118.118
  157.230.118.87
  157.230.12.188
  157.230.12.231
@@ -27349,6 +26985,7 @@
  157.230.16.205
  157.230.16.91
  157.230.163.6
+157.230.164.216
  157.230.166.98
  157.230.180.187
  157.230.189.177
@@ -27357,7 +26994,6 @@
  157.230.2.161
  157.230.2.208
  157.230.209.141
-157.230.209.186
  157.230.210.84
  157.230.211.219
  157.230.216.126
@@ -27374,13 +27010,13 @@
  157.230.233.211
  157.230.234.93
  157.230.238.19
-157.230.24.117
  157.230.244.46
  157.230.245.91
  157.230.249.202
  157.230.249.74
  157.230.251.115
  157.230.251.239
+157.230.251.61
  157.230.251.62
  157.230.252.123
  157.230.252.128
@@ -27393,6 +27029,7 @@
  157.230.36.200
  157.230.38.102
  157.230.38.150
+157.230.40.120
  157.230.42.155
  157.230.42.191
  157.230.42.76
@@ -27406,13 +27043,13 @@
  157.230.5.169
  157.230.54.248
  157.230.55.177
-157.230.57.43
  157.230.58.223
  157.230.6.213
  157.230.62.50
  157.230.63.81
  157.230.7.236
  157.230.80.232
+157.230.83.145
  157.230.89.219
  157.230.9.227
  157.230.90.18
@@ -27432,7 +27069,6 @@
  157.245.104.19
  157.245.106.153
  157.245.108.35
-157.245.109.207
  157.245.109.222
  157.245.113.214
  157.245.12.107
@@ -27468,6 +27104,7 @@
  157.245.201.109
  157.245.201.119
  157.245.203.130
+157.245.212.120
  157.245.212.8
  157.245.218.45
  157.245.221.93
@@ -27475,10 +27112,10 @@
  157.245.227.165
  157.245.230.59
  157.245.230.64
-157.245.231.45
  157.245.233.164
  157.245.235.243
  157.245.238.196
+157.245.239.174
  157.245.241.179
  157.245.242.125
  157.245.242.172
@@ -27489,11 +27126,11 @@
  157.245.253.245
  157.245.32.33
  157.245.35.47
+157.245.38.42
  157.245.39.243
  157.245.5.133
  157.245.5.202
  157.245.53.23
-157.245.54.200
  157.245.55.32
  157.245.6.58
  157.245.60.215
@@ -27521,20 +27158,16 @@
  157.25.197.74
  157.25.23.231
  157.32.183.125
-157.32.248.104
-157.35.239.150
  157.38.18.55
-157.38.38.149
-157.41.107.4
-157.41.143.186
-157.41.30.224
-157.42.102.41
-157.42.118.237
  157.42.206.1
  157.44.64.76
-157.47.248.178
+157.45.162.19
+157.45.168.108
+157.45.182.84
+157.45.187.220
+157.45.187.244
+157.45.191.103
  157.52.151.84
-157.52.185.94
  157.52.252.12
  157.52.252.141
  157.52.252.4
@@ -27669,6 +27302,7 @@
  157.7.188.97
  157.7.211.107
  157.90.21.130
+157.90.50.193
  157.92.13.105
  157.92.13.155
  157.92.49.151
@@ -27681,8 +27315,6 @@
  158.101.108.255
  158.101.12.235
  158.101.165.14
-158.101.19.129
-158.101.227.39
  158.101.7.100
  158.106.211.78
  158.106.67.181
@@ -27691,8 +27323,10 @@
  158.110.145.243
  158.129.140.201
  158.130.48.250
+158.140.126.65
  158.140.137.186
  158.140.144.78
+158.140.167.148
  158.140.169.104
  158.140.173.212
  158.140.174.37
@@ -27700,6 +27334,7 @@
  158.140.182.24
  158.170.64.23
  158.174.122.199
+158.174.166.88
  158.174.213.128
  158.174.231.241
  158.174.239.183
@@ -27708,6 +27343,7 @@
  158.174.61.67
  158.175.132.168
  158.181.125.150
+158.181.149.152
  158.181.18.158
  158.181.226.33
  158.199.195.169
@@ -27721,10 +27357,11 @@
  158.222.4.202
  158.222.6.143
  158.222.6.61
+158.222.8.238
  158.248.198.75
-158.248.41.12
  158.255.213.71
  158.255.23.146
+158.255.249.215
  158.255.249.58
  158.255.31.93
  158.255.51.213
@@ -27734,8 +27371,10 @@
  158.255.7.49
  158.46.127.222
  158.51.121.163
+158.51.121.174
  158.51.121.98
  158.51.124.112
+158.51.201.249
  158.51.97.132
  158.58.131.27
  158.58.133.106
@@ -27748,6 +27387,8 @@
  158.69.0.200
  158.69.100.192
  158.69.100.194
+158.69.107.80
+158.69.107.82
  158.69.110.31
  158.69.116.169
  158.69.118.130
@@ -27764,7 +27405,6 @@
  158.69.162.70
  158.69.165.176
  158.69.170.217
-158.69.170.61
  158.69.173.134
  158.69.192.200
  158.69.192.35
@@ -27773,6 +27413,7 @@
  158.69.197.49
  158.69.199.225
  158.69.202.69
+158.69.206.125
  158.69.208.5
  158.69.211.201
  158.69.212.126
@@ -27805,9 +27446,9 @@
  158.69.27.201
  158.69.31.229
  158.69.35.227
-158.69.38.243
  158.69.42.209
  158.69.48.64
+158.69.53.211
  158.69.54.200
  158.69.59.241
  158.69.60.138
@@ -27832,14 +27473,13 @@
  158makrobet.com
  159-365.net
  159.0.106.98
+159.0.223.245
  159.100.242.254
  159.100.245.237
  159.100.248.234
  159.100.249.179
  159.100.250.198
-159.100.254.107
  159.100.255.18
-159.118.11.14
  159.122.144.23
  159.122.222.207
  159.122.254.235
@@ -27857,27 +27497,26 @@
  159.148.186.196
  159.148.3.177
  159.148.65.178
+159.180.43.179
  159.192.104.53
  159.192.105.152
  159.192.114.231
  159.192.114.232
+159.192.114.237
  159.192.120.228
  159.192.121.240
  159.192.136.141
  159.192.136.166
-159.192.137.4
  159.192.141.89
  159.192.142.42
  159.192.143.249
  159.192.148.4
-159.192.164.87
+159.192.165.106
  159.192.169.199
  159.192.220.186
-159.192.224.119
  159.192.227.218
-159.192.229.232
+159.192.228.29
  159.192.229.79
-159.192.231.56
  159.192.234.214
  159.192.240.122
  159.192.240.63
@@ -27887,7 +27526,6 @@
  159.192.249.125
  159.192.249.175
  159.192.249.184
-159.192.249.194
  159.192.249.205
  159.192.249.45
  159.192.249.78
@@ -27895,8 +27533,6 @@
  159.192.250.54
  159.192.250.98
  159.192.253.210
-159.192.68.122
-159.192.72.208
  159.192.74.70
  159.192.8.4
  159.192.88.205
@@ -27989,7 +27625,6 @@
  159.203.189.23
  159.203.189.74
  159.203.19.228
-159.203.190.189
  159.203.191.2
  159.203.196.79
  159.203.2.227
@@ -28097,6 +27732,7 @@
  159.203.96.147
  159.203.98.128
  159.217.146.76
+159.224.114.186
  159.224.121.221
  159.224.166.129
  159.224.189.250
@@ -28108,8 +27744,6 @@
  159.224.37.181
  159.226.73.77
  159.242.234.108
-159.242.234.117
-159.242.234.165
  159.242.234.209
  159.246.29.101
  159.246.29.103
@@ -28141,6 +27775,7 @@
  159.253.46.18
  159.253.69.102
  159.253.7.218
+159.253.82.14
  159.255.167.89
  159.255.250.241
  159.65.1.41
@@ -28158,6 +27793,7 @@
  159.65.113.228
  159.65.116.48
  159.65.12.108
+159.65.12.255
  159.65.120.158
  159.65.121.183
  159.65.123.164
@@ -28169,7 +27805,6 @@
  159.65.130.198
  159.65.130.72
  159.65.131.226
-159.65.132.97
  159.65.133.150
  159.65.133.176
  159.65.133.234
@@ -28186,7 +27821,6 @@
  159.65.141.206
  159.65.142.192
  159.65.142.92
-159.65.143.187
  159.65.144.102
  159.65.144.219
  159.65.144.233
@@ -28203,7 +27837,6 @@
  159.65.152.201
  159.65.153.147
  159.65.154.238
-159.65.154.48
  159.65.155.229
  159.65.156.139
  159.65.169.25
@@ -28220,6 +27853,7 @@
  159.65.181.185
  159.65.181.26
  159.65.184.162
+159.65.184.79
  159.65.186.147
  159.65.187.247
  159.65.19.77
@@ -28243,6 +27877,7 @@
  159.65.206.185
  159.65.207.22
  159.65.207.32
+159.65.216.161
  159.65.216.84
  159.65.218.161
  159.65.220.170
@@ -28286,6 +27921,7 @@
  159.65.57.197
  159.65.6.99
  159.65.63.101
+159.65.64.17
  159.65.64.70
  159.65.64.76
  159.65.65.170
@@ -28335,10 +27971,10 @@
  159.69.85.172
  159.69.85.209
  159.75.0.175
-159.75.138.89
  159.75.14.88
  159.75.16.106
  159.75.16.134
+159.75.17.29
  159.75.17.64
  159.75.18.68
  159.75.2.55
@@ -28350,6 +27986,7 @@
  159.75.28.167
  159.75.29.95
  159.75.3.66
+159.75.45.64
  159.8.64.60
  159.8.93.184
  159.82.166.133
@@ -28417,10 +28054,8 @@
  159.89.164.104
  159.89.165.127
  159.89.167.183
-159.89.168.42
  159.89.170.100
  159.89.171.165
-159.89.171.81
  159.89.172.207
  159.89.172.219
  159.89.173.232
@@ -28428,6 +28063,7 @@
  159.89.18.157
  159.89.18.80
  159.89.182.64
+159.89.183.168
  159.89.183.74
  159.89.184.25
  159.89.184.37
@@ -28448,10 +28084,10 @@
  159.89.20.86
  159.89.200.182
  159.89.200.236
+159.89.200.32
  159.89.202.113
  159.89.202.95
  159.89.205.186
-159.89.207.44
  159.89.21.232
  159.89.210.220
  159.89.22.152
@@ -28505,7 +28141,6 @@
  159.89.89.44
  159.89.9.140
  159.89.91.67
-159.89.91.92
  159.89.92.217
  159.89.93.130
  159.89.96.26
@@ -28533,6 +28168,7 @@
  15s4g.xyz
  15uaer.coragem.cf
  15w12pa9khzfq658043xrdgv7e2yi84sb076.xyz
+160.0.203.116
  160.0.203.139
  160.0.203.141
  160.0.203.25
@@ -28541,23 +28177,21 @@
  160.0.203.65
  160.0.203.73
  160.0.203.81
+160.0.217.120
  160.1.93.241
  160.116.0.165
-160.116.0.166
  160.116.0.173
  160.116.0.174
  160.116.0.27
  160.116.0.98
+160.116.0.99
  160.119.128.102
  160.119.128.70
-160.119.130.130
  160.119.131.114
  160.119.211.15
-160.119.235.162
  160.119.254.19
  160.119.50.93
-160.120.150.163
-160.120.177.106
+160.119.66.121
  160.124.14.211
  160.124.140.153
  160.124.156.68
@@ -28567,11 +28201,13 @@
  160.124.236.220
  160.124.236.221
  160.124.236.222
+160.124.49.179
  160.124.49.249
  160.124.50.93
  160.153.146.164
  160.153.146.165
  160.153.146.79
+160.153.147.137
  160.153.147.141
  160.153.147.142
  160.153.147.143
@@ -28580,12 +28216,12 @@
  160.153.147.155
  160.153.147.158
  160.153.147.16
+160.153.147.160
  160.153.147.161
  160.153.147.162
  160.153.147.23
  160.153.147.35
  160.153.147.37
-160.153.153.157
  160.153.153.29
  160.153.153.30
  160.153.153.31
@@ -28593,9 +28229,13 @@
  160.153.154.18
  160.153.154.19
  160.153.154.2
+160.153.154.20
  160.153.154.21
+160.153.154.23
  160.153.154.24
  160.153.154.26
+160.153.154.27
+160.153.154.29
  160.153.154.31
  160.153.154.5
  160.153.154.6
@@ -28607,16 +28247,17 @@
  160.153.156.135
  160.153.156.136
  160.153.156.137
+160.153.156.138
  160.153.156.141
  160.153.203.129
  160.153.234.236
  160.153.235.106
  160.153.244.20
-160.153.245.175
  160.153.249.218
  160.153.251.133
  160.153.252.9
  160.154.137.125
+160.154.59.53
  160.155.224.146
  160.16.0.30
  160.16.101.124
@@ -28634,15 +28275,16 @@
  160.16.84.152
  160.174.128.172
  160.176.101.217
-160.176.46.86
  160.177.19.217
  160.178.104.90
+160.178.25.13
+160.179.211.87
  160.19.246.57
+160.2.156.49
  160.2.52.234
  160.20.200.234
  160.202.106.209
  160.202.145.35
-160.202.156.157
  160.202.162.186
  160.202.162.48
  160.202.163.100
@@ -28659,6 +28301,7 @@
  160.238.163.20
  160.238.163.29
  160.238.227.153
+160.238.236.230
  160.238.251.142
  160.251.0.114
  160.251.2.158
@@ -28668,29 +28311,27 @@
  160.251.20.218
  160.251.21.74
  160.251.3.228
-160.251.7.180
  160.251.8.225
  160.251.9.131
  160.251.9.25
  160.36.130.180
  160.39.192.136
+160.39.222.209
  160.39.48.77
  160holiganbet.com
  161.0.153.184
  161.0.153.60
-161.0.158.231
  161.0.72.11
  161.10.238.226
  161.117.0.66
  161.117.10.46
-161.117.11.53
  161.117.176.46
+161.117.177.158
  161.117.191.130
-161.117.254.85
-161.117.255.189
+161.117.248.141
  161.117.49.174
  161.117.51.35
-161.117.56.255
+161.117.7.137
  161.117.7.172
  161.117.9.99
  161.129.35.214
@@ -28701,12 +28342,14 @@
  161.148.21.224
  161.156.175.40
  161.189.111.230
+161.189.114.127
+161.189.193.50
  161.200.98.10
  161.202.124.146
  161.202.197.118
  161.202.226.194
  161.202.41.12
-161.29.255.120
+161.230.87.255
  161.35.1.155
  161.35.1.55
  161.35.10.226
@@ -28715,7 +28358,9 @@
  161.35.106.253
  161.35.108.141
  161.35.109.122
+161.35.109.17
  161.35.11.118
+161.35.110.195
  161.35.110.226
  161.35.116.30
  161.35.118.14
@@ -28742,18 +28387,21 @@
  161.35.148.75
  161.35.15.187
  161.35.15.34
-161.35.154.24
  161.35.156.92
-161.35.161.13
+161.35.158.138
  161.35.161.170
+161.35.164.12
  161.35.167.148
  161.35.173.212
+161.35.176.121
+161.35.178.33
  161.35.179.139
  161.35.179.225
  161.35.186.56
  161.35.187.61
  161.35.188.60
  161.35.189.1
+161.35.19.188
  161.35.190.246
  161.35.193.16
  161.35.193.6
@@ -28761,15 +28409,19 @@
  161.35.195.30
  161.35.197.166
  161.35.205.180
+161.35.207.11
  161.35.212.246
  161.35.224.185
  161.35.225.155
  161.35.227.204
  161.35.23.222
+161.35.232.146
  161.35.233.130
  161.35.235.27
+161.35.235.28
  161.35.237.200
  161.35.24.244
+161.35.26.90
  161.35.4.201
  161.35.45.62
  161.35.47.220
@@ -28793,6 +28445,7 @@
  161.35.86.23
  161.35.9.18
  161.35.9.202
+161.35.9.81
  161.35.90.45
  161.35.98.45
  161.35.98.96
@@ -28808,31 +28461,32 @@
  161.53.240.18
  161.53.240.25
  161.53.81.21
-161.81.220.80
  161.81.36.21
  161.82.246.91
  161.97.100.170
  161.97.101.31
  161.97.101.36
-161.97.103.183
  161.97.107.17
  161.97.109.229
  161.97.125.222
-161.97.126.2
  161.97.127.179
  161.97.128.127
  161.97.128.207
+161.97.129.105
  161.97.131.168
  161.97.131.255
  161.97.131.71
  161.97.133.225
  161.97.137.189
-161.97.140.161
-161.97.145.43
+161.97.138.237
+161.97.148.234
+161.97.151.231
  161.97.157.241
  161.97.160.72
+161.97.160.87
  161.97.161.23
  161.97.162.121
+161.97.162.130
  161.97.176.229
  161.97.178.101
  161.97.179.222
@@ -28843,7 +28497,6 @@
  161.97.68.59
  161.97.69.170
  161.97.70.157
-161.97.70.30
  161.97.74.111
  161.97.76.191
  161.97.78.179
@@ -28865,12 +28518,10 @@
  162.0.227.56
  162.0.227.68
  162.0.228.57
-162.0.230.32
  162.0.231.190
  162.0.233.227
  162.0.234.152
  162.0.234.154
-162.0.234.198
  162.0.234.202
  162.0.234.214
  162.0.234.96
@@ -28910,12 +28561,11 @@
  162.142.125.128
  162.142.125.37
  162.142.125.38
-162.142.125.39
  162.142.125.40
  162.142.125.53
  162.142.125.54
  162.142.125.55
-162.144.104.137
+162.142.125.56
  162.144.107.199
  162.144.108.177
  162.144.127.197
@@ -28934,6 +28584,7 @@
  162.144.38.125
  162.144.38.233
  162.144.39.157
+162.144.40.21
  162.144.42.60
  162.144.49.154
  162.144.50.132
@@ -28947,40 +28598,25 @@
  162.144.91.33
  162.144.96.64
  162.144.99.9
+162.154.101.112
  162.154.207.147
  162.154.38.103
+162.155.26.90
  162.156.152.42
  162.156.219.13
  162.156.23.202
  162.157.71.213
-162.158.111.223
-162.158.111.35
-162.158.134.74
+162.158.111.221
  162.158.142.101
  162.158.154.185
  162.158.154.221
-162.158.154.83
-162.158.155.114
-162.158.155.12
-162.158.155.252
+162.158.154.71
+162.158.154.95
  162.158.155.36
-162.158.155.42
-162.158.155.68
-162.158.155.71
  162.158.155.78
-162.158.158.153
-162.158.158.177
  162.158.158.195
-162.158.158.201
-162.158.158.241
-162.158.158.243
-162.158.158.245
-162.158.158.79
+162.158.158.229
  162.158.159.136
-162.158.159.14
-162.158.159.54
-162.158.159.74
-162.158.159.8
  162.158.159.88
  162.158.165.127
  162.158.165.132
@@ -28997,17 +28633,14 @@
  162.158.165.193
  162.158.165.199
  162.158.165.211
-162.158.165.220
  162.158.165.221
  162.158.165.33
  162.158.165.41
-162.158.165.44
  162.158.165.45
  162.158.165.51
  162.158.165.69
  162.158.165.79
  162.158.165.91
-162.158.166.112
  162.158.166.118
  162.158.166.146
  162.158.166.178
@@ -29040,12 +28673,15 @@
  162.158.167.59
  162.158.167.79
  162.158.167.9
-162.158.183.227
-162.158.238.216
-162.158.238.236
-162.158.62.27
+162.158.183.128
+162.158.183.151
+162.158.183.153
+162.158.183.157
+162.158.19.9
+162.158.238.210
+162.158.63.100
+162.158.63.114
  162.158.63.191
-162.158.63.238
  162.158.88.135
  162.158.91.54
  162.158.92.107
@@ -29055,9 +28691,9 @@
  162.17.143.229
  162.17.143.234
  162.17.252.5
-162.17.6.147
  162.191.197.222
  162.191.33.164
+162.197.167.42
  162.198.193.52
  162.198.89.189
  162.199.19.25
@@ -29132,8 +28768,8 @@
  162.212.115.93
  162.212.115.95
  162.212.168.115
-162.212.168.136
  162.212.168.76
+162.212.169.170
  162.212.169.254
  162.212.170.154
  162.212.170.161
@@ -29149,6 +28785,7 @@
  162.212.174.238
  162.212.175.65
  162.212.175.67
+162.212.187.82
  162.212.225.198
  162.213.121.194
  162.213.152.146
@@ -29167,6 +28804,7 @@
  162.214.101.36
  162.214.101.56
  162.214.103.187
+162.214.148.112
  162.214.155.215
  162.214.171.114
  162.214.28.25
@@ -29194,6 +28832,7 @@
  162.218.234.56
  162.219.122.165
  162.219.176.211
+162.219.178.59
  162.219.179.101
  162.219.4.93
  162.219.5.83
@@ -29218,7 +28857,9 @@
  162.223.91.231
  162.227.78.128
  162.229.183.99
+162.234.176.204
  162.239.57.201
+162.241.114.56
  162.241.115.216
  162.241.117.105
  162.241.117.179
@@ -29230,6 +28871,7 @@
  162.241.125.112
  162.241.148.33
  162.241.148.86
+162.241.149.130
  162.241.149.137
  162.241.149.45
  162.241.153.151
@@ -29251,6 +28893,7 @@
  162.241.75.116
  162.241.77.166
  162.241.87.45
+162.241.90.139
  162.241.92.219
  162.242.153.132
  162.242.156.81
@@ -29328,6 +28971,7 @@
  162.243.233.102
  162.243.237.90
  162.243.237.95
+162.243.240.141
  162.243.241.183
  162.243.243.223
  162.243.25.182
@@ -29385,6 +29029,7 @@
  162.244.9.13
  162.244.9.190
  162.244.9.70
+162.245.154.146
  162.245.81.151
  162.246.211.27
  162.246.22.20
@@ -29413,10 +29058,13 @@
  162.249.248.218
  162.249.6.128
  162.250.126.186
+162.250.161.13
  162.250.188.194
  162.250.189.53
  162.250.235.127
-162.252.241.118
+162.253.129.118
+162.253.129.186
+162.253.129.67
  162.253.131.131
  162.253.66.50
  162.253.66.76
@@ -29430,6 +29078,7 @@
  162.39.119.102
  162.41.8.12
  162.62.18.226
+162.62.20.122
  162.62.26.218
  162.62.34.86
  162.62.9.72
@@ -29438,12 +29087,8 @@
  162783-dot-n-e-w-me-ss-age-po-rt-al.wl.r.appspot.com
  162840-dot-n-e-w-me-ss-age-po-rt-al.wl.r.appspot.com
  163.121.188.3
-163.125.18.255
-163.125.192.203
  163.125.193.101
-163.125.226.237
-163.125.248.140
-163.125.251.237
+163.125.193.138
  163.13.182.105
  163.131.167.23
  163.139.169.79
@@ -29452,7 +29097,6 @@
  163.158.173.243
  163.158.202.112
  163.158.243.230
-163.158.60.179
  163.171.130.78
  163.171.132.59
  163.171.132.60
@@ -29463,12 +29107,12 @@
  163.172.109.132
  163.172.113.108
  163.172.113.177
-163.172.114.82
  163.172.115.25
  163.172.117.155
  163.172.119.84
+163.172.120.82
+163.172.121.6
  163.172.121.98
-163.172.123.92
  163.172.124.156
  163.172.128.177
  163.172.128.98
@@ -29505,8 +29149,7 @@
  163.172.185.11
  163.172.189.32
  163.172.190.160
-163.172.193.209
-163.172.195.78
+163.172.194.207
  163.172.197.147
  163.172.198.85
  163.172.201.184
@@ -29521,7 +29164,6 @@
  163.172.217.103
  163.172.219.130
  163.172.220.221
-163.172.228.214
  163.172.229.188
  163.172.234.206
  163.172.234.207
@@ -29538,8 +29180,8 @@
  163.172.29.30
  163.172.31.79
  163.172.32.190
+163.172.33.228
  163.172.35.247
-163.172.40.200
  163.172.40.218
  163.172.41.115
  163.172.41.228
@@ -29551,7 +29193,6 @@
  163.172.48.194
  163.172.49.123
  163.172.49.61
-163.172.49.74
  163.172.5.199
  163.172.50.9
  163.172.51.180
@@ -29572,8 +29213,6 @@
  163.172.97.118
  163.172.98.25
  163.179.47.250
-163.179.47.252
-163.18.46.176
  163.198.132.31
  163.198.132.37
  163.198.132.58
@@ -29607,15 +29246,12 @@
  163.44.158.143
  163.44.159.154
  163.44.168.207
-163.44.193.158
  163.44.193.95
  163.44.194.47
  163.44.196.132
  163.44.197.129
-163.44.197.71
  163.44.198.43
  163.44.198.59
-163.44.239.70
  163.47.146.118
  163.47.146.74
  163.47.15.168
@@ -29636,7 +29272,6 @@
  163.53.207.52
  163.53.209.7
  163.53.209.8
-163.53.209.9
  163.mailcn.org
  163b7da4b400d8de32f3d9b7df9737c6-dot-dbenitonline.ey.r.appspot.com
  163s.ddns.net
@@ -29656,7 +29291,7 @@
  164.132.126.140
  164.132.148.184
  164.132.151.175
-164.132.155.14
+164.132.155.20
  164.132.159.58
  164.132.160.230
  164.132.177.218
@@ -29665,7 +29300,6 @@
  164.132.199.114
  164.132.205.148
  164.132.222.249
-164.132.224.68
  164.132.228.134
  164.132.229.117
  164.132.23.43
@@ -29681,7 +29315,6 @@
  164.132.40.238
  164.132.42.32
  164.132.44.25
-164.132.44.97
  164.132.46.129
  164.132.46.14
  164.132.47.67
@@ -29701,12 +29334,10 @@
  164.132.98.75
  164.138.236.227
  164.155.104.184
-164.155.104.9
  164.155.231.247
  164.155.231.251
  164.155.88.65
  164.155.89.7
-164.155.90.50
  164.155.95.28
  164.160.128.100
  164.160.128.104
@@ -29719,23 +29350,25 @@
  164.163.250.18
  164.163.250.80
  164.163.3.240
-164.163.3.243
  164.163.99.10
  164.177.104.186
-164.177.42.146
  164.39.202.75
  164.52.24.164
  164.52.24.168
-164.52.24.172
  164.52.25.162
+164.52.42.6
  164.52.89.94
  164.58.29.186
+164.68.103.252
  164.68.104.88
  164.68.106.226
  164.68.107.225
  164.68.108.59
  164.68.109.215
+164.68.111.155
+164.68.112.178
  164.68.113.112
+164.68.113.245
  164.68.114.114
  164.68.116.168
  164.68.116.198
@@ -29754,12 +29387,8 @@
  164.77.133.220
  164.77.135.159
  164.77.135.175
-164.77.135.3
  164.77.147.93
-164.77.154.146
-164.77.156.106
  164.77.175.246
-164.77.188.106
  164.77.221.98
  164.90.146.175
  164.90.148.76
@@ -29769,21 +29398,21 @@
  164.90.191.170
  164.90.198.71
  164.90.208.125
+164.90.210.8
  164.90.212.168
  164.90.214.238
  164.90.215.39
  164.90.217.133
  164.90.217.167
  164.90.225.28
-164.90.225.91
  164.90.227.92
  164.90.237.125
  164.90.241.64
  1643.31cf4fdae.com
  165.132.30.11
-165.138.4.47
  165.138.55.107
  165.139.252.55
+165.16.17.14
  165.16.203.55
  165.16.23.17
  165.16.25.18
@@ -29807,7 +29436,6 @@
  165.165.132.60
  165.165.134.1
  165.165.144.251
-165.165.171.160
  165.169.173.85
  165.194.27.141
  165.22.0.113
@@ -29834,6 +29462,7 @@
  165.22.13.160
  165.22.13.92
  165.22.132.86
+165.22.14.77
  165.22.148.191
  165.22.16.134
  165.22.163.18
@@ -29849,19 +29478,18 @@
  165.22.205.45
  165.22.206.182
  165.22.207.116
-165.22.209.132
  165.22.209.168
  165.22.21.136
  165.22.210.35
  165.22.210.69
  165.22.213.4
  165.22.213.55
-165.22.213.86
  165.22.213.9
  165.22.216.228
  165.22.217.96
  165.22.219.167
  165.22.22.250
+165.22.22.63
  165.22.22.92
  165.22.221.230
  165.22.223.100
@@ -29876,9 +29504,8 @@
  165.22.23.23
  165.22.231.74
  165.22.233.194
-165.22.234.248
  165.22.235.29
-165.22.236.96
+165.22.235.77
  165.22.237.13
  165.22.237.253
  165.22.238.167
@@ -29886,7 +29513,7 @@
  165.22.24.32
  165.22.24.71
  165.22.242.174
-165.22.242.228
+165.22.242.39
  165.22.246.219
  165.22.247.221
  165.22.249.223
@@ -29902,10 +29529,10 @@
  165.22.33.32
  165.22.35.21
  165.22.35.80
+165.22.36.112
  165.22.40.128
  165.22.43.247
  165.22.44.115
-165.22.44.194
  165.22.48.140
  165.22.49.42
  165.22.50.136
@@ -29915,6 +29542,7 @@
  165.22.57.164
  165.22.58.237
  165.22.59.208
+165.22.60.129
  165.22.60.7
  165.22.61.205
  165.22.61.82
@@ -29930,7 +29558,6 @@
  165.22.73.254
  165.22.75.225
  165.22.75.227
-165.22.76.190
  165.22.76.96
  165.22.77.163
  165.22.77.219
@@ -29954,6 +29581,7 @@
  165.227.102.121
  165.227.105.69
  165.227.105.86
+165.227.106.183
  165.227.106.20
  165.227.106.28
  165.227.107.217
@@ -29963,12 +29591,10 @@
  165.227.109.246
  165.227.109.3
  165.227.11.143
-165.227.11.158
  165.227.11.196
  165.227.11.254
  165.227.110.132
  165.227.110.218
-165.227.111.252
  165.227.114.134
  165.227.115.226
  165.227.116.136
@@ -29984,6 +29610,7 @@
  165.227.121.90
  165.227.122.212
  165.227.122.24
+165.227.123.134
  165.227.124.168
  165.227.124.80
  165.227.126.48
@@ -29997,6 +29624,7 @@
  165.227.132.8
  165.227.132.96
  165.227.136.116
+165.227.136.179
  165.227.137.216
  165.227.139.148
  165.227.139.75
@@ -30015,7 +29643,6 @@
  165.227.161.121
  165.227.163.238
  165.227.163.85
-165.227.163.91
  165.227.165.102
  165.227.165.22
  165.227.166.125
@@ -30025,20 +29652,21 @@
  165.227.169.12
  165.227.169.7
  165.227.172.118
+165.227.172.228
  165.227.173.181
  165.227.174.92
  165.227.175.240
  165.227.175.52
-165.227.176.208
+165.227.180.167
  165.227.180.243
  165.227.180.91
+165.227.181.9
  165.227.182.136
  165.227.184.221
  165.227.189.115
  165.227.19.191
  165.227.193.157
  165.227.193.66
-165.227.195.122
  165.227.195.204
  165.227.195.71
  165.227.196.229
@@ -30163,7 +29791,6 @@
  165.231.103.110
  165.231.103.114
  165.231.103.133
-165.231.103.156
  165.231.103.188
  165.231.103.190
  165.231.103.198
@@ -30171,8 +29798,10 @@
  165.231.103.214
  165.231.103.215
  165.231.103.223
+165.231.103.63
  165.231.105.101
  165.231.105.129
+165.231.105.158
  165.231.105.165
  165.231.105.19
  165.231.105.243
@@ -30180,15 +29809,14 @@
  165.231.108.238
  165.231.108.35
  165.231.108.8
-165.231.120.141
  165.231.120.251
  165.231.120.74
  165.231.120.96
  165.231.130.233
  165.231.143.106
  165.231.143.132
-165.231.143.133
  165.231.143.179
+165.231.143.216
  165.231.163.20
  165.231.212.222
  165.231.212.250
@@ -30201,6 +29829,7 @@
  165.231.45.146
  165.231.45.23
  165.231.45.68
+165.231.45.79
  165.231.84.13
  165.231.84.168
  165.231.84.173
@@ -30217,7 +29846,6 @@
  165.231.95.143
  165.231.95.177
  165.231.95.179
-165.231.95.188
  165.231.95.29
  165.231.95.4
  165.231.98.129
@@ -30234,7 +29862,6 @@
  165.232.99.140
  165.246.38.139
  165.255.254.204
-165.255.67.144
  165.255.87.175
  165.255.87.84
  165.255.88.133
@@ -30280,6 +29907,7 @@
  166.111.152.230
  166.111.60.108
  166.111.72.109
+166.130.73.79
  166.137.10.116
  166.137.10.23
  166.137.10.85
@@ -30308,6 +29936,7 @@
  166.137.252.93
  166.137.8.113
  166.137.90.15
+166.155.19.234
  166.166.84.239
  166.170.0.117
  166.170.14.108
@@ -30356,7 +29985,6 @@
  167.114.136.27
  167.114.144.159
  167.114.150.100
-167.114.152.170
  167.114.153.111
  167.114.159.159
  167.114.169.194
@@ -30372,6 +30000,7 @@
  167.114.213.144
  167.114.213.214
  167.114.219.41
+167.114.220.131
  167.114.221.238
  167.114.224.218
  167.114.224.6
@@ -30398,7 +30027,6 @@
  167.114.65.240
  167.114.85.125
  167.114.96.156
-167.114.97.215
  167.114.98.229
  167.114.98.233
  167.114.98.234
@@ -30409,7 +30037,6 @@
  167.160.36.151
  167.160.72.223
  167.160.74.223
-167.160.74.236
  167.160.74.248
  167.160.76.56
  167.172.0.218
@@ -30441,13 +30068,11 @@
  167.172.151.136
  167.172.153.14
  167.172.153.173
-167.172.154.44
  167.172.155.86
  167.172.156.12
  167.172.158.68
  167.172.16.47
  167.172.161.10
-167.172.161.169
  167.172.161.171
  167.172.163.162
  167.172.163.167
@@ -30476,8 +30101,6 @@
  167.172.195.99
  167.172.201.94
  167.172.204.125
-167.172.207.139
-167.172.208.194
  167.172.209.140
  167.172.209.209
  167.172.209.22
@@ -30490,11 +30113,11 @@
  167.172.23.70
  167.172.235.137
  167.172.235.25
+167.172.238.4
  167.172.242.166
  167.172.242.210
  167.172.242.89
  167.172.246.182
-167.172.246.195
  167.172.246.23
  167.172.246.245
  167.172.246.83
@@ -30515,8 +30138,6 @@
  167.172.45.225
  167.172.54.27
  167.172.55.6
-167.172.56.36
-167.172.60.40
  167.172.61.145
  167.172.63.17
  167.172.64.157
@@ -30525,13 +30146,12 @@
  167.172.96.42
  167.172.97.140
  167.172.98.89
-167.179.106.112
+167.172.99.167
+167.179.105.129
  167.179.109.215
-167.179.117.213
-167.179.119.197
-167.179.139.79
  167.179.153.249
-167.179.159.139
+167.179.157.35
+167.179.161.32
  167.179.4.134
  167.179.4.142
  167.179.64.113
@@ -30545,35 +30165,33 @@
  167.179.95.153
  167.179.96.13
  167.179.96.172
-167.179.97.17
-167.179.99.242
  167.248.133.37
  167.248.133.39
  167.248.133.40
  167.248.133.53
  167.248.133.54
+167.248.133.56
+167.248.174.148
  167.249.170.26
-167.249.181.236
  167.249.181.245
  167.249.212.17
-167.249.66.0
  167.249.9.37
  167.250.127.235
  167.250.160.206
+167.250.175.134
  167.250.206.195
  167.250.49.155
  167.250.65.246
-167.250.96.75
+167.250.96.152
  167.56.252.192
  167.56.7.75
-167.58.109.36
+167.60.172.214
  167.68.23.251
  167.71.10.37
  167.71.102.102
  167.71.102.201
  167.71.104.1
  167.71.105.58
-167.71.108.96
  167.71.109.120
  167.71.11.57
  167.71.111.16
@@ -30599,6 +30217,7 @@
  167.71.15.69
  167.71.152.101
  167.71.153.244
+167.71.154.15
  167.71.159.219
  167.71.16.200
  167.71.162.16
@@ -30616,6 +30235,7 @@
  167.71.184.82
  167.71.185.113
  167.71.196.176
+167.71.202.105
  167.71.202.109
  167.71.202.40
  167.71.203.215
@@ -30638,6 +30258,7 @@
  167.71.224.234
  167.71.225.204
  167.71.226.130
+167.71.226.154
  167.71.227.113
  167.71.227.169
  167.71.228.224
@@ -30649,11 +30270,11 @@
  167.71.232.129
  167.71.232.89
  167.71.234.29
-167.71.236.220
  167.71.236.26
  167.71.239.181
  167.71.241.109
  167.71.243.10
+167.71.33.119
  167.71.34.115
  167.71.34.243
  167.71.36.193
@@ -30674,8 +30295,6 @@
  167.71.58.244
  167.71.59.56
  167.71.6.91
-167.71.63.47
-167.71.69.173
  167.71.7.109
  167.71.72.70
  167.71.73.244
@@ -30691,7 +30310,6 @@
  167.71.95.157
  167.71.96.148
  167.71.98.172
-167.71.99.196
  167.78.4.18
  167.86.100.11
  167.86.100.98
@@ -30701,6 +30319,7 @@
  167.86.105.53
  167.86.109.151
  167.86.109.171
+167.86.109.204
  167.86.110.76
  167.86.113.5
  167.86.114.150
@@ -30709,6 +30328,7 @@
  167.86.116.202
  167.86.116.212
  167.86.116.69
+167.86.117.111
  167.86.67.67
  167.86.73.56
  167.86.78.148
@@ -30716,7 +30336,6 @@
  167.86.80.173
  167.86.81.74
  167.86.87.90
-167.86.90.214
  167.86.90.239
  167.86.94.107
  167.86.95.160
@@ -30737,7 +30356,7 @@
  167.89.10.200
  167.89.104.248
  167.89.16.130
-167.89.24.42
+167.89.80.129
  167.98.71.52
  167.99.10.128
  167.99.10.176
@@ -30751,6 +30370,7 @@
  167.99.110.154
  167.99.110.179
  167.99.112.243
+167.99.12.47
  167.99.13.63
  167.99.13.90
  167.99.132.132
@@ -30773,6 +30393,7 @@
  167.99.160.9
  167.99.161.236
  167.99.164.171
+167.99.165.105
  167.99.166.74
  167.99.167.135
  167.99.169.17
@@ -30811,6 +30432,7 @@
  167.99.210.7
  167.99.211.208
  167.99.212.138
+167.99.212.191
  167.99.213.209
  167.99.214.186
  167.99.215.8
@@ -30838,8 +30460,8 @@
  167.99.234.199
  167.99.234.59
  167.99.236.253
+167.99.238.183
  167.99.240.241
-167.99.241.111
  167.99.242.205
  167.99.247.235
  167.99.251.192
@@ -30855,6 +30477,7 @@
  167.99.35.87
  167.99.37.200
  167.99.37.6
+167.99.38.143
  167.99.38.77
  167.99.38.80
  167.99.39.114
@@ -30864,7 +30487,6 @@
  167.99.40.161
  167.99.40.38
  167.99.40.42
-167.99.41.0
  167.99.42.220
  167.99.42.83
  167.99.42.89
@@ -30893,7 +30515,6 @@
  167.99.66.74
  167.99.67.142
  167.99.67.42
-167.99.68.226
  167.99.68.65
  167.99.7.190
  167.99.7.239
@@ -30983,10 +30604,8 @@
  168.121.137.64
  168.121.139.199
  168.121.139.31
-168.121.216.37
  168.121.45.208
  168.121.54.29
-168.121.67.44
  168.121.97.67
  168.126.28.24
  168.126.85.182
@@ -31011,14 +30630,11 @@
  168.151.226.228
  168.151.228.224
  168.151.228.228
-168.151.229.17
  168.151.229.76
-168.151.98.51
  168.167.85.255
  168.181.121.195
  168.181.121.197
  168.181.134.119
-168.181.145.242
  168.181.196.33
  168.181.242.81
  168.181.245.129
@@ -31028,14 +30644,15 @@
  168.187.77.177
  168.194.13.4
  168.194.14.126
-168.194.154.139
  168.194.162.170
  168.194.164.46
  168.194.165.74
  168.194.201.6
  168.194.207.58
+168.194.232.44
  168.194.83.25
  168.194.83.45
+168.195.101.175
  168.195.182.62
  168.195.196.14
  168.195.196.18
@@ -31049,26 +30666,25 @@
  168.196.114.241
  168.196.114.7
  168.196.12.27
-168.196.148.131
  168.196.52.80
  168.196.96.37
  168.197.176.8
  168.197.26.139
  168.197.52.224
+168.205.108.2
+168.205.111.194
  168.205.111.43
  168.205.139.13
  168.205.140.224
  168.205.183.241
-168.205.217.14
  168.205.217.144
  168.205.217.164
-168.205.217.174
-168.205.217.207
  168.205.217.31
  168.205.217.32
  168.205.217.60
  168.205.218.126
  168.205.218.161
+168.205.218.167
  168.205.218.177
  168.205.218.225
  168.205.218.72
@@ -31082,7 +30698,6 @@
  168.215.65.71
  168.226.214.98
  168.227.106.100
-168.227.109.6
  168.227.146.34
  168.227.147.243
  168.227.15.229
@@ -31103,7 +30718,6 @@
  168.227.158.61
  168.227.158.9
  168.227.212.130
-168.227.212.154
  168.227.78.94
  168.227.99.11
  168.228.118.25
@@ -31138,10 +30752,11 @@
  168.235.83.139
  168.235.90.188
  168.235.98.150
-168.245.120.69
+168.245.154.200
  168.245.65.6
  168.61.18.166
  168.61.55.120
+168.62.161.53
  168.62.174.233
  168.62.175.22
  168.62.21.233
@@ -31149,15 +30764,16 @@
  168.62.248.25
  168.63.137.51
  168.63.151.21
-168.63.253.109
  168.63.54.181
  168.70.42.15
+168.70.43.159
  168.70.62.18
  168.80.228.114
  168.80.244.6
  168.80.44.249
  168.90.16.27
  168.90.196.15
+168.90.196.156
  168.90.196.163
  168.90.196.174
  168.90.196.19
@@ -31173,10 +30789,9 @@
  168.90.196.88
  168.90.196.91
  168.90.196.94
-168.90.197.127
-168.90.197.83
  168.90.199.130
-168.90.199.210
+168.90.199.135
+168.90.199.154
  168.90.199.45
  168.90.199.71
  168.90.22.119
@@ -31186,7 +30801,6 @@
  168.90.34.234
  168.90.34.239
  168.90.50.118
-168.90.65.250
  168.90.88.40
  168.90.89.125
  168.90.89.238
@@ -31195,20 +30809,17 @@
  168.90.90.57
  168.90.92.34
  168.91.45.114
-168.91.45.57
  168.91.46.2
+168.91.66.101
  168.91.76.109
  168.91.80.149
-168.91.80.152
  168.91.80.209
  168.91.81.164
  168.91.81.165
  168.91.81.82
  168.91.81.85
-168.91.82.130
  168.91.82.160
  168.91.82.250
-168.91.83.192
  168.91.83.221
  168.91.83.223
  168.wtuo100.com
@@ -31220,19 +30831,17 @@
  169-239-129-63.cprapid.com
  169.0.67.26
  169.0.86.80
-169.1.71.161
+169.1.11.210
  169.149.133.127
  169.239.129.63
  169.239.166.134
  169.239.171.59
-169.239.182.135
  169.239.182.217
  169.239.223.136
  169.239.236.101
  169.239.236.27
  169.239.45.37
  169.239.45.78
-169.255.121.228
  169.255.126.211
  169.255.136.14
  169.255.136.8
@@ -31243,9 +30852,9 @@
  169.255.234.166
  169.255.28.154
  169.255.6.26
+169.255.65.250
  169.255.65.254
  169.255.75.117
-169.44.153.122
  169.44.34.203
  169.48.163.176
  169.48.179.124
@@ -31302,40 +30911,15 @@
  170.106.50.166
  170.106.65.54
  170.106.75.81
+170.106.82.81
  170.130.126.110
  170.130.126.96
  170.130.172.40
  170.130.172.42
  170.130.187.2
+170.130.187.6
  170.130.205.117
  170.130.31.177
-170.130.46.226
-170.130.46.227
-170.130.46.229
-170.130.46.230
-170.130.46.231
-170.130.46.232
-170.130.46.233
-170.130.46.234
-170.130.46.235
-170.130.46.236
-170.130.46.237
-170.130.46.238
-170.130.46.239
-170.130.46.240
-170.130.46.241
-170.130.46.242
-170.130.46.243
-170.130.46.244
-170.130.46.245
-170.130.46.246
-170.130.46.247
-170.130.46.248
-170.130.46.250
-170.130.46.251
-170.130.46.252
-170.130.46.253
-170.130.46.254
  170.130.55.65
  170.130.55.97
  170.130.58.166
@@ -31346,24 +30930,24 @@
  170.130.63.244
  170.130.63.42
  170.130.63.95
-170.150.101.119
  170.150.101.136
  170.150.101.166
  170.150.101.77
  170.150.102.115
  170.150.102.148
+170.150.102.182
+170.150.102.206
  170.150.103.137
  170.150.103.192
  170.150.103.244
  170.150.103.77
  170.150.139.138
  170.150.139.139
+170.150.139.140
  170.150.139.148
  170.150.52.210
  170.150.52.5
  170.150.52.65
-170.150.53.96
-170.150.72.28
  170.151.0.4
  170.185.68.14
  170.210.136.56
@@ -31373,10 +30957,10 @@
  170.210.214.50
  170.210.4.222
  170.210.71.10
+170.231.105.215
  170.231.187.209
  170.231.232.97
  170.231.56.3
-170.231.58.183
  170.233.115.90
  170.233.117.32
  170.233.120.98
@@ -31390,13 +30974,11 @@
  170.238.119.77
  170.238.14.133
  170.238.141.101
-170.238.142.146
  170.238.156.30
  170.238.212.135
-170.238.255.90
+170.238.231.75
  170.238.74.61
  170.239.108.10
-170.239.201.3
  170.239.222.182
  170.244.0.178
  170.244.0.179
@@ -31408,10 +30990,8 @@
  170.244.64.198
  170.244.64.225
  170.244.88.67
-170.245.200.100
  170.245.245.194
  170.246.3.242
-170.246.69.110
  170.246.69.58
  170.246.85.106
  170.246.85.108
@@ -31428,15 +31008,16 @@
  170.247.200.33
  170.247.200.5
  170.247.201.17
+170.247.202.193
+170.247.202.5
  170.247.202.94
-170.247.202.96
  170.247.203.1
  170.247.203.235
  170.247.41.191
  170.247.43.142
  170.249.191.114
  170.250.84.130
-170.253.30.172
+170.254.148.110
  170.254.148.94
  170.254.224.7
  170.254.226.157
@@ -31450,6 +31031,7 @@
  170.75.163.136
  170.78.37.7
  170.78.38.96
+170.78.39.12
  170.78.39.132
  170.78.39.58bin.sh
  170.78.96.1
@@ -31466,11 +31048,13 @@
  170.79.233.162
  170.79.251.203
  170.79.45.184
+170.79.72.139
+170.79.85.224
  170.79.87.178
  170.79.9.54
  170.79.91.98
  170.79.94.110
-170.79.94.208
+170.79.94.174
  170.80.225.16
  170.80.36.150
  170.80.36.2
@@ -31496,11 +31080,14 @@
  170.81.48.2
  170.81.92.102
  170.81.93.44
-170.82.189.152
  170.82.52.48
  170.82.54.39
+170.82.77.189
+170.82.79.115
  170.83.115.4
+170.83.14.11
  170.83.156.14
+170.83.176.11
  170.83.176.120
  170.83.176.121
  170.83.176.123
@@ -31514,13 +31101,14 @@
  170.83.176.188
  170.83.176.193
  170.83.176.199
+170.83.176.201
  170.83.176.210
  170.83.176.225
-170.83.176.230
  170.83.176.25
  170.83.176.253
  170.83.176.3
  170.83.176.55
+170.83.176.56
  170.83.176.74
  170.83.176.82
  170.83.177.114
@@ -31533,8 +31121,8 @@
  170.83.177.188
  170.83.177.201
  170.83.177.227
+170.83.177.230
  170.83.177.32
-170.83.177.45
  170.83.177.54
  170.83.177.60
  170.83.177.64
@@ -31543,10 +31131,11 @@
  170.83.177.95
  170.83.178.108
  170.83.178.12
+170.83.178.139
  170.83.178.141
  170.83.178.173
+170.83.178.174
  170.83.178.182
-170.83.178.203
  170.83.178.207
  170.83.178.220
  170.83.178.31
@@ -31555,11 +31144,11 @@
  170.83.178.6
  170.83.178.86
  170.83.178.96
+170.83.179.16
  170.83.179.198
  170.83.179.232
  170.83.179.4
  170.83.179.51
-170.83.179.84
  170.83.199.9
  170.84.182.145
  170.84.183.193
@@ -31581,11 +31170,11 @@
  1700restaurant.com
  1702525-dot-n-e-w-me-ss-age-po-rt-al.wl.r.appspot.com
  171.100.102.154
-171.100.21.152
  171.100.77.31
  171.100.8.82
  171.100.9.126
  171.101.102.20
+171.101.124.69
  171.101.131.133
  171.101.99.79
  171.103.174.222
@@ -31597,6 +31186,7 @@
  171.103.197.46
  171.103.197.58
  171.103.199.14
+171.103.199.202
  171.103.200.46
  171.103.78.130
  171.103.9.22
@@ -31609,8 +31199,8 @@
  171.112.44.234
  171.112.45.160
  171.113.40.47
+171.118.165.181
  171.118.24.229
-171.119.192.151
  171.119.209.26
  171.119.223.219
  171.121.122.102
@@ -31619,47 +31209,39 @@
  171.123.109.137
  171.123.120.177
  171.123.15.218
-171.124.255.248
-171.125.104.190
-171.125.115.96
  171.125.195.122
-171.125.4.52
  171.125.50.166
-171.125.72.224
-171.125.82.145
  171.125.95.175
-171.125.95.56
  171.15.17.161
  171.211.25.217
  171.22.122.109
+171.22.123.103
  171.22.123.12
-171.22.123.156
  171.22.123.221
  171.22.123.235
  171.22.123.245
+171.22.123.251
+171.22.123.254
  171.22.123.40
  171.22.123.44
  171.22.123.68
  171.22.145.107
-171.22.145.112
-171.22.145.142
  171.22.145.15
  171.22.145.150
  171.22.145.208
  171.22.145.6
  171.22.24.185
  171.22.253.189
+171.22.253.33
  171.22.255.146
  171.221.151.111
  171.221.200.175
  171.221.210.158
  171.221.217.145
  171.221.254.175
-171.224.178.150
  171.224.178.161
-171.224.181.170
  171.224.237.178
-171.225.251.100
+171.225.254.164
  171.225.254.189
  171.226.1.242
  171.226.1.56
@@ -31690,26 +31272,27 @@
  171.228.196.238
  171.228.211.13
  171.228.220.53
+171.228.53.202
+171.228.6.197
  171.228.69.230
-171.229.182.29
  171.229.39.167
-171.229.80.179
  171.231.119.140
-171.231.169.179
-171.231.210.65
  171.231.5.16
-171.232.136.139
+171.231.60.228
  171.232.244.141
+171.234.142.41
  171.235.50.243
  171.235.51.218
  171.235.54.188
+171.235.56.70
+171.235.62.33
  171.235.63.50
  171.235.81.248
  171.235.82.228
  171.235.84.29
  171.235.86.129
  171.235.87.27
-171.237.10.194
+171.237.108.179
  171.237.152.11
  171.238.154.69
  171.239.184.178
@@ -31727,14 +31310,12 @@
  171.240.195.82
  171.240.196.176
  171.240.197.61
-171.240.201.2
  171.240.204.189
  171.240.204.28
  171.240.205.195
  171.240.205.2
  171.240.207.76
  171.240.9.241
-171.241.25.125
  171.241.50.164
  171.242.32.3
  171.243.245.147
@@ -31745,13 +31326,10 @@
  171.244.139.67
  171.244.140.174
  171.244.142.202
-171.244.15.38
  171.244.16.85
  171.244.18.14
-171.244.18.197
  171.244.188.205
  171.244.19.212
-171.244.21.74
  171.244.38.56
  171.244.45.137
  171.244.51.114
@@ -31767,9 +31345,6 @@
  171.249.138.136
  171.249.138.191
  171.249.139.98
-171.249.192.22
-171.249.219.22
-171.249.223.148
  171.249.38.210
  171.25.193.131
  171.25.193.20
@@ -31782,8 +31357,9 @@
  171.251.19.13
  171.251.20.155
  171.251.20.190
-171.251.235.227
+171.251.238.229
  171.251.239.49
+171.251.239.59
  171.251.25.186
  171.251.25.44
  171.251.26.168
@@ -31792,29 +31368,21 @@
  171.252.22.163
  171.255.199.129
  171.34.113.168
-171.34.115.101
-171.34.115.87
+171.34.150.16
  171.34.173.17
  171.34.176.117
  171.34.177.12
-171.34.177.75
  171.34.178.93
-171.34.179.192
  171.34.70.28
-171.34.78.107
  171.35.140.59
  171.35.160.80
  171.35.166.11
  171.35.166.37
  171.35.170.35
-171.35.171.185
  171.35.173.215
  171.35.174.233
  171.35.213.57
-171.38.144.250
-171.38.151.225
-171.38.219.190
-171.4.94.2
+171.4.249.165
  171.42.161.164bin.sh
  171.42.17.114
  171.42.32.127
@@ -31822,60 +31390,61 @@
  171.44.141.4
  171.44.143.233
  171.49.193.228
-171.49.206.225
  171.5.16.34
  171.5.162.113
+171.5.163.175
  171.5.165.29
  171.5.222.124
+171.5.225.242
  171.5.24.169
+171.5.24.78
  171.5.249.76
  171.5.25.179
  171.5.25.41
  171.5.29.34
-171.50.244.173
  171.6.229.229
-171.6.233.32
  171.6.49.208
  171.6.6.190
+171.6.73.122
  171.6.73.53
  171.60.161.182
+171.60.233.150
+171.61.35.203
  171.7.23.20
+171.7.23.31
  171.7.25.191
  171.7.26.24
  171.7.27.245
  171.76.15.169
-171.78.157.154
-171.78.189.92
  171.78.199.48
  171.80.162.7
  171.81.105.212
  171.84.2.6
+171.88.52.168
  171.88.53.97
  171.95.87.35
+171.96.111.32
  171.96.138.44
  171.96.158.8
  171.96.159.150
+171.96.219.144
  171.96.220.134
  171.96.220.220
  171.96.247.18
  171.97.107.112
-171.97.112.24
  171.97.129.201
  171.97.169.36
  171.97.177.49
  171.97.239.246
-171.97.40.29
  171.97.42.16
  171.97.42.82
-171.97.48.119
  171.97.67.81
  171.97.85.142
  171.98.73.6
+171.98.76.129
  171.98.76.80
-171.99.147.202
  171.99.157.37
  171.99.167.98
-171.99.205.75
  171298-dot-n-e-w-me-ss-age-po-rt-al.wl.r.appspot.com
  1717jackwills.000webhostapp.com
  17199.wang
@@ -31926,6 +31495,7 @@
  172.104.181.119
  172.104.182.103
  172.104.186.166
+172.104.189.79
  172.104.191.206
  172.104.203.73
  172.104.208.218
@@ -31975,7 +31545,6 @@
  172.104.7.181
  172.104.75.136
  172.104.81.87
-172.104.88.113
  172.104.9.251
  172.104.90.95
  172.104.92.108
@@ -32117,13 +31686,11 @@
  172.107.1.140
  172.107.1.152
  172.107.1.155
-172.107.1.156
  172.107.1.16
  172.107.1.160
  172.107.1.162
  172.107.1.164
  172.107.1.166
-172.107.1.168
  172.107.1.172
  172.107.1.175
  172.107.1.179
@@ -32157,7 +31724,6 @@
  172.107.1.34
  172.107.1.37
  172.107.1.38
-172.107.1.40
  172.107.1.42
  172.107.1.44
  172.107.1.46
@@ -32188,17 +31754,62 @@
  172.125.40.123
  172.125.55.96
  172.168.54.2.transfereunits.com
+172.193.100.33
  172.193.14.201
  172.218.182.132
  172.221.213.190
-172.221.34.69
-172.222.125.46
+172.241.192.10
+172.241.192.103
+172.241.192.119
+172.241.192.123
+172.241.192.126
+172.241.192.130
+172.241.192.134
+172.241.192.136
+172.241.192.145
+172.241.192.148
+172.241.192.152
+172.241.192.16
+172.241.192.162
+172.241.192.166
+172.241.192.172
+172.241.192.174
+172.241.192.182
+172.241.192.186
+172.241.192.190
+172.241.192.195
+172.241.192.196
+172.241.192.202
+172.241.192.207
+172.241.192.211
+172.241.192.228
+172.241.192.231
+172.241.192.240
+172.241.192.248
+172.241.192.25
+172.241.192.251
+172.241.192.3
+172.241.192.37
+172.241.192.4
+172.241.192.40
  172.241.192.46
+172.241.192.49
+172.241.192.50
+172.241.192.67
+172.241.192.68
+172.241.192.7
+172.241.192.73
+172.241.192.74
+172.241.192.78
+172.241.192.85
+172.241.192.86
+172.241.192.88
+172.241.192.9
+172.241.192.90
+172.241.192.92
  172.241.242.110
  172.241.242.187
-172.241.242.197
  172.241.243.139
-172.241.243.16
  172.241.37.123
  172.245.10.143
  172.245.10.150
@@ -32212,41 +31823,39 @@
  172.245.112.72
  172.245.135.133
  172.245.14.217
-172.245.14.219
  172.245.154.107
  172.245.158.131
+172.245.163.42
  172.245.180.177
  172.245.181.157
  172.245.181.211
-172.245.181.221
  172.245.181.236
  172.245.181.252
  172.245.184.199
  172.245.185.165
-172.245.194.241
  172.245.205.137
  172.245.208.159
  172.245.211.91
+172.245.215.52
  172.245.218.53
  172.245.220.82
  172.245.224.153
  172.245.224.154
  172.245.224.62
  172.245.228.19
-172.245.228.87
-172.245.230.167
+172.245.228.84
  172.245.230.177
  172.245.230.178
+172.245.230.184
  172.245.230.185
  172.245.244.25
  172.245.244.28
  172.245.248.239
  172.245.25.33
-172.245.252.229
  172.245.253.22
  172.245.253.57
  172.245.254.35
-172.245.254.7
+172.245.254.8
  172.245.28.175
  172.245.30.191
  172.245.4.26
@@ -32256,10 +31865,10 @@
  172.245.52.122
  172.245.52.225
  172.245.52.231
+172.245.56.78
  172.245.60.27
  172.245.62.64
  172.245.64.10
-172.245.64.173
  172.245.64.210
  172.245.64.212
  172.245.64.237
@@ -32269,10 +31878,9 @@
  172.245.70.134
  172.245.8.9
  172.245.82.13
-172.245.91.226
-172.245.91.238
  172.245.92.147
  172.245.97.184
+172.248.13.224
  172.249.171.9
  172.250.7.113
  172.254.154.243
@@ -32280,7 +31888,8 @@
  172.255.80.215
  172.255.81.110
  172.255.83.14
-172.68.132.12
+172.68.10.204
+172.68.10.6
  172.68.144.144
  172.68.146.121
  172.68.146.145
@@ -32291,17 +31900,27 @@
  172.68.146.193
  172.68.146.199
  172.68.146.229
-172.68.182.28
-172.68.182.46
+172.68.182.100
  172.68.211.5
-172.68.238.239
+172.68.238.110
+172.68.238.118
+172.68.238.238
+172.68.238.242
+172.68.238.254
+172.68.239.101
  172.68.239.127
+172.68.239.168
  172.68.239.215
+172.68.239.225
  172.68.239.229
  172.68.239.43
  172.68.239.61
+172.68.24.146
+172.68.24.162
+172.68.244.156
  172.68.244.24
-172.68.246.80
+172.68.246.117
+172.68.246.168
  172.68.46.192
  172.69.134.116
  172.69.134.146
@@ -32319,19 +31938,22 @@
  172.69.138.34
  172.69.138.46
  172.69.138.52
-172.69.194.34
+172.69.138.56
+172.69.138.59
+172.69.190.14
+172.69.190.25
+172.69.194.46
+172.69.194.58
  172.69.194.6
  172.69.194.64
  172.69.22.231
-172.69.34.30
-172.69.35.111
-172.69.63.53
-172.74.126.241
+172.69.54.21
+172.69.55.209
  172.74.184.175
+172.81.129.118
  172.81.129.154
-172.81.129.226
+172.81.129.190
  172.81.129.58
-172.81.129.98
  172.81.177.138
  172.81.177.66
  172.81.182.34
@@ -32346,7 +31968,6 @@
  172.81.235.238
  172.81.239.224
  172.81.241.252
-172.81.241.92
  172.81.242.40
  172.81.243.195
  172.81.246.239
@@ -32368,38 +31989,37 @@
  172.86.84.57
  172.87.193.178
  172.87.221.221
-172.88.195.0
  172.9.237.123
  172.90.13.91
  172.91.208.86
  172.92.153.222
  172.92.205.8
+172.92.91.250
  172.93.101.73
  172.93.120.184
+172.93.165.51
+172.93.165.69
  172.93.166.12
  172.93.166.135
  172.93.38.228
  172.93.39.189
  172.93.49.142
  172.94.109.43
+172.94.23.35
  172.94.23.69
-172.94.24.90
  172.94.34.67
  172.94.34.68
  172.94.34.82
  172.94.34.84
  172.94.34.85
  172.94.63.58
-172.94.69.79
  172.95.161.66
-172.96.14.66
  172.96.16.214
  172.96.161.244
  172.96.166.188
  172.96.172.68
  172.96.176.129
  172.96.184.39
-172.96.185.68
  172.96.190.154
  172.96.191.17
  172.96.196.185
@@ -32411,6 +32031,7 @@
  172.96.220.171
  172.96.223.81
  172.96.227.148
+172.96.227.178
  172.96.227.95
  172.96.234.93
  172.96.238.154
@@ -32432,7 +32053,6 @@
  1725studio.com
  172910209315.ip-dynamic.com
  172princessbet.com
-173.0.136.70
  173.0.49.138
  173.10.184.69
  173.10.184.70
@@ -32449,6 +32069,8 @@
  173.15.162.157
  173.15.28.165
  173.15.85.9
+173.16.188.29
+173.16.254.243
  173.161.156.201
  173.161.208.193
  173.161.87.170
@@ -32458,15 +32080,14 @@
  173.164.210.49
  173.167.46.61
  173.167.85.89
-173.17.36.31
  173.17.69.206
  173.173.254.105
  173.174.105.66
  173.174.181.12
  173.177.237.29
+173.180.233.151
  173.182.141.43
  173.184.104.166
-173.184.29.223
  173.19.58.108
  173.192.125.10
  173.192.34.95
@@ -32474,8 +32095,6 @@
  173.193.136.52
  173.193.219.168
  173.193.22.6
-173.195.15.117
-173.195.15.223
  173.199.114.115
  173.199.114.171
  173.199.114.99
@@ -32493,20 +32112,27 @@
  173.199.143.137
  173.199.186.15
  173.199.71.150
+173.20.18.189
  173.200.213.46
  173.201.196.104
+173.201.196.113
  173.201.196.116
+173.201.196.119
+173.201.196.144
  173.201.196.172
  173.201.196.174
  173.201.196.175
  173.201.196.176
  173.201.196.184
+173.201.196.197
  173.201.196.207
  173.201.196.220
+173.201.196.26
  173.201.196.4
  173.201.196.59
  173.201.196.67
  173.201.196.7
+173.201.196.96
  173.201.196.97
  173.201.31.88
  173.201.39.206
@@ -32551,7 +32177,6 @@
  173.202.27.25
  173.202.29.183
  173.202.30.177
-173.202.30.19
  173.202.80.16
  173.203.126.125
  173.203.215.83
@@ -32574,9 +32199,9 @@
  173.208.157.186
  173.208.166.82
  173.208.168.194
+173.208.168.243
  173.208.169.26
  173.208.169.42
-173.208.173.114
  173.208.176.146
  173.208.177.58
  173.208.177.59
@@ -32596,10 +32221,8 @@
  173.208.248.90
  173.208.249.130
  173.208.249.194
-173.208.40.42
  173.208.46.67
  173.209.44.34
-173.211.25.153
  173.212.192.195
  173.212.197.167
  173.212.197.237
@@ -32616,7 +32239,6 @@
  173.212.208.189
  173.212.209.175
  173.212.209.27
-173.212.212.244
  173.212.214.113
  173.212.215.253
  173.212.216.52
@@ -32644,26 +32266,26 @@
  173.212.242.27
  173.212.243.27
  173.212.245.133
+173.212.249.235
  173.212.252.65
  173.212.253.137
  173.212.253.26
  173.212.254.171
  173.212.254.30
  173.213.85.6
-173.213.87.136
-173.213.87.143
+173.213.87.147
+173.213.87.45
  173.213.96.68
  173.214.155.218
  173.214.174.108
  173.214.181.39
  173.214.185.62
  173.215.38.143
-173.216.214.223
  173.216.245.75
  173.217.255.36
-173.217.97.76
  173.218.65.200
  173.219.43.147
+173.219.72.14
  173.219.86.196
  173.219.89.135
  173.220.222.227
@@ -32686,7 +32308,6 @@
  173.231.192.43
  173.231.200.117
  173.231.200.98
-173.231.59.195
  173.231.63.88
  173.232.146.105
  173.232.146.141
@@ -32694,6 +32315,7 @@
  173.232.7.143
  173.233.72.96
  173.234.100.207
+173.234.100.209
  173.234.143.176
  173.234.151.165
  173.234.153.122
@@ -33473,7 +33095,6 @@
  173.234.227.99
  173.234.48.138
  173.234.48.69
-173.236.144.16
  173.236.144.241
  173.236.144.82
  173.236.152.135
@@ -33520,6 +33141,7 @@
  173.236.177.78
  173.236.177.85
  173.236.177.94
+173.236.178.116
  173.236.178.128
  173.236.178.141
  173.236.178.155
@@ -33626,7 +33248,6 @@
  173.239.3.93
  173.239.33.84
  173.239.33.90
-173.239.71.130
  173.24.113.136
  173.240.15.11
  173.240.248.38
@@ -33642,9 +33263,10 @@
  173.244.36.48
  173.244.48.66
  173.245.202.152
-173.245.203.69
+173.245.203.106
  173.245.219.130
  173.245.36.254
+173.245.52.157
  173.246.13.149
  173.246.159.134
  173.246.39.180
@@ -33690,7 +33312,6 @@
  173.249.42.83
  173.249.45.75
  173.249.46.22
-173.249.47.173
  173.249.48.168
  173.249.48.175
  173.249.48.41
@@ -33724,10 +33345,8 @@
  173.254.250.14
  173.254.87.47
  173.255.115.135
-173.255.191.12
  173.255.193.118
  173.255.193.235
-173.255.194.65
  173.255.197.68
  173.255.199.69
  173.255.204.124
@@ -33746,11 +33365,15 @@
  173.255.240.205
  173.255.248.135
  173.255.250.144
+173.29.202.249
  173.30.96.81
+173.31.177.245
  173.31.204.211
  173.35.147.204
  173.44.123.163
  173.44.152.128
+173.44.152.152
+173.44.152.172
  173.44.153.102
  173.44.153.119
  173.44.153.23
@@ -33762,9 +33385,11 @@
  173.44.155.226
  173.44.165.106
  173.44.165.177
+173.44.166.174
  173.44.167.135
  173.44.167.139
  173.44.167.20
+173.44.167.205
  173.44.167.219
  173.44.167.237
  173.44.167.241
@@ -33774,13 +33399,12 @@
  173.44.222.86
  173.44.223.13
  173.44.223.135
-173.44.223.147
  173.44.223.203
  173.44.223.209
  173.44.223.21
  173.44.223.4
+173.44.227.144
  173.44.227.2
-173.44.227.201
  173.44.227.239
  173.44.227.247
  173.44.227.65
@@ -33789,6 +33413,7 @@
  173.44.41.250
  173.44.42.135
  173.44.42.137
+173.44.60.58
  173.45.100.18
  173.45.238.23
  173.45.79.178
@@ -33802,23 +33427,21 @@
  173.56.235.225
  173.56.92.166
  173.59.247.22
-173.61.122.125
  173.62.236.28
  173.62.253.103
  173.63.146.243
  173.63.203.104
  173.63.217.110
+173.63.59.81
  173.63.64.213
  173.63.97.174
  173.64.72.247
-173.66.111.204
  173.67.141.58
  173.67.202.245
  173.68.185.170
  173.68.191.203
  173.69.174.252
  173.69.200.104
-173.70.12.86
  173.70.24.15
  173.70.61.180
  173.73.115.178
@@ -33832,6 +33455,8 @@
  173.79.252.210
  173.8.134.217
  173.81.218.65
+173.81.229.105
+173.82.104.207
  173.82.105.129
  173.82.119.161
  173.82.123.229
@@ -33879,6 +33504,7 @@
  173.89.28.137
  173.89.68.61
  173.91.11.142
+173.91.160.39
  173.92.22.111
  173.94.178.164
  173.94.215.84
@@ -33891,7 +33517,6 @@
  174.100.141.37
  174.100.209.2
  174.100.27.229
-174.102.201.18
  174.102.48.180
  174.104.40.238
  174.105.122.60
@@ -33900,7 +33525,6 @@
  174.109.212.183
  174.110.88.87
  174.111.19.140
-174.112.103.12
  174.112.205.57
  174.112.212.46
  174.113.69.136
@@ -34103,7 +33727,6 @@
  174.138.15.47
  174.138.16.109
  174.138.16.99
-174.138.178.194
  174.138.18.194
  174.138.2.113
  174.138.2.114
@@ -34328,6 +33951,7 @@
  174.21.0.67
  174.21.171.48
  174.21.181.30
+174.21.31.242
  174.21.55.202
  174.21.94.33
  174.22.107.92
@@ -34739,10 +34363,12 @@
  174.59.3.38
  174.59.9.9
  174.6.100.50
+174.60.143.149
  174.62.76.244
  174.64.199.79
  174.64.199.82
  174.64.199.87
+174.64.199.92
  174.7.185.78
  174.7.29.42
  174.70.100.90
@@ -34753,10 +34379,9 @@
  174.70.241.27
  174.70.241.7
  174.70.241.8
-174.71.185.194
-174.71.185.203
  174.71.60.232
  174.72.49.29
+174.72.93.110
  174.74.15.121
  174.75.211.222
  174.76.35.7
@@ -34788,12 +34413,12 @@
  174.91.192.106
  174.91.5.72
  174.92.142.223
-174.93.55.80
  174.94.101.110
  174.94.111.225
  174.94.155.224
-174.95.109.34
+174.95.110.84
  174.95.178.64
+174.96.30.156
  175-365.net
  175.0.122.80
  175.0.9.153
@@ -34801,7 +34426,6 @@
  175.10.144.174
  175.10.145.138
  175.10.18.177
-175.10.220.117
  175.10.243.83
  175.100.103.132
  175.100.103.170
@@ -34816,12 +34440,10 @@
  175.100.72.95
  175.100.73.206
  175.101.11.198
-175.101.117.8
  175.101.13.125
  175.103.38.146
  175.103.46.82
  175.103.47.1
-175.106.10.164
  175.106.10.226
  175.106.12.182
  175.106.17.102
@@ -34846,9 +34468,8 @@
  175.11.195.108
  175.11.195.90
  175.11.202.78
-175.11.213.253
-175.11.216.114
  175.11.216.117
+175.11.216.33
  175.11.64.170
  175.11.65.35
  175.11.94.110
@@ -34863,10 +34484,10 @@
  175.116.222.47
  175.117.144.37
  175.117.145.166
-175.117.145.202
  175.118.126.20
  175.118.126.99
  175.118.152.100
+175.120.228.95
  175.121.184.46
  175.123.253.188
  175.123.253.220
@@ -34878,12 +34499,14 @@
  175.125.95.160
  175.126.167.148
  175.126.176.21
+175.126.38.143
  175.126.38.47
  175.126.62.28
  175.126.73.16
  175.136.2.222
  175.136.226.231
  175.136.97.58
+175.137.115.215
  175.137.121.75
  175.137.246.152
  175.137.4.228
@@ -34892,12 +34515,11 @@
  175.138.233.116
  175.138.48.167
  175.138.49.82
-175.138.80.201
  175.139.161.55
+175.139.162.54
  175.139.179.65
  175.139.188.181
  175.139.252.193
-175.139.76.167
  175.140.138.193
  175.140.184.75
  175.140.217.55
@@ -34905,14 +34527,9 @@
  175.140.89.82
  175.141.69.201
  175.142.212.123
-175.143.114.242
-175.143.143.56
-175.143.184.208
-175.143.210.131
  175.143.51.221
  175.143.79.81
  175.143.94.120
-175.144.163.195
  175.144.198.13
  175.144.198.225
  175.144.198.226
@@ -34922,33 +34539,28 @@
  175.144.70.244
  175.145.109.202
  175.145.178.96
+175.145.200.192
  175.145.200.216
  175.145.234.102
  175.147.21.193
  175.150.183.63
+175.157.247.8
+175.157.36.240
  175.158.170.213
  175.158.38.68
+175.160.187.82
  175.162.0.98
  175.162.1.57
-175.162.10.162
-175.162.2.105
  175.162.221.130
-175.162.77.71
-175.169.118.51
-175.169.26.13
-175.170.142.136
  175.170.149.29
-175.172.51.94
-175.175.68.20
-175.175.69.153
+175.171.151.43
+175.175.78.202
  175.176.18.138
-175.176.18.243
  175.176.184.5
  175.176.185.106
-175.176.19.157
  175.176.19.208
  175.176.223.133
-175.176.81.40
+175.176.30.23
  175.176.83.10
  175.176.89.193
  175.182.175.145
@@ -34961,7 +34573,6 @@
  175.186.0.161
  175.19.187.234
  175.19.209.244
-175.192.85.39
  175.193.13.3
  175.193.2.152
  175.193.2.152bin.sh
@@ -34971,10 +34582,9 @@
  175.195.197.176
  175.195.33.102
  175.196.10.125
-175.196.178.187
+175.196.69.174
  175.197.233.197
  175.198.80.24
-175.198.99.146
  175.199.229.203
  175.199.229.203bin.sh
  175.199.33.139
@@ -34982,7 +34592,6 @@
  175.201.64.37
  175.202.14.244
  175.203.179.215
-175.204.98.96
  175.205.126.190
  175.205.136.127
  175.206.182.103
@@ -34995,15 +34604,17 @@
  175.208.191.37
  175.208.251.15
  175.209.141.227
-175.210.137.145
+175.211.13.150
  175.211.44.107
  175.211.69.151
+175.212.159.89
  175.212.180.131
  175.212.225.71
  175.213.81.178
  175.213.81.184
  175.213.81.19
  175.213.82.49
+175.215.105.78
  175.215.141.197
  175.215.202.131
  175.24.1.203
@@ -35045,7 +34656,6 @@
  175.24.45.137
  175.24.45.144
  175.24.46.21
-175.24.49.210
  175.24.49.95
  175.24.50.107
  175.24.51.66
@@ -35066,14 +34676,12 @@
  175.24.97.62
  175.27.128.235
  175.27.157.206
-175.27.187.38
  175.28.14.2
  175.29.183.2
  175.29.188.27
  175.29.188.9
  175.30.204.158
  175.36.126.63
-175.41.167.83
  175.41.191.216
  175.41.218.218
  175.41.44.26
@@ -35081,7 +34689,6 @@
  175.41.44.51
  175.41.45.129
  175.42.100.24
-175.42.44.57
  175.43.176.182
  175.43.240.43
  175.44.158.139
@@ -35095,18 +34702,17 @@
  175.45.187.30
  175.6.102.248
  175.6.108.125
+175.6.115.99
  175.6.130.39
  175.6.146.207
  175.6.254.57
-175.6.32.134
  175.6.35.140
  175.6.35.166
  175.6.35.207
-175.6.35.46
+175.6.35.228
  175.6.35.52
  175.6.35.82
  175.6.35.93
-175.6.36.97
  175.6.40.14
  175.6.6.147
  175.6.73.4
@@ -35115,6 +34721,7 @@
  175.8.142.21
  175.8.41.237
  175.8.61.45
+175.9.121.89
  175.97.132.101
  175.97.135.16
  175.97.136.186
@@ -35131,27 +34738,22 @@
  176.100.75.27
  176.101.119.72
  176.101.221.119
+176.102.176.182
  176.102.224.53
  176.102.224.60
  176.102.240.51
  176.103.174.123
  176.103.174.198
-176.103.33.188
-176.103.40.198
  176.103.45.24
  176.103.56.70
  176.103.74.89
  176.103.91.193
-176.104.107.20
-176.104.16.58
  176.104.176.188
  176.104.180.238
  176.104.25.140
  176.104.52.46
  176.104.54.43
  176.105.202.158
-176.105.212.242
-176.106.122.21
  176.106.126.217
  176.106.186.35
  176.106.186.99
@@ -35182,11 +34784,11 @@
  176.108.104.84
  176.108.106.25
  176.108.106.5
-176.108.124.150
  176.108.176.181
  176.110.121.90
  176.110.125.233
  176.110.130.150
+176.110.134.2
  176.111.173.11
  176.111.173.12
  176.111.173.13
@@ -35198,10 +34800,13 @@
  176.111.173.22
  176.111.173.23
  176.111.173.46
+176.111.173.47
  176.111.173.48
+176.111.173.49
+176.111.173.50
  176.111.180.209
  176.111.208.100
-176.111.51.85
+176.111.209.246
  176.111.60.55
  176.111.73.57
  176.112.113.20
@@ -35260,6 +34865,7 @@
  176.113.161.95
  176.113.209.13
  176.113.226.68
+176.113.227.122
  176.113.227.67
  176.113.234.112
  176.113.72.133
@@ -35269,11 +34875,9 @@
  176.114.131.205
  176.114.153.102
  176.114.153.113
-176.114.153.120
  176.114.153.16
  176.114.153.22
  176.114.153.45
-176.114.153.70
  176.114.228.40
  176.115.197.118
  176.116.57.51
@@ -35292,10 +34896,7 @@
  176.119.1.180
  176.119.1.75
  176.119.109.177
-176.119.134.1
-176.119.134.80
-176.119.134.85
-176.119.140.82
+176.119.134.222
  176.119.141.200
  176.119.141.202
  176.119.141.32
@@ -35303,8 +34904,6 @@
  176.119.26.12
  176.119.29.70
  176.119.29.8
-176.12.69.77
-176.120.211.250
  176.120.216.143
  176.120.220.199
  176.120.28.140
@@ -35314,6 +34913,7 @@
  176.121.14.109
  176.121.243.10
  176.122.129.114
+176.122.141.223
  176.122.142.162
  176.122.156.32
  176.122.158.234
@@ -35321,7 +34921,6 @@
  176.122.161.175
  176.122.164.94
  176.122.166.91
-176.122.172.102
  176.122.174.22
  176.122.175.66
  176.122.188.28
@@ -35368,6 +34967,7 @@
  176.124.146.59
  176.124.188.3
  176.124.231.76
+176.126.167.10
  176.126.167.107
  176.126.84.210
  176.126.85.207
@@ -35378,7 +34978,6 @@
  176.14.153.182
  176.14.156.48
  176.14.243.96
-176.142.216.192
  176.143.111.17
  176.144.197.191
  176.145.11.22
@@ -35389,6 +34988,7 @@
  176.168.131.91
  176.168.170.82
  176.169.144.248
+176.169.228.114
  176.170.212.136
  176.174.199.40
  176.175.186.14
@@ -35409,16 +35009,17 @@
  176.197.5.218
  176.197.86.2
  176.197.95.2
+176.198.104.40
  176.198.215.108
  176.198.40.56
  176.198.94.109
-176.20.249.211
  176.20.60.141
  176.202.169.139
  176.202.232.137
-176.202.233.154
  176.202.233.70
+176.202.233.77
  176.205.22.4
+176.206.104.63
  176.206.121.23
  176.206.148.218
  176.210.99.14
@@ -35426,8 +35027,6 @@
  176.212.36.226
  176.212.40.60
  176.212.59.84
-176.215.114.232
-176.215.255.141
  176.215.97.160
  176.218.1.105
  176.221.104.2
@@ -35493,7 +35092,6 @@
  176.236.37.160
  176.236.37.168
  176.236.37.175
-176.236.86.162
  176.237.4.193
  176.239.0.210
  176.241.141.167
@@ -35505,7 +35103,7 @@
  176.241.94.228
  176.25.37.117
  176.251.81.227
-176.26.15.157
+176.255.86.185
  176.28.116.58
  176.30.212.184
  176.30.212.190
@@ -35526,6 +35124,7 @@
  176.31.165.144
  176.31.17.187
  176.31.18.148
+176.31.182.125
  176.31.193.24
  176.31.200.130
  176.31.200.15
@@ -35555,11 +35154,14 @@
  176.31.255.63
  176.31.31.185
  176.31.33.66
+176.31.34.12
+176.31.40.50
  176.31.46.178
  176.31.46.240
  176.31.47.100
  176.32.177.30
  176.32.195.69
+176.32.230.23
  176.32.33.174
  176.34.121.38
  176.34.148.66
@@ -35567,18 +35169,15 @@
  176.34.252.88
  176.34.254.113
  176.34.89.217
-176.36.109.96
  176.36.147.195
  176.36.20.67
  176.36.37.21
-176.37.248.76
  176.37.44.170
-176.37.96.163
  176.37.99.111
  176.38.7.43
  176.41.24.102
  176.42.114.128
-176.44.21.199
+176.44.29.245
  176.52.200.130
  176.52.219.6
  176.52.253.14
@@ -35597,14 +35196,13 @@
  176.56.107.176
  176.56.107.189
  176.56.107.200
+176.56.107.202
  176.56.107.203
  176.56.107.206
-176.56.107.207
  176.56.107.213
  176.56.107.221
  176.56.107.230
  176.56.107.251
-176.56.107.72
  176.56.107.79
  176.56.107.87
  176.56.136.137
@@ -35622,12 +35220,12 @@
  176.58.107.100
  176.58.110.181
  176.58.121.177
+176.58.192.90
  176.58.65.52
  176.58.65.6
  176.58.89.182
  176.58.93.123
  176.59.1.36
-176.59.10.130
  176.61.137.230
  176.61.140.118
  176.61.140.143
@@ -35637,11 +35235,15 @@
  176.61.143.38
  176.61.233.67
  176.61.60.76
+176.62.178.247
  176.62.185.72
  176.62.188.158
+176.63.0.175
  176.63.203.149
  176.63.205.248
+176.63.8.230
  176.65.242.30
+176.65.254.101
  176.67.86.128
  176.67.86.129
  176.67.86.140
@@ -35659,16 +35261,14 @@
  176.67.86.36
  176.67.86.47
  176.67.86.52
+176.67.86.60
  176.74.11.254
  176.74.136.237
-176.74.153.104
-176.78.2.47
+176.74.80.162
  176.78.83.96
  176.79.52.126
-176.83.175.246
-176.84.177.68
  176.86.165.85
-176.88.31.110
+176.88.44.122
  176.88.81.118
  176.9.1.234
  176.9.10.227
@@ -35741,6 +35341,7 @@
  176.96.238.185
  176.96.238.201
  176.96.238.223
+176.96.238.86
  176.96.241.1
  176.96.241.253
  176.97.247.9
@@ -35753,6 +35354,7 @@
  176.98.95.111
  176.98.95.132
  176.99.10.22
+176.99.169.75
  176.99.2.207
  176.99.2.90
  176.99.5.150
@@ -35776,13 +35378,12 @@
  177.10.201.170
  177.10.211.198
  177.10.212.166
-177.10.240.102
-177.10.46.19
+177.10.241.126
  177.10.84.121
-177.101.124.34
+177.101.116.189
  177.101.125.251
  177.101.172.14
-177.101.85.114
+177.102.115.34
  177.102.143.23
  177.103.157.126
  177.103.159.44
@@ -35795,13 +35396,12 @@
  177.105.135.57
  177.105.35.54
  177.105.65.45
-177.105.68.0
  177.105.68.100
  177.105.68.105
  177.105.68.106
-177.105.68.11
  177.105.68.110
  177.105.68.112
+177.105.68.114
  177.105.68.118
  177.105.68.122
  177.105.68.126
@@ -35810,9 +35410,8 @@
  177.105.68.136
  177.105.68.140
  177.105.68.146
-177.105.68.151
+177.105.68.153
  177.105.68.155
-177.105.68.166
  177.105.68.17
  177.105.68.175
  177.105.68.177
@@ -35827,27 +35426,32 @@
  177.105.68.231
  177.105.68.236
  177.105.68.248
-177.105.68.25
+177.105.68.253
+177.105.68.26
  177.105.68.31
  177.105.68.32
  177.105.68.36
  177.105.68.45
  177.105.68.51
  177.105.68.52
+177.105.68.56
  177.105.68.64
  177.105.68.74
  177.105.68.80
  177.105.68.86
+177.105.68.89
+177.105.68.92
  177.105.68.98
-177.106.43.88
+177.106.252.58
  177.106.94.77
  177.107.134.94
  177.107.26.255
  177.107.50.18
+177.107.50.21
  177.107.68.19
  177.107.68.22
-177.11.118.197
  177.11.156.246
+177.11.167.125
  177.11.167.50
  177.11.22.76
  177.11.65.126
@@ -35860,6 +35464,7 @@
  177.12.241.50
  177.12.244.28
  177.12.244.3
+177.12.251.250
  177.12.28.118
  177.124.10.140
  177.124.10.53
@@ -35868,12 +35473,12 @@
  177.124.184.72
  177.124.185.0
  177.124.201.61
-177.124.210.124
  177.124.217.185
  177.124.225.106
  177.124.23.147
  177.125.160.101
  177.125.160.250
+177.125.161.248
  177.125.162.58
  177.125.163.239
  177.125.165.78
@@ -35885,32 +35490,35 @@
  177.125.204.200
  177.125.204.85
  177.125.205.116
+177.125.205.191
  177.125.206.4
  177.125.207.147
  177.125.62.46
  177.126.123.82
  177.126.153.253
-177.126.200.66
  177.126.200.83
  177.126.200.85
  177.126.208.56
  177.126.210.111
-177.126.220.190
+177.126.216.149
  177.126.77.47
  177.126.78.10
  177.126.81.33
  177.126.81.62
  177.126.89.59
  177.126.93.170
+177.128.149.44
  177.128.212.30
  177.128.216.2
  177.128.232.30
  177.128.35.51
  177.128.42.122
+177.128.42.45
  177.128.94.142
  177.129.17.52
  177.129.202.92
  177.129.202.97
+177.129.206.119
  177.129.206.236
  177.129.207.23
  177.129.207.36
@@ -35924,23 +35532,23 @@
  177.130.141.181
  177.130.141.95
  177.130.150.235
+177.130.160.162
  177.130.51.198
+177.130.53.68
  177.130.95.172
  177.131.13.9
  177.131.22.186
  177.133.125.26
+177.133.150.163
  177.133.43.161
  177.133.78.210
  177.135.101.101
  177.135.103.54
-177.135.192.210
  177.135.250.32
  177.136.121.145
  177.136.14.178
  177.136.168.82
  177.136.185.200
-177.136.194.172
-177.136.209.236
  177.136.210.135
  177.136.213.194
  177.136.213.231
@@ -35955,7 +35563,6 @@
  177.137.151.249
  177.137.160.233
  177.137.160.236
-177.137.163.49
  177.137.163.53
  177.137.163.84
  177.137.163.86
@@ -35964,27 +35571,26 @@
  177.137.163.94
  177.137.168.129
  177.137.168.130
-177.137.168.143
-177.137.168.147
+177.137.168.132
+177.137.168.135
  177.137.168.149
  177.137.168.151
  177.137.168.154
  177.137.168.156
  177.137.168.159
-177.137.170.163
  177.137.170.164
  177.137.170.171
  177.137.170.198
  177.137.170.201
  177.137.170.204
  177.137.170.206
-177.137.207.51
  177.137.227.14
  177.139.130.157
  177.139.163.80
  177.139.169.206
-177.139.172.160
  177.139.176.122
+177.139.176.242
+177.140.105.113
  177.140.140.36
  177.140.196.172
  177.140.40.11
@@ -35996,29 +35602,38 @@
  177.152.124.20
  177.152.124.21
  177.152.124.24
+177.152.169.114
+177.152.185.26
  177.152.64.35
  177.154.16.102
  177.154.224.206
+177.154.226.174
  177.154.226.210
+177.154.226.75
+177.154.230.119
  177.154.234.179
+177.154.234.245
  177.154.236.179
  177.154.236.189
  177.154.237.120
-177.154.237.182
+177.154.237.140
+177.154.237.179
+177.154.239.36
+177.154.239.84
  177.154.52.34
  177.154.55.114
  177.155.214.139
+177.155.215.227
  177.155.232.15
  177.155.248.159
-177.17.174.190
  177.170.134.239
-177.179.226.123
-177.181.116.57
+177.183.228.253
  177.184.137.165
  177.184.139.81
  177.184.140.222
  177.184.192.50
  177.184.207.125
+177.184.215.181
  177.184.62.59
  177.184.64.2
  177.184.67.1
@@ -36048,8 +35663,6 @@
  177.188.121.26
  177.189.244.193
  177.19.164.149
-177.19.165.26
-177.19.187.79
  177.19.226.178
  177.19.238.230
  177.190.145.196
@@ -36061,29 +35674,27 @@
  177.190.254.18
  177.190.77.225
  177.190.82.41
-177.190.82.61
  177.191.18.204
  177.191.20.16
-177.193.240.80
-177.20.209.234
-177.20.209.238
  177.200.189.205
  177.200.219.114
  177.200.247.235
  177.200.64.234
+177.200.66.31
  177.200.72.214
+177.200.76.61
  177.200.82.126
  177.200.89.62
+177.200.90.118
  177.200.94.150
-177.202.108.18
  177.202.118.44
-177.203.153.25
+177.203.48.179
  177.204.167.141
-177.205.166.154
-177.205.238.141
+177.206.56.180
  177.207.192.137
  177.21.120.102
  177.21.19.87
+177.21.213.182
  177.21.213.98
  177.21.30.184
  177.21.30.32
@@ -36100,6 +35711,8 @@
  177.220.173.170
  177.220.174.58
  177.220.175.68
+177.220.177.99
+177.220.178.203
  177.220.178.225
  177.220.178.231
  177.220.188.213
@@ -36110,6 +35723,7 @@
  177.221.73.75
  177.222.248.168
  177.223.226.253
+177.223.226.64
  177.223.48.126
  177.223.50.130
  177.223.58.68
@@ -36118,15 +35732,17 @@
  177.224.90.29
  177.226.25.78
  177.228.70.43
+177.23.107.158
  177.23.16.17
  177.23.16.73
+177.23.167.166
  177.23.184.166
  177.23.227.136
  177.23.58.23
  177.23.7.151
  177.23.74.75
-177.23.75.190
-177.23.77.111
+177.23.74.94
+177.23.77.139
  177.23.77.174
  177.230.20.38
  177.234.154.77
@@ -36135,7 +35751,6 @@
  177.239.160.121
  177.239.51.129
  177.240.174.84
-177.240.195.235
  177.240.204.200
  177.241.245.226
  177.243.161.11
@@ -36143,11 +35758,9 @@
  177.243.175.63
  177.244.36.134
  177.247.70.91
-177.249.160.187
-177.25.243.152
-177.255.11.229
+177.25.231.101
+177.25.234.199
  177.30.47.9
-177.30.79.51
  177.32.8.85
  177.33.25.121
  177.34.59.115
@@ -36170,7 +35783,6 @@
  177.36.251.5
  177.36.37.116
  177.36.37.241
-177.37.157.237
  177.37.159.240
  177.37.161.4
  177.37.162.57
@@ -36183,31 +35795,26 @@
  177.38.243.90
  177.38.39.130
  177.38.5.102
-177.38.5.107
-177.38.5.113
-177.38.5.114
+177.38.5.112
+177.38.5.122
  177.38.5.126
  177.38.5.131
+177.38.5.137
  177.38.5.151
  177.38.5.152
-177.38.5.156
  177.38.5.159
  177.38.5.163
  177.38.5.174
  177.38.5.176
  177.38.5.191
-177.38.5.192
-177.38.5.24
  177.38.5.242
  177.38.5.249
  177.38.5.41
-177.38.5.51
  177.38.5.55
  177.38.5.59
  177.38.5.63
  177.38.5.77
  177.38.5.93
-177.38.5.97
  177.38.69.111
  177.39.126.238
  177.39.129.116
@@ -36216,11 +35823,13 @@
  177.39.218.94
  177.4.125.22
  177.42.118.254
+177.43.223.91
  177.43.249.42
  177.44.175.198
  177.44.18.114
  177.44.18.124
  177.44.18.96
+177.44.26.93
  177.44.74.59
  177.44.82.232
  177.44.88.168
@@ -36232,14 +35841,15 @@
  177.47.135.246
  177.47.224.1
  177.47.27.234
+177.47.92.84
  177.52.173.62
  177.52.249.220
  177.52.26.194
  177.52.26.234
-177.52.28.116
  177.52.48.225
-177.52.62.41
-177.52.74.43
+177.52.74.141
+177.53.110.172
+177.53.110.238
  177.53.144.63
  177.53.152.36
  177.53.16.84
@@ -36256,7 +35866,6 @@
  177.54.251.104
  177.54.52.163
  177.55.143.141
-177.56.184.47
  177.57.2.10
  177.6.254.194
  177.63.213.122
@@ -36266,7 +35875,7 @@
  177.66.195.116
  177.66.195.118
  177.66.221.5
-177.66.223.151
+177.66.240.178
  177.66.247.233
  177.66.247.81
  177.66.31.42
@@ -36347,23 +35956,19 @@
  177.74.143.175
  177.74.143.97
  177.74.180.40
+177.74.181.142
  177.74.2.10
  177.74.228.34
-177.74.254.113
  177.74.63.197
  177.75.143.112
  177.75.15.162
-177.75.150.77
  177.75.159.200
  177.75.69.142
-177.75.92.190
  177.76.224.57
-177.76.8.131
  177.8.169.172
  177.8.170.122
  177.8.172.137
  177.8.216.114
-177.8.247.23
  177.81.228.212
  177.84.108.76
  177.84.109.10
@@ -36376,28 +35981,27 @@
  177.84.148.47
  177.84.148.71
  177.84.17.22
+177.84.171.179
  177.84.219.9
  177.84.222.254
+177.84.84.195
  177.85.121.36
-177.85.157.232
-177.85.157.235
-177.85.157.238
  177.85.167.10
  177.85.19.37
  177.85.200.241
  177.85.200.45
-177.85.61.169
  177.85.66.254
  177.85.66.82
  177.85.70.42
  177.85.75.8
-177.85.98.168
  177.85.98.19
  177.86.115.2
  177.86.115.65
  177.86.115.97
+177.86.138.87
  177.86.158.102
  177.86.160.4
+177.86.167.159
  177.86.181.206
  177.86.182.56
  177.86.201.22
@@ -36416,20 +36020,22 @@
  177.86.64.93
  177.87.10.186
  177.87.108.93
-177.87.168.10
+177.87.168.105
  177.87.221.172
  177.87.223.194
  177.87.230.1
  177.87.230.29
  177.87.230.31
  177.87.36.193
-177.87.40.62
+177.87.68.149
  177.87.68.154
-177.87.68.158
-177.87.68.82
  177.9.179.25
+177.91.111.233
+177.91.135.23
+177.91.182.157
+177.91.184.224
  177.91.186.60
-177.91.19.172
+177.91.188.226
  177.91.214.89
  177.91.218.20
  177.91.33.131
@@ -36449,8 +36055,6 @@
  177.92.165.73
  177.92.249.112
  177.92.34.180
-177.92.37.76
-177.92.41.31
  177.92.66.227
  177.92.9.10
  177.92.9.12
@@ -36465,6 +36069,7 @@
  177.94.227.188
  177.95.75.169
  177.95.93.99
+177.97.41.204
  177.99.175.58
  1770122162.jclecardinal.com
  177306689.servehalflife.com
@@ -36472,23 +36077,22 @@
  177momo.com
  178-365.net
  178.10.192.85
+178.116.120.90
  178.116.213.31
-178.116.86.211
  178.116.96.223
+178.118.161.146
+178.118.168.103
  178.12.221.130
+178.12.224.17
  178.120.22.2
  178.120.48.199
  178.121.128.17
  178.121.181.25
  178.121.69.188
  178.121.69.232
-178.122.125.208
  178.122.148.122
  178.122.205.228
  178.123.182.2
-178.123.212.242
-178.123.215.161
-178.123.80.100
  178.124.131.178
  178.124.162.209
  178.124.209.209
@@ -36498,7 +36102,7 @@
  178.125.17.15
  178.125.183.115
  178.125.221.124
-178.125.235.254
+178.126.214.212
  178.128.1.194
  178.128.1.219
  178.128.100.167
@@ -36534,13 +36138,13 @@
  178.128.125.16
  178.128.125.4
  178.128.126.101
+178.128.126.108
  178.128.127.126
  178.128.127.62
  178.128.13.61
  178.128.131.130
  178.128.14.102
  178.128.14.47
-178.128.144.81
  178.128.146.154
  178.128.146.170
  178.128.146.87
@@ -36557,8 +36161,8 @@
  178.128.159.158
  178.128.160.25
  178.128.161.170
+178.128.162.10
  178.128.162.115
-178.128.162.42
  178.128.163.3
  178.128.164.145
  178.128.166.156
@@ -36567,7 +36171,7 @@
  178.128.169.213
  178.128.169.88
  178.128.17.153
-178.128.178.187
+178.128.176.187
  178.128.18.14
  178.128.180.162
  178.128.180.252
@@ -36581,7 +36185,6 @@
  178.128.205.229
  178.128.206.34
  178.128.206.59
-178.128.208.128
  178.128.208.38
  178.128.209.139
  178.128.209.253
@@ -36592,7 +36195,6 @@
  178.128.215.134
  178.128.215.16
  178.128.215.76
-178.128.216.9
  178.128.217.42
  178.128.218.188
  178.128.218.70
@@ -36603,7 +36205,6 @@
  178.128.224.143
  178.128.225.74
  178.128.226.2
-178.128.230.35
  178.128.230.50
  178.128.232.28
  178.128.234.32
@@ -36686,6 +36287,7 @@
  178.128.61.211
  178.128.62.201
  178.128.63.183
+178.128.63.189
  178.128.63.28
  178.128.64.238
  178.128.7.8
@@ -36703,8 +36305,8 @@
  178.128.8.241
  178.128.8.41
  178.128.80.85
-178.128.83.209
  178.128.83.28
+178.128.84.200
  178.128.84.47
  178.128.87.73
  178.128.88.244
@@ -37018,12 +36620,14 @@
  178.137.89.28
  178.137.93.24
  178.137.95.244
+178.138.33.133
  178.140.137.233
  178.141.130.232
  178.141.165.37
  178.141.223.11
  178.141.4.175
  178.142.56.12
+178.142.63.146
  178.143.12.103
  178.143.52.84
  178.147.233.236
@@ -37037,6 +36641,7 @@
  178.150.139.189
  178.150.15.194
  178.150.194.243
+178.150.207.53
  178.150.237.198
  178.150.237.227
  178.150.47.62
@@ -37051,30 +36656,26 @@
  178.151.241.122
  178.154.249.146
  178.155.12.177
-178.155.5.104
  178.155.5.136
  178.155.5.152
  178.155.5.176
  178.155.5.179
  178.155.5.183
  178.155.5.189
-178.155.5.199
  178.155.5.211
+178.155.5.236
  178.155.5.33
  178.155.5.7
  178.155.5.72
  178.155.5.81
  178.156.44.128
  178.157.91.246
-178.158.0.235
  178.158.12.143
  178.158.14.234
  178.158.16.249
-178.158.17.83
  178.158.18.130
  178.158.185.167
  178.158.32.149
-178.158.34.123
  178.158.34.201
  178.158.35.158
  178.159.0.204
@@ -37087,7 +36688,6 @@
  178.159.242.73
  178.159.242.91
  178.159.245.55
-178.159.3.167
  178.159.3.177
  178.159.36.172
  178.159.37.104
@@ -37095,6 +36695,7 @@
  178.159.37.125
  178.159.37.128
  178.159.37.13
+178.159.37.134
  178.159.37.139
  178.159.37.142
  178.159.37.163
@@ -37135,8 +36736,6 @@
  178.162.218.42
  178.162.222.227
  178.164.152.138
-178.164.153.62
-178.164.216.151
  178.165.103.188
  178.165.128.170
  178.165.128.183
@@ -37173,7 +36772,6 @@
  178.17.171.197
  178.17.171.22
  178.17.171.39
-178.17.171.53
  178.17.171.78
  178.17.174.10
  178.17.174.13
@@ -37186,15 +36784,15 @@
  178.17.174.68
  178.170.117.50
  178.170.146.195
+178.170.166.162
  178.170.168.212
  178.170.220.162
  178.172.147.45
+178.172.208.244
  178.173.171.10
-178.173.192.253
  178.174.148.58
  178.174.159.163
  178.174.245.153
-178.174.31.62
  178.175.119.165
  178.175.129.41
  178.175.129.42
@@ -37204,20 +36802,18 @@
  178.175.132.67
  178.175.132.70
  178.175.132.71
-178.175.132.72
  178.175.148.148
  178.175.148.224
-178.175.225.29
  178.175.234.9
  178.176.169.154
-178.176.174.55
-178.176.174.62
  178.176.175.128
  178.176.175.80
  178.176.224.36
  178.176.61.193
  178.176.72.37
  178.176.77.66
+178.176.78.99
+178.176.79.212
  178.176.79.60
  178.18.138.41
  178.18.16.21
@@ -37229,24 +36825,21 @@
  178.184.69.201
  178.184.72.179
  178.188.67.190
-178.189.225.242
  178.19.106.234
  178.19.106.26
  178.19.107.27
  178.19.179.30
  178.19.247.25
-178.190.154.38
  178.191.190.75
  178.193.226.120
  178.194.110.8
  178.194.193.94
+178.194.26.106
  178.195.53.244
  178.196.1.133
  178.196.1.210
-178.197.227.246
  178.198.130.101
  178.198.148.79
-178.199.108.65
  178.199.129.214
  178.20.100.35
  178.20.137.178
@@ -37264,23 +36857,25 @@
  178.203.120.68
  178.203.146.227
  178.203.16.15
+178.203.16.17
  178.204.52.119
  178.205.101.67
  178.205.136.73
  178.205.141.180
  178.205.254.106
  178.208.143.150
-178.208.172.21
+178.208.255.8
  178.208.75.227
  178.209.170.75
  178.209.42.84
  178.209.66.210
  178.21.20.102
+178.210.137.245
  178.210.163.36
+178.210.2.69
  178.210.44.131
  178.210.66.37
  178.211.45.66
-178.211.57.114
  178.212.176.82
  178.212.192.118
  178.212.54.137
@@ -37307,9 +36902,7 @@
  178.216.2.9
  178.216.200.48
  178.216.232.173
-178.216.234.94
  178.216.49.147
-178.216.50.212
  178.217.106.245
  178.217.152.234
  178.217.169.10
@@ -37318,6 +36911,7 @@
  178.217.216.184
  178.217.40.208
  178.217.43.135
+178.217.43.190
  178.218.104.42
  178.218.104.8
  178.218.201.155
@@ -37327,30 +36921,30 @@
  178.219.173.193
  178.219.175.128
  178.219.31.252
-178.219.37.70
  178.219.89.121
  178.22.168.44
  178.22.221.201
  178.22.65.147
  178.221.110.179
+178.221.183.217
  178.221.39.148
  178.221.41.10
  178.222.148.139
  178.222.252.130
  178.223.68.233
+178.227.61.187
  178.23.244.208
  178.233.208.145
+178.234.29.184
  178.234.35.26
  178.234.35.42
  178.234.37.197
-178.235.190.2
  178.236.137.63
  178.236.232.8
  178.236.87.138
  178.238.133.232
  178.238.224.166
  178.238.224.98
-178.238.225.147
  178.238.227.217
  178.238.231.155
  178.238.232.57
@@ -37360,6 +36954,7 @@
  178.238.78.15
  178.239.160.203
  178.239.161.214
+178.239.168.190
  178.239.168.57
  178.239.169.130
  178.239.173.176
@@ -37373,26 +36968,27 @@
  178.248.108.51
  178.248.200.16
  178.248.57.92
-178.248.64.10
  178.248.87.44
  178.249.95.43
  178.250.156.229
  178.250.157.177
  178.250.54.208
-178.251.12.147
-178.251.12.177
+178.250.54.221
  178.251.12.198
+178.251.12.36
  178.251.12.6
  178.251.140.3
  178.252.122.139
  178.252.127.236
+178.252.190.194
  178.252.197.64
  178.252.199.46
  178.252.75.13
  178.252.80.226
-178.253.101.193
-178.253.198.2
+178.253.217.118
  178.253.248.146
+178.253.95.152
+178.254.135.204
  178.254.138.82
  178.254.139.33
  178.254.139.41
@@ -37401,7 +36997,6 @@
  178.254.148.37
  178.254.149.33
  178.254.149.37
-178.254.171.32
  178.254.171.41
  178.254.174.196
  178.254.22.25
@@ -37415,14 +37010,12 @@
  178.255.229.102
  178.255.42.126
  178.255.45.214
-178.26.160.249
  178.26.166.118
  178.27.103.45
  178.27.122.202
-178.27.198.142
+178.27.197.240
  178.27.202.90
  178.3.145.208
-178.3.210.163
  178.30.241.242
  178.30.75.243
  178.32.1.128
@@ -37434,7 +37027,6 @@
  178.32.181.66
  178.32.189.89
  178.32.192.85
-178.32.197.82
  178.32.197.87
  178.32.198.183
  178.32.205.2
@@ -37449,8 +37041,8 @@
  178.32.53.209
  178.32.58.209
  178.32.79.49
+178.32.87.248
  178.32.88.23
-178.32.90.162
  178.33.122.96
  178.33.131.26
  178.33.132.215
@@ -37474,6 +37066,7 @@
  178.33.228.210
  178.33.232.69
  178.33.233.230
+178.33.234.205
  178.33.251.230
  178.33.38.55
  178.33.67.12
@@ -37482,11 +37075,14 @@
  178.33.70.40
  178.33.93.88
  178.34.146.222
+178.34.150.93
  178.38.132.54
  178.38.49.155
  178.38.71.231
+178.39.157.66
  178.41.165.5
  178.42.48.18
+178.44.219.23
  178.46.163.191
  178.46.164.5
  178.46.199.220
@@ -37495,6 +37091,7 @@
  178.47.139.50
  178.47.141.128
  178.47.141.196
+178.47.141.85
  178.47.143.198
  178.47.65.105
  178.48.165.143
@@ -37505,11 +37102,11 @@
  178.49.192.210
  178.57.115.124
  178.57.125.78
+178.60.12.166
  178.60.12.198
  178.60.28.98
-178.61.158.242
-178.62.1.145
  178.62.10.18
+178.62.100.17
  178.62.101.135
  178.62.101.95
  178.62.103.30
@@ -37577,7 +37174,6 @@
  178.62.224.183
  178.62.225.191
  178.62.225.62
-178.62.226.175
  178.62.226.177
  178.62.227.11
  178.62.227.177
@@ -37657,7 +37253,6 @@
  178.62.86.172
  178.62.86.6
  178.62.87.246
-178.62.88.90
  178.62.89.173
  178.62.89.199
  178.62.9.122
@@ -37671,6 +37266,7 @@
  178.63.13.15
  178.63.132.83
  178.63.16.7
+178.63.174.225
  178.63.18.3
  178.63.189.139
  178.63.2.220
@@ -37692,16 +37288,13 @@
  178.63.88.48
  178.63.97.34
  178.63.98.228
-178.65.166.186
  178.66.182.76
-178.67.169.218
  178.67.195.64
  178.67.205.104
  178.68.53.8
  178.69.12.30
  178.69.191.120
  178.70.128.126
-178.71.252.75
  178.72.162.242
  178.72.163.252
  178.72.68.101
@@ -37712,9 +37305,12 @@
  178.72.68.146
  178.72.68.156
  178.72.68.160
+178.72.68.163
  178.72.68.17
  178.72.68.171
+178.72.68.18
  178.72.68.183
+178.72.68.200
  178.72.68.232
  178.72.68.234
  178.72.68.236
@@ -37733,7 +37329,6 @@
  178.72.69.168
  178.72.69.182
  178.72.69.220
-178.72.69.227
  178.72.69.231
  178.72.69.40
  178.72.69.42
@@ -37749,14 +37344,15 @@
  178.72.70.175
  178.72.70.179
  178.72.70.181
-178.72.70.186
  178.72.70.209
  178.72.70.235
  178.72.70.248
+178.72.70.25
  178.72.70.28
  178.72.70.34
  178.72.70.4
  178.72.70.43
+178.72.70.44
  178.72.70.63
  178.72.70.84
  178.72.70.85
@@ -37775,14 +37371,15 @@
  178.72.71.56
  178.72.71.62
  178.72.71.63
+178.72.71.79
  178.72.71.86
  178.72.71.96
  178.72.74.40
  178.73.192.7
+178.73.192.8
  178.75.27.131
  178.75.92.109
  178.76.210.226
-178.76.226.109
  178.76.234.182
  178.76.238.246
  178.76.254.130
@@ -37790,6 +37387,8 @@
  178.77.154.111
  178.77.238.2
  178.78.104.202
+178.78.69.28
+178.79.116.11
  178.79.134.207
  178.79.138.62
  178.79.161.166
@@ -37802,7 +37401,9 @@
  178.79.187.33
  178.79.189.74
  178.79.24.36
+178.79.32.9
  178.80.41.103
+178.80.81.82
  178.82.50.84
  178.84.195.232
  178.84.197.175
@@ -37813,40 +37414,47 @@
  178.86.163.62
  178.89.32.171
  178.90.54.157
-178.93.12.109
-178.93.14.91
  178.93.15.192
  178.93.23.56
  178.93.24.110
  178.93.25.39
  178.93.26.87
-178.93.27.45
  178.93.29.20
+178.93.31.243
+178.93.31.37
  178.93.36.241
+178.93.37.104
  178.93.37.232
  178.93.41.114
+178.93.45.140
+178.93.51.225
  178.93.51.28
+178.93.52.80
  178.93.54.41
+178.93.57.85
  178.93.6.134
  178.93.6.233
+178.93.61.224
  178.93.8.14
-178.93.8.141
-178.93.8.175
  178.93.9.105
  178.94.11.234
  178.94.146.50
  178.94.149.31
  178.94.173.6
+178.94.183.152
  178.95.150.151
  178j.life
  179.1.1.11
  179.1.91.130
+179.104.33.180
+179.104.33.81
  179.106.150.4
  179.106.150.5
  179.106.150.7
  179.106.159.204
  179.106.223.27
  179.107.11.195
+179.107.15.237
  179.107.189.61
  179.107.190.83
  179.107.191.179
@@ -37861,15 +37469,16 @@
  179.107.58.243
  179.107.59.165
  179.107.59.220
+179.107.59.80
  179.107.60.0
  179.107.60.178
  179.107.60.60
  179.107.61.167
-179.107.61.178
  179.107.61.68
  179.107.67.80
  179.107.84.10
  179.108.123.210
+179.108.132.4
  179.108.158.122
  179.108.158.142
  179.108.158.224
@@ -37886,6 +37495,7 @@
  179.108.251.41
  179.108.56.40
  179.108.57.238
+179.108.78.90
  179.108.94.75
  179.109.2.90
  179.109.38.42
@@ -37894,25 +37504,23 @@
  179.110.133.235
  179.111.212.162
  179.111.41.21
-179.116.194.59
  179.124.137.83
  179.124.137.84
  179.124.137.86
+179.124.19.111
  179.124.240.199
  179.124.36.196
  179.125.172.177
  179.125.172.210
  179.125.25.218
  179.125.39.230
-179.125.6.178
  179.127.140.113
  179.127.140.142
-179.127.147.65
  179.127.167.201
  179.127.175.202
+179.127.198.73
  179.127.229.213
  179.127.229.240
-179.127.249.213
  179.127.35.17
  179.131.10.103
  179.131.11.234
@@ -37920,18 +37528,17 @@
  179.157.206.101
  179.157.4.188
  179.157.66.64
-179.171.20.50
  179.171.35.50
+179.171.5.121
+179.171.94.203
  179.176.1.21
  179.176.243.182
  179.177.186.121
  179.178.122.5
  179.179.173.124
  179.179.53.106
-179.180.11.37
  179.180.66.87
  179.180.98.209
-179.181.111.8
  179.184.161.221
  179.184.230.194
  179.184.246.10
@@ -37942,6 +37549,7 @@
  179.186.110.131
  179.186.16.39
  179.189.125.222
+179.189.204.52
  179.189.229.82
  179.189.253.122
  179.189.27.28
@@ -37953,6 +37561,7 @@
  179.191.53.235
  179.191.68.86
  179.191.69.146
+179.208.125.217
  179.210.120.225
  179.213.33.206
  179.213.95.241
@@ -37961,10 +37570,11 @@
  179.219.99.144
  179.222.67.144
  179.225.253.69
+179.227.207.237
  179.228.128.37
  179.228.43.74
  179.228.74.3
-179.232.75.13
+179.232.1.252
  179.233.129.76
  179.233.3.103
  179.233.3.89
@@ -37972,11 +37582,11 @@
  179.234.232.150
  179.234.40.169
  179.27.214.238
-179.27.60.34
  179.27.66.106
  179.27.66.74
  179.27.73.234
  179.27.83.222
+179.36.185.178
  179.40.75.1
  179.41.4.149
  179.42.196.78
@@ -38022,14 +37632,15 @@
  179.49.57.150
  179.5.118.12
  179.51.253.190
-179.51.59.56
  179.52.118.143
+179.52.244.177
  179.53.73.70
  179.54.115.180
  179.55.196.169
  179.56.248.64
  179.6.32.61
  179.60.127.45
+179.60.150.81
  179.60.215.37
  179.60.229.168
  179.60.243.38
@@ -38039,13 +37650,10 @@
  179.61.148.164
  179.61.148.176
  179.61.148.179
-179.61.156.15
  179.61.161.126
-179.61.164.62
-179.61.166.68
+179.61.163.57
  179.61.167.28
  179.61.168.11
-179.61.168.12
  179.61.179.206
  179.61.182.69
  179.61.182.93
@@ -38065,19 +37673,19 @@
  179.93.149.17
  179.93.57.86
  179.93.59.246
-179.95.143.134
  179.95.232.131
+179.95.29.26
  179.96.184.70
  179.96.20.138
  179.96.28.225
  179.96.62.105
-179.97.166.129
  179.97.229.35
  179.97.241.202
  179.97.241.247
  179.97.244.91
  179.97.249.94
  179.97.67.188
+179.97.8.197
  179.97.86.254
  179.99.200.39
  179381017012724-dot-aql-rkl-evh.appspot.com
@@ -38126,11 +37734,14 @@
  18.136.144.35
  18.136.200.216
  18.136.202.37
+18.136.204.175
  18.136.72.135
  18.136.74.240
  18.139.212.16
  18.140.214.227
+18.141.179.52
  18.141.210.87
+18.141.222.175
  18.144.49.66
  18.144.54.86
  18.144.73.74
@@ -38214,6 +37825,7 @@
  18.188.2.244
  18.188.210.105
  18.188.211.162
+18.188.223.149
  18.188.25.0
  18.188.34.228
  18.188.40.131
@@ -38221,6 +37833,7 @@
  18.188.69.107
  18.188.8.106
  18.189.171.33
+18.191.105.214
  18.191.109.28
  18.191.145.149
  18.191.159.221
@@ -38245,6 +37858,7 @@
  18.191.89.219
  18.192.62.125
  18.192.62.41
+18.193.112.114
  18.193.113.81
  18.193.3.1
  18.193.5.93
@@ -38421,7 +38035,6 @@
  18.221.143.49
  18.221.162.186
  18.221.162.53
-18.221.168.157
  18.221.206.247
  18.221.223.108
  18.221.226.11
@@ -38435,6 +38048,7 @@
  18.221.93.208
  18.221.98.132
  18.222.120.10
+18.222.137.213
  18.222.149.209
  18.222.165.211
  18.222.167.188
@@ -38446,6 +38060,7 @@
  18.222.21.252
  18.222.210.24
  18.222.218.210
+18.222.225.14
  18.222.226.53
  18.222.229.143
  18.222.255.206
@@ -38507,6 +38122,7 @@
  18.234.174.252
  18.234.208.74
  18.234.221.133
+18.234.43.113
  18.234.79.31
  18.236.105.250
  18.236.113.157
@@ -38524,20 +38140,23 @@
  18.237.21.47
  18.237.223.114
  18.237.233.96
+18.237.237.221
  18.237.4.98
-18.237.53.236
  18.237.57.238
  18.237.9.108
  18.27.197.252
  18.27.79.17
  180.100.206.226
  180.100.206.35
+180.100.213.72
  180.100.243.210
  180.101.147.147
  180.101.202.30
  180.101.221.152
+180.101.248.148
  180.102.132.248
  180.103.218.129
+180.104.124.35
  180.104.13.145
  180.104.13.50
  180.104.175.217
@@ -38558,27 +38177,32 @@
  180.104.39.202
  180.104.59.28
  180.104.61.229
+180.104.65.30
  180.104.74.135
  180.104.76.83
  180.104.79.77
  180.104.85.70
  180.104.9.150
-180.106.122.26
+180.106.122.109
+180.106.122.71
  180.106.194.89
  180.106.236.105
-180.106.238.21
  180.106.81.168
  180.106.87.170
  180.107.109.21
-180.107.115.45
+180.107.128.195
  180.107.128.227
-180.107.128.51
-180.107.135.117
+180.107.134.144
+180.107.250.49
  180.107.50.6
  180.107.58.136
-180.107.58.189
  180.107.76.147
+180.107.94.200
  180.108.121.161
+180.108.155.131
+180.108.201.112
+180.108.201.174
+180.108.243.123
  180.109.130.174
  180.109.32.215
  180.109.34.10
@@ -38589,23 +38213,16 @@
  180.112.185.135
  180.112.191.24
  180.113.140.150
-180.113.142.158
-180.113.143.131
-180.113.147.174
-180.113.147.240
-180.113.60.210
+180.113.67.62
  180.114.101.116
-180.114.150.209
-180.114.151.5
+180.114.150.71
  180.114.169.253
-180.114.176.157
  180.114.194.102
  180.114.77.193
  180.115.100.182
  180.115.112.173
  180.115.117.241
  180.115.117.55
-180.115.182.28
  180.115.3.162
  180.115.66.239
  180.115.89.203
@@ -38656,6 +38273,7 @@
  180.118.97.77
  180.120.12.85
  180.120.175.141
+180.120.211.248
  180.120.79.159
  180.121.247.122
  180.123.108.63
@@ -38728,13 +38346,14 @@
  180.125.98.225
  180.127.109.12
  180.127.77.148
+180.127.77.151
+180.127.92.230
  180.128.0.237
  180.128.1.30
  180.128.1.87
  180.131.110.155
  180.136.96.44
  180.137.45.182
-180.139.113.231
  180.142.130.246
  180.148.214.178
  180.148.215.101
@@ -38746,6 +38365,7 @@
  180.149.245.78
  180.149.96.131
  180.150.19.243
+180.150.21.223
  180.150.21.41
  180.150.226.214
  180.150.226.44
@@ -38757,26 +38377,23 @@
  180.150.227.71
  180.150.230.16
  180.150.35.183
-180.150.50.188
  180.150.52.37
  180.150.58.14
  180.150.73.103
  180.150.86.215
  180.151.198.70
  180.151.246.58
+180.151.56.119
  180.151.56.124
  180.151.56.99
-180.151.58.106
  180.151.58.108
  180.152.235.82
  180.153.60.142
  180.153.91.15
  180.153.91.17
-180.156.116.205
  180.157.10.59
  180.157.250.73
  180.158.2.122
-180.158.6.168
  180.164.19.89
  180.164.221.112
  180.166.114.14
@@ -38803,7 +38420,6 @@
  180.168.47.238
  180.168.95.234
  180.169.214.21
-180.171.11.223
  180.171.58.166
  180.175.196.51
  180.175.224.230
@@ -38814,19 +38430,19 @@
  180.176.96.248
  180.177.180.6
  180.177.243.251
-180.178.127.39
+180.178.127.204
  180.178.134.162
  180.178.135.98
  180.178.159.197
  180.178.37.186
  180.178.63.10
  180.178.97.90
-180.179.13.135
  180.179.98.22
  180.180.100.236
  180.180.102.180
  180.180.102.211
  180.180.104.133
+180.180.111.60
  180.180.112.186
  180.180.114.48
  180.180.119.40
@@ -38834,7 +38450,8 @@
  180.180.123.41
  180.180.141.131
  180.180.151.137
-180.180.151.184
+180.180.151.169
+180.180.151.19
  180.180.151.53
  180.180.151.61
  180.180.151.64
@@ -38845,7 +38462,6 @@
  180.180.152.98
  180.180.156.15
  180.180.161.239
-180.180.162.193
  180.180.170.188
  180.180.170.218
  180.180.171.113
@@ -38856,15 +38472,16 @@
  180.180.200.210
  180.180.200.228
  180.180.201.127
+180.180.201.180
  180.180.201.46
  180.180.201.88
  180.180.202.136
  180.180.202.14
  180.180.202.187
  180.180.216.177
-180.180.217.199
  180.180.217.241
  180.180.218.12
+180.180.224.94
  180.180.241.93
  180.180.26.182
  180.180.35.182
@@ -38879,73 +38496,66 @@
  180.180.99.22
  180.181.159.200
  180.182.47.132
-180.183.0.190
  180.183.0.198
  180.183.1.207
  180.183.1.221
  180.183.114.180
+180.183.119.230
  180.183.129.22
  180.183.13.188
  180.183.131.130
  180.183.139.12
  180.183.152.253
  180.183.153.246
+180.183.154.147
  180.183.154.94
  180.183.155.146
  180.183.155.221
  180.183.156.164
  180.183.159.173
  180.183.159.210
-180.183.159.77
  180.183.17.83
-180.183.174.186
  180.183.180.18
-180.183.19.225
-180.183.19.94
  180.183.226.205
  180.183.227.213
  180.183.228.148
-180.183.229.154
  180.183.229.57
  180.183.244.34
+180.183.246.110
  180.183.247.248
-180.183.249.175
  180.183.25.163
+180.183.250.6
  180.183.29.100
  180.183.29.125
  180.183.3.234
-180.183.3.66
+180.183.3.71
  180.183.3.76
  180.183.44.213
  180.183.5.254
  180.183.5.61
  180.183.6.170
  180.183.6.215
-180.183.6.43
+180.183.97.134
  180.183.98.202
  180.183.98.216
  180.188.241.130
  180.188.241.145
  180.188.241.173
-180.190.10.145
-180.190.10.17
-180.190.174.202
  180.190.179.27
+180.190.33.150
+180.190.33.196
  180.191.157.220
  180.191.158.111
  180.210.201.54
  180.210.201.57
  180.210.205.53
  180.210.206.208
-180.210.222.101
  180.210.222.105
-180.210.222.109
  180.210.222.113
  180.210.222.117
  180.210.222.121
  180.210.222.125
  180.210.222.129
-180.210.222.133
  180.210.222.153
  180.210.222.197
  180.210.222.201
@@ -38966,12 +38576,12 @@
  180.211.102.186
  180.211.115.155
  180.211.120.61
-180.211.135.118
  180.211.141.158
  180.211.158.122
  180.211.162.114
  180.211.162.146
  180.211.170.214
+180.211.172.151
  180.211.179.150
  180.211.183.178
  180.211.183.2
@@ -38992,9 +38602,9 @@
  180.214.236.190
  180.214.236.98
  180.214.237.13
-180.214.237.247
  180.214.238.5
  180.214.239.54
+180.215.194.18
  180.215.197.146
  180.215.199.158
  180.215.202.138
@@ -39003,6 +38613,8 @@
  180.215.214.88
  180.215.215.156
  180.215.223.247
+180.215.225.104
+180.215.225.115
  180.215.227.16
  180.215.227.32
  180.215.64.98
@@ -39012,7 +38624,6 @@
  180.218.5.171
  180.218.6.90
  180.222.161.85
-180.229.240.161
  180.229.5.108
  180.231.222.41
  180.232.123.251
@@ -39024,8 +38635,9 @@
  180.235.138.96
  180.241.154.247
  180.241.159.90
-180.241.175.183
+180.241.217.45
  180.241.252.45
+180.241.47.32
  180.241.47.52
  180.241.75.230
  180.242.12.254
@@ -39036,35 +38648,30 @@
  180.242.72.201
  180.244.202.227
  180.244.235.155
-180.244.68.29
-180.246.110.70
+180.245.157.160
  180.246.148.55
  180.246.148.79
  180.246.17.93
  180.246.175.238
-180.247.148.113
+180.247.100.101
  180.247.178.201
  180.247.194.247
  180.247.197.34
  180.247.61.132
-180.247.63.198
  180.248.0.149
-180.248.1.196
  180.248.120.254
  180.248.123.185
-180.248.200.174
+180.248.173.92
  180.248.27.89
  180.248.43.196
  180.248.98.249
  180.249.111.97
-180.249.164.215
+180.249.117.131
  180.249.167.204
-180.249.184.27
  180.249.231.79
  180.250.101.146
  180.250.111.86
  180.250.115.121
-180.250.12.10
  180.250.124.227
  180.250.131.94
  180.250.136.138
@@ -39084,7 +38691,6 @@
  180.250.210.185
  180.250.247.123
  180.250.247.124
-180.250.247.126
  180.250.247.45
  180.250.248.169
  180.250.248.170
@@ -39104,17 +38710,15 @@
  180.252.122.250
  180.252.126.182
  180.252.157.188
+180.252.243.115
  180.253.138.182
  180.253.163.148
-180.253.164.125
  180.253.165.166
-180.253.166.181
  180.253.166.55
-180.253.225.34
+180.253.4.96
  180.254.12.125
  180.254.34.139
  180.254.40.151
-180.254.46.171
  180.33.192.153
  180.52.66.193
  180.59.248.202
@@ -39122,6 +38726,7 @@
  180.66.102.25
  180.66.53.93
  180.68.49.93
+180.69.47.83
  180.71.47.198
  180.71.58.134
  180.76.101.229
@@ -39137,14 +38742,15 @@
  180.76.133.173
  180.76.133.88
  180.76.134.199
+180.76.141.221
  180.76.141.248
  180.76.147.52
+180.76.148.87
  180.76.150.139
  180.76.152.17
  180.76.152.65
  180.76.158.36
  180.76.160.35
-180.76.167.13
  180.76.167.16
  180.76.171.20
  180.76.171.230
@@ -39188,14 +38794,13 @@
  180.76.96.164
  180.76.99.171
  180.87.195.22
-180.89.58.27
+180.89.56.108
  180.92.233.82
  180.92.238.251
  180.92.239.110
  180.92.239.217
  180.94.170.166
  180.94.64.114
-180.95.139.169
  180.96.11.20
  180.96.63.162
  180.97.182.111
@@ -39225,7 +38830,6 @@
  181.102.120.194
  181.102.124.212
  181.102.127.241
-181.102.138.81
  181.102.14.1
  181.102.14.170
  181.102.143.227
@@ -39233,18 +38837,19 @@
  181.102.162.164
  181.102.17.139
  181.102.19.42
-181.102.2.31
  181.102.203.11
  181.102.21.219
  181.102.29.177
  181.102.32.63
  181.102.43.84
  181.102.45.92
+181.102.49.25
  181.102.5.84
  181.102.54.123
  181.102.55.151
  181.102.59.98
  181.102.65.209
+181.102.65.62
  181.102.75.115
  181.102.90.75
  181.102.94.227
@@ -39261,9 +38866,12 @@
  181.112.49.206
  181.112.56.94
  181.112.57.2
+181.112.57.62
+181.112.62.122
  181.113.121.158
  181.113.135.214
  181.113.135.254
+181.113.21.117
  181.113.22.158
  181.113.225.114
  181.113.225.130
@@ -39279,7 +38887,10 @@
  181.113.67.54
  181.114.110.217
  181.114.195.137
-181.114.211.110
+181.114.195.179
+181.114.195.222
+181.114.211.118
+181.114.211.157
  181.114.212.131
  181.114.222.252
  181.115.146.34
@@ -39300,7 +38911,6 @@
  181.124.152.197
  181.126.70.117
  181.126.83.37
-181.128.15.7
  181.129.104.139
  181.129.134.18
  181.129.136.226
@@ -39315,7 +38925,6 @@
  181.129.30.18
  181.129.30.20
  181.129.30.22
-181.129.33.76
  181.129.36.138
  181.129.42.26
  181.129.49.4
@@ -39330,11 +38939,9 @@
  181.129.66.138
  181.129.7.202
  181.129.70.82
-181.129.74.58
  181.129.98.146
  181.13.110.44
  181.130.133.135
-181.131.171.178
  181.134.21.219
  181.134.9.162
  181.135.153.203
@@ -39359,11 +38966,13 @@
  181.143.81.52
  181.15.154.154
  181.15.154.156
+181.15.156.170
  181.16.136.1
  181.16.136.41
+181.16.144.224
  181.16.17.210
-181.16.198.177
  181.16.198.78
+181.160.26.174
  181.164.131.51
  181.164.132.26
  181.164.210.228
@@ -39371,9 +38980,12 @@
  181.165.200.185
  181.165.68.127
  181.166.106.224
+181.166.37.189
+181.166.8.158
  181.167.247.186
  181.167.96.215
  181.168.206.106
+181.170.24.194
  181.171.120.21
  181.171.209.241
  181.174.100.66
@@ -39386,10 +38998,12 @@
  181.176.222.68
  181.176.241.142
  181.176.242.168
-181.177.111.2
+181.177.111.143
+181.177.111.207
  181.177.111.214
  181.177.111.231
  181.177.111.52
+181.177.112.113
  181.177.172.130
  181.177.20.15
  181.177.231.245
@@ -39400,8 +39014,8 @@
  181.177.96.185
  181.177.96.222
  181.177.96.249
-181.177.96.52
  181.177.96.99
+181.18.42.60
  181.188.149.134
  181.188.166.74
  181.188.171.55
@@ -39417,20 +39031,18 @@
  181.196.0.78
  181.196.138.134
  181.196.142.114
+181.196.145.106
  181.196.176.22
  181.196.181.146
  181.196.2.172
-181.196.205.250
  181.196.207.202
  181.196.242.126
  181.196.244.182
  181.196.246.246
  181.196.254.202
-181.196.3.47
  181.196.51.14
  181.196.57.150
  181.196.57.230
-181.197.101.27
  181.197.108.171
  181.198.2.22
  181.198.203.45
@@ -39454,7 +39066,6 @@
  181.209.75.68
  181.209.82.154
  181.209.86.130
-181.209.86.133
  181.21.159.119
  181.211.101.90
  181.211.11.78
@@ -39466,15 +39077,15 @@
  181.211.38.62
  181.211.6.34
  181.211.8.34
+181.212.5.89
  181.214.156.26
-181.214.158.179
  181.214.87.25
  181.214.89.231
  181.214.89.252
  181.214.92.100
  181.215.114.160
-181.215.121.255
  181.215.4.242
+181.221.230.154
  181.223.160.231
  181.223.176.108
  181.223.88.209
@@ -39486,10 +39097,10 @@
  181.225.65.244
  181.225.70.142
  181.226.166.148
-181.228.55.57
  181.229.35.35
  181.230.116.163
  181.230.219.66
+181.230.222.64
  181.231.220.232
  181.231.54.156
  181.236.221.138
@@ -39500,14 +39111,11 @@
  181.239.208.122
  181.28.101.14
  181.28.152.133
-181.29.90.48
  181.30.101.242
  181.30.12.67
  181.30.126.66
  181.30.28.174
-181.30.28.198
  181.30.28.201
-181.30.28.219
  181.30.28.46
  181.30.30.166
  181.30.61.163
@@ -39516,19 +39124,22 @@
  181.30.99.114
  181.31.211.181
  181.31.213.158
+181.31.96.84
  181.36.42.205
+181.37.126.135
  181.39.135.122
-181.39.139.68
  181.40.122.102
  181.40.122.2
  181.40.73.86
  181.40.84.38
  181.40.84.50
  181.41.241.164
-181.41.82.85
+181.44.183.65
  181.45.71.86
  181.45.99.149
-181.46.164.33
+181.46.66.210
+181.46.68.180
+181.46.9.239
  181.48.105.6
  181.48.111.246
  181.48.120.220
@@ -39537,7 +39148,6 @@
  181.48.139.118
  181.48.15.227
  181.48.155.149
-181.48.28.13
  181.48.36.42
  181.48.46.195
  181.48.54.202
@@ -39560,24 +39170,20 @@
  181.49.43.210
  181.49.50.202
  181.49.50.226
-181.49.53.106
  181.49.54.250
  181.49.59.226
  181.49.96.186
  181.5.192.159
-181.5.197.73
  181.5.199.51
  181.5.203.242
+181.5.205.22
  181.5.207.149
-181.5.215.191
  181.5.217.154
  181.5.217.245
  181.5.217.92
  181.5.222.21
  181.5.228.38
  181.5.229.200
-181.5.234.98
-181.5.238.104
  181.5.246.6
  181.5.251.165
  181.50.251.25
@@ -39593,21 +39199,18 @@
  181.55.188.218
  181.57.100.178
  181.57.151.214
-181.57.184.218
+181.57.167.246
  181.57.77.77
  181.57.97.189
  181.57.98.228
  181.58.189.155
-181.58.245.84
  181.6.0.165
  181.6.101.89
  181.6.108.15
  181.6.112.33
  181.6.123.136
-181.6.127.164
  181.6.138.223
  181.6.142.167
-181.6.144.197
  181.6.149.215
  181.6.158.119
  181.6.16.52
@@ -39615,12 +39218,9 @@
  181.6.19.83
  181.6.190.13
  181.6.196.229
-181.6.20.105
  181.6.20.217
  181.6.201.13
  181.6.204.22
-181.6.207.191
-181.6.208.168
  181.6.209.30
  181.6.211.133
  181.6.212.12
@@ -39632,7 +39232,6 @@
  181.6.227.111
  181.6.23.67
  181.6.231.65
-181.6.233.179
  181.6.244.171
  181.6.251.52
  181.6.29.31
@@ -39643,15 +39242,14 @@
  181.6.48.69
  181.6.49.172
  181.6.55.54
-181.6.63.103
  181.6.69.39
  181.6.69.70
  181.6.69.85
-181.6.70.254
  181.6.87.73
  181.6.91.206
  181.60.79.253
  181.62.245.247
+181.62.3.100
  181.63.248.149
  181.64.160.234
  181.64.233.43
@@ -39666,29 +39264,21 @@
  181.7.205.218
  181.7.209.169
  181.7.216.47
-181.7.222.159
  181.7.224.187
  181.7.235.113
-181.7.235.37
  181.7.241.136
-181.7.243.175
  181.7.244.161
-181.7.247.167
  181.7.248.93
  181.7.251.132
  181.7.254.88
  181.7.255.114
  181.72.201.229
-181.78.11.93
  181.78.8.43
  181.80.18.10
  181.82.231.38
-181.82.234.233
  181.82.237.192
-181.83.231.13
  181.83.236.222
  181.88.176.122
-181.89.48.60
  181.94.221.15
  181.94.226.236
  181.94.244.133
@@ -39696,66 +39286,46 @@
  18190.8wix.com
  182.101.207.11
  182.106.189.57
-182.112.52.174
+182.107.237.104
+182.112.183.150
  182.112.9.196
-182.113.12.220
-182.113.193.96
  182.113.205.213
  182.113.205.251
-182.113.207.37
  182.113.211.248
  182.113.215.240
  182.113.228.239
  182.113.43.246
  182.113.58.37
-182.114.123.83
  182.114.20.91
  182.114.254.27
  182.114.254.79
  182.114.64.33
-182.114.70.130
-182.114.90.88
  182.114.92.204
-182.114.93.238
-182.115.175.177
  182.115.199.21
-182.115.204.58
  182.116.101.36
  182.116.102.170
-182.116.103.91
-182.116.105.89
-182.116.106.57
  182.116.108.16
  182.116.109.252
-182.116.109.39
  182.116.110.177
-182.116.111.20
  182.116.115.46
  182.116.115.78
  182.116.118.247
  182.116.38.160
-182.116.40.227
-182.116.60.73
+182.116.38.225
  182.116.66.118
  182.116.70.143
  182.116.71.231
-182.116.87.195
  182.116.96.194
  182.116.98.31
  182.116.99.66
  182.117.10.20
  182.117.103.176
  182.117.111.133
-182.117.155.49
  182.117.207.206
  182.117.227.55
-182.117.230.190
  182.117.230.78
  182.117.27.218
  182.117.28.104
-182.117.28.67
-182.117.50.161
-182.117.6.167
  182.117.67.215
  182.117.71.196
  182.117.74.106
@@ -39766,101 +39336,58 @@
  182.117.91.235
  182.117.94.187
  182.117.96.14
-182.119.106.139
  182.119.12.199
-182.119.155.43
+182.119.136.111
  182.119.160.254
-182.119.164.83
  182.119.167.42
-182.119.185.248
  182.119.189.90
  182.119.207.145
-182.119.207.54
-182.119.208.233
  182.119.215.94
  182.119.219.132
-182.119.226.145
+182.119.229.138
  182.119.32.89
  182.119.58.36
-182.119.6.195
-182.119.62.16
-182.119.73.141
  182.119.9.51
  182.120.16.115
  182.120.33.50
-182.120.35.202
  182.120.36.28bin.sh
-182.120.36.83
  182.120.40.42
  182.120.5.105
  182.120.86.249
-182.121.113.115
  182.121.117.254
-182.121.128.69
-182.121.155.186
  182.121.157.170
-182.121.202.164
-182.121.21.220
-182.121.211.0
-182.121.233.40
-182.121.238.143
-182.121.241.224
+182.121.224.209
  182.121.248.160
  182.121.25.182
-182.121.33.151
-182.121.82.225
-182.121.84.238
-182.121.85.60
-182.121.87.32
-182.121.9.247
  182.122.160.137
  182.122.249.8
  182.122.25.85
  182.122.251.231bin.sh
-182.122.252.42
+182.122.253.72
  182.122.56.237
-182.122.57.76
-182.123.167.49
  182.123.208.31
-182.123.210.106
  182.123.210.25
  182.123.211.164
  182.123.251.182
  182.124.159.26
-182.124.190.173
  182.124.217.212
  182.124.5.172
  182.126.101.85
-182.126.112.44
-182.126.112.63
  182.126.118.161
-182.126.118.167
-182.126.123.31
-182.126.125.228
-182.126.125.58
  182.126.193.96
  182.126.234.24
  182.126.65.75
-182.126.66.40
-182.126.66.80
  182.126.69.180
  182.126.69.88
  182.126.71.233
  182.126.73.51
-182.126.86.25
-182.126.92.184
-182.126.92.238
-182.126.96.21
-182.126.97.223
-182.127.115.160
-182.127.120.110
  182.127.152.142
  182.127.155.174
  182.127.156.246
  182.127.171.4
-182.127.213.139
+182.127.212.63
  182.127.29.87
-182.127.84.129
+182.139.86.229
  182.142.112.88
  182.142.115.84
  182.142.118.25
@@ -39871,22 +39398,20 @@
  182.150.57.34
  182.150.63.191
  182.150.63.195
-182.151.16.46
  182.151.2.98
  182.151.204.23
  182.151.28.254
  182.151.3.137
  182.151.52.16
  182.151.57.115
+182.155.216.15
  182.156.209.222
  182.156.213.183
-182.156.214.14
  182.16.10.90
  182.16.10.91
  182.16.10.94
  182.16.163.10
  182.16.163.233
-182.16.165.62
  182.16.166.249
  182.16.169.110
  182.16.170.246
@@ -39898,6 +39423,7 @@
  182.16.178.178
  182.16.179.82
  182.16.181.90
+182.16.234.26
  182.16.240.238
  182.16.245.54
  182.16.44.138
@@ -39908,10 +39434,8 @@
  182.160.109.214
  182.160.110.178
  182.160.117.130
-182.160.119.155
  182.160.123.148
  182.160.124.26
-182.160.125.174
  182.160.127.53
  182.160.163.131
  182.161.19.122
@@ -39921,36 +39445,35 @@
  182.165.90.235
  182.168.21.206
  182.171.246.142
+182.172.36.164
  182.172.36.95
  182.176.102.157
  182.176.110.189
-182.176.148.203
  182.176.171.52
  182.176.222.232
-182.176.96.22
  182.18.144.99
  182.18.152.36
  182.18.153.206
-182.18.206.122
+182.18.19.145
  182.180.128.132
  182.180.128.134
  182.180.82.28
-182.183.226.2
-182.184.111.206
  182.184.122.101
+182.184.76.170
  182.185.107.7
  182.185.139.224
-182.185.158.209
  182.185.194.231
-182.185.240.197
+182.186.136.22
  182.186.145.244
  182.186.34.22
+182.186.56.127
  182.188.46.64
  182.189.32.68
  182.19.41.145
  182.19.65.177
  182.19.88.253
  182.191.84.39
+182.201.242.129
  182.201.242.20
  182.208.124.155
  182.208.252.91
@@ -39968,6 +39491,7 @@
  182.23.54.0
  182.23.54.146
  182.23.54.210
+182.23.54.211
  182.23.62.195
  182.23.79.162
  182.23.91.200
@@ -39979,8 +39503,8 @@
  182.232.37.55
  182.241.226.68
  182.242.143.78
+182.242.22.178
  182.245.15.219
-182.253.102.102
  182.253.105.42
  182.253.105.44
  182.253.106.13
@@ -39997,23 +39521,20 @@
  182.253.119.50
  182.253.141.27
  182.253.142.21
-182.253.154.38
  182.253.16.170
  182.253.16.172
  182.253.16.173
  182.253.16.174
  182.253.16.3
  182.253.169.128
+182.253.172.110
+182.253.172.18
  182.253.172.19
  182.253.172.191
+182.253.172.225
  182.253.173.133
-182.253.174.254
-182.253.174.51
-182.253.175.197
-182.253.175.23
  182.253.175.44
  182.253.18.141
-182.253.190.154
  182.253.191.106
  182.253.192.11
  182.253.192.186
@@ -40024,14 +39545,15 @@
  182.253.201.26
  182.253.201.66
  182.253.201.76
+182.253.215.92
  182.253.22.2
-182.253.220.190
  182.253.223.75
  182.253.224.100
  182.253.232.101
  182.253.232.12
  182.253.232.131
  182.253.232.18
+182.253.232.33
  182.253.232.76
  182.253.233.12
  182.253.233.126
@@ -40053,7 +39575,6 @@
  182.253.62.194
  182.253.63.225
  182.253.66.206
-182.253.68.18
  182.253.78.34
  182.253.80.134
  182.253.92.177
@@ -40067,13 +39588,16 @@
  182.254.140.176
  182.254.146.173
  182.254.149.130
+182.254.149.33
  182.254.149.99
  182.254.151.2
  182.254.153.138
  182.254.153.41
+182.254.154.181
  182.254.155.254
  182.254.155.85
  182.254.158.205
+182.254.161.202
  182.254.164.34
  182.254.165.138
  182.254.166.97
@@ -40102,6 +39626,7 @@
  182.254.225.214
  182.254.225.85
  182.254.226.225
+182.254.227.79
  182.254.228.49
  182.254.229.35
  182.254.240.149
@@ -40116,7 +39641,7 @@
  182.30.113.249
  182.30.116.192
  182.42.47.133
-182.43.218.252
+182.43.234.34
  182.46.158.85
  182.48.211.228
  182.48.70.145
@@ -40128,13 +39653,20 @@
  182.48.88.205
  182.50.130.1
  182.50.130.115
+182.50.130.133
  182.50.130.134
+182.50.130.146
  182.50.130.147
+182.50.130.150
+182.50.130.152
  182.50.130.173
  182.50.130.192
  182.50.130.223
  182.50.130.226
+182.50.130.57
  182.50.130.7
+182.50.130.8
+182.50.130.86
  182.50.132.101
  182.50.132.113
  182.50.132.79
@@ -40142,6 +39674,7 @@
  182.50.135.52
  182.50.135.54
  182.50.135.59
+182.50.135.72
  182.50.135.73
  182.50.141.145
  182.50.151.12
@@ -40154,11 +39687,11 @@
  182.52.108.104
  182.52.110.216
  182.52.110.225
-182.52.110.97
+182.52.110.35
  182.52.111.104
  182.52.111.174
+182.52.111.192
  182.52.111.208
-182.52.111.240
  182.52.111.53
  182.52.111.8
  182.52.131.108
@@ -40170,6 +39703,7 @@
  182.52.19.173
  182.52.19.180
  182.52.19.182
+182.52.216.19
  182.52.22.58
  182.52.229.57
  182.52.238.111
@@ -40183,7 +39717,6 @@
  182.52.32.20
  182.52.32.235
  182.52.32.251
-182.52.4.18
  182.52.40.170
  182.52.51.10
  182.52.51.101
@@ -40219,11 +39752,8 @@
  182.53.206.26
  182.53.206.40
  182.53.206.44
-182.53.21.191
  182.53.241.68
  182.53.5.68
-182.53.55.221
-182.53.55.44
  182.53.63.58
  182.53.90.6
  182.53.92.140
@@ -40238,18 +39768,18 @@
  182.54.172.11
  182.54.207.74
  182.55.245.25
-182.56.202.34
  182.56.212.160
-182.57.66.60
+182.57.112.177
  182.58.49.77
+182.59.183.160
  182.59.2.193
-182.59.222.42
  182.59.3.33
  182.61.10.28
  182.61.12.9
  182.61.13.54
  182.61.130.51
  182.61.132.205
+182.61.132.240
  182.61.133.15
  182.61.136.149
  182.61.136.17
@@ -40291,7 +39821,6 @@
  182.61.36.44
  182.61.37.144
  182.61.38.212
-182.61.39.203
  182.61.40.124
  182.61.40.161
  182.61.40.198
@@ -40304,49 +39833,47 @@
  182.61.44.194
  182.61.49.107
  182.61.50.174
+182.61.50.49
  182.61.52.98
-182.61.61.58
  182.64.105.143
  182.64.115.245
-182.64.131.210
  182.64.212.140
  182.64.4.50
+182.65.212.128
+182.68.177.31
  182.68.251.215
-182.69.88.235
-182.71.116.54
-182.71.121.58
+182.70.151.147
  182.71.138.178
-182.71.188.10
  182.71.197.195
  182.71.223.194
-182.71.26.235
  182.71.46.37
  182.71.6.158
  182.71.85.94
  182.71.90.202
  182.72.141.202
  182.72.142.62
-182.72.147.170
  182.72.161.90
  182.72.162.16
  182.72.171.242
+182.72.180.14
  182.72.235.174
  182.72.30.66
-182.72.39.130
  182.72.94.146
  182.73.141.2
  182.73.143.146
  182.73.147.154
  182.73.39.13
-182.73.65.182
  182.73.7.59
  182.73.95.218
+182.74.112.150
  182.74.145.118
+182.74.18.26
  182.74.215.50
  182.74.31.182
  182.74.37.226
-182.74.51.206
+182.74.88.162
  182.74.92.178
+182.75.112.254
  182.75.115.59
  182.75.125.50
  182.75.128.246
@@ -40358,6 +39885,7 @@
  182.75.220.186
  182.75.249.98
  182.75.35.100
+182.75.63.54
  182.75.82.158
  182.75.90.137
  182.76.128.36
@@ -40365,26 +39893,26 @@
  182.76.169.195
  182.76.204.237
  182.76.23.134
+182.76.231.178
  182.76.237.118
  182.76.28.148
  182.76.40.26
-182.77.114.89
-182.78.141.50
  182.78.194.78
  182.84.124.208
+182.84.124.226
  182.84.162.89
  182.87.130.182
+182.92.107.145
  182.92.113.148
-182.92.160.8
-182.92.225.82
-182.92.238.80
+182.92.121.8
+182.92.216.63
  182.92.242.11
+182.92.56.10
  182.92.79.23
  182.92.81.194
  182.92.84.176
  182.93.222.39
  182.93.77.46
-182.93.79.111
  182.93.80.11
  182.93.80.28
  182.93.80.3
@@ -40393,7 +39921,6 @@
  182.93.84.136
  182.93.94.80
  182.93.95.146
-182.99.206.129
  182.99.206.175
  1821456.dg398993.web.hosting-test.net
  182elexusbet.com
@@ -40404,11 +39931,11 @@
  183.102.114.251
  183.102.227.174
  183.102.238.69
+183.103.228.11
  183.103.86.116
  183.103.9.171
  183.104.248.85
  183.105.189.193
-183.106.158.235
  183.106.163.80
  183.107.64.187
  183.109.124.137
@@ -40436,11 +39963,12 @@
  183.132.21.109
  183.134.209.42
  183.134.209.44
+183.134.6.42
  183.134.65.197
  183.134.66.124
  183.134.73.32
  183.134.76.75
-183.136.194.146
+183.134.78.191
  183.136.221.35
  183.136.221.37
  183.136.221.38
@@ -40453,34 +39981,31 @@
  183.136.225.56
  183.136.239.218
  183.14.133.111
-183.14.212.220
-183.14.31.131
-183.141.42.123
-183.141.43.9
+183.143.62.100
  183.146.213.157
  183.146.213.198
+183.150.134.194
  183.151.119.59
-183.151.96.3
  183.156.2.119
  183.158.55.229
  183.159.111.34
-183.16.211.113
  183.162.230.169
  183.162.79.39
  183.165.40.245
  183.165.60.142
+183.166.170.113
  183.166.177.124
-183.167.199.12
  183.167.205.82
  183.167.229.180
+183.167.230.105
+183.17.126.229
+183.17.126.70
  183.17.144.89
+183.17.227.113
  183.17.51.228
-183.17.62.33
  183.171.185.95
  183.171.19.240
  183.171.22.79
-183.171.71.17
-183.171.97.14
  183.178.60.201
  183.18.52.27
  183.181.164.180
@@ -40488,40 +40013,36 @@
  183.181.174.169
  183.181.88.119
  183.182.101.32
-183.182.116.103
+183.184.11.81
  183.186.84.54
-183.187.195.161
-183.188.100.58
  183.188.103.56
-183.188.133.244
  183.188.134.235
-183.188.175.11
  183.188.198.118
  183.188.204.2
  183.188.207.37
-183.188.54.100
+183.188.45.189
  183.188.55.170
-183.188.6.192
-183.188.97.70
  183.190.148.241
+183.192.85.55
  183.194.212.16
  183.196.132.209
  183.196.233.193
  183.197.56.100
  183.197.56.101
-183.197.56.102
  183.197.56.103
  183.197.56.106
  183.197.56.107
  183.197.56.11
  183.197.56.111
  183.197.56.112
+183.197.56.116
  183.197.56.117
  183.197.56.119
  183.197.56.126
  183.197.56.134
  183.197.56.140
  183.197.56.153
+183.197.56.160
  183.197.56.163
  183.197.56.164
  183.197.56.167
@@ -40534,9 +40055,10 @@
  183.197.56.198
  183.197.56.201
  183.197.56.203
+183.197.56.209
  183.197.56.212
-183.197.56.221
  183.197.56.223
+183.197.56.224
  183.197.56.230
  183.197.56.231
  183.197.56.234
@@ -40578,7 +40100,6 @@
  183.199.125.15
  183.199.125.151
  183.199.125.153
-183.199.125.155
  183.199.125.157
  183.199.125.16
  183.199.125.162
@@ -40629,22 +40150,24 @@
  183.199.125.84
  183.199.125.86
  183.199.125.90
+183.2.96.227
  183.203.157.188
  183.207.176.78
  183.215.136.245
-183.22.24.103
  183.220.1.118
  183.220.144.87
-183.221.100.79
  183.221.125.206
  183.224.38.56
  183.225.111.56
  183.226.57.105
  183.230.37.179
+183.230.37.94
  183.230.91.108
  183.232.250.154
+183.233.166.172
  183.233.169.210
  183.233.183.70
+183.233.183.71
  183.234.58.41
  183.234.64.3
  183.236.25.188
@@ -40658,16 +40181,17 @@
  183.242.4.146
  183.246.176.179
  183.251.87.5
+183.31.101.47
  183.4.28.24
  183.4.30.105
  183.4.30.251
  183.47.14.74
  183.48.25.19
+183.49.45.28
  183.56.167.10
  183.6.107.248
  183.6.107.44
  183.6.107.68
-183.6.152.11
  183.6.159.35
  183.6.177.234
  183.60.110.85
@@ -40707,21 +40231,24 @@
  183.81.185.205
  183.82.0.15
  183.82.0.21
-183.82.102.66
+183.82.104.71
  183.82.115.221
  183.82.121.34
  183.82.144.225
  183.82.157.180
  183.82.32.153
-183.82.34.162
  183.82.34.94
  183.82.42.67
  183.82.42.98
  183.82.97.25
+183.83.1.221
+183.83.113.188
+183.83.118.95
  183.83.122.188
+183.83.126.99
  183.83.146.159
-183.83.153.77
-183.83.211.9
+183.83.15.212
+183.83.21.120
  183.83.217.190
  183.83.89.226
  183.86.194.68
@@ -40731,7 +40258,6 @@
  183.87.110.22
  183.87.114.130
  183.87.14.125
-183.87.14.202
  183.87.14.250
  183.87.153.182
  183.87.153.98
@@ -40743,40 +40269,41 @@
  183.87.69.233
  183.87.70.210
  183.87.76.17
-183.88.10.106
-183.88.108.27
  183.88.109.250
  183.88.130.151
+183.88.131.34
  183.88.133.164
-183.88.135.159
  183.88.14.22
+183.88.168.204
  183.88.17.76
+183.88.19.12
  183.88.19.47
-183.88.20.233
  183.88.212.141
  183.88.212.247
  183.88.214.143
  183.88.214.88
  183.88.219.206
-183.88.22.21
  183.88.223.208
  183.88.224.150
+183.88.224.206
  183.88.237.226
  183.88.240.200
  183.88.240.53
+183.88.251.154
  183.88.253.14
+183.88.253.18
+183.88.33.178
  183.88.65.117
  183.88.68.177
  183.88.7.39
  183.88.74.115
-183.88.85.53
-183.88.94.31
  183.89.112.114
  183.89.113.31
-183.89.116.224
+183.89.117.204
  183.89.118.125
  183.89.118.166
  183.89.118.206
+183.89.119.135
  183.89.119.42
  183.89.12.71
  183.89.122.88
@@ -40786,16 +40313,19 @@
  183.89.161.138
  183.89.162.199
  183.89.162.84
+183.89.166.217
+183.89.167.3
  183.89.167.94
  183.89.176.12
  183.89.178.234
  183.89.181.192
-183.89.188.122
  183.89.188.32
  183.89.190.61
  183.89.196.190
  183.89.196.207
+183.89.196.45
  183.89.196.57
+183.89.199.59
  183.89.237.171
  183.89.25.38
  183.89.42.58
@@ -40804,6 +40334,7 @@
  183.89.6.52
  183.89.71.220
  183.89.72.163
+183.89.75.206
  183.89.8.238
  183.89.98.148
  183.89.99.130
@@ -40816,18 +40347,15 @@
  183.91.68.148
  183.91.78.211
  183.91.82.88
-183.92.205.130
  183.92.214.38
  183.93.10.57
  183.95.144.236
-183.95.147.27
  183.95.246.160
+183.96.155.93
  183.96.65.145
  183.96.89.113
  183.98.48.163
  183.99.179.218
-183.99.212.215
-183.99.59.168
  1830488.synergyglobal.one
  1834.31cf4fdae.com
  183da2ac-98c9-41cf-9f59-0c377e76b19b.htmlcomponentservice.com
@@ -40867,6 +40395,7 @@
  184.100.197.178
  184.100.2.223
  184.100.20.173
+184.100.205.90
  184.100.219.130
  184.100.220.65
  184.100.223.69
@@ -40879,6 +40408,7 @@
  184.100.41.114
  184.100.41.251
  184.100.43.191
+184.100.46.153
  184.100.49.82
  184.100.50.10
  184.100.52.110
@@ -40947,7 +40477,6 @@
  184.102.129.231
  184.102.131.1
  184.102.132.34
-184.102.133.16
  184.102.133.48
  184.102.134.121
  184.102.134.195
@@ -41106,7 +40635,9 @@
  184.144.204.194
  184.145.167.92
  184.147.0.8
+184.147.112.163
  184.148.38.190
+184.148.7.93
  184.149.56.146
  184.153.135.2
  184.153.247.218
@@ -41114,6 +40645,7 @@
  184.154.150.120
  184.154.207.42
  184.155.36.194
+184.155.60.198
  184.156.144.30
  184.156.144.5
  184.156.181.18
@@ -41158,7 +40690,6 @@
  184.158.250.196
  184.158.32.131
  184.158.32.23
-184.158.32.97
  184.158.33.114
  184.158.33.162
  184.158.34.241
@@ -41179,11 +40710,9 @@
  184.158.44.108
  184.158.44.42
  184.158.47.190
-184.158.47.196
  184.158.47.70
  184.158.48.6
  184.158.49.237
-184.158.50.24
  184.158.51.45
  184.158.52.194
  184.158.52.206
@@ -41212,43 +40741,69 @@
  184.163.72.52
  184.164.89.183
  184.168.146.10
+184.168.152.104
+184.168.152.111
+184.168.152.125
  184.168.152.128
  184.168.152.14
  184.168.152.142
+184.168.152.16
  184.168.152.162
+184.168.152.166
  184.168.152.182
+184.168.152.183
  184.168.152.186
  184.168.152.20
  184.168.152.201
+184.168.152.211
+184.168.152.6
  184.168.152.64
+184.168.152.66
  184.168.152.7
  184.168.152.75
+184.168.152.78
  184.168.152.95
  184.168.193.10
  184.168.193.101
+184.168.193.119
+184.168.193.127
+184.168.193.139
+184.168.193.147
  184.168.193.155
  184.168.193.156
  184.168.193.163
  184.168.193.168
  184.168.193.172
+184.168.193.187
+184.168.193.195
  184.168.193.199
+184.168.193.201
  184.168.193.204
  184.168.193.205
+184.168.193.38
  184.168.193.59
  184.168.193.60
+184.168.193.67
  184.168.193.72
+184.168.193.97
  184.168.193.98
  184.168.200.173
  184.168.200.205
-184.168.27.108
  184.168.27.112
  184.168.27.144
  184.168.27.161
  184.168.27.169
+184.168.27.194
  184.168.27.26
+184.168.27.59
+184.168.27.90
  184.168.46.100
+184.168.46.103
  184.168.46.111
+184.168.46.121
  184.168.46.129
+184.168.46.152
+184.168.46.186
  184.168.46.187
  184.168.46.200
  184.168.46.207
@@ -41256,9 +40811,9 @@
  184.168.46.220
  184.168.46.82
  184.168.46.84
-184.169.212.158
  184.170.145.60
  184.170.212.94
+184.170.223.148
  184.170.242.191
  184.171.208.109
  184.171.250.187
@@ -41267,21 +40822,19 @@
  184.172.196.106
  184.173.190.42
  184.173.222.71
+184.174.70.105
  184.175.42.20
  184.176.69.170
  184.178.125.242
-184.178.172.11
+184.178.172.10
  184.178.172.13
  184.178.172.18
  184.178.172.24
  184.178.172.25
  184.178.172.28
  184.178.172.5
-184.179.216.134
+184.178.172.8
  184.179.216.135
-184.179.216.138
-184.179.216.139
-184.179.216.141
  184.179.216.143
  184.179.216.144
  184.179.216.146
@@ -41290,10 +40843,12 @@
  184.179.216.151
  184.180.129.98
  184.180.181.202
+184.180.28.60
  184.183.14.151
+184.183.3.211
  184.185.2.149
+184.186.211.111
  184.187.22.44
-184.188.101.157
  184.190.136.197
  184.2.208.183
  184.2.56.146
@@ -41306,8 +40861,8 @@
  184.2.84.235
  184.2.87.207
  184.2.87.63
+184.22.120.197
  184.22.2.103
-184.22.212.252
  184.22.234.114
  184.22.4.224
  184.3.103.69
@@ -41391,7 +40946,6 @@
  184.56.104.242
  184.57.184.168
  184.57.66.197
-184.58.151.71
  184.59.224.76
  184.6.10.2
  184.6.12.87
@@ -41430,7 +40984,6 @@
  184.7.244.208
  184.7.55.99
  184.70.244.67
-184.70.33.190
  184.71.9.2
  184.72.116.54
  184.72.147.110
@@ -41452,14 +41005,10 @@
  184.75.209.107
  184.75.209.42
  184.75.209.46
-184.75.210.122
  184.75.210.126
  184.75.210.181
  184.75.210.52
  184.75.211.131
-184.75.211.134
-184.75.211.142
-184.75.211.146
  184.75.211.147
  184.75.211.150
  184.75.211.155
@@ -41467,7 +41016,6 @@
  184.75.214.196
  184.75.214.197
  184.75.221.203
-184.75.223.203
  184.75.223.28
  184.82.107.64
  184.82.128.211
@@ -41477,20 +41025,21 @@
  184.82.146.6
  184.82.148.98
  184.82.195.90
-184.82.239.95
  184.82.29.169
+184.82.45.219
  184.82.70.173
  184.82.92.72
+184.83.176.199
  184.88.136.19
-184.90.175.92
+184.88.28.190
  184.95.32.130
  184.95.32.132
  184.95.32.134
-184.95.38.138
  184.95.48.13
  184.96.128.47
  184.96.157.28
  184.96.176.25
+184.96.179.161
  184.96.189.35
  184.96.215.233
  184.96.216.253
@@ -41605,7 +41154,7 @@
  185.10.68.40
  185.10.68.66
  185.10.73.233
-185.100.13.156
+185.100.65.60
  185.100.84.149
  185.100.85.101
  185.100.85.61
@@ -41613,7 +41162,6 @@
  185.100.86.154
  185.100.86.167
  185.100.86.182
-185.100.87.203
  185.100.87.206
  185.100.87.207
  185.100.87.240
@@ -41636,12 +41184,15 @@
  185.103.181.2
  185.103.246.197
  185.103.252.12
+185.103.252.24
  185.103.37.61
  185.104.112.199
  185.104.120.134
  185.104.120.135
  185.104.120.60
+185.104.141.4
  185.104.180.7
+185.104.184.110
  185.104.184.114
  185.104.184.116
  185.104.184.117
@@ -41674,11 +41225,9 @@
  185.104.217.90
  185.104.218.107
  185.104.219.69
-185.104.242.143
-185.104.242.197
+185.104.253.51
  185.104.29.4
  185.105.197.78
-185.105.39.249
  185.106.120.109
  185.106.120.179
  185.106.120.206
@@ -41711,7 +41260,7 @@
  185.107.94.110
  185.107.94.183
  185.107.94.233
-185.108.105.65
+185.107.94.249
  185.108.106.206
  185.108.107.42
  185.108.197.122
@@ -41740,19 +41289,20 @@
  185.112.249.123
  185.112.249.208
  185.112.250.128
+185.112.33.46
  185.113.128.30
  185.113.129.154
  185.113.6.254
-185.114.137.14
  185.114.157.61
+185.114.224.107
  185.114.23.40
-185.114.80.201
  185.116.214.194
  185.116.254.15
  185.116.254.18
  185.116.254.5
  185.116.254.8
  185.117.10.122
+185.117.117.171
  185.117.118.187
  185.117.118.34
  185.117.119.189
@@ -41771,6 +41321,7 @@
  185.118.48.206
  185.118.65.230
  185.118.66.114
+185.12.177.17
  185.12.179.222
  185.12.20.205
  185.12.45.114
@@ -41787,7 +41338,8 @@
  185.121.69.42
  185.122.104.171
  185.122.144.98
-185.122.170.127
+185.122.170.108
+185.122.170.129
  185.122.170.166
  185.122.170.80
  185.122.174.171
@@ -41795,13 +41347,13 @@
  185.122.174.176
  185.122.174.180
  185.122.174.182
-185.122.200.20
  185.122.44.218
  185.123.164.52
  185.123.164.54
  185.123.194.28
  185.124.183.102
-185.125.207.12
+185.124.186.19
+185.124.241.245
  185.125.231.156
  185.126.131.37
  185.126.178.243
@@ -41811,9 +41363,8 @@
  185.127.255.92
  185.128.126.18
  185.128.245.68
-185.128.25.236
  185.128.26.215
-185.128.37.4
+185.128.26.52
  185.128.38.100
  185.128.38.146
  185.128.41.50
@@ -41832,6 +41383,7 @@
  185.130.184.213
  185.130.184.220
  185.130.184.222
+185.130.184.225
  185.130.206.162
  185.130.215.18
  185.130.215.62
@@ -41849,6 +41401,8 @@
  185.130.6.49
  185.130.7.22
  185.131.60.17
+185.131.62.250
+185.131.63.130
  185.131.63.83
  185.132.133.160
  185.132.133.52
@@ -41884,6 +41438,7 @@
  185.132.53.239
  185.132.53.251
  185.132.53.27
+185.132.53.29
  185.132.53.31
  185.132.53.36
  185.132.53.5
@@ -41894,6 +41449,8 @@
  185.132.53.98
  185.133.225.26
  185.133.36.46
+185.134.114.11
+185.134.120.75
  185.134.213.130
  185.134.81.11
  185.134.81.16
@@ -41905,7 +41462,7 @@
  185.135.157.120
  185.135.157.138
  185.135.157.44
-185.135.224.140
+185.135.224.226
  185.135.72.124
  185.136.150.201
  185.136.150.252
@@ -41916,11 +41473,9 @@
  185.136.204.3
  185.136.204.42
  185.136.205.136
-185.136.205.146
-185.136.219.79
+185.136.219.73
  185.136.242.193
  185.136.85.228
-185.136.95.193
  185.137.13.136
  185.137.175.25
  185.137.234.101
@@ -41952,12 +41507,9 @@
  185.14.248.98
  185.14.251.4
  185.14.28.54
-185.14.29.150
  185.14.29.188
  185.14.29.202
  185.14.29.22
-185.14.30.131
-185.14.30.30
  185.14.31.11
  185.14.31.113
  185.140.242.82
@@ -41972,7 +41524,6 @@
  185.141.10.67
  185.141.105.60
  185.141.11.202
-185.141.206.203
  185.141.207.235
  185.141.24.195
  185.141.24.198
@@ -41989,18 +41540,20 @@
  185.142.236.209
  185.142.236.34
  185.142.236.35
-185.142.239.205
+185.142.239.16
  185.142.239.42
  185.142.239.49
  185.142.43.132
  185.142.67.23
  185.143.145.113
+185.143.145.3
  185.143.223.136
  185.143.228.214
  185.143.230.175
-185.143.230.179
+185.143.230.208
  185.143.231.197
  185.143.231.207
+185.144.78.75
  185.144.82.236
  185.144.83.112
  185.145.128.21
@@ -42010,21 +41563,19 @@
  185.145.156.211
  185.145.156.76
  185.145.253.67
-185.145.36.220
  185.145.37.239
+185.145.38.225
  185.146.113.157
  185.146.159.217
-185.147.130.39
  185.147.213.104
  185.147.213.145
+185.147.213.20
  185.147.213.67
-185.147.213.97
+185.147.213.85
  185.147.214.100
-185.147.214.111
  185.147.214.117
  185.147.214.130
  185.147.214.177
-185.147.214.19
  185.147.214.43
  185.147.214.70
  185.147.214.94
@@ -42035,6 +41586,7 @@
  185.148.216.9
  185.148.3.227
  185.148.44.65
+185.148.84.48
  185.15.92.18
  185.150.162.111
  185.150.8.157
@@ -42042,7 +41594,6 @@
  185.151.204.9
  185.151.242.196
  185.151.243.250
-185.151.247.94
  185.151.51.123
  185.152.12.49
  185.152.12.68
@@ -42057,9 +41608,11 @@
  185.153.198.177
  185.153.198.223
  185.153.198.234
+185.153.35.219
  185.154.131.4
  185.154.15.87
  185.154.159.164
+185.154.16.92
  185.154.2.3
  185.154.52.140
  185.154.52.207
@@ -42072,7 +41625,10 @@
  185.156.179.233
  185.156.214.34
  185.156.35.156
+185.156.72.27
+185.156.73.57
  185.156.74.65
+185.157.246.39
  185.157.79.3
  185.158.105.151
  185.158.114.14
@@ -42092,15 +41648,15 @@
  185.159.81.162
  185.16.204.58
  185.16.32.203
+185.16.38.10
  185.16.38.105
  185.16.38.107
  185.16.38.109
  185.16.38.123
  185.16.38.42
-185.16.38.47
  185.16.38.48
  185.16.38.52
-185.16.38.57
+185.16.38.56
  185.16.38.59
  185.16.38.60
  185.16.38.61
@@ -42123,6 +41679,7 @@
  185.161.71.145
  185.161.71.190
  185.161.71.196
+185.161.71.245
  185.161.71.25
  185.161.71.44
  185.162.0.74
@@ -42131,7 +41688,6 @@
  185.162.142.81
  185.162.235.150
  185.162.235.64
-185.162.235.66
  185.162.65.109
  185.162.8.125
  185.162.9.191
@@ -42139,6 +41695,7 @@
  185.163.126.12
  185.163.44.36
  185.163.45.42
+185.164.30.78
  185.164.56.180
  185.164.56.218
  185.164.56.239
@@ -42151,8 +41708,8 @@
  185.164.59.192
  185.164.59.216
  185.164.59.217
-185.164.59.36
  185.164.59.74
+185.164.59.85
  185.164.72.222
  185.164.72.248
  185.165.111.163
@@ -42172,15 +41729,12 @@
  185.165.29.72
  185.165.29.84
  185.165.31.12
+185.165.36.221
  185.165.88.222
  185.166.239.49
  185.166.25.134
-185.166.86.106
-185.166.86.93
-185.166.86.95
-185.166.86.99
+185.166.84.128
  185.166.87.198
-185.167.113.59
  185.167.116.211
  185.167.116.61
  185.167.163.103
@@ -42202,7 +41756,6 @@
  185.17.133.107
  185.17.134.149
  185.17.143.220
-185.17.165.148
  185.17.18.133
  185.17.183.22
  185.17.38.1
@@ -42210,7 +41763,6 @@
  185.170.114.25
  185.170.210.47
  185.170.42.18
-185.170.56.72
  185.171.120.81
  185.171.52.101
  185.171.54.26
@@ -42281,14 +41833,11 @@
  185.172.111.226
  185.172.111.235
  185.173.104.47
-185.173.227.95
  185.173.245.127
  185.173.92.119
  185.174.100.242
  185.174.100.60
  185.174.102.15
-185.174.159.16
-185.174.159.18
  185.174.195.128
  185.174.195.129
  185.174.195.130
@@ -42306,6 +41855,7 @@
  185.174.195.142
  185.174.195.143
  185.174.195.239
+185.174.210.138
  185.174.210.198
  185.174.43.2
  185.174.43.3
@@ -42333,11 +41883,12 @@
  185.177.54.9
  185.177.59.184
  185.178.220.126
+185.178.95.241
  185.179.132.117
+185.179.24.39
  185.18.245.66
  185.18.6.65
-185.18.60.39
-185.18.69.201
+185.18.66.84
  185.180.196.143
  185.180.220.33
  185.180.221.201
@@ -42345,14 +41896,9 @@
  185.180.92.248
  185.181.10.234
  185.181.176.246
-185.181.230.74
-185.181.246.154
-185.181.246.180
  185.181.61.140
  185.181.9.76
  185.182.56.123
-185.182.82.133
-185.183.106.3
  185.183.12.25
  185.183.16.47
  185.183.195.23
@@ -42365,7 +41911,6 @@
  185.183.98.244
  185.183.99.214
  185.183.99.215
-185.184.0.175
  185.184.12.132
  185.184.221.66
  185.185.170.27
@@ -42375,6 +41920,7 @@
  185.186.143.123
  185.186.143.55
  185.186.143.62
+185.186.17.132
  185.186.208.162
  185.186.246.141
  185.186.69.114
@@ -42395,7 +41941,6 @@
  185.189.112.228
  185.189.114.123
  185.189.114.167
-185.189.114.173
  185.189.114.98
  185.189.12.75
  185.189.149.235
@@ -42431,8 +41976,8 @@
  185.191.124.152
  185.191.124.153
  185.191.204.3
+185.191.205.141
  185.191.215.99
-185.192.111.51
  185.192.112.56
  185.192.137.82
  185.193.125.168
@@ -42455,10 +42000,12 @@
  185.198.184.14
  185.198.188.48
  185.198.189.21
+185.198.244.195
  185.198.57.238
  185.198.58.146
  185.198.58.199
  185.198.58.47
+185.199.119.226
  185.199.197.148
  185.2.140.155
  185.2.150.186
@@ -42484,12 +42031,12 @@
  185.20.44.244
  185.20.90.50
  185.200.116.185
-185.200.117.169
-185.200.117.172
+185.200.176.137
  185.200.240.237
  185.200.36.91
  185.201.114.220
  185.201.47.155
+185.201.51.226
  185.201.89.122
  185.201.9.197
  185.202.1.194
@@ -42512,10 +42059,8 @@
  185.205.209.205
  185.205.209.241
  185.205.210.245
-185.205.250.253
  185.205.251.212.zt.hu
  185.205.251.234
-185.205.82.90
  185.206.118.62
  185.206.145.66
  185.206.146.141
@@ -42523,23 +42068,25 @@
  185.206.172.213
  185.206.172.214
  185.206.212.12
-185.206.212.218
  185.206.214.130
  185.206.214.71
  185.206.224.199
  185.206.224.213
  185.206.224.221
-185.206.225.244
  185.206.225.51
  185.206.91.42
  185.206.93.87
+185.207.177.116
  185.207.177.148
  185.207.177.16
  185.207.177.189
+185.207.177.231
  185.207.177.239
  185.207.177.253
-185.207.177.26
  185.207.177.39
+185.207.177.52
+185.207.177.61
+185.207.177.74
  185.207.205.129
  185.207.205.130
  185.207.205.134
@@ -42560,11 +42107,11 @@
  185.21.41.49
  185.21.6.38
  185.21.67.212
+185.210.217.243
  185.210.217.247
  185.210.217.249
  185.210.217.8
  185.210.224.102
-185.211.244.132
  185.211.246.135
  185.211.48.17
  185.211.59.50
@@ -42585,33 +42132,27 @@
  185.213.191.200
  185.213.191.201
  185.213.191.202
-185.213.191.203
  185.213.191.204
  185.213.191.205
-185.213.191.206
  185.213.191.208
  185.213.191.209
  185.213.191.224
-185.213.191.226
  185.213.191.227
-185.213.191.229
-185.213.191.230
  185.213.191.232
  185.213.191.44
  185.213.191.57
-185.213.191.60
+185.213.20.243
  185.214.165.113
  185.214.187.38
  185.215.113.207
  185.215.113.47
+185.215.113.71
  185.215.113.77
  185.215.150.209
  185.215.227.107
-185.215.227.56
  185.215.227.77
  185.216.119.235
  185.216.140.41
-185.216.177.182
  185.216.178.231
  185.216.179.32
  185.216.179.80
@@ -42620,11 +42161,13 @@
  185.216.32.130
  185.216.33.137
  185.216.34.233
+185.216.8.34
  185.217.0.11
  185.217.1.246
  185.217.1.30
  185.217.117.220
-185.217.162.188
+185.217.162.202
+185.217.170.146
  185.217.241.142
  185.217.68.142
  185.217.90.140
@@ -42636,9 +42179,7 @@
  185.219.168.51
  185.219.6.251
  185.219.81.127
-185.22.152.17
  185.22.152.225
-185.22.153.216
  185.22.172.177
  185.22.172.99
  185.22.174.119
@@ -42778,6 +42319,8 @@
  185.220.50.249
  185.220.50.253
  185.220.70.168
+185.220.70.196
+185.221.140.71
  185.221.201.34
  185.222.202.104
  185.222.202.12
@@ -42793,7 +42336,6 @@
  185.223.29.137
  185.224.128.41
  185.224.129.142
-185.224.138.48
  185.224.171.130
  185.224.80.108
  185.225.137.206
@@ -42822,11 +42364,11 @@
  185.228.140.104
  185.228.235.25
  185.229.251.47
-185.23.128.180
+185.229.251.49
  185.23.151.171
  185.230.125.36
  185.230.125.40
-185.230.4.220
+185.230.126.23
  185.230.81.96
  185.231.155.153
  185.232.182.218
@@ -42847,6 +42389,7 @@
  185.233.148.87
  185.233.186.129
  185.233.186.131
+185.233.186.23
  185.234.216.198
  185.234.216.56
  185.234.217.102
@@ -42887,10 +42430,7 @@
  185.234.218.86
  185.234.219.140
  185.234.72.64
-185.235.165.146
-185.235.165.147
-185.235.165.165
-185.235.165.176
+185.235.165.166
  185.235.165.18
  185.235.165.184
  185.235.165.186
@@ -42902,6 +42442,10 @@
  185.235.165.83
  185.235.165.93
  185.236.202.151
+185.236.202.168
+185.236.202.170
+185.236.202.205
+185.236.203.156
  185.236.203.208
  185.236.203.49
  185.236.232.118
@@ -42913,7 +42457,6 @@
  185.236.39.150
  185.236.39.153
  185.236.39.157
-185.236.39.180
  185.236.39.195
  185.236.42.119
  185.236.77.144
@@ -42936,10 +42479,9 @@
  185.239.242.109
  185.239.242.117
  185.239.242.136
-185.239.242.138
+185.239.242.149
  185.239.242.157
  185.239.242.158
-185.239.242.162
  185.239.242.171
  185.239.242.174
  185.239.242.195
@@ -42950,7 +42492,7 @@
  185.239.242.249
  185.239.242.251
  185.239.242.29
-185.239.242.40
+185.239.242.63
  185.239.242.76
  185.239.242.79
  185.239.242.86
@@ -42963,11 +42505,11 @@
  185.24.234.230
  185.24.235.206
  185.24.92.236
-185.240.224.117
  185.241.100.1
  185.241.101.5
  185.241.102.1
  185.241.103.1
+185.241.52.148
  185.242.104.197
  185.242.104.78
  185.242.104.98
@@ -42988,13 +42530,12 @@
  185.243.113.221
  185.243.113.24
  185.243.115.28
-185.243.174.72
  185.243.215.254
  185.243.241.142
  185.243.241.182
  185.243.241.196
-185.243.241.220
  185.243.241.234
+185.243.53.139
  185.243.57.211
  185.244.100.106
  185.244.150.165
@@ -43016,6 +42557,7 @@
  185.244.217.126
  185.244.217.172
  185.244.217.3
+185.244.217.76
  185.244.217.80
  185.244.25.107
  185.244.25.133
@@ -43050,10 +42592,11 @@
  185.245.2.168
  185.245.84.153
  185.245.84.180
+185.245.84.56
  185.245.85.11
  185.245.85.146
  185.245.85.23
-185.245.85.26
+185.245.85.25
  185.245.85.38
  185.245.85.43
  185.245.85.44
@@ -43073,10 +42616,10 @@
  185.248.160.218
  185.248.160.243
  185.248.160.65
+185.248.78.91
  185.249.198.100
  185.249.198.73
  185.249.199.106
-185.249.89.146
  185.25.148.240
  185.25.151.159
  185.25.224.202
@@ -43100,7 +42643,6 @@
  185.251.161.54
  185.251.39.230
  185.251.45.64
-185.251.91.218
  185.252.41.232
  185.252.77.220
  185.253.160.132
@@ -43120,12 +42662,12 @@
  185.255.46.100
  185.255.46.171
  185.255.47.115
+185.255.47.206
  185.255.47.27
  185.255.47.50
  185.255.9.34
  185.255.96.99
  185.26.113.95
-185.26.181.241
  185.26.219.34
  185.26.28.170
  185.26.28.173
@@ -43141,7 +42683,6 @@
  185.29.11.241
  185.29.11.253
  185.29.11.32
-185.29.254.250
  185.29.255.26
  185.29.8.30
  185.29.9.154
@@ -43157,7 +42698,6 @@
  185.30.177.236
  185.30.32.183
  185.30.46.136
-185.30.46.83
  185.30.88.238
  185.30.96.198
  185.31.166.155
@@ -43185,12 +42725,9 @@
  185.34.52.203
  185.34.88.37
  185.34.88.5
-185.35.101.17
-185.35.12.243
  185.35.137.219
  185.35.142.70
  185.35.202.222
-185.35.217.51
  185.35.222.181
  185.35.67.109
  185.35.78.77
@@ -43201,12 +42738,12 @@
  185.36.63.212
  185.36.81.174
  185.36.81.39
+185.36.81.47
  185.36.81.62
  185.37.161.129
  185.37.211.222
  185.37.213.76
  185.37.89.7
-185.38.111.1
  185.38.14.171
  185.38.14.215
  185.38.175.71
@@ -43263,6 +42800,7 @@
  185.45.193.33
  185.45.72.176
  185.46.11.239
+185.46.122.205
  185.46.170.253
  185.46.18.99
  185.46.186.153
@@ -43274,6 +42812,7 @@
  185.47.108.92
  185.47.184.253
  185.47.65.30
+185.47.7.36
  185.48.56.34
  185.49.14.190
  185.49.15.23
@@ -43289,7 +42828,6 @@
  185.5.55.219
  185.5.55.45
  185.5.55.62
-185.50.197.66
  185.50.250.114
  185.50.250.175
  185.50.250.193
@@ -43308,7 +42846,6 @@
  185.52.55.237
  185.53.152.189
  185.53.168.96
-185.53.169.22
  185.53.173.64
  185.53.88.106
  185.53.88.182
@@ -43318,6 +42855,7 @@
  185.56.136.106
  185.56.153.236
  185.56.171.94
+185.56.209.114
  185.56.80.65
  185.56.81.8
  185.56.82.14
@@ -43331,6 +42869,7 @@
  185.60.135.103
  185.61.137.165
  185.61.148.69
+185.61.149.233
  185.61.149.24
  185.61.149.249
  185.61.149.35
@@ -43344,7 +42883,6 @@
  185.61.92.228
  185.61.94.65
  185.61.94.70
-185.62.103.21
  185.62.136.25
  185.62.136.26
  185.62.188.204
@@ -43356,7 +42894,6 @@
  185.62.190.156
  185.62.190.55
  185.62.194.253
-185.62.56.101
  185.63.188.200
  185.63.191.226
  185.63.252.55
@@ -43387,9 +42924,10 @@
  185.66.143.190
  185.66.180.33
  185.66.228.149
-185.66.233.61
  185.66.56.3
+185.66.57.100
  185.66.57.106
+185.66.57.109
  185.66.57.110
  185.66.57.112
  185.66.57.118
@@ -43397,10 +42935,10 @@
  185.66.57.124
  185.66.57.133
  185.66.57.142
+185.66.57.146
  185.66.57.148
  185.66.57.153
  185.66.57.154
-185.66.57.156
  185.66.57.159
  185.66.57.162
  185.66.57.164
@@ -43408,9 +42946,7 @@
  185.66.57.171
  185.66.57.173
  185.66.57.174
-185.66.57.177
  185.66.57.180
-185.66.57.184
  185.66.57.191
  185.66.57.194
  185.66.57.196
@@ -43436,12 +42972,13 @@
  185.66.58.170
  185.66.58.175
  185.66.58.177
+185.66.58.185
  185.66.58.192
-185.66.58.2
  185.66.59.192
  185.66.59.195
  185.66.59.2
  185.66.59.203
+185.66.59.215
  185.66.59.224
  185.66.59.227
  185.66.59.229
@@ -43449,12 +42986,12 @@
  185.66.59.234
  185.66.59.236
  185.66.59.240
+185.66.59.251
  185.66.59.254
  185.66.59.4
  185.67.101.35
  185.67.45.160
  185.67.82.114
-185.67.92.8
  185.67.95.179
  185.68.93.27
  185.69.54.231
@@ -43468,12 +43005,11 @@
  185.70.185.34
  185.70.185.56
  185.70.52.1
-185.70.55.30
+185.71.217.173
  185.73.235.114
  185.74.4.17
  185.74.4.189
  185.74.4.20
-185.74.5.253
  185.75.117.124
  185.75.181.219
  185.75.5.158
@@ -43492,10 +43028,10 @@
  185.78.86.34
  185.79.243.137
  185.79.243.153
-185.79.95.195
  185.8.104.152
  185.8.172.118
  185.8.172.123
+185.8.173.85
  185.8.202.254
  185.8.236.170
  185.8.239.148
@@ -43528,10 +43064,11 @@
  185.81.157.59
  185.81.157.66
  185.81.157.73
+185.81.158.121
  185.81.166.77
+185.81.51.131
  185.81.96.201
  185.82.127.125
-185.82.177.147
  185.82.202.109
  185.82.202.132
  185.82.202.17
@@ -43568,6 +43105,7 @@
  185.86.151.146
  185.86.151.152
  185.86.231.10
+185.86.4.132
  185.87.123.170
  185.87.123.34
  185.87.45.95
@@ -43576,7 +43114,6 @@
  185.87.70.237
  185.88.100.152
  185.88.101.53
-185.88.178.116
  185.88.179.172
  185.88.233.144
  185.88.36.101
@@ -43584,12 +43121,15 @@
  185.88.36.124
  185.88.36.40
  185.88.36.48
+185.88.36.70
+185.88.36.78
  185.88.36.83
  185.88.36.92
  185.88.36.99
  185.88.37.66
  185.89.0.22
  185.89.0.237
+185.89.100.224
  185.89.101.145
  185.89.101.59
  185.89.101.98
@@ -43611,7 +43151,6 @@
  185.94.191.18
  185.94.191.94
  185.94.192.214
-185.94.192.36
  185.94.192.85
  185.94.192.86
  185.94.192.87
@@ -43638,13 +43177,11 @@
  185.95.157.27
  185.95.157.63
  185.95.219.53
-185.96.162.101
  185.96.162.105
  185.96.162.126
  185.96.162.141
  185.96.162.172
  185.96.162.177
-185.96.162.2
  185.96.162.23
  185.96.162.27
  185.96.6.106
@@ -43653,7 +43190,6 @@
  185.97.12.130
  185.97.134.4
  185.98.1.60
-185.98.1.62
  185.98.26.21
  185.99.184.147
  1851kitchen.com
@@ -43689,37 +43225,37 @@
  186.103.215.118
  186.103.220.234
  186.103.234.75
+186.105.44.75
  186.107.76.68
  186.108.227.4
+186.108.245.25
  186.109.81.112
+186.113.17.42
  186.113.21.156
  186.113.46.198
-186.116.78.2
  186.117.164.208
  186.119.116.226
  186.119.122.11
  186.121.204.10
-186.121.206.234
  186.121.206.237
  186.121.206.241
-186.121.206.253
  186.122.148.216
  186.122.148.9
  186.122.149.191
+186.124.61.138
  186.125.171.245
  186.125.59.8
  186.126.0.137
  186.126.110.60
+186.126.115.69
  186.126.116.151
  186.126.12.68
  186.126.121.5
-186.126.122.120
  186.126.122.16
  186.126.13.121
  186.126.130.196
  186.126.132.242
  186.126.133.213
-186.126.14.80
  186.126.15.46
  186.126.151.218
  186.126.154.172
@@ -43731,23 +43267,18 @@
  186.126.168.59
  186.126.170.111
  186.126.171.150
-186.126.171.197
  186.126.177.198
  186.126.177.41
  186.126.19.111
  186.126.190.81
  186.126.192.187
-186.126.195.58
  186.126.197.155
  186.126.198.38
  186.126.199.151
  186.126.205.201
  186.126.206.72
-186.126.208.19
  186.126.21.221
-186.126.212.60
  186.126.214.130
-186.126.22.21
  186.126.223.58
  186.126.223.92
  186.126.224.129
@@ -43759,39 +43290,33 @@
  186.126.242.131
  186.126.25.194
  186.126.25.66
-186.126.27.122
-186.126.3.41
  186.126.32.230
-186.126.34.101
  186.126.34.114
  186.126.34.191
  186.126.37.69
  186.126.39.62
  186.126.4.83
-186.126.41.20
  186.126.42.169
  186.126.45.166
  186.126.47.190
+186.126.51.193
  186.126.53.182
+186.126.55.23
  186.126.55.30
  186.126.56.73
-186.126.58.78
  186.126.59.225
  186.126.6.92
  186.126.60.94
-186.126.63.74
  186.126.69.243
-186.126.7.110
  186.126.70.135
  186.126.71.197
  186.126.71.31
  186.126.71.51
-186.126.76.121
  186.126.81.94
  186.126.82.227
  186.126.82.46
+186.126.84.57
  186.126.86.98
-186.126.91.88
  186.126.92.240
  186.126.93.125
  186.126.94.90
@@ -43799,6 +43324,8 @@
  186.126.97.120
  186.126.97.149
  186.126.97.77
+186.130.110.157
+186.134.26.47
  186.136.45.239
  186.137.79.39
  186.137.85.76
@@ -43834,12 +43361,12 @@
  186.151.160.174
  186.151.197.189
  186.151.57.137
-186.153.222.137
  186.154.197.178
  186.154.241.229
  186.155.150.213
  186.155.226.43
  186.156.79.6
+186.157.136.175
  186.159.1.217
  186.159.1.58
  186.159.115.66
@@ -43856,43 +43383,41 @@
  186.167.33.244
  186.168.166.37
  186.170.28.46
+186.177.141.223
  186.177.165.196
  186.177.174.163
+186.178.60.177
  186.178.61.199
  186.179.100.105
-186.179.100.115
-186.179.100.118
+186.179.100.127
  186.179.100.134
+186.179.100.144
+186.179.100.161
  186.179.100.167
-186.179.100.176
  186.179.100.184
  186.179.100.20
-186.179.100.214
  186.179.100.217
+186.179.100.221
  186.179.100.228
-186.179.100.23
-186.179.100.237
  186.179.100.241
  186.179.100.255
  186.179.100.55
-186.179.100.83
+186.179.100.6
  186.179.100.88
+186.179.100.93
  186.179.18.145
  186.179.18.192
  186.179.18.238
+186.179.18.44
  186.179.18.63
  186.179.18.75
-186.179.192.194
-186.179.194.12
-186.179.194.2
  186.179.243.77
  186.179.40.84
  186.18.224.149
  186.183.199.203
  186.189.193.207
-186.19.156.154
-186.190.167.196
-186.190.226.141
+186.19.4.149
+186.190.224.116
  186.192.17.242
  186.192.236.58
  186.192.253.111
@@ -43916,7 +43441,6 @@
  186.193.8.124
  186.193.8.126
  186.195.108.66
-186.195.218.222
  186.195.90.16
  186.20.154.22
  186.20.208.239
@@ -43924,9 +43448,9 @@
  186.200.68.34
  186.201.31.186
  186.201.43.66
-186.204.247.29
  186.204.78.90
  186.204.83.32
+186.206.129.189
  186.206.157.14
  186.207.131.216
  186.207.189.33
@@ -43941,6 +43465,7 @@
  186.208.121.210
  186.208.122.226
  186.208.192.18
+186.208.216.186
  186.208.224.139
  186.208.244.121
  186.208.5.216
@@ -43972,13 +43497,16 @@
  186.213.24.136
  186.214.234.27
  186.215.100.50
+186.215.143.149
  186.215.197.15
  186.215.198.137
  186.215.199.65
  186.215.202.34
-186.216.138.218
-186.216.154.19
-186.216.176.97
+186.216.153.129
+186.216.154.28
+186.216.246.44
+186.216.64.52
+186.216.71.53
  186.216.81.21
  186.216.91.127
  186.219.210.86
@@ -43995,11 +43523,10 @@
  186.219.96.47
  186.22.245.39
  186.220.212.101
+186.223.165.219
  186.224.225.98
  186.224.238.32
  186.224.240.53
-186.224.27.227
-186.225.106.146
  186.225.124.90
  186.225.135.54
  186.225.146.173
@@ -44011,6 +43538,7 @@
  186.225.186.162
  186.225.186.254
  186.225.194.78
+186.225.234.56
  186.225.242.165
  186.225.250.26
  186.225.32.97
@@ -44018,27 +43546,28 @@
  186.225.52.105
  186.225.54.138
  186.225.63.134
-186.225.87.52
+186.225.82.152
  186.225.98.234
  186.226.145.228
-186.226.170.186
  186.226.171.94
  186.226.172.1
  186.226.172.165
  186.226.183.170
+186.226.191.47
  186.226.216.2
  186.226.37.125
  186.227.148.107
-186.227.46.68
  186.227.55.102
  186.227.55.78
  186.228.147.58
  186.23.19.160
  186.232.119.58
+186.232.141.21
  186.232.141.23
  186.232.15.9
  186.232.161.234
  186.232.200.51
+186.232.23.205
  186.232.48.98
  186.232.51.25
  186.232.57.18
@@ -44046,15 +43575,17 @@
  186.232.57.26
  186.233.175.26
  186.233.176.26
-186.233.96.246
  186.233.98.146
  186.233.98.173
  186.234.249.196
+186.234.80.228
  186.235.184.194
  186.235.184.9
  186.235.53.196
  186.235.54.10
-186.236.29.25
+186.236.10.194
+186.236.108.108
+186.236.8.62
  186.237.131.122
  186.237.161.142
  186.237.161.50
@@ -44069,7 +43600,6 @@
  186.237.223.42
  186.238.23.10
  186.238.31.10
-186.239.134.158
  186.239.178.94
  186.24.14.92
  186.24.218.195
@@ -44100,12 +43630,9 @@
  186.249.83.86
  186.250.115.52
  186.250.157.116
-186.250.157.146
  186.250.158.252
-186.250.200.77
-186.250.202.151
+186.250.194.26
  186.250.202.195
-186.250.203.2
  186.250.203.233
  186.250.244.138
  186.250.52.226
@@ -44132,6 +43659,7 @@
  186.251.255.121
  186.251.255.125
  186.251.255.129
+186.251.255.133
  186.251.255.137
  186.251.255.141
  186.251.255.149
@@ -44148,6 +43676,7 @@
  186.251.255.217
  186.251.255.221
  186.251.255.233
+186.251.255.237
  186.251.255.241
  186.251.255.245
  186.251.255.249
@@ -44159,7 +43688,7 @@
  186.251.255.45
  186.251.255.49
  186.251.255.53
-186.251.255.57
+186.251.255.61
  186.251.255.65
  186.251.255.73
  186.251.255.77
@@ -44173,6 +43702,7 @@
  186.29.135.133
  186.29.135.64
  186.29.143.70
+186.29.147.217
  186.29.163.97
  186.29.34.136
  186.29.69.68
@@ -44191,58 +43721,55 @@
  186.33.104.102
  186.33.104.107
  186.33.104.109
-186.33.104.129
  186.33.104.145
  186.33.104.156
  186.33.104.209
+186.33.104.23
  186.33.104.30
  186.33.104.38
  186.33.104.51
  186.33.104.67
  186.33.104.79
  186.33.104.84
-186.33.105.11
-186.33.105.8
+186.33.104.93
+186.33.105.4
  186.33.122.109
-186.33.122.128
  186.33.122.129
  186.33.122.142
-186.33.122.149
-186.33.122.151
  186.33.122.155
+186.33.122.157
  186.33.122.16
-186.33.122.161
  186.33.122.166
  186.33.122.191
+186.33.122.202
  186.33.122.210
-186.33.122.220
-186.33.122.233
-186.33.122.243
-186.33.122.41
-186.33.122.46
-186.33.122.5
+186.33.122.229
+186.33.122.37
+186.33.122.40
+186.33.122.64
  186.33.122.66
-186.33.122.70
  186.33.123.0
-186.33.123.114
-186.33.123.118
  186.33.123.12
+186.33.123.124
+186.33.123.125
  186.33.123.127
  186.33.123.142
-186.33.123.148
  186.33.123.32
  186.33.123.46
  186.33.123.47
  186.33.123.49
-186.33.123.58
+186.33.123.52
  186.33.123.7
+186.33.123.79
  186.33.123.81
+186.33.123.88
  186.33.167.11
  186.34.12.201
  186.34.92.253
  186.35.50.22
  186.38.26.5
  186.38.38.2
+186.38.79.55
  186.4.136.153
  186.4.148.195
  186.4.172.5
@@ -44282,21 +43809,16 @@
  186.5.203.1
  186.5.204.2
  186.5.207.1
-186.50.104.208
-186.50.170.80
-186.52.154.115
+186.50.187.61
+186.52.160.171
  186.53.148.112
+186.56.10.51
  186.58.191.87
-186.58.248.40
-186.58.36.137
  186.59.132.129
  186.61.13.196
-186.61.21.177
-186.64.116.65
  186.64.118.125
-186.64.119.245
  186.64.119.85
-186.64.95.116
+186.64.70.131
  186.67.13.244
  186.67.130.162
  186.67.159.100
@@ -44307,9 +43829,11 @@
  186.68.141.218
  186.68.93.46
  186.69.246.194
-186.7.7.105
+186.7.168.133
+186.7.175.178
+186.7.194.211
+186.7.225.233
  186.71.71.44
-186.73.102.132
  186.73.132.114
  186.73.188.132
  186.74.169.155
@@ -44317,16 +43841,16 @@
  186.74.221.210
  186.75.130.46
  186.75.241.230
-186.77.196.176
-186.77.204.26
  186.79.180.71
  186.80.27.227
  186.82.235.14
  186.83.41.2
  186.84.173.153
  186.84.174.13
+186.84.22.140
  186.85.159.135
  186.86.247.169
+186.87.164.161
  186.88.44.220
  186.89.212.45
  186.9.11.188
@@ -44341,9 +43865,11 @@
  186.96.109.181
  186.96.110.5
  186.96.112.250
+186.96.121.85
  186.96.127.221
  186.96.170.61
  186.96.178.5
+186.96.193.133
  186.97.146.138
  1860poga.co.za
  186181.com
@@ -44360,32 +43886,35 @@
  187.10.132.171
  187.10.35.207
  187.102.13.140
+187.102.13.18
  187.102.16.166
  187.102.16.70
+187.102.255.138
+187.102.255.168
  187.102.71.1
  187.102.96.95
  187.103.15.17
  187.103.15.54
  187.103.74.137
  187.103.81.39
+187.103.81.49
  187.103.82.116
  187.103.82.123
-187.103.82.78
  187.103.82.91
  187.103.82.95
  187.104.145.210
  187.108.38.170
  187.108.46.204
  187.108.48.22
-187.108.76.147
+187.108.79.170
  187.108.86.40
-187.109.10.100
  187.109.116.64
  187.109.181.77
  187.109.253.246
  187.109.34.243
  187.109.36.251
  187.109.40.9
+187.109.46.123
  187.11.113.231
  187.11.126.254
  187.11.149.4
@@ -44394,7 +43923,6 @@
  187.111.160.10
  187.111.160.23
  187.111.160.29
-187.111.160.6
  187.111.160.8
  187.111.192.125
  187.111.192.165
@@ -44415,8 +43943,6 @@
  187.111.193.80
  187.111.195.0
  187.111.195.6
-187.111.39.5
-187.111.46.199
  187.115.10.50
  187.116.125.80
  187.119.191.48
@@ -44426,11 +43952,11 @@
  187.120.15.26
  187.120.221.165
  187.120.253.119
-187.120.253.137
-187.120.29.45
+187.121.0.207
  187.121.105.52
  187.121.109.248
  187.121.110.17
+187.121.114.151
  187.121.115.197
  187.121.119.218
  187.121.120.43
@@ -44449,28 +43975,22 @@
  187.123.56.57
  187.125.30.122
  187.133.59.220
-187.134.213.153
-187.134.246.133
-187.135.123.100
  187.137.159.55
-187.138.162.31
  187.138.71.204
  187.141.128.42
  187.141.129.86
  187.141.138.200
  187.141.143.180
-187.143.169.208
  187.143.75.193
  187.144.248.15
  187.144.50.63
  187.145.225.49
+187.148.179.125
  187.148.3.156
  187.149.110.136
  187.149.60.246
  187.149.71.247
-187.150.131.94
  187.151.201.205
-187.155.132.119
  187.16.109.209
  187.16.255.199
  187.16.4.126
@@ -44485,16 +44005,13 @@
  187.17.145.237
  187.17.172.218
  187.17.19.90
-187.170.230.209
  187.170.243.251
-187.172.202.196
  187.174.65.4
  187.177.155.123
  187.178.241.208
-187.18.108.73
  187.18.125.34
-187.18.254.159
  187.18.47.210
+187.182.19.26
  187.184.98.222
  187.187.230.145
  187.188.107.115
@@ -44502,16 +44019,16 @@
  187.188.127.180
  187.188.141.220
  187.188.166.192
-187.188.174.78
  187.188.182.87
  187.188.183.82
  187.188.187.140
  187.188.188.231
  187.188.190.217
+187.188.197.82
  187.188.200.2
  187.188.200.20
-187.188.202.106
  187.188.202.186
+187.188.206.106
  187.188.213.38
  187.188.213.4
  187.188.236.198
@@ -44521,22 +44038,22 @@
  187.188.34.227
  187.188.90.141
  187.189.111.113
-187.189.122.67
+187.189.122.25
  187.189.170.100
  187.189.175.4
  187.189.178.16
  187.189.195.208
  187.189.211.33
  187.189.225.148
-187.189.225.85
  187.189.230.108
  187.189.230.143
-187.189.231.218
  187.189.232.175
-187.189.234.239
+187.189.232.53
  187.189.235.42
+187.189.237.186
  187.189.237.7
  187.189.243.167
+187.189.32.70
  187.189.51.115
  187.189.52.132
  187.189.60.10
@@ -44553,7 +44070,10 @@
  187.19.127.238
  187.19.127.253
  187.19.150.221
+187.19.152.29
  187.19.197.144
+187.19.197.148
+187.19.197.150
  187.19.202.42
  187.19.203.194
  187.19.204.23
@@ -44561,11 +44081,12 @@
  187.190.10.175
  187.190.102.83
  187.190.109.158
-187.190.192.215
  187.190.197.38
+187.190.202.192
  187.190.205.58
  187.190.221.53
  187.190.227.62
+187.190.233.7
  187.190.236.88
  187.190.237.69
  187.190.237.71
@@ -44573,7 +44094,6 @@
  187.190.239.216
  187.190.255.230
  187.190.40.95
-187.190.45.106
  187.190.48.20
  187.191.38.74
  187.191.39.189
@@ -44583,11 +44103,11 @@
  187.194.80.233
  187.195.74.33
  187.20.214.78
+187.200.149.88
  187.200.186.144
+187.200.195.80
  187.202.83.41
  187.205.136.76
-187.207.203.240
-187.207.217.122
  187.211.82.147
  187.212.190.44
  187.216.81.178
@@ -44599,12 +44119,10 @@
  187.216.81.189
  187.216.81.190
  187.216.81.82
-187.216.93.20
  187.217.246.82
  187.217.39.84
  187.220.43.45
  187.223.162.79
-187.223.244.150
  187.224.196.70
  187.228.153.58
  187.237.103.210
@@ -44614,16 +44132,13 @@
  187.237.217.18
  187.243.240.54
  187.243.250.222
-187.243.251.154
  187.243.253.182
  187.243.253.2
  187.243.255.174
-187.245.95.138
  187.248.21.27
  187.250.149.15
  187.252.154.90
  187.26.221.189
-187.26.33.157
  187.32.175.203
  187.32.212.208
  187.32.225.177
@@ -44631,7 +44146,6 @@
  187.32.58.98
  187.32.92.129
  187.33.160.252
-187.33.162.112
  187.33.70.110
  187.33.86.101
  187.33.87.98
@@ -44641,6 +44155,7 @@
  187.33.92.94
  187.33.93.157
  187.33.93.197
+187.35.140.169
  187.35.147.87
  187.36.186.3
  187.38.185.224
@@ -44651,12 +44166,10 @@
  187.44.1.206
  187.44.110.157
  187.44.126.204
+187.44.138.148
  187.44.138.149
  187.44.138.150
  187.44.138.151
-187.44.138.153
-187.44.138.154
-187.44.138.155
  187.44.14.19
  187.44.160.174
  187.44.167.78
@@ -44664,9 +44177,11 @@
  187.44.177.178
  187.44.210.246
  187.44.213.166
+187.44.231.162
  187.44.252.106
  187.44.254.62
  187.44.99.182
+187.45.103.15
  187.45.106.54
  187.45.123.110
  187.45.123.137
@@ -44677,6 +44192,7 @@
  187.49.207.65
  187.5.96.149
  187.50.136.210
+187.53.124.9
  187.53.5.247
  187.54.225.76
  187.54.74.23
@@ -44684,7 +44200,9 @@
  187.57.12.226
  187.58.107.81
  187.58.131.11
+187.58.132.235
  187.58.151.15
+187.59.95.170
  187.60.34.234
  187.60.34.86
  187.60.36.164
@@ -44705,7 +44223,8 @@
  187.65.12.111
  187.65.55.231
  187.67.128.35
-187.68.195.85
+187.67.83.62
+187.68.219.99
  187.72.177.131
  187.72.231.193
  187.72.239.185
@@ -44727,12 +44246,14 @@
  187.74.128.194
  187.74.132.6
  187.74.132.64
+187.74.32.101
  187.75.209.161
  187.76.190.74
  187.8.113.122
  187.8.182.30
  187.8.226.10
  187.8.78.101
+187.82.203.222
  187.84.177.17
  187.84.187.33
  187.84.191.129
@@ -44748,26 +44269,27 @@
  187.84.191.41
  187.84.191.50
  187.84.191.9
-187.84.80.239
  187.85.130.98
  187.85.150.148
  187.85.164.7
-187.85.229.190
  187.85.84.202
+187.86.128.94
  187.86.129.122
  187.86.129.132
  187.86.129.134
  187.86.201.4
-187.87.1.238
+187.87.12.163
  187.87.204.202
  187.87.204.205
  187.87.208.230
+187.87.5.165
  187.9.119.44
  187.9.86.122
+187.93.176.2
  187.94.16.59
  187.94.221.0
+187.94.5.9
  187.95.11.195
-187.95.110.153
  187.95.114.125
  187.95.119.2
  187.95.124.103
@@ -44793,12 +44315,13 @@
  188.0.191.219
  188.0.240.178
  188.0.240.38
-188.10.161.2
  188.10.210.132
  188.101.49.228
  188.104.156.80
  188.112.145.230
  188.112.194.6
+188.112.7.25
+188.112.9.237
  188.113.106.183
  188.113.158.18
  188.113.166.222
@@ -44809,14 +44332,13 @@
  188.114.111.215
  188.114.128.173
  188.114.155.58
-188.116.29.37
  188.117.176.56
  188.119.113.201
-188.119.150.229
  188.119.30.71
  188.119.30.72
  188.119.30.80
  188.119.67.114
+188.120.117.92
  188.120.133.127
  188.120.224.201
  188.120.225.104
@@ -44841,13 +44363,12 @@
  188.122.2.55
  188.123.126.172
  188.124.181.6
-188.124.245.195
-188.124.36.153
  188.124.42.107
  188.124.42.119
  188.124.42.124
  188.125.107.117
  188.126.116.26
+188.126.18.122
  188.126.44.3
  188.126.73.10
  188.126.73.198
@@ -44861,6 +44382,7 @@
  188.126.73.219
  188.126.73.221
  188.126.73.222
+188.126.82.100
  188.126.89.103
  188.126.89.115
  188.126.89.119
@@ -44875,11 +44397,10 @@
  188.126.89.28
  188.126.89.36
  188.126.89.4
-188.126.94.72
-188.127.170.26
  188.127.188.23
-188.127.225.2
  188.127.229.105
+188.127.237.115
+188.127.237.158
  188.127.249.210
  188.127.251.245
  188.128.202.35.bc.googleusercontent.com
@@ -44890,15 +44411,12 @@
  188.129.34.213
  188.130.129.138
  188.130.138.105
-188.130.142.167
  188.130.185.151
  188.130.185.220
  188.130.210.243
-188.130.211.213
  188.130.7.221
  188.131.130.86
  188.131.131.210
-188.131.133.196
  188.131.133.91
  188.131.135.161
  188.131.135.188
@@ -44910,11 +44428,9 @@
  188.131.146.238
  188.131.146.4
  188.131.149.215
-188.131.150.74
  188.131.151.197
  188.131.155.179
  188.131.172.48
-188.131.177.57
  188.131.177.59
  188.131.179.87
  188.131.183.242
@@ -44927,7 +44443,6 @@
  188.131.247.56
  188.131.249.145
  188.132.169.90
-188.132.219.172
  188.133.160.22
  188.133.165.206
  188.133.166.42
@@ -44943,6 +44458,7 @@
  188.135.15.49
  188.136.143.83
  188.136.167.33
+188.137.76.154
  188.138.11.56
  188.138.112.171
  188.138.112.60
@@ -44957,6 +44473,7 @@
  188.138.40.166
  188.138.84.69
  188.138.88.184
+188.138.88.47
  188.14.85.21
  188.141.34.156
  188.141.79.43
@@ -45489,12 +45006,14 @@
  188.156.179.10
  188.156.240.240
  188.156.43.228
-188.157.65.153
  188.16.100.56
+188.161.231.158
  188.161.62.114
  188.162.142.192
+188.162.199.167
  188.162.41.226
  188.162.43.125
+188.162.43.153
  188.163.104.113
  188.163.109.142
  188.163.170.130
@@ -45503,8 +45022,8 @@
  188.163.42.254
  188.163.46.254
  188.163.47.9
-188.163.57.66
  188.163.74.184
+188.163.93.215
  188.165.11.196
  188.165.113.29
  188.165.119.138
@@ -45515,6 +45034,7 @@
  188.165.141.114
  188.165.16.230
  188.165.166.72
+188.165.169.140
  188.165.17.91
  188.165.179.58
  188.165.180.120
@@ -45569,7 +45089,6 @@
  188.166.109.215
  188.166.109.87
  188.166.11.150
-188.166.110.18
  188.166.114.8
  188.166.116.147
  188.166.119.231
@@ -45596,6 +45115,7 @@
  188.166.159.127
  188.166.16.36
  188.166.161.142
+188.166.161.90
  188.166.164.10
  188.166.165.121
  188.166.170.70
@@ -45610,7 +45130,6 @@
  188.166.183.217
  188.166.183.237
  188.166.185.112
-188.166.185.157
  188.166.185.16
  188.166.185.236
  188.166.185.245
@@ -45647,6 +45166,7 @@
  188.166.22.22
  188.166.220.180
  188.166.220.74
+188.166.222.186
  188.166.223.102
  188.166.224.24
  188.166.224.51
@@ -45662,7 +45182,6 @@
  188.166.234.253
  188.166.236.56
  188.166.236.57
-188.166.238.73
  188.166.24.63
  188.166.240.30
  188.166.241.194
@@ -45695,7 +45214,6 @@
  188.166.34.234
  188.166.35.206
  188.166.35.81
-188.166.38.40
  188.166.4.178
  188.166.43.209
  188.166.46.210
@@ -45704,6 +45222,8 @@
  188.166.5.210
  188.166.5.50
  188.166.5.84
+188.166.53.163
+188.166.56.218
  188.166.56.221
  188.166.56.50
  188.166.58.130
@@ -45720,7 +45240,6 @@
  188.166.63.236
  188.166.64.245
  188.166.65.239
-188.166.69.54
  188.166.69.56
  188.166.71.168
  188.166.71.170
@@ -45738,7 +45257,9 @@
  188.166.87.110
  188.166.87.132
  188.166.87.188
+188.166.87.22
  188.166.9.210
+188.166.9.57
  188.166.93.228
  188.166.94.176
  188.166.97.113
@@ -45746,6 +45267,7 @@
  188.166.99.160
  188.166.99.74
  188.167.158.203
+188.167.251.181
  188.168.248.23
  188.168.27.71
  188.168.27.73
@@ -45779,9 +45301,9 @@
  188.169.45.115
  188.169.45.140
  188.169.45.223
-188.169.45.232
  188.169.45.237
  188.169.45.239
+188.169.45.28
  188.169.45.92
  188.169.61.115
  188.169.61.12
@@ -45792,7 +45314,6 @@
  188.17.106.157
  188.17.148.154
  188.170.122.155
-188.170.129.251
  188.170.13.225
  188.170.183.138
  188.170.208.210
@@ -45806,7 +45327,6 @@
  188.172.94.56
  188.173.14.99
  188.174.35.38
-188.174.55.139
  188.175.191.162
  188.18.225.106
  188.18.54.130
@@ -45833,21 +45353,20 @@
  188.191.166.23
  188.191.232.66
  188.191.28.109
+188.192.100.71
  188.192.12.35
  188.192.175.128
  188.193.103.156
-188.193.167.54
  188.193.172.17
  188.193.44.23
-188.194.188.88
-188.194.5.121
+188.194.171.33
+188.194.56.129
  188.194.58.118
+188.195.106.107
+188.195.140.6
  188.195.169.0
  188.2.16.112
-188.2.217.94
  188.205.25.124
-188.208.111.62
-188.208.121.7
  188.209.155.250
  188.209.49.164
  188.212.100.2
@@ -45866,7 +45385,6 @@
  188.214.133.114
  188.214.133.181
  188.214.152.109
-188.214.30.149
  188.214.30.78
  188.215.70.115
  188.216.254.72
@@ -45875,10 +45393,10 @@
  188.217.97.1
  188.218.232.45
  188.218.47.5
+188.218.66.121
  188.219.117.26
  188.219.31.12
  188.220.144.162
-188.220.249.149
  188.223.123.122
  188.225.177.37
  188.225.178.130
@@ -45892,6 +45410,8 @@
  188.225.83.41
  188.225.83.5
  188.225.84.102
+188.225.87.65
+188.225.87.85
  188.226.128.122
  188.226.130.128
  188.226.131.171
@@ -45912,7 +45432,6 @@
  188.226.179.232
  188.226.180.234
  188.226.188.45
-188.226.189.117
  188.226.192.115
  188.226.233.196
  188.226.250.187
@@ -45923,7 +45442,9 @@
  188.227.193.60
  188.227.195.66
  188.227.195.70
+188.227.221.172
  188.227.85.53
+188.228.233.70
  188.23.51.11
  188.230.136.208
  188.230.189.138
@@ -45933,6 +45454,7 @@
  188.234.218.19
  188.234.247.110
  188.234.251.138
+188.234.3.235
  188.235.0.42
  188.235.128.166
  188.235.133.102
@@ -45946,11 +45468,13 @@
  188.237.135.3
  188.237.148.12
  188.24.108.129
+188.24.133.151
  188.24.40.110
  188.240.136.75
  188.240.191.163
  188.240.208.26
  188.240.208.4
+188.240.221.7
  188.241.25.165
  188.241.39.65
  188.241.45.61
@@ -45981,7 +45505,6 @@
  188.247.39.14
  188.247.65.179
  188.25.168.172
-188.25.17.89
  188.25.224.74
  188.251.196.56
  188.251.213.180
@@ -45997,9 +45520,10 @@
  188.254.0.182
  188.254.172.147
  188.254.172.151
+188.255.103.80
  188.255.118.20
  188.255.120.9
-188.255.145.164
+188.255.184.93
  188.255.208.1
  188.255.208.10
  188.255.208.105
@@ -46047,24 +45571,18 @@
  188.27.137.163
  188.27.36.71
  188.27.59.198
-188.3.195.184
  188.32.128.29
  188.32.145.79
  188.34.140.122
  188.34.142.109
  188.34.144.180
  188.34.152.77
-188.34.165.172
-188.34.165.183
-188.34.166.17
-188.34.166.31
  188.34.194.155
  188.35.167.7
  188.36.167.248
  188.37.24.190
  188.38.97.58
  188.4.196.139
-188.4.75.117
  188.40.114.21
  188.40.136.208
  188.40.155.227
@@ -46102,8 +45620,8 @@
  188.68.56.168
  188.68.56.223
  188.69.135.214
-188.69.197.0
-188.72.187.212
+188.70.37.171
+188.71.245.172
  188.72.202.147
  188.72.6.98
  188.72.98.85
@@ -46117,7 +45635,6 @@
  188.81.254.135
  188.82.39.247
  188.85.143.170
-188.87.95.97
  188.92.190.38
  188.92.243.82
  188.92.244.38
@@ -46137,7 +45654,6 @@
  18850306929.mer.lstest.siquality.com
  188elexusbet.blogspot.com
  188winerium.com
-189.1.10.46
  189.1.11.66
  189.1.123.19
  189.1.152.26
@@ -46151,9 +45667,11 @@
  189.1.4.126
  189.1.4.129
  189.100.253.150
+189.102.193.2
  189.107.23.86
  189.108.178.6
  189.108.236.148
+189.109.219.116
  189.109.252.155
  189.109.32.234
  189.11.126.17
@@ -46166,15 +45684,14 @@
  189.112.228.153
  189.112.89.17
  189.113.186.219
+189.113.187.1
  189.113.187.98
  189.113.2.23
  189.113.217.35
  189.114.1.52
-189.114.140.70
  189.114.67.195
  189.114.67.217
-189.115.171.132
-189.115.210.172
+189.12.227.147
  189.122.185.116
  189.122.185.23
  189.123.173.24
@@ -46192,6 +45709,8 @@
  189.127.106.16
  189.127.107.43
  189.127.128.226
+189.127.15.106
+189.127.27.249
  189.128.56.231
  189.129.43.161
  189.130.230.223
@@ -46213,42 +45732,38 @@
  189.14.194.113
  189.14.233.26
  189.14.96.74
-189.140.160.101
  189.142.120.23
  189.146.131.206
  189.146.156.58
  189.148.103.223
  189.15.17.127
  189.150.164.106
+189.151.57.84
  189.152.130.84
  189.152.213.9
  189.152.61.86
  189.153.95.182
  189.154.161.142
-189.154.220.90
  189.155.9.184
  189.159.210.106
-189.159.56.189
  189.16.123.100
  189.162.123.139
  189.162.183.59
  189.166.212.235
-189.167.14.31
-189.167.45.102
-189.17.228.136
+189.167.30.71
  189.171.65.89
-189.172.180.188
-189.172.34.21
  189.174.130.74
-189.174.83.178
  189.174.9.172
+189.176.153.225
+189.176.225.126
  189.177.110.65
  189.177.189.116
  189.177.80.175
  189.178.112.205
-189.178.164.109
+189.178.152.238
  189.178.73.157
  189.18.181.92
+189.180.7.136
  189.187.128.178
  189.189.0.152
  189.191.3.53
@@ -46263,9 +45778,10 @@
  189.2.177.210
  189.2.218.179
  189.2.65.162
-189.20.55.148
  189.20.98.204
  189.200.81.82
+189.201.185.34
+189.201.189.13
  189.201.189.2
  189.201.189.5
  189.201.191.17
@@ -46286,7 +45802,6 @@
  189.203.194.2
  189.203.235.215
  189.203.26.46
-189.203.37.79
  189.203.45.199
  189.203.73.102
  189.204.242.178
@@ -46308,12 +45823,12 @@
  189.212.199.126
  189.212.249.122
  189.213.228.237
-189.213.228.57
  189.214.64.34
-189.216.94.83
  189.218.107.128
  189.218.156.138
  189.218.165.63
+189.218.236.235
+189.218.238.43
  189.219.220.206
  189.219.69.229
  189.219.72.148
@@ -46321,34 +45836,27 @@
  189.22.55.34
  189.220.226.38
  189.222.175.66
-189.222.39.151
  189.223.19.109
  189.223.208.162
  189.231.48.145
-189.231.97.160
-189.232.17.219
  189.235.87.72
  189.236.122.23
  189.236.212.18
  189.236.32.128
-189.236.73.159
-189.237.100.42
  189.240.117.236
  189.240.225.205
-189.240.50.226
  189.240.62.227
-189.241.124.20
  189.241.145.77
  189.241.235.106
  189.242.130.16
  189.243.159.109
  189.243.25.216
+189.243.98.161
  189.244.76.49
  189.244.92.231
  189.248.93.110
  189.250.126.76
  189.252.102.40
-189.252.214.18
  189.254.232.61
  189.254.242.60
  189.254.255.180
@@ -46357,8 +45865,11 @@
  189.26.78.155
  189.27.79.166
  189.28.186.26
+189.28.241.153
  189.28.249.101
  189.30.181.98
+189.30.6.86
+189.38.165.120
  189.38.90.83
  189.39.102.67
  189.39.127.118
@@ -46368,13 +45879,9 @@
  189.4.128.122
  189.4.3.44
  189.41.137.1
-189.41.212.76
  189.41.215.72
  189.41.241.111
-189.41.66.86
-189.41.90.107
  189.44.178.170
-189.44.20.193
  189.45.144.26
  189.45.199.37
  189.47.112.65
@@ -46383,17 +45890,17 @@
  189.50.145.18
  189.51.101.126
  189.51.101.145
+189.51.102.139
  189.51.103.125
-189.51.103.95
  189.51.108.23
  189.51.116.5
+189.51.126.223
  189.51.127.1
  189.51.143.10
  189.51.97.126
  189.51.97.35
  189.51.98.182
  189.51.98.20
-189.52.154.213
  189.52.165.134
  189.52.165.84
  189.52.24.146
@@ -46401,12 +45908,15 @@
  189.55.194.94
  189.57.121.10
  189.57.62.34
+189.59.3.225
+189.6.241.243
+189.6.25.134
  189.6.28.187
+189.6.32.197
  189.6.78.34
  189.61.87.178
  189.62.148.166
-189.63.87.20
-189.69.0.153
+189.7.217.23
  189.7.81.29
  189.75.115.204
  189.76.49.165
@@ -46442,7 +45952,7 @@
  189.9.25.89
  189.9.25.92
  189.9.25.94
-189.90.208.193
+189.90.210.192
  189.90.244.46
  189.90.244.82
  189.90.248.112
@@ -46450,8 +45960,9 @@
  189.91.101.54
  189.91.115.6
  189.91.239.194
+189.91.4.207
  189.91.84.25
-189.93.152.225
+189.95.188.18
  189cj.cn
  189zx.com
  18a.buzz
@@ -46484,10 +45995,11 @@
  190.0.53.213
  190.0.61.18
  190.0.8.134
-190.1.203.180
  190.100.117.152
+190.100.170.253
+190.101.104.58
  190.101.168.19
-190.102.59.117
+190.102.241.95
  190.103.1.146
  190.103.125.194
  190.103.125.199
@@ -46496,7 +46008,6 @@
  190.103.28.14
  190.103.28.76
  190.103.29.236
-190.104.124.162
  190.104.149.194
  190.104.17.3
  190.104.17.4
@@ -46506,7 +46017,6 @@
  190.104.235.8
  190.104.237.148
  190.104.24.109
-190.104.245.28
  190.104.247.220
  190.104.249.44
  190.104.25.210
@@ -46515,19 +46025,19 @@
  190.104.26.227
  190.104.64.242
  190.104.65.249
+190.104.66.191
  190.104.68.246
  190.104.69.241
  190.105.213.165
-190.105.250.198
  190.106.103.250
  190.106.104.2
  190.106.146.44
+190.106.28.98
  190.106.97.230
  190.107.118.125
-190.107.177.238
-190.107.177.240
  190.108.226.1
  190.108.228.48
+190.108.45.198
  190.108.84.166
  190.109.160.73
  190.109.167.9
@@ -46549,13 +46059,15 @@
  190.109.74.1
  190.109.75.253
  190.11.15.14
+190.11.15.2
  190.11.168.226
  190.11.198.89
  190.11.21.43
  190.11.24.36
+190.11.87.150
  190.110.197.18
  190.110.86.134
-190.111.151.225
+190.111.151.226
  190.111.231.8
  190.112.136.149
  190.112.136.153
@@ -46584,13 +46096,13 @@
  190.117.206.153
  190.119.197.210
  190.119.199.18
+190.119.231.226
  190.119.242.38
  190.12.102.205
  190.12.37.142
  190.12.39.194
  190.12.47.246
  190.12.66.27
-190.12.67.9
  190.12.8.146
  190.12.8.206
  190.12.86.98
@@ -46599,7 +46111,6 @@
  190.120.123.4
  190.120.229.139
  190.120.23.157
-190.120.250.55
  190.120.253.66
  190.120.254.17
  190.120.254.37
@@ -46613,16 +46124,19 @@
  190.121.142.158
  190.121.142.166
  190.121.142.202
+190.121.157.33
  190.121.157.90
  190.121.16.250
  190.121.5.210
  190.122.112.14
  190.122.112.3
-190.122.112.37
  190.122.112.42
  190.122.112.57
  190.122.112.69
+190.122.112.70
  190.122.112.72
+190.122.112.74
+190.122.128.177
  190.122.128.196
  190.123.197.168
  190.123.230.168
@@ -46644,8 +46158,8 @@
  190.123.90.242
  190.123.90.246
  190.124.164.78
-190.124.29.37
  190.124.34.221
+190.128.129.18
  190.128.135.130
  190.128.137.90
  190.128.148.198
@@ -46661,7 +46175,9 @@
  190.128.88.4
  190.129.143.30
  190.129.49.62
+190.129.60.125
  190.129.69.101
+190.13.106.108
  190.13.138.50
  190.13.173.67
  190.13.82.242
@@ -46669,9 +46185,12 @@
  190.13.84.221
  190.131.167.50
  190.131.196.18
+190.131.218.212
  190.131.220.101
  190.131.229.126
+190.131.243.186
  190.132.77.44
+190.133.190.45
  190.133.223.104
  190.136.109.66
  190.136.176.89
@@ -46679,20 +46198,19 @@
  190.138.206.15
  190.138.206.16
  190.138.206.18
+190.139.62.18
  190.14.170.109
+190.14.18.126
  190.14.225.117
  190.14.231.212
  190.14.235.115
  190.14.39.239
  190.140.131.14
-190.140.182.89
  190.140.92.234
  190.141.196.80
-190.143.137.114
  190.143.39.211
  190.144.100.58
  190.144.114.162
-190.144.135.118
  190.144.139.76
  190.144.14.170
  190.144.182.86
@@ -46703,7 +46221,6 @@
  190.144.70.74
  190.144.79.157
  190.144.81.94
-190.144.82.194
  190.144.91.252
  190.144.99.11
  190.145.12.233
@@ -46714,6 +46231,7 @@
  190.145.148.34
  190.145.156.58
  190.145.159.26
+190.145.162.138
  190.145.174.26
  190.145.192.106
  190.145.200.126
@@ -46721,9 +46239,7 @@
  190.145.224.18
  190.145.254.138
  190.145.255.246
-190.145.33.211
  190.145.38.91
-190.145.5.170
  190.145.60.229
  190.145.69.123
  190.145.77.219
@@ -46743,10 +46259,8 @@
  190.148.69.74
  190.149.165.162
  190.149.216.74
-190.149.56.251
  190.151.100.10
  190.151.94.2
-190.151.94.3
  190.152.12.54
  190.152.15.194
  190.152.17.62
@@ -46771,6 +46285,8 @@
  190.153.152.56
  190.153.222.250
  190.153.249.99
+190.155.106.74
+190.156.218.12
  190.156.227.27
  190.156.229.215
  190.156.231.182
@@ -46785,6 +46301,8 @@
  190.163.31.26
  190.164.232.254
  190.164.43.178
+190.165.175.167
+190.166.181.229
  190.166.28.179
  190.166.90.2
  190.167.215.170
@@ -46799,7 +46317,7 @@
  190.171.218.40
  190.171.240.51
  190.177.114.135
-190.178.147.248
+190.18.10.68
  190.18.184.113
  190.18.207.58
  190.18.3.250
@@ -46819,13 +46337,13 @@
  190.184.144.170
  190.184.201.146
  190.184.201.154
+190.184.204.4
  190.185.112.117
  190.185.119.44
  190.185.150.4
  190.186.1.46
  190.186.144.99
  190.186.170.82
-190.186.253.86
  190.186.36.22
  190.186.36.74
  190.186.76.19
@@ -46842,12 +46360,11 @@
  190.190.159.143
  190.190.219.184
  190.190.229.75
-190.191.127.2
  190.191.163.147
+190.191.167.216
  190.191.171.72
  190.191.8.220
  190.192.39.136
-190.193.158.220
  190.193.8.28
  190.194.12.132
  190.194.139.28
@@ -46856,11 +46373,13 @@
  190.195.148.163
  190.195.static.wline.lns.sme.cust.swisscom-ipv6.ch
  190.196.150.40
+190.196.154.122
  190.196.161.110
  190.196.20.166
  190.196.226.145
  190.196.23.170
  190.196.231.245
+190.196.231.36
  190.196.60.122
  190.196.66.74
  190.196.66.76
@@ -46869,17 +46388,18 @@
  190.196.9.155
  190.197.113.149
  190.198.118.138
-190.2.109.108
+190.2.112.191
+190.2.118.147
  190.2.130.195
  190.2.130.44
  190.2.131.167
+190.2.131.175
  190.2.134.140
  190.2.142.44
  190.2.143.222
  190.2.145.177
  190.2.146.90
  190.2.148.87
-190.2.149.232
  190.2.150.132
  190.2.152.163
  190.2.16.178
@@ -46888,7 +46408,7 @@
  190.2.210.106
  190.2.31.172
  190.20.97.244
-190.200.187.230
+190.201.5.46
  190.202.0.214
  190.202.124.93
  190.202.147.253
@@ -46898,15 +46418,14 @@
  190.202.44.194
  190.202.54.12
  190.202.84.129
+190.205.122.242
  190.205.156.139
  190.205.48.29
  190.206.113.156
  190.207.108.147
  190.207.60.130
  190.208.17.136
-190.21.57.120
  190.210.15.194
-190.210.164.141
  190.210.182.179
  190.210.184.138
  190.210.231.34
@@ -46935,14 +46454,12 @@
  190.214.44.230
  190.214.50.158
  190.214.51.166
-190.214.52.226
  190.214.53.134
  190.214.55.138
+190.214.76.134
+190.214.76.191
  190.214.77.181
  190.214.77.220
-190.214.78.233
-190.214.78.53
-190.214.79.166
  190.214.9.10
  190.215.117.69
  190.215.155.196
@@ -46951,7 +46468,6 @@
  190.215.220.34
  190.215.220.36
  190.215.220.38
-190.215.48.118
  190.216.140.123
  190.216.147.229
  190.216.166.200
@@ -46966,7 +46482,6 @@
  190.217.1.57
  190.217.1.89
  190.217.1.9
-190.217.108.147
  190.217.4.102
  190.217.68.210
  190.217.68.211
@@ -46976,16 +46491,13 @@
  190.218.192.201
  190.218.237.244
  190.219.149.236
-190.219.159.3
  190.219.179.200
-190.219.33.109
  190.220.16.92
  190.220.17.34
  190.221.152.130
  190.221.46.78
  190.223.26.38
  190.224.35.254
-190.224.35.31
  190.225.247.196
  190.226.244.9
  190.226.46.114
@@ -47001,14 +46513,14 @@
  190.228.171.8
  190.228.29.70
  190.229.255.239
+190.230.134.122
  190.230.60.129
  190.232.112.115
-190.232.137.233
+190.232.74.207
  190.234.135.32
  190.234.135.55
  190.234.135.88
-190.234.204.30
-190.235.15.118
+190.236.211.178
  190.236.239.88
  190.237.15.221
  190.239.1.225
@@ -47024,14 +46536,14 @@
  190.242.47.102
  190.242.47.126
  190.242.98.61
+190.244.117.59
  190.244.96.69
  190.246.152.105
+190.246.155.29
  190.247.139.101
  190.248.133.62
-190.248.134.106
  190.248.153.162
  190.248.68.18
-190.249.137.158
  190.249.150.97
  190.25.168.216
  190.25.189.178
@@ -47042,10 +46554,12 @@
  190.253.19.101
  190.254.58.196
  190.255.49.83
+190.255.97.14
  190.26.164.111
  190.26.168.203
  190.26.170.121
  190.26.173.238
+190.26.192.212
  190.26.41.20
  190.26.45.204
  190.27.114.131
@@ -47053,15 +46567,15 @@
  190.27.162.35
  190.27.21.108
  190.27.63.71
+190.29.111.9
  190.29.166.0
  190.29.26.190
  190.29.96.187
  190.3.117.18
  190.3.194.209
-190.3.205.213
  190.3.23.35
-190.30.103.216
  190.31.53.131
+190.33.71.38
  190.34.149.226
  190.34.204.10
  190.37.208.145
@@ -47072,21 +46586,23 @@
  190.4.205.226
  190.4.56.17
  190.40.85.200
+190.42.250.85
+190.42.98.75
  190.43.172.170
  190.43.172.210
+190.43.172.59
  190.44.157.81
  190.45.149.187
  190.45.24.210
-190.45.90.233
+190.46.124.59
  190.5.118.42
  190.5.122.174
  190.5.162.204
-190.5.228.74
  190.5.241.140
  190.5.242.114
  190.5.85.242
+190.51.189.168
  190.52.168.20
-190.52.183.173
  190.52.187.226
  190.52.191.49
  190.52.193.102
@@ -47116,7 +46632,6 @@
  190.6.202.13
  190.6.206.77
  190.60.110.240
-190.62.251.96
  190.63.144.26
  190.63.144.29
  190.63.160.62
@@ -47127,6 +46642,7 @@
  190.64.64.75
  190.64.68.106
  190.64.68.178
+190.64.69.50
  190.64.88.186
  190.66.10.152
  190.7.141.66
@@ -47148,28 +46664,24 @@
  190.72.52.193
  190.73.12.20
  190.75.150.153
+190.75.2.233
  190.77.210.230
-190.77.242.181
-190.77.66.130
-190.79.114.25
  190.79.131.206
  190.8.117.5
  190.8.169.206
  190.8.43.19
  190.8.61.36
  190.80.159.189
-190.80.159.210
  190.80.243.251
  190.80.50.153
  190.80.61.113
-190.81.117.218
-190.82.80.2
+190.80.97.114
+190.83.166.70
  190.83.31.2
  190.83.84.209
  190.83.84.211
-190.83.84.98
  190.84.116.32
-190.84.118.155
+190.84.119.175
  190.84.232.82
  190.85.10.147
  190.85.102.124
@@ -47179,6 +46691,7 @@
  190.85.130.174
  190.85.18.130
  190.85.186.254
+190.85.201.36
  190.85.213.51
  190.85.239.59
  190.85.34.140
@@ -47187,7 +46700,6 @@
  190.85.65.50
  190.85.67.171
  190.86.203.60
-190.88.250.85
  190.89.144.18
  190.89.28.0
  190.89.28.10
@@ -47200,6 +46712,7 @@
  190.89.28.122
  190.89.28.124
  190.89.28.131
+190.89.28.14
  190.89.28.141
  190.89.28.152
  190.89.28.154
@@ -47221,7 +46734,6 @@
  190.89.28.4
  190.89.28.48
  190.89.28.6
-190.89.28.65
  190.89.28.66
  190.89.28.69
  190.89.28.73
@@ -47243,6 +46755,7 @@
  190.90.140.55
  190.90.20.229
  190.90.20.230
+190.90.28.142
  190.90.95.12
  190.90.95.3
  190.92.46.114
@@ -47252,15 +46765,18 @@
  190.94.148.130
  190.94.18.2
  190.94.3.227
+190.95.214.178
  190.95.231.98
  190.96.117.106
  190.96.118.15
  190.96.118.251
  190.96.15.50
+190.96.172.101
  190.96.214.59
  190.97.167.214
  190.97.219.241
  190.97.219.4
+190.97.232.213
  190.97.240.82
  190.97.30.167
  190.98.37.135
@@ -47268,11 +46784,12 @@
  190.99.76.98
  191-365.net
  191.100.20.127
+191.100.20.14
  191.100.24.91
+191.100.245.222
  191.100.28.217
  191.101.109.187
  191.101.117.125
-191.101.125.4
  191.101.125.6
  191.101.166.80
  191.101.166.81
@@ -47297,49 +46814,53 @@
  191.101.39.226
  191.101.39.237
  191.101.39.29
-191.101.39.54
  191.101.39.81
-191.101.66.50
-191.101.66.60
  191.101.70.105
  191.101.76.254
-191.101.77.218
-191.101.78.158
  191.101.81.137
-191.101.82.191
  191.101.87.146
  191.101.88.51
  191.101.90.43
  191.101.95.63
-191.101.96.127
  191.101.96.140
  191.101.98.31
-191.101.99.11
-191.101.99.15
+191.102.101.83
  191.102.106.1
  191.102.120.10
+191.102.120.114
  191.102.120.117
  191.102.120.13
-191.102.120.160
+191.102.120.171
  191.102.120.175
  191.102.120.33
  191.102.120.50
  191.102.120.85
  191.102.122.180
  191.102.126.147
+191.102.130.243
  191.102.131.146
  191.102.131.181
  191.102.131.203
  191.102.131.224
+191.102.148.144
+191.102.148.183
  191.102.148.243
-191.102.150.124
-191.102.150.58
-191.102.151.136
+191.102.150.101
+191.102.150.179
+191.102.150.3
+191.102.150.37
+191.102.150.39
+191.102.150.44
+191.102.150.8
+191.102.150.87
+191.102.151.41
  191.102.153.179
-191.102.154.142
+191.102.154.118
  191.102.154.191
  191.102.154.193
+191.102.154.196
  191.102.156.19
+191.102.156.237
  191.102.164.223
  191.102.166.128
  191.102.166.14
@@ -47347,14 +46868,14 @@
  191.102.166.34
  191.102.166.39
  191.102.167.120
-191.102.167.132
  191.102.167.158
  191.102.167.199
  191.102.167.38
+191.102.188.136
  191.102.189.107
  191.102.189.191
  191.102.65.132
-191.102.78.240
+191.102.72.200
  191.102.83.167
  191.102.83.31
  191.102.88.218
@@ -47364,13 +46885,11 @@
  191.103.254.125
  191.103.254.145
  191.113.244.94
-191.125.174.94
+191.13.157.152
  191.13.251.209
  191.13.62.106
-191.143.210.64
  191.162.211.179
  191.162.211.98
-191.162.215.114
  191.162.216.124
  191.182.144.80
  191.182.6.118
@@ -47380,16 +46899,19 @@
  191.186.143.99
  191.186.80.43
  191.189.31.176
+191.19.19.4
  191.19.52.183
-191.20.191.130
  191.205.136.34
  191.205.248.196
  191.209.114.90
+191.209.157.41
  191.209.21.188
  191.209.21.39
  191.209.21.52
  191.209.88.62
+191.21.192.114
  191.217.170.33
+191.220.177.120
  191.221.251.141
  191.223.254.101
  191.223.36.170
@@ -47400,13 +46922,13 @@
  191.232.169.208
  191.232.172.50
  191.232.176.226
-191.232.197.39
  191.232.211.168
  191.232.211.83
  191.232.241.128
  191.232.246.6
  191.232.247.86
  191.232.251.219
+191.232.48.213
  191.232.54.142
  191.233.137.53
  191.233.192.40
@@ -47435,17 +46957,20 @@
  191.239.242.192
  191.239.243.104
  191.239.249.178
+191.239.251.15
  191.239.255.175
+191.240.113.137
  191.240.113.194
+191.240.126.118
  191.240.152.129
  191.240.152.132
  191.240.152.134
  191.240.154.122
  191.240.157.186
  191.240.28.25
-191.240.89.61
  191.240.99.142
-191.241.160.76
+191.241.160.131
+191.241.160.168
  191.241.226.173
  191.241.226.230
  191.241.233.198
@@ -47466,8 +46991,6 @@
  191.243.54.245
  191.243.72.2
  191.243.72.34
-191.246.74.113
-191.248.27.31
  191.250.238.185
  191.252.113.123
  191.252.205.120
@@ -47482,33 +47005,39 @@
  191.31.175.8
  191.31.18.203
  191.31.228.19
+191.31.239.92
  191.31.27.129
-191.31.5.71
+191.33.247.54
  191.34.128.108
  191.36.173.34
  191.37.0.214
  191.37.165.82
  191.37.165.84
  191.37.183.209
+191.37.203.50
  191.37.220.93
  191.37.79.238
  191.43.35.67
-191.47.236.218
  191.47.242.220
  191.5.102.13
+191.5.196.11
  191.5.55.7
  191.5.82.140
-191.53.104.154
+191.5.98.237
  191.53.112.170
  191.53.134.16
-191.53.220.237
+191.53.17.165
+191.53.195.118
+191.53.198.112
  191.53.236.119
  191.54.131.97
+191.55.190.112
+191.55.190.200
  191.55.190.63
  191.55.191.126
-191.55.191.9
+191.55.191.47
  191.55.219.32
-191.55.229.138
+191.55.219.56
  191.6.132.105
  191.6.132.126
  191.6.133.166
@@ -47520,7 +47049,6 @@
  191.6.135.90
  191.6.135.93
  191.6.60.63
-191.6.91.244
  191.6.93.191
  191.7.172.49
  191.7.192.10
@@ -47543,6 +47071,7 @@
  191.7.209.74
  191.7.211.234
  191.7.215.236
+191.8.82.194
  191.96.149.36
  191.96.164.95
  191.96.17.149
@@ -47554,22 +47083,22 @@
  191.96.249.3
  191.96.249.4
  191.96.25.226
-191.96.251.158
  191.96.253.10
  191.96.253.104
+191.96.253.109
  191.96.253.122
  191.96.253.60
  191.96.253.77
  191.96.28.147
+191.96.43.183
  191.96.52.251
  191.96.63.169
-191.96.82.220
-191.97.10.25
  191.97.11.121
  191.97.12.212
  191.97.3.195
  191.97.4.238
  191.97.53.43
+191.97.6.213
  191.97.7.165
  191.98.144.217
  191.98.177.177
@@ -47582,7 +47111,6 @@
  191.98.192.253
  191.98.192.53
  191.98.192.65
-191.98.192.75
  191.98.192.85
  191.98.193.17
  191.98.193.193
@@ -47597,7 +47125,7 @@
  191.99.160.58
  191gm.com
  192-168-1-45.000webhostapp.com
-192.0.102.194
+192.0.119.68
  192.0.91.201
  192.100.213.83
  192.109.110.108
@@ -47610,17 +47138,18 @@
  192.109.165.124
  192.109.165.129
  192.109.165.139
+192.109.165.221
  192.109.165.222
  192.109.165.239
  192.109.165.58
  192.111.129.150
  192.111.130.2
  192.111.135.21
+192.111.135.210
  192.111.137.35
  192.111.138.29
  192.111.139.165
  192.111.146.37
-192.111.152.117
  192.116.142.153
  192.117.146.110
  192.119.106.9
@@ -47633,6 +47162,7 @@
  192.119.111.47
  192.119.111.66
  192.119.111.84
+192.119.116.124
  192.119.117.111
  192.119.144.142
  192.119.151.196
@@ -47669,8 +47199,6 @@
  192.126.162.162
  192.126.162.243
  192.126.162.52
-192.126.226.195
-192.126.226.51
  192.129.186.62
  192.129.188.98
  192.129.189.115
@@ -47679,6 +47207,8 @@
  192.129.227.26
  192.129.245.69
  192.139.35.143
+192.140.145.202
+192.140.40.246
  192.140.42.28
  192.140.42.81
  192.140.42.83
@@ -47687,11 +47217,8 @@
  192.141.12.70
  192.141.129.219
  192.141.208.1
-192.142.218.11
-192.142.219.231
  192.144.104.1
  192.144.104.33
-192.144.129.98
  192.144.130.54
  192.144.138.102
  192.144.140.20
@@ -47704,7 +47231,10 @@
  192.144.171.119
  192.144.172.241
  192.144.185.202
+192.144.188.237
  192.144.190.178
+192.144.190.244
+192.144.191.17
  192.144.198.189
  192.144.204.6
  192.144.205.87
@@ -47716,7 +47246,6 @@
  192.144.218.101
  192.144.218.21
  192.144.218.38
-192.144.218.46
  192.144.227.36
  192.144.228.40
  192.144.230.43
@@ -47736,6 +47265,7 @@
  192.145.239.209
  192.145.239.210
  192.145.239.221
+192.145.239.30
  192.145.239.48
  192.145.37.92
  192.145.45.196
@@ -47747,7 +47277,6 @@
  192.154.105.21
  192.154.227.193
  192.154.228.190
-192.154.244.18
  192.155.93.237
  192.155.94.15
  192.157.201.202
@@ -47764,6 +47293,8 @@
  192.160.102.168
  192.160.102.169
  192.160.102.170
+192.160.193.94
+192.161.161.214
  192.161.165.180
  192.161.172.215
  192.161.190.171
@@ -47794,7 +47325,6 @@
  192.169.189.120
  192.169.193.54
  192.169.201.143
-192.169.201.24
  192.169.227.134
  192.169.243.124
  192.169.6.101
@@ -47804,7 +47334,6 @@
  192.169.7.120
  192.169.7.152
  192.169.7.80
-192.171.81.120
  192.171.83.115
  192.171.91.135
  192.171.91.57
@@ -47812,36 +47341,39 @@
  192.180.191.44
  192.182.157.119
  192.185.129.96
-192.185.130.170
  192.185.2.172
  192.185.4.62
+192.186.130.130
+192.186.130.134
  192.186.130.154
  192.186.131.26
  192.186.134.116
-192.186.134.122
  192.186.134.153
  192.186.134.53
  192.186.134.60
  192.186.134.92
-192.186.134.94
  192.186.143.22
+192.186.145.115
+192.186.145.30
  192.186.145.51
  192.186.145.58
  192.186.145.62
-192.186.153.183
-192.186.153.185
+192.186.153.182
  192.186.153.233
  192.186.153.234
  192.186.153.235
  192.186.157.77
  192.186.158.74
  192.186.161.141
+192.186.161.142
  192.186.161.194
-192.186.161.227
  192.186.163.125
  192.186.168.230
  192.186.171.133
+192.186.171.134
  192.186.171.135
+192.186.171.140
+192.186.171.142
  192.186.171.156
  192.186.171.237
  192.186.171.28
@@ -47854,14 +47386,13 @@
  192.186.180.146
  192.186.180.151
  192.186.180.157
-192.186.180.252
-192.186.182.31
+192.186.182.11
  192.186.182.32
  192.186.182.46
+192.186.182.55
  192.186.182.73
  192.186.182.75
  192.186.190.148
-192.187.102.10
  192.187.109.250
  192.187.110.198
  192.187.121.46
@@ -47869,7 +47400,6 @@
  192.187.125.75
  192.187.126.42
  192.187.99.194
-192.187.99.90
  192.188.2.58
  192.190.170.45
  192.190.19.6
@@ -47886,9 +47416,9 @@
  192.198.118.180
  192.198.119.20
  192.198.119.30
-192.198.119.52
-192.198.119.56
+192.198.119.61
  192.198.119.92
+192.198.122.252
  192.198.122.254
  192.198.125.144
  192.198.125.50
@@ -47906,25 +47436,26 @@
  192.198.98.54
  192.198.98.57
  192.198.98.58
+192.198.98.61
  192.199.53.131
  192.200.122.226
  192.200.192.2
  192.200.215.162
  192.200.215.90
  192.204.197.190
-192.210.135.126
  192.210.140.199
+192.210.150.182
  192.210.163.110
  192.210.163.149
  192.210.181.231
  192.210.185.104
  192.210.185.117
  192.210.185.125
-192.210.185.126
  192.210.185.192
  192.210.185.216
  192.210.185.75
  192.210.185.98
+192.210.191.163
  192.210.195.23
  192.210.200.206
  192.210.200.207
@@ -47939,7 +47470,7 @@
  192.210.226.106
  192.210.226.125
  192.210.228.229
-192.210.230.137
+192.210.229.116
  192.210.230.140
  192.210.231.101
  192.210.236.38
@@ -47959,7 +47490,8 @@
  192.227.137.250
  192.227.137.251
  192.227.137.253
-192.227.138.100
+192.227.138.105
+192.227.138.106
  192.227.138.117
  192.227.138.121
  192.227.138.125
@@ -47970,7 +47502,7 @@
  192.227.138.244
  192.227.138.250
  192.227.138.78
-192.227.139.213
+192.227.138.88
  192.227.152.136
  192.227.152.253
  192.227.158.103
@@ -47982,34 +47514,29 @@
  192.227.158.61
  192.227.159.102
  192.227.171.45
-192.227.172.139
+192.227.171.56
  192.227.176.61
  192.227.180.108
  192.227.180.110
  192.227.180.55
-192.227.180.62
-192.227.180.65
  192.227.180.90
+192.227.207.14
  192.227.207.84
  192.227.207.90
-192.227.209.203
  192.227.209.212
  192.227.209.213
  192.227.209.228
  192.227.209.239
  192.227.211.39
-192.227.211.51
+192.227.211.48
+192.227.211.57
  192.227.212.226
  192.227.214.146
  192.227.215.147
  192.227.215.66
-192.227.215.74
  192.227.215.77
-192.227.216.130
-192.227.216.39
  192.227.217.112
  192.227.217.122
-192.227.219.203
  192.227.232.83
  192.227.233.8
  192.227.238.209
@@ -48024,8 +47551,6 @@
  192.227.253.235
  192.227.69.80
  192.227.80.83
-192.228.100.100
-192.228.100.222
  192.228.100.250
  192.228.107.187
  192.232.204.242
@@ -48047,7 +47572,6 @@
  192.236.160.24
  192.236.161.206
  192.236.161.98
-192.236.162.179
  192.236.162.32
  192.236.162.48
  192.236.163.200
@@ -48068,6 +47592,7 @@
  192.236.236.74
  192.240.150.133
  192.241.105.182
+192.241.106.66
  192.241.106.69
  192.241.106.71
  192.241.106.86
@@ -48094,7 +47619,6 @@
  192.241.145.8
  192.241.146.155
  192.241.146.84
-192.241.147.184
  192.241.147.98
  192.241.148.219
  192.241.150.222
@@ -48112,14 +47636,15 @@
  192.241.162.69
  192.241.165.72
  192.241.167.114
+192.241.169.184
  192.241.171.169
  192.241.172.229
+192.241.172.234
  192.241.173.142
  192.241.173.157
  192.241.173.18
  192.241.174.101
  192.241.174.106
-192.241.174.114
  192.241.174.44
  192.241.175.149
  192.241.175.203
@@ -48130,7 +47655,6 @@
  192.241.182.13
  192.241.182.61
  192.241.183.101
-192.241.184.22
  192.241.184.220
  192.241.185.120
  192.241.185.214
@@ -48143,7 +47667,7 @@
  192.241.198.37
  192.241.200.176
  192.241.200.243
-192.241.200.41
+192.241.200.27
  192.241.201.157
  192.241.201.181
  192.241.201.227
@@ -48157,46 +47681,45 @@
  192.241.209.221
  192.241.210.14
  192.241.210.178
-192.241.211.126
  192.241.211.78
  192.241.213.38
-192.241.214.34
+192.241.214.123
  192.241.215.116
  192.241.215.124
  192.241.215.188
  192.241.215.189
-192.241.216.41
+192.241.216.210
  192.241.216.90
  192.241.217.147
  192.241.217.190
  192.241.217.60
-192.241.217.61
  192.241.218.151
+192.241.218.190
  192.241.218.229
  192.241.218.40
-192.241.218.42
-192.241.218.58
  192.241.218.69
  192.241.219.158
+192.241.220.15
  192.241.220.155
-192.241.220.171
  192.241.220.183
  192.241.220.227
  192.241.221.112
+192.241.221.29
  192.241.221.76
-192.241.222.110
  192.241.222.158
  192.241.222.89
+192.241.223.138
+192.241.223.182
  192.241.223.212
  192.241.223.235
-192.241.223.25
+192.241.223.49
  192.241.224.105
  192.241.224.33
-192.241.224.66
  192.241.224.78
  192.241.225.11
  192.241.225.203
  192.241.225.38
+192.241.225.68
  192.241.226.82
  192.241.227.59
  192.241.229.67
@@ -48214,25 +47737,24 @@
  192.241.255.117
  192.241.255.77
  192.241.64.114
+192.241.64.243
  192.241.64.245
-192.241.64.249
  192.241.64.26
  192.241.64.3
  192.241.64.30
  192.241.64.86
-192.241.64.91
-192.241.64.92
  192.241.65.35
  192.241.70.54
  192.241.73.198
  192.241.80.139
  192.241.80.158
-192.241.80.161
+192.241.80.170
  192.241.80.175
  192.241.80.197
  192.241.80.22
  192.241.80.254
  192.241.84.117
+192.241.98.88
  192.243.100.114
  192.243.102.171
  192.243.114.21
@@ -48517,8 +48039,9 @@
  192.252.213.182
  192.252.215.2
  192.252.215.5
+192.252.222.35
+192.252.222.36
  192.252.222.38
-192.252.233.27
  192.253.243.25
  192.253.245.222
  192.253.253.45
@@ -48530,13 +48053,14 @@
  192.3.100.249
  192.3.103.251
  192.3.105.118
+192.3.105.122
+192.3.105.91
  192.3.11.20
  192.3.11.24
  192.3.11.73
  192.3.111.182
  192.3.12.113
  192.3.120.51
-192.3.120.53
  192.3.122.100
  192.3.124.189
  192.3.124.40
@@ -48545,16 +48069,17 @@
  192.3.136.75
  192.3.139.145
  192.3.139.159
+192.3.139.173
  192.3.139.56
  192.3.139.71
+192.3.139.90
  192.3.140.202
+192.3.141.122
  192.3.141.134
  192.3.141.139
-192.3.142.125
  192.3.142.214
  192.3.142.83
  192.3.143.133
-192.3.143.178
  192.3.143.188
  192.3.147.218
  192.3.147.227
@@ -48565,9 +48090,7 @@
  192.3.180.191
  192.3.180.237
  192.3.180.251
-192.3.181.221
  192.3.185.210
-192.3.185.27
  192.3.185.29
  192.3.188.105
  192.3.188.115
@@ -48576,6 +48099,7 @@
  192.3.188.124
  192.3.188.205
  192.3.188.251
+192.3.188.80
  192.3.188.97
  192.3.193.251
  192.3.194.169
@@ -48586,6 +48110,7 @@
  192.3.203.55
  192.3.203.61
  192.3.207.170
+192.3.208.126
  192.3.208.127
  192.3.208.190
  192.3.208.68
@@ -48596,23 +48121,27 @@
  192.3.214.2
  192.3.214.29
  192.3.214.5
+192.3.214.55
  192.3.214.58
  192.3.215.247
  192.3.22.50
  192.3.23.41
-192.3.240.199
-192.3.240.200
+192.3.233.229
  192.3.240.232
+192.3.242.147
  192.3.247.112
  192.3.247.119
  192.3.25.135
  192.3.251.67
+192.3.253.49
  192.3.255.142
  192.3.255.169
  192.3.26.105
  192.3.28.114
-192.3.28.238
  192.3.28.245
+192.3.28.246
+192.3.28.36
+192.3.28.59
  192.3.31.212
  192.3.31.213
  192.3.31.219
@@ -48633,11 +48162,13 @@
  192.34.58.174
  192.34.58.211
  192.34.59.22
-192.34.60.204
+192.34.61.86
  192.34.62.193
  192.34.62.208
  192.34.80.176
+192.35.168.32
  192.35.168.64
+192.35.168.96
  192.36.27.4
  192.40.95.118
  192.40.95.121
@@ -48652,7 +48183,6 @@
  192.40.95.32
  192.40.95.38
  192.40.95.42
-192.40.95.45
  192.40.95.6
  192.40.95.87
  192.40.95.94
@@ -48678,7 +48208,7 @@
  192.43.209.197
  192.44.77.205
  192.46.223.151
-192.46.231.240
+192.46.225.80
  192.46.232.37
  192.46.237.154
  192.52.166.9
@@ -48693,7 +48223,6 @@
  192.64.114.84
  192.64.118.132
  192.64.52.124
-192.64.80.135
  192.65.170.15
  192.69.180.182
  192.69.235.189
@@ -48724,20 +48253,19 @@
  192.81.223.236
  192.81.38.31
  192.82.64.219
+192.82.67.215
  192.82.76.215
-192.92.97.227
-192.92.97.230
  192.95.12.175
  192.95.18.190
  192.95.2.165
  192.95.24.39
  192.95.29.218
  192.95.29.97
-192.95.30.137
  192.95.30.185
  192.95.30.65
  192.95.31.71
  192.95.31.9
+192.95.36.221
  192.95.36.229
  192.95.37.160
  192.95.49.93
@@ -48745,7 +48273,6 @@
  192.96.206.186
  192.96.206.197
  192.96.24.1
-192.99.0.98
  192.99.1.38
  192.99.101.152
  192.99.11.13
@@ -48778,7 +48305,6 @@
  192.99.167.221
  192.99.168.9
  192.99.169.223
-192.99.174.110
  192.99.184.200
  192.99.19.154
  192.99.2.41
@@ -48795,14 +48321,13 @@
  192.99.35.135
  192.99.35.149
  192.99.36.177
-192.99.4.179
  192.99.4.59
  192.99.4.63
  192.99.42.246
+192.99.44.151
  192.99.47.10
  192.99.47.125
  192.99.5.123
-192.99.5.14
  192.99.5.94
  192.99.55.64
  192.99.70.54
@@ -48811,7 +48336,6 @@
  192.99.8.102
  192.99.8.157
  192.99.83.47
-192.99.98.209
  192.99.98.86
  1929128.servicesbpd.club
  192mobility0040.info
@@ -48826,10 +48350,8 @@
  193.105.206.253
  193.105.62.11
  193.105.7.24
-193.105.83.6
  193.106.130.249
  193.106.175.103
-193.106.229.186
  193.106.231.145
  193.106.28.8
  193.106.29.2
@@ -48848,10 +48370,12 @@
  193.107.236.167
  193.107.48.3
  193.107.75.42
-193.107.76.146
-193.107.76.211
  193.107.76.220
  193.107.76.242
+193.107.76.244
+193.107.77.29
+193.107.77.45
+193.107.77.72
  193.107.85.56
  193.108.249.107
  193.109.140.14
@@ -48865,13 +48389,12 @@
  193.111.152.71
  193.111.156.2
  193.111.38.178
-193.111.4.165
+193.111.4.157
  193.112.1.26
  193.112.100.26
  193.112.102.52
  193.112.102.75
  193.112.108.11
-193.112.108.135
  193.112.109.108
  193.112.110.35
  193.112.111.207
@@ -48883,7 +48406,6 @@
  193.112.140.108
  193.112.144.168
  193.112.16.245
-193.112.160.226
  193.112.160.70
  193.112.162.48
  193.112.169.87
@@ -48893,12 +48415,10 @@
  193.112.191.228
  193.112.192.63
  193.112.195.121
-193.112.196.101
  193.112.201.103
  193.112.202.61
  193.112.203.134
  193.112.208.73
-193.112.209.128
  193.112.213.187
  193.112.213.227
  193.112.213.248
@@ -48941,15 +48461,16 @@
  193.122.134.181
  193.122.144.192
  193.122.163.242
+193.122.2.165
  193.124.136.211
  193.124.181.169
  193.124.182.77
-193.124.183.165
  193.124.183.187
  193.125.67.164
  193.135.153.242
  193.135.9.84
  193.137.208.199
+193.138.194.190
  193.138.204.251
  193.138.218.162
  193.138.218.222
@@ -48979,15 +48500,13 @@
  193.149.225.228
  193.15.16.4
  193.150.121.66
-193.150.13.100
  193.150.13.106
  193.150.153.32
  193.150.170.204
  193.150.233.115
  193.151.12.117
  193.151.98.112
-193.154.222.77
-193.159.131.215
+193.159.138.244
  193.160.10.242
  193.164.131.14
  193.164.131.223
@@ -49000,6 +48519,8 @@
  193.164.94.244
  193.164.94.246
  193.168.147.25
+193.168.152.254
+193.168.177.213
  193.169.145.194
  193.169.145.202
  193.169.145.66
@@ -49028,10 +48549,13 @@
  193.169.253.69
  193.169.254.116
  193.169.254.63
+193.169.255.205
  193.169.5.14
  193.169.61.162
  193.17.184.250
+193.17.195.84
  193.176.186.145
+193.176.186.218
  193.176.186.238
  193.176.186.41
  193.176.186.51
@@ -49044,7 +48568,7 @@
  193.176.85.87
  193.176.86.108
  193.178.169.252
-193.183.216.28
+193.183.246.194
  193.188.254.67
  193.189.117.189
  193.189.117.243
@@ -49060,12 +48584,14 @@
  193.190.253.145
  193.192.122.65
  193.193.194.194
+193.193.224.170
  193.193.240.34
  193.193.240.36
  193.193.71.178
  193.194.149.203
  193.194.69.114
  193.194.69.36
+193.194.69.98
  193.194.77.194
  193.194.80.6
  193.194.82.217
@@ -49075,6 +48601,7 @@
  193.196.39.26
  193.196.39.5
  193.196.39.95
+193.198.168.245
  193.198.17.206
  193.198.34.24
  193.198.68.178
@@ -49089,6 +48616,7 @@
  193.201.227.83
  193.202.80.146
  193.202.82.61
+193.210.224.12
  193.213.89.72
  193.216.178.70
  193.218.118.100
@@ -49122,7 +48650,6 @@
  193.228.57.194
  193.228.58.132
  193.228.58.151
-193.228.58.164
  193.228.58.170
  193.228.58.177
  193.228.58.191
@@ -49144,6 +48671,7 @@
  193.228.91.124
  193.231.187.33
  193.232.117.129
+193.233.14.18
  193.233.6.156
  193.233.9.167
  193.234.224.132
@@ -49160,6 +48688,7 @@
  193.239.147.118
  193.239.147.125
  193.239.147.139
+193.239.147.146
  193.239.147.192
  193.239.147.195
  193.239.147.22
@@ -49167,6 +48696,7 @@
  193.239.147.229
  193.239.147.34
  193.239.147.52
+193.239.147.56
  193.239.147.66
  193.239.147.84
  193.239.186.138
@@ -49186,21 +48716,21 @@
  193.243.164.60
  193.247.213.196
  193.248.180.212
-193.248.188.227
  193.248.247.215
  193.25.197.129
+193.25.253.19
  193.251.6.236
  193.252.149.16
-193.252.189.37
  193.252.54.240
  193.252.8.76
  193.254.184.188
+193.26.156.69
  193.26.159.199
  193.27.13.180
  193.27.19.92
  193.27.228.164
-193.27.229.200
  193.27.229.219
+193.27.229.86
  193.27.23.83
  193.29.106.108
  193.29.107.249
@@ -49208,6 +48738,7 @@
  193.29.14.105
  193.29.14.113
  193.29.14.122
+193.29.14.123
  193.29.14.126
  193.29.14.132
  193.29.14.133
@@ -49223,12 +48754,9 @@
  193.30.121.100
  193.30.123.70
  193.30.246.136
-193.31.127.140
-193.31.127.215
  193.31.24.154
  193.32.126.161
  193.32.126.162
-193.32.127.215
  193.32.129.34
  193.32.129.36
  193.32.161.77
@@ -49242,9 +48770,8 @@
  193.34.55.64
  193.34.8.49
  193.34.93.221
+193.36.116.71
  193.36.15.173
-193.36.225.22
-193.36.225.37
  193.36.225.45
  193.37.152.138
  193.37.192.243
@@ -49255,19 +48782,18 @@
  193.37.215.67
  193.37.252.231
  193.37.255.114
+193.37.33.197
  193.38.51.25
-193.38.55.24
  193.39.185.214
-193.39.245.144
  193.40.10.82
  193.41.114.13
-193.41.114.8
+193.41.114.51
  193.41.122.18
  193.41.122.34
-193.41.123.3
  193.41.86.136
+193.41.86.150
  193.41.86.162
-193.41.87.171
+193.41.87.231
  193.41.87.243
  193.42.110.30
  193.42.122.25
@@ -49280,7 +48806,6 @@
  193.46.2.17
  193.46.202.3
  193.47.69.8
-193.47.69.95
  193.53.168.218
  193.56.240.213
  193.56.252.231
@@ -49299,25 +48824,21 @@
  193.56.28.205
  193.56.28.242
  193.56.28.33
-193.56.28.36
  193.56.29.102
  193.56.29.104
-193.56.29.106
  193.56.29.22
  193.56.29.23
  193.56.29.251
-193.56.29.29
  193.56.29.36
+193.56.29.41
  193.56.29.44
-193.57.40.55
-193.58.168.177
+193.56.64.51
  193.58.169.203
  193.58.196.212
  193.59.26.243
  193.59.26.248
  193.59.26.46
  193.59.27.83
-193.61.86.38
  193.68.19.34
  193.68.200.227
  193.68.41.17
@@ -49340,9 +48861,10 @@
  193.70.84.113
  193.70.88.213
  193.70.91.79
+193.77.117.97
  193.77.159.82
  193.77.242.110
-193.8.231.8
+193.8.215.12
  193.8.83.234
  193.83.42.124
  193.84.116.22
@@ -49351,12 +48873,14 @@
  193.85.228.178
  193.85.228.182
  193.86.118.16
+193.87.1.94
  193.87.81.18
  193.87.81.20
  193.87.99.18
  193.9.114.250
  193.9.115.120
  193.9.115.122
+193.9.115.123
  193.9.158.112
  193.9.158.156
  193.9.158.43
@@ -49375,21 +48899,21 @@
  193.93.192.223
  193.93.192.46
  193.93.193.106
-193.93.193.119
  193.93.193.129
  193.93.193.189
  193.93.193.51
  193.93.194.183
-193.93.195.118
+193.93.194.98
  193.93.216.63
  193.93.219.102
  193.95.228.13
+193.95.24.114
+193.95.78.209
  193.95.81.121
  1933611911.findprofile.net.pl
  19399.wang
  194-58-108-245.ovz.vps.regruhosting.ru
  194.0.157.1
-194.0.157.102
  194.0.163.116
  194.1.221.244
  194.1.247.250
@@ -49404,16 +48928,17 @@
  194.106.99.119
  194.109.20.68
  194.11.225.53
-194.110.114.122
  194.110.114.78
+194.110.115.198
+194.110.115.21
  194.110.115.211
  194.110.115.217
  194.110.115.230
  194.110.84.105
-194.110.84.113
-194.110.84.179
  194.113.107.233
+194.118.33.81
  194.12.121.100
+194.12.84.171
  194.124.213.78
  194.124.251.18
  194.124.50.69
@@ -49422,7 +48947,6 @@
  194.126.113.130
  194.126.113.135
  194.126.183.171
-194.127.172.77
  194.127.172.92
  194.127.179.119
  194.135.135.69
@@ -49443,16 +48967,18 @@
  194.143.151.96
  194.143.194.107
  194.143.229.6
+194.143.248.132
  194.143.248.163
  194.143.248.176
  194.143.248.96
+194.143.249.113
  194.143.249.180
+194.143.249.226
  194.143.249.229
+194.143.249.65
  194.143.249.78
-194.143.249.91
-194.143.250.100
-194.143.250.188
  194.143.250.195
+194.143.250.230
  194.143.250.242
  194.143.250.53
  194.143.251.185
@@ -49461,7 +48987,6 @@
  194.143.251.243
  194.143.251.42
  194.143.251.49
-194.143.251.63
  194.143.251.64
  194.145.175.76
  194.145.199.26
@@ -49472,27 +48997,23 @@
  194.147.115.84
  194.147.115.86
  194.147.115.95
-194.147.140.101
-194.147.140.102
  194.147.140.107
  194.147.140.109
-194.147.140.22
  194.147.140.24
  194.147.140.25
  194.147.140.32
  194.147.140.40
  194.147.140.41
-194.147.140.48
-194.147.140.50
-194.147.140.52
+194.147.140.46
+194.147.140.47
+194.147.140.49
+194.147.140.51
+194.147.140.53
  194.147.140.61
-194.147.140.64
-194.147.140.65
  194.147.140.88
  194.147.140.94
  194.147.34.66
  194.147.34.74
-194.147.35.224
  194.15.36.10
  194.15.36.102
  194.15.36.104
@@ -49526,64 +49047,57 @@
  194.15.36.96
  194.15.36.97
  194.150.118.7
-194.150.214.114
-194.150.214.119
  194.150.214.120
  194.150.214.122
+194.150.214.124
+194.150.214.130
  194.150.214.133
-194.150.214.135
  194.150.214.136
  194.150.214.138
  194.150.214.142
  194.150.215.101
-194.150.215.108
  194.150.215.109
  194.150.215.115
-194.150.215.116
-194.150.215.117
  194.150.215.124
  194.150.215.125
-194.150.215.130
  194.150.215.131
-194.150.215.132
  194.150.215.133
-194.150.215.135
  194.150.215.152
  194.150.215.177
+194.150.215.23
  194.150.215.34
-194.150.215.35
-194.150.215.40
-194.150.215.41
-194.150.215.45
+194.150.215.36
+194.150.215.55
  194.150.215.56
  194.150.215.60
+194.150.215.64
  194.150.215.67
  194.150.215.70
  194.150.215.97
-194.150.215.99
  194.150.235.150
  194.150.235.165
-194.150.235.171
+194.150.235.167
  194.150.235.173
-194.150.235.180
  194.150.235.182
  194.150.235.184
  194.150.235.187
  194.150.235.188
  194.150.235.189
+194.150.235.223
  194.150.235.224
  194.150.235.225
  194.150.235.228
  194.150.235.229
+194.150.235.231
+194.150.235.233
+194.150.235.234
  194.150.235.237
  194.150.235.238
+194.150.235.239
  194.150.235.241
-194.150.235.243
  194.150.235.247
-194.150.235.249
  194.150.235.250
-194.150.235.82
-194.150.235.85
+194.150.235.31
  194.150.253.204
  194.150.255.200
  194.152.206.103
@@ -49607,6 +49121,7 @@
  194.156.175.65
  194.156.95.223
  194.156.95.245
+194.156.97.147
  194.156.97.183
  194.156.97.193
  194.158.201.236
@@ -49641,8 +49156,9 @@
  194.182.160.70
  194.182.72.214
  194.183.15.230
+194.183.168.129
  194.183.170.59
-194.183.174.14
+194.183.186.184
  194.183.244.147
  194.186.138.214
  194.186.168.50
@@ -49682,23 +49198,23 @@
  194.190.67.75
  194.190.93.136
  194.190.96.114
+194.191.230.133
  194.201.253.190
  194.201.253.5
  194.204.194.11
-194.206.36.150
  194.208.43.43
  194.213.43.166
  194.219.62.23
  194.225.58.214
  194.226.61.18
  194.226.61.26
+194.228.11.148
  194.228.129.189
  194.228.84.10
  194.244.16.53
  194.244.16.58
  194.246.105.27
  194.250.240.160
-194.250.91.157
  194.254.163.71
  194.26.180.142
  194.26.25.147
@@ -49707,8 +49223,8 @@
  194.28.112.12
  194.28.222.1
  194.28.223.242
+194.28.34.88
  194.31.168.253
-194.31.54.3
  194.32.229.12
  194.32.229.123
  194.32.237.152
@@ -49716,9 +49232,8 @@
  194.32.76.210
  194.32.79.210
  194.34.248.155
-194.35.113.156
  194.35.12.125
-194.35.233.43
+194.35.233.46
  194.35.248.23
  194.36.167.122
  194.36.167.37
@@ -49737,18 +49252,16 @@
  194.36.98.75
  194.36.99.132
  194.36.99.7
-194.37.81.239
  194.37.81.243
  194.38.123.211
  194.38.146.73
  194.39.127.40
+194.39.196.13
  194.4.58.192
  194.4.58.215
  194.42.16.25
  194.44.146.181
-194.44.172.254
  194.44.20.22
-194.44.20.28
  194.44.230.115
  194.44.230.122
  194.44.230.135
@@ -49765,7 +49278,6 @@
  194.5.159.197
  194.5.176.112
  194.5.177.111
-194.5.177.174
  194.5.177.98
  194.5.178.148
  194.5.193.13
@@ -49790,7 +49302,6 @@
  194.61.24.29
  194.61.53.41
  194.61.54.51
-194.61.9.144
  194.62.1.123
  194.62.6.156
  194.62.6.190
@@ -49802,7 +49313,6 @@
  194.67.90.178
  194.68.225.68
  194.68.27.32
-194.68.44.163
  194.71.130.93
  194.72.112.130
  194.79.157.171
@@ -49848,6 +49358,7 @@
  194.87.94.145
  194.88.107.222
  194.88.107.53
+194.88.143.18
  194.9.177.10
  194.9.177.13
  194.9.178.16
@@ -49857,7 +49368,6 @@
  194.90.160.133
  194.90.73.231
  194.99.20.29
-195.101.67.42
  195.103.51.22
  195.110.147.194
  195.110.35.115
@@ -49867,14 +49377,12 @@
  195.112.252.180
  195.112.64.53
  195.114.121.46
-195.114.19.59
  195.114.9.19
  195.117.107.182
  195.117.107.190
  195.117.193.1
  195.117.56.56
  195.12.49.210
-195.120.185.218
  195.122.226.164
  195.123.188.186
  195.123.209.106
@@ -49882,6 +49390,7 @@
  195.123.225.23
  195.123.233.21
  195.123.234.33
+195.123.237.100
  195.123.237.110
  195.123.240.236
  195.123.242.97
@@ -49894,10 +49403,10 @@
  195.128.174.132
  195.13.201.98
  195.130.152.71
-195.130.197.37
  195.130.73.229
  195.133.197.78
  195.133.220.18
+195.133.56.165
  195.135.194.8
  195.136.10.1
  195.136.10.253
@@ -49905,7 +49414,9 @@
  195.137.140.179
  195.137.74.2
  195.138.73.54
+195.138.82.198
  195.138.83.218
+195.138.87.163
  195.138.90.121
  195.138.91.220
  195.138.92.152
@@ -49915,7 +49426,6 @@
  195.140.232.216
  195.141.179.119
  195.141.234.38
-195.142.222.154
  195.144.205.25
  195.144.21.161
  195.144.21.219
@@ -49934,6 +49444,7 @@
  195.154.107.28
  195.154.111.146
  195.154.112.155
+195.154.113.130
  195.154.113.90
  195.154.114.115
  195.154.114.117
@@ -49959,6 +49470,7 @@
  195.154.183.162
  195.154.184.174
  195.154.185.20
+195.154.185.7
  195.154.187.115
  195.154.187.6
  195.154.188.9
@@ -49989,7 +49501,6 @@
  195.154.223.131
  195.154.225.16
  195.154.233.102
-195.154.237.166
  195.154.240.184
  195.154.241.208
  195.154.242.189
@@ -49999,16 +49510,15 @@
  195.154.251.15
  195.154.251.86
  195.154.255.110
+195.154.26.192
  195.154.29.215
  195.154.33.70
  195.154.40.254
  195.154.41.150
-195.154.42.133
  195.154.42.43
  195.154.43.1
  195.154.43.44
  195.154.45.133
-195.154.49.222
  195.154.49.84
  195.154.50.29
  195.154.50.81
@@ -50024,6 +49534,7 @@
  195.158.248.44
  195.158.26.238
  195.158.28.62
+195.158.3.198
  195.158.5.11
  195.158.8.206
  195.159.180.19
@@ -50036,6 +49547,7 @@
  195.161.114.231
  195.161.2.66
  195.162.4.15
+195.162.4.35
  195.162.4.5
  195.162.4.60
  195.162.4.8
@@ -50049,8 +49561,8 @@
  195.176.3.20
  195.176.3.23
  195.176.3.24
+195.177.95.153
  195.178.106.145
-195.178.56.33
  195.18.224.6
  195.18.33.130
  195.181.128.156
@@ -50059,9 +49571,9 @@
  195.181.170.69
  195.181.170.74
  195.181.172.78
-195.181.175.106
+195.181.173.201
+195.181.198.178
  195.181.215.65
-195.181.37.52
  195.182.131.101
  195.182.152.238
  195.186.64.163
@@ -50076,8 +49588,8 @@
  195.190.166.35
  195.191.214.118
  195.191.32.134
+195.192.229.73
  195.199.151.131
-195.2.92.155
  195.2.92.46
  195.2.93.50
  195.20.133.161
@@ -50094,15 +49606,11 @@
  195.201.171.162
  195.201.202.225
  195.201.217.17
-195.201.22.197
-195.201.22.232
-195.201.236.56
+195.201.236.57
  195.201.236.61
  195.201.236.64
  195.201.24.22
  195.201.240.107
-195.201.25.135
-195.201.25.183
  195.201.56.56
  195.201.56.70
  195.201.71.60
@@ -50113,21 +49621,22 @@
  195.202.169.149
  195.204.173.39
  195.205.173.1
+195.205.179.14
+195.205.179.18
  195.205.179.251
-195.205.179.73
+195.205.179.85
  195.206.105.217
  195.206.105.27
  195.206.105.42
  195.206.106.73
  195.206.107.147
  195.206.169.184
-195.206.183.122
+195.206.183.142
  195.206.34.215
  195.206.36.25
  195.206.55.154
  195.207.15.79
  195.208.17.70
-195.208.170.75
  195.209.131.19
  195.209.236.77
  195.21.141.52
@@ -50143,15 +49652,18 @@
  195.211.160.88
  195.211.161.124
  195.211.219.47
+195.211.240.171
  195.211.30.115
  195.211.84.104
  195.214.214.253
  195.214.223.84
+195.214.231.45
  195.214.252.110
  195.214.253.108
-195.216.155.103
-195.216.155.56
-195.216.155.66
+195.216.155.102
+195.216.155.138
+195.216.155.54
+195.216.155.79
  195.216.160.149
  195.216.214.27
  195.218.174.50
@@ -50159,8 +49671,10 @@
  195.22.117.1
  195.22.153.174
  195.22.153.177
+195.22.157.108
  195.22.239.150
  195.22.239.238
+195.22.251.13
  195.22.253.234
  195.22.253.238
  195.22.28.35
@@ -50183,6 +49697,7 @@
  195.225.49.134
  195.225.49.136
  195.226.207.109
+195.226.207.53
  195.226.227.73
  195.228.133.203
  195.228.148.10
@@ -50197,7 +49712,6 @@
  195.230.141.68
  195.230.154.2
  195.231.8.43
-195.231.81.208
  195.231.82.44
  195.234.171.80
  195.234.215.26
@@ -50216,7 +49730,6 @@
  195.239.26.38
  195.239.48.166
  195.239.7.18
-195.239.91.210
  195.24.129.234
  195.24.207.199
  195.24.49.142
@@ -50225,7 +49738,6 @@
  195.242.145.147
  195.242.145.49
  195.244.209.70
-195.244.215.150
  195.244.36.65
  195.245.112.235
  195.246.120.126
@@ -50239,7 +49751,6 @@
  195.246.120.162
  195.246.120.163
  195.246.120.164
-195.246.120.165
  195.246.120.166
  195.246.120.171
  195.246.120.174
@@ -50254,6 +49765,7 @@
  195.254.134.10
  195.254.134.194
  195.254.135.76
+195.28.11.29
  195.28.56.56
  195.29.102.29
  195.29.102.42
@@ -50270,21 +49782,18 @@
  195.3.144.92
  195.3.195.8
  195.32.106.250
-195.33.206.179
  195.33.206.195
  195.33.246.1
  195.34.221.33
  195.34.221.81
  195.34.242.131
  195.34.78.110
-195.36.209.249
  195.37.209.9
  195.38.35.58
  195.38.98.224
  195.39.114.210
  195.39.211.250
  195.39.243.197
-195.4.128.37
  195.46.105.233
  195.46.20.146
  195.47.243.254
@@ -50292,9 +49801,9 @@
  195.5.246.162
  195.53.165.150
  195.53.237.122
-195.53.49.11
  195.54.160.134
  195.54.160.20
+195.54.160.223
  195.54.161.122
  195.54.162.38
  195.54.163.83
@@ -50312,7 +49821,6 @@
  195.62.16.111
  195.62.32.188
  195.62.32.218
-195.62.46.153
  195.62.53.253
  195.67.139.54
  195.69.135.78
@@ -50326,6 +49834,7 @@
  195.70.32.203
  195.70.60.100
  195.78.112.235
+195.78.93.28
  195.78.94.193
  195.8.105.201
  195.8.51.55
@@ -50337,6 +49846,7 @@
  195.81.66.65
  195.82.116.230
  195.83.197.222
+195.85.219.5
  195.86.221.36
  195.86.221.37
  195.86.221.42
@@ -50345,7 +49855,6 @@
  195.86.221.45
  195.86.221.46
  195.88.121.112
-195.88.152.77
  195.88.184.186
  195.88.208.35
  195.88.209.156
@@ -50361,6 +49870,7 @@
  195.9.89.68
  195.9.89.70
  195.91.186.78
+195.91.48.25
  195.95.131.211
  195.95.131.214
  195.95.131.215
@@ -50374,12 +49884,11 @@
  196.0.111.186
  196.0.111.194
  196.0.113.10
-196.0.34.142
+196.0.113.110
  196.0.58.214
-196.1.238.130
  196.1.238.2
  196.1.238.58
-196.1.250.74
+196.10.94.244
  196.11.80.154
  196.112.9.69
  196.12.186.34
@@ -50393,15 +49902,13 @@
  196.15.249.151
  196.16.1.193
  196.16.11.189
-196.16.170.244
+196.16.12.22
+196.16.160.148
+196.16.180.254
  196.16.234.68
-196.16.243.2
  196.17.161.116
  196.17.162.116
  196.17.163.208
-196.17.236.20
-196.17.240.15
-196.179.227.47
  196.179.232.49
  196.18.157.252
  196.18.225.232
@@ -50412,20 +49919,22 @@
  196.181.184.191
  196.183.230.199
  196.184.35.117
+196.188.176.195
  196.188.73.98
  196.189.91.162
  196.189.91.166
  196.19.244.53
  196.19.244.83
+196.190.154.211
+196.190.154.213
+196.191.228.115
  196.192.181.235
-196.196.112.3
  196.196.116.69
  196.196.116.95
  196.196.117.102
+196.196.117.106
  196.196.117.122
-196.196.147.155
  196.196.147.167
-196.196.147.171
  196.196.147.205
  196.196.147.219
  196.196.147.232
@@ -50433,7 +49942,6 @@
  196.196.147.254
  196.196.147.88
  196.196.148.116
-196.196.148.127
  196.196.148.130
  196.196.148.136
  196.196.148.23
@@ -50457,25 +49965,26 @@
  196.196.216.170
  196.196.220.249
  196.196.222.6
-196.196.224.21
-196.196.255.254
+196.196.222.80
+196.196.246.157
+196.196.34.149
  196.196.34.159
+196.196.34.53
  196.196.39.162
  196.196.39.200
+196.196.47.106
  196.196.47.135
  196.196.47.144
-196.196.47.186
  196.196.47.237
  196.196.50.117
  196.196.50.130
  196.196.50.162
  196.196.50.41
  196.199.122.101
-196.199.122.11
  196.199.122.124
  196.199.122.200
+196.199.122.221
  196.199.122.233
-196.199.122.241
  196.199.122.243
  196.199.122.245
  196.199.122.34
@@ -50483,24 +49992,19 @@
  196.199.122.55
  196.199.122.7
  196.2.13.12
-196.20.171.13
  196.20.68.81
+196.200.16.88
  196.200.181.2
  196.200.39.184
  196.201.224.30
-196.202.152.18
  196.202.202.197
  196.202.220.95
  196.203.182.166
  196.203.219.138
-196.203.251.14
  196.204.230.226
-196.206.227.105
  196.206.83.31
  196.206.87.210
-196.207.176.215
  196.207.184.14
-196.207.205.84
  196.213.65.166
  196.215.192.62
  196.216.220.196
@@ -50519,19 +50023,25 @@
  196.22.224.98
  196.220.42.100
  196.221.145.196
+196.221.145.207
+196.221.146.119
+196.221.147.7
+196.221.150.131
+196.221.202.159
+196.221.202.171
+196.221.202.179
+196.221.202.47
+196.221.85.127
  196.223.136.65
-196.223.160.182
  196.223.160.214
  196.223.160.242
  196.223.161.150
  196.223.234.136
  196.23.22.27
-196.235.88.45
  196.240.104.104
  196.240.105.190
  196.240.105.246
  196.240.109.103
-196.240.109.119
  196.240.109.189
  196.240.109.19
  196.240.109.204
@@ -50541,25 +50051,25 @@
  196.240.143.165
  196.240.143.173
  196.240.143.183
-196.240.143.214
  196.240.173.194
  196.240.173.195
  196.240.173.29
+196.240.173.46
  196.240.173.95
  196.240.237.146
  196.240.237.21
-196.240.237.59
-196.240.237.89
+196.240.237.212
+196.240.237.23
  196.240.250.115
  196.240.250.155
  196.240.250.173
  196.240.250.198
+196.240.250.200
  196.240.250.214
  196.240.250.231
  196.240.250.236
  196.240.250.237
  196.240.250.26
-196.240.250.52
  196.240.250.53
  196.240.254.11
  196.240.254.14
@@ -50571,9 +50081,10 @@
  196.242.10.100
  196.242.10.116
  196.242.10.179
-196.242.10.199
  196.242.10.222
+196.242.10.236
  196.242.10.68
+196.242.10.81
  196.242.114.121
  196.242.114.125
  196.242.114.139
@@ -50596,7 +50107,6 @@
  196.242.195.213
  196.242.195.225
  196.242.195.94
-196.242.195.96
  196.242.20.104
  196.242.20.124
  196.242.20.136
@@ -50608,17 +50118,23 @@
  196.242.20.70
  196.242.200.154
  196.242.200.169
+196.242.200.182
  196.242.200.66
  196.242.21.105
  196.242.21.220
  196.242.244.235
  196.242.244.239
  196.242.3.115
+196.242.3.146
+196.242.3.150
  196.242.3.153
  196.242.3.163
  196.242.3.169
  196.242.3.187
  196.242.3.242
+196.242.3.63
+196.242.3.8
+196.242.3.82
  196.242.47.13
  196.242.47.172
  196.242.47.200
@@ -50627,52 +50143,62 @@
  196.242.47.45
  196.242.57.125
  196.242.84.177
-196.244.200.123
  196.244.200.180
-196.244.200.3
+196.244.4.161
  196.244.4.224
  196.244.4.53
  196.244.4.82
-196.245.148.166
+196.245.148.136
+196.245.149.49
+196.245.149.88
  196.245.157.228
-196.245.158.253
  196.245.159.247
  196.245.184.124
  196.245.184.160
  196.245.184.225
-196.245.184.37
+196.245.185.127
  196.245.185.2
  196.245.185.37
  196.245.185.97
+196.245.217.73
+196.245.219.182
  196.245.237.169
-196.245.237.46
+196.245.247.195
+196.245.247.24
  196.245.254.125
  196.245.254.182
  196.245.255.34
  196.247.16.203
+196.247.160.133
  196.247.160.73
-196.247.163.25
+196.247.163.162
+196.247.18.104
  196.247.18.154
  196.247.18.230
  196.247.18.68
+196.247.192.210
  196.247.192.74
+196.247.205.173
  196.247.205.222
+196.247.212.84
  196.247.212.87
  196.247.212.96
  196.247.213.222
+196.247.213.247
  196.247.213.35
  196.247.5.129
  196.247.5.163
+196.25.230.69
  196.25.237.218
  196.25.67.186
  196.25.94.134
+196.250.209.35
  196.250.39.65
  196.27.106.112
  196.27.107.173
  196.27.107.231
  196.27.127.170
  196.27.127.58
-196.27.127.61
  196.28.226.33
  196.28.234.66
  196.3.100.45
@@ -50689,6 +50215,7 @@
  196.37.111.217
  196.38.150.104
  196.38.70.24
+196.40.0.120
  196.40.97.14
  196.41.102.130
  196.41.122.94
@@ -50699,7 +50226,7 @@
  196.44.10.207
  196.44.176.55
  196.44.182.183
-196.46.202.238
+196.46.180.117
  196.46.202.68
  196.46.39.53
  196.47.67.180
@@ -50718,13 +50245,13 @@
  196.52.84.80
  196.6.112.70
  196.6.232.32
+196.61.32.40
  196.64.126.227
  196.65.248.216
  196.70.252.2
  196.70.33.28
  196.71.250.48
  196.74.122.57
-196.75.122.152
  196.75.80.170
  196.77.8.223
  196.89.211.129
@@ -50736,26 +50263,30 @@
  197.1.94.79
  197.115.19.200
  197.115.33.95
+197.118.215.92
  197.13.2.215
+197.135.113.55
  197.136.142.5
  197.14.199.24
  197.14.216.207
-197.14.22.63
  197.14.82.93
+197.148.29.45
  197.149.128.25
  197.149.148.110
+197.149.183.53
  197.153.160.42
+197.153.200.230
+197.153.74.203
  197.153.75.189
-197.153.79.154
-197.155.137.129
+197.153.81.193
  197.155.193.115
  197.155.194.194
  197.155.6.43
+197.156.107.230
  197.156.139.69
  197.156.234.164
  197.156.65.138
  197.156.77.45
-197.156.97.73
  197.157.17.86
  197.157.219.168
  197.157.219.169
@@ -50766,21 +50297,21 @@
  197.159.12.167
  197.159.23.174
  197.159.3.35
-197.182.94.162
  197.185.103.229
-197.185.104.41
-197.185.97.226
-197.188.150.11
-197.188.165.176
+197.185.109.75
+197.188.165.207
+197.188.221.206
  197.2.143.125
  197.2.148.6
  197.206.139.101
  197.207.168.30
-197.210.10.19
+197.209.104.246
  197.210.114.50
  197.210.114.58
  197.210.117.38
  197.210.120.72
+197.210.120.73
+197.210.120.76
  197.210.120.78
  197.210.124.186
  197.210.135.139
@@ -50792,10 +50323,18 @@
  197.210.181.220
  197.210.191.131
  197.210.217.66
-197.210.226.170
+197.210.226.202
+197.210.227.181
  197.210.246.30
+197.210.54.141
+197.210.54.203
+197.210.55.152
+197.210.55.87
+197.210.55.90
+197.210.84.44
  197.211.209.236
  197.211.238.220
+197.211.240.84
  197.211.245.21
  197.211.3.238
  197.211.38.187
@@ -50803,8 +50342,11 @@
  197.211.45.4
  197.211.57.62
  197.220.169.143
+197.221.148.202
  197.221.158.186
+197.221.254.62
  197.221.28.59
+197.221.4.249
  197.221.90.54
  197.230.17.94
  197.230.26.130
@@ -50815,16 +50357,14 @@
  197.231.198.172
  197.231.202.106
  197.231.221.211
-197.232.115.197
  197.232.18.249
  197.232.21.22
-197.232.26.137
  197.232.36.108
  197.232.36.64
  197.232.41.216
  197.232.47.102
  197.232.55.224
-197.232.61.209
+197.232.61.212
  197.232.76.135
  197.232.88.167
  197.234.13.13
@@ -50832,15 +50372,13 @@
  197.234.13.16
  197.234.13.2
  197.234.13.26
-197.234.13.28
+197.234.13.29
  197.234.13.31
  197.234.13.33
  197.234.13.34
  197.234.13.36
  197.234.13.4
  197.234.13.40
-197.234.13.44
-197.234.13.46
  197.234.13.51
  197.234.13.52
  197.234.13.54
@@ -50860,18 +50398,19 @@
  197.234.13.84
  197.234.13.88
  197.234.13.90
-197.234.13.93
  197.234.13.94
  197.234.13.96
  197.234.179.102
  197.234.221.31
+197.234.221.77
  197.234.247.203
  197.234.35.82
  197.234.48.242
  197.237.137.20
-197.237.151.38
+197.237.175.99
  197.237.18.14
  197.237.90.67
+197.238.29.46
  197.240.209.56
  197.240.76.29
  197.242.144.229
@@ -50885,16 +50424,14 @@
  197.245.25.228
  197.245.30.24
  197.246.202.238
-197.246.255.206
  197.248.114.226
  197.248.136.250
  197.248.184.157
  197.248.190.170
  197.248.2.229
  197.248.236.134
-197.25.164.13
  197.250.8.162
-197.251.193.152
+197.253.194.51
  197.254.115.162
  197.254.29.22
  197.254.38.250
@@ -50905,19 +50442,26 @@
  197.255.0.98
  197.255.162.162
  197.255.176.29
+197.255.225.24
  197.255.253.210
  197.255.255.113
  197.3.10.98
  197.32.144.247
+197.33.252.205
  197.33.32.108
+197.35.37.41
  197.35.46.71
  197.37.114.148
+197.38.125.80
  197.39.210.11
  197.40.158.14
  197.40.196.212
-197.41.222.184
+197.45.13.45
  197.45.163.117
+197.45.200.11
  197.45.47.140
+197.48.175.211
+197.48.98.39
  197.5.145.102
  197.5.145.106
  197.5.145.112
@@ -50936,9 +50480,8 @@
  197.52.30.33
  197.52.93.117
  197.53.218.213
-197.55.8.93
  197.57.61.13
-197.59.31.230
+197.62.200.140
  197.81.132.193
  197.81.192.73
  197.82.208.133
@@ -50947,17 +50490,20 @@
  197.85.185.156
  197.88.32.60
  197.89.103.103
+197.89.140.138
+197.89.153.31
  197.89.166.124
+197.89.166.19
  197.89.35.201
  197.89.38.191
  197.89.73.107
  197.89.73.157
-197.89.73.162
+197.89.73.236
  197.89.73.28
  197.89.73.31
  197.89.73.42
-197.89.73.89
  197.89.73.92
+197.90.146.150
  19725.psdzy.com
  1975365.com
  19766.wang
@@ -50980,22 +50526,23 @@
  198.100.155.37
  198.100.158.202
  198.100.159.54
+198.105.117.130
  198.105.117.76
  198.106.189.76
  198.12.108.108
+198.12.108.125
  198.12.108.204
+198.12.108.219
+198.12.108.5
  198.12.110.89
  198.12.120.170
  198.12.121.184
  198.12.123.144
  198.12.123.145
  198.12.123.154
-198.12.125.228
+198.12.125.229
  198.12.125.237
-198.12.224.76
  198.12.225.100
-198.12.227.90
-198.12.229.101
  198.12.248.100
  198.12.249.249
  198.12.250.116
@@ -51010,15 +50557,16 @@
  198.12.66.110
  198.12.68.57
  198.12.72.38
-198.12.72.44
  198.12.72.49
  198.12.80.132
+198.12.80.141
  198.12.80.157
  198.12.80.166
  198.12.80.175
  198.12.83.181
  198.12.84.18
  198.12.84.221
+198.12.85.122
  198.12.87.153
  198.12.97.66
  198.13.33.52
@@ -51048,6 +50596,7 @@
  198.144.176.137
  198.144.176.147
  198.144.176.85
+198.144.177.219
  198.144.191.135
  198.148.153.20
  198.15.105.10
@@ -51059,17 +50608,16 @@
  198.154.113.151
  198.154.60.143
  198.154.63.131
+198.154.81.106
  198.154.81.117
  198.154.81.189
  198.154.81.235
  198.154.85.251
+198.16.66.197
  198.167.136.150
  198.167.140.237
-198.167.201.21
-198.167.207.6
-198.167.214.75
  198.178.120.5
-198.181.163.223
+198.181.163.99
  198.181.43.204
  198.187.30.116
  198.199.100.215
@@ -51125,7 +50673,6 @@
  198.199.91.213
  198.199.91.215
  198.199.91.6
-198.199.92.41
  198.199.94.96
  198.199.95.124
  198.199.96.229
@@ -51146,20 +50693,21 @@
  198.20.163.226
  198.20.164.43
  198.20.168.234
+198.20.168.237
+198.20.168.239
  198.20.168.242
-198.20.168.243
  198.20.168.88
  198.20.172.153
  198.20.172.157
  198.20.172.228
-198.20.172.76
  198.20.172.77
  198.20.174.173
  198.20.175.146
-198.20.176.178
+198.20.176.177
  198.20.176.190
  198.20.176.227
  198.20.179.204
+198.20.179.215
  198.20.179.223
  198.20.180.22
  198.20.191.60
@@ -51202,12 +50750,9 @@
  198.211.104.28
  198.211.105.114
  198.211.107.224
-198.211.109.14
-198.211.110.186
  198.211.110.89
  198.211.113.207
  198.211.114.136
-198.211.115.226
  198.211.116.13
  198.211.116.68
  198.211.117.96
@@ -51236,7 +50781,6 @@
  198.23.137.142
  198.23.145.200
  198.23.145.205
-198.23.145.208
  198.23.145.82
  198.23.148.137
  198.23.167.27
@@ -51247,7 +50791,6 @@
  198.23.172.170
  198.23.172.171
  198.23.172.177
-198.23.172.190
  198.23.173.157
  198.23.173.249
  198.23.173.250
@@ -51255,33 +50798,34 @@
  198.23.174.151
  198.23.174.152
  198.23.174.153
+198.23.174.165
  198.23.174.166
  198.23.174.185
-198.23.174.186
  198.23.174.189
+198.23.174.48
  198.23.174.51
+198.23.174.59
  198.23.174.62
  198.23.176.210
  198.23.177.47
  198.23.182.246
  198.23.188.74
-198.23.197.47
-198.23.197.52
  198.23.197.57
  198.23.197.58
  198.23.200.241
  198.23.201.187
  198.23.203.204
  198.23.206.131
-198.23.206.134
  198.23.207.238
  198.23.212.138
  198.23.212.27
+198.23.212.92
  198.23.213.30
  198.23.213.57
  198.23.217.200
  198.23.217.205
  198.23.217.64
+198.23.217.89
  198.23.221.32
  198.23.226.254
  198.23.228.254
@@ -51290,11 +50834,15 @@
  198.23.236.144
  198.23.238.15
  198.23.238.179
+198.23.238.180
  198.23.238.187
  198.23.238.188
  198.23.238.27
  198.23.240.250
+198.23.247.176
+198.23.247.184
  198.23.247.188
+198.23.247.189
  198.23.57.226
  198.23.60.180
  198.23.71.113
@@ -51316,14 +50864,11 @@
  198.245.67.126
  198.245.67.24
  198.245.67.49
-198.245.72.143
  198.245.72.156
  198.245.72.28
  198.245.72.8
  198.245.76.247
-198.245.76.249
  198.251.117.82
-198.251.77.254
  198.251.80.157
  198.251.80.213
  198.251.83.193
@@ -51337,6 +50882,7 @@
  198.27.123.127
  198.27.66.144
  198.27.66.37
+198.27.67.87
  198.27.68.223
  198.27.68.80
  198.27.70.45
@@ -51344,7 +50890,6 @@
  198.27.79.180
  198.27.80.123
  198.27.80.144
-198.27.80.212
  198.27.80.38
  198.27.81.24
  198.27.81.94
@@ -51369,13 +50914,13 @@
  198.46.166.35
  198.46.166.95
  198.46.168.25
-198.46.174.33
-198.46.174.9
+198.46.172.19
+198.46.172.60
  198.46.193.202
  198.46.194.140
  198.46.198.115
  198.46.199.105
-198.46.201.234
+198.46.199.73
  198.46.201.240
  198.46.202.121
  198.46.205.78
@@ -51384,6 +50929,7 @@
  198.46.210.32
  198.46.213.203
  198.46.214.149
+198.46.214.151
  198.46.214.173
  198.46.214.25
  198.46.214.29
@@ -51393,6 +50939,7 @@
  198.46.235.107
  198.46.235.119
  198.46.238.3
+198.46.238.7
  198.46.249.206
  198.46.81.12
  198.46.81.34
@@ -51401,6 +50948,7 @@
  198.48.223.179
  198.48.225.88
  198.48.229.28
+198.48.229.44
  198.49.68.101
  198.50.128.237
  198.50.132.54
@@ -51432,7 +50980,6 @@
  198.50.212.208
  198.50.212.209
  198.50.222.102
-198.50.224.232
  198.50.234.102
  198.50.234.106
  198.50.234.107
@@ -51480,6 +51027,7 @@
  198.7.62.217
  198.71.224.92
  198.71.225.141
+198.71.225.149
  198.71.226.24
  198.71.226.54
  198.71.227.45
@@ -51491,13 +51039,13 @@
  198.71.228.63
  198.71.230.47
  198.71.230.52
+198.71.231.29
  198.71.231.31
  198.71.231.35
  198.71.231.4
  198.71.231.76
  198.71.234.40
  198.71.235.21
-198.71.235.50
  198.71.235.70
  198.71.236.11
  198.71.236.12
@@ -51506,6 +51054,7 @@
  198.71.236.46
  198.71.237.24
  198.71.237.9
+198.71.238.11
  198.71.238.12
  198.71.238.15
  198.71.238.16
@@ -51516,6 +51065,7 @@
  198.71.238.21
  198.71.238.22
  198.71.238.3
+198.71.238.31
  198.71.238.4
  198.71.238.6
  198.71.238.7
@@ -51523,11 +51073,14 @@
  198.71.238.9
  198.71.239.13
  198.71.239.14
-198.71.239.17
+198.71.239.15
  198.71.239.19
  198.71.239.20
+198.71.239.25
  198.71.239.26
+198.71.239.29
  198.71.239.30
+198.71.239.31
  198.71.239.34
  198.71.239.36
  198.71.239.38
@@ -51541,7 +51094,7 @@
  198.71.240.42
  198.71.241.14
  198.71.241.40
-198.71.50.212
+198.71.243.16
  198.71.58.92
  198.71.60.177
  198.71.63.95
@@ -51588,6 +51141,7 @@
  198.98.58.244
  198.98.58.66
  198.98.59.197
+198.98.60.112
  198.98.60.179
  198.98.60.90
  198.98.61.131
@@ -51602,6 +51156,7 @@
  19840209.com
  19858327-dot-sydneyma.appspot.com
  198663092739365.cf
+199.101.103.19
  199.101.127.168
  199.102.224.190
  199.115.101.178
@@ -51615,7 +51170,6 @@
  199.117.182.232
  199.119.139.4
  199.119.74.245
-199.126.170.162
  199.127.62.34
  199.15.233.139
  199.15.233.140
@@ -51646,12 +51200,11 @@
  199.182.184.204
  199.184.215.11
  199.187.124.83
-199.188.100.235
  199.188.100.237
  199.188.102.154
  199.188.103.200
+199.188.103.220
  199.188.103.222
-199.188.103.76
  199.188.204.174
  199.188.204.25
  199.188.204.4
@@ -51664,7 +51217,6 @@
  199.19.213.228
  199.19.224.253
  199.19.224.46
-199.19.224.51
  199.19.225.16
  199.19.225.212
  199.19.226.170
@@ -51720,12 +51272,12 @@
  199.223.236.90
  199.229.250.50
  199.229.250.94
-199.231.166.82
  199.231.185.79
  199.231.188.237
  199.231.189.251
  199.231.189.99
  199.233.246.195
+199.241.139.178
  199.241.145.219
  199.246.25.93
  199.247.15.234
@@ -51799,6 +51351,7 @@
  199.249.230.187
  199.249.230.188
  199.249.230.189
+199.249.230.37
  199.249.230.64
  199.249.230.65
  199.249.230.66
@@ -51826,13 +51379,12 @@
  199.249.230.89
  199.250.194.83
  199.34.16.230
-199.34.78.210
  199.34.87.81
  199.34.90.43
  199.4.18.206
  199.47.54.200
+199.48.116.65
  199.48.147.141
-199.48.225.58
  199.48.92.184
  199.58.86.206
  199.58.86.209
@@ -52121,6 +51673,8 @@
  2.132.91.60
  2.133.189.92
  2.133.61.161
+2.133.78.101
+2.134.86.49
  2.136.116.101
  2.136.95.251
  2.137.162.255
@@ -52137,32 +51691,28 @@
  2.139.69.101
  2.144.230.229
  2.144.243.102
-2.15.159.201
  2.152.78.124
  2.153.80.222
  2.154.110.116
  2.154.20.238
  2.176.153.143
-2.177.157.211
+2.177.242.49
  2.178.255.157
  2.179.167.112
  2.180.29.55
  2.183.8.121
  2.183.9.187
  2.196.193.181
-2.20.49.50
-2.200.165.88
  2.200.83.134
  2.201.135.143
  2.201.42.176
  2.204.71.195
  2.205.169.96
  2.205.22.78
-2.206.153.205
  2.206.193.188
  2.217.44.77
  2.217.45.18
-2.223.239.114
+2.219.138.31
  2.224.246.80
  2.225.249.9
  2.228.87.194
@@ -52182,18 +51732,14 @@
  2.238.115.47
  2.238.147.10
  2.238.18.160
-2.247.244.230
  2.247.249.229
  2.247.249.34
  2.25.93.113
  2.26.38.161
-2.27.217.164
  2.28.108.159
  2.30.116.253
  2.30.234.171
  2.32.38.166
-2.32.92.118
-2.34.230.209
  2.35.41.59
  2.36.67.194
  2.37.111.40
@@ -52203,6 +51749,7 @@
  2.38.2.58
  2.38.99.79
  2.39.173.126
+2.39.53.125
  2.4.78.202
  2.42.112.242
  2.42.173.240
@@ -52215,8 +51762,8 @@
  2.49.23.89
  2.4buyuklergazete.com
  2.50.134.11
+2.50.144.229
  2.50.159.186
-2.50.19.133
  2.50.223.242
  2.51.26.64
  2.55.89.193
@@ -52224,6 +51771,7 @@
  2.56.102.177
  2.56.102.57
  2.56.139.208
+2.56.180.98
  2.56.62.144
  2.56.62.165
  2.56.8.123
@@ -52236,51 +51784,47 @@
  2.57.122.167
  2.57.122.186
  2.57.122.196
-2.57.122.20
  2.57.122.202
  2.57.122.21
  2.57.122.223
-2.57.122.23
  2.57.122.26
+2.57.122.27
  2.57.122.31
  2.57.122.9
  2.57.19.137
  2.58.12.128
  2.58.12.151
  2.58.12.217
-2.58.12.25
  2.58.12.37
  2.58.12.43
  2.58.12.50
-2.58.12.56
  2.58.12.68
  2.58.12.74
-2.58.16.85
  2.58.16.86
  2.58.16.88
  2.58.16.89
  2.58.46.202
  2.59.21.200
+2.59.21.51
  2.59.23.102
  2.6.185.246
  2.7.248.51
  2.80.112.146
-2.80.67.235
  2.82.167.249
  2.82.170.124
+2.82.180.50
  2.82.75.215
  2.82.84.56
  2.84.232.100
+2.85.250.6
+2.88.82.193
  2.89.82.192
  2.89.87.54
-2.90.235.91
  2.90.255.190
  2.90.68.10
+2.91.27.255
  2.92.39.39
-2.92.51.124
  2.94.17.97
-2.94.244.220
-2.95.250.114
  2.95.55.65
  2.96.22.155
  2.96.36.182
@@ -52311,11 +51855,8 @@
  20.191.119.145
  20.194.200.87
  20.194.50.237
-20.195.50.97
  20.197.92.22
-20.198.136.200
  20.198.178.215
-20.199.24.203
  20.36.46.115
  20.37.50.97
  20.39.190.208
@@ -52326,15 +51867,14 @@
  20.40.146.61
  20.42.107.213
  20.42.108.200
+20.43.35.19
  20.43.39.32
  20.43.59.45
  20.43.60.99
  20.46.114.59
  20.46.224.110
-20.46.225.105
  20.46.250.169
  20.48.0.101
-20.48.104.18
  20.49.178.57
  20.49.186.22
  20.4buyuklergazete.com
@@ -52345,15 +51885,15 @@
  20.52.157.170
  20.52.237.102
  20.53.160.120
-20.55.21.29
+20.55.0.66
  20.55.48.1
  20.55.74.2
+20.55.96.105
  20.57.10.194
  20.57.168.34
  20.58.32.226
  20.62.200.252
  20.62.40.13
-20.63.72.228
  20.64.0.165
  20.64.157.95
  20.65.160.35
@@ -52367,7 +51907,6 @@
  200-365.net
  200.0.118.29
  200.0.46.50
-200.10.37.12
  200.10.37.138
  200.10.85.251
  200.10.96.157
@@ -52387,9 +51926,9 @@
  200.105.209.170
  200.105.212.96
  200.105.242.58
-200.105.248.182
  200.105.74.140
  200.106.147.35
+200.107.119.128
  200.107.12.194
  200.107.253.130
  200.107.253.138
@@ -52409,6 +51948,7 @@
  200.110.188.187
  200.110.188.188
  200.111.120.180
+200.111.153.194
  200.111.167.170
  200.111.182.6
  200.111.232.234
@@ -52430,13 +51970,14 @@
  200.118.62.33
  200.119.112.204
  200.119.125.194
+200.119.198.188
  200.119.204.19
  200.119.40.13
  200.119.85.93
  200.120.188.167
-200.121.154.187
  200.121.169.156
  200.122.128.162
+200.122.128.204
  200.122.181.2
  200.122.202.107
  200.122.226.154
@@ -52454,6 +51995,7 @@
  200.123.233.33bin.sh
  200.124.243.62
  200.125.44.242
+200.126.235.182
  200.127.1.233
  200.127.14.97
  200.128.62.2
@@ -52464,7 +52006,6 @@
  200.133.39.84
  200.135.228.230
  200.137.5.195
-200.14.234.180
  200.141.100.54
  200.141.166.170
  200.141.248.186
@@ -52491,6 +52032,7 @@
  200.150.86.138
  200.152.49.163
  200.152.78.48
+200.155.139.74
  200.155.188.173
  200.155.57.213
  200.158.124.146
@@ -52508,6 +52050,7 @@
  200.17.13.3
  200.170.127.133
  200.170.160.246
+200.170.98.10
  200.174.158.26
  200.174.29.2
  200.175.104.103
@@ -52538,16 +52081,13 @@
  200.199.8.118
  200.2.182.114
  200.20.186.254
-200.201.155.2
  200.201.180.130
-200.202.216.74
  200.203.104.18
  200.203.123.32
  200.203.123.34
  200.203.126.15
  200.203.239.188
  200.204.150.216
-200.204.174.163
  200.204.190.244
  200.205.134.107
  200.206.63.34
@@ -52563,6 +52103,7 @@
  200.215.171.238
  200.216.30.196
  200.216.31.148
+200.216.31.20
  200.216.77.154
  200.217.168.98
  200.217.191.130
@@ -52585,8 +52126,8 @@
  200.233.186.57
  200.233.204.200
  200.233.204.47
+200.236.20.210
  200.238.102.225
-200.24.138.2
  200.24.80.13
  200.24.80.2
  200.24.84.12
@@ -52632,16 +52173,17 @@
  200.33.152.207
  200.34.227.204
  200.35.145.133
+200.35.162.153
  200.35.49.50
  200.35.49.89
  200.35.56.161
  200.35.56.81
+200.35.75.73
  200.37.108.195
  200.37.176.156
  200.37.200.178
  200.37.241.185
  200.37.3.10
-200.38.19.235
  200.38.232.248
  200.38.79.134
  200.40.86.142
@@ -52650,6 +52192,7 @@
  200.41.182.243
  200.41.79.230
  200.41.86.59
+200.41.94.113
  200.42.174.109
  200.44.158.226
  200.44.50.155
@@ -52685,7 +52228,6 @@
  200.54.183.234
  200.54.221.202
  200.54.247.98
-200.54.37.211
  200.54.51.124
  200.54.56.107
  200.54.56.108
@@ -52693,10 +52235,8 @@
  200.54.78.178
  200.55.140.181
  200.55.208.196
-200.55.218.202
  200.55.243.138
  200.56.17.5
-200.56.58.221
  200.56.60.157
  200.57.102.71
  200.57.183.176
@@ -52704,6 +52244,7 @@
  200.58.118.226
  200.58.118.26
  200.58.171.51
+200.58.76.220
  200.58.83.144
  200.58.83.179
  200.59.41.132
@@ -52722,19 +52263,20 @@
  200.60.92.170
  200.60.97.194
  200.60.97.196
+200.61.16.80
  200.61.185.200
  200.62.146.174
  200.62.96.66
  200.63.105.129
-200.66.117.246
-200.66.123.15
+200.66.114.143
+200.66.116.252
+200.66.117.104
  200.66.68.145
  200.66.77.178
  200.68.13.26
  200.68.136.10
  200.68.136.159
  200.68.158.250
-200.68.187.92
  200.68.230.193
  200.68.230.197
  200.68.60.131
@@ -52744,32 +52286,30 @@
  200.69.210.185
  200.69.224.73
  200.69.77.34
-200.69.78.21
  200.69.78.22
  200.69.81.10
  200.69.81.198
  200.69.83.54
-200.69.85.13
  200.69.87.109
+200.69.93.242
  200.7.102.76
  200.7.118.10
  200.7.149.112
  200.7.173.110
-200.7.193.229
  200.7.198.66
  200.7.252.118
  200.7.98.102
  200.70.22.77
  200.70.56.204
  200.71.122.54
+200.71.154.142
+200.71.191.58
  200.71.72.14
  200.71.72.201
  200.71.72.234
  200.71.72.245
  200.71.73.222
  200.71.73.242
-200.73.113.217
-200.73.128.100
  200.73.128.148
  200.73.128.173
  200.73.128.175
@@ -52781,7 +52321,6 @@
  200.73.129.128
  200.73.129.33
  200.73.129.37
-200.73.130.156
  200.73.130.187
  200.73.130.213
  200.73.130.226
@@ -52789,6 +52328,7 @@
  200.73.131.100
  200.73.131.129
  200.73.131.239
+200.73.3.171
  200.73.6.198
  200.74.243.12
  200.75.228.42
@@ -52808,6 +52348,7 @@
  200.77.186.211
  200.77.186.219
  200.8.127.73
+200.8.19.35
  200.80.22.36
  200.80.227.234
  200.81.117.10
@@ -52820,7 +52361,6 @@
  200.81.145.241
  200.81.145.253
  200.81.147.1
-200.82.130.91
  200.82.170.231
  200.83.202.237
  200.84.172.252
@@ -52840,9 +52380,7 @@
  200.85.139.9
  200.85.169.18
  200.85.95.234
-200.86.175.183
  200.87.180.226
-200.87.233.68
  200.87.73.51
  200.87.90.39
  200.89.114.58
@@ -52852,7 +52390,6 @@
  200.89.159.190
  200.89.159.240
  200.89.174.105
-200.89.178.104
  200.89.178.19
  200.89.178.208
  200.89.178.212
@@ -52870,9 +52407,9 @@
  200.94.140.50
  200.97.148.167
  200.97.250.150
+200.98.1.182
  200.98.1.195
  200.98.1.212
-200.98.1.251
  200.98.163.13
  200.98.2.2
  200.98.200.147
@@ -52880,7 +52417,6 @@
  200.98.4.119
  200.98.4.163
  200.98.4.183
-200.98.4.209
  200.98.4.83
  2000526.com
  2000central.monster
@@ -52906,10 +52442,8 @@
  201.116.227.194
  201.116.52.104
  201.122.102.21
-201.122.212.15
  201.122.212.30
  201.123.172.44
-201.127.78.53
  201.128.204.26
  201.130.79.47
  201.131.126.17
@@ -52934,6 +52468,7 @@
  201.143.32.82
  201.144.122.243
  201.144.206.244
+201.144.210.221
  201.144.234.22
  201.144.51.200
  201.145.253.185
@@ -52942,11 +52477,12 @@
  201.148.126.38
  201.148.127.209
  201.148.127.57
-201.148.246.11
+201.148.246.65
  201.148.71.65
  201.149.119.133
  201.149.20.161
  201.149.26.51
+201.149.33.34
  201.149.44.237
  201.149.49.146
  201.149.49.162
@@ -52954,11 +52490,13 @@
  201.15.121.73
  201.151.0.135
  201.151.6.30
+201.151.79.30
  201.155.182.49
  201.155.192.248
  201.158.105.3
  201.158.106.71
  201.158.120.40
+201.158.60.100
  201.159.112.70
  201.159.179.164
  201.159.95.101
@@ -52978,12 +52516,11 @@
  201.163.162.179
  201.163.180.183
  201.163.239.132
+201.163.40.3
  201.163.74.202
  201.163.74.204
  201.163.98.162
  201.164.220.56
-201.165.215.183
-201.165.52.129
  201.166.149.154
  201.166.199.205
  201.167.56.18
@@ -53004,23 +52541,24 @@
  201.173.92.212
  201.174.110.126
  201.174.122.29
-201.174.225.130
  201.175.113.237
  201.175.17.129
  201.175.73.218
  201.178.196.79
+201.179.131.167
  201.179.35.103
  201.18.13.154
  201.18.88.150
-201.180.235.57
  201.182.120.230
  201.182.181.39
+201.182.214.101
  201.182.66.18
  201.182.88.10
  201.182.88.13
  201.182.88.2
  201.182.88.93
  201.182.91.15
+201.183.224.39
  201.183.239.5
  201.184.105.242
  201.184.128.134
@@ -53041,6 +52579,7 @@
  201.185.69.28
  201.187.103.18
  201.190.184.22
+201.190.254.253
  201.191.42.39
  201.192.136.240
  201.193.160.196
@@ -53062,7 +52601,6 @@
  201.204.168.106
  201.204.43.38
  201.204.46.10
-201.207.53.62
  201.208.10.38
  201.210.246.136
  201.211.31.45
@@ -53073,6 +52611,7 @@
  201.215.208.78
  201.216.217.25
  201.216.222.155
+201.216.223.6
  201.216.238.41
  201.217.143.51
  201.217.159.155
@@ -53093,6 +52632,8 @@
  201.219.216.132
  201.219.217.70
  201.219.218.130
+201.219.248.230
+201.22.162.230
  201.220.138.42
  201.220.140.6
  201.221.133.86
@@ -53129,23 +52670,25 @@
  201.238.235.11
  201.238.239.51
  201.24.199.23
+201.240.5.194
+201.240.68.91
  201.241.127.190
  201.244.141.167
  201.244.213.9
  201.244.214.162
-201.248.226.181
+201.247.41.158
  201.249.146.101
  201.249.57.132
  201.249.61.60
  201.249.75.13
  201.249.88.38
-201.250.104.217
  201.251.63.208
  201.26.174.39
  201.26.179.96
+201.28.105.119
  201.28.105.213
+201.28.130.42
  201.28.135.246
-201.28.187.217
  201.28.225.242
  201.28.87.42
  201.28.87.43
@@ -53153,11 +52696,13 @@
  201.33.17.229
  201.33.170.25
  201.33.228.154
+201.33.229.165
  201.35.168.225
  201.35.168.227
  201.35.168.253
  201.36.173.93
  201.40.41.12
+201.40.60.126
  201.41.81.130
  201.42.114.249
  201.42.115.9
@@ -53171,7 +52716,6 @@
  201.48.121.65
  201.48.184.157
  201.48.192.60
-201.48.222.45
  201.48.25.161
  201.48.28.2
  201.48.34.199
@@ -53180,12 +52724,17 @@
  201.48.62.65
  201.49.115.117
  201.49.22.14
+201.49.58.234
  201.49.89.221
  201.49.94.216
  201.50.47.169
  201.54.113.170
  201.55.103.34
-201.55.158.133
+201.55.149.181
+201.55.158.219
+201.55.159.190
+201.55.179.176
+201.55.186.254
  201.59.201.92
  201.6.101.122
  201.6.247.90
@@ -53256,7 +52805,6 @@
  202.104.101.27
  202.104.112.217
  202.104.188.147
-202.104.45.85
  202.105.184.66
  202.105.98.210
  202.108.211.135
@@ -53264,9 +52812,8 @@
  202.110.125.190
  202.110.125.199
  202.110.125.217
-202.110.8.164
  202.111.131.236
-202.118.32.62
+202.112.51.45
  202.12.74.243
  202.120.13.51
  202.121.138.74
@@ -53287,6 +52834,7 @@
  202.126.98.42
  202.127.0.116
  202.129.0.27
+202.129.164.186
  202.129.184.10
  202.129.189.58
  202.129.38.3
@@ -53315,8 +52863,8 @@
  202.136.123.254
  202.136.124.38
  202.136.127.14
-202.136.127.221
  202.136.127.254
+202.136.212.82
  202.136.88.68
  202.137.10.179
  202.137.10.180
@@ -53327,32 +52875,33 @@
  202.137.141.98
  202.137.142.103
  202.137.142.138
+202.137.142.28
  202.137.154.138
  202.137.154.154
  202.137.154.62
  202.137.155.142
  202.137.155.146
-202.137.155.168
+202.137.155.171
  202.137.155.181
  202.137.155.212
-202.137.155.234
+202.137.155.78
  202.137.159.132
  202.137.26.10
  202.137.26.12
  202.137.26.4
  202.137.26.6
  202.137.26.8
+202.137.28.92
  202.138.233.162
  202.138.234.18
  202.138.239.102
-202.138.241.97
  202.138.242.116
  202.138.242.22
  202.138.242.6
  202.138.242.8
  202.138.248.85
  202.138.254.154
-202.139.192.25
+202.139.196.249
  202.14.4.190
  202.14.5.165
  202.14.6.131
@@ -53367,7 +52916,6 @@
  202.141.233.166
  202.141.242.3
  202.142.102.138
-202.142.137.92
  202.142.147.162
  202.142.153.179
  202.142.153.181
@@ -53376,6 +52924,7 @@
  202.142.158.114
  202.142.159.204
  202.142.162.186
+202.142.172.10
  202.142.178.114
  202.142.181.78
  202.142.184.166
@@ -53399,7 +52948,6 @@
  202.146.218.45
  202.146.222.249
  202.146.245.156
-202.146.85.2
  202.147.169.66
  202.147.192.134
  202.147.198.115
@@ -53412,11 +52960,9 @@
  202.148.31.172
  202.148.31.174
  202.149.199.194
-202.150.141.134
  202.150.148.218
  202.150.151.85
  202.150.176.100
-202.150.177.141
  202.150.181.58
  202.150.216.211
  202.151.15.80
@@ -53424,6 +52970,7 @@
  202.151.231.71
  202.152.149.26
  202.152.33.132
+202.152.33.66
  202.152.38.74
  202.152.38.76
  202.152.40.28
@@ -53461,12 +53008,10 @@
  202.159.30.9
  202.159.35.105
  202.159.35.113
-202.159.35.121
  202.159.35.137
  202.159.35.145
  202.159.35.153
  202.159.35.177
-202.159.35.189
  202.159.35.201
  202.159.35.217
  202.159.35.225
@@ -53477,7 +53022,6 @@
  202.159.35.65
  202.159.35.73
  202.159.35.81
-202.159.35.97
  202.159.37.14
  202.159.60.113
  202.159.60.137
@@ -53493,12 +53037,12 @@
  202.162.192.112
  202.162.194.203
  202.162.203.210
+202.162.204.34
  202.162.211.46
  202.162.214.243
  202.162.214.250
  202.162.219.10
  202.162.219.12
-202.164.136.191
  202.164.138.10
  202.164.138.102
  202.164.138.112
@@ -53509,8 +53053,8 @@
  202.164.138.124
  202.164.138.130
  202.164.138.133
-202.164.138.137
  202.164.138.138
+202.164.138.140
  202.164.138.141
  202.164.138.147
  202.164.138.149
@@ -53521,6 +53065,7 @@
  202.164.138.18
  202.164.138.181
  202.164.138.183
+202.164.138.185
  202.164.138.19
  202.164.138.194
  202.164.138.197
@@ -53546,8 +53091,10 @@
  202.164.138.64
  202.164.138.68
  202.164.138.69
+202.164.138.70
  202.164.138.72
  202.164.138.74
+202.164.138.76
  202.164.138.81
  202.164.138.83
  202.164.138.84
@@ -53600,9 +53147,9 @@
  202.164.139.233
  202.164.139.253
  202.164.139.28
+202.164.139.34
  202.164.139.35
  202.164.139.37
-202.164.139.4
  202.164.139.41
  202.164.139.43
  202.164.139.49
@@ -53612,16 +53159,15 @@
  202.164.139.63
  202.164.139.68
  202.164.139.70
+202.164.139.84
  202.164.139.95
  202.164.139.96
  202.164.152.229
  202.164.152.233
-202.164.210.65
  202.164.211.116
  202.164.211.118
  202.164.211.51
  202.164.222.41
-202.164.39.25
  202.165.22.177
  202.165.22.2
  202.165.22.203
@@ -53631,7 +53177,6 @@
  202.165.228.161
  202.165.228.225
  202.165.66.103
-202.166.163.195
  202.166.170.43
  202.166.174.218
  202.166.196.34
@@ -53642,12 +53187,12 @@
  202.166.205.78
  202.166.205.85
  202.166.205.87
+202.166.206.138
  202.166.206.151
  202.166.207.218
  202.166.207.229
  202.166.207.58
  202.166.210.122
-202.166.210.49
  202.166.211.48
  202.166.212.249
  202.166.213.156
@@ -53657,6 +53202,7 @@
  202.168.146.105
  202.168.146.106
  202.168.146.108
+202.168.146.111
  202.168.146.112
  202.168.146.120
  202.168.146.124
@@ -53667,7 +53213,6 @@
  202.168.159.54
  202.168.201.123
  202.168.225.141
-202.169.106.230
  202.169.240.54
  202.169.244.178
  202.169.246.55
@@ -53691,8 +53236,6 @@
  202.178.121.220
  202.179.185.130
  202.179.21.58
-202.179.86.229
-202.179.91.28
  202.180.54.211
  202.180.54.97
  202.182.100.165
@@ -53717,22 +53260,25 @@
  202.183.32.185
  202.184.0.102
  202.184.197.236
-202.185.164.139
  202.185.198.77
+202.186.122.123
+202.186.125.6
  202.186.199.15
  202.188.101.106
  202.188.101.4
  202.188.20.123
  202.188.20.126
+202.190.76.128
  202.191.120.12
  202.191.121.12
-202.191.122.129
  202.191.122.62
  202.191.126.100
  202.191.126.60
  202.191.15.253
  202.191.56.154
+202.201.13.134
  202.202.32.40
+202.205.160.242
  202.208.223.251
  202.21.115.94
  202.21.123.124
@@ -53740,15 +53286,14 @@
  202.21.124.226
  202.21.32.158
  202.210.150.70
-202.212.164.194
  202.22.141.45
  202.228.204.204
  202.228.204.224
  202.239.42.192
  202.28.10.20
+202.28.213.170
  202.28.221.106
  202.28.247.202
-202.28.33.169
  202.28.7.138
  202.28.77.46
  202.29.18.25
@@ -53766,7 +53311,6 @@
  202.29.243.250
  202.29.243.252
  202.29.243.254
-202.29.243.58
  202.29.245.46
  202.29.33.245
  202.29.4.97
@@ -53780,9 +53324,7 @@
  202.36.55.19
  202.38.181.171
  202.39.237.188
-202.39.245.247
  202.4.173.49
-202.4.186.49
  202.40.139.165
  202.40.177.94
  202.40.186.157
@@ -53800,7 +53342,6 @@
  202.43.190.11
  202.43.191.10
  202.43.191.14
-202.43.228.206
  202.43.34.50
  202.44.199.62
  202.44.210.20
@@ -53816,6 +53357,7 @@
  202.47.116.121
  202.47.118.107
  202.47.34.236
+202.47.51.86
  202.47.52.112
  202.5.17.28
  202.5.36.215
@@ -53857,6 +53399,8 @@
  202.51.87.184
  202.51.89.9
  202.52.146.71
+202.52.224.137
+202.52.224.238
  202.52.234.236
  202.52.244.150
  202.52.248.254
@@ -53886,7 +53430,7 @@
  202.57.52.18
  202.57.55.242
  202.58.108.1
-202.58.108.101
+202.58.108.100
  202.58.108.102
  202.58.108.18
  202.58.108.29
@@ -53901,12 +53445,12 @@
  202.58.108.81
  202.58.108.86
  202.58.108.98
+202.58.252.23
  202.59.166.146
  202.59.173.203
  202.59.173.204
  202.6.224.50
  202.6.224.52
-202.6.237.26
  202.60.225.49
  202.60.227.65
  202.60.72.107
@@ -53928,7 +53472,6 @@
  202.62.39.111
  202.62.45.17
  202.62.45.53
-202.62.48.112
  202.62.50.81
  202.62.51.25
  202.62.51.45
@@ -53937,6 +53480,7 @@
  202.62.84.210
  202.62.88.185
  202.62.89.194
+202.62.9.108
  202.62.92.225
  202.62.99.170
  202.63.104.89
@@ -53949,7 +53493,8 @@
  202.69.105.18
  202.69.36.45
  202.69.38.237
-202.69.48.126
+202.69.45.22
+202.70.136.100
  202.70.136.160
  202.70.34.82
  202.70.44.195
@@ -53958,7 +53503,6 @@
  202.70.84.201
  202.71.108.26
  202.71.185.90
-202.71.27.60
  202.72.209.3
  202.72.225.17
  202.72.233.18
@@ -53992,27 +53536,21 @@
  202.80.118.90
  202.80.213.188
  202.80.216.126
-202.83.167.42
  202.83.172.218
  202.83.54.167
-202.83.54.228
-202.83.56.41
  202.83.59.87
  202.85.222.190
  202.86.217.90
-202.87.105.41
  202.87.248.134
  202.87.248.50
  202.87.249.45
  202.88.150.74
-202.88.154.70
  202.88.239.11
  202.88.241.107
  202.88.241.181
  202.89.73.94
  202.9.38.20
  202.9.39.139
-202.91.10.123
  202.91.34.32
  202.91.35.253
  202.91.69.53
@@ -54034,8 +53572,8 @@
  202.94.175.136
  202.94.175.2
  202.94.175.221
-202.94.175.246
  202.94.175.42
+202.94.175.97
  202.95.11.253
  202.95.8.227
  202.99.48.140
@@ -54289,10 +53827,10 @@
  203.10.58.4
  203.106.164.74
  203.109.113.155
-203.109.201.243
  203.11.71.1
  203.110.164.139
  203.110.211.90
+203.110.89.252
  203.110.89.253
  203.110.91.77
  203.111.254.243
@@ -54320,13 +53858,14 @@
  203.115.73.4
  203.115.73.46
  203.115.73.92
-203.116.81.254
-203.117.138.190
  203.122.19.101
  203.122.225.70
  203.122.226.250
  203.122.26.98
+203.122.41.250
+203.122.48.58
  203.123.125.210
+203.124.61.90
  203.125.29.136
  203.128.67.130
  203.128.71.86
@@ -54338,7 +53877,6 @@
  203.128.83.130
  203.128.84.61
  203.129.113.142
-203.129.197.98
  203.129.218.76
  203.129.220.182
  203.130.0.69
@@ -54349,9 +53887,8 @@
  203.130.255.2
  203.131.229.187
  203.131.252.210
-203.132.92.216
-203.132.95.10
  203.134.194.240
+203.134.194.71
  203.135.20.36
  203.135.33.202
  203.135.98.5
@@ -54375,13 +53912,13 @@
  203.150.113.129
  203.150.113.179
  203.150.113.89
+203.150.114.179
  203.150.168.100
  203.150.179.210
  203.150.180.183
  203.150.225.2
  203.150.228.180
  203.151.166.124
-203.151.169.108
  203.151.20.19
  203.151.215.130
  203.152.210.122
@@ -54437,6 +53974,7 @@
  203.169.225.68
  203.170.115.82
  203.170.58.241
+203.170.59.244
  203.170.66.1
  203.170.66.161
  203.170.66.173
@@ -54448,7 +53986,6 @@
  203.170.66.41
  203.170.66.49
  203.170.66.57
-203.170.66.9
  203.170.67.109
  203.170.67.145
  203.170.67.157
@@ -54466,11 +54003,14 @@
  203.170.68.129
  203.170.68.137
  203.170.68.145
+203.170.68.161
  203.170.68.185
  203.170.68.205
  203.170.68.21
+203.170.68.225
  203.170.68.249
  203.170.68.33
+203.170.68.97
  203.171.21.225
  203.171.31.156
  203.172.162.163
@@ -54499,6 +54039,7 @@
  203.184.132.191
  203.185.129.36
  203.186.105.153
+203.186.187.169
  203.186.54.237
  203.187.177.34
  203.188.242.222
@@ -54529,6 +54070,7 @@
  203.190.53.6
  203.190.55.213
  203.192.219.7
+203.192.236.104
  203.192.241.206
  203.192.25.1
  203.194.21.241
@@ -54550,14 +54092,17 @@
  203.195.204.47
  203.195.205.202
  203.195.206.243
+203.195.207.85
  203.195.211.173
  203.195.214.173
  203.195.224.229
  203.195.245.241
  203.197.88.53
+203.198.225.9
  203.198.246.86
  203.198.94.132
  203.199.238.249
+203.2.112.100
  203.2.118.84
  203.2.162.41
  203.200.95.142
@@ -54576,15 +54121,16 @@
  203.205.35.201
  203.206.127.69
  203.206.167.242
-203.207.52.206
  203.207.52.38
  203.207.57.222
  203.208.65.96
  203.209.190.154
  203.209.190.202
  203.210.149.193
+203.210.210.241
  203.210.232.44
  203.210.84.83
+203.212.243.157
  203.213.249.66
  203.213.66.170
  203.215.181.218
@@ -54604,6 +54150,7 @@
  203.219.151.169
  203.219.157.41
  203.22.204.107
+203.220.83.86
  203.221.14.215
  203.223.171.161
  203.223.41.34
@@ -54625,8 +54172,10 @@
  203.238.191.9
  203.24.188.242
  203.24.188.59
+203.243.10.151
+203.243.10.161
+203.243.10.249
  203.243.142.45
-203.243.32.129
  203.245.29.148
  203.245.30.248
  203.245.41.96
@@ -54643,13 +54192,13 @@
  203.253.25.15
  203.255.228.8
  203.30.95.15
+203.34.58.50
  203.41.236.130
  203.43.95.165
  203.45.171.181
  203.46.223.176
  203.56.191.129
  203.56.240.254
-203.56.4.47
  203.58.26.70
  203.6.149.115
  203.62.185.131
@@ -54657,10 +54206,12 @@
  203.66.14.161
  203.66.168.81
  203.66.57.117
+203.69.181.253
  203.69.91.190
  203.71.2.73
  203.71.220.140
  203.73.150.177
+203.74.151.140
  203.74.190.196
  203.76.109.178
  203.76.110.186
@@ -54685,7 +54236,6 @@
  203.80.191.18
  203.81.241.191
  203.81.75.37
-203.81.83.199
  203.81.87.186
  203.81.95.70
  203.82.204.154
@@ -54695,6 +54245,7 @@
  203.83.184.54
  203.83.189.126
  203.84.159.59
+203.86.207.21
  203.86.7.110
  203.90.61.133
  203.91.118.71
@@ -54706,6 +54257,7 @@
  203.94.243.59
  203.95.193.100
  203.95.212.41
+203.95.212.99
  203.95.220.33
  203.95.7.164
  203.97.30.12
@@ -54713,7 +54265,6 @@
  203.99.123.25
  203.99.131.218
  203.99.131.241
-203.99.233.25
  203.99.62.158
  203102102682672-dot-vui-egd-lhs.appspot.com
  20311.goosage.com
@@ -54747,7 +54298,6 @@
  204.13.201.163
  204.13.239.221
  204.132.129.234
-204.137.191.245
  204.14.245.176
  204.145.94.123
  204.145.94.154
@@ -54824,8 +54374,6 @@
  204.86.22.251
  204.9.243.81
  204.93.113.108
-204.93.154.211
-204.93.180.13
  204.93.180.3
  204.93.197.85
  204.98.164.243
@@ -54839,7 +54387,6 @@
  205.134.182.106
  205.134.255.225
  205.141.197.38
-205.144.212.237
  205.157.156.10
  205.164.3.143
  205.172.134.229
@@ -54885,27 +54432,21 @@
  205.185.127.35
  205.185.127.67
  205.185.127.74
-205.185.193.138
  205.185.209.228
-205.185.214.63
-205.185.214.65
-205.185.222.131
  205.185.222.20
  205.185.223.172
-205.185.223.4
  205.186.131.199
  205.186.132.245
  205.186.152.130
  205.186.166.172
  205.186.176.33
-205.201.49.132
  205.206.227.110
  205.209.160.130
  205.209.173.8
  205.209.183.209
  205.209.97.120
  205.215.21.193
-205.234.152.106
+205.234.152.104
  205.234.159.186
  205.234.184.42
  205.234.198.191
@@ -54933,6 +54474,7 @@
  2050391180620948717180.us-south.cf.appdomain.cloud
  205539.cc
  205630.cc
+206.123.139.149
  206.123.139.150
  206.123.139.182
  206.123.139.194
@@ -54944,7 +54486,7 @@
  206.123.139.237
  206.123.139.41
  206.123.153.8
-206.123.233.250
+206.123.95.6
  206.124.149.66
  206.125.169.164
  206.126.81.103
@@ -54956,9 +54498,10 @@
  206.126.81.49
  206.126.81.82
  206.126.81.92
-206.130.139.29
+206.130.141.124
  206.138.29.96
  206.166.251.64
+206.172.99.38
  206.173.219.10
  206.174.117.24
  206.174.214.90
@@ -54969,6 +54512,7 @@
  206.189.0.110
  206.189.0.250
  206.189.1.246
+206.189.100.34
  206.189.101.164
  206.189.101.68
  206.189.102.195
@@ -54987,6 +54531,7 @@
  206.189.110.77
  206.189.111.208
  206.189.113.118
+206.189.113.210
  206.189.115.231
  206.189.117.49
  206.189.117.9
@@ -55059,6 +54604,7 @@
  206.189.173.185
  206.189.173.188
  206.189.174.127
+206.189.178.171
  206.189.18.129
  206.189.18.40
  206.189.180.178
@@ -55066,6 +54612,7 @@
  206.189.181.12
  206.189.181.87
  206.189.182.117
+206.189.183.0
  206.189.183.229
  206.189.183.71
  206.189.186.211
@@ -55086,6 +54633,7 @@
  206.189.200.8
  206.189.204.111
  206.189.205.248
+206.189.206.82
  206.189.207.90
  206.189.208.7
  206.189.208.80
@@ -55107,6 +54655,7 @@
  206.189.223.181
  206.189.223.88
  206.189.225.85
+206.189.227.203
  206.189.23.189
  206.189.23.60
  206.189.231.196
@@ -55118,7 +54667,7 @@
  206.189.234.238
  206.189.237.94
  206.189.238.171
-206.189.238.213
+206.189.24.222
  206.189.24.87
  206.189.25.102
  206.189.26.219
@@ -55132,12 +54681,11 @@
  206.189.35.67
  206.189.36.195
  206.189.38.237
-206.189.4.55
  206.189.42.116
  206.189.45.137
  206.189.45.138
+206.189.45.151
  206.189.45.96
-206.189.46.50
  206.189.46.85
  206.189.47.166
  206.189.47.179
@@ -55151,6 +54699,7 @@
  206.189.62.8
  206.189.62.95
  206.189.63.155
+206.189.63.200
  206.189.63.80
  206.189.64.158
  206.189.69.35
@@ -55168,7 +54717,6 @@
  206.189.85.88
  206.189.87.108
  206.189.88.253
-206.189.88.65
  206.189.88.91
  206.189.91.211
  206.189.91.219
@@ -55179,18 +54727,17 @@
  206.189.95.193
  206.189.97.110
  206.189.97.84
+206.189.97.99
  206.189.98.152
  206.189.99.191
+206.189.99.34
  206.192.226.90
  206.196.108.34
  206.196.145.143
  206.198.196.82
-206.198.216.19
-206.198.219.162
  206.212.255.154
  206.214.143.126
  206.214.217.188
-206.217.128.130
  206.217.128.132
  206.217.129.244
  206.217.129.94
@@ -55199,6 +54746,7 @@
  206.217.134.181
  206.217.134.184
  206.217.135.166
+206.217.138.209
  206.221.176.149
  206.221.176.87
  206.221.191.237
@@ -55215,7 +54763,6 @@
  206.252.192.8
  206.253.224.74
  206.253.226.7
-206.255.113.29
  206.29.180.76
  206.31.242.26
  206.41.173.108
@@ -55226,6 +54773,7 @@
  206.41.175.235
  206.41.175.38
  206.41.176.203
+206.41.176.241
  206.41.176.26
  206.41.177.158
  206.41.177.236
@@ -55249,13 +54797,14 @@
  206.41.187.208
  206.47.41.166
  206.54.209.61
+206.55.210.10
  206.55.74.0
-206.63.239.142
  206.71.228.129
  206.71.228.193
  206.72.195.231
-206.72.201.202
+206.72.197.164
  206.72.206.4
+206.74.101.70
  206.80.42.35
  206.81.1.200
  206.81.10.215
@@ -55265,7 +54814,6 @@
  206.81.149.147
  206.81.16.252
  206.81.17.70
-206.81.18.5
  206.81.19.217
  206.81.20.218
  206.81.23.70
@@ -55329,7 +54877,6 @@
  207.118.180.91
  207.118.181.117
  207.118.181.119
-207.118.181.138
  207.118.182.172
  207.118.182.196
  207.118.183.151
@@ -55498,6 +55045,7 @@
  207.180.202.254
  207.180.205.117
  207.180.207.205
+207.180.208.251
  207.180.217.42
  207.180.221.187
  207.180.223.239
@@ -55514,11 +55062,11 @@
  207.180.248.85
  207.180.250.228
  207.180.251.11
-207.180.255.139
  207.182.137.218
  207.182.154.178
  207.188.41.2
  207.189.250.78
+207.190.83.119
  207.191.165.8
  207.191.186.10
  207.191.26.202
@@ -55538,12 +55086,10 @@
  207.225.37.164
  207.228.240.76
  207.229.46.30
-207.230.100.110
  207.230.100.247
  207.231.235.145
  207.235.124.166
  207.236.211.36
-207.237.108.28
  207.237.127.163
  207.241.227.38
  207.241.229.212
@@ -55571,11 +55117,13 @@
  207.244.240.40
  207.244.251.210
  207.244.251.23
+207.244.252.148
  207.244.68.199
  207.244.70.35
  207.246.104.203
  207.246.104.231
  207.246.106.74
+207.246.113.213
  207.246.119.222
  207.246.120.203
  207.246.124.223
@@ -55604,7 +55152,7 @@
  207.30.207.4
  207.30.28.244
  207.30.28.246
-207.32.219.92
+207.34.208.72
  207.38.90.177
  207.46.13.0
  207.46.13.103
@@ -55718,7 +55266,6 @@
  207.7.108.203
  207.73.213.92
  207.74.74.6
-207.74.82.103
  207.81.31.205
  207.89.22.102
  207.96.90.42
@@ -55731,9 +55278,6 @@
  208.100.13.56
  208.100.170.91
  208.100.26.230
-208.100.32.120
-208.100.32.122
-208.100.32.123
  208.101.33.22
  208.101.5.28
  208.102.51.6
@@ -55756,6 +55300,7 @@
  208.109.190.141
  208.109.209.94
  208.109.248.165
+208.109.41.235
  208.109.53.185
  208.109.8.153
  208.109.8.97
@@ -55843,7 +55388,6 @@
  208.113.181.151
  208.113.182.208
  208.113.182.33
-208.113.200.18
  208.113.200.240
  208.113.200.242
  208.113.220.113
@@ -55890,9 +55434,7 @@
  208.116.25.29
  208.116.44.162
  208.116.50.118
-208.117.117.63
  208.118.245.141
-208.123.11.85
  208.123.119.107
  208.123.119.114
  208.125.16.254
@@ -55923,11 +55465,11 @@
  208.25.206.130
  208.255.161.107
  208.29.185.38
-208.30.116.46
  208.31.49.51
  208.38.133.39
  208.38.180.67
  208.38.237.219
+208.38.4.181
  208.43.13.149
  208.43.225.84
  208.43.225.85
@@ -55939,10 +55481,9 @@
  208.52.154.243
  208.52.161.177
  208.52.161.99
+208.52.5.176
  208.53.34.202
-208.53.99.29
  208.54.231.218
-208.58.39.98
  208.59.132.133
  208.59.170.5
  208.6.49.2
@@ -55969,7 +55510,6 @@
  208.71.173.74
  208.73.205.14
  208.73.21.13
-208.73.211.108
  208.74.205.40
  208.74.77.246
  208.76.252.198
@@ -55993,12 +55533,11 @@
  208.88.6.140
  208.89.214.167
  208.90.15.84
-208.90.184.101
-208.91.196.170
+208.91.196.182
  208.91.196.195
-208.91.197.11
-208.91.197.21
-208.91.197.49
+208.91.196.201
+208.91.197.26
+208.91.197.48
  208.91.198.102
  208.91.198.110
  208.91.198.220
@@ -56025,21 +55564,21 @@
  209.105.239.88
  209.105.243.145
  209.105.243.164
+209.107.196.166
  209.107.196.28
  209.107.204.103
  209.107.204.73
  209.107.210.164
+209.107.210.171
  209.107.210.180
  209.107.210.194
  209.107.210.210
  209.107.210.48
  209.107.214.195
-209.107.216.247
  209.11.246.11
  209.118.108.194
  209.118.108.196
  209.122.211.18
-209.124.55.40
  209.124.88.144
  209.124.90.241
  209.126.1.226
@@ -56055,7 +55594,6 @@
  209.126.76.205
  209.127.178.46
  209.127.179.9
-209.127.186.196
  209.127.20.106
  209.128.84.141
  209.13.96.163
@@ -56064,6 +55602,7 @@
  209.13.96.171
  209.13.96.172
  209.131.236.105
+209.137.225.132
  209.140.29.226
  209.141.33.119
  209.141.33.138
@@ -56116,6 +55655,7 @@
  209.141.53.10
  209.141.53.20
  209.141.53.219
+209.141.53.56
  209.141.53.73
  209.141.54.122
  209.141.54.153
@@ -56146,12 +55686,12 @@
  209.141.61.233
  209.141.62.139
  209.145.48.22
+209.145.49.96
  209.145.87.30bin.sh
  209.146.23.182
  209.15.158.30
  209.15.236.190
-209.150.240.168
-209.150.252.43
+209.150.243.144
  209.150.60.107
  209.151.224.239
  209.151.224.247
@@ -56162,14 +55702,18 @@
  209.160.54.26
  209.160.64.61
  209.160.72.40
+209.161.136.155
  209.163.117.86
-209.163.119.169
  209.163.160.253
  209.164.189.107
  209.169.166.148
  209.17.96.218
  209.17.96.226
-209.17.97.114
+209.17.96.74
+209.17.97.10
+209.17.97.50
+209.17.97.58
+209.171.90.19
  209.172.0.85
  209.172.40.10
  209.172.50.172
@@ -56196,7 +55740,6 @@
  209.190.46.193
  209.190.5.26
  209.194.236.25
-209.195.124.216
  209.198.180.142
  209.20.64.41
  209.200.23.116
@@ -56207,7 +55750,6 @@
  209.201.63.135
  209.201.63.141
  209.203.130.25
-209.203.130.59
  209.203.22.217
  209.205.221.162
  209.206.166.53
@@ -56243,7 +55785,6 @@
  209.235.136.115
  209.235.136.116
  209.236.117.207
-209.236.118.251
  209.236.123.42
  209.236.133.201
  209.236.228.26
@@ -56278,11 +55819,14 @@
  209.251.22.185
  209.31.182.178
  209.33.120.130
+209.33.227.198
  209.41.180.93
  209.41.67.169
  209.44.101.82
  209.44.113.34
  209.44.99.194
+209.45.111.194
+209.45.111.198
  209.45.61.108
  209.50.48.105
  209.50.48.123
@@ -56303,7 +55847,6 @@
  209.58.157.87
  209.58.168.52
  209.58.183.70
-209.59.137.137
  209.59.137.142
  209.59.138.182
  209.59.141.149
@@ -56375,7 +55918,6 @@
  209.97.158.250
  209.97.159.10
  209.97.160.168
-209.97.160.56
  209.97.161.222
  209.97.163.175
  209.97.165.196
@@ -56411,6 +55953,7 @@
  209.97.212.185
  209.99.131.146
  209.99.131.150
+209.99.131.157
  209.99.131.168
  209.99.131.209
  209.99.132.168
@@ -56422,7 +55965,6 @@
  209.99.132.73
  209.99.132.75
  209.99.132.84
-209.99.133.166
  209.99.133.85
  209.99.134.102
  209.99.134.126
@@ -56438,9 +55980,11 @@
  209.99.135.137
  209.99.135.166
  209.99.135.171
+209.99.135.197
  209.99.135.230
  209.99.135.253
  209.99.135.28
+209.99.135.32
  209.99.135.38
  209.99.135.43
  209.99.136.11
@@ -56452,15 +55996,11 @@
  209.99.168.239
  209.99.168.240
  209.99.168.3
-209.99.168.50
  209.99.168.72
  209.99.169.100
  209.99.169.105
  209.99.169.138
  209.99.170.123
-209.99.170.13
-209.99.170.159
-209.99.172.209
  209.99.173.82
  209.99.173.98
  209.99.174.92
@@ -56492,6 +56032,7 @@
  210.1.226.124
  210.1.82.194
  210.10.205.158
+210.10.208.238
  210.100.217.198
  210.103.187.19
  210.104.112.207
@@ -56508,7 +56049,6 @@
  210.113.179.42
  210.114.1.172
  210.114.17.198
-210.114.19.152
  210.118.170.11
  210.12.168.79
  210.12.27.226
@@ -56517,12 +56057,10 @@
  210.12.78.16
  210.121.223.61
  210.121.223.78
-210.123.1.78
  210.124.149.19
  210.125.92.58
  210.127.209.27
  210.127.209.30
-210.127.247.6
  210.127.249.145
  210.127.253.179
  210.127.253.247
@@ -56538,7 +56076,6 @@
  210.143.35.13
  210.146.36.62
  210.149.29.182
-210.149.70.82
  210.153.106.106
  210.16.100.8
  210.16.101.36
@@ -56546,13 +56083,13 @@
  210.16.102.68
  210.16.180.231
  210.16.187.206
-210.16.189.87
+210.16.189.4
  210.16.84.102
  210.16.84.182
  210.16.85.134
  210.16.85.142
  210.16.85.98
-210.16.88.219
+210.16.89.18
  210.165.156.91
  210.166.214.192
  210.166.230.64
@@ -56562,6 +56099,8 @@
  210.178.94.227
  210.179.11.208
  210.179.177.167
+210.18.133.185
+210.18.139.236
  210.180.118.162
  210.180.237.212
  210.182.148.126
@@ -56572,7 +56111,7 @@
  210.183.21.48
  210.183.46.232
  210.183.89.229
-210.186.98.58
+210.186.96.159
  210.187.189.107
  210.188.218.41
  210.19.212.234
@@ -56580,26 +56119,30 @@
  210.195.151.150
  210.195.187.128
  210.195.190.88
+210.195.243.100
  210.196.144.26
  210.2.157.130
  210.2.86.96
  210.200.161.132
  210.201.139.189
+210.203.210.163
  210.205.6.107
  210.205.6.171
  210.205.6.233
  210.205.8.250
+210.206.24.238
  210.206.92.137
  210.209.123.158
  210.209.125.65
  210.209.72.82
  210.209.89.74
  210.209.93.90
-210.21.121.200
  210.21.221.156
+210.210.117.95
  210.210.130.139
  210.210.136.147
  210.210.136.170
+210.210.185.185
  210.211.107.3
  210.211.111.85
  210.211.116.204
@@ -56612,7 +56155,7 @@
  210.212.253.227
  210.212.29.215
  210.212.68.213
-210.213.127.206
+210.212.97.186
  210.213.146.195
  210.213.240.230
  210.216.153.142
@@ -56620,7 +56163,6 @@
  210.219.173.21
  210.22.5.117
  210.220.150.170
-210.221.110.131
  210.221.124.147
  210.221.154.117
  210.222.86.19
@@ -56654,11 +56196,9 @@
  210.246.240.42
  210.246.243.70
  210.246.63.55
-210.251.213.165
-210.251.214.133
  210.255.240.125
  210.26.49.104
-210.26.49.89
+210.3.155.18
  210.3.176.42
  210.3.176.43
  210.3.176.44
@@ -56699,10 +56239,10 @@
  210.57.234.93
  210.57.237.70
  210.59.98.106
+210.6.150.39
  210.61.216.66
  210.61.28.106
  210.61.47.79
-210.65.47.133
  210.66.100.173
  210.66.16.184
  210.68.245.55
@@ -56710,11 +56250,11 @@
  210.72.91.6
  210.74.11.97
  210.76.64.46
+210.76.9.48
  210.89.176.166
  210.9.47.154
+210.91.3.210
  210.92.18.163
-210.92.18.172
-210.92.18.179
  210.92.18.25
  210.94.133.243
  210.96.116.236
@@ -56726,7 +56266,6 @@
  210676-dot-n-e-w-me-ss-age-po-rt-al.wl.r.appspot.com
  2109f.com
  210sadivorce.com
-211.1.211.59
  211.1.230.194
  211.101.18.158
  211.101.61.231
@@ -56739,12 +56278,14 @@
  211.106.56.88
  211.108.51.122
  211.108.69.103
+211.109.11.227
  211.110.125.62
  211.110.229.161
  211.110.44.63
  211.112.187.197
  211.114.134.118
  211.114.178.168
+211.114.187.69
  211.114.74.87
  211.115.110.64
  211.115.212.166
@@ -56761,7 +56302,6 @@
  211.121.191.53
  211.125.122.47
  211.136.100.154
-211.137.21.233
  211.137.225.102
  211.137.225.116
  211.137.225.120
@@ -56782,13 +56322,12 @@
  211.137.225.83
  211.137.225.96
  211.140.118.18
-211.140.196.90
+211.142.31.152
+211.142.44.83
  211.144.221.226
  211.144.68.45
  211.144.69.249
  211.147.26.186
-211.147.65.218
-211.149.152.250
  211.152.33.24
  211.155.225.104
  211.159.146.141
@@ -56827,18 +56366,17 @@
  211.192.95.167
  211.193.184.102
  211.193.31.52
+211.193.4.108
  211.193.60.137
  211.194.183.51
  211.194.20.45
  211.196.195.46
  211.197.103.127
-211.197.212.3
  211.197.34.175
  211.198.174.72
  211.198.180.137
  211.198.184.230
  211.198.240.52
-211.198.31.204
  211.198.90.77bin.sh
  211.199.153.194
  211.199.233.146
@@ -56846,11 +56384,11 @@
  211.20.145.202
  211.20.145.204
  211.20.154.102
-211.20.154.167
  211.20.176.82
  211.20.181.113
  211.20.238.33
  211.20.36.113
+211.200.60.111
  211.201.33.182
  211.202.2.220
  211.203.180.144
@@ -56859,13 +56397,12 @@
  211.204.244.88
  211.206.120.187
  211.206.124.179
+211.208.63.193
  211.21.104.173
  211.21.120.163
-211.21.182.37
  211.21.92.211
  211.210.219.71
  211.210.3.214
-211.211.184.191
  211.214.161.205
  211.215.18.93
  211.216.185.130
@@ -56891,17 +56428,19 @@
  211.222.69.222
  211.223.201.177
  211.223.205.250
+211.224.122.67
  211.224.166.251
+211.224.221.25
  211.227.155.206
  211.229.107.60
  211.229.19.45
  211.229.236.149
  211.229.30.62
  211.23.149.10
+211.23.45.39
  211.23.87.106
  211.230.156.161
  211.230.71.151
-211.230.94.88
  211.233.11.27
  211.233.16.217
  211.233.16.218
@@ -56916,7 +56455,6 @@
  211.234.122.76
  211.235.244.38
  211.236.157.57
-211.236.240.87
  211.236.43.200
  211.237.114.96
  211.237.120.13
@@ -56960,7 +56498,7 @@
  211.255.32.134
  211.255.32.19
  211.26.10.49
-211.26.187.128
+211.30.243.82
  211.34.252.96
  211.35.66.57
  211.35.66.61
@@ -56995,25 +56533,21 @@
  211.48.121.149
  211.48.194.11
  211.48.20.244
+211.48.75.147
  211.48.90.28
  211.48.90.28bin.sh
  211.49.225.146
  211.49.225.208
-211.49.242.69
  211.5.245.2
  211.50.170.252
-211.51.179.202
  211.55.116.245
  211.55.116.245bin.sh
-211.55.202.189
  211.56.15.42
  211.56.15.44
  211.56.15.46
  211.63.60.50
  211.63.71.72
  211.72.111.146
-211.72.86.169
-211.74.78.88
  211.75.194.88
  211.75.219.214
  211.95.27.50
@@ -57027,8 +56561,6 @@
  212.1.97.254
  212.100.129.238
  212.100.253.201
-212.100.50.142
-212.101.231.27
  212.102.118.90
  212.102.152.184
  212.102.152.6
@@ -57045,16 +56577,17 @@
  212.102.57.119
  212.102.57.131
  212.102.57.193
-212.102.57.201
  212.102.57.210
+212.102.61.71
  212.103.61.157
  212.103.61.160
-212.106.240.169
+212.107.233.222
  212.107.237.28
  212.107.238.101
-212.107.27.15
+212.107.27.144
  212.108.146.218
  212.108.216.5
+212.108.220.135
  212.108.5.60
  212.109.0.153
  212.109.192.155
@@ -57083,14 +56616,16 @@
  212.115.49.239
  212.115.51.55
  212.116.65.244
+212.116.86.206
+212.116.86.218
  212.116.94.217
  212.117.165.14
  212.117.170.192
  212.117.19.215
  212.119.190.162
  212.119.226.86
-212.119.44.181
-212.119.46.128
+212.119.44.58
+212.119.46.54
  212.12.114.34
  212.12.114.81
  212.12.18.203
@@ -57100,8 +56635,10 @@
  212.122.86.105
  212.124.114.242
  212.124.160.4
+212.124.6.143
  212.125.128.12
  212.126.102.142
+212.126.107.2
  212.126.108.172
  212.126.125.10
  212.126.97.83
@@ -57142,20 +56679,21 @@
  212.129.9.107
  212.129.9.233
  212.13.49.186
+212.133.198.36
+212.133.243.154
  212.14.104.104
  212.14.163.206
  212.142.104.138
  212.142.121.168
  212.143.230.27
  212.145.192.205
-212.146.195.160
-212.146.224.121
  212.146.241.36
  212.146.44.91
  212.149.202.12
  212.15.184.190
  212.154.250.21
  212.154.58.100
+212.154.58.102
  212.154.58.104
  212.154.58.105
  212.154.58.108
@@ -57167,7 +56705,7 @@
  212.154.58.98
  212.154.62.34
  212.154.83.100
-212.154.83.104
+212.154.83.105
  212.154.83.106
  212.154.83.107
  212.154.83.108
@@ -57182,19 +56720,19 @@
  212.156.133.218
  212.156.136.114
  212.156.17.218
-212.156.217.202
  212.156.55.34
  212.156.59.70
  212.156.86.130
  212.158.161.117
  212.158.163.67
  212.158.167.98
-212.159.110.81
+212.159.105.249
  212.159.61.155
  212.16.104.33
  212.16.64.224
  212.16.64.226
  212.16.64.86
+212.160.230.95
  212.160.66.194
  212.162.14.222
  212.162.151.144
@@ -57207,15 +56745,14 @@
  212.170.207.29
  212.172.38.61
  212.172.74.14
+212.174.187.83
  212.174.253.6
+212.174.54.142
  212.174.61.19
  212.175.113.250
  212.175.167.137
  212.175.87.57
  212.175.87.9
-212.179.200.192
-212.179.226.17
-212.184.132.226
  212.184.138.170
  212.185.62.33
  212.186.191.177
@@ -57234,11 +56771,13 @@
  212.199.61.51
  212.2.5.120
  212.20.73.70
+212.200.103.28
  212.200.118.98
  212.200.146.50
  212.200.212.50
  212.200.217.80
  212.200.236.42
+212.200.33.69
  212.200.34.202
  212.200.89.254
  212.205.112.162
@@ -57258,10 +56797,12 @@
  212.227.164.228
  212.227.164.87
  212.227.210.81
+212.227.211.160
  212.227.248.216
  212.227.253.11
  212.227.39.1
  212.227.54.144
+212.230.117.134
  212.230.136.235
  212.231.216.2
  212.231.60.98
@@ -57280,7 +56821,6 @@
  212.237.0.244
  212.237.10.57
  212.237.100.181
-212.237.118.183
  212.237.134.85
  212.237.15.70
  212.237.23.60
@@ -57304,8 +56844,10 @@
  212.24.107.243
  212.24.47.68
  212.241.14.104
+212.241.18.85
  212.241.70.213
  212.243.175.122
+212.244.23.165
  212.244.23.45
  212.247.113.115
  212.247.59.121
@@ -57314,9 +56856,11 @@
  212.250.127.10
  212.250.127.100
  212.250.127.111
+212.251.11.211
  212.252.63.247
  212.28.71.86
  212.28.84.105
+212.29.237.99
  212.3.109.7
  212.3.142.238
  212.3.146.80
@@ -57349,27 +56893,21 @@
  212.40.85.177
  212.40.87.20
  212.41.210.78
+212.42.113.250
  212.42.116.29
  212.42.117.207
  212.42.199.112
+212.42.211.79
  212.42.99.22
  212.42.99.32
+212.46.10.36
  212.46.255.78
-212.47.136.205
-212.47.136.222
+212.47.136.61
  212.47.137.44
-212.47.138.239
-212.47.139.69
  212.47.139.95
-212.47.140.150
  212.47.140.153
-212.47.140.253
-212.47.140.28
+212.47.140.229
  212.47.141.184
-212.47.141.36
-212.47.142.227
-212.47.143.212
-212.47.143.8
  212.47.220.165
  212.47.229.189
  212.47.229.4
@@ -57394,6 +56932,7 @@
  212.5.200.188
  212.5.214.210
  212.50.227.91
+212.50.94.43
  212.51.132.226
  212.51.136.133
  212.51.139.66
@@ -57408,19 +56947,21 @@
  212.52.131.9
  212.54.110.231
  212.56.194.238
+212.56.197.118
  212.56.202.198
  212.56.203.114
  212.56.211.138
+212.57.42.121
  212.58.200.126
  212.58.202.70
  212.59.11.66
  212.59.11.71
  212.59.30.110
  212.59.6.16
-212.60.162.178
  212.60.21.66
  212.60.5.220
  212.62.210.176
+212.62.217.206
  212.63.206.39
  212.64.1.170
  212.64.1.42
@@ -57431,10 +56972,12 @@
  212.64.14.185
  212.64.23.30
  212.64.25.106
+212.64.27.53
  212.64.29.136
  212.64.3.194
  212.64.32.67
  212.64.33.244
+212.64.36.88
  212.64.38.8
  212.64.4.3
  212.64.40.200
@@ -57472,6 +57015,7 @@
  212.68.244.157
  212.69.19.223
  212.69.218.47
+212.69.37.29
  212.7.20.104
  212.70.149.54
  212.70.149.70
@@ -57491,8 +57035,11 @@
  212.72.47.218
  212.73.131.30
  212.73.150.21
+212.73.68.156
  212.73.69.6
  212.75.22.200
+212.75.222.26
+212.77.138.161
  212.77.43.160
  212.79.169.50
  212.8.189.20
@@ -57503,7 +57050,6 @@
  212.8.250.141
  212.8.251.41
  212.80.219.11
-212.81.134.86
  212.81.208.102
  212.83.129.80
  212.83.130.32
@@ -57516,7 +57062,6 @@
  212.83.139.203
  212.83.140.195
  212.83.141.195
-212.83.144.11
  212.83.146.233
  212.83.150.172
  212.83.152.183
@@ -57545,7 +57090,6 @@
  212.86.114.74
  212.86.32.106
  212.86.97.111
-212.87.243.90
  212.89.173.216
  212.9.185.194
  212.90.166.34
@@ -57553,8 +57097,8 @@
  212.90.168.150
  212.90.58.56
  212.91.163.140
+212.91.177.139
  212.91.181.154
-212.91.184.5
  212.91.188.166
  212.91.91.242
  212.91.91.246
@@ -57566,12 +57110,14 @@
  212.92.123.55
  212.92.204.54
  212.92.23.235
+212.93.108.85
  212.93.109.186
  212.93.114.14
  212.95.110.30
  212.95.137.19
  212.95.142.64
  212.95.148.53
+212.95.180.50
  212.95.41.41
  212.96.34.143
  212.97.48.5
@@ -57594,12 +57140,9 @@
  213.105.29.14
  213.108.119.84
  213.108.18.34
-213.108.199.151
  213.108.200.11
  213.108.248.127
  213.108.249.127
-213.108.5.224
-213.108.5.226
  213.109.160.48
  213.109.162.199
  213.109.162.82
@@ -57614,7 +57157,6 @@
  213.111.197.81
  213.111.77.182
  213.113.250.106
-213.114.231.129
  213.114.234.199
  213.115.224.65
  213.115.254.197
@@ -57622,17 +57164,16 @@
  213.123.237.152
  213.123.60.59
  213.124.126.26
-213.124.184.182
  213.125.144.146
  213.125.67.108
-213.127.100.61
  213.127.189.18
-213.128.188.23
+213.129.34.100
  213.129.99.10
  213.131.7.103
  213.133.100.200
  213.133.81.2
  213.134.192.13
+213.134.208.90
  213.135.238.177
  213.135.4.164
  213.135.42.100
@@ -57661,6 +57202,7 @@
  213.14.25.68
  213.14.25.72
  213.14.25.76
+213.14.25.78
  213.14.31.122
  213.14.6.17
  213.14.6.2
@@ -57678,6 +57220,7 @@
  213.145.110.75
  213.145.137.102
  213.147.107.58
+213.147.118.56
  213.148.199.23
  213.149.103.132
  213.149.171.218
@@ -57687,12 +57230,10 @@
  213.152.161.101
  213.152.161.40
  213.152.176.162
-213.152.186.168
  213.154.0.120
  213.154.2.42
  213.154.3.102
  213.154.70.102
-213.154.80.21
  213.155.114.205
  213.155.3.216
  213.158.29.179
@@ -57706,7 +57247,6 @@
  213.16.99.243
  213.160.138.50
  213.160.150.239
-213.160.156.181
  213.160.91.138
  213.162.112.80
  213.162.22.190
@@ -57732,17 +57272,20 @@
  213.165.238.253
  213.165.242.22
  213.165.246.66
+213.166.154.182
  213.166.69.123
  213.166.78.148
+213.166.78.189
  213.166.79.176
  213.166.79.191
-213.167.195.233
+213.166.79.247
  213.167.202.58
-213.167.217.240
  213.168.187.27
  213.168.190.59
  213.168.210.76
+213.168.249.115
  213.168.88.138
+213.169.34.196
  213.171.196.14
  213.171.225.234
  213.171.37.206
@@ -57757,6 +57300,7 @@
  213.173.80.3
  213.173.93.228
  213.174.0.72
+213.174.10.58
  213.174.123.194
  213.174.156.71
  213.174.156.72
@@ -57769,7 +57313,6 @@
  213.176.60.74
  213.177.107.170
  213.178.155.74
-213.178.215.124
  213.178.252.28
  213.178.252.30
  213.178.28.118
@@ -57812,17 +57355,17 @@
  213.194.149.28
  213.194.168.204
  213.194.173.90
-213.194.99.235
  213.194.99.250
  213.195.127.45
+213.197.182.102
  213.198.161.64
  213.198.67.46
-213.199.198.85
  213.200.221.94
  213.202.212.78
  213.202.255.4
  213.202.35.178
  213.203.138.236
+213.204.120.88
  213.204.80.167
  213.206.249.181
  213.206.91.61
@@ -57830,19 +57373,23 @@
  213.207.92.226
  213.208.164.14
  213.208.191.82
-213.208.217.206
  213.210.67.186
+213.211.209.155
  213.215.0.122
+213.215.100.129
  213.215.24.158
  213.216.229.245
  213.216.48.21
  213.216.48.9
  213.216.80.33
+213.217.201.162
  213.217.229.34
+213.217.241.101
+213.217.43.66
+213.217.43.68
  213.218.137.112
  213.218.154.210
  213.218.204.46
-213.219.164.208
  213.219.210.178
  213.219.210.180
  213.219.210.182
@@ -57855,23 +57402,21 @@
  213.226.11.149
  213.226.114.189
  213.226.80.70
-213.227.135.173
-213.227.139.142
  213.227.154.145
  213.227.155.145
  213.227.57.58
  213.227.93.117
-213.228.74.83
+213.228.99.152
  213.229.125.87
  213.229.60.50
  213.229.86.240
  213.23.12.149
  213.230.107.202
  213.230.110.39
-213.230.127.140
+213.230.121.113
+213.230.127.139
  213.230.67.32
  213.230.69.33
-213.230.70.146
  213.230.71.0
  213.230.77.13
  213.230.96.243
@@ -57907,14 +57452,14 @@
  213.240.218.15
  213.241.53.122
  213.241.94.243
+213.241.94.245
  213.241.94.246
-213.243.228.170
  213.244.123.182
  213.244.8.59
  213.245.241.3
  213.247.197.142
  213.248.39.163
-213.249.110.212
+213.25.135.49
  213.250.21.112
  213.250.247.146
  213.251.132.198
@@ -57941,9 +57486,7 @@
  213.3.24.104
  213.3.25.204
  213.3.26.176
-213.31.57.105
  213.32.103.2
-213.32.103.54
  213.32.108.123
  213.32.111.52
  213.32.113.159
@@ -57984,9 +57527,7 @@
  213.37.205.33
  213.37.5.133
  213.39.55.13
-213.39.63.107
  213.4.38.162
-213.4.59.226
  213.42.28.185
  213.42.95.134
  213.46.85.185
@@ -58001,6 +57542,7 @@
  213.5.67.223
  213.52.129.250
  213.52.74.198
+213.56.166.35
  213.58.202.70
  213.59.135.87
  213.6.101.174
@@ -58018,7 +57560,6 @@
  213.6.188.214
  213.6.199.210
  213.6.199.94
-213.6.204.153
  213.6.204.241
  213.6.210.50
  213.6.218.86
@@ -58036,17 +57577,21 @@
  213.61.215.54
  213.61.220.144
  213.61.89.51
+213.64.150.182
+213.64.191.148
  213.66.116.248
  213.66.226.35
+213.67.79.18
  213.7.196.26
+213.7.208.27
  213.7.96.25
+213.76.166.90
  213.79.101.98
-213.8.246.218
+213.80.121.227
  213.80.160.166
  213.80.166.5
  213.80.225.40
  213.81.155.129
-213.81.161.155
  213.81.178.129
  213.81.178.130
  213.81.178.133
@@ -58070,19 +57615,19 @@
  213.81.178.190
  213.81.178.240
  213.81.178.243
+213.81.178.245
  213.81.178.246
  213.81.178.248
  213.81.178.253
  213.81.182.29
  213.81.203.66
-213.82.39.68
  213.86.150.242
  213.86.23.219
  213.86.4.51
+213.87.197.25
  213.87.245.215
  213.89.131.35
  213.89.131.53
-213.89.23.171
  213.91.187.242
  213.91.202.230
  213.91.221.54
@@ -58091,6 +57636,7 @@
  213.92.109.101
  213.92.118.159
  213.92.191.122
+213.92.204.140
  213.93.145.183
  213.93.176.58
  213.94.55.1
@@ -58124,6 +57670,7 @@
  216.114.108.65
  216.115.153.201
  216.115.227.160
+216.116.72.8
  216.117.136.95
  216.118.233.141
  216.118.233.142
@@ -58138,7 +57685,6 @@
  216.126.41.115
  216.126.41.89
  216.126.82.39
-216.127.164.142
  216.127.171.242
  216.13.56.89
  216.137.244.18
@@ -58926,12 +58472,11 @@
  216.151.163.114
  216.151.180.117
  216.151.180.135
-216.151.180.33
+216.151.180.225
  216.151.180.87
-216.151.183.124
-216.151.183.52
  216.151.183.70
  216.151.184.46
+216.151.191.45
  216.152.249.0
  216.152.249.1
  216.152.249.10
@@ -59450,7 +58995,7 @@
  216.157.21.35
  216.157.27.59
  216.158.192.32
-216.158.194.105
+216.158.194.60
  216.158.217.2
  216.158.226.150
  216.158.226.164
@@ -59495,7 +59040,6 @@
  216.176.190.232
  216.177.140.4
  216.177.141.15
-216.177.187.101
  216.177.193.90
  216.18.178.238
  216.18.201.130
@@ -59528,6 +59072,7 @@
  216.185.44.230
  216.186.133.172
  216.187.92.10
+216.188.250.178
  216.189.145.11
  216.189.153.207
  216.189.153.64
@@ -59536,12 +59081,10 @@
  216.191.44.114
  216.191.44.121
  216.193.128.54
-216.194.170.233
  216.195.17.30
  216.196.140.205
  216.199.232.112
  216.20.131.111
-216.200.107.94
  216.200.166.188
  216.207.207.150
  216.208.127.101
@@ -59553,6 +59096,7 @@
  216.215.152.170
  216.218.134.12
  216.218.15.48
+216.218.217.190
  216.218.221.201
  216.218.222.12
  216.218.222.14
@@ -59598,7 +59142,6 @@
  216.244.86.114
  216.244.87.179
  216.244.93.52
-216.245.193.22
  216.245.206.226
  216.245.220.19
  216.246.109.114
@@ -59614,17 +59157,20 @@
  216.251.20.209
  216.251.26.123
  216.251.83.79
+216.254.235.67
  216.27.60.2
  216.31.116.138
  216.36.51.150
  216.37.138.181
  216.38.129.164
+216.38.195.238
  216.38.52.171
  216.4.95.61
  216.4.95.62
  216.40.218.210
  216.41.233.253
  216.41.235.125
+216.41.235.180
  216.45.59.90
  216.47.196.104
  216.47.216.113
@@ -59633,11 +59179,16 @@
  216.49.225.186
  216.49.37.157
  216.49.54.211
+216.50.216.68
+216.50.216.70
+216.50.216.72
+216.50.216.80
  216.55.141.92
  216.55.146.49
  216.56.31.99
  216.56.48.245
  216.56.63.247
+216.57.167.214
  216.6.201.3
  216.6.230.16
  216.65.1.208
@@ -59686,10 +59237,11 @@
  2162e66b18eb.ngrok.io
  217.10.103.163
  217.10.103.170
+217.10.103.227
  217.10.144.19
-217.100.104.238
  217.100.189.106
  217.100.97.156
+217.103.102.96
  217.103.144.253
  217.103.94.158
  217.104.75.11
@@ -59699,8 +59251,6 @@
  217.107.197.240
  217.107.34.48
  217.107.71.14
-217.11.157.141
-217.11.157.92
  217.11.182.59
  217.11.225.189
  217.11.249.81
@@ -59712,7 +59262,6 @@
  217.112.21.78
  217.112.92.251
  217.113.114.80
-217.113.250.81
  217.114.212.26
  217.115.11.163
  217.115.213.186
@@ -59733,10 +59282,12 @@
  217.12.68.58
  217.120.202.189
  217.123.170.239
+217.123.190.54
  217.126.50.212
+217.127.133.214
  217.128.133.129
-217.128.179.60
  217.128.199.182
+217.128.216.68
  217.128.8.98
  217.129.143.86
  217.13.106.14
@@ -59754,10 +59305,9 @@
  217.133.58.148
  217.133.95.209
  217.136.13.236
-217.138.192.28
+217.138.192.100
  217.138.202.42
  217.138.205.162
-217.138.212.190
  217.138.221.72
  217.138.222.66
  217.138.252.188
@@ -59774,7 +59324,6 @@
  217.146.27.53
  217.146.76.212
  217.147.1.128
-217.147.165.79
  217.147.169.244
  217.147.25.78
  217.147.29.44
@@ -59782,6 +59331,7 @@
  217.148.89.86
  217.149.58.106
  217.149.7.232
+217.149.7.234
  217.15.117.26
  217.15.178.7
  217.15.195.141
@@ -59802,17 +59352,17 @@
  217.160.214.101
  217.160.239.186
  217.160.250.141
+217.160.251.151
  217.160.254.33
+217.160.42.149
  217.160.59.241
  217.160.59.64
  217.160.65.177
-217.160.69.194
  217.160.78.166
  217.163.11.111
  217.163.28.231
  217.168.76.230
  217.168.76.77
-217.169.16.126
  217.169.210.130
  217.169.211.50
  217.169.222.210
@@ -59827,14 +59377,18 @@
  217.170.206.146
  217.171.62.42
  217.171.66.171
-217.172.122.14
+217.172.122.10
+217.172.122.12
  217.172.122.16
+217.172.122.4
  217.172.179.138
  217.172.179.75
  217.172.186.250
+217.172.84.46
  217.173.202.37
  217.174.177.139
  217.174.248.162
+217.175.35.214
  217.18.216.89
  217.182.103.201
  217.182.131.4
@@ -59868,22 +59422,20 @@
  217.182.225.67
  217.182.23.55
  217.182.236.67
-217.182.250.191
  217.182.253.217
  217.182.253.249
  217.182.27.217
  217.182.30.160
  217.182.32.41
+217.182.32.42
  217.182.37.121
  217.182.38.130
  217.182.38.147
-217.182.42.222
  217.182.45.107
  217.182.54.204
  217.182.54.205
  217.182.54.210
  217.182.66.235
-217.182.67.242
  217.182.68.147
  217.182.68.93
  217.182.70.150
@@ -59898,16 +59450,17 @@
  217.194.6.58
  217.195.164.4
  217.195.202.34
-217.195.203.29
+217.195.203.28
  217.195.206.229
  217.196.212.150
+217.196.54.240
  217.196.64.12
  217.196.67.61
  217.197.160.186
  217.197.244.238
  217.197.244.243
  217.197.244.28
-217.197.244.61
+217.197.245.135
  217.197.245.234
  217.197.245.57
  217.199.160.224
@@ -59926,6 +59479,7 @@
  217.21.193.74
  217.21.54.173
  217.21.54.221
+217.21.60.36
  217.211.101.29
  217.211.51.143
  217.216.106.107
@@ -59933,6 +59487,11 @@
  217.218.233.164
  217.22.141.61
  217.22.60.25
+217.225.120.250
+217.229.145.144
+217.229.149.155
+217.229.149.94
+217.229.158.72
  217.229.48.139
  217.23.12.100
  217.23.12.47
@@ -59941,29 +59500,31 @@
  217.23.4.32
  217.23.5.68
  217.23.69.146
-217.23.74.198
  217.23.8.80
  217.23.81.223
+217.230.217.212
  217.230.223.121
-217.230.223.180
  217.232.151.226
  217.233.46.138
  217.237.112.101
  217.24.18.226
  217.24.240.68
  217.24.72.52
+217.245.94.126
  217.25.113.79
+217.25.162.41
  217.25.198.133
  217.25.221.60
  217.25.229.134
  217.25.25.246
  217.25.31.20
-217.250.115.106
-217.250.115.56
-217.255.187.89
+217.250.127.224
+217.251.137.250
+217.254.211.19
  217.26.163.82
  217.26.47.10
  217.27.117.136
+217.27.131.208
  217.27.193.106
  217.27.219.14
  217.29.126.136
@@ -59976,12 +59537,12 @@
  217.35.82.250
  217.37.30.218
  217.40.96.250
-217.42.207.180
  217.44.196.189
+217.55.155.244
  217.57.140.58
  217.6.21.170
-217.60.184.156
  217.60.184.171
+217.60.184.236
  217.60.184.25
  217.60.184.32
  217.60.185.136
@@ -59996,7 +59557,6 @@
  217.64.113.195
  217.64.133.220
  217.64.149.184
-217.64.2.185
  217.64.42.157
  217.64.42.35
  217.64.47.138
@@ -60012,6 +59572,7 @@
  217.69.133.9
  217.69.15.213
  217.69.2.73
+217.69.223.22
  217.69.4.204
  217.69.5.132
  217.69.5.25
@@ -60028,9 +59589,9 @@
  217.72.4.157
  217.73.143.168
  217.73.143.80
+217.73.81.133
  217.75.213.26
  217.76.45.235
-217.76.75.88
  217.77.221.209
  217.77.46.38
  217.77.62.21
@@ -60062,7 +59623,7 @@
  217.81.21.173
  217.86.210.82
  217.87.222.191
-217.9.50.45
+217.91.139.4
  217.91.215.177
  217.92.128.231
  217.92.44.164
@@ -60071,19 +59632,28 @@
  217.96.228.206
  217.97.73.173
  217538-dot-n-e-w-me-ss-age-po-rt-al.wl.r.appspot.com
+218.1.77.233
  218.101.202.186
+218.102.202.137
+218.103.131.4
+218.103.21.14
  218.103.37.55
  218.104.153.60
  218.106.167.102
  218.106.244.72
+218.107.0.165
  218.108.109.90
  218.108.140.245
  218.108.31.28
  218.108.32.102
  218.108.32.210
  218.108.39.210
+218.109.145.152
  218.11.10.252
+218.11.107.191
+218.111.23.24
  218.13.165.166
+218.13.56.222
  218.14.109.42
  218.14.208.90
  218.144.62.85
@@ -60095,16 +59665,15 @@
  218.148.103.136
  218.149.128.186
  218.150.109.3
-218.150.216.229
  218.150.243.158
  218.150.85.170
  218.152.150.177
  218.152.150.177bin.sh
  218.153.168.50
+218.153.235.208
  218.153.89.102
  218.154.222.46
  218.155.162.71
-218.155.199.58
  218.155.48.210
  218.155.48.210bin.sh
  218.156.226.141
@@ -60116,11 +59685,9 @@
  218.158.57.21
  218.159.85.196
  218.159.85.197
-218.159.85.198
  218.16.204.227
  218.161.39.151
  218.166.36.57
-218.17.162.119
  218.17.185.162
  218.17.185.223
  218.17.228.102
@@ -60133,17 +59700,19 @@
  218.188.39.51
  218.188.39.59
  218.189.19.30
+218.19.158.120
  218.19.164.115
  218.192.12.166
  218.193.191.123
  218.2.106.125
  218.2.53.161
  218.203.206.137
+218.204.160.122
  218.204.46.170
  218.206.233.198
-218.207.170.134
  218.208.209.217
  218.208.21.7
+218.208.8.132
  218.21.170.15
  218.21.170.20
  218.21.170.238
@@ -60164,14 +59733,20 @@
  218.21.171.51
  218.21.171.55
  218.21.171.57
+218.21.240.24
+218.21.254.3
  218.21.71.36
  218.21.78.35
+218.21.96.128
  218.212.171.35
+218.212.29.99
  218.213.137.21
+218.214.91.77
  218.217.114.239
  218.219.238.62
  218.219.99.184
  218.22.127.176
+218.22.183.236
  218.22.190.133
  218.22.27.14
  218.22.36.135
@@ -60192,10 +59767,9 @@
  218.241.234.48
  218.242.33.29
  218.245.1.169
+218.245.63.247
  218.246.20.221
  218.246.22.202
-218.247.40.100
-218.248.116.142
  218.248.232.24
  218.248.64.239
  218.249.175.227
@@ -60204,31 +59778,32 @@
  218.25.161.226
  218.25.89.99
  218.250.224.35
-218.253.81.214
  218.255.136.110
  218.255.151.12
+218.255.162.53
  218.255.226.166
  218.255.240.34
  218.255.242.114
  218.255.245.10
  218.255.86.29
-218.255.94.186
  218.26.101.226
+218.26.163.125
  218.26.172.61
  218.26.243.138
  218.27.202.183
  218.27.203.107
  218.28.108.237
-218.28.132.182
  218.28.133.53
-218.28.160.174
  218.28.238.162
  218.28.30.125
+218.28.49.68
+218.28.63.250
+218.28.77.206
  218.28.83.106
-218.28.98.161
  218.29.128.195
  218.29.139.3
  218.29.16.11
+218.29.165.154
  218.29.188.139
  218.29.188.169
  218.29.196.186
@@ -60239,6 +59814,7 @@
  218.29.85.98
  218.3.194.137
  218.3.223.134
+218.30.19.190
  218.30.21.209
  218.30.5.19
  218.30.91.130
@@ -60261,16 +59837,15 @@
  218.38.56.83
  218.39.130.113
  218.39.91.20
+218.4.217.14
  218.4.239.146
  218.4.62.141
  218.5.74.92
  218.50.52.241
  218.51.205.132
-218.53.142.200
  218.53.89.239
  218.54.123.239
  218.54.149.67
-218.54.175.51
  218.55.227.145
  218.56.11.181
  218.56.11.236
@@ -60278,7 +59853,6 @@
  218.56.160.82
  218.56.226.68
  218.56.65.232
-218.56.69.11
  218.56.71.164
  218.57.118.56
  218.57.210.226
@@ -60286,7 +59860,6 @@
  218.57.237.243
  218.57.51.87
  218.57.51.87bin.sh
-218.57.55.87
  218.57.81.236
  218.57.87.42
  218.58.104.202
@@ -60298,40 +59871,38 @@
  218.59.139.12
  218.59.14.132
  218.59.193.14
-218.59.235.26
  218.59.235.30
  218.59.34.248
  218.59.46.158
  218.59.98.138bin.sh
  218.59.98.44
  218.6.106.104
-218.6.160.15
+218.6.211.195
  218.60.22.20
  218.60.31.162
-218.60.41.136
  218.60.8.99
  218.61.194.13
  218.63.242.237
+218.64.218.43
  218.64.252.168
  218.64.57.12
  218.64.69.79
+218.64.84.73
  218.65.219.119
  218.65.221.24
  218.65.6.37
-218.66.81.90
-218.69.65.76
+218.66.253.195
  218.69.91.84
  218.70.148.133
  218.70.66.187
  218.71.141.62
  218.72.248.42
-218.72.49.84
  218.73.128.154
-218.73.135.80
  218.73.60.118
  218.75.110.41
  218.75.110.51
  218.75.121.74
+218.75.156.2
  218.75.156.247
  218.75.190.215
  218.75.210.46
@@ -60339,12 +59910,13 @@
  218.75.72.82
  218.75.77.92
  218.76.101.25
-218.76.159.239
  218.76.223.50
  218.76.52.120
  218.76.69.43
  218.76.8.99
+218.77.106.88
  218.77.108.48
+218.77.43.152
  218.78.104.127
  218.78.209.1
  218.78.209.241
@@ -60355,21 +59927,23 @@
  218.81.48.153
  218.81.52.172
  218.82.136.117
+218.84.125.8
+218.84.2.78
  218.84.236.94
  218.85.119.92
+218.85.22.67
  218.86.155.143
  218.86.31.67
  218.86.60.18
  218.86.87.171
  218.86.95.156
  218.87.254.235
-218.88.204.17
  218.88.205.3
-218.88.205.62
  218.88.215.49
-218.88.31.128
-218.88.31.165
-218.88.45.238
+218.88.24.158
+218.88.26.105
+218.88.27.169
+218.88.46.198
  218.89.222.16
  218.89.222.178
  218.89.81.109
@@ -60380,17 +59954,21 @@
  218.92.0.191
  218.92.0.192
  218.92.0.195
+218.92.0.198
+218.92.0.199
  218.92.0.200
  218.92.0.201
  218.92.0.202
  218.92.0.203
+218.92.0.204
+218.92.0.205
  218.92.0.206
  218.92.0.207
+218.92.0.208
  218.92.0.210
  218.92.0.211
  218.92.0.248
  218.92.150.130
-218.92.150.134
  218.92.173.58
  218.92.175.102
  218.92.192.170
@@ -60398,19 +59976,20 @@
  218.92.40.162
  218.93.119.90
  218.93.12.178
-218.93.14.42
+218.93.14.235
  218.93.172.55
  218.93.208.150
  218.93.21.43
  218.93.220.102
  218.93.225.150
  218.94.136.90
-218.94.149.234
  218.94.149.235
+218.94.19.226
  218.94.57.157
  218.94.71.198
  218.95.14.44
  218.95.175.166
+218.95.182.149
  218.95.182.38
  218.95.37.66
  218270aa6e0294fb7a7a4f77229e10301cd5aec3.info
@@ -60422,21 +60001,23 @@
  219.111.105.182
  219.111.2.38
  219.117.196.250
+219.117.198.120
  219.117.223.106
+219.117.254.114
  219.119.136.54
  219.121.0.60
  219.131.193.180
  219.133.177.109
+219.134.217.223
  219.134.218.248
  219.135.209.164
  219.135.97.82
  219.136.249.151
  219.137.113.64
-219.137.248.236
  219.137.248.36
-219.137.52.101
  219.137.74.24
  219.138.184.228
+219.139.131.21
  219.139.191.129
  219.140.115.133
  219.140.198.51
@@ -60453,64 +60034,40 @@
  219.147.74.48
  219.147.99.190
  219.148.31.135
-219.150.93.157
+219.148.39.218
  219.151.149.33
-219.151.151.202
+219.151.151.35
  219.151.152.196
  219.151.248.79
  219.151.9.139
  219.152.169.167
  219.152.170.58
-219.152.170.95
  219.153.100.153
  219.153.103.46
  219.153.20.224
-219.153.33.234
  219.154.102.109
-219.154.104.32
  219.154.105.253
+219.154.113.177
+219.154.119.236
  219.154.160.74
-219.154.228.155
  219.154.81.150
-219.154.81.241
-219.154.96.248
  219.155.210.213
  219.155.215.80
  219.155.23.198
-219.155.29.160
-219.155.37.18
-219.155.39.247
  219.155.69.108
-219.155.8.79
  219.155.96.191
  219.156.107.98
-219.156.161.4
-219.156.182.211
  219.156.188.241
-219.156.23.136
  219.156.62.111
  219.156.77.236
-219.156.9.204
-219.157.133.116
-219.157.133.79
  219.157.134.45
  219.157.168.233
-219.157.179.20
-219.157.180.166
-219.157.183.106
-219.157.204.252
-219.157.213.128
+219.157.20.15
  219.157.214.236
  219.157.221.183
  219.157.235.93
-219.157.241.180
-219.157.246.74
-219.157.251.185
-219.157.253.44
-219.157.27.216
  219.157.32.53
  219.157.36.105
-219.157.50.168
  219.157.54.191
  219.157.54.231
  219.232.124.237
@@ -60531,25 +60088,24 @@
  219.254.36.16
  219.255.134.109
  219.255.197.90
-219.255.230.95
  219.255.42.109
-219.59.165.54
  219.68.163.7
  219.68.2.48
  219.68.245.229
  219.69.110.49
  219.70.215.34
-219.74.195.86
  219.76.192.202
  219.76.200.27
  219.77.230.232
  219.79.154.231
-219.79.172.219
+219.79.232.167
  219.80.133.57
  219.83.125.35
+219.83.160.162
  219.83.191.104
  219.84.106.91
  219.84.234.73
+219.84.236.108
  219.84.28.244
  219.85.145.194
  219.85.145.194bin.sh
@@ -60562,16 +60118,22 @@
  219.90.174.233
  219.91.110.131
  219.91.153.198
+219.91.206.226
  219.91.241.15
  219.91.255.178
  219.91.255.179
  219.91.64.192
  219.92.103.234
  219.92.13.25
+219.92.154.18
  219.92.228.222
+219.92.40.96
+219.92.42.78
  219.92.59.93
  219.92.6.185
+219.92.80.199
  219.93.110.60
+219.93.121.62
  219.93.127.126
  219.94.128.174
  219.94.194.248
@@ -60591,31 +60153,28 @@
  21robo.com
  220-365.net
  220.110.145.21
+220.110.145.22
  220.116.55.86
  220.116.55.86bin.sh
  220.116.58.28
  220.117.141.40
-220.117.160.182
  220.118.168.155
-220.120.106.254
  220.120.15.27
-220.120.20.130
  220.121.112.170
  220.122.105.26
  220.122.253.188
  220.123.122.250bin.sh
-220.123.175.73
  220.123.235.22
  220.123.239.163
  220.123.241.30
  220.124.102.47
  220.124.192.178
-220.124.239.208
+220.124.240.66
  220.125.119.207
  220.125.223.105
  220.125.237.35
-220.127.198.153
  220.128.159.121
+220.129.29.45
  220.130.10.13
  220.130.148.106
  220.130.151.85
@@ -60644,6 +60203,7 @@
  220.143.161.233
  220.143.192.220
  220.143.70.100
+220.149.25.33
  220.158.216.101
  220.158.216.107
  220.158.216.121
@@ -60651,6 +60211,7 @@
  220.158.216.139
  220.158.216.15
  220.158.226.71
+220.160.64.56
  220.163.200.4
  220.164.118.16
  220.164.161.201
@@ -60665,32 +60226,33 @@
  220.168.240.227
  220.168.52.245
  220.169.127.172
-220.170.89.89
+220.170.195.204
  220.171.104.130
  220.171.93.62
+220.172.193.180
  220.173.160.221
  220.173.160.221bin.sh
  220.177.92.227
  220.178.171.184
  220.178.221.74
-220.179.231.168
+220.179.231.165
  220.179.231.197
+220.179.88.106
  220.180.112.208
  220.180.119.192
+220.180.169.154
  220.180.192.152
  220.180.192.77
-220.181.108.160
-220.181.108.84
+220.180.30.114
  220.181.187.187
  220.181.58.12
-220.181.77.162
-220.184.68.222
  220.185.195.156
  220.185.198.208
  220.185.215.165
-220.189.70.224
+220.189.116.248
+220.189.70.120
  220.189.71.201
-220.189.71.212
+220.189.71.30
  220.191.179.102
  220.194.140.38
  220.194.237.2
@@ -60701,19 +60263,19 @@
  220.210.140.71
  220.211.115.214
  220.225.126.55
+220.225.7.81
  220.225.87.129
  220.226.103.254
  220.226.188.32
  220.230.121.57
  220.231.127.7
-220.231.134.2
  220.233.149.34
  220.233.36.24
-220.235.186.6
+220.235.181.140
  220.240.102.198
-220.240.220.194
  220.245.124.14
  220.245.198.194
+220.245.238.93
  220.246.37.182
  220.246.66.166
  220.247.166.135
@@ -60730,17 +60292,13 @@
  220.250.50.90
  220.255.1.162
  220.66.155.2
-220.67.70.6
  220.70.43.145bin.sh
  220.71.140.168
  220.71.140.168bin.sh
-220.72.113.18
-220.72.184.133
  220.72.87.151
  220.73.134.140
  220.73.144.196
  220.73.162.48
-220.74.76.130
  220.74.98.214
  220.76.192.95
  220.76.205.178
@@ -60751,9 +60309,9 @@
  220.77.23.6bin.sh
  220.78.108.217
  220.78.170.103
-220.78.218.116
  220.78.28.68
  220.79.131.182
+220.79.156.40
  220.79.180.243
  220.79.34.109
  220.80.108.150
@@ -60765,11 +60323,11 @@
  220.83.67.225
  220.84.179.125
  220.85.104.202
+220.85.144.136
  220.85.144.169
  220.85.233.146
  220.86.227.220
  220.86.29.35
-220.87.29.2
  220.87.94.21
  220.87.94.21bin.sh
  220.88.1.208
@@ -60780,7 +60338,6 @@
  220.92.208.198
  220.92.208.230
  220.92.208.35
-220.94.220.106
  220.94.53.193
  220.94.66.153bin.sh
  220.94.87.179
@@ -60798,13 +60355,16 @@
  221.1.200.242
  221.1.220.185
  221.10.141.8
+221.11.33.158
  221.118.117.219
+221.12.100.170
  221.12.105.58
  221.120.189.209
  221.120.199.35
  221.120.98.49
  221.120.99.241
  221.121.12.238
+221.121.12.250
  221.121.145.137
  221.121.145.159
  221.122.119.50
@@ -60819,12 +60379,12 @@
  221.122.91.64
  221.122.91.65
  221.122.91.66
+221.122.91.71
  221.122.91.74
  221.122.93.178
  221.122.93.227
+221.124.76.201
  221.126.244.72
-221.13.183.119
-221.13.237.55
  221.131.165.119
  221.131.165.124
  221.131.165.85
@@ -60836,12 +60396,12 @@
  221.138.17.241
  221.139.0.56
  221.139.0.75
-221.139.207.238
  221.139.3.168
  221.139.50.13
-221.14.11.120
  221.14.122.28
  221.14.152.158
+221.14.6.29
+221.14.61.122
  221.14.7.241
  221.141.1.113
  221.141.253.171
@@ -60854,50 +60414,40 @@
  221.143.48.143
  221.143.48.34
  221.144.226.155
+221.145.202.130
  221.146.152.30
  221.146.28.163
  221.146.36.121
  221.147.217.184
  221.148.107.154
  221.148.123.67
-221.148.30.225
  221.148.45.168
  221.15.11.116
-221.15.124.61
-221.15.125.205
-221.15.143.14
  221.15.145.158
-221.15.146.80
  221.15.176.96
-221.15.189.213
  221.15.196.210
+221.15.198.237
  221.15.22.0
  221.15.22.137
  221.15.22.26
  221.15.224.195
-221.15.234.55
-221.15.254.71
  221.15.255.184
  221.15.4.174
-221.15.5.135
  221.15.54.162
  221.15.6.110
-221.15.61.136
-221.15.7.115
  221.150.22.201
  221.150.43.110
  221.151.207.173
  221.151.26.232
  221.152.34.222
+221.153.164.8
  221.153.211.94
  221.154.43.88
  221.156.114.167
  221.156.126.1
-221.156.143.20
  221.156.35.214
  221.158.33.13
  221.158.33.23
-221.159.155.120
  221.159.237.189
  221.159.237.189bin.sh
  221.159.47.113
@@ -60914,7 +60464,6 @@
  221.161.31.8
  221.164.122.198
  221.164.211.139bin.sh
-221.164.38.249
  221.165.13.155
  221.165.252.143
  221.166.250.205
@@ -60934,6 +60483,7 @@
  221.181.185.223
  221.181.185.29
  221.182.204.114
+221.182.31.54
  221.192.138.58
  221.192.199.35
  221.192.241.97
@@ -60941,8 +60491,6 @@
  221.195.1.201
  221.195.73.68
  221.195.73.86
-221.196.121.238
-221.198.173.252
  221.199.149.66
  221.2.157.133
  221.2.35.78
@@ -60955,7 +60503,6 @@
  221.204.177.58
  221.207.122.234
  221.209.17.222
-221.210.134.9
  221.210.211.102
  221.210.211.11
  221.210.211.12
@@ -60977,63 +60524,57 @@
  221.210.211.50
  221.210.211.60
  221.210.211.8
-221.210.80.133
  221.210.82.174
+221.210.9.82
  221.213.221.232
  221.213.26.61
  221.213.63.210
  221.214.110.130
-221.214.128.2
  221.214.130.215
  221.214.147.153
  221.214.154.68
-221.214.156.7
  221.214.160.207
  221.214.167.3
  221.214.212.149
  221.214.221.27
  221.214.225.157
  221.214.229.168
-221.214.254.224
  221.214.74.10
-221.214.9.158
  221.215.109.185
  221.215.149.34
  221.215.154.71
  221.215.167.86
-221.215.192.172
  221.215.199.46
-221.215.231.148
  221.215.233.153
  221.215.234.14
  221.215.235.3
+221.215.237.220
  221.215.5.225
  221.215.82.167
  221.215.82.87
+221.216.139.86
  221.216.142.174
  221.216.205.26
  221.216.95.120
  221.218.247.202
  221.218.6.146
+221.221.106.92
  221.223.26.158
  221.224.213.156
+221.224.28.51
+221.224.41.219
  221.225.126.57
  221.225.129.63
-221.225.170.96
-221.225.68.96
+221.225.70.143
+221.225.71.79
  221.225.81.86
-221.225.82.74
  221.225.83.45
  221.226.184.178
  221.226.196.131
  221.226.39.202
  221.226.48.102
  221.226.94.218
-221.227.106.237
-221.227.106.48
-221.227.109.59
-221.227.109.63
-221.227.111.93
+221.227.109.164
  221.227.125.75
  221.228.109.146
  221.228.240.130
@@ -61050,7 +60591,6 @@
  221.231.135.2
  221.231.139.168
  221.231.72.66
-221.232.131.40
  221.232.158.106
  221.234.218.225
  221.235.184.101
@@ -61059,16 +60599,13 @@
  221.235.79.146
  221.237.189.26
  221.238.32.130
-221.238.40.98
  221.239.206.120
  221.3.105.164
  221.3.27.182
  221.3.32.216
-221.3.32.250
  221.3.66.153
  221.3.87.204
  221.3.89.189
-221.3.89.221
  221.4.133.52
  221.5.11.110
  221.5.31.159
@@ -61100,6 +60637,7 @@
  222.104.57.220
  222.105.154.124
  222.105.26.35
+222.106.48.146
  222.106.82.48
  222.107.145.100
  222.107.156.227
@@ -61117,6 +60655,7 @@
  222.118.4.109
  222.119.28.7
  222.120.62.20
+222.121.50.229
  222.122.141.47
  222.122.157.111
  222.122.161.125
@@ -61137,7 +60676,6 @@
  222.124.155.106
  222.124.170.66
  222.124.200.250
-222.124.202.179
  222.124.30.138
  222.124.7.150
  222.126.154.49
@@ -61151,77 +60689,50 @@
  222.128.6.99
  222.128.60.162
  222.128.9.235
-222.134.31.199
+222.134.22.74
  222.134.91.170
  222.135.131.48
  222.135.176.219
-222.135.221.54
-222.135.223.189
-222.135.81.251
-222.135.85.169
-222.136.154.89
  222.136.212.112
-222.136.50.50
  222.137.0.44
-222.137.1.252
  222.137.120.141
-222.137.120.156
  222.137.120.37
-222.137.121.206
  222.137.122.142
  222.137.122.90
-222.137.132.164
  222.137.136.116
-222.137.136.199
  222.137.136.35
  222.137.137.238
  222.137.138.152
-222.137.138.168
  222.137.138.38
  222.137.138.5
  222.137.138.51
  222.137.138.58
  222.137.139.188
-222.137.139.21
  222.137.139.4
-222.137.173.17
-222.137.178.115
-222.137.182.57
  222.137.215.83
  222.137.233.24
-222.137.237.112
-222.137.28.196
-222.137.37.194
-222.137.5.3
  222.137.5.44
+222.137.73.115
  222.137.75.165
-222.138.114.41
  222.138.174.120
  222.138.174.182
  222.138.180.34
  222.138.181.119
  222.138.190.135
-222.138.201.95
  222.138.201.98
-222.138.218.167
  222.138.96.76
  222.139.209.19
  222.139.224.153
  222.139.245.70
  222.139.28.84
-222.139.59.197
-222.139.62.144
-222.140.174.228
+222.139.60.201
  222.140.19.172
  222.140.6.102
  222.140.72.174
-222.141.171.173
-222.141.251.20
-222.141.41.27
+222.141.46.180
  222.141.50.131
-222.141.9.144
  222.142.113.51
-222.142.210.245
+222.142.142.172
  222.142.211.190
  222.142.223.3
  222.153.112.136
@@ -61233,6 +60744,7 @@
  222.165.182.42
  222.165.194.67
  222.165.194.68
+222.165.205.254
  222.165.221.12
  222.165.221.9
  222.165.223.137
@@ -61241,21 +60753,24 @@
  222.165.233.250
  222.165.234.147
  222.168.18.227
-222.168.44.140
  222.169.185.239
  222.170.63.27
+222.171.243.27
+222.173.120.18
  222.173.242.30
+222.173.28.194
  222.173.82.126
  222.174.213.178
  222.174.213.180
+222.174.255.13
  222.174.56.114
  222.175.171.6
  222.175.5.114
+222.175.62.130
  222.179.125.77
  222.179.205.14
  222.179.215.189
  222.180.208.14
-222.180.250.42
  222.184.14.90
  222.184.254.170
  222.184.7.26
@@ -61306,13 +60821,14 @@
  222.187.190.50
  222.187.191.224
  222.187.221.88
-222.187.222.53
  222.187.222.55
  222.187.224.132
  222.187.232.190
  222.187.238.87
+222.187.238.97
  222.187.239.31
  222.187.60.56
+222.188.102.114
  222.188.131.220
  222.188.136.214
  222.188.190.206
@@ -61327,9 +60843,7 @@
  222.190.236.140
  222.190.254.130
  222.191.156.7
-222.191.176.79
-222.191.177.82
-222.191.178.105
+222.191.178.190
  222.191.234.30
  222.191.243.187
  222.195.93.60
@@ -61339,25 +60853,25 @@
  222.208.183.195
  222.208.183.218
  222.208.3.115
+222.211.148.83
  222.211.90.83
  222.212.238.30
  222.214.218.37
  222.214.48.252
+222.215.196.115
  222.215.50.156
  222.217.65.112
+222.217.65.21
  222.217.68.17
  222.222.185.242
-222.223.122.204
  222.223.162.77
  222.223.203.3
-222.223.212.78
  222.231.1.69
  222.231.3.128
  222.231.31.220
  222.231.60.131
  222.232.29.235
  222.234.103.90
-222.234.179.84
  222.234.2.152
  222.235.67.132
  222.236.220.146
@@ -61366,6 +60880,7 @@
  222.236.47.188
  222.236.47.23
  222.237.76.118
+222.238.173.192
  222.239.124.19
  222.239.223.75
  222.239.227.209
@@ -61373,7 +60888,6 @@
  222.239.255.101
  222.239.28.177
  222.240.1.0
-222.240.148.170
  222.240.184.126
  222.240.205.13
  222.240.223.85
@@ -61385,16 +60899,14 @@
  222.242.158.161
  222.242.182.166
  222.243.14.67
-222.243.213.59
  222.244.113.38
-222.244.132.94
  222.244.139.132
-222.244.142.61
  222.244.146.232
  222.246.111.216
  222.247.1.145
  222.247.84.30
  222.249.173.170
+222.249.234.100
  222.251.206.176
  222.252.144.249
  222.252.148.134
@@ -61415,6 +60927,7 @@
  222.58.151.67
  222.64.159.53
  222.64.226.66
+222.65.163.108
  222.70.181.55
  222.72.38.22
  222.73.114.78
@@ -61433,6 +60946,7 @@
  222.74.73.202
  222.75.1.197
  222.75.12.10
+222.77.212.227
  222.80.132.148
  222.80.148.4
  222.80.170.172
@@ -61449,6 +60963,7 @@
  222.82.213.123
  222.82.214.218
  222.82.246.162
+222.82.253.106
  222.83.120.226
  222.83.120.227
  222.83.120.228
@@ -61462,12 +60977,13 @@
  222.83.53.212
  222.83.68.37
  222.83.71.235
-222.84.117.30
  222.84.250.43
  222.87.177.3
  222.87.198.108
  222.87.198.114
+222.87.198.63
  222.87.198.78
+222.87.54.164
  222.87.54.4
  222.88.236.236
  222.88.64.94
@@ -61496,21 +61012,16 @@
  223.100.140.10
  223.100.166.3
  223.100.167.105
-223.11.63.224
  223.113.4.109
-223.13.87.136
  223.130.29.100
  223.130.29.137
-223.130.29.193
  223.131.82.2
  223.149.162.179
  223.149.184.31
+223.149.202.17
  223.149.51.208
  223.15.14.29
-223.150.112.140
-223.150.214.35
-223.150.229.1
-223.151.226.55
+223.151.126.199
  223.151.228.249
  223.152.129.113
  223.152.27.141
@@ -61519,7 +61030,6 @@
  223.154.81.219
  223.154.81.58
  223.16.229.241
-223.165.149.41
  223.165.241.9
  223.165.243.161
  223.165.243.209
@@ -61528,14 +61038,13 @@
  223.17.120.140
  223.17.215.76
  223.171.46.146
-223.171.71.50
  223.18.248.95
  223.18.5.147
  223.19.191.30
  223.19.48.25
-223.190.116.78
  223.191.34.173
  223.196.67.195
+223.197.135.155
  223.197.151.55
  223.197.175.171
  223.197.175.91
@@ -61544,18 +61053,23 @@
  223.197.188.206
  223.197.193.131
  223.197.242.160
+223.197.253.148
  223.197.56.102
  223.199.21.89
-223.204.179.29
+223.199.24.210
+223.199.25.73
  223.204.191.215
+223.204.233.181
  223.204.246.106
+223.204.64.246
  223.205.216.210
  223.205.222.14
  223.205.224.154
  223.205.228.172
  223.205.232.61
  223.205.90.100
-223.206.220.141
+223.206.21.40
+223.206.223.44
  223.206.225.175
  223.206.225.38
  223.206.226.244
@@ -61568,14 +61082,10 @@
  223.206.245.229
  223.207.224.168
  223.207.230.223
-223.207.243.168
  223.212.234.84
  223.212.5.29
  223.212.57.118bin.sh
-223.212.57.89
-223.212.73.105
  223.213.112.88
-223.213.133.38
  223.213.138.218
  223.214.71.73
  223.215.7.24
@@ -61583,24 +61093,24 @@
  223.220.143.231
  223.220.251.232
  223.221.36.149
-223.223.132.235
  223.223.142.16
  223.223.156.5
  223.223.176.184
  223.223.194.101
  223.225.169.107
-223.226.55.124
+223.226.0.200
+223.226.244.163
  223.229.172.223
+223.229.212.202
+223.230.13.224
+223.230.62.250
  223.233.68.46
  223.235.136.81
  223.235.14.155
-223.236.65.236
-223.24.148.219
-223.24.157.60
  223.240.104.222
  223.240.208.44
+223.240.209.226
  223.240.209.244
-223.240.65.72
  223.240.71.236
  223.241.118.11
  223.241.118.190
@@ -61610,15 +61120,15 @@
  223.241.78.218
  223.241.78.221
  223.241.78.67
+223.243.64.49
  223.244.96.55
+223.247.154.138
  223.247.156.49
  223.247.185.150
  223.247.194.119
-223.247.200.251
  223.247.201.32
  223.247.207.75
  223.247.218.112
-223.247.219.165
  223.247.33.150
  223.25.101.242
  223.25.111.8
@@ -61626,23 +61136,26 @@
  223.25.99.163
  223.25.99.37
  223.255.182.94
+223.255.225.226
  223.255.28.203
  223.26.16.175
  223.27.194.66
  223.27.255.174
+223.28.249.56
  223.29.204.242
+223.29.204.245
+223.31.191.50
  223.4.66.84
  223.68.190.130
  223.70.163.118
  223.70.163.90
  223.71.127.194
+223.71.150.228
  223.71.150.229
  223.71.150.78
-223.71.167.169
  223.72.51.194
-223.73.84.147
-223.75.175.52
  223.75.237.42
+223.80.100.87
  223.84.208.69
  223.85.197.58
  223.9.149.141
@@ -61653,12 +61166,12 @@
  223.93.188.234
  223.94.44.161
  223.95.112.107
+223.95.116.13
  223.95.86.157
-223.96.91.194
  223.99.170.130
  223.99.22.139
  223.99.22.141
-223.99.22.149
+223.99.3.82
  22334444.com
  224001.selcdn.ru
  224268.com
@@ -61688,7 +61201,6 @@
  23.100.41.141
  23.100.56.88
  23.101.11.35
-23.101.112.231
  23.101.137.61
  23.101.139.240
  23.101.164.210
@@ -61702,7 +61214,6 @@
  23.102.155.128
  23.102.160.69
  23.102.182.181
-23.102.36.108
  23.102.68.69
  23.104.158.15
  23.104.158.53
@@ -61713,6 +61224,7 @@
  23.105.157.198
  23.105.157.31
  23.105.157.82
+23.105.198.77
  23.105.203.158
  23.105.207.225
  23.105.213.174
@@ -61722,8 +61234,26 @@
  23.105.231.117
  23.105.231.120
  23.105.7.70
-23.105.86.22
-23.105.86.35
+23.105.71.202
+23.105.71.225
+23.105.71.234
+23.105.78.200
+23.105.78.211
+23.105.78.249
+23.105.86.10
+23.105.86.106
+23.105.86.109
+23.105.86.27
+23.105.86.30
+23.105.86.41
+23.105.86.49
+23.105.86.57
+23.105.86.65
+23.105.86.83
+23.105.86.84
+23.105.86.90
+23.105.86.93
+23.105.86.99
  23.106.124.196
  23.106.150.15
  23.106.159.187
@@ -61732,24 +61262,29 @@
  23.106.215.179
  23.106.216.131
  23.106.216.220
-23.106.219.28
+23.106.216.81
  23.106.223.127
  23.106.248.103
-23.106.27.251
  23.106.27.69
  23.106.60.132
  23.107.13.123
  23.108.15.160
  23.108.2.167
  23.108.2.65
-23.108.254.118
+23.108.254.156
  23.108.254.172
  23.108.254.174
  23.108.254.216
-23.108.42.204
-23.108.43.104
-23.108.43.252
+23.108.42.1
+23.108.42.15
+23.108.42.26
+23.108.42.32
+23.108.42.37
+23.108.43.102
+23.108.43.40
+23.108.43.95
  23.108.45.216
+23.108.45.239
  23.108.47.194
  23.108.47.201
  23.108.47.222
@@ -61757,15 +61292,13 @@
  23.108.47.86
  23.108.48.186
  23.108.48.68
-23.108.50.130
  23.108.50.150
  23.108.75.247
-23.108.86.211
  23.108.86.220
  23.108.86.236
-23.108.86.27
  23.108.93.104
  23.108.93.114
+23.108.93.148
  23.108.93.57
  23.108.93.69
  23.111.173.98
@@ -61833,14 +61366,13 @@
  23.133.5.241
  23.133.5.253
  23.136.64.8
-23.141.128.239
  23.141.240.206
  23.145.80.104
  23.146.240.230
  23.146.242.148
  23.148.145.13
+23.148.145.21
  23.148.145.235
-23.148.145.238
  23.148.145.240
  23.148.145.242
  23.148.145.26
@@ -61851,16 +61383,19 @@
  23.152.0.96
  23.154.160.216
  23.154.160.223
-23.154.160.226
  23.16.24.244
  23.160.192.125
  23.160.193.106
  23.163.0.100
  23.163.0.146
  23.163.0.62
-23.17.236.155
  23.17.9.24
-23.19.248.233
+23.19.10.101
+23.19.10.119
+23.19.10.69
+23.19.10.70
+23.19.7.174
+23.19.7.188
  23.20.126.138
  23.20.134.24
  23.20.165.224
@@ -61868,6 +61403,7 @@
  23.20.221.87
  23.20.240.200
  23.20.85.16
+23.20.91.64
  23.21.103.74
  23.21.185.95
  23.21.22.213
@@ -61879,6 +61415,7 @@
  23.22.178.111
  23.22.22.111
  23.22.241.231
+23.224.108.85
  23.225.169.106
  23.225.200.200
  23.225.207.179
@@ -61892,8 +61429,11 @@
  23.227.196.210
  23.227.201.165
  23.227.207.140
-23.228.101.16
+23.228.101.4
+23.228.101.7
  23.228.114.34
+23.228.115.41
+23.228.115.56
  23.228.125.180
  23.228.126.143
  23.228.192.206
@@ -61907,14 +61447,14 @@
  23.229.10.103
  23.229.109.117
  23.229.111.174
+23.229.114.59
  23.229.14.228
  23.229.22.121
  23.229.25.76
  23.229.25.92
  23.229.34.190
-23.229.34.233
-23.229.34.234
  23.229.34.84
+23.229.35.10
  23.229.35.24
  23.229.35.44
  23.229.35.71
@@ -61925,6 +61465,7 @@
  23.229.35.98
  23.229.40.215
  23.229.40.79
+23.229.45.136
  23.229.5.66
  23.229.55.153
  23.229.56.237
@@ -61932,23 +61473,26 @@
  23.229.57.146
  23.229.57.240
  23.229.58.169
-23.229.58.227
+23.229.58.17
+23.229.58.226
  23.229.58.230
  23.229.58.231
  23.229.58.28
  23.229.64.108
+23.229.64.217
  23.229.70.172
  23.229.73.152
  23.229.73.158
  23.229.73.176
  23.229.73.185
  23.229.73.217
+23.229.73.72
  23.229.75.47
-23.229.75.59
  23.229.76.28
  23.229.79.163
  23.229.88.161
  23.229.88.178
+23.229.92.184
  23.23.181.36
  23.23.185.97
  23.23.208.27
@@ -61964,6 +61508,9 @@
  23.231.32.163
  23.231.32.2
  23.231.32.225
+23.231.32.36
+23.231.32.42
+23.231.32.57
  23.231.34.105
  23.231.34.13
  23.231.34.152
@@ -61971,12 +61518,9 @@
  23.231.34.228
  23.231.34.254
  23.231.34.77
-23.231.37.101
-23.231.37.190
-23.231.39.169
+23.231.37.138
  23.231.39.220
  23.231.39.221
-23.231.39.253
  23.231.39.42
  23.231.39.91
  23.231.40.126
@@ -61988,6 +61532,7 @@
  23.235.221.57
  23.235.227.124
  23.235.252.194
+23.235.252.218
  23.235.253.41
  23.235.253.44
  23.236.126.45
@@ -61996,6 +61541,7 @@
  23.236.148.13
  23.236.148.80
  23.236.152.21
+23.236.152.26
  23.236.152.42
  23.236.156.221
  23.236.168.14
@@ -62006,7 +61552,6 @@
  23.236.210.196
  23.236.210.204
  23.236.210.219
-23.236.216.142
  23.236.216.253
  23.236.216.85
  23.236.221.203
@@ -62014,33 +61559,36 @@
  23.236.221.250
  23.236.221.39
  23.236.221.46
+23.236.221.59
  23.236.221.60
  23.236.221.64
+23.236.221.94
  23.236.223.169
  23.236.223.203
  23.236.223.29
  23.236.223.32
+23.236.223.35
  23.236.223.36
  23.236.223.5
+23.236.223.6
  23.236.223.7
  23.236.223.71
  23.236.223.92
  23.236.228.14
+23.236.228.201
  23.236.228.207
  23.236.228.246
-23.236.228.26
-23.236.228.7
+23.236.228.79
  23.236.229.1
  23.236.229.125
  23.236.229.211
  23.236.229.232
  23.236.229.239
  23.236.229.244
+23.236.229.92
  23.236.229.99
  23.236.230.34
  23.236.231.54
-23.236.232.162
-23.236.232.166
  23.236.232.196
  23.236.233.48
  23.236.238.24
@@ -62081,8 +61629,6 @@
  23.247.11.85
  23.247.129.202
  23.247.33.61
-23.247.42.10
-23.247.42.110
  23.247.5.46
  23.247.55.202
  23.247.97.117
@@ -62100,13 +61646,12 @@
  23.250.1.147
  23.250.108.156
  23.250.109.1
-23.250.11.250
  23.250.11.253
  23.250.118.23
  23.250.16.110
  23.250.16.19
  23.250.16.28
-23.250.17.226
+23.250.16.74
  23.250.24.59
  23.250.26.124
  23.250.26.22
@@ -62116,16 +61661,19 @@
  23.250.4.235
  23.250.42.180
  23.250.42.199
+23.250.42.220
  23.250.42.221
  23.250.42.244
  23.250.44.223
  23.250.49.222
  23.250.52.180
  23.250.56.224
+23.250.60.106
  23.250.60.109
  23.250.94.154
  23.250.94.221
-23.250.94.234
+23.250.94.226
+23.250.94.239
  23.251.149.109
  23.251.32.80
  23.251.55.234
@@ -62146,7 +61694,6 @@
  23.253.94.80
  23.254.10.185
  23.254.10.198
-23.254.10.211
  23.254.10.212
  23.254.10.218
  23.254.11.169
@@ -62155,7 +61702,6 @@
  23.254.132.185
  23.254.132.219
  23.254.153.122
-23.254.161.49
  23.254.164.208
  23.254.164.220
  23.254.164.76
@@ -62201,29 +61747,29 @@
  23.254.253.127
  23.254.4.111
  23.254.4.38
+23.254.4.59
  23.254.4.61
  23.254.47.141
+23.254.47.147
  23.254.47.156
  23.254.47.157
  23.254.47.98
  23.254.5.121
-23.254.55.119
  23.254.56.41
  23.254.56.55
-23.254.56.59
  23.254.56.62
-23.254.56.64
  23.254.56.79
  23.254.6.55
  23.254.6.61
  23.254.62.213
  23.254.65.113
  23.254.68.54
-23.254.82.110
  23.254.82.113
  23.254.82.121
  23.254.82.126
+23.254.82.225
  23.254.82.233
+23.254.82.83
  23.254.82.87
  23.254.82.91
  23.254.83.61
@@ -62240,30 +61786,60 @@
  23.4.43.27
  23.4buyuklergazete.com
  23.80.147.25
+23.80.149.4
  23.80.149.7
  23.80.97.102
  23.80.97.174
+23.81.127.103
+23.81.127.111
+23.81.127.123
+23.81.127.125
+23.81.127.141
+23.81.127.151
+23.81.127.154
+23.81.127.165
+23.81.127.171
+23.81.127.185
+23.81.127.187
+23.81.127.192
+23.81.127.21
+23.81.127.210
+23.81.127.224
+23.81.127.229
+23.81.127.231
+23.81.127.29
+23.81.127.33
+23.81.127.35
+23.81.127.52
+23.81.127.6
+23.81.127.67
+23.81.127.72
+23.81.127.74
+23.81.127.83
+23.81.127.87
  23.81.140.25
  23.81.140.30
  23.81.179.102
  23.81.227.171
-23.81.229.70
+23.81.229.102
+23.81.229.34
+23.81.229.85
+23.81.230.145
  23.81.230.148
-23.81.230.173
  23.81.232.88
  23.81.246.150
  23.81.246.166
  23.81.246.83
  23.81.27.114
+23.82.110.78
  23.82.28.105
  23.82.28.31
  23.82.28.42
  23.82.28.51
  23.82.28.69
-23.82.29.110
  23.82.29.151
+23.82.29.176
  23.82.29.51
-23.82.29.55
  23.82.44.69
  23.82.80.198
  23.82.80.234
@@ -62273,6 +61849,7 @@
  23.82.81.183
  23.83.133.250
  23.83.134.109
+23.83.179.167
  23.83.225.179
  23.83.231.153
  23.83.240.209
@@ -62292,8 +61869,9 @@
  23.90.28.185
  23.90.28.51
  23.90.28.59
-23.90.29.203
  23.90.29.227
+23.90.31.72
+23.90.40.190
  23.90.40.89
  23.90.40.9
  23.90.42.107
@@ -62316,6 +61894,7 @@
  23.94.103.40
  23.94.104.126
  23.94.104.26
+23.94.108.109
  23.94.108.115
  23.94.108.88
  23.94.123.242
@@ -62324,9 +61903,13 @@
  23.94.154.254
  23.94.154.41
  23.94.158.75
+23.94.158.91
+23.94.168.176
  23.94.17.200
  23.94.17.237
+23.94.175.22
  23.94.175.37
+23.94.176.177
  23.94.177.146
  23.94.177.148
  23.94.179.44
@@ -62341,14 +61924,12 @@
  23.94.190.119
  23.94.191.234
  23.94.20.158
-23.94.20.159
  23.94.20.163
  23.94.20.234
  23.94.204.102
  23.94.204.232
  23.94.206.177
  23.94.206.186
-23.94.206.189
  23.94.221.128
  23.94.228.74
  23.94.230.218
@@ -62358,7 +61939,6 @@
  23.94.4.152
  23.94.4.157
  23.94.4.224
-23.94.4.96
  23.94.4.98
  23.94.43.186
  23.94.47.103
@@ -62396,13 +61976,12 @@
  23.95.15.114
  23.95.182.150
  23.95.182.161
+23.95.182.190
  23.95.182.62
-23.95.185.215
+23.95.185.143
  23.95.185.219
  23.95.185.222
-23.95.185.34
  23.95.186.183
-23.95.188.172
  23.95.188.189
  23.95.200.157
  23.95.207.214
@@ -62414,9 +61993,9 @@
  23.95.226.107
  23.95.226.153
  23.95.231.200
-23.95.239.149
  23.95.239.201
  23.95.7.124
+23.95.81.36
  23.95.82.48
  23.95.89.71
  23.95.89.78
@@ -62428,24 +62007,23 @@
  23.95.97.187
  23.96.38.43
  23.96.53.62
-23.96.54.187
  23.96.54.209
  23.96.97.232
-23.97.154.104
  23.97.155.197
  23.97.180.45
  23.97.193.163
+23.97.225.206
  23.98.140.102
  23.98.191.127
  23.98.191.58
  23.98.216.241
+23.98.66.167
  23.99.10.223
  23.99.134.224
  23.99.196.41
  23.99.219.238
  23.99.221.5
  23.99.7.13
-23.99.97.154
  230-365.net
  2311046.carpicsediting.com
  23124234.smtpmouse.com
@@ -62495,6 +62073,7 @@
  24-7-supporting-link.world
  24-rw-in-ak-llc.net
  24.0.114.228
+24.1.228.202
  24.102.91.203
  24.103.166.34
  24.105.202.216
@@ -62503,8 +62082,6 @@
  24.106.226.216
  24.107.23.133
  24.109.248.25
-24.11.101.35
-24.11.124.75
  24.11.203.133
  24.111.39.66
  24.113.10.158
@@ -62524,15 +62101,15 @@
  24.113.238.213
  24.113.44.144
  24.113.92.37
-24.114.80.99
  24.116.202.31
+24.116.231.202
  24.116.90.152
  24.118.165.35
  24.12.184.19
  24.12.204.206
  24.120.10.18
  24.121.219.54
-24.121.29.92
+24.121.34.27
  24.122.28.67
  24.123.196.28
  24.123.20.50
@@ -62540,6 +62117,7 @@
  24.124.98.230
  24.125.254.207
  24.125.46.75
+24.125.91.128
  24.126.152.6
  24.126.7.19
  24.132.168.28
@@ -62549,11 +62127,11 @@
  24.134.42.229
  24.134.6.165
  24.135.207.56
-24.136.52.146
  24.137.76.62
  24.139.143.210
  24.139.143.226
  24.139.244.238
+24.14.180.241
  24.14.211.163
  24.141.166.152
  24.142.165.126
@@ -62561,6 +62139,7 @@
  24.143.76.121
  24.148.52.186
  24.148.98.177
+24.150.211.82
  24.153.190.114
  24.154.144.221
  24.154.160.24
@@ -62595,25 +62174,28 @@
  24.179.112.4
  24.179.13.119
  24.18.163.184
-24.18.77.142
  24.180.55.125
  24.181.205.134
-24.182.52.2
  24.184.0.146
  24.184.1.41
+24.185.0.106
  24.185.157.190
  24.185.159.118
  24.185.159.69
  24.185.179.244
  24.186.221.111
+24.186.87.106
  24.188.176.255
  24.189.48.184
  24.192.191.109
+24.192.245.64
  24.193.239.107
+24.193.64.139
  24.193.76.156
  24.196.138.163
  24.196.49.98
  24.196.88.234
+24.198.88.96
  24.2.117.135
  24.2.150.131
  24.2.154.151
@@ -62627,7 +62209,6 @@
  24.205.144.72
  24.205.215.192
  24.207.12.61
-24.209.164.31
  24.21.176.186
  24.21.229.157
  24.211.7.38
@@ -62645,29 +62226,28 @@
  24.22.122.39
  24.220.176.108
  24.220.5.235
-24.221.197.241
+24.221.19.31
  24.222.131.233
+24.222.164.76
  24.222.43.8
  24.226.68.134
-24.227.101.106
  24.227.47.162
-24.228.8.57
  24.229.161.228
+24.229.250.50
  24.23.133.203
  24.23.226.178
  24.230.124.78
  24.230.133.253
-24.230.215.40
  24.231.68.53
  24.231.70.85
  24.231.88.85
+24.232.118.60
  24.232.131.222
  24.232.227.50
  24.232.228.233
  24.232.36.99
  24.233.245.188
  24.234.133.205
-24.234.142.118
  24.234.175.131
  24.234.197.4
  24.234.50.44
@@ -62679,11 +62259,13 @@
  24.239.67.57
  24.240.96.140
  24.241.102.26
+24.241.243.153
  24.243.11.175
  24.244.157.205
  24.245.100.212
  24.245.121.47
  24.245.126.32
+24.245.227.211
  24.246.11.34
  24.248.207.7
  24.248.44.90
@@ -62693,17 +62275,19 @@
  24.249.17.108
  24.249.199.12
  24.249.199.14
+24.249.199.26
  24.249.199.4
+24.251.146.235
  24.251.77.26
  24.252.1.231
  24.252.140.29
+24.253.12.98
  24.253.146.50
  24.253.226.15
  24.253.9.109
  24.254.38.127
  24.255.192.211
  24.26.156.42
-24.29.205.226
  24.3.111.215
  24.30.124.181
  24.31.15.232
@@ -62722,16 +62306,18 @@
  24.39.154.236
  24.39.162.98
  24.39.181.18
+24.39.222.110
  24.39.5.26
-24.4.68.254
+24.4.88.103
+24.41.161.238
  24.42.167.242
+24.43.21.186
  24.43.32.186
  24.43.99.75
-24.45.199.162
+24.47.192.59
  24.47.90.156
  24.48.12.36
  24.4buyuklergazete.com
-24.5.111.241
  24.5.246.58
  24.51.219.223
  24.51.32.49
@@ -62741,19 +62327,18 @@
  24.54.211.91
  24.56.242.244
  24.57.227.242
-24.58.52.157
  24.6.173.249
  24.6.78.186
+24.60.1.125
  24.60.104.154
  24.62.213.192
  24.64.72.174
-24.64.80.162
  24.66.35.226
  24.68.94.168
  24.69.65.8
  24.70.96.78
  24.84.207.249
-24.84.29.147
+24.86.141.242
  24.86.184.66
  24.87.154.248
  24.87.71.106
@@ -62765,6 +62350,7 @@
  24.92.187.5
  24.97.165.106
  24.98.109.144
+24.98.86.219
  24.ogloszeniateraz97.club
  24073.xc.08an.com
  2415460e44bce092512caa5c73e4a5a6430da2f1.info
@@ -62880,9 +62466,11 @@
  26coder.net
  26v.cn
  27.0.158.183
+27.1.225.116
  27.1.245.16
  27.1.245.16bin.sh
  27.1.245.33
+27.1.253.142
  27.100.15.106
  27.102.102.139
  27.102.127.39
@@ -62904,15 +62492,13 @@
  27.105.198.65
  27.106.12.218
  27.106.18.218
+27.106.36.236
  27.106.84.186
  27.106.92.106
  27.109.115.140
-27.109.116.119
  27.109.116.171
  27.109.153.99
-27.11.21.238
  27.11.212.90
-27.110.177.189
  27.111.29.180
  27.111.35.13
  27.111.44.196
@@ -62928,7 +62514,7 @@
  27.116.51.92
  27.117.105.125
  27.117.105.125bin.sh
-27.12.223.83
+27.117.159.89
  27.120.109.165
  27.122.237.243
  27.122.56.147
@@ -62936,7 +62522,6 @@
  27.122.59.100
  27.122.59.86
  27.123.1.185
-27.123.171.65
  27.123.213.170
  27.123.213.172
  27.123.254.130
@@ -62945,8 +62530,11 @@
  27.123.3.140
  27.124.4.35
  27.124.43.81
+27.124.93.157
  27.125.136.147
  27.125.188.123
+27.125.203.215
+27.125.250.42
  27.126.179.44
  27.126.179.46
  27.126.188.205
@@ -62970,7 +62558,6 @@
  27.147.179.232
  27.147.183.49
  27.147.190.202
-27.147.202.97
  27.147.209.215
  27.147.210.35
  27.147.217.194
@@ -62980,14 +62567,14 @@
  27.148.165.23
  27.148.190.100
  27.148.208.14
-27.148.248.203
  27.150.170.26
  27.150.182.230
  27.150.22.155
  27.150.30.162
-27.152.73.62
+27.153.180.140
  27.153.181.253
  27.153.185.196
+27.153.254.70
  27.154.225.186
  27.154.32.202
  27.154.34.146
@@ -62999,10 +62586,13 @@
  27.155.77.93
  27.155.83.174
  27.155.97.12
+27.156.2.251
  27.156.4.179
  27.156.6.147
  27.156.72.6
+27.157.18.35
  27.158.161.91
+27.158.210.126
  27.159.72.85
  27.17.28.132
  27.184.217.107
@@ -63012,14 +62602,10 @@
  27.187.250.184
  27.187.251.203
  27.188.62.55
-27.19.196.128
-27.19.255.221
  27.191.234.69
  27.192.137.78
  27.193.105.154
  27.193.106.206bin.sh
-27.193.119.35
-27.193.132.73
  27.193.158.32
  27.193.189.201
  27.193.201.33
@@ -63029,10 +62615,8 @@
  27.193.253.146
  27.193.86.150
  27.193.89.119
-27.194.114.247
  27.194.129.92
  27.194.134.4
-27.194.138.66
  27.194.143.157
  27.194.157.123
  27.194.157.226
@@ -63041,7 +62625,6 @@
  27.194.164.63
  27.194.192.37
  27.194.226.245
-27.194.252.109
  27.194.252.247
  27.194.26.98
  27.194.36.216
@@ -63049,24 +62632,19 @@
  27.197.149.195
  27.197.211.233
  27.197.26.190
-27.197.28.210
  27.197.39.53
  27.197.83.147
  27.198.115.85
-27.198.22.182
-27.198.224.171
  27.198.33.255
  27.198.51.21
-27.199.160.22
-27.199.179.102
  27.199.192.250
  27.199.198.206
  27.199.79.91
  27.199.83.249
+27.2.113.180
  27.2.7.59
  27.200.1.139
  27.200.105.117
-27.200.168.40
  27.200.93.1
  27.201.110.238
  27.201.118.119
@@ -63075,9 +62653,9 @@
  27.201.191.126
  27.201.205.12
  27.201.244.14
-27.202.0.73
  27.202.137.28
  27.202.142.222
+27.202.151.37
  27.202.190.53
  27.202.2.207
  27.202.210.80
@@ -63092,11 +62670,8 @@
  27.203.128.182
  27.203.159.220
  27.203.167.160
-27.203.185.42
  27.203.25.103
  27.203.25.103bin.sh
-27.203.250.158
-27.203.255.139
  27.203.4.188
  27.203.42.58
  27.203.5.143
@@ -63106,18 +62681,15 @@
  27.203.97.11
  27.204.237.251
  27.204.242.5
-27.204.253.74
  27.204.254.155
  27.206.108.54
+27.206.177.12
  27.206.180.8
  27.206.183.206
-27.206.184.188
  27.206.220.118
  27.206.40.134
  27.206.66.103
-27.206.74.50
  27.207.12.223
-27.207.120.95
  27.207.180.93
  27.207.192.7
  27.207.197.49bin.sh
@@ -63127,18 +62699,14 @@
  27.207.54.110
  27.207.8.238
  27.207.86.225
-27.207.93.10
  27.208.11.250
  27.208.145.149
-27.208.146.188
-27.208.157.126
  27.208.163.180
  27.208.200.128
  27.208.205.154
  27.208.21.167
  27.208.35.110
  27.208.43.59
-27.209.104.154
  27.209.126.200
  27.209.153.236
  27.21.168.118
@@ -63149,13 +62717,10 @@
  27.210.146.169
  27.210.147.237
  27.210.173.204
-27.210.206.109
-27.210.227.10
  27.210.236.134
  27.210.246.189
  27.210.255.236
  27.210.35.107bin.sh
-27.210.36.56
  27.210.42.130
  27.210.55.84
  27.210.82.136
@@ -63164,10 +62729,7 @@
  27.213.148.166
  27.213.170.203bin.sh
  27.213.172.173
-27.213.175.209
-27.213.188.221
  27.213.208.35
-27.213.237.126
  27.213.244.125
  27.213.244.152
  27.213.252.208
@@ -63175,54 +62737,46 @@
  27.213.66.238
  27.213.84.41
  27.213.95.75
-27.213.99.44
  27.215.113.23
+27.215.113.36
  27.215.113.84
  27.215.122.212
-27.215.137.10
  27.215.140.240
  27.215.146.216
  27.215.148.27
-27.215.168.123
+27.215.171.107
  27.215.171.138
  27.215.171.57
  27.215.176.224
  27.215.193.110
  27.215.198.168
-27.215.216.184
  27.215.224.48
  27.215.228.253
  27.215.232.194
+27.215.245.134
+27.215.245.244
  27.215.245.98
  27.215.35.102
  27.215.54.234
-27.215.58.7
+27.215.57.111
+27.215.58.92
  27.215.61.73
  27.215.68.87
  27.215.83.51
  27.215.83.51bin.sh
-27.215.93.62
-27.216.112.91
  27.216.123.241
  27.216.129.117
-27.216.139.138
  27.216.174.156
  27.216.186.136
-27.216.187.143
  27.216.214.166
  27.216.214.38
-27.216.225.28
  27.216.227.58
  27.216.254.180
  27.216.48.72
-27.216.55.196
  27.217.136.68bin.sh
  27.217.138.46
  27.217.139.169
-27.217.155.141
-27.217.2.188
  27.217.213.201
-27.217.232.22
  27.217.242.231bin.sh
  27.217.31.245
  27.217.46.206
@@ -63230,7 +62784,6 @@
  27.217.54.35
  27.218.187.213
  27.219.124.153
-27.219.126.229
  27.219.126.249
  27.219.137.38bin.sh
  27.219.146.237
@@ -63238,32 +62791,24 @@
  27.219.178.44
  27.219.184.240
  27.219.184.57
-27.219.24.40
  27.219.254.146
-27.219.31.70
+27.219.41.172
  27.219.67.178
-27.219.85.200
  27.219.97.176
-27.220.123.108
-27.220.123.254
+27.220.122.147
  27.220.158.71
  27.220.170.180
-27.220.174.74
  27.220.206.236
-27.220.43.39
-27.220.45.101
+27.220.51.178
  27.220.87.121
  27.220.89.7
  27.220.94.247
  27.220.98.17
  27.221.18.26
  27.221.18.27
-27.221.225.186
  27.222.142.26
  27.222.143.116
-27.222.180.68
  27.222.203.117
-27.222.205.43
  27.222.242.112
  27.222.54.39
  27.222.76.194
@@ -63273,10 +62818,10 @@
  27.223.203.99
  27.223.230.215
  27.223.254.218
-27.223.44.106
-27.223.55.163
  27.223.89.238
+27.223.98.206
  27.223.99.130
+27.24.28.134
  27.24.29.111bin.sh
  27.24.29.251bin.sh
  27.24.30.46
@@ -63285,16 +62830,16 @@
  27.254.150.77
  27.254.206.238
  27.254.34.177
-27.254.46.67
  27.254.60.60
  27.254.95.199
+27.255.57.71
  27.255.58.34
  27.255.65.107
  27.255.75.150
-27.255.75.159
  27.255.75.163
+27.255.75.18
  27.255.75.19
-27.255.75.8
+27.255.75.9
  27.255.77.182
  27.255.79.116
  27.255.79.37
@@ -63302,20 +62847,19 @@
  27.255.81.140
  27.255.81.163
  27.255.94.166
-27.26.143.126
  27.28.71.118
  27.3.204.185
  27.3.41.234
+27.3.67.89
  27.30.4.118
  27.32.209.56
  27.32.42.128
  27.33.160.196
-27.34.10.217
  27.34.161.42
  27.34.20.87
-27.34.4.41
  27.34.47.231
  27.34.69.131
+27.34.69.246
  27.35.100.245
  27.35.104.17
  27.35.105.206
@@ -63335,10 +62879,8 @@
  27.35.58.5
  27.38.154.199
  27.38.60.107
-27.38.60.123
  27.38.61.82
  27.38.61.86
-27.41.10.243
  27.41.157.5
  27.41.158.204
  27.41.179.202
@@ -63348,18 +62890,14 @@
  27.41.204.88
  27.41.206.175
  27.41.218.40
-27.41.4.42
-27.41.6.205
  27.41.6.226
-27.41.6.234
-27.42.168.46
-27.44.107.195
  27.46.23.251
  27.5.112.81
-27.5.126.137
  27.5.32.191
  27.5.40.9
+27.5.41.179
  27.5.45.52
+27.5.47.69
  27.50.160.35
  27.50.164.114
  27.50.164.117
@@ -63372,10 +62910,10 @@
  27.54.118.235
  27.54.163.132
  27.54.166.212
-27.54.190.58
-27.56.136.65
-27.57.182.128
+27.55.79.247
+27.55.82.223
  27.6.104.60bin.sh
+27.6.177.9
  27.6.207.11
  27.6.30.211
  27.64.14.153
@@ -63384,6 +62922,7 @@
  27.69.241.47
  27.69.247.136
  27.69.25.112
+27.7.132.117
  27.7.143.136
  27.70.134.169
  27.71.227.142
@@ -63401,15 +62940,17 @@
  27.72.72.228
  27.72.72.48
  27.72.75.227
-27.74.245.175
+27.73.130.175
  27.74.247.135
  27.74.247.140
-27.74.71.246
  27.76.251.78
+27.77.213.175
+27.78.224.243
  27.78.25.204
  27.78.27.110
-27.79.147.232
+27.8.111.57
  27.8.235.240
+27.98.239.89
  272101.com
  27353.join78.ga
  2746.31cf4fdae.com
@@ -63686,10 +63227,13 @@
  3.0.172.253
  3.0.178.55
  3.0.22.9
+3.0.92.38
+3.0.97.94
  3.1.101.22
  3.1.201.76
  3.1.220.100
  3.10.5.123
+3.10.5.142
  3.10.70.38
  3.101.125.70
  3.101.67.35
@@ -63706,6 +63250,7 @@
  3.112.61.151
  3.113.172.125
  3.113.172.54
+3.113.23.117
  3.114.246.28
  3.114.58.183
  3.114.77.240
@@ -63722,6 +63267,7 @@
  3.120.37.138
  3.120.37.218
  3.120.99.93
+3.121.114.20
  3.121.203.141
  3.121.203.169
  3.121.203.211
@@ -63731,6 +63277,7 @@
  3.122.59.101
  3.123.19.130
  3.123.222.19
+3.123.236.170
  3.123.254.92
  3.123.26.194
  3.123.28.195
@@ -63766,6 +63313,8 @@
  3.14.163.152
  3.14.168.201
  3.15.140.156
+3.15.2.76
+3.15.21.115
  3.15.37.142
  3.16.1.181
  3.16.10.26
@@ -63811,7 +63360,6 @@
  3.221.155.232
  3.222.213.197
  3.224.147.129
-3.226.108.72
  3.227.11.183
  3.228.87.114
  3.23.227.175
@@ -63823,7 +63371,6 @@
  3.234.251.85
  3.235.183.241
  3.235.183.74
-3.235.190.217
  3.235.228.195
  3.236.226.212
  3.236.45.242
@@ -63834,7 +63381,6 @@
  3.237.47.155
  3.237.65.243
  3.238.8.21
-3.239.111.134
  3.248.223.135
  3.25.130.248
  3.25.97.204
@@ -63845,14 +63391,13 @@
  3.34.180.213
  3.34.189.221
  3.35.138.214
-3.35.14.53
  3.35.166.20
  3.35.168.137
+3.35.18.228
  3.35.40.175
  3.6.144.180
  3.6.206.209
  3.6.251.241
-3.6.38.76
  3.7.190.231
  3.8.101.127
  3.8.101.76
@@ -63870,9 +63415,9 @@
  3.8.9.247
  3.81.144.22
  3.81.208.241
+3.81.220.140
  3.81.67.195
  3.81.94.209
-3.82.141.14
  3.82.243.73
  3.82.58.104
  3.83.190.102
@@ -63892,6 +63437,7 @@
  3.94.249.60
  3.94.96.136
  3.96.126.235
+3.96.135.161
  3.96.170.113
  3.96.190.111
  3.96.218.124
@@ -63952,6 +63498,7 @@
  30yearsred.com
  30ywc.codesandbox.io
  31-31-199-49.ovz.vps.regruhosting.ru
+31.0.125.212
  31.0.255.84
  31.10.110.132
  31.10.148.224
@@ -63979,14 +63526,14 @@
  31.133.57.134
  31.134.121.223
  31.134.125.80
-31.134.143.197
  31.135.77.117
  31.135.91.9
+31.135.93.56
  31.14.136.210
  31.14.201.156
-31.14.241.244
  31.14.40.154
  31.14.40.19
+31.14.86.1
  31.145.111.25
  31.145.165.213
  31.145.166.27
@@ -64020,12 +63567,13 @@
  31.15.212.80
  31.15.88.72
  31.15.89.51
-31.150.157.19
+31.150.170.69
  31.150.211.185
+31.150.96.42
  31.153.101.140
+31.154.71.182
  31.16.176.69
  31.16.185.139
-31.16.19.42
  31.16.217.18
  31.162.152.3
  31.162.29.238
@@ -64035,11 +63583,12 @@
  31.163.176.228
  31.163.198.162
  31.163.202.55
+31.163.241.158
  31.164.104.12
  31.166.192.183
  31.166.247.86
+31.167.104.130
  31.167.240.226
-31.167.92.193
  31.168.157.167
  31.168.162.22
  31.168.168.167
@@ -64051,10 +63600,11 @@
  31.17.249.196
  31.17.70.80
  31.170.123.8
+31.170.139.234
  31.170.160.90
-31.170.165.53
  31.170.166.18
  31.170.173.73
+31.170.53.9
  31.170.61.199
  31.170.62.166
  31.170.62.210
@@ -64070,7 +63620,6 @@
  31.173.13.190
  31.173.138.204
  31.173.210.36
-31.173.241.98
  31.173.48.61
  31.173.82.62
  31.173.84.98
@@ -64078,23 +63627,22 @@
  31.173.85.37
  31.173.94.93
  31.176.172.81
-31.176.185.151
  31.176.188.146
-31.176.189.219
  31.178.150.200
  31.178.168.64
+31.178.171.177
  31.179.127.164
  31.179.131.246
  31.179.204.142
  31.179.224.42
  31.179.235.105
  31.179.247.161
-31.18.112.138
  31.18.117.156
-31.18.155.45
+31.18.161.230
  31.18.191.17
+31.18.250.210
+31.18.38.68
  31.181.116.57
-31.181.128.248
  31.181.93.197
  31.182.12.3
  31.182.13.17
@@ -64102,7 +63650,6 @@
  31.184.197.119
  31.184.198.75
  31.184.199.114
-31.184.204.43
  31.184.218.3
  31.184.224.90
  31.184.233.106
@@ -64113,31 +63660,34 @@
  31.186.26.130
  31.186.48.216
  31.186.83.248
+31.187.232.68
+31.19.224.198
  31.192.105.16
  31.192.128.148
  31.192.134.193
+31.192.154.197
  31.192.198.215
  31.193.124.70
  31.194.34.148
  31.195.76.3
-31.197.243.66
  31.20.193.52
+31.201.103.115
  31.201.13.250
  31.201.222.51
  31.201.236.49
  31.201.50.78
  31.202.101.40
-31.202.16.98
+31.202.223.104
  31.202.30.118
  31.203.250.221
  31.204.155.160
  31.204.180.44
+31.206.199.165
  31.206.38.40
  31.206.38.46
  31.206.38.48
  31.206.38.50
  31.206.38.55
-31.206.63.226
  31.207.33.100
  31.207.33.153
  31.207.44.34
@@ -64172,8 +63722,6 @@
  31.211.82.33
  31.214.157.247
  31.214.157.73
-31.215.73.236
-31.216.85.63
  31.220.0.186
  31.220.0.202
  31.220.0.203
@@ -64196,7 +63744,6 @@
  31.220.3.99
  31.220.4.124
  31.220.4.17
-31.220.4.50
  31.220.40.163
  31.220.40.236
  31.220.40.237
@@ -64220,8 +63767,10 @@
  31.220.61.75
  31.220.63.23
  31.221.95.5
+31.222.1.135
  31.222.12.22
  31.222.129.14
+31.222.6.25
  31.222.6.48
  31.222.6.61
  31.222.7.133
@@ -64231,7 +63780,6 @@
  31.222.7.57
  31.222.7.59
  31.222.7.68
-31.222.8.27
  31.223.34.234
  31.223.34.237
  31.223.34.238
@@ -64246,13 +63794,13 @@
  31.25.241.224
  31.25.246.206
  31.27.59.105
+31.28.161.20
  31.28.162.4
  31.28.163.51
  31.28.163.53
  31.28.172.16
  31.28.241.117
  31.28.27.44
-31.28.99.25
  31.29.99.227
  31.29.99.230
  31.3.135.181
@@ -64264,7 +63812,7 @@
  31.30.81.12
  31.31.11.139
  31.31.117.96
-31.31.29.169
+31.31.3.204
  31.31.6.158
  31.31.72.24
  31.31.74.47
@@ -64275,7 +63823,7 @@
  31.40.1.60
  31.40.135.67
  31.40.208.113
-31.40.208.58
+31.40.249.58
  31.40.253.39
  31.40.254.61
  31.40.255.33
@@ -64290,7 +63838,6 @@
  31.41.89.237
  31.41.92.154
  31.41.93.230
-31.42.173.15
  31.42.177.43
  31.42.177.97
  31.42.186.161
@@ -64298,10 +63845,13 @@
  31.42.254.24
  31.43.14.252
  31.43.140.190
+31.43.180.68
+31.43.3.247
  31.43.63.70
  31.44.12.233
  31.44.161.205
  31.44.184.50
+31.44.48.12
  31.45.199.156
  31.45.240.114
  31.45.240.154
@@ -64318,6 +63868,7 @@
  31.54.11.236
  31.6.11.120
  31.6.71.218
+31.60.141.215
  31.7.185.28
  31.7.3.57
  31.7.59.204
@@ -64326,7 +63877,6 @@
  31.7.61.188
  31.7.61.189
  31.7.61.190
-31.7.62.102
  31.7.62.115
  31.7.62.118
  310051-dot-n-e-w-me-ss-age-po-rt-al.wl.r.appspot.com
@@ -64464,12 +64014,9 @@
  34.121.149.22
  34.121.162.44
  34.121.191.59
-34.121.214.188
  34.121.220.45
-34.121.45.5
  34.121.56.218
  34.122.17.53
-34.122.18.76
  34.122.25.140
  34.122.32.203
  34.122.52.154
@@ -64477,7 +64024,6 @@
  34.123.160.251
  34.123.178.160
  34.123.213.165
-34.123.223.229
  34.123.255.76
  34.123.84.183
  34.125.112.156
@@ -64489,7 +64035,6 @@
  34.125.176.182
  34.125.177.239
  34.125.180.222
-34.125.183.133
  34.125.190.73
  34.125.46.3
  34.125.47.186
@@ -64514,6 +64059,7 @@
  34.195.96.196
  34.196.237.214
  34.196.72.89
+34.197.252.121
  34.198.101.191
  34.198.110.128
  34.198.253.38
@@ -64568,6 +64114,7 @@
  34.207.144.61
  34.207.165.167
  34.207.171.9
+34.207.195.22
  34.207.196.66
  34.207.212.175
  34.207.224.94
@@ -64637,6 +64184,7 @@
  34.212.191.195
  34.212.192.189
  34.212.202.231
+34.212.230.149
  34.212.255.95
  34.212.29.94
  34.212.83.125
@@ -64797,6 +64345,7 @@
  34.231.21.96
  34.231.234.150
  34.232.106.159
+34.232.120.177
  34.232.63.88
  34.234.149.96
  34.234.208.165
@@ -64813,6 +64362,7 @@
  34.235.198.68
  34.235.22.184
  34.235.57.135
+34.235.88.38
  34.236.113.58
  34.236.168.240
  34.236.169.124
@@ -64829,8 +64379,10 @@
  34.238.127.130
  34.238.138.127
  34.238.153.76
+34.238.166.63
  34.238.174.178
  34.238.193.141
+34.238.193.169
  34.238.39.172
  34.238.58.137
  34.239.0.159
@@ -64901,6 +64453,7 @@
  34.248.48.8
  34.249.105.79
  34.249.130.99
+34.249.158.199
  34.249.165.68
  34.249.172.87
  34.249.184.215
@@ -64957,7 +64510,6 @@
  34.64.209.210
  34.64.211.116
  34.64.213.1
-34.64.218.102
  34.64.219.206
  34.64.233.186
  34.64.243.112
@@ -64981,21 +64533,24 @@
  34.65.68.114
  34.65.71.81
  34.66.68.153
+34.67.158.14
  34.67.175.232
  34.67.186.17
  34.67.224.244
  34.67.51.20
-34.68.114.57
  34.68.165.103
  34.68.180.110
  34.68.210.208
  34.68.243.140
-34.68.97.70
+34.69.1.28
  34.69.106.155
  34.69.253.72
  34.69.69.205
+34.69.79.83
+34.70.103.152
  34.70.109.189
  34.70.138.19
+34.70.150.94
  34.70.196.248
  34.70.217.179
  34.70.219.55
@@ -65008,7 +64563,6 @@
  34.72.163.246
  34.72.42.133
  34.72.53.156
-34.72.72.122
  34.72.85.73
  34.73.101.96
  34.73.71.43
@@ -65022,8 +64576,8 @@
  34.75.54.59
  34.76.14.99
  34.76.203.45
+34.76.60.69
  34.76.95.40
-34.77.168.63
  34.78.103.223
  34.78.14.25
  34.78.159.8
@@ -65080,6 +64634,7 @@
  34.87.112.13
  34.87.117.102
  34.87.126.179
+34.87.136.247
  34.87.140.178
  34.87.160.10
  34.87.160.111
@@ -65095,7 +64650,6 @@
  34.87.53.100
  34.87.6.228
  34.87.61.90
-34.87.7.26
  34.87.70.59
  34.87.75.75
  34.87.88.54
@@ -65116,7 +64670,6 @@
  34.90.157.209
  34.90.160.87
  34.90.70.223
-34.91.110.254
  34.91.127.26
  34.91.140.191
  34.91.188.86
@@ -65132,7 +64685,8 @@
  34.92.247.201
  34.92.27.145
  34.92.29.25
-34.92.41.62
+34.92.55.136
+34.92.70.174
  34.92.87.60
  34.92.95.72
  34.93.116.89
@@ -65141,6 +64695,7 @@
  34.93.152.123
  34.93.175.206
  34.93.177.66
+34.93.181.167
  34.93.185.190
  34.93.204.215
  34.93.206.77
@@ -65154,7 +64709,6 @@
  34.94.187.145
  34.94.201.103
  34.94.246.180
-34.94.247.253
  34.94.255.160
  34.94.29.47
  34.94.30.169
@@ -65166,6 +64720,7 @@
  34.95.164.161
  34.95.165.1
  34.95.17.184
+34.95.209.45
  34.95.223.61
  34.95.29.216
  34.95.38.162
@@ -65235,15 +64790,13 @@
  35-23-4532-34.com
  35-40konkatsu.net
  35.0.127.52
-35.129.134.190
  35.129.213.177
-35.134.94.153
  35.137.236.32
-35.138.248.129
+35.142.163.228
  35.142.207.246
+35.143.154.58
  35.143.99.174
  35.152.37.200
-35.153.102.107
  35.153.133.181
  35.153.168.135
  35.153.203.202
@@ -65338,7 +64891,6 @@
  35.164.151.193
  35.164.16.145
  35.164.161.132
-35.164.186.73
  35.164.200.151
  35.164.43.55
  35.164.45.9
@@ -65351,6 +64903,7 @@
  35.165.198.33
  35.165.231.142
  35.165.232.48
+35.165.239.97
  35.165.24.132
  35.165.242.14
  35.165.33.31
@@ -65505,6 +65058,7 @@
  35.178.99.158
  35.179.76.180
  35.180.103.8
+35.180.122.204
  35.180.129.212
  35.180.135.246
  35.180.146.207
@@ -65568,7 +65122,6 @@
  35.183.60.98
  35.183.61.192
  35.184.116.118
-35.184.117.117
  35.184.128.99
  35.184.139.145
  35.184.144.99
@@ -65620,7 +65173,6 @@
  35.188.134.17
  35.188.14.97
  35.188.153.75
-35.188.164.246
  35.188.186.244
  35.188.191.27
  35.188.194.225
@@ -65648,7 +65200,7 @@
  35.189.84.191
  35.190.139.73
  35.190.165.76
-35.190.196.200
+35.190.193.19
  35.190.200.254
  35.192.113.118
  35.192.131.204
@@ -65730,18 +65282,17 @@
  35.198.155.181
  35.198.162.31
  35.198.182.228
-35.198.195.1
  35.198.203.184
  35.198.205.123
  35.198.209.255
  35.198.228.240
+35.198.39.30
  35.198.48.176
  35.198.49.11
  35.198.58.34
  35.199.10.191
  35.199.107.158
  35.199.117.232
-35.199.122.191
  35.199.123.23
  35.199.159.226
  35.199.190.33
@@ -65774,6 +65325,7 @@
  35.200.71.247
  35.200.75.228
  35.200.77.30
+35.200.83.50
  35.200.95.220
  35.200.97.57
  35.201.13.82
@@ -65813,34 +65365,18 @@
  35.205.117.63
  35.205.22.29
  35.205.83.203
-35.206.168.27
-35.207.149.98
  35.207.65.42
  35.208.134.190
-35.208.251.120
-35.208.59.255
  35.209.158.181
-35.209.176.126
  35.209.209.15
-35.209.217.190
-35.209.29.157
-35.209.33.211
+35.209.251.229
  35.209.51.212
-35.209.88.12
  35.209.9.189
-35.209.99.146
  35.211.2.103
  35.211.251.190
-35.212.180.253
-35.213.149.152
+35.212.163.36
  35.213.164.234
-35.213.167.58
  35.213.18.190
-35.213.184.155
-35.213.185.189
-35.214.158.233
-35.214.183.12
-35.214.247.216
  35.216.73.53
  35.220.138.138
  35.220.147.109
@@ -65848,7 +65384,6 @@
  35.220.179.119
  35.220.191.191
  35.220.199.212
-35.220.199.63
  35.220.209.206
  35.220.212.29
  35.220.221.203
@@ -65869,9 +65404,9 @@
  35.223.145.37
  35.223.167.122
  35.223.255.227
-35.223.80.237
  35.224.1.26
  35.224.107.234
+35.224.124.158
  35.224.132.48
  35.224.144.160
  35.224.160.36
@@ -65911,6 +65446,7 @@
  35.227.60.169
  35.227.64.238
  35.227.77.27
+35.228.114.224
  35.228.132.48
  35.228.169.211
  35.228.173.101
@@ -65980,7 +65516,6 @@
  35.234.7.71
  35.234.78.228
  35.235.89.230
-35.235.96.109
  35.236.118.211
  35.236.12.131
  35.236.125.18
@@ -66026,9 +65561,10 @@
  35.239.212.255
  35.239.229.191
  35.239.42.76
+35.240.155.72
  35.240.189.61
  35.240.204.250
-35.240.234.239
+35.240.216.169
  35.240.252.177
  35.240.7.194
  35.241.116.147
@@ -66036,7 +65572,6 @@
  35.241.66.61
  35.242.148.200
  35.242.205.19
-35.242.214.242
  35.242.218.196
  35.243.156.63
  35.243.174.84
@@ -66095,7 +65630,6 @@
  35sjo60r.lcrsystems-inc.com
  35tolaeaia7.visualizarfatura.me
  35y.2c8.myftpupload.com
-36.102.204.34
  36.102.208.158
  36.102.232.2
  36.103.223.61
@@ -66124,12 +65658,11 @@
  36.110.39.217
  36.111.145.226
  36.112.104.194
+36.112.128.203
  36.112.133.190
  36.112.150.9
  36.112.172.125
  36.133.112.61
-36.133.131.185
-36.133.131.190
  36.133.37.3
  36.133.37.4
  36.133.37.6
@@ -66141,22 +65674,22 @@
  36.134.155.34
  36.134.27.190
  36.134.42.245
+36.134.6.95
  36.134.69.8
  36.134.72.246
  36.152.142.45
  36.152.26.250
  36.152.38.149
-36.153.231.18
+36.153.84.53
  36.154.110.46
  36.154.118.47
  36.154.37.158
  36.159.117.27
+36.187.96.14
  36.189.253.226
-36.22.178.114
  36.22.187.34
  36.227.171.220
  36.227.175.60
-36.227.4.183
  36.229.7.108
  36.231.201.150
  36.231.69.25
@@ -66176,6 +65709,7 @@
  36.25.228.115
  36.25.243.251
  36.25.243.51
+36.25.43.35
  36.250.175.95
  36.250.203.94
  36.250.229.115
@@ -66183,11 +65717,9 @@
  36.250.229.92
  36.250.5.117
  36.251.157.225
-36.251.18.2
  36.251.52.129
  36.251.66.253
  36.251.68.194
-36.251.98.247
  36.255.104.1
  36.255.104.17
  36.255.104.9
@@ -66195,7 +65727,6 @@
  36.255.156.126
  36.255.156.78
  36.255.211.1
-36.255.233.178
  36.255.234.20
  36.255.61.190
  36.255.85.227
@@ -66215,10 +65746,13 @@
  36.255.87.240
  36.255.87.247
  36.255.87.250
+36.255.90.219
+36.255.96.67
  36.26.194.61
  36.26.194.83
  36.26.210.57
  36.26.68.112
+36.26.84.45
  36.27.114.223
  36.27.208.157
  36.27.5.237
@@ -66241,8 +65775,6 @@
  36.35.161.156
  36.35.161.7
  36.35.164.52
-36.35.218.243
-36.35.7.132
  36.36.243.67
  36.37.104.98
  36.37.112.210
@@ -66261,18 +65793,22 @@
  36.37.191.185
  36.37.242.67
  36.37.73.245
+36.37.74.60
  36.37.81.135
  36.37.98.113
  36.39.18.226
+36.41.74.127
  36.43.65.41
-36.48.166.159
+36.48.128.232
  36.48.168.238
+36.49.158.219
+36.49.158.255
+36.49.159.96
+36.49.92.138
  36.5.253.214
  36.55.230.146
-36.56.152.239
  36.56.191.197
  36.57.70.137
-36.6.56.8
  36.65.16.90
  36.65.173.7
  36.65.199.190
@@ -66282,7 +65818,6 @@
  36.66.126.219
  36.66.132.90
  36.66.133.19
-36.66.137.249
  36.66.140.15
  36.66.146.93
  36.66.149.211
@@ -66304,7 +65839,6 @@
  36.66.216.81
  36.66.216.82
  36.66.231.113
-36.66.235.70
  36.66.242.146
  36.66.242.148
  36.66.243.115
@@ -66317,6 +65851,7 @@
  36.66.61.7
  36.66.7.137
  36.66.83.203
+36.66.98.10
  36.66.98.232
  36.66.98.233
  36.66.98.234
@@ -66332,6 +65867,7 @@
  36.67.128.145
  36.67.144.61
  36.67.153.58
+36.67.158.49
  36.67.16.253
  36.67.163.146
  36.67.168.117
@@ -66374,7 +65910,6 @@
  36.67.80.19
  36.67.82.242
  36.67.84.235
-36.67.86.183
  36.67.88.77
  36.67.89.179
  36.67.93.209
@@ -66382,36 +65917,38 @@
  36.68.100.181
  36.68.121.135
  36.68.129.205
+36.68.13.5
  36.68.14.147
+36.68.217.69
+36.68.219.191
  36.68.42.14
-36.68.43.152
+36.68.53.137
  36.68.63.166
+36.69.3.133
  36.69.62.119
-36.7.159.17
  36.7.159.60
+36.7.175.86
+36.7.67.235
  36.7.69.56
  36.7.87.126
+36.70.250.240
+36.70.254.219
  36.70.26.19
-36.71.112.49
-36.71.137.228
-36.71.139.67
-36.71.141.146
  36.71.153.178
-36.71.233.241
  36.71.233.80
  36.71.235.126
  36.71.235.183
  36.71.237.112
  36.71.239.147
  36.71.239.96
-36.71.77.77
  36.72.10.63
+36.72.111.99
  36.72.14.69
-36.72.215.8
  36.72.236.35
  36.72.37.172
  36.72.48.151
  36.72.57.115
+36.73.144.93
  36.73.176.235
  36.73.22.199
  36.73.247.189
@@ -66421,40 +65958,46 @@
  36.74.101.96
  36.74.144.83
  36.74.148.66
-36.74.18.107
  36.74.27.23
-36.74.44.174
+36.74.44.161
+36.74.48.132
  36.74.75.31
  36.75.16.40
-36.75.19.203
  36.75.212.60
  36.75.67.161
  36.76.89.130
  36.77.109.97
  36.77.17.182
+36.77.221.89
+36.77.251.81
+36.77.35.125
  36.77.45.165
  36.77.95.203
  36.77.95.230
  36.78.210.176
-36.78.97.35
  36.79.155.82
  36.79.20.187
-36.79.20.214
  36.79.213.135
  36.79.223.204
-36.79.251.192
-36.79.35.210
+36.79.248.254
+36.79.249.31
+36.79.251.151
  36.80.125.115
  36.80.139.118
  36.80.161.100
  36.80.34.225
  36.80.36.57
+36.80.48.9
+36.80.74.65
+36.81.15.235
  36.81.151.56
  36.81.223.185
  36.81.255.22
  36.81.9.24
+36.82.106.238
  36.82.144.35
  36.82.179.100
+36.82.195.179
  36.83.177.227
  36.83.186.101
  36.83.237.106
@@ -66464,14 +66007,17 @@
  36.84.100.210
  36.84.100.230
  36.84.59.53
+36.84.80.31
+36.85.105.14
  36.85.123.161
-36.85.130.9
+36.85.21.216
+36.85.218.215
  36.85.222.236
  36.85.91.95
  36.88.60.154
  36.89.10.51
  36.89.105.61
-36.89.11.173
+36.89.106.69
  36.89.119.149
  36.89.122.240
  36.89.129.183
@@ -66509,6 +66055,7 @@
  36.89.190.85
  36.89.191.119
  36.89.191.217
+36.89.193.109
  36.89.193.169
  36.89.193.181
  36.89.193.73
@@ -66519,6 +66066,8 @@
  36.89.227.98
  36.89.228.201
  36.89.229.97
+36.89.233.127
+36.89.234.229
  36.89.237.170
  36.89.237.172
  36.89.240.9
@@ -66533,7 +66082,6 @@
  36.89.55.95
  36.89.65.253
  36.89.68.38
-36.89.71.23
  36.89.76.119
  36.89.77.147
  36.89.77.252
@@ -66545,14 +66093,13 @@
  36.89.93.28
  36.89.94.139
  36.89.99.98
+36.90.122.138
  36.90.122.172
  36.90.122.181
  36.90.123.171
  36.90.123.173
  36.90.123.254
  36.90.123.89
-36.90.14.64
-36.90.15.185
  36.90.16.64
  36.90.16.90
  36.90.171.214
@@ -66560,22 +66107,26 @@
  36.90.172.32
  36.90.172.51
  36.90.173.132
+36.90.173.137
+36.90.173.2
  36.90.173.249
  36.90.173.36
  36.90.181.124
  36.90.19.89
  36.90.233.19
-36.90.234.241
  36.90.251.127
  36.90.254.189
  36.90.29.68
-36.90.36.6
+36.90.32.187
+36.90.36.167
+36.90.36.178
+36.90.36.89
  36.90.40.162
  36.90.40.216
  36.90.41.142
  36.90.42.119
+36.90.43.161
  36.90.43.239
-36.90.43.251
  36.90.48.243
  36.90.51.134
  36.90.51.176
@@ -66587,10 +66138,8 @@
  36.90.62.129
  36.90.63.110
  36.90.63.169
-36.90.64.126
  36.90.64.209
  36.90.67.245
-36.90.68.38
  36.90.81.240
  36.90.84.61
  36.90.9.100
@@ -66605,7 +66154,6 @@
  36.91.160.171
  36.91.192.114
  36.91.194.25
-36.91.194.29
  36.91.207.65
  36.91.218.130
  36.91.36.155
@@ -66613,6 +66161,7 @@
  36.91.45.10
  36.91.48.186
  36.91.54.25
+36.91.61.181
  36.92.10.95
  36.92.109.147
  36.92.111.143
@@ -66633,7 +66182,6 @@
  36.92.246.170
  36.92.33.194
  36.92.35.73
-36.92.43.107
  36.92.68.141
  36.92.68.145
  36.92.70.209
@@ -66654,6 +66202,7 @@
  36.94.217.171
  36.94.23.90
  36.94.23.91
+36.94.37.66
  36.94.43.122
  36.94.43.124
  36.94.43.130
@@ -66664,16 +66213,17 @@
  36.94.8.19
  36.94.81.147
  36.94.82.147
-36.95.1.161
  36.96.12.49
  36.96.184.215
+36.97.143.172
+36.99.160.161
  36.99.163.230
  36.99.164.90
+36.99.165.71
+36.99.169.141
  36.99.34.108
-36.99.35.61
  36.99.40.139
  36.99.41.29
-36.99.46.128
  360.lcy2zzx.pw
  360925443516409-dot-wetransfer-auth-file333.appspot.com
  360corona.com
@@ -66951,17 +66501,16 @@
  37.109.3.250
  37.110.133.102
  37.110.66.21
-37.111.136.142
  37.111.42.210
  37.112.35.163
  37.113.130.109
+37.113.183.8
  37.113.184.86
  37.113.24.141
  37.113.47.145
  37.114.149.20
  37.114.61.73
  37.115.112.150
-37.115.113.0
  37.115.190.73
  37.115.191.132
  37.115.193.27
@@ -66974,19 +66523,17 @@
  37.120.140.134
  37.120.143.164
  37.120.143.168
-37.120.143.173
  37.120.143.174
  37.120.143.53
  37.120.143.60
  37.120.146.26
-37.120.155.179
+37.120.155.104
  37.120.171.27
  37.120.176.61
  37.120.192.154
  37.120.193.184
  37.120.193.185
  37.120.193.231
-37.120.193.232
  37.120.200.100
  37.120.200.102
  37.120.200.104
@@ -66995,10 +66542,8 @@
  37.120.200.108
  37.120.200.109
  37.120.200.110
-37.120.200.41
  37.120.200.99
  37.120.203.131
-37.120.203.172
  37.120.203.71
  37.120.204.252
  37.120.205.84
@@ -67007,19 +66552,20 @@
  37.120.217.54
  37.120.218.106
  37.120.218.110
+37.120.218.113
  37.120.218.115
  37.120.218.120
  37.120.218.124
-37.120.218.86
  37.120.218.88
  37.120.218.90
  37.120.222.44
  37.120.235.154
-37.120.60.119
+37.122.190.19
  37.128.107.98
+37.13.209.24
+37.130.155.126
  37.130.202.92
  37.130.227.133
-37.130.29.74
  37.131.164.102
  37.131.164.124
  37.131.164.39
@@ -67032,7 +66578,7 @@
  37.131.30.210
  37.133.129.0
  37.134.238.244
-37.138.200.42
+37.135.147.2
  37.139.0.44
  37.139.1.197
  37.139.102.73
@@ -67042,7 +66588,6 @@
  37.139.15.38
  37.139.16.206
  37.139.16.229
-37.139.17.137
  37.139.17.71
  37.139.19.78
  37.139.19.89
@@ -67063,7 +66608,6 @@
  37.139.31.50
  37.139.4.240
  37.139.4.69
-37.139.42.34
  37.139.43.9
  37.139.5.134
  37.139.5.94
@@ -67084,12 +66628,11 @@
  37.144.247.180
  37.144.65.114
  37.146.63.79
-37.146.71.254
  37.147.174.213
  37.148.159.91
+37.15.208.46
  37.15.209.166
  37.15.210.176
-37.15.211.52
  37.152.163.35
  37.152.176.65
  37.152.181.144
@@ -67105,10 +66648,14 @@
  37.157.193.84
  37.157.212.109
  37.157.253.35
+37.159.126.250
  37.159.208.218
-37.159.9.197
+37.159.66.85
+37.162.46.173
+37.163.172.5
  37.17.12.32
  37.17.12.33
+37.17.131.68
  37.17.14.59
  37.17.16.61
  37.17.168.163
@@ -67119,10 +66666,10 @@
  37.17.182.24
  37.17.38.196
  37.17.56.44
+37.17.72.50
  37.17.9.140
  37.17.9.28
  37.179.206.158
-37.179.65.107
  37.182.202.122
  37.183.10.222
  37.183.188.131
@@ -67155,7 +66702,6 @@
  37.187.124.25
  37.187.127.114
  37.187.129.166
-37.187.129.23
  37.187.130.92
  37.187.132.113
  37.187.132.31
@@ -67183,20 +66729,20 @@
  37.187.19.226
  37.187.196.218
  37.187.196.70
-37.187.197.220
  37.187.2.199
  37.187.2.31
  37.187.21.2
  37.187.21.81
  37.187.22.60
-37.187.226.82
  37.187.23.106
  37.187.25.137
  37.187.252.148
+37.187.3.112
  37.187.34.191
  37.187.39.210
  37.187.5.202
  37.187.50.99
+37.187.53.168
  37.187.53.180
  37.187.54.45
  37.187.54.67
@@ -67215,6 +66761,7 @@
  37.187.78.196
  37.187.79.227
  37.187.80.217
+37.187.91.7
  37.187.94.86
  37.187.95.218
  37.187.96.183
@@ -67228,8 +66775,10 @@
  37.193.125.103
  37.193.227.16
  37.195.209.169
+37.195.51.49
  37.196.26.48
  37.200.77.123
+37.200.80.70
  37.201.116.60
  37.201.118.103
  37.201.139.93
@@ -67241,15 +66790,14 @@
  37.205.8.78
  37.205.81.41
  37.205.9.252
-37.208.181.252
+37.208.66.130
  37.208.68.130
  37.209.12.181
  37.209.81.220
-37.21.119.113
+37.21.116.145
  37.21.179.187
  37.211.158.240
  37.211.19.161
-37.212.136.63
  37.212.138.205
  37.212.158.16
  37.212.182.90
@@ -67257,11 +66805,9 @@
  37.212.252.97
  37.212.41.233
  37.212.8.236
-37.213.122.0
  37.213.229.124
  37.214.181.208
  37.214.67.130
-37.215.244.186
  37.215.9.127
  37.218.191.190
  37.218.245.25
@@ -67282,7 +66828,9 @@
  37.221.198.57
  37.221.204.206
  37.221.209.222
+37.223.238.12
  37.223.33.149
+37.224.58.61
  37.228.129.2
  37.228.129.5
  37.228.241.125
@@ -67305,7 +66853,6 @@
  37.235.206.211
  37.235.212.243
  37.235.220.140
-37.235.221.243
  37.235.252.223
  37.235.48.172
  37.235.55.45
@@ -67313,10 +66860,10 @@
  37.236.146.218
  37.236.167.250
  37.236.224.225
-37.236.252.66
  37.237.65.43
  37.238.130.50
  37.238.130.84
+37.238.166.15
  37.238.80.28
  37.239.46.2
  37.239.46.26
@@ -67324,11 +66871,9 @@
  37.24.199.68
  37.24.240.15
  37.24.38.254
-37.24.98.190
  37.247.111.141
  37.247.209.179
  37.247.231.90
-37.248.216.194
  37.252.11.91
  37.252.15.13
  37.252.15.241
@@ -67336,7 +66881,6 @@
  37.252.190.224
  37.252.64.48
  37.252.67.184
-37.252.69.70
  37.252.70.69
  37.252.72.189
  37.252.73.252
@@ -67344,6 +66888,7 @@
  37.252.77.194
  37.252.77.196
  37.252.77.200
+37.252.93.41
  37.26.136.181
  37.26.136.224
  37.26.2.122
@@ -67357,15 +66902,15 @@
  37.32.44.1
  37.34.208.91
  37.34.57.179
-37.35.66.111
  37.35.66.68
  37.36.149.249
  37.37.202.158
  37.4.227.227
+37.41.170.195
  37.41.43.203
-37.44.127.207
  37.44.137.205
  37.44.238.35
+37.44.247.93
  37.44.253.67
  37.44.253.75
  37.44.255.212
@@ -67378,29 +66923,28 @@
  37.46.150.167
  37.46.150.184
  37.46.150.195
+37.46.150.196
  37.46.150.206
  37.46.150.225
  37.46.150.235
  37.46.150.243
  37.46.150.247
  37.46.150.26
-37.46.150.40
  37.46.150.48
  37.46.150.51
-37.46.150.7
-37.46.150.78
-37.46.150.81
  37.46.73.5
+37.47.163.246
  37.47.173.41
  37.48.103.228
  37.48.105.203
  37.48.109.26
-37.48.120.176
  37.48.120.196
  37.48.125.238
+37.48.39.65
  37.48.65.175
  37.48.73.19
  37.48.84.223
+37.48.89.8
  37.48.94.6
  37.49.224.100
  37.49.224.101
@@ -67442,41 +66986,40 @@
  37.49.224.9
  37.49.224.98
  37.49.225.110
-37.49.225.12
  37.49.225.122
  37.49.225.134
  37.49.225.136
  37.49.225.137
  37.49.225.138
+37.49.225.139
  37.49.225.140
-37.49.225.15
+37.49.225.150
  37.49.225.151
  37.49.225.156
-37.49.225.157
  37.49.225.165
  37.49.225.169
-37.49.225.17
-37.49.225.170
  37.49.225.173
  37.49.225.18
  37.49.225.182
+37.49.225.184
  37.49.225.19
  37.49.225.194
  37.49.225.196
+37.49.225.200
  37.49.225.201
+37.49.225.204
  37.49.225.205
-37.49.225.207
  37.49.225.212
  37.49.225.213
  37.49.225.218
  37.49.225.224
-37.49.225.231
  37.49.225.233
  37.49.225.235
  37.49.225.236
  37.49.225.238
  37.49.225.240
  37.49.225.245
+37.49.225.25
  37.49.225.252
  37.49.226.101
  37.49.226.102
@@ -67533,9 +67076,11 @@
  37.49.230.102
  37.49.230.103
  37.49.230.128
+37.49.230.130
  37.49.230.131
  37.49.230.133
  37.49.230.141
+37.49.230.142
  37.49.230.157
  37.49.230.159
  37.49.230.160
@@ -67571,7 +67116,7 @@
  37.49.231.62
  37.49.48.46
  37.49.53.222
-37.52.132.242
+37.52.151.36
  37.53.93.198
  37.55.18.244
  37.57.0.198
@@ -67580,9 +67125,7 @@
  37.57.147.41
  37.57.15.43
  37.57.169.85
-37.57.187.151
  37.57.206.219
-37.57.216.2
  37.57.216.4
  37.57.231.110
  37.57.231.111
@@ -67604,13 +67147,13 @@
  37.59.106.38
  37.59.109.58
  37.59.123.166
-37.59.131.237
  37.59.141.40
  37.59.179.5
  37.59.192.122
  37.59.200.29
  37.59.200.31
  37.59.205.11
+37.59.210.216
  37.59.215.22
  37.59.223.107
  37.59.224.39
@@ -67651,9 +67194,9 @@
  37.59.9.55
  37.59.90.90
  37.59.98.31
-37.6.13.20
  37.6.14.134
  37.6.194.24
+37.6.2.182
  37.61.202.71
  37.61.219.34
  37.61.219.53
@@ -67671,18 +67214,19 @@
  37.72.190.238
  37.72.190.42
  37.72.190.65
+37.74.224.18
+37.75.131.172
  37.75.135.161
  37.75.81.120
  37.76.234.230
-37.78.159.185
+37.78.89.4
  37.79.131.252
  37.79.139.125
  37.79.16.230
-37.79.251.238
-37.79.254.152
  37.79.255.195
  37.79.30.245
  37.9.134.133
+37.9.153.224
  37.9.168.167
  37.9.169.4
  37.9.169.5
@@ -67690,6 +67234,7 @@
  37.9.41.129
  37.9.41.26
  37.9.46.143
+37.9.46.56
  37.97.139.116
  37.97.152.141
  37.97.173.245
@@ -67823,7 +67368,6 @@
  38.109.195.42
  38.111.114.155
  38.114.83.77
-38.117.123.2
  38.121.60.2
  38.122.16.146
  38.123.64.242
@@ -67844,7 +67388,6 @@
  38.142.63.146
  38.145.201.162
  38.145.201.41
-38.145.86.169
  38.145.92.147
  38.146.5.58
  38.17.54.101
@@ -67852,7 +67395,6 @@
  38.17.54.50
  38.242.12.100
  38.242.21.27
-38.27.122.246
  38.29.147.15
  38.29.206.101
  38.39.205.6
@@ -67870,7 +67412,6 @@
  38.73.238.134
  38.73.238.138
  38.77.14.237
-38.87.158.226
  38.87.234.241
  38.87.234.242
  38.87.54.162
@@ -67899,31 +67440,27 @@
  38f1d44f1a954bd72362716c792b3cf7-dot-dbenitonline.ey.r.appspot.com
  38seventeen.com
  39.100.120.117
-39.100.149.197
  39.100.156.81
  39.100.210.12
-39.100.227.126
  39.100.230.115
  39.100.231.125
-39.100.234.46
-39.100.247.204
  39.100.28.79
  39.100.36.150
  39.101.136.226
  39.101.142.197
+39.101.174.194
  39.101.194.214
+39.101.199.226
  39.101.206.20
  39.101.213.69
  39.103.139.6
  39.104.118.116
-39.104.14.232
  39.104.77.51
  39.104.81.231
  39.105.129.219
  39.105.136.217
  39.105.192.77
  39.105.200.55
-39.105.209.58
  39.105.25.53
  39.105.46.101
  39.105.85.40
@@ -67936,11 +67473,11 @@
  39.106.7.117
  39.106.74.141
  39.106.9.88
-39.107.106.105
  39.107.176.14
  39.107.234.140
  39.107.236.42
  39.107.250.245
+39.107.98.215
  39.108.104.226
  39.108.123.4
  39.108.141.158
@@ -67952,7 +67489,6 @@
  39.109.112.98
  39.109.113.204
  39.109.123.18
-39.109.123.188
  39.109.125.99
  39.109.126.80
  39.109.127.81
@@ -67973,6 +67509,7 @@
  39.114.137.102
  39.115.133.87
  39.115.19.1
+39.116.190.2
  39.117.31.162
  39.118.216.192
  39.129.55.85
@@ -67980,45 +67517,42 @@
  39.137.69.10
  39.137.69.7
  39.145.126.86
-39.152.42.235
-39.155.208.78
+39.152.177.33
  39.155.215.199
+39.162.187.254
  39.164.112.139
  39.164.44.148
  39.164.99.60
+39.170.50.16
  39.183.132.49
  39.33.131.225
  39.33.170.49
  39.33.182.5
-39.33.210.35
-39.33.216.64
  39.33.220.56
  39.33.222.197
-39.34.187.53
+39.33.234.41
+39.33.78.171
+39.34.168.21
  39.34.222.130
  39.34.226.168
  39.35.146.38
-39.40.201.3
-39.40.231.56
+39.40.13.40
+39.40.50.207
+39.41.118.114
  39.42.26.227
+39.42.46.87
  39.43.32.98
  39.44.237.47
  39.45.21.37
-39.45.4.184
  39.46.52.159
-39.49.95.54
  39.50.107.75
-39.50.88.150
  39.50.97.132
-39.52.130.19
  39.53.126.151
  39.57.138.131
-39.57.148.100
  39.60.26.170
-39.64.134.162
+39.62.63.42
  39.64.36.1
  39.65.102.212
-39.65.133.234
  39.65.165.65
  39.65.170.117
  39.65.172.250
@@ -68029,7 +67563,6 @@
  39.65.3.194
  39.66.149.230
  39.66.179.245
-39.66.230.54
  39.66.33.156
  39.66.85.78
  39.66.97.214
@@ -68039,22 +67572,17 @@
  39.68.11.133
  39.68.144.83
  39.68.154.55
-39.68.22.7
-39.68.226.21
  39.68.37.250
  39.69.115.100
-39.69.127.21
-39.71.194.235
+39.72.0.247
  39.72.110.171
  39.72.13.11
  39.73.1.187
  39.73.122.199
  39.73.123.45
-39.73.132.87
  39.73.160.208
  39.73.169.24
  39.73.17.175
-39.73.183.14
  39.73.217.43
  39.73.243.234
  39.73.29.216
@@ -68077,11 +67605,9 @@
  39.74.36.15
  39.74.48.199
  39.74.52.144
-39.76.189.174
  39.76.22.176
  39.76.239.158
  39.76.69.95
-39.76.71.243
  39.77.106.17
  39.77.110.170
  39.77.115.171
@@ -68097,71 +67623,53 @@
  39.79.185.120bin.sh
  39.79.217.51
  39.79.220.21
-39.79.226.228
-39.79.230.241
  39.79.34.245
  39.79.65.231
  39.79.95.113
  39.80.159.96
-39.80.189.122
  39.80.191.223
  39.80.191.49
  39.80.191.49bin.sh
  39.80.202.13
-39.80.213.30
  39.80.29.237
  39.80.49.229
  39.80.83.114
-39.81.129.193
  39.81.139.3
  39.81.151.137
  39.81.189.207
  39.81.211.185
-39.81.228.167
  39.81.238.18
  39.81.25.141
-39.81.25.160
-39.81.61.64
-39.81.63.80
-39.81.71.183
-39.82.126.204
+39.81.61.102
  39.82.249.12
  39.82.8.36
-39.83.0.12
+39.83.14.102
  39.83.185.237
  39.83.186.54
-39.83.187.141
  39.83.56.21
-39.84.161.197
-39.84.175.185
+39.83.76.97
  39.84.39.52
  39.84.83.126
  39.84.91.64
  39.85.1.167
+39.85.146.34
  39.85.197.204
  39.85.64.200
  39.85.92.197
-39.86.13.0
  39.86.235.120
-39.86.236.119
  39.86.239.185
  39.86.249.146
  39.86.39.219
-39.86.48.26
-39.86.62.165
  39.86.62.244
  39.86.63.244
  39.86.65.119
  39.86.66.16
-39.86.67.24
  39.86.76.213
-39.86.80.133
  39.86.82.189
  39.86.83.30
  39.87.237.182
  39.87.60.188
  39.87.69.253
-39.87.84.12
  39.87.98.115
  39.88.109.128
  39.88.133.23
@@ -68169,23 +67677,19 @@
  39.88.155.96
  39.88.159.244
  39.88.170.162
-39.88.173.182
  39.88.191.213
  39.88.193.81
  39.88.206.41bin.sh
  39.88.217.189
  39.88.228.48
-39.88.66.7
  39.88.67.184
  39.88.67.92
  39.88.92.58
  39.89.103.52
-39.89.113.181
  39.89.115.200
  39.89.120.174bin.sh
  39.89.131.223
  39.89.140.197
-39.89.144.241
  39.89.145.90
  39.89.147.224
  39.89.151.217
@@ -68194,18 +67698,16 @@
  39.89.174.67
  39.89.194.231
  39.89.204.42
-39.89.206.19
-39.89.208.87
  39.89.209.81
  39.89.237.220
  39.89.30.218
-39.90.10.214
  39.90.143.105
  39.90.143.116
  39.90.143.208
  39.90.152.43
  39.90.154.220
  39.90.159.54bin.sh
+39.90.169.113
  39.90.169.223
  39.90.174.219
  39.90.174.81
@@ -68216,15 +67718,16 @@
  39.96.21.32
  39.96.82.174
  39.96.82.217
-39.97.107.254
+39.97.109.91
  39.97.212.218
  39.97.219.148
  39.97.227.7
  39.97.231.198
  39.97.244.212
-39.97.252.78
  39.98.120.161
+39.98.125.164
  39.99.143.137
+39.99.171.26
  39.99.203.251
  39.99.224.182
  39.99.232.25
@@ -68492,11 +67995,6 @@
  40.115.6.17
  40.115.79.44
  40.117.133.229
-40.117.137.242
-40.117.140.117
-40.117.140.181
-40.117.141.180
-40.117.143.183
  40.117.150.31
  40.117.180.167
  40.117.191.139
@@ -68516,21 +68014,17 @@
  40.121.12.127
  40.121.142.168
  40.121.154.151
-40.121.16.238
  40.121.17.49
  40.121.183.0
  40.121.196.179
-40.121.20.2
-40.121.22.191
-40.121.22.88
  40.121.3.52
-40.121.52.52
  40.121.58.255
  40.121.70.33
  40.121.86.78
  40.121.87.17
  40.121.90.30
  40.121.91.147
+40.121.92.192
  40.121.92.33
  40.122.122.77
  40.122.162.59
@@ -68538,6 +68032,7 @@
  40.122.200.59
  40.122.27.80
  40.122.30.84
+40.122.39.58
  40.122.49.211
  40.122.68.214
  40.122.70.73
@@ -68553,7 +68048,7 @@
  40.127.139.82
  40.127.160.75
  40.127.177.193
-40.127.201.29
+40.130.19.178
  40.131.87.38
  40.132.242.226
  40.68.255.214
@@ -68577,6 +68072,7 @@
  40.73.103.188
  40.73.120.132
  40.73.35.39
+40.73.59.55
  40.73.67.85
  40.73.77.249
  40.73.79.203
@@ -68593,13 +68089,11 @@
  40.76.21.137
  40.76.222.119
  40.76.24.2
-40.76.243.64
  40.76.44.230
  40.76.59.137
  40.76.82.187
  40.76.92.194
  40.77.105.109
-40.77.107.169
  40.77.167.0
  40.77.167.1
  40.77.167.10
@@ -68679,12 +68173,9 @@
  40.79.26.139
  40.79.35.48
  40.80.146.253
-40.80.89.113
-40.80.89.228
  40.83.13.220
  40.83.181.2
  40.83.190.122
-40.83.216.122
  40.83.89.19
  40.84.128.101
  40.84.137.248
@@ -68693,15 +68184,17 @@
  40.84.157.119
  40.84.216.97
  40.84.225.234
-40.85.114.229
-40.85.115.181
  40.85.160.135
  40.85.162.35
  40.85.186.102
-40.85.187.136
  40.85.202.11
  40.85.205.219
  40.85.252.223
+40.85.88.144
+40.85.88.87
+40.85.92.152
+40.85.95.59
+40.85.95.62
  40.86.218.34
  40.86.219.220
  40.86.223.44
@@ -68710,19 +68203,15 @@
  40.86.87.161
  40.86.94.7
  40.86.99.195
-40.87.111.42
  40.87.17.154
  40.87.54.154
  40.89.137.145
  40.89.157.144
  40.89.159.38
+40.89.187.157
  40.90.160.83
-40.91.192.48
  40.91.194.198
-40.91.197.81
  40.91.198.12
-40.91.198.55
-40.91.200.53
  4000095599.com
  400517034274668-dot-charming-sky-2700.appspot.com
  4006261166.com
@@ -68743,6 +68232,7 @@
  40buofa40.bankofamericaslpemr.com
  40buortfa40.bankofamericaslpemr.com
  40hops.com
+41.0.36.69
  41.0.82.166
  41.100.35.162
  41.101.40.77
@@ -68751,38 +68241,37 @@
  41.102.69.6
  41.102.97.25
  41.103.208.28
-41.105.173.176
  41.105.60.148
  41.107.222.164
+41.107.31.55
  41.107.69.41
  41.110.141.3
+41.110.182.197
  41.111.123.99
  41.111.130.125
  41.111.133.103
+41.112.170.103
  41.130.62.64
  41.137.19.58
  41.138.241.106
  41.138.54.13
  41.139.131.177
-41.139.134.169
-41.139.19.133
  41.139.223.242
  41.139.9.47
-41.140.157.168
-41.140.244.48
  41.140.31.106
  41.141.220.3
  41.142.232.133
-41.142.245.48
  41.142.248.91
  41.143.149.21
+41.143.17.138
  41.143.249.57
  41.143.249.60
  41.143.37.128
  41.144.159.85
+41.144.77.62
  41.144.82.131
-41.155.250.79
  41.157.64.105
+41.158.112.120
  41.160.100.202
  41.160.100.204
  41.160.114.37
@@ -68796,6 +68285,7 @@
  41.162.125.226
  41.162.186.2
  41.162.57.82
+41.162.92.66
  41.162.94.52
  41.164.24.243
  41.164.247.186
@@ -68810,8 +68300,9 @@
  41.169.78.42
  41.169.79.166
  41.170.12.92
-41.174.92.228
+41.170.4.42
  41.175.155.78
+41.175.20.123
  41.180.4.117
  41.180.64.254
  41.180.65.27
@@ -68820,13 +68311,7 @@
  41.180.82.158
  41.180.96.110
  41.180.98.70
-41.182.131.219
-41.182.131.229
-41.182.133.154
-41.182.135.118
-41.182.146.218
  41.182.146.227
-41.182.150.112
  41.185.28.84
  41.185.29.128
  41.185.8.170
@@ -68844,15 +68329,14 @@
  41.190.233.17
  41.190.233.61
  41.190.33.162
+41.190.39.125
  41.190.92.84
  41.190.92.92
  41.190.95.20
  41.190.95.92
-41.191.204.124
  41.191.205.121
  41.191.222.26
  41.193.12.50
-41.193.192.100
  41.193.22.146
  41.193.22.153
  41.193.5.52
@@ -68868,21 +68352,21 @@
  41.207.251.194
  41.207.252.122
  41.208.150.114
-41.208.164.253
  41.210.12.203
  41.210.140.35
  41.210.161.114
+41.211.105.81
  41.211.108.123
  41.211.122.81
  41.211.125.122
  41.212.121.138
  41.212.41.144
-41.212.75.162
  41.213.13.146
  41.213.13.154
  41.215.10.6
  41.215.100.112
  41.215.116.215
+41.215.147.90
  41.215.33.186
  41.215.37.230
  41.215.39.25
@@ -68898,12 +68382,12 @@
  41.215.95.113
  41.216.102.178
  41.216.148.55
+41.216.163.218
  41.216.173.222
  41.216.177.127
  41.216.177.169
  41.216.177.17
  41.216.177.3
-41.216.178.63
  41.216.225.250
  41.217.216.17
  41.217.216.45
@@ -68912,6 +68396,9 @@
  41.217.219.165
  41.217.219.49
  41.217.219.53
+41.217.56.221
+41.217.63.216
+41.217.94.200
  41.218.116.38
  41.218.253.127
  41.219.17.115
@@ -68924,7 +68411,6 @@
  41.221.236.62
  41.221.238.5
  41.222.0.194
-41.222.157.53
  41.222.226.98
  41.222.4.146
  41.222.57.63
@@ -68932,17 +68418,15 @@
  41.223.108.13
  41.223.136.40
  41.223.142.211
-41.223.192.155
  41.223.213.175
-41.223.232.115
  41.223.234.116
  41.223.4.155
+41.224.248.91
  41.225.16.155
  41.225.17.53
  41.225.186.80
  41.225.239.204
  41.225.99.33
-41.226.248.98
  41.226.25.4
  41.226.25.65
  41.226.27.133
@@ -68950,15 +68434,17 @@
  41.226.60.115
  41.226.60.138
  41.227.119.223
+41.227.25.145
+41.228.161.240
  41.229.253.214
  41.230.104.255
  41.230.14.107
  41.230.230.113
+41.230.4.33
  41.231.53.25
  41.233.102.53
-41.234.194.54
+41.233.232.69
  41.234.66.53
-41.236.46.222
  41.238.200.222
  41.239.97.150
  41.242.117.242
@@ -68981,10 +68467,13 @@
  41.251.106.8
  41.251.195.2
  41.254.41.230
+41.254.43.109
  41.254.44.62
  41.32.213.239
+41.33.13.26
  41.33.212.68
  41.33.45.180
+41.33.47.74
  41.33.66.227
  41.33.66.228
  41.33.66.230
@@ -68998,17 +68487,17 @@
  41.33.66.254
  41.33.84.42
  41.34.244.224
-41.37.120.172
-41.37.242.159
  41.38.119.243
  41.38.18.230
  41.39.153.4
+41.39.79.194
  41.40.178.81
  41.41.138.9
  41.41.70.190
  41.42.154.210
  41.43.140.210
  41.45.213.110
+41.46.124.27
  41.46.17.110
  41.57.104.3
  41.57.109.74
@@ -69035,8 +68524,9 @@
  41.63.1.39
  41.65.111.226
  41.65.146.38
+41.65.244.26
  41.66.11.29
-41.66.197.90
+41.66.46.147
  41.67.48.101
  41.67.48.110
  41.67.48.71
@@ -69045,6 +68535,7 @@
  41.71.24.168
  41.71.24.180
  41.71.24.190
+41.72.105.171
  41.72.203.182
  41.72.203.66
  41.72.219.102
@@ -69052,6 +68543,7 @@
  41.73.15.134
  41.73.15.14
  41.73.15.246
+41.73.9.101
  41.74.4.166
  41.75.110.37
  41.75.113.217
@@ -69062,6 +68554,7 @@
  41.75.123.8
  41.75.126.50
  41.76.117.194
+41.76.157.202
  41.76.157.46
  41.76.168.88
  41.76.175.129
@@ -69080,7 +68573,6 @@
  41.78.246.118
  41.78.247.252
  41.78.26.155
-41.78.73.144
  41.78.75.45
  41.78.82.180
  41.79.138.87
@@ -69105,16 +68597,16 @@
  41.79.66.106
  41.79.78.59
  41.79.82.46
-41.80.227.212
  41.80.233.27
  41.80.241.89
+41.80.243.186
+41.80.96.34
  41.82.100.8
  41.82.83.76
  41.83.109.15
-41.83.238.98
+41.83.133.218
  41.83.27.249
  41.84.147.218
-41.84.193.18
  41.84.228.65
  41.85.189.66
  41.85.191.6
@@ -69131,13 +68623,12 @@
  41.86.19.200
  41.86.19.205
  41.86.19.206
+41.86.19.210
  41.86.21.14
  41.86.21.23
  41.86.21.27
  41.86.21.28
-41.86.21.3
  41.86.21.44
-41.86.21.52
  41.86.21.59
  41.86.21.61
  41.86.21.62
@@ -69153,12 +68644,14 @@
  41.89.94.30
  41.90.126.158
  41.90.29.49
+41.90.32.90
+41.92.55.115
  41.93.155.17
  41.93.32.89
  41.93.47.69
  41.95.17.156
  41.95.30.205
-41.96.121.202
+41.97.82.108
  41.98.127.12
  41.98.84.239
  4117570-dot-n-e-w-me-ss-age-po-rt-al.wl.r.appspot.com
@@ -69170,23 +68663,26 @@
  41d976d239e293e20374502f2b2e7b67-dot-online-validation-sevice.ey.r.appspot.com
  41fde.codesandbox.io
  41r73tlc.gmz.cc
-42.106.108.13
-42.106.126.104
-42.106.127.210
-42.107.65.147
-42.107.68.47
+42.105.48.6
+42.106.19.117
  42.111.208.127
  42.111.212.168
+42.112.148.40
  42.112.16.74
  42.112.20.32
  42.112.209.164
  42.112.224.234
  42.112.26.30
+42.112.30.70
  42.112.87.166
  42.113.143.144
  42.113.184.20
+42.113.191.12
+42.113.224.138
  42.113.245.10
  42.114.121.237
+42.114.206.69
+42.114.211.103
  42.115.10.67
  42.115.25.55
  42.115.33.152
@@ -69197,15 +68693,16 @@
  42.115.88.12
  42.115.91.82
  42.116.146.217
-42.116.152.22
-42.116.170.150
  42.116.18.180
  42.116.181.82
  42.116.220.35
-42.118.140.166
+42.116.82.122
+42.118.236.138
  42.118.242.189
  42.118.253.62
  42.119.146.228
+42.123.99.67
+42.125.165.110
  42.157.3.138
  42.159.10.142
  42.159.142.14
@@ -69216,12 +68713,13 @@
  42.159.80.91
  42.159.83.169
  42.159.86.108
+42.177.53.180
+42.177.54.218
  42.177.54.79
  42.177.55.88
  42.178.193.125
  42.178.205.97
-42.178.219.51
-42.179.174.79
+42.179.173.94
  42.180.206.145
  42.192.100.189
  42.192.117.179
@@ -69240,8 +68738,6 @@
  42.192.132.171
  42.192.133.81
  42.192.134.92
-42.192.135.112
-42.192.135.182
  42.192.136.151
  42.192.138.146
  42.192.14.177
@@ -69272,6 +68768,7 @@
  42.192.173.228
  42.192.178.163
  42.192.182.169
+42.192.182.40
  42.192.183.38
  42.192.186.106
  42.192.186.182
@@ -69289,7 +68786,6 @@
  42.192.21.140
  42.192.220.171
  42.192.220.183
-42.192.221.34
  42.192.223.129
  42.192.223.137
  42.192.223.241
@@ -69297,12 +68793,10 @@
  42.192.228.144
  42.192.228.146
  42.192.228.246
-42.192.229.249
  42.192.23.131
  42.192.233.228
  42.192.234.117
  42.192.234.33
-42.192.234.71
  42.192.234.75
  42.192.235.102
  42.192.235.189
@@ -69323,6 +68817,7 @@
  42.192.42.119
  42.192.47.135
  42.192.51.95
+42.192.52.209
  42.192.53.50
  42.192.54.145
  42.192.55.156
@@ -69358,14 +68853,18 @@
  42.192.94.8
  42.192.94.81
  42.193.0.63
+42.193.1.230
+42.193.10.176
+42.193.101.191
  42.193.101.204
  42.193.106.209
-42.193.106.33
  42.193.110.36
  42.193.111.2
  42.193.112.207
  42.193.116.37
+42.193.116.61
  42.193.119.53
+42.193.127.186
  42.193.139.57
  42.193.141.218
  42.193.172.5
@@ -69377,8 +68876,10 @@
  42.193.40.237
  42.193.46.62
  42.193.5.242
+42.193.6.134
  42.193.96.159
  42.194.128.158
+42.194.128.243
  42.194.129.72
  42.194.131.128
  42.194.132.178
@@ -69419,143 +68920,90 @@
  42.200.149.223
  42.200.155.72
  42.200.196.30
-42.200.196.78
  42.200.200.146
  42.200.206.225
  42.200.226.58
+42.200.244.164
  42.200.35.174
  42.200.35.239
  42.200.66.164
  42.200.78.78
  42.200.80.42
-42.200.98.180
  42.201.189.212
  42.201.208.179
+42.202.99.1
  42.224.122.152
-42.224.129.133
-42.224.141.136
-42.224.171.133
-42.224.173.161
+42.224.171.66
  42.224.174.231
  42.224.177.237
-42.224.179.175
  42.224.180.248
-42.224.209.11
-42.224.240.143
-42.224.3.26
-42.224.69.71
+42.224.180.71
  42.224.70.21
  42.224.98.101
  42.224.99.28
-42.225.204.14
-42.225.36.238
-42.225.50.217
  42.227.121.217
-42.227.153.62
  42.227.165.192
  42.227.172.211
  42.227.184.249
  42.227.184.46
-42.227.192.179
  42.227.25.126
  42.228.124.84
  42.228.237.138
-42.228.36.218
-42.228.37.90
+42.228.36.48
  42.228.38.126
  42.228.43.26
  42.228.45.197
  42.228.47.6
  42.228.59.226
-42.228.78.186
  42.228.79.60
  42.228.79.65
  42.228.80.137
-42.229.192.68
-42.230.100.194
-42.230.122.229
-42.230.125.3
-42.230.14.63
-42.230.217.101
+42.230.216.231
  42.230.217.131
-42.230.225.186
  42.230.244.137
  42.230.27.134
  42.230.43.23
  42.230.50.192
-42.230.56.236
-42.230.6.86
  42.230.62.207
-42.230.84.237
-42.230.87.123
-42.230.89.236
-42.230.94.229
-42.230.98.98
+42.230.84.184
  42.231.111.173
-42.231.135.217
  42.231.161.220
  42.231.37.113
  42.231.42.217
  42.232.100.48
  42.232.101.226
  42.232.239.137
-42.233.143.220
-42.233.174.39
-42.233.232.90
  42.233.232.93
-42.233.248.144
  42.233.254.41
  42.233.32.16
-42.233.89.142
+42.234.160.126
  42.234.186.167
-42.234.232.33
-42.234.234.85
+42.234.211.111
  42.234.236.206
  42.235.117.33
-42.235.151.97
+42.235.120.54
  42.235.156.137
-42.235.159.171
-42.235.160.162
  42.235.20.211
  42.235.57.48
  42.235.84.141
  42.235.88.20
-42.235.94.208
  42.236.160.189
  42.236.161.183
  42.236.161.43
-42.236.212.209
-42.236.213.156
-42.236.213.97
-42.236.214.23
-42.236.215.122
  42.236.215.249
  42.236.221.189
  42.236.223.79
-42.236.254.224
  42.237.197.58
  42.237.40.112
-42.237.41.14
  42.237.94.1
-42.238.172.133
-42.238.224.112
  42.238.231.157
-42.238.243.249
-42.238.248.193
  42.238.5.149
  42.239.145.30
-42.239.155.94
-42.239.168.235
  42.239.181.224
  42.239.193.119
  42.239.233.243
  42.239.239.71
-42.239.240.187
  42.239.246.63
-42.239.248.58
-42.239.31.165
-42.239.42.194
-42.239.94.203
  42.242.200.90
  42.242.92.45
  42.248.77.136
@@ -69567,38 +69015,33 @@
  42.3.16.199
  42.5.100.169
  42.5.100.68
-42.5.101.14
  42.5.102.117
-42.5.150.236
+42.5.102.147
  42.5.150.95
  42.5.151.152
+42.51.15.159
  42.51.173.18
  42.51.18.107
  42.51.201.86
  42.51.26.79
  42.51.34.169
+42.52.187.194
  42.52.92.136
-42.54.233.49
-42.56.62.18
-42.57.216.66
+42.55.88.103
  42.58.119.2
  42.59.122.236
  42.59.204.103
+42.59.39.40
  42.59.52.170
  42.59.52.74
-42.59.53.32
+42.61.182.234
  42.63.24.226
-42.81.124.15
-42.86.3.146
-42.86.76.64
-42.86.77.167
  42.86.77.3
  42.87.76.172
  42.98.152.233
-42.98.78.134
+42.98.4.72
  42.98.8.73
  42.99.116.139
-42.99.180.135
  420365365.com
  420marijuanalist.com
  420weeds.us
@@ -69619,6 +69062,7 @@
  42ec77ecb9e159e516146845f9bb06ba.icu
  43-245-61-213.cprapid.com
  43.224.1.156
+43.224.1.223
  43.224.10.13
  43.224.10.19
  43.224.10.23
@@ -69637,6 +69081,7 @@
  43.224.117.202
  43.224.118.46
  43.224.128.110
+43.224.128.22
  43.224.155.199
  43.224.234.88
  43.224.248.159
@@ -69665,7 +69110,6 @@
  43.225.61.103
  43.225.62.107
  43.225.67.181
-43.225.67.39
  43.225.98.18
  43.225.98.22
  43.226.144.179
@@ -69673,25 +69117,28 @@
  43.226.144.80
  43.226.145.228
  43.226.146.108
-43.226.147.142
  43.226.147.160
  43.226.147.226
  43.226.147.4
+43.226.148.89
  43.226.152.45
  43.226.153.101
  43.226.153.158
  43.226.16.20
  43.226.22.77
+43.226.22.99
  43.226.238.12
  43.226.29.168
  43.226.32.12
  43.226.33.22
  43.226.34.50
  43.226.40.176
+43.226.51.13
  43.226.51.234
  43.226.53.29
  43.226.69.103
  43.227.128.6
+43.227.131.123
  43.227.135.214
  43.227.253.247
  43.227.68.118
@@ -69714,10 +69161,12 @@
  43.229.55.61
  43.229.62.133
  43.229.72.220
+43.229.73.198
  43.229.73.201
  43.229.73.204
  43.229.73.224
  43.229.73.225
+43.229.73.228
  43.229.73.229
  43.229.73.232
  43.229.73.233
@@ -69726,10 +69175,13 @@
  43.229.73.240
  43.229.73.253
  43.229.73.254
+43.229.89.94
+43.229.90.70
  43.230.168.149
  43.230.196.98
  43.230.41.219
  43.230.62.157
+43.230.64.117
  43.230.7.65
  43.230.89.50
  43.230.89.54
@@ -69739,25 +69191,27 @@
  43.231.56.52
  43.231.62.98
  43.231.76.1
-43.231.76.105
  43.231.76.109
  43.231.76.117
  43.231.76.129
+43.231.76.142
  43.231.76.145
  43.231.76.149
  43.231.76.157
+43.231.76.161
  43.231.76.169
  43.231.76.173
  43.231.76.177
+43.231.76.185
  43.231.76.189
  43.231.76.193
  43.231.76.201
  43.231.76.205
  43.231.76.209
  43.231.76.213
+43.231.76.221
  43.231.76.225
  43.231.76.25
-43.231.76.29
  43.231.76.33
  43.231.76.49
  43.231.76.57
@@ -69776,8 +69230,7 @@
  43.231.77.49
  43.231.77.53
  43.231.77.65
-43.231.77.77
-43.231.77.94
+43.231.77.73
  43.231.78.1
  43.231.78.41
  43.231.78.45
@@ -69785,12 +69238,13 @@
  43.231.78.53
  43.231.78.57
  43.231.78.61
+43.231.78.73
  43.231.78.81
  43.231.78.89
  43.231.78.9
  43.231.79.1
+43.231.79.129
  43.231.79.9
-43.239.160.241
  43.239.67.110
  43.239.75.102
  43.239.75.145
@@ -69808,15 +69262,16 @@
  43.240.66.46
  43.240.66.85
  43.241.106.183
+43.241.141.21
  43.241.17.89
  43.241.196.78
  43.241.30.222
  43.241.56.15
+43.241.58.1
  43.241.63.96
  43.242.128.32
  43.242.174.69
  43.242.174.70
-43.242.39.151
  43.242.68.114
  43.243.171.24
  43.243.204.106
@@ -69845,17 +69300,19 @@
  43.248.24.234
  43.248.25.6
  43.248.26.18
+43.248.71.224
  43.248.71.246
  43.248.9.100
+43.249.113.219
  43.249.113.220
  43.249.113.235
+43.249.113.236
  43.249.113.243
  43.249.113.246
  43.249.114.36
  43.249.205.169
  43.249.52.100
  43.249.53.182
-43.249.55.42
  43.249.65.56
  43.249.83.11
  43.250.126.1
@@ -69868,6 +69325,7 @@
  43.251.104.46
  43.251.159.144
  43.251.16.143
+43.251.166.53
  43.251.17.39
  43.251.17.61
  43.251.171.201
@@ -69911,9 +69369,9 @@
  43.255.140.133
  43.255.140.38
  43.255.152.16
+43.255.166.36
  43.255.217.186
  43.255.228.150
-43.255.31.78
  430lodsposlok.site
  430lodsposlok.store
  431-365.net
@@ -69922,7 +69380,6 @@
  435072835117215-dot-wetransfer-auth-file-343.appspot.com
  43512bc74be66e4dd8305d3b0d52a2616-dot-gold-cycling-287718.df.r.appspot.com
  435r4q3r.win
-4365b67f-a597-4e17-8b51-179628.godaddysites.com
  436945-dot-n-e-w-me-ss-age-po-rt-al.wl.r.appspot.com
  437.31cf4fdae.com
  43784643.weebly.com
@@ -69967,6 +69424,7 @@
  45.10.165.27
  45.10.232.104
  45.10.232.111
+45.10.232.123
  45.10.232.140
  45.10.232.141
  45.10.232.146
@@ -69982,6 +69440,8 @@
  45.10.232.80
  45.10.232.87
  45.10.237.109
+45.10.237.158
+45.10.237.31
  45.10.24.197
  45.10.24.60
  45.10.24.65
@@ -69989,8 +69449,6 @@
  45.10.55.243
  45.10.88.124
  45.11.183.191
-45.11.20.182
-45.11.27.219
  45.11.79.19
  45.11.79.57
  45.112.0.34
@@ -69998,10 +69456,12 @@
  45.112.1.161
  45.112.11.25
  45.112.127.23
+45.112.2.183
  45.112.203.124
  45.112.242.105
  45.112.242.120
  45.112.242.254
+45.112.3.149
  45.112.56.142
  45.112.57.230
  45.113.1.94
@@ -70024,11 +69484,13 @@
  45.115.171.30
  45.115.173.205
  45.115.174.29
-45.115.176.235
+45.115.179.155
+45.115.179.156
  45.115.211.10
  45.115.60.197
  45.115.62.131
  45.115.63.78
+45.116.112.22
  45.116.14.20
  45.116.162.37
  45.116.2.17
@@ -70060,6 +69522,7 @@
  45.117.228.89
  45.117.228.97
  45.117.249.175
+45.117.29.2
  45.117.30.153
  45.117.30.177
  45.117.30.201
@@ -70080,7 +69543,6 @@
  45.118.145.223
  45.118.151.85
  45.118.32.73
-45.118.35.69
  45.119.125.88
  45.119.203.170
  45.119.212.14
@@ -70096,7 +69558,7 @@
  45.119.83.164
  45.119.83.68
  45.119.84.18
-45.119.85.145
+45.119.96.4
  45.12.177.127
  45.12.177.199
  45.12.177.212
@@ -70110,26 +69572,27 @@
  45.120.224.19
  45.120.49.124
  45.120.49.150
+45.120.49.16
  45.120.49.186
  45.120.49.212
-45.120.49.219
+45.120.50.106
  45.120.50.176
  45.120.50.179
  45.120.50.18
  45.120.50.180
+45.120.50.193
  45.120.50.253
  45.120.50.32
-45.120.50.43
  45.120.50.50
  45.120.51.103
  45.120.51.111
  45.120.51.120
-45.120.51.14
  45.120.51.150
  45.120.51.176
  45.120.51.195
  45.120.51.5
  45.120.51.9
+45.120.51.93
  45.120.69.244
  45.121.111.1
  45.121.147.52
@@ -70162,6 +69625,7 @@
  45.124.24.215
  45.124.24.38
  45.124.25.237
+45.124.64.95
  45.124.86.155
  45.124.95.174
  45.125.12.170
@@ -70177,10 +69641,8 @@
  45.125.245.89
  45.125.245.91
  45.125.63.46
-45.125.65.118
  45.125.65.119
  45.125.65.45
-45.126.11.57
  45.126.124.242
  45.126.168.69
  45.126.169.137
@@ -70194,6 +69656,7 @@
  45.128.133.233
  45.128.133.242
  45.128.206.91
+45.128.247.199
  45.128.60.6
  45.129.165.136
  45.129.166.40
@@ -70204,43 +69667,41 @@
  45.13.228.129
  45.13.228.160
  45.13.228.179
-45.13.231.144
+45.13.228.85
+45.13.231.105
  45.13.231.161
  45.13.231.187
  45.13.231.32
+45.13.252.96
  45.13.58.149
  45.13.58.4
-45.130.128.201
  45.130.138.6
-45.130.229.230
  45.130.255.114
  45.130.255.126
  45.130.255.231
  45.130.255.24
-45.130.97.187
+45.131.172.33
  45.131.174.78
-45.131.192.91
  45.131.194.177
  45.131.195.112
  45.131.195.132
  45.131.195.192
  45.131.47.106
-45.132.104.18
  45.132.105.43
  45.132.129.237
-45.132.184.118
+45.132.184.219
  45.132.184.226
-45.132.186.245
  45.132.194.10
-45.132.194.12
+45.132.226.143
  45.132.242.49
  45.132.95.111
  45.133.107.130
  45.133.107.161
  45.133.119.138
  45.133.180.94
-45.133.192.140
+45.133.182.94
  45.133.192.156
+45.133.192.170
  45.133.193.72
  45.133.9.209
  45.133.9.21
@@ -70251,34 +69712,29 @@
  45.134.187.150
  45.134.187.94
  45.134.22.2
+45.134.252.92
  45.135.118.144
+45.135.32.210
  45.135.39.35
  45.135.4.143
  45.135.4.215
-45.136.0.194
  45.136.12.45
  45.136.12.47
-45.136.173.207
  45.136.228.110
  45.136.246.38
  45.137.10.89
  45.137.190.249
-45.137.195.41
  45.137.22.156
  45.137.22.84
  45.137.65.84
-45.138.100.27
  45.138.101.178
  45.138.101.28
-45.138.102.120
  45.138.72.125
  45.138.97.46
-45.138.97.73
  45.138.98.146
  45.138.99.4
  45.139.176.170
  45.139.176.78
-45.139.186.55
  45.139.236.14
  45.139.236.5
  45.14.148.105
@@ -70318,18 +69774,17 @@
  45.140.168.138
  45.140.169.30
  45.140.170.187
-45.140.206.198
  45.140.53.62
  45.140.54.95
  45.141.156.169
  45.141.156.18
  45.141.156.19
  45.141.156.25
+45.141.156.53
  45.141.156.54
  45.141.156.66
  45.141.157.123
  45.141.159.63
-45.141.176.189
  45.141.36.203
  45.141.59.178
  45.141.70.159
@@ -70350,6 +69805,7 @@
  45.142.120.183
  45.142.120.192
  45.142.120.20
+45.142.120.200
  45.142.120.209
  45.142.120.215
  45.142.120.31
@@ -70377,8 +69833,18 @@
  45.142.120.84
  45.142.120.87
  45.142.120.90
+45.142.120.93
  45.142.120.99
  45.142.124.128
+45.142.182.34
+45.142.182.38
+45.142.182.39
+45.142.182.40
+45.142.182.42
+45.142.182.54
+45.142.182.57
+45.142.182.60
+45.142.182.62
  45.142.214.153
  45.143.220.125
  45.143.220.246
@@ -70397,18 +69863,16 @@
  45.143.223.249
  45.143.223.42
  45.143.223.7
-45.143.92.168
  45.144.136.187
-45.144.215.106
  45.144.30.41
+45.144.33.34
  45.144.65.49
  45.145.117.73
  45.145.118.85
  45.145.119.38
  45.145.125.90
-45.145.128.139
  45.145.128.222
-45.145.185.0
+45.145.128.80
  45.145.185.106
  45.145.185.111
  45.145.185.120
@@ -70422,25 +69886,28 @@
  45.145.185.229
  45.145.185.253
  45.145.185.26
+45.145.185.27
  45.145.185.31
  45.145.185.36
  45.145.185.48
  45.145.185.56
+45.145.185.65
  45.145.185.74
  45.145.185.75
  45.145.185.94
  45.145.32.226
  45.145.56.88
  45.145.56.92
+45.145.67.74
  45.146.15.24
-45.146.165.25
+45.146.164.151
+45.146.165.160
+45.146.165.216
  45.146.166.198
-45.146.167.61
  45.146.168.173
  45.147.192.52
  45.147.192.87
  45.147.198.62
-45.147.201.59
  45.147.228.245
  45.147.229.234
  45.148.10.159
@@ -70456,7 +69923,6 @@
  45.148.10.202
  45.148.10.47
  45.148.10.54
-45.148.10.61
  45.148.10.83
  45.148.10.86
  45.148.10.89
@@ -70470,13 +69936,14 @@
  45.148.120.193
  45.148.120.88
  45.148.122.113
+45.148.235.210
+45.148.8.160
  45.148.8.6
  45.148.8.73
  45.149.130.215
  45.149.131.202
  45.149.77.27
  45.149.78.128
-45.149.78.45
  45.149.83.208
  45.15.143.129
  45.15.143.183
@@ -70499,11 +69966,12 @@
  45.151.167.10
  45.151.28.36
  45.152.180.20
-45.152.181.20
  45.152.181.212
-45.152.199.190
+45.152.182.151
+45.152.199.155
  45.152.199.236
  45.152.199.254
+45.152.200.0
  45.152.202.133
  45.152.202.138
  45.152.202.68
@@ -70547,6 +70015,7 @@
  45.154.1.68
  45.154.1.71
  45.154.245.187
+45.154.245.237
  45.154.252.98
  45.154.255.147
  45.154.255.66
@@ -70566,24 +70035,27 @@
  45.154.35.219
  45.154.35.220
  45.154.35.236
+45.154.56.160
  45.155.156.96
  45.155.157.21
  45.155.157.239
  45.155.173.239
+45.155.205.103
  45.155.205.108
  45.155.205.177
+45.155.205.22
+45.155.205.23
  45.155.205.24
  45.155.205.25
  45.155.205.41
  45.155.205.78
  45.155.205.86
  45.155.205.87
-45.155.89.122
+45.155.70.141
  45.156.185.186
  45.156.21.219
  45.156.22.152
  45.156.23.33
-45.156.26.91
  45.156.84.236
  45.157.138.108
  45.157.60.21
@@ -70597,13 +70069,11 @@
  45.160.179.6
  45.160.75.11
  45.161.242.102
-45.161.242.84
  45.161.255.21
  45.161.255.62
  45.162.123.9
  45.162.225.82
  45.162.231.108
-45.162.231.75
  45.162.4.175
  45.162.4.83
  45.163.117.6
@@ -70618,7 +70088,6 @@
  45.164.140.133
  45.164.140.152
  45.164.141.101
-45.164.161.10
  45.164.221.106
  45.164.247.136
  45.164.8.244
@@ -70633,16 +70102,18 @@
  45.166.35.12
  45.166.35.17
  45.166.35.22
+45.166.35.65
  45.166.35.72
+45.166.35.74
  45.166.35.79
  45.166.35.80
  45.166.35.9
-45.167.10.212
+45.166.35.91
  45.167.178.73
  45.167.220.135
  45.167.36.35
  45.167.36.49
-45.168.15.131
+45.167.9.252
  45.168.15.136
  45.168.15.143
  45.168.15.152
@@ -70652,6 +70123,7 @@
  45.168.15.201
  45.168.15.50
  45.168.15.67
+45.168.15.78
  45.168.15.83
  45.168.15.86
  45.168.15.89
@@ -70672,53 +70144,57 @@
  45.170.135.67
  45.170.14.146
  45.170.14.19
-45.170.14.240
  45.170.14.30
  45.171.144.37
  45.171.144.39
  45.171.246.64
+45.172.108.65
+45.172.108.67
  45.172.108.72
+45.172.108.73
  45.172.108.76
  45.172.133.0
  45.172.133.218
  45.172.135.230
  45.172.83.254
-45.173.138.78
  45.173.140.128
-45.173.204.32
  45.173.228.97
+45.173.26.104
  45.173.28.1
  45.173.72.9
  45.173.88.33
-45.174.92.6
+45.174.92.3
  45.175.173.25
  45.175.176.128
  45.175.179.182
  45.175.179.229
  45.175.179.230
  45.176.109.28bin.sh
+45.176.109.78
+45.176.110.235
+45.176.111.120
  45.176.111.6
-45.177.108.98
+45.176.214.50
  45.177.109.244
-45.177.208.9
  45.177.223.2
  45.177.233.106
+45.178.0.52
  45.178.181.98
+45.179.112.118
+45.179.188.73
  45.179.24.234
  45.179.245.177
-45.181.222.192
  45.181.228.208
  45.181.228.212
  45.181.228.214
-45.181.228.217
-45.181.228.218
+45.181.228.216
  45.181.228.220
  45.181.228.222
  45.181.229.23
  45.181.30.99
-45.181.31.113
-45.181.31.250
-45.181.31.53
+45.181.31.204
+45.181.31.209
+45.181.31.75
  45.181.47.1
  45.182.145.192
  45.183.192.14
@@ -70726,12 +70202,9 @@
  45.184.24.5
  45.184.68.32
  45.184.81.228
-45.185.193.91
  45.185.40.6
  45.185.41.65
  45.186.132.130
-45.186.4.157
-45.186.4.49
  45.187.137.26
  45.187.93.26
  45.188.82.131
@@ -70750,9 +70223,11 @@
  45.190.178.9
  45.190.179.2
  45.190.179.5
+45.190.248.26
  45.190.253.134
  45.190.253.217
  45.190.253.218
+45.190.9.50
  45.195.177.32
  45.199.13.17
  45.20.67.1
@@ -70769,13 +70244,11 @@
  45.220.1.17
  45.221.11.52
  45.221.77.82
-45.224.161.134
  45.224.161.217
+45.224.169.142
  45.224.173.254
  45.224.197.137
-45.224.22.162
-45.224.23.57
-45.224.43.68
+45.224.199.40
  45.225.90.118
  45.225.92.93
  45.226.138.6
@@ -70784,6 +70257,7 @@
  45.226.48.54
  45.226.48.57
  45.226.48.61
+45.226.62.135
  45.227.151.14
  45.227.151.18
  45.227.151.50
@@ -70792,7 +70266,8 @@
  45.227.159.7
  45.227.254.241
  45.227.254.245
-45.227.97.95
+45.227.97.35
+45.228.137.6
  45.228.138.18
  45.228.164.158
  45.228.189.240
@@ -70815,14 +70290,12 @@
  45.228.96.65
  45.229.173.234
  45.229.174.32
-45.229.53.251
  45.229.54.1
  45.229.54.104
  45.229.54.108
  45.229.54.109
  45.229.54.122
  45.229.54.129
-45.229.54.132
  45.229.54.133
  45.229.54.139
  45.229.54.141
@@ -70852,6 +70325,7 @@
  45.229.54.45
  45.229.54.48
  45.229.54.49
+45.229.54.55
  45.229.54.58
  45.229.54.69
  45.229.54.73
@@ -70891,12 +70365,14 @@
  45.230.237.31
  45.230.244.20
  45.230.8.20
-45.230.80.130
+45.230.80.56
  45.231.12.37
+45.231.132.170
  45.231.133.196
  45.231.213.110
+45.231.29.239
  45.231.29.60
-45.231.29.72
+45.231.30.229
  45.231.31.244
  45.231.61.227
  45.232.165.1
@@ -70905,10 +70381,11 @@
  45.232.226.158
  45.232.226.78
  45.232.244.5
-45.232.251.12
  45.232.64.17
+45.232.64.195
  45.232.65.214
  45.232.66.66
+45.232.73.46
  45.232.73.46bin.sh
  45.232.73.57
  45.232.73.83
@@ -70924,16 +70401,16 @@
  45.234.212.234
  45.234.67.76
  45.235.110.153
+45.235.110.66
  45.235.120.65
-45.235.21.137
-45.235.216.112
  45.235.34.16
  45.235.4.132
  45.235.4.172
-45.235.5.163
  45.236.120.241
  45.236.129.243
+45.236.139.75
  45.236.149.17
+45.236.149.240
  45.236.149.37
  45.236.149.69
  45.236.152.121
@@ -70950,7 +70427,6 @@
  45.237.168.204
  45.237.168.218
  45.237.168.247
-45.237.168.31
  45.237.168.70
  45.237.182.98
  45.238.208.6
@@ -70963,7 +70439,6 @@
  45.240.88.20
  45.240.88.35
  45.240.88.36
-45.242.19.81
  45.247.150.190
  45.248.138.210
  45.248.139.140
@@ -70971,11 +70446,10 @@
  45.248.160.133
  45.248.192.232
  45.248.192.48
-45.248.193.120
+45.248.193.121
  45.248.194.75
  45.248.195.170
  45.248.195.94
-45.248.25.122
  45.248.43.33
  45.248.57.126
  45.248.85.91
@@ -70994,23 +70468,25 @@
  45.249.79.105
  45.249.79.185
  45.249.79.190
+45.249.82.203
  45.249.91.181
  45.250.226.136
  45.250.226.56
  45.250.244.218
-45.250.245.119
-45.250.245.154
+45.251.116.10
  45.251.240.125
  45.251.240.197
  45.252.189.141
  45.252.189.144
  45.252.189.197
  45.252.189.200
+45.252.189.237
  45.252.189.242
  45.252.189.66
  45.252.189.80
  45.252.248.152
  45.252.248.18
+45.252.77.204
  45.253.26.158
  45.254.26.239
  45.3.204.22
@@ -71082,7 +70558,6 @@
  45.32.251.55
  45.32.252.50
  45.32.253.17
-45.32.29.101
  45.32.33.178
  45.32.34.25
  45.32.37.138
@@ -71096,7 +70571,7 @@
  45.32.48.134
  45.32.5.21
  45.32.51.158
-45.32.51.20
+45.32.52.194
  45.32.53.231
  45.32.56.132
  45.32.57.155
@@ -71123,7 +70598,6 @@
  45.33.12.226
  45.33.120.15
  45.33.122.117
-45.33.124.121
  45.33.125.57
  45.33.126.180
  45.33.126.185
@@ -71168,8 +70642,6 @@
  45.35.86.118
  45.36.184.6
  45.4.158.22
-45.4.168.106
-45.4.170.203
  45.4.187.43
  45.4.202.109
  45.4.237.72
@@ -71180,16 +70652,18 @@
  45.4.85.152
  45.40.130.40
  45.40.156.15
-45.40.164.163
+45.40.164.165
  45.40.164.166
+45.40.165.142
  45.40.166.139
  45.40.166.141
  45.40.166.142
  45.40.166.144
+45.40.166.145
  45.40.166.146
+45.40.166.148
  45.40.166.150
  45.40.166.157
-45.40.166.167
  45.40.166.172
  45.40.166.2
  45.40.167.5
@@ -71202,18 +70676,17 @@
  45.40.251.51
  45.40.253.179
  45.41.132.198
-45.41.134.130
  45.41.180.24
+45.42.6.127
  45.43.129.129
-45.43.13.176
  45.43.18.171
  45.43.18.215
  45.43.27.71
  45.46.162.85
  45.46.210.164
  45.46.51.2
-45.47.94.177
  45.48.168.16
+45.48.21.142
  45.5.119.86
  45.5.194.138
  45.5.208.129
@@ -71225,8 +70698,8 @@
  45.5.208.53
  45.5.208.57
  45.5.208.6
+45.5.209.13
  45.5.209.14
-45.5.238.103
  45.50.46.221
  45.55.1.145
  45.55.105.105
@@ -71388,11 +70861,10 @@
  45.56.122.75
  45.56.126.93
  45.56.127.75
-45.56.142.78
-45.56.150.125
+45.56.161.52
  45.56.162.8
+45.56.171.36
  45.56.174.74
-45.56.180.7
  45.56.77.104
  45.56.79.249
  45.56.80.116
@@ -71406,6 +70878,7 @@
  45.57.144.28
  45.57.147.59
  45.57.153.13
+45.57.153.53
  45.57.153.61
  45.57.153.62
  45.57.153.68
@@ -71413,7 +70886,11 @@
  45.57.159.169
  45.57.163.219
  45.57.165.199
-45.57.216.13
+45.57.165.201
+45.57.165.210
+45.57.216.106
+45.57.216.115
+45.57.216.65
  45.57.216.78
  45.57.216.79
  45.57.220.224
@@ -71421,6 +70898,7 @@
  45.57.220.235
  45.57.220.236
  45.57.220.238
+45.57.228.131
  45.57.230.153
  45.57.247.164
  45.57.252.153
@@ -71434,24 +70912,19 @@
  45.6.120.126
  45.6.123.30
  45.6.123.32
-45.6.137.149
  45.6.15.79
  45.6.18.13
  45.6.195.247bin.sh
  45.6.228.178
  45.6.229.224
  45.6.231.106
-45.6.27.210
  45.6.29.44
  45.6.37.241
-45.6.56.54
  45.6.92.131
  45.61.136.14
  45.61.136.31
  45.61.139.13
  45.61.139.48
-45.61.161.214
-45.61.161.230
  45.61.161.235
  45.61.162.234
  45.61.162.75
@@ -71471,8 +70944,9 @@
  45.61.166.33
  45.61.166.51
  45.61.166.59
+45.61.169.115
  45.61.169.248
-45.61.169.81
+45.61.169.79
  45.61.171.200
  45.61.171.233
  45.61.171.54
@@ -71511,7 +70985,6 @@
  45.63.4.201
  45.63.4.71
  45.63.43.74
-45.63.51.89
  45.63.54.13
  45.63.55.253
  45.63.58.187
@@ -71541,6 +71014,7 @@
  45.64.213.46
  45.64.237.24
  45.64.75.111
+45.64.87.102
  45.64.9.126
  45.64.99.13
  45.65.128.216
@@ -71573,7 +71047,6 @@
  45.67.228.196
  45.67.230.130
  45.67.230.58
-45.7.107.241
  45.7.116.162
  45.7.134.138
  45.7.171.48
@@ -71617,7 +71090,7 @@
  45.7.179.142
  45.7.179.144
  45.7.179.149
-45.7.179.151
+45.7.179.150
  45.7.179.154
  45.7.179.158
  45.7.179.201
@@ -71629,6 +71102,7 @@
  45.70.0.17
  45.70.0.250
  45.70.112.186
+45.70.196.180
  45.70.204.100
  45.70.204.17
  45.70.204.21
@@ -71641,9 +71115,9 @@
  45.70.206.33
  45.70.207.253
  45.70.208.42
-45.70.222.57
+45.70.21.244
+45.70.222.52
  45.70.3.30
-45.70.60.217
  45.70.84.1
  45.70.84.145
  45.70.84.32
@@ -71666,6 +71140,7 @@
  45.72.244.39
  45.72.26.10
  45.72.3.143
+45.72.35.254
  45.72.55.115
  45.72.67.13
  45.72.67.18
@@ -71699,7 +71174,6 @@
  45.76.132.156
  45.76.135.239
  45.76.141.111
-45.76.145.208
  45.76.145.89
  45.76.146.75
  45.76.147.15
@@ -71809,7 +71283,6 @@
  45.77.132.175
  45.77.133.49
  45.77.134.155
-45.77.134.64
  45.77.139.58
  45.77.139.91
  45.77.142.47
@@ -71839,7 +71312,6 @@
  45.77.224.233
  45.77.229.118
  45.77.229.156
-45.77.23.119
  45.77.23.209
  45.77.233.6
  45.77.237.44
@@ -71963,6 +71435,7 @@
  45.79.77.44
  45.79.78.5
  45.79.80.173
+45.79.82.183
  45.79.82.86
  45.79.86.247
  45.79.87.122
@@ -71972,8 +71445,8 @@
  45.79.95.107
  45.79.95.154
  45.79.99.208
-45.8.44.67
  45.8.44.71
+45.80.106.202
  45.80.106.221
  45.80.106.83
  45.80.114.10
@@ -71982,12 +71455,15 @@
  45.80.153.177
  45.80.153.178
  45.80.182.233
+45.80.210.102
  45.80.210.156
  45.80.210.184
  45.80.210.209
  45.80.210.242
  45.80.210.32
-45.80.64.142
+45.80.210.37
+45.80.210.64
+45.80.210.87
  45.80.64.230
  45.80.64.246
  45.81.139.48
@@ -72005,7 +71481,7 @@
  45.82.72.92
  45.82.81.215
  45.82.83.216
-45.83.151.69
+45.83.67.166
  45.83.91.90
  45.84.196.100
  45.84.196.110
@@ -72053,7 +71529,9 @@
  45.85.0.98
  45.85.219.74
  45.85.85.9
+45.85.90.2
  45.86.1.70
+45.86.15.113
  45.86.15.127
  45.86.15.132
  45.86.15.135
@@ -72080,17 +71558,18 @@
  45.86.201.205
  45.86.201.236
  45.86.201.3
-45.86.247.156
+45.86.202.115
  45.86.65.210
  45.87.115.231
  45.87.184.64
  45.87.186.77
  45.87.2.128
-45.87.248.206
+45.87.249.140
  45.87.89.89
  45.88.106.132
  45.88.106.31
  45.88.106.72
+45.88.106.85
  45.88.106.90
  45.88.109.161
  45.88.110.171
@@ -72101,9 +71580,9 @@
  45.88.3.244
  45.89.16.45
  45.89.173.98
-45.89.174.104
-45.89.174.84
+45.89.174.86
  45.89.233.98
+45.9.122.204
  45.9.122.225
  45.9.122.253
  45.9.122.28
@@ -72121,26 +71600,26 @@
  45.9.229.28
  45.90.109.15
  45.90.141.44
-45.90.188.142
+45.90.217.103
  45.90.222.161
  45.90.57.101
-45.90.57.194
  45.91.101.18
  45.91.203.3
  45.92.156.107
  45.92.28.101
-45.92.28.122
  45.92.28.56
  45.92.32.10
  45.92.33.4
  45.92.43.12
-45.94.232.98
+45.93.201.121
+45.93.251.197
+45.94.234.131
+45.94.235.122
  45.94.235.158
-45.94.235.199
+45.94.235.17
  45.94.235.219
  45.94.235.239
  45.94.235.82
-45.95.119.45
  45.95.119.49
  45.95.168.102
  45.95.168.103
@@ -72247,6 +71726,7 @@
  45.95.168.97
  45.95.169.2
  45.95.169.208
+45.95.169.210
  45.95.169.229
  45.95.169.232
  45.95.169.233
@@ -72260,13 +71740,13 @@
  45.95.235.45
  45.95.29.250
  45.95.39.123
+45.95.39.161
  45.95.39.220
  45.95.39.84
  45.95.55.110
  45.95.55.58
  45.95.55.69
  45.95.64.55
-45.95.64.64
  451cb6f0c987036eae512441aed22cf6-dot-tomberera.appspot.com
  452578956.000webhostapp.com
  452901.com
@@ -72302,7 +71782,6 @@
  46.0.203.99
  46.10.199.90
  46.10.221.163
-46.100.58.5
  46.100.74.74
  46.101.0.138
  46.101.1.193
@@ -72321,11 +71800,9 @@
  46.101.115.96
  46.101.116.212
  46.101.117.167
-46.101.117.230
  46.101.118.25
  46.101.12.160
  46.101.120.159
-46.101.120.8
  46.101.127.55
  46.101.128.55
  46.101.129.207
@@ -72344,6 +71821,7 @@
  46.101.141.96
  46.101.143.148
  46.101.144.52
+46.101.146.6
  46.101.149.23
  46.101.150.11
  46.101.151.167
@@ -72441,6 +71919,7 @@
  46.101.254.193
  46.101.254.30
  46.101.27.223
+46.101.28.212
  46.101.29.76
  46.101.3.206
  46.101.3.224
@@ -72461,7 +71940,6 @@
  46.101.52.217
  46.101.53.154
  46.101.53.190
-46.101.57.241
  46.101.58.148
  46.101.58.149
  46.101.58.151
@@ -72489,7 +71967,6 @@
  46.101.88.159
  46.101.90.205
  46.101.94.141
-46.101.95.65
  46.101.97.5
  46.101.97.80
  46.101.99.84
@@ -72497,9 +71974,9 @@
  46.102.152.201
  46.102.245.174
  46.102.97.90
+46.103.234.5
  46.105.100.149
  46.105.100.183
-46.105.100.82
  46.105.101.28
  46.105.101.95
  46.105.102.203
@@ -72537,10 +72014,9 @@
  46.105.29.160
  46.105.31.249
  46.105.32.34
-46.105.41.136
-46.105.45.118
  46.105.46.162
  46.105.49.134
+46.105.49.88
  46.105.56.193
  46.105.6.199
  46.105.75.179
@@ -72555,7 +72031,11 @@
  46.107.238.24
  46.107.238.30
  46.108.136.27
+46.109.32.138
  46.109.92.121
+46.114.0.169
+46.114.0.7
+46.114.107.206
  46.114.6.251
  46.116.168.126
  46.118.112.135
@@ -72571,6 +72051,7 @@
  46.119.112.23
  46.119.113.162
  46.119.115.106
+46.119.121.204
  46.119.121.84
  46.119.126.245
  46.119.127.129
@@ -72580,20 +72061,18 @@
  46.119.174.102
  46.119.180.141
  46.119.190.168
-46.119.94.217
  46.121.210.238
  46.124.169.22
  46.126.139.2
  46.126.203.45
  46.126.205.128
-46.126.230.24
  46.126.236.2
  46.126.3.28
  46.127.117.25
+46.127.28.156
  46.128.140.193
  46.128.41.9
  46.128.92.113
-46.13.164.177
  46.13.45.162
  46.130.248.250
  46.132.185.169
@@ -72604,22 +72083,19 @@
  46.138.245.49
  46.138.91.226
  46.139.105.181
-46.142.121.203
-46.142.145.33
-46.142.159.41
+46.142.124.45
  46.142.72.69
-46.142.73.115
+46.142.73.168
  46.143.184.209
  46.146.136.8
  46.146.20.23
  46.146.203.124
-46.146.206.106
  46.146.214.111
  46.146.214.244
-46.146.218.79
  46.146.244.97
  46.146.248.89
  46.146.43.11
+46.146.95.7
  46.147.132.50
  46.148.18.122
  46.148.196.106
@@ -72633,8 +72109,10 @@
  46.150.170.10
  46.150.173.75
  46.150.23.93
+46.150.76.25
  46.151.150.11
  46.151.157.115
+46.151.212.24
  46.151.212.38
  46.151.52.196
  46.151.52.197
@@ -72645,11 +72123,11 @@
  46.158.237.242
  46.16.226.6
  46.16.228.6
+46.16.231.233
  46.160.195.121
  46.160.202.162
  46.161.27.48
  46.161.40.104
-46.161.60.148
  46.161.61.24
  46.161.61.30
  46.161.61.33
@@ -72660,7 +72138,6 @@
  46.161.62.198
  46.161.62.202
  46.161.62.204
-46.161.62.206
  46.161.62.207
  46.161.62.208
  46.161.62.210
@@ -72682,6 +72159,7 @@
  46.161.63.124
  46.161.63.127
  46.161.63.133
+46.161.63.136
  46.161.63.139
  46.161.63.140
  46.161.63.143
@@ -72691,7 +72169,6 @@
  46.161.63.162
  46.161.63.172
  46.161.63.176
-46.161.63.178
  46.161.63.18
  46.161.63.185
  46.161.63.187
@@ -72709,7 +72186,6 @@
  46.161.63.25
  46.161.63.250
  46.161.63.251
-46.161.63.252
  46.161.63.37
  46.161.63.43
  46.161.63.53
@@ -72757,7 +72233,6 @@
  46.166.139.20
  46.166.139.35
  46.166.142.2
-46.166.142.216
  46.166.142.221
  46.166.143.104
  46.166.148.160
@@ -72802,21 +72277,20 @@
  46.17.42.156
  46.17.42.24
  46.17.99.143
-46.170.142.2
  46.171.110.250
  46.171.163.10
  46.171.202.117
  46.171.236.4
-46.171.236.5
  46.171.28.162
  46.171.65.210
+46.172.10.5
  46.172.223.250
  46.172.244.215
  46.172.65.135
  46.172.69.163
  46.172.69.76
  46.172.84.203
-46.173.112.137
+46.172.87.70
  46.173.175.178
  46.173.191.124
  46.173.191.94
@@ -72832,17 +72306,19 @@
  46.175.21.30
  46.175.70.69
  46.176.76.193
+46.177.177.206
  46.18.142.142
  46.18.202.159
-46.18.229.203
  46.18.76.4
  46.18.77.177
  46.180.141.150
  46.180.156.230
  46.181.102.77
+46.181.221.24
  46.181.29.197
  46.182.111.80
  46.182.129.31
+46.182.130.71
  46.182.19.219
  46.182.19.3
  46.182.19.32
@@ -72850,7 +72326,6 @@
  46.182.230.59
  46.182.5.30
  46.182.5.40
-46.183.135.167
  46.183.135.251
  46.183.216.142
  46.183.217.69
@@ -72879,33 +72354,30 @@
  46.183.56.107
  46.183.66.210
  46.185.114.98
-46.185.129.185
  46.185.138.163
  46.185.50.138
-46.185.50.140
  46.185.50.221
  46.185.50.250
  46.185.50.48
  46.185.50.50
+46.185.50.65
  46.185.50.70
  46.185.50.73
-46.185.51.225
-46.185.51.235
+46.185.51.181
  46.185.51.249
-46.185.51.28
  46.185.51.85
  46.188.10.187
  46.188.109.21
  46.188.15.6
  46.188.18.71
  46.188.30.118
+46.188.30.95
  46.188.44.82
  46.188.47.4
  46.188.53.61
  46.188.6.120
  46.188.82.11
  46.188.82.63
-46.19.137.135
  46.19.137.74
  46.19.141.82
  46.19.141.83
@@ -72928,12 +72400,11 @@
  46.20.2.220
  46.20.2.222
  46.20.59.11
+46.20.9.19
  46.20.93.83
-46.201.3.68
  46.201.5.174
-46.201.52.94
+46.204.18.91
  46.204.22.160
-46.204.34.114
  46.208.193.102
  46.21.111.219
  46.21.145.91
@@ -72943,6 +72414,7 @@
  46.21.250.85
  46.21.55.3
  46.210.121.171
+46.214.161.163
  46.216.11.214
  46.216.54.244
  46.216.59.142
@@ -72954,15 +72426,18 @@
  46.218.85.69
  46.219.112.33
  46.219.120.59
+46.219.231.228
  46.22.173.131
  46.22.49.41
  46.221.19.138
  46.221.46.81
  46.221.52.246
+46.221.61.60
  46.223.168.10
  46.223.42.171
  46.223.79.103
  46.225.104.250
+46.225.105.29
  46.225.119.60
  46.225.124.124
  46.225.240.122
@@ -72975,7 +72450,6 @@
  46.226.18.135
  46.227.162.98
  46.227.36.1
-46.227.36.147
  46.227.36.152
  46.227.37.1
  46.227.37.113
@@ -72986,6 +72460,7 @@
  46.227.37.157
  46.227.37.161
  46.227.37.169
+46.227.37.17
  46.227.37.177
  46.227.37.25
  46.227.37.33
@@ -72999,10 +72474,8 @@
  46.227.37.9
  46.227.37.97
  46.227.38.1
-46.227.38.2
  46.227.39.1
  46.227.39.2
-46.228.199.124
  46.228.93.242
  46.229.165.141
  46.229.165.142
@@ -73049,10 +72522,10 @@
  46.229.238.187
  46.229.67.198
  46.23.42.113
-46.23.68.90
  46.23.74.181
  46.23.87.218
  46.231.56.216
+46.231.79.178
  46.232.132.249
  46.232.133.26
  46.232.176.45
@@ -73063,6 +72536,7 @@
  46.237.253.139
  46.238.164.110
  46.24.148.191
+46.24.71.220
  46.24.87.236
  46.240.133.39
  46.240.151.166
@@ -73084,19 +72558,20 @@
  46.243.233.65
  46.243.236.116
  46.243.68.16
-46.244.226.30
-46.244.28.50
+46.244.229.6
  46.245.222.203
+46.246.122.81
  46.246.123.133
  46.246.123.151
  46.246.3.254
  46.246.40.179
-46.246.6.11
  46.246.61.185
  46.246.77.55
+46.246.81.2
  46.246.94.204
  46.249.114.178
  46.249.199.7
+46.249.204.4
  46.249.38.194
  46.249.59.113
  46.249.59.91
@@ -73129,6 +72604,7 @@
  46.28.227.78
  46.28.67.124
  46.28.75.214
+46.29.11.254
  46.29.116.6
  46.29.161.214
  46.29.164.31
@@ -73137,6 +72613,8 @@
  46.29.19.25
  46.29.248.166
  46.29.248.238
+46.29.249.153
+46.29.249.160
  46.29.249.166
  46.29.249.195
  46.29.250.186
@@ -73147,20 +72625,21 @@
  46.29.252.70
  46.29.252.98
  46.29.254.246
-46.29.77.134
+46.29.255.160
  46.29.79.57
+46.29.9.46
  46.30.189.41
  46.30.245.65
-46.31.146.91
+46.31.146.90
  46.32.229.152
  46.32.234.8
  46.32.239.84
  46.32.254.123
  46.32.50.98
  46.32.53.120
-46.32.67.0
  46.32.78.150
-46.33.100.162
+46.33.101.166
+46.33.114.98
  46.33.253.29
  46.33.32.1
  46.33.33.25
@@ -73171,7 +72650,6 @@
  46.35.193.240
  46.35.249.189
  46.35.27.74
-46.36.103.1
  46.36.132.68
  46.36.220.44
  46.36.27.120
@@ -73185,6 +72663,9 @@
  46.38.51.183
  46.39.129.114
  46.39.129.82
+46.39.130.96
+46.39.21.163
+46.39.29.4
  46.39.41.21
  46.4.100.141
  46.4.103.105
@@ -73238,14 +72719,16 @@
  46.4.97.19
  46.40.127.164
  46.40.3.158
+46.40.44.235
+46.41.136.41
  46.41.141.30
  46.42.86.128
  46.43.1.22
  46.43.2.95
  46.44.166.125
+46.44.166.52
  46.45.146.65
  46.45.229.159
-46.46.42.77
  46.47.255.194
  46.47.80.188bin.sh
  46.48.19.132
@@ -73261,40 +72744,42 @@
  46.53.195.177
  46.53.241.198
  46.53.243.160
+46.53.244.46
  46.55.25.191
  46.59.12.86
-46.59.189.81
+46.59.196.252
  46.59.243.225
  46.59.40.91
  46.59.65.88
  46.59.67.69
  46.59.69.54
  46.59.94.142
-46.6.15.129
+46.6.11.156
  46.6.8.128
  46.6.8.135
  46.61.48.32
  46.62.144.80
  46.63.0.17
-46.63.215.85
  46.63.53.238
  46.63.71.13
  46.63.81.195
  46.64.117.80
+46.64.160.233
+46.7.75.126
+46.70.11.239
  46.73.33.253
  46.75.47.111
-46.75.79.138
+46.8.107.5
  46.8.15.214
  46.8.156.173
+46.8.156.54
  46.8.159.147
-46.8.16.235
  46.8.16.53
  46.8.172.35
-46.8.174.116
  46.8.174.212
  46.8.179.104
-46.8.22.75
-46.8.23.129
+46.8.193.51
+46.8.223.16
  46.8.243.235
  46.8.247.3
  46.8.33.101
@@ -73316,10 +72801,11 @@
  46.8.33.245
  46.8.33.250
  46.8.48.89
-46.8.56.117
  46.8.56.152
  46.8.56.21
+46.8.57.71
  46.80.142.29
+46.83.249.82
  46.83.46.240
  46.83.64.222
  46.83.64.63
@@ -73329,26 +72815,28 @@
  46.83.72.164
  46.83.73.54
  46.83.77.136
-46.87.182.119
+46.87.252.253
  46.88.190.210
+46.88.232.95
  46.89.18.146
-46.90.87.93
-46.90.93.58
+46.9.94.78
+46.90.90.9
  46.90.94.228
  46.91.120.206
  46.92.17.217
+46.93.83.85
  46.93.99.39
-46.97.199.206
  46.97.44.18
  46.98.127.20
+46.98.130.149
  46.98.212.193
  46.98.218.195
-46.98.63.124
  46.99.113.190
+46.99.12.195
  46.99.133.169
  46.99.135.154
  46.99.135.237
-46.99.163.241
+46.99.159.24
  46.99.195.53
  46.99.195.78
  46.99.252.42
@@ -73384,21 +72872,17 @@
  47.100.119.112
  47.100.120.52
  47.100.162.210
+47.100.19.78
  47.100.192.146
-47.100.228.93
  47.100.244.87
-47.100.3.181
  47.100.85.212
  47.100.88.65
  47.101.151.15
  47.101.187.9
  47.101.190.190
-47.101.194.15
  47.101.202.14
-47.101.207.137
  47.101.212.77
  47.101.36.129
-47.102.122.175
  47.102.145.130
  47.102.193.203
  47.102.216.176
@@ -73407,22 +72891,27 @@
  47.103.199.150
  47.103.205.33
  47.103.91.169
-47.103.93.33
  47.104.156.239
+47.104.174.198
  47.104.191.32
  47.104.222.64
  47.104.252.203
  47.104.68.172
+47.104.73.4
  47.104.79.149
+47.104.90.58
  47.105.100.191
  47.105.127.151
  47.105.164.105
+47.105.194.2
  47.105.220.149
+47.105.36.164
  47.105.36.69
+47.105.60.140
+47.105.67.205
  47.106.124.179
  47.106.161.182
  47.106.192.167
-47.106.196.84
  47.106.197.184
  47.106.201.134
  47.106.221.116
@@ -73433,12 +72922,15 @@
  47.107.134.197
  47.107.140.142
  47.107.141.34
+47.107.144.13
  47.107.147.168
+47.107.161.104
  47.107.175.190
  47.107.228.241
  47.107.231.92
  47.107.244.98
  47.107.45.148
+47.107.53.126
  47.107.61.8
  47.107.70.252
  47.107.92.175
@@ -73461,47 +72953,43 @@
  47.108.81.144
  47.108.93.71
  47.110.225.78
-47.110.48.205
  47.110.49.177
  47.110.61.9
  47.110.79.249
  47.110.92.146
  47.111.12.85
  47.111.14.20
-47.111.246.143
  47.112.116.126
  47.112.122.216
  47.112.127.188
  47.112.144.63
+47.112.164.200
  47.112.173.155
-47.112.231.143
  47.113.108.107
  47.113.95.224
  47.113.97.212
  47.114.96.237
  47.115.146.83
-47.115.179.69
  47.115.40.219
  47.115.52.118
  47.115.53.163
  47.12.245.148
+47.12.7.176
  47.13.106.162
  47.13.235.230
  47.133.107.160
  47.134.141.179
-47.14.6.66
  47.144.21.37
  47.144.226.123
  47.144.81.151
  47.145.218.59
  47.146.117.214
-47.146.32.175
  47.148.18.2
  47.149.32.120
  47.149.41.240
  47.149.67.129
+47.15.102.107
  47.152.159.183
-47.152.60.174
  47.153.167.86
  47.153.183.211
  47.156.70.145
@@ -73530,7 +73018,6 @@
  47.187.29.151
  47.187.7.210
  47.188.241.189
-47.189.240.211
  47.190.132.213
  47.190.19.75
  47.192.118.43
@@ -73541,10 +73028,10 @@
  47.203.61.229
  47.203.92.216
  47.203.93.167
+47.205.22.150
  47.208.246.213
  47.21.41.254
  47.21.54.222
-47.218.222.9
  47.220.190.167
  47.221.237.222
  47.222.103.234
@@ -73552,28 +73039,29 @@
  47.223.167.153
  47.225.11.69
  47.225.35.250
+47.225.9.135
  47.227.226.242
  47.233.36.224
  47.233.5.131
-47.24.185.128
+47.234.191.166
  47.240.230.87
-47.240.49.58
+47.241.104.189
  47.241.106.223
  47.241.116.84
-47.241.15.42
+47.241.131.177
  47.241.17.34
  47.241.26.71
  47.241.29.56
  47.241.34.42
-47.241.36.77
+47.241.61.131
  47.241.62.245
  47.241.63.196
  47.241.66.186
-47.241.7.56
  47.241.70.0
  47.242.128.121
  47.242.150.202
  47.242.156.55
+47.242.17.79
  47.242.170.47
  47.242.220.246
  47.242.223.170
@@ -73583,19 +73071,16 @@
  47.242.252.24
  47.242.28.70
  47.242.49.218
-47.242.63.115
  47.242.67.241
  47.242.70.166
  47.242.87.227
  47.242.9.50
  47.244.1.172
-47.244.103.226
  47.244.107.89
  47.244.119.155
  47.244.120.6
  47.244.137.178
  47.244.151.211
-47.244.165.29
  47.244.166.23
  47.244.172.73
  47.244.175.167
@@ -73604,9 +73089,7 @@
  47.244.19.14
  47.244.191.212
  47.244.20.191
-47.244.213.73
  47.244.221.47
-47.244.228.65
  47.244.26.70
  47.244.27.17
  47.244.44.239
@@ -73617,6 +73100,7 @@
  47.244.52.99
  47.244.57.253
  47.244.9.128
+47.245.25.87
  47.245.26.36
  47.245.35.107
  47.245.35.30
@@ -73624,9 +73108,9 @@
  47.245.52.169
  47.245.52.209
  47.245.54.201
+47.245.56.216
  47.247.103.161
-47.25.66.141
-47.250.40.25
+47.251.7.70
  47.251.8.182
  47.252.73.221
  47.252.80.192
@@ -73638,10 +73122,11 @@
  47.253.5.99
  47.254.133.69
  47.254.134.244
+47.254.134.56
  47.254.145.104
+47.254.151.241
  47.254.170.214
  47.254.172.215
-47.254.173.103
  47.254.173.87
  47.254.174.194
  47.254.174.39
@@ -73649,42 +73134,33 @@
  47.254.175.100
  47.254.177.13
  47.254.178.15
-47.254.192.96
  47.254.194.27
  47.254.194.47
  47.254.20.82
  47.254.215.132
-47.254.234.70
-47.254.238.111
-47.254.240.95
+47.254.238.227
+47.254.242.97
  47.254.243.29
-47.254.247.217
  47.254.29.128
  47.254.73.32
  47.254.77.228
  47.254.93.177
  47.254.95.196
  47.26.91.137
-47.28.94.84
  47.29.136.176
  47.29.141.63
-47.29.144.249
  47.29.151.88
-47.29.154.120
-47.29.159.227
  47.29.179.240
-47.29.181.241
-47.29.76.200
-47.35.236.9
+47.29.94.33
+47.34.183.214
  47.36.140.164
-47.36.230.241
  47.39.207.183
-47.41.196.233
  47.49.12.165
  47.49.12.168
  47.49.147.253
  47.5.170.67
  47.50.246.114
+47.51.65.70
  47.52.101.94
  47.52.128.231
  47.52.134.197
@@ -73692,10 +73168,8 @@
  47.52.193.158
  47.52.201.10
  47.52.204.241
-47.52.209.162
  47.52.211.53
  47.52.227.166
-47.52.229.116
  47.52.230.235
  47.52.231.140
  47.52.232.24
@@ -73705,12 +73179,12 @@
  47.52.39.76
  47.52.59.139
  47.52.61.250
+47.52.63.33
  47.52.68.110
  47.53.17.8
  47.54.149.133
  47.54.211.232
  47.54.214.102
-47.56.126.247
  47.56.141.204
  47.56.154.54
  47.56.183.121
@@ -73726,22 +73200,22 @@
  47.62.108.176
  47.62.215.108
  47.62.38.166
+47.72.185.213
+47.74.17.225
  47.74.175.100
  47.74.182.10
  47.74.185.172
+47.74.190.56
  47.74.209.175
  47.74.228.168
  47.74.231.192
-47.74.234.121
  47.74.240.108
  47.74.241.204
  47.74.242.64
  47.74.35.128
-47.74.35.143
  47.74.44.83
  47.74.46.162
  47.74.48.82
-47.74.48.89
  47.74.62.158
  47.74.70.72
  47.74.84.115
@@ -73759,11 +73233,12 @@
  47.75.175.59
  47.75.176.144
  47.75.177.195
-47.75.178.149
  47.75.179.199
  47.75.184.180
+47.75.191.68
  47.75.199.52
  47.75.2.225
+47.75.202.172
  47.75.204.149
  47.75.204.212
  47.75.253.127
@@ -73784,7 +73259,6 @@
  47.88.28.221
  47.88.5.227
  47.88.54.50
-47.88.7.18
  47.88.76.141
  47.88.79.207
  47.88.84.125
@@ -73802,8 +73276,6 @@
  47.89.49.161
  47.89.8.133
  47.89.8.91
-47.9.224.154
-47.9.233.81
  47.90.0.38
  47.90.120.25
  47.90.243.190
@@ -73818,33 +73290,36 @@
  47.90.9.211
  47.90.95.192
  47.91.106.108
+47.91.106.208
+47.91.124.172
  47.91.165.233
  47.91.17.45
  47.91.178.158
-47.91.19.156
  47.91.196.15
  47.91.206.207
  47.91.215.113
-47.91.223.116
  47.91.228.50
-47.91.233.114
  47.91.239.118
+47.91.24.166
  47.91.246.186
  47.91.253.239
  47.91.29.30
  47.91.88.100
  47.91.89.32
  47.91.92.101
+47.91.92.228
+47.92.109.48
  47.92.137.121
+47.92.166.137
  47.92.204.240
  47.92.212.252
  47.92.245.97
  47.92.38.51
  47.92.78.176
-47.92.90.12
  47.92.94.125
  47.93.150.202
  47.93.150.5
+47.93.150.93
  47.93.173.17
  47.93.198.131
  47.93.230.171
@@ -73852,12 +73327,10 @@
  47.93.4.61
  47.93.96.145
  47.93.97.47
-47.94.1.121
  47.94.104.165
  47.94.111.103
  47.94.148.130
  47.94.175.175
-47.94.19.128
  47.94.194.39
  47.94.196.118
  47.94.200.124
@@ -73865,6 +73338,7 @@
  47.94.242.18
  47.94.243.77
  47.94.40.1
+47.94.41.69
  47.94.89.87
  47.95.12.84
  47.95.143.14
@@ -73872,28 +73346,23 @@
  47.95.211.213
  47.95.213.15
  47.95.215.4
-47.95.223.118
  47.95.32.92
-47.96.101.247
+47.96.104.219
  47.96.111.238
  47.96.119.168
-47.96.123.190
  47.96.144.102
  47.96.148.248
+47.96.150.119
  47.96.164.251
  47.96.5.37
-47.97.153.92
  47.97.154.202
+47.97.163.238
  47.97.173.229
  47.97.204.57
  47.97.90.220
  47.98.114.56
  47.98.138.84
-47.98.166.108
-47.98.170.47
  47.98.192.141
-47.98.42.210
-47.99.149.110
  47.99.158.238
  47.99.65.77
  470365365.com
@@ -73943,7 +73412,6 @@
  48blv.weblium.site
  48rro.weblium.site
  49.0.39.186
-49.0.82.190
  49.1.244.139
  49.112.196.49
  49.112.197.0
@@ -73981,18 +73449,16 @@
  49.12.11.16
  49.12.126.6
  49.12.163.214
-49.12.165.64
  49.12.32.67
  49.12.4.194
  49.12.47.176
  49.12.64.114
-49.12.74.93
-49.12.75.224
  49.12.83.44
  49.12.85.232
  49.12.98.122
  49.128.181.229
  49.135.34.49
+49.135.40.29
  49.142.180.230
  49.142.74.124
  49.142.94.79
@@ -74003,21 +73469,26 @@
  49.143.32.92
  49.144.7.160
  49.145.105.98
-49.145.107.36
  49.145.108.22
  49.145.165.217
-49.145.171.66
+49.145.170.50
  49.145.206.124
  49.145.226.213
+49.145.3.156
  49.145.66.194
+49.145.71.150
+49.145.71.76
  49.146.64.207
-49.146.66.1
-49.147.127.111
-49.147.142.16
  49.147.197.126
  49.147.198.250
+49.148.147.75
+49.149.102.227
  49.149.109.80
+49.149.143.184
+49.149.203.192
  49.149.45.236
+49.149.78.117
+49.149.99.94
  49.150.228.59
  49.150.240.212
  49.150.34.157
@@ -74031,9 +73502,8 @@
  49.156.45.181
  49.156.47.61
  49.159.160.71
-49.172.28.35
-49.176.168.68
  49.195.105.206
+49.204.180.115
  49.204.231.7
  49.204.81.186
  49.205.165.42
@@ -74041,19 +73511,20 @@
  49.205.182.134
  49.205.216.183
  49.205.234.221
+49.205.244.116
  49.205.245.84
  49.205.77.108
  49.205.79.89
  49.206.121.76
-49.206.15.109
  49.206.16.156
  49.206.18.102
  49.206.228.138
  49.206.244.236
+49.207.137.245
+49.207.137.34
  49.207.140.81
-49.207.142.138
  49.207.177.234
-49.207.198.117
+49.207.198.186
  49.212.135.219
  49.212.151.222
  49.212.179.180
@@ -74062,13 +73533,11 @@
  49.228.10.186
  49.228.195.145
  49.228.237.222
-49.228.238.191
-49.228.240.154
-49.228.249.53
+49.228.242.224
  49.228.27.23
  49.228.49.53
-49.228.74.114
  49.229.69.4
+49.230.204.73
  49.230.64.223
  49.231.0.178
  49.231.145.150
@@ -74087,11 +73556,13 @@
  49.232.129.139
  49.232.13.22
  49.232.131.72
+49.232.134.70
  49.232.135.12
  49.232.135.77
  49.232.136.228
  49.232.136.246
  49.232.136.90
+49.232.137.200
  49.232.139.175
  49.232.139.183
  49.232.14.84
@@ -74124,12 +73595,10 @@
  49.232.172.23
  49.232.174.142
  49.232.174.152
-49.232.174.23
  49.232.175.137
  49.232.18.108
  49.232.191.178
  49.232.191.67
-49.232.192.91
  49.232.194.141
  49.232.196.185
  49.232.197.175
@@ -74149,6 +73618,7 @@
  49.232.208.26
  49.232.209.128
  49.232.210.195
+49.232.212.10
  49.232.212.5
  49.232.213.140
  49.232.214.24
@@ -74169,6 +73639,8 @@
  49.232.250.57
  49.232.251.68
  49.232.26.148
+49.232.27.19
+49.232.30.29
  49.232.31.85
  49.232.39.21
  49.232.41.237
@@ -74190,6 +73662,7 @@
  49.232.83.75
  49.232.83.86
  49.232.84.172
+49.232.86.158
  49.232.87.218
  49.232.89.242
  49.232.9.144
@@ -74208,7 +73681,6 @@
  49.233.157.204
  49.233.16.90
  49.233.160.217
-49.233.162.63
  49.233.166.113
  49.233.166.251
  49.233.168.100
@@ -74239,22 +73711,23 @@
  49.233.204.226
  49.233.214.16
  49.233.22.214
+49.233.221.231
  49.233.23.193
  49.233.23.221
  49.233.250.147
  49.233.251.161
-49.233.254.190
  49.233.254.253
  49.233.28.77
  49.233.3.177
  49.233.30.125
  49.233.30.96
+49.233.32.245
  49.233.34.26
  49.233.34.5
  49.233.34.7
  49.233.34.9
  49.233.35.206
-49.233.39.3
+49.233.37.15
  49.233.4.143
  49.233.4.31
  49.233.51.48
@@ -74270,9 +73743,9 @@
  49.233.77.44
  49.233.79.152
  49.233.80.20
-49.233.81.161
  49.233.84.191
  49.233.85.167
+49.233.87.97
  49.233.90.175
  49.233.91.148
  49.234.100.123
@@ -74281,7 +73754,6 @@
  49.234.100.95
  49.234.101.196
  49.234.104.247
-49.234.105.100
  49.234.107.24
  49.234.111.57
  49.234.111.90
@@ -74303,9 +73775,11 @@
  49.234.143.24
  49.234.145.57
  49.234.145.59
+49.234.149.92
  49.234.150.187
  49.234.158.131
  49.234.158.16
+49.234.163.189
  49.234.178.175
  49.234.18.158
  49.234.181.60
@@ -74326,7 +73800,6 @@
  49.234.224.108
  49.234.224.88
  49.234.225.128
-49.234.225.74
  49.234.227.17
  49.234.227.202
  49.234.228.195
@@ -74344,7 +73817,6 @@
  49.234.30.113
  49.234.32.74
  49.234.33.123
-49.234.33.229
  49.234.35.79
  49.234.37.38
  49.234.38.42
@@ -74356,7 +73828,9 @@
  49.234.43.224
  49.234.43.39
  49.234.45.241
+49.234.45.94
  49.234.46.181
+49.234.46.36
  49.234.47.124
  49.234.49.197
  49.234.50.247
@@ -74374,8 +73848,6 @@
  49.234.71.65
  49.234.78.216
  49.234.79.129
-49.234.79.193
-49.234.80.81
  49.234.84.58
  49.234.9.92
  49.234.92.108
@@ -74384,7 +73856,6 @@
  49.234.96.30
  49.234.97.87
  49.234.99.246
-49.235.1.23
  49.235.100.147
  49.235.101.138
  49.235.103.12
@@ -74396,7 +73867,6 @@
  49.235.109.216
  49.235.11.137
  49.235.110.143
-49.235.111.75
  49.235.113.101
  49.235.113.235
  49.235.117.50
@@ -74454,6 +73924,7 @@
  49.235.65.127
  49.235.68.79
  49.235.68.90
+49.235.72.35
  49.235.73.19
  49.235.73.82
  49.235.74.168
@@ -74480,6 +73951,7 @@
  49.236.214.144
  49.238.142.12
  49.243.9.118
+49.246.65.251
  49.247.135.55
  49.247.204.78
  49.247.208.185
@@ -74493,48 +73965,49 @@
  49.249.239.198
  49.255.35.114
  49.255.93.10
-49.34.176.218
-49.34.182.251
-49.34.192.247
-49.34.206.90
-49.34.207.210
-49.36.119.196
-49.36.137.168
+49.36.138.74
  49.36.139.195
+49.36.139.2
  49.36.145.145
+49.36.157.230
  49.36.164.99
-49.36.165.137
-49.36.168.219
  49.36.240.199
  49.36.243.82
+49.36.33.104
  49.36.6.64
+49.36.66.97
+49.37.150.128
  49.37.165.82
-49.37.180.127
+49.37.2.254
  49.37.2.45
+49.37.211.71
  49.37.213.101
+49.37.213.221
  49.37.221.0
  49.37.4.108
+49.37.4.193
  49.37.7.12
  49.37.7.84
+49.37.82.160
  49.37.82.75
  49.37.82.77
+49.37.83.184
+49.37.86.119
  49.4.31.138
  49.4.67.31
-49.48.148.25
+49.48.109.178
  49.48.231.117
  49.48.33.129
+49.48.50.125
  49.48.90.78
  49.48.99.76
  49.49.0.79
  49.49.2.104
-49.49.217.189
  49.49.236.188
-49.49.241.26
  49.49.43.91
  49.50.105.62
  49.50.107.221
  49.50.164.24
-49.50.96.101
  49.51.138.189
  49.51.161.40
  49.51.180.170
@@ -74555,10 +74028,8 @@
  49.51.47.149
  49.51.49.254
  49.51.90.173
-49.64.159.98
-49.64.252.154
  49.64.52.200
-49.64.63.84
+49.64.52.75
  49.65.134.12
  49.68.123.52
  49.68.124.248
@@ -74567,7 +74038,6 @@
  49.68.131.148
  49.68.131.194
  49.68.131.71
-49.68.144.193
  49.68.151.194
  49.68.154.105
  49.68.154.84
@@ -74620,7 +74090,7 @@
  49.68.77.182
  49.68.83.170
  49.68.83.240
-49.69.51.215
+49.7.20.85
  49.70.106.4
  49.70.119.0
  49.70.123.252
@@ -74639,14 +74109,19 @@
  49.70.95.248
  49.72.111.207
  49.72.171.111
+49.72.212.22
  49.72.38.74
-49.73.124.59
+49.73.124.116
+49.73.124.221
+49.73.124.68
  49.73.124.89
+49.73.177.31
+49.73.177.53
  49.73.187.114
-49.73.187.84
  49.73.235.149
-49.73.244.221
-49.73.4.159
+49.73.4.31
+49.73.7.196
+49.73.7.26
  49.73.90.107
  49.73.98.100
  49.74.106.177
@@ -74654,12 +74129,14 @@
  49.75.122.29
  49.75.138.31
  49.75.14.22
-49.75.141.12
  49.75.153.147
-49.75.194.100
+49.75.153.48
  49.75.237.30
+49.75.237.69
+49.75.27.178
  49.75.59.242
-49.75.59.45
+49.76.10.232
+49.76.87.4
  49.80.122.175
  49.80.224.75
  49.80.231.237
@@ -74674,6 +74151,7 @@
  49.81.134.150
  49.81.134.246
  49.81.141.138
+49.81.144.228
  49.81.153.56
  49.81.156.134
  49.81.156.149
@@ -74713,37 +74191,40 @@
  49.84.125.254
  49.84.125.71
  49.84.127.92
-49.84.145.73
  49.85.162.210
  49.85.179.51
-49.85.195.87
+49.85.195.169
+49.85.216.212
  49.85.236.145
  49.85.54.87
+49.87.194.187
  49.87.201.232
  49.87.250.42
  49.87.46.40
  49.87.73.77
  49.88.112.110
  49.88.112.112
+49.88.112.113
  49.88.112.114
  49.88.112.115
  49.88.112.116
  49.88.112.117
  49.88.112.118
  49.88.112.4
+49.88.112.60
  49.88.112.65
  49.88.112.67
  49.88.112.68
+49.88.112.69
+49.88.112.71
  49.88.112.72
+49.88.112.73
  49.88.112.75
  49.88.112.76
  49.88.112.77
  49.88.185.144
-49.88.223.117
  49.88.64.59
  49.88.65.19
-49.88.66.111
-49.88.67.198
  49.89.103.106
  49.89.109.14
  49.89.115.124
@@ -74936,7 +74417,6 @@
  4xasfasfasffa.blowewiux.com
  4xhcjscumch77fhmpszi.waysaeha.com
  4xp.com
-4yo-j01n.000webhostapp.com
  4you.by
  4youbeautysalon.com
  4zi.134mcp.com
@@ -74948,7 +74428,6 @@
  5.1.53.46
  5.10.18.42
  5.10.206.195
-5.10.41.229
  5.10.68.248
  5.10.76.30
  5.100.228.206
@@ -74978,28 +74457,26 @@
  5.104.105.223
  5.104.105.241
  5.104.105.247
-5.107.169.55
  5.11.116.221
-5.11.134.152
+5.11.223.200
+5.12.126.100
  5.12.205.152
  5.12.233.12
-5.12.29.202
+5.12.240.209
  5.128.100.109
+5.128.100.240
  5.128.87.126
-5.130.103.126
+5.13.220.56
  5.130.168.9
  5.133.11.119
-5.133.179.164
  5.133.179.243
-5.133.179.45
  5.133.24.117
  5.133.65.82
  5.135.123.36
  5.135.129.180
  5.135.14.247
  5.135.140.215
-5.135.141.147
-5.135.141.158
+5.135.15.12
  5.135.156.68
  5.135.16.122
  5.135.160.228
@@ -75028,9 +74505,6 @@
  5.135.23.3
  5.135.232.8
  5.135.237.216
-5.135.238.194
-5.135.238.220
-5.135.238.228
  5.135.239.81
  5.135.244.251
  5.135.34.152
@@ -75038,17 +74512,16 @@
  5.135.72.184
  5.135.74.187
  5.135.94.191
-5.137.188.149
+5.136.170.208
+5.137.191.107
  5.137.98.199
  5.138.104.80
  5.138.159.73
  5.139.129.114
  5.139.129.188
-5.139.135.172
  5.139.142.39
  5.14.167.123
  5.140.212.175
-5.140.233.250
  5.140.68.171
  5.140.78.35
  5.141.131.164
@@ -75057,9 +74530,7 @@
  5.141.81.106
  5.141.86.233
  5.142.154.178
-5.142.163.108
-5.142.222.15
-5.143.101.195
+5.143.95.240
  5.144.130.12
  5.144.176.130
  5.144.176.194
@@ -75077,14 +74548,18 @@
  5.149.250.76
  5.149.252.252
  5.149.254.109
+5.149.255.178
  5.149.64.194
+5.149.94.108
  5.15.8.16
+5.150.201.139
  5.150.209.181
  5.150.230.8
  5.150.239.205
  5.150.240.82
  5.150.249.254
  5.152.0.210
+5.152.156.205
  5.152.158.4
  5.152.174.62
  5.152.203.117
@@ -75105,6 +74580,7 @@
  5.157.11.231
  5.157.11.30
  5.157.11.47
+5.157.14.242
  5.157.17.30
  5.157.17.62
  5.157.19.2
@@ -75129,26 +74605,28 @@
  5.157.24.32
  5.157.24.84
  5.157.26.137
+5.157.26.212
+5.157.27.174
  5.157.27.224
  5.157.27.23
  5.157.27.65
  5.157.27.70
  5.157.27.82
  5.157.27.87
+5.157.29.165
+5.157.29.249
  5.157.29.93
  5.157.32.162
-5.157.32.219
-5.157.32.227
  5.157.32.30
  5.157.32.39
  5.157.32.47
  5.157.38.42
  5.157.5.18
-5.157.5.201
-5.157.5.31
  5.157.55.112
+5.157.55.12
  5.157.55.131
  5.157.55.134
+5.157.55.156
  5.157.55.163
  5.157.55.196
  5.157.55.200
@@ -75157,6 +74635,7 @@
  5.157.56.76
  5.157.56.79
  5.157.58.72
+5.157.58.99
  5.157.59.210
  5.157.59.252
  5.157.60.132
@@ -75171,7 +74650,6 @@
  5.158.187.169
  5.158.236.116
  5.158.239.100
-5.158.71.129
  5.159.118.65
  5.159.50.62
  5.16.13.38
@@ -75180,12 +74658,14 @@
  5.160.243.153
  5.164.150.22
  5.164.193.127
+5.164.193.186
  5.164.196.200
  5.164.197.180
+5.164.199.139
  5.164.200.148
  5.164.209.113
  5.164.212.137
-5.164.212.203
+5.164.212.186
  5.164.215.19
  5.164.219.136
  5.164.222.162
@@ -77259,7 +76739,7 @@
  5.171.213.150
  5.172.144.154
  5.175.225.107
-5.176.108.38
+5.175.90.163
  5.178.135.226
  5.178.142.58
  5.178.193.43
@@ -77267,17 +76747,16 @@
  5.178.61.121
  5.178.68.221
  5.18.246.203
-5.180.107.194
-5.180.220.142
+5.180.220.178
  5.180.244.21
  5.180.244.213
  5.180.244.233
  5.180.244.25
  5.180.245.234
-5.180.79.248
  5.181.156.165
  5.181.170.164
  5.181.234.38
+5.181.235.14
  5.181.4.201
  5.181.4.247
  5.182.208.67
@@ -77293,6 +76772,8 @@
  5.182.26.119
  5.182.26.126
  5.182.26.129
+5.183.108.89
+5.183.181.77
  5.183.212.79
  5.183.255.129
  5.183.69.243
@@ -77311,18 +76792,17 @@
  5.183.92.44
  5.183.92.55
  5.183.92.56
-5.183.92.61
  5.183.92.80
  5.183.92.91
  5.183.93.20
  5.183.94.15
  5.183.94.22
  5.183.94.35
+5.183.94.51
  5.183.94.63
-5.183.94.99
-5.184.235.70
+5.183.94.67
+5.184.226.180
  5.185.66.236
-5.186.116.59
  5.186.60.13
  5.187.141.37
  5.187.55.242
@@ -77332,6 +76812,7 @@
  5.188.11.114
  5.188.11.115
  5.188.11.165
+5.188.156.67
  5.188.168.127
  5.188.206.2
  5.188.206.204
@@ -77342,10 +76823,7 @@
  5.188.210.10
  5.188.210.16
  5.188.210.18
-5.188.210.242
-5.188.210.36
  5.188.210.47
-5.188.210.61
  5.188.210.78
  5.188.210.8
  5.188.210.84
@@ -77364,7 +76842,6 @@
  5.188.48.10
  5.188.48.111
  5.188.48.115
-5.188.48.12
  5.188.48.13
  5.188.48.33
  5.188.48.40
@@ -77379,6 +76856,7 @@
  5.188.62.18
  5.188.62.214
  5.188.62.24
+5.188.62.76
  5.188.84.147
  5.188.84.15
  5.188.84.186
@@ -77395,6 +76873,7 @@
  5.188.93.31
  5.189.128.186
  5.189.128.45
+5.189.129.214
  5.189.130.21
  5.189.130.228
  5.189.132.254
@@ -77403,6 +76882,7 @@
  5.189.137.50
  5.189.140.133
  5.189.140.14
+5.189.141.119
  5.189.144.193
  5.189.147.147
  5.189.149.185
@@ -77417,6 +76897,7 @@
  5.189.168.53
  5.189.171.179
  5.189.173.197
+5.189.175.115
  5.189.176.171
  5.189.176.196
  5.189.178.241
@@ -77437,16 +76918,18 @@
  5.19.140.86
  5.19.144.26
  5.19.164.33
+5.190.145.167
+5.190.179.146
+5.190.189.106
  5.190.189.71
  5.190.237.95
-5.190.63.24
-5.190.65.72
+5.190.81.108
+5.190.81.129
  5.195.10.174
  5.196.102.86
  5.196.110.170
  5.196.148.255
  5.196.148.75
-5.196.148.77
  5.196.167.44
  5.196.195.139
  5.196.198.147
@@ -77462,7 +76945,9 @@
  5.196.29.8
  5.196.35.138
  5.196.59.57
+5.196.63.119
  5.196.64.61
+5.196.67.45
  5.196.68.118
  5.196.69.107
  5.196.70.107
@@ -77481,6 +76966,7 @@
  5.196.83.88
  5.196.88.214
  5.196.90.58
+5.196.92.240
  5.196.95.80
  5.198.68.181
  5.199.130.127
@@ -77500,7 +76986,6 @@
  5.2.64.199
  5.2.64.230
  5.2.67.21
-5.2.68.5
  5.2.68.74
  5.2.69.5
  5.2.69.6
@@ -77522,29 +77007,32 @@
  5.2.78.87
  5.2.79.179
  5.2.79.82
-5.20.62.201
+5.20.13.80
  5.200.55.159
  5.200.85.197
+5.201.128.221
  5.201.164.104
  5.202.107.17
  5.202.112.26
  5.202.44.214
  5.202.45.101
+5.202.45.142
  5.202.45.190
  5.202.45.2
  5.202.45.208
+5.202.45.21
+5.202.45.254
+5.202.45.26
  5.202.45.76
  5.202.46.111
  5.202.46.114
  5.202.46.117
+5.202.46.123
  5.202.46.132
  5.202.46.137
  5.202.46.138
-5.202.46.140
-5.202.46.143
  5.202.46.145
  5.202.46.147
-5.202.46.153
  5.202.46.162
  5.202.46.173
  5.202.46.179
@@ -77552,38 +77040,37 @@
  5.202.46.188
  5.202.46.198
  5.202.46.204
-5.202.46.249
+5.202.46.241
  5.202.46.27
  5.202.46.3
  5.202.46.32
-5.202.46.46
  5.202.46.6
  5.202.46.67
+5.202.46.81
  5.202.46.82
  5.202.46.90
  5.202.46.97
  5.202.47.104
  5.202.47.116
  5.202.47.147
+5.202.47.154
  5.202.47.156
+5.202.47.16
  5.202.47.172
-5.202.47.174
  5.202.47.186
  5.202.47.20
  5.202.47.204
  5.202.47.208
  5.202.47.216
-5.202.47.222
+5.202.47.229
  5.202.47.233
  5.202.47.238
  5.202.47.30
-5.202.47.38
  5.202.47.50
  5.202.47.69
  5.202.47.74
  5.202.47.76
  5.202.47.9
-5.202.95.148
  5.206.224.138
  5.206.224.171
  5.206.224.216
@@ -77597,36 +77084,39 @@
  5.206.227.18
  5.206.227.228
  5.206.227.45
+5.206.227.64
  5.206.230.62
  5.206.232.190
+5.206.233.167
  5.206.236.45
  5.206.88.106
+5.218.22.12
  5.22.154.50
  5.225.220.76
  5.226.138.3
  5.226.70.68
  5.226.98.18
+5.227.253.236
  5.228.232.101
  5.228.57.189
  5.23.102.194
  5.23.103.98
  5.230.22.248
  5.231.180.127
-5.231.88.40
  5.232.118.51
-5.234.183.78
-5.237.202.200
  5.243.121.37
  5.248.164.210
  5.248.19.91
  5.248.225.172
  5.248.241.239
+5.248.57.178
  5.248.86.134
  5.249.147.91
  5.249.148.162
  5.249.153.62
  5.249.9.216
  5.251.49.142
+5.251.64.148
  5.252.193.211
  5.252.194.137
  5.252.194.29
@@ -77634,12 +77124,9 @@
  5.253.18.191
  5.253.204.11
  5.253.204.131
-5.253.204.14
-5.253.204.158
  5.253.204.39
  5.253.25.147
  5.253.25.217
-5.253.25.64
  5.253.86.13
  5.253.86.183
  5.254.101.226
@@ -77663,22 +77150,22 @@
  5.255.81.155
  5.255.86.110
  5.255.91.73
+5.28.28.96
+5.29.144.158
  5.3.129.219
  5.3.133.139
  5.3.140.143
  5.3.147.137
  5.3.216.168
  5.3.218.163
-5.3.220.207
-5.3.221.18
  5.3.221.85
  5.3.233.248
  5.3.6.82
+5.32.134.226
  5.32.181.13
  5.34.158.102
  5.34.178.126
  5.34.180.177
-5.34.180.179
  5.34.181.13
  5.34.181.17
  5.34.183.136
@@ -77686,10 +77173,14 @@
  5.34.221.226
  5.34.241.196
  5.34.243.34
+5.34.46.10
  5.34.86.230
  5.36.123.12
+5.36.181.222
  5.36.249.176
  5.36.92.161
+5.36.96.48
+5.37.249.238
  5.38.216.48
  5.38.244.239
  5.39.101.15
@@ -77728,9 +77219,9 @@
  5.39.94.46
  5.39.95.38
  5.39.97.155
+5.41.5.195
  5.42.246.46
  5.44.25.146
-5.44.3.44
  5.45.104.77
  5.45.110.20
  5.45.124.42
@@ -77785,7 +77276,6 @@
  5.62.43.61
  5.62.56.11
  5.62.58.170
-5.62.61.38
  5.63.146.172
  5.63.158.140
  5.63.158.232
@@ -77800,15 +77290,12 @@
  5.69.89.34
  5.71.155.237
  5.71.186.2
-5.76.191.11
-5.76.196.177
  5.77.35.249
  5.79.105.33
  5.79.109.46
  5.79.109.48
  5.79.123.3
  5.79.165.108
-5.79.206.182
  5.79.254.141
  5.79.42.20
  5.79.66.162
@@ -77859,6 +77346,9 @@
  5.8.71.45
  5.8.88.75
  5.80.115.86
+5.80.93.182
+5.80.97.36
+5.81.23.232
  5.83.104.130
  5.83.104.133
  5.83.104.136
@@ -77892,7 +77382,6 @@
  5.83.162.160
  5.83.163.164
  5.83.93.197
-5.88.115.5
  5.88.135.45
  5.88.155.130
  5.89.175.250
@@ -77948,6 +77437,7 @@
  5.9.22.98
  5.9.225.134
  5.9.23.231
+5.9.23.6
  5.9.233.203
  5.9.239.131
  5.9.244.157
@@ -78000,22 +77490,20 @@
  5.9.94.237
  5.9.98.178
  5.9.99.120
-5.90.15.159
-5.90.18.42
-5.90.209.18
-5.90.214.233
+5.90.13.241
  5.90.222.217
-5.90.37.184
  5.90.44.95
-5.90.83.118
+5.90.83.195
+5.90.93.142
+5.91.13.177
+5.91.19.123
  5.91.30.95
-5.91.6.131
  5.aba.vg
  5.top4top.io
  5.zxczj.top
  50-87-224-50.unifiedlayer.com
  50.0.51.253
-50.106.201.205
+50.0.71.24
  50.107.49.234
  50.112.39.196
  50.112.66.163
@@ -78104,7 +77592,6 @@
  50.193.202.81
  50.194.237.58
  50.195.128.188
-50.195.197.105
  50.195.7.180
  50.196.105.87
  50.196.126.233
@@ -78116,21 +77603,19 @@
  50.199.246.133
  50.199.46.20
  50.2.13.166
-50.2.188.170
  50.2.190.18
  50.2.77.198
-50.2.77.199
-50.2.77.200
  50.2.77.203
-50.2.77.216
-50.2.77.219
+50.2.77.204
+50.2.77.205
+50.2.77.206
+50.2.77.211
+50.2.77.218
  50.2.77.223
-50.2.77.226
  50.2.77.227
-50.2.77.249
+50.2.77.248
  50.20.209.84
  50.20.246.172
-50.201.217.170
  50.201.51.216
  50.201.58.84
  50.202.139.150
@@ -78150,20 +77635,17 @@
  50.22.53.71
  50.22.75.14
  50.220.121.222
-50.227.195.3
  50.227.46.1
  50.23.43.242
  50.23.69.44
  50.23.76.241
  50.230.160.35
-50.233.228.147
  50.233.42.98
  50.235.28.146
  50.235.92.14
  50.235.92.65
  50.236.148.246
  50.236.148.254
-50.236.218.78
  50.236.62.30
  50.236.77.190
  50.237.206.138
@@ -78177,7 +77659,6 @@
  50.243.170.153
  50.243.2.110
  50.243.62.19
-50.244.113.98
  50.244.173.237
  50.244.9.1
  50.245.107.73
@@ -78201,23 +77682,24 @@
  50.250.56.129
  50.250.75.153
  50.251.216.225
+50.251.216.228
+50.251.228.93
  50.251.29.57
  50.252.47.29
  50.253.187.214
-50.253.211.61
  50.253.49.189
  50.254.135.209
  50.254.136.133
  50.254.218.37
+50.255.127.82
  50.255.183.165
  50.255.64.233
  50.26.216.137
-50.27.125.104
-50.27.91.140
  50.28.1.43
  50.28.105.15
  50.28.18.205
  50.28.33.173
+50.28.36.117
  50.28.51.143
  50.28.59.10
  50.28.84.148
@@ -78231,20 +77713,18 @@
  50.3.177.72
  50.3.177.76
  50.3.192.102
+50.3.192.111
  50.3.192.171
  50.3.192.78
  50.3.197.154
-50.3.197.226
  50.3.73.109
  50.3.74.72
-50.3.79.58
+50.3.79.46
+50.3.84.123
  50.3.89.143
+50.3.89.186
  50.3.89.206
-50.3.89.240
-50.3.89.30
-50.3.89.41
  50.30.37.150
-50.30.84.233
  50.30.93.94
  50.31.10.228
  50.31.146.37
@@ -78264,8 +77744,8 @@
  50.4.46.52
  50.4.69.112
  50.45.232.189
-50.46.218.6
  50.5.46.195
+50.53.239.161
  50.53.250.162
  50.54.141.230
  50.56.109.107
@@ -78285,9 +77765,12 @@
  50.62.133.47
  50.62.160.157
  50.62.160.218
+50.62.161.133
  50.62.161.140
  50.62.161.211
  50.62.161.52
+50.62.169.117
+50.62.176.125
  50.62.176.148
  50.62.176.151
  50.62.176.178
@@ -78295,10 +77778,13 @@
  50.62.176.236
  50.62.176.241
  50.62.176.247
+50.62.176.28
  50.62.176.62
  50.62.176.75
  50.62.176.95
+50.62.177.116
  50.62.177.122
+50.62.177.163
  50.62.177.189
  50.62.177.223
  50.62.177.230
@@ -78306,9 +77792,12 @@
  50.62.177.55
  50.62.177.91
  50.62.208.106
+50.62.208.139
+50.62.208.149
  50.62.208.155
  50.62.208.165
  50.62.208.166
+50.62.208.200
  50.62.208.36
  50.62.208.39
  50.62.208.68
@@ -78318,21 +77807,25 @@
  50.62.30.5
  50.62.35.16
  50.63.12.201
-50.63.12.70
-50.63.13.108
+50.63.13.221
  50.63.167.184
  50.63.194.47
-50.63.196.142
+50.63.194.53
+50.63.196.133
  50.63.196.183
+50.63.196.204
  50.63.196.24
  50.63.196.76
+50.63.196.8
  50.63.196.86
-50.63.197.101
  50.63.197.133
+50.63.197.150
  50.63.197.166
  50.63.197.209
  50.63.197.21
+50.63.197.25
  50.63.197.27
+50.63.197.35
  50.63.197.69
  50.63.197.71
  50.63.197.88
@@ -78374,7 +77867,6 @@
  50.87.38.190
  50.88.20.178
  50.88.217.109
-50.88.93.72
  50.89.240.142
  50.90.3.116
  50.91.114.38
@@ -78412,9 +77904,7 @@
  51.103.130.57
  51.103.133.157
  51.103.142.75
-51.103.144.230
  51.103.151.231
-51.103.24.144
  51.103.32.47
  51.103.36.201
  51.103.36.217
@@ -78437,10 +77927,8 @@
  51.13.65.199
  51.132.52.203
  51.136.33.31
-51.137.150.11
  51.140.15.164
  51.140.185.84
-51.140.228.46
  51.140.29.247
  51.140.48.231
  51.140.67.211
@@ -78449,9 +77937,13 @@
  51.141.167.27
  51.141.79.141
  51.144.106.161
+51.144.122.125
+51.144.122.233
+51.144.127.14
+51.144.127.47
  51.144.234.30
-51.144.238.134
  51.144.238.248
+51.144.247.76
  51.144.73.114
  51.148.153.60
  51.15.10.158
@@ -78479,12 +77971,12 @@
  51.15.147.166
  51.15.154.16
  51.15.154.163
+51.15.154.73
  51.15.154.74
  51.15.157.205
  51.15.157.211
  51.15.159.90
  51.15.162.102
-51.15.163.21
  51.15.165.15
  51.15.165.173
  51.15.166.138
@@ -78497,16 +77989,15 @@
  51.15.177.162
  51.15.179.65
  51.15.18.144
+51.15.180.146
  51.15.180.168
  51.15.181.211
  51.15.185.78
  51.15.187.128
  51.15.189.142
-51.15.191.21
  51.15.191.81
  51.15.195.121
  51.15.199.181
-51.15.2.189
  51.15.204.155
  51.15.204.27
  51.15.205.46
@@ -78529,7 +78020,6 @@
  51.15.233.253
  51.15.233.75
  51.15.234.207
-51.15.24.173
  51.15.240.1
  51.15.248.110
  51.15.254.2
@@ -78599,7 +78089,6 @@
  51.154.53.96
  51.154.57.233
  51.158.104.101
-51.158.105.98
  51.158.107.202
  51.158.108.135
  51.158.111.157
@@ -78635,7 +78124,6 @@
  51.158.191.252
  51.158.20.200
  51.158.23.2
-51.158.24.101
  51.158.28.129
  51.158.29.101
  51.158.64.175
@@ -78650,8 +78138,8 @@
  51.158.76.106
  51.158.98.121
  51.158.99.51
+51.159.0.180
  51.159.0.6
-51.159.1.34
  51.159.1.45
  51.159.139.77
  51.159.148.67
@@ -78662,12 +78150,17 @@
  51.159.2.240
  51.159.24.172
  51.159.29.5
+51.159.29.96
  51.159.30.99
  51.159.56.104
  51.159.56.106
  51.159.56.204
  51.159.56.35
+51.159.58.126
+51.159.58.129
+51.159.67.165
  51.159.70.147
+51.159.93.108
  51.159.94.210
  51.161.10.20
  51.161.116.175
@@ -78678,6 +78171,7 @@
  51.161.43.235
  51.161.45.174
  51.161.52.46
+51.161.57.15
  51.161.57.155
  51.161.62.153
  51.161.68.186
@@ -78689,17 +78183,16 @@
  51.174.28.217
  51.174.76.107
  51.175.126.46
-51.178.136.52
  51.178.137.106
  51.178.138.1
  51.178.139.115
  51.178.142.175
  51.178.143.70
+51.178.146.199
  51.178.161.32
  51.178.17.214
  51.178.17.63
  51.178.182.104
-51.178.182.70
  51.178.184.225
  51.178.218.150
  51.178.218.163
@@ -78717,7 +78210,6 @@
  51.178.49.77
  51.178.50.174
  51.178.50.20
-51.178.52.177
  51.178.52.245
  51.178.53.233
  51.178.60.145
@@ -78733,6 +78225,7 @@
  51.178.86.137
  51.178.86.97
  51.178.87.42
+51.178.9.100
  51.19.88.183
  51.195.100.153
  51.195.101.173
@@ -78741,14 +78234,12 @@
  51.195.103.74
  51.195.107.147
  51.195.118.213
-51.195.132.50
  51.195.136.190
  51.195.136.233
  51.195.136.73
  51.195.136.9
  51.195.137.109
  51.195.138.52
-51.195.142.38
  51.195.147.49
  51.195.148.139
  51.195.148.18
@@ -78756,12 +78247,12 @@
  51.195.150.222
  51.195.166.160
  51.195.166.162
-51.195.167.137
  51.195.188.98
  51.195.195.168
  51.195.195.169
  51.195.195.170
  51.195.195.171
+51.195.195.172
  51.195.195.173
  51.195.195.174
  51.195.195.175
@@ -78770,9 +78261,11 @@
  51.195.202.145
  51.195.202.7
  51.195.203.247
+51.195.205.226
  51.195.205.227
  51.195.205.229
  51.195.205.230
+51.195.205.231
  51.195.205.236
  51.195.205.237
  51.195.205.238
@@ -78789,13 +78282,11 @@
  51.195.221.250
  51.195.232.155
  51.195.32.4
-51.195.34.192
  51.195.4.41
  51.195.42.226
  51.195.42.58
  51.195.43.245
  51.195.47.79
-51.195.57.51
  51.195.6.99
  51.195.91.241
  51.210.103.96
@@ -78883,14 +78374,13 @@
  51.210.83.66
  51.210.96.169
  51.210.97.105
-51.210.97.29
  51.210.98.10
  51.222.0.40
  51.222.111.6
  51.222.121.169
  51.222.13.24
-51.222.130.20
  51.222.136.229
+51.222.136.41
  51.222.139.65
  51.222.14.28
  51.222.14.78
@@ -78905,6 +78395,7 @@
  51.222.40.156
  51.222.56.152
  51.222.87.112
+51.222.9.32
  51.254.100.220
  51.254.100.56
  51.254.101.227
@@ -78956,7 +78447,6 @@
  51.254.222.185
  51.254.222.68
  51.254.23.227
-51.254.235.35
  51.254.237.77
  51.254.237.78
  51.254.247.80
@@ -79022,18 +78512,20 @@
  51.255.76.71
  51.255.80.230
  51.255.85.180
+51.255.85.26
  51.255.87.121
-51.255.9.14
  51.255.91.64
  51.255.95.26
-51.36.11.49
+51.37.12.207
+51.37.232.86
  51.37.49.140
+51.37.82.55
  51.37.86.176
  51.38.101.119
  51.38.103.163
+51.38.120.36
  51.38.124.206
  51.38.126.75
-51.38.128.30
  51.38.129.120
  51.38.129.133
  51.38.129.49
@@ -79048,6 +78540,7 @@
  51.38.179.113
  51.38.180.231
  51.38.186.53
+51.38.187.226
  51.38.187.74
  51.38.188.101
  51.38.188.63
@@ -79063,7 +78556,6 @@
  51.38.237.230
  51.38.238.165
  51.38.238.205
-51.38.238.3
  51.38.244.38
  51.38.32.230
  51.38.37.254
@@ -79079,9 +78571,9 @@
  51.38.51.200
  51.38.56.35
  51.38.57.53
+51.38.57.78
  51.38.58.134
  51.38.64.136
-51.38.65.138
  51.38.65.2
  51.38.68.83
  51.38.70.175
@@ -79132,6 +78624,7 @@
  51.68.198.222
  51.68.199.114
  51.68.204.150
+51.68.207.81
  51.68.208.252
  51.68.212.230
  51.68.212.44
@@ -79168,7 +78661,7 @@
  51.68.91.191
  51.68.93.212
  51.68.94.206
-51.7.72.73
+51.7.124.49
  51.75.103.216
  51.75.123.107
  51.75.126.115
@@ -79177,7 +78670,6 @@
  51.75.133.116
  51.75.133.14
  51.75.140.153
-51.75.140.19
  51.75.142.24
  51.75.144.43
  51.75.146.127
@@ -79223,22 +78715,22 @@
  51.75.64.23
  51.75.66.142
  51.75.66.92
+51.75.69.120
  51.75.71.111
  51.75.73.21
  51.75.78.168
-51.75.78.253
  51.75.79.181
  51.75.79.248
-51.75.86.211
  51.75.90.164
+51.75.90.39
  51.75.92.67
  51.75.96.245
  51.77.103.164
-51.77.103.248
  51.77.108.33
  51.77.109.98
  51.77.11.182
  51.77.112.168
+51.77.117.99
  51.77.121.96
  51.77.121.97
  51.77.135.89
@@ -79292,10 +78784,6 @@
  51.77.246.155
  51.77.247.43
  51.77.249.201
-51.77.33.216
-51.77.33.217
-51.77.33.218
-51.77.33.219
  51.77.39.255
  51.77.52.201
  51.77.53.133
@@ -79311,10 +78799,9 @@
  51.77.95.120
  51.79.111.220
  51.79.140.125
+51.79.140.161
  51.79.141.100
-51.79.142.174
  51.79.142.211
-51.79.142.233
  51.79.145.154
  51.79.147.177
  51.79.157.109
@@ -79324,6 +78811,7 @@
  51.79.159.176
  51.79.160.231
  51.79.164.102
+51.79.165.162
  51.79.173.166
  51.79.192.244
  51.79.25.250
@@ -79355,6 +78843,7 @@
  51.79.86.180
  51.79.86.181
  51.79.86.237
+51.79.99.219
  51.81.0.103
  51.81.118.2
  51.81.122.147
@@ -79402,13 +78891,9 @@
  51.83.132.19
  51.83.134.17
  51.83.134.39
-51.83.134.64
+51.83.166.179
  51.83.171.11
  51.83.171.25
-51.83.176.3
-51.83.177.0
-51.83.177.12
-51.83.177.14
  51.83.180.147
  51.83.180.241
  51.83.182.185
@@ -79422,12 +78907,9 @@
  51.83.191.223
  51.83.191.225
  51.83.191.226
-51.83.191.228
+51.83.191.227
  51.83.191.229
  51.83.191.230
-51.83.193.117
-51.83.193.118
-51.83.193.119
  51.83.200.164
  51.83.200.176
  51.83.200.179
@@ -79436,9 +78918,9 @@
  51.83.210.201
  51.83.210.220
  51.83.216.201
-51.83.244.104
-51.83.244.105
+51.83.254.55
  51.83.32.113
+51.83.33.156
  51.83.33.202
  51.83.33.88
  51.83.41.120
@@ -79463,6 +78945,7 @@
  51.83.74.203
  51.83.74.86
  51.83.77.224
+51.83.96.154
  51.83.97.245
  51.83.98.104
  51.83.99.227
@@ -79474,7 +78957,6 @@
  51.89.119.120
  51.89.119.154
  51.89.13.174
-51.89.134.87
  51.89.136.104
  51.89.148.69
  51.89.149.0
@@ -79501,7 +78983,7 @@
  51.89.252.167
  51.89.36.180
  51.89.40.32
-51.89.40.99
+51.89.42.147
  51.89.62.241
  51.89.76.220
  51.9.138.233
@@ -79540,12 +79022,12 @@
  51.91.212.159
  51.91.229.147
  51.91.229.20
-51.91.239.11
  51.91.248.152
  51.91.250.197
  51.91.250.49
  51.91.255.113
  51.91.255.147
+51.91.255.68
  51.91.39.84
  51.91.56.133
  51.91.66.179
@@ -79653,6 +79135,7 @@
  52.130.66.150
  52.130.75.32
  52.130.78.186
+52.130.93.83
  52.138.0.111
  52.138.144.107
  52.138.19.31
@@ -79677,6 +79160,7 @@
  52.14.39.185
  52.14.53.142
  52.14.78.244
+52.14.79.82
  52.14.87.72
  52.140.103.80
  52.141.35.112
@@ -79716,6 +79200,7 @@
  52.151.117.83
  52.151.24.212
  52.151.250.126
+52.152.103.41
  52.152.140.14
  52.156.134.132
  52.156.78.167
@@ -79744,11 +79229,6 @@
  52.163.63.49
  52.164.124.121
  52.164.209.35
-52.164.251.68
-52.164.252.105
-52.164.252.241
-52.164.253.51
-52.164.253.73
  52.165.152.75
  52.165.32.203
  52.165.33.244
@@ -79805,11 +79285,12 @@
  52.171.211.43
  52.172.153.7
  52.172.165.176
+52.172.168.59
  52.172.170.61
  52.173.143.59
  52.173.37.67
  52.173.74.94
-52.174.152.97
+52.174.144.150
  52.174.236.181
  52.175.150.108
  52.175.201.251
@@ -79862,7 +79343,6 @@
  52.186.156.78
  52.187.117.17
  52.187.130.77
-52.187.188.41
  52.187.56.107
  52.188.0.112
  52.188.113.116
@@ -79871,6 +79351,8 @@
  52.188.153.36
  52.188.158.184
  52.188.172.62
+52.188.59.11
+52.188.60.58
  52.188.68.29
  52.188.69.174
  52.188.9.234
@@ -79886,13 +79368,6 @@
  52.19.75.131
  52.19.80.88
  52.19.87.193
-52.191.112.69
-52.191.113.131
-52.191.113.62
-52.191.114.253
-52.191.115.10
-52.191.115.171
-52.191.115.99
  52.191.135.197
  52.191.137.182
  52.191.163.162
@@ -79909,14 +79384,12 @@
  52.194.247.32
  52.194.254.127
  52.195.1.72
-52.196.1.52
+52.195.16.107
  52.196.172.79
  52.196.77.240
  52.197.138.23
  52.197.154.176
  52.197.219.51
-52.197.5.152
-52.197.54.134
  52.198.215.35
  52.198.236.247
  52.199.105.160
@@ -79926,7 +79399,6 @@
  52.2.152.40
  52.2.32.57
  52.2.45.196
-52.20.207.217
  52.20.250.185
  52.20.46.101
  52.20.7.202
@@ -79944,7 +79416,6 @@
  52.201.78.102
  52.202.111.254
  52.202.140.158
-52.202.15.149
  52.202.78.94
  52.202.79.158
  52.202.95.190
@@ -80053,6 +79524,7 @@
  52.221.235.57
  52.221.237.237
  52.221.239.141
+52.221.239.149
  52.221.37.242
  52.221.96.166
  52.222.123.169
@@ -80068,6 +79540,7 @@
  52.224.176.178
  52.224.221.90
  52.224.240.91
+52.224.240.95
  52.224.66.246
  52.226.64.27
  52.229.159.234
@@ -80081,17 +79554,15 @@
  52.23.245.243
  52.23.252.19
  52.230.3.147
-52.231.102.178
  52.231.155.199
  52.231.167.166
-52.231.216.47
  52.231.26.86
+52.231.73.247
  52.231.77.116
  52.231.92.23
  52.232.246.85
  52.233.45.15
  52.234.224.154
-52.235.32.57
  52.235.42.75
  52.236.131.152
  52.236.32.160
@@ -80136,6 +79607,7 @@
  52.255.147.248
  52.255.162.142
  52.255.167.164
+52.255.170.144
  52.255.199.24
  52.255.203.95
  52.255.238.86
@@ -80304,7 +79776,6 @@
  52.4.1.77
  52.4.208.102
  52.4.226.95
-52.4.65.190
  52.40.182.0
  52.40.227.98
  52.40.44.255
@@ -80323,7 +79794,6 @@
  52.42.130.28
  52.42.152.76
  52.42.219.234
-52.42.249.69
  52.42.28.91
  52.42.40.31
  52.42.55.24
@@ -80556,7 +80026,6 @@
  52.77.227.135
  52.77.232.238
  52.77.233.168
-52.78.0.94
  52.78.139.36
  52.78.16.216
  52.78.163.216
@@ -80580,6 +80049,7 @@
  52.8.218.129
  52.8.32.220
  52.8.83.81
+52.80.184.226
  52.80.223.199
  52.80.58.248
  52.86.11.253
@@ -80635,7 +80105,6 @@
  52.9.71.221
  52.90.100.167
  52.90.106.50
-52.90.139.206
  52.90.212.201
  52.90.231.255
  52.90.43.54
@@ -80847,6 +80316,7 @@
  54.165.81.162
  54.165.89.112
  54.165.99.78
+54.166.163.242
  54.166.17.133
  54.166.241.147
  54.166.49.162
@@ -80865,6 +80335,7 @@
  54.169.150.124
  54.169.154.52
  54.169.158.55
+54.169.174.226
  54.169.180.100
  54.169.2.10
  54.169.240.111
@@ -80900,6 +80371,7 @@
  54.173.152.30
  54.173.173.33
  54.173.203.239
+54.173.226.244
  54.174.1.56
  54.174.1.59
  54.174.103.183
@@ -80935,13 +80407,13 @@
  54.176.18.9
  54.176.188.51
  54.176.236.95
-54.176.94.7
  54.177.150.209
  54.177.177.232
  54.178.155.230
  54.178.157.112
  54.178.182.46
  54.178.207.38
+54.179.157.202
  54.179.160.149
  54.179.60.243
  54.180.137.207
@@ -80958,12 +80430,10 @@
  54.183.161.206
  54.183.169.192
  54.183.169.241
-54.183.18.147
  54.183.187.60
  54.183.188.22
  54.183.200.90
  54.183.206.25
-54.183.209.209
  54.183.250.50
  54.183.31.190
  54.183.99.239
@@ -80987,7 +80457,6 @@
  54.186.244.149
  54.186.34.136
  54.187.117.98
-54.187.141.28
  54.187.154.214
  54.187.172.238
  54.187.209.170
@@ -81224,6 +80693,7 @@
  54.222.181.198
  54.224.128.129
  54.224.130.89
+54.224.170.121
  54.224.206.20
  54.224.38.115
  54.224.95.8
@@ -81241,8 +80711,6 @@
  54.227.250.228
  54.227.66.57
  54.227.79.173
-54.228.252.14
-54.228.254.42
  54.229.151.112
  54.229.206.137
  54.229.239.56
@@ -81300,6 +80768,7 @@
  54.238.229.227
  54.238.238.34
  54.241.144.222
+54.241.5.13
  54.241.9.72
  54.242.17.7
  54.242.177.136
@@ -81351,7 +80820,6 @@
  54.250.245.105
  54.250.87.247
  54.251.134.94
-54.251.135.185
  54.251.145.112
  54.251.181.118
  54.251.181.125
@@ -81375,8 +80843,8 @@
  54.254.67.231
  54.254.75.70
  54.255.139.92
+54.255.153.20
  54.255.164.240
-54.255.166.196
  54.255.182.210
  54.255.195.80
  54.255.204.204
@@ -81390,7 +80858,7 @@
  54.36.148.198
  54.36.148.210
  54.36.148.80
-54.36.149.51
+54.36.149.2
  54.36.149.63
  54.36.149.89
  54.36.165.192
@@ -81437,6 +80905,7 @@
  54.37.156.188
  54.37.159.12
  54.37.16.241
+54.37.17.21
  54.37.19.108
  54.37.19.60
  54.37.19.65
@@ -81475,7 +80944,6 @@
  54.38.137.36
  54.38.143.245
  54.38.143.246
-54.38.144.254
  54.38.156.28
  54.38.156.63
  54.38.157.22
@@ -81504,7 +80972,7 @@
  54.38.241.162
  54.38.243.187
  54.38.243.189
-54.38.248.133
+54.38.244.150
  54.38.253.1
  54.38.33.178
  54.38.36.210
@@ -81558,7 +81026,6 @@
  54.68.222.90
  54.68.24.1
  54.68.82.186
-54.69.135.38
  54.69.139.245
  54.69.152.63
  54.69.155.93
@@ -81597,8 +81064,10 @@
  54.80.47.186
  54.80.55.31
  54.80.63.76
+54.81.105.6
  54.81.223.190
  54.81.58.144
+54.81.75.244
  54.82.185.0
  54.82.227.198
  54.82.229.41
@@ -81755,20 +81224,22 @@
  57bofa75.bofa0serivceb.com
  57d3e30e.duckdns.org
  57vd9.app.link
-58.106.192.52
+58.101.212.255
+58.106.192.1
+58.106.192.123
+58.106.192.39
  58.106.192.99
  58.11.158.114
+58.11.24.59
  58.11.57.98
-58.11.83.111
  58.115.174.4
+58.12.200.211
  58.120.227.139
  58.120.27.153
  58.120.36.66
  58.121.0.32
-58.124.111.251
  58.124.248.233
  58.125.213.139
-58.126.223.166
  58.126.247.95
  58.127.186.231
  58.130.120.224
@@ -81777,7 +81248,6 @@
  58.141.122.109
  58.141.144.18
  58.141.144.18bin.sh
-58.141.226.2
  58.142.144.134
  58.142.200.124
  58.142.200.124bin.sh
@@ -81790,7 +81260,6 @@
  58.147.170.132
  58.147.170.226
  58.147.171.114
-58.147.187.38
  58.149.49.186
  58.149.52.124
  58.150.192.131
@@ -81801,18 +81270,20 @@
  58.153.112.168
  58.153.255.89
  58.158.0.86
+58.16.113.219
+58.16.113.48
  58.16.204.238
-58.160.112.29
  58.162.143.57
  58.162.218.151
  58.162.229.173
-58.169.49.172
+58.169.66.17
  58.17.185.231
  58.17.200.197
  58.171.135.242
  58.171.153.81
  58.171.38.26
  58.175.65.14
+58.176.147.14
  58.176.45.132
  58.177.86.10
  58.179.192.105
@@ -81820,42 +81291,47 @@
  58.184.252.3
  58.185.183.60
  58.185.69.243
-58.186.117.109
-58.186.217.27
+58.186.113.107
+58.186.225.180
+58.186.57.239
  58.186.60.205
+58.186.61.15
  58.186.61.222
  58.186.63.106
  58.20.108.76
  58.20.30.77
  58.20.54.143
-58.20.74.244
  58.20.74.31
-58.208.136.156
  58.208.172.10
-58.208.172.189
+58.208.172.209
  58.208.172.58
-58.208.180.27
-58.208.73.42
-58.209.192.226
+58.208.180.160
+58.209.143.40
+58.209.228.250
  58.209.239.23
  58.209.61.60
  58.210.235.10
  58.210.241.5
+58.210.3.251
  58.210.82.250
  58.210.88.98
  58.211.134.98
  58.211.203.122
+58.211.236.108
  58.211.8.182
  58.211.82.170
  58.212.59.53
  58.213.116.170
  58.213.151.122
+58.213.65.195
  58.213.84.234
+58.214.36.178
  58.214.36.86
  58.215.120.178
  58.215.120.180
  58.215.177.24
  58.215.201.98
+58.216.218.236
  58.216.218.98
  58.216.236.42
  58.218.10.103
@@ -81868,12 +81344,11 @@
  58.218.26.111
  58.218.30.167
  58.218.5.3
-58.218.56.93
  58.219.227.184
-58.219.60.107
-58.22.214.68
-58.22.5.85
+58.219.60.163
+58.219.61.123
  58.22.7.73
+58.22.93.124
  58.22.95.225
  58.22.95.235
  58.22.95.36
@@ -81886,15 +81361,12 @@
  58.220.95.44
  58.220.95.54
  58.220.95.60
-58.220.95.66
  58.220.95.80
  58.220.95.83
  58.220.95.84
  58.220.95.86
  58.220.95.90
  58.221.101.182
-58.221.183.130
-58.221.183.210
  58.221.204.114
  58.221.62.191
  58.221.62.199
@@ -81903,7 +81375,6 @@
  58.221.62.228
  58.221.64.51
  58.222.107.253
-58.222.116.138
  58.222.20.220
  58.223.21.35
  58.225.75.151
@@ -81911,7 +81382,6 @@
  58.226.23.129
  58.226.23.55
  58.227.193.198
-58.227.194.171
  58.229.114.170
  58.229.157.178
  58.229.184.242
@@ -81928,23 +81398,19 @@
  58.230.147.230
  58.233.240.94
  58.234.250.211
-58.236.111.112
  58.236.160.218
  58.236.77.157
+58.237.8.37
  58.238.42.192
  58.239.153.252
  58.239.224.9
  58.240.103.107
-58.240.121.212
-58.240.146.133
-58.240.146.154
  58.240.148.13
  58.240.148.13bin.sh
-58.240.173.205
-58.242.164.10
  58.242.169.14
  58.242.197.25
  58.242.59.139
+58.243.104.86
  58.243.121.118
  58.243.121.230
  58.243.122.144
@@ -81957,7 +81423,6 @@
  58.243.127.215
  58.243.181.70
  58.243.188.145
-58.243.189.105
  58.243.189.67
  58.243.19.107
  58.243.19.196
@@ -81972,70 +81437,58 @@
  58.246.251.27
  58.246.60.162
  58.246.64.11
-58.246.68.6
  58.247.10.90
  58.247.111.70
-58.247.43.46
  58.247.51.194
-58.248.113.151
  58.248.193.91
-58.248.74.23
-58.248.76.225
-58.248.84.189
-58.249.13.228
-58.249.20.140
+58.249.11.203
  58.249.23.33
-58.249.78.56
-58.249.80.61
-58.249.81.30
+58.249.86.31
  58.250.169.130
  58.250.176.94
  58.251.23.125
-58.252.16.40
  58.252.17.170
-58.252.177.40
-58.252.177.77
-58.252.2.236
  58.252.219.12
+58.253.216.100
  58.254.184.102
  58.254.220.116
  58.27.17.165
+58.27.200.226
  58.27.215.212
  58.27.215.3
  58.27.237.218
  58.27.95.2
-58.30.77.194
  58.33.160.139
  58.33.197.82
  58.33.199.188
  58.33.242.2
  58.33.242.3
  58.33.35.82
+58.33.45.30
  58.33.49.196
  58.33.84.251
  58.35.58.58
-58.35.65.177
  58.40.124.174
  58.42.30.64
  58.47.3.196
  58.48.168.166
-58.48.196.76
-58.48.199.241
+58.48.198.213
  58.49.116.78
  58.49.208.18
  58.49.208.22
+58.49.76.100
  58.49.94.213
  58.50.130.68
  58.52.179.215
  58.53.128.61
  58.56.132.10
  58.56.140.62
+58.56.177.142
  58.56.181.58
  58.56.32.238
  58.56.34.146
  58.56.40.210
  58.57.13.171
-58.57.15.29
  58.57.178.30
  58.57.186.106
  58.57.4.238
@@ -82044,11 +81497,13 @@
  58.58.58.114
  58.58.71.218
  58.59.17.74
+58.59.250.14
  58.59.251.114
  58.6.169.109
  58.60.10.10
  58.61.143.138
  58.61.50.198
+58.61.51.12
  58.62.18.194
  58.63.37.211
  58.64.129.15
@@ -82059,8 +81514,10 @@
  58.64.204.170
  58.65.136.170
  58.65.167.165
+58.65.212.17
  58.69.147.74
-58.69.215.66
+58.69.161.161
+58.69.69.46
  58.69.87.58
  58.71.15.10
  58.71.5.154
@@ -82082,13 +81539,13 @@
  58.84.31.149
  58.84.31.157
  58.84.31.169
-58.84.31.17
  58.84.31.173
  58.84.31.201
  58.84.31.209
  58.84.31.21
  58.84.31.217
  58.84.31.25
+58.84.31.41
  58.84.31.45
  58.84.31.65
  58.84.31.77
@@ -82103,13 +81560,11 @@
  58.87.117.152
  58.87.119.20
  58.87.120.117
-58.87.120.53
  58.87.121.166
  58.87.122.18
  58.87.126.58
  58.87.65.28
  58.87.65.57
-58.87.65.87
  58.87.66.82
  58.87.67.126
  58.87.67.226
@@ -82123,17 +81578,20 @@
  58.87.84.31
  58.87.85.37
  58.87.90.156
+58.87.90.192
  58.87.94.75
  58.9.182.62
  58.9.99.67
  58.96.175.218
  58.96.50.39
-58.97.195.223
  58.97.201.45
+58.97.205.164
  58.97.206.33
  58.97.211.3
  58.97.214.5
  58.97.215.240
+58.97.224.149
+58.97.225.113
  58.97.72.83
  58.97.8.10
  581073-dot-n-e-w-me-ss-age-po-rt-al.wl.r.appspot.com
@@ -82167,12 +81625,8 @@
  59.102.148.151
  59.102.24.194
  59.102.43.21
-59.103.113.175
  59.103.114.112
-59.103.120.216
-59.103.122.22
-59.103.124.95
-59.103.125.152
+59.103.116.116
  59.103.164.174
  59.103.193.189
  59.106.141.147
@@ -82184,17 +81638,17 @@
  59.110.12.12
  59.110.12.129
  59.110.153.239
-59.110.241.156
+59.110.237.26
+59.110.42.216
  59.110.50.141
  59.110.54.10
  59.110.70.236
+59.110.71.59
  59.111.103.165
  59.111.93.64
  59.111.95.152
  59.115.121.228
  59.115.137.7
-59.115.139.163
-59.12.209.209
  59.120.227.134
  59.120.231.151
  59.120.5.154
@@ -82225,9 +81679,9 @@
  59.127.85.233
  59.128.66.213
  59.128.66.213bin.sh
-59.128.71.25
  59.13.125.142
  59.13.74.78
+59.14.105.92
  59.14.147.227
  59.144.81.162
  59.145.111.67
@@ -82258,15 +81712,13 @@
  59.153.121.164
  59.153.121.168
  59.153.121.176
-59.153.121.180
-59.153.121.182
  59.153.121.184
  59.153.121.188
  59.153.17.186
  59.153.18.90
  59.153.84.253
  59.154.237.20
-59.157.130.41
+59.154.242.188
  59.160.171.91
  59.162.86.8
  59.167.155.59
@@ -82276,7 +81728,7 @@
  59.174.51.108
  59.175.116.137
  59.175.176.233
-59.175.19.24
+59.175.44.191
  59.175.84.142
  59.177.37.32
  59.181.106.18
@@ -82291,7 +81743,6 @@
  59.19.29.102
  59.2.207.18
  59.20.252.136
-59.20.31.84
  59.20.40.127
  59.21.150.93
  59.21.235.119
@@ -82307,7 +81758,6 @@
  59.24.93.138
  59.25.142.68
  59.25.6.100
-59.26.207.16
  59.26.209.230
  59.26.214.148
  59.26.218.228
@@ -82325,6 +81775,7 @@
  59.31.90.206
  59.36.136.238
  59.36.172.8
+59.36.178.98
  59.36.210.233
  59.36.73.94
  59.36.75.227
@@ -82335,19 +81786,18 @@
  59.4.70.88
  59.4.98.61
  59.40.79.227
-59.41.131.48
+59.40.82.7
  59.41.64.164
  59.42.10.71
  59.42.206.164
  59.42.207.60
  59.42.37.80
-59.42.38.38
+59.42.38.37
+59.42.39.11
  59.46.116.117
  59.46.124.38
  59.46.13.123
  59.46.136.139
-59.46.136.140
-59.46.136.141
  59.46.169.194
  59.48.102.174
  59.48.146.66
@@ -82355,27 +81805,25 @@
  59.5.230.140bin.sh
  59.52.205.18
  59.53.227.78
-59.55.28.255
-59.55.36.121
  59.55.36.16
-59.55.36.180
+59.55.37.191
  59.55.37.192
-59.55.37.77
  59.55.38.120
-59.55.38.250
  59.55.38.80
-59.55.39.112
  59.55.39.72
+59.55.58.195
+59.55.8.20
  59.56.106.103
  59.56.126.143
  59.56.148.35
-59.56.168.59
  59.56.62.43
  59.56.99.130
  59.57.83.94
  59.58.139.126
  59.6.180.232
  59.6.86.176
+59.61.207.6
+59.63.212.100
  59.63.225.99
  59.63.230.46
  59.64.129.180
@@ -82390,40 +81838,41 @@
  59.80.34.102
  59.83.222.82
  59.83.229.119
+59.88.197.236
+59.88.229.73
+59.9.243.192
  59.9.77.181
-59.90.86.53
+59.90.30.197
  59.91.122.1
  59.91.122.57
  59.91.92.162
-59.92.178.31
-59.92.182.105
-59.92.182.116
+59.92.177.123
+59.92.181.69
+59.92.182.254
  59.92.5.201
  59.92.69.22
  59.92.85.231
-59.93.20.0
-59.93.22.184
-59.93.23.127
+59.93.17.118
+59.93.19.212
+59.93.21.55
  59.93.242.221
-59.95.172.74
+59.94.181.250
+59.94.182.184
+59.94.183.224
+59.94.183.6
  59.95.173.191
  59.96.104.42
-59.96.38.166
+59.96.36.103
+59.96.38.83
+59.96.39.117
  59.97.169.36
-59.97.170.98
-59.97.172.8
-59.99.139.129
-59.99.139.53
+59.97.170.218
+59.97.171.108
+59.97.171.119
+59.97.174.184
  59.99.140.11
-59.99.140.151
-59.99.142.69
-59.99.161.110
-59.99.42.64
-59.99.43.138
-59.99.43.163
-59.99.43.241
-59.99.46.144
-59.99.95.84
+59.99.141.38
+59.99.42.194
  590466-dot-n-e-w-me-ss-age-po-rt-al.wl.r.appspot.com
  5918062d-fb42-4707-b098-e2c266e14d95.htmlpasta.com
  591860.playcode.io
@@ -82560,12 +82009,9 @@
  60.126.37.246
  60.13.126.151
  60.13.251.214
-60.13.60.143
  60.15.67.178
-60.16.237.27
  60.16.8.172
  60.161.13.44
-60.161.215.7
  60.162.123.120
  60.162.178.183
  60.162.183.254
@@ -82574,6 +82020,7 @@
  60.162.191.86
  60.163.204.209
  60.164.130.220
+60.164.205.176
  60.164.243.190
  60.165.219.14
  60.166.182.6
@@ -82583,13 +82030,9 @@
  60.167.113.53
  60.167.118.62
  60.167.119.188
-60.167.134.58
-60.167.177.107
+60.167.133.163
+60.167.135.78
  60.167.177.25
-60.167.178.50
-60.167.178.69
-60.167.180.177
-60.167.180.193
  60.167.21.222
  60.167.22.104
  60.167.22.38
@@ -82605,8 +82048,11 @@
  60.167.82.84
  60.168.132.85
  60.168.207.71
+60.168.80.132
+60.168.80.72
  60.169.115.81
  60.169.149.137
+60.169.69.101
  60.169.94.19
  60.169.94.37
  60.169.94.40
@@ -82615,16 +82061,15 @@
  60.17.40.73
  60.17.42.51
  60.170.101.25
+60.170.152.46
  60.170.162.110
  60.170.189.102
-60.171.163.115
+60.170.255.63
  60.171.17.185
  60.171.208.199
-60.171.220.86
  60.172.152.139
-60.172.23.155
-60.173.105.206
  60.173.116.25
+60.173.151.40
  60.173.161.143
  60.174.166.119
  60.174.234.57
@@ -82632,13 +82077,15 @@
  60.174.242.172
  60.174.72.198
  60.175.124.27
-60.175.204.158
+60.175.197.186
  60.178.10.55
+60.178.36.88
  60.178.6.173
+60.179.116.40
+60.18.27.60
  60.183.3.161
-60.184.116.28
+60.184.194.126
  60.184.95.135
-60.185.148.45
  60.185.159.249
  60.189.30.4
  60.19.64.6
@@ -82650,23 +82097,24 @@
  60.191.116.76
  60.191.119.124
  60.191.125.106
+60.191.125.35
  60.191.134.34
  60.191.17.221
  60.191.187.235
-60.191.243.218
  60.191.29.210
  60.191.43.2
  60.196.60.122
  60.196.69.234
  60.199.223.196
  60.2.44.182
-60.20.11.226
  60.20.128.152
+60.20.234.0
  60.205.181.62
  60.205.188.24
  60.205.221.72
  60.205.226.185
  60.205.229.123
+60.207.215.7
  60.208.157.173
  60.209.103.93bin.sh
  60.209.129.217
@@ -82682,13 +82130,10 @@
  60.209.80.102
  60.210.104.22
  60.211.110.32
-60.211.19.63
  60.211.218.78
  60.211.22.227
-60.211.28.221
  60.211.29.18
  60.211.3.191
-60.211.4.138
  60.211.94.123
  60.211.94.184
  60.211.94.68
@@ -82697,12 +82142,8 @@
  60.212.107.162
  60.212.107.162bin.sh
  60.212.124.131
-60.212.140.53
  60.212.153.164
-60.212.157.210
-60.212.158.49
  60.212.180.197
-60.212.21.146
  60.212.24.148
  60.212.255.86
  60.212.26.164
@@ -82711,42 +82152,37 @@
  60.213.121.185
  60.213.171.219
  60.213.177.63
-60.213.61.36
+60.213.27.250
  60.213.88.124
  60.214.239.108
  60.214.33.185
  60.214.34.129
  60.214.55.159
  60.215.161.69
-60.215.163.80
  60.215.188.174
  60.215.190.176
  60.215.202.140
  60.215.203.48
-60.215.23.218
-60.215.4.89
  60.216.101.46
  60.216.235.175
  60.217.120.44
-60.217.125.133
  60.217.194.226
  60.217.64.237
+60.217.72.12
  60.220.185.199
  60.220.185.35
  60.220.185.61
-60.220.21.128
-60.222.233.208
  60.228.245.111
  60.235.183.70
  60.235.24.222
  60.237.91.10
  60.24.124.52
-60.24.45.226
  60.24.72.131
  60.240.17.148
  60.241.229.146
  60.241.231.114
  60.241.53.60
+60.243.123.204
  60.243.149.14
  60.244.109.18
  60.246.171.51
@@ -82758,12 +82194,12 @@
  60.248.131.75
  60.248.199.194
  60.248.2.163
+60.248.243.116
  60.248.249.190
  60.249.214.243
  60.249.217.225
  60.249.241.202
  60.249.82.121
-60.249.9.145
  60.249.94.193
  60.250.159.191
  60.250.164.169
@@ -82772,7 +82208,6 @@
  60.251.129.61
  60.251.133.227
  60.251.136.127
-60.251.153.223
  60.251.60.100
  60.253.14.166
  60.253.4.72
@@ -82783,48 +82218,39 @@
  60.253.62.43
  60.253.8.65
  60.253.8.81
+60.254.115.169
  60.254.16.200
  60.255.151.82
-60.26.13.185
  60.26.230.19
-60.26.231.21
-60.27.118.22
  60.28.60.49
  60.29.111.231
  60.29.123.202
  60.3.208.37
  60.30.98.194
+60.31.155.40
  60.31.213.115
  60.48.1.149
  60.48.249.38
  60.49.0.221
-60.5.64.189
  60.50.16.200
  60.50.178.13
+60.50.37.100
+60.50.52.199
  60.50.99.134
  60.51.111.99
-60.51.170.105
  60.51.228.233
  60.51.36.129
  60.51.4.203
  60.52.146.245
-60.52.37.41
  60.52.84.101
  60.53.126.184
-60.53.200.178
  60.53.203.3
+60.53.97.188
  60.54.61.91
  60.6.209.7
  60.6.237.123
-60.7.145.73
-60.7.189.60
-60.7.241.77
-60.7.242.145
-60.7.246.23
  60.7.94.111
-60.8.213.170
  60.8.229.219
-60.9.4.15
  60.93.23.51
  60.93.62.64
  60112501-dot-sydneyma.appspot.com
@@ -82843,6 +82269,7 @@
  60minutesoffame.com
  60triple.com
  60xggrhtuemyoowf7.easy.co
+61.0.84.176
  61.0.88.108
  61.100.181.218
  61.100.186.87
@@ -82854,10 +82281,12 @@
  61.110.22.144
  61.115.1.182
  61.118.35.94
+61.12.67.132
  61.12.67.133
  61.12.82.102
+61.12.93.10
  61.129.112.168
-61.132.170.6
+61.132.170.39
  61.132.225.82
  61.132.46.219
  61.132.52.29
@@ -82874,6 +82303,7 @@
  61.135.136.184
  61.135.136.185
  61.135.155.82
+61.135.24.218
  61.136.101.166
  61.136.144.41
  61.136.163.183
@@ -82889,6 +82319,7 @@
  61.141.21.34
  61.141.224.191
  61.141.64.50
+61.141.75.30
  61.141.86.69
  61.142.72.150
  61.145.178.134
@@ -82900,20 +82331,18 @@
  61.147.67.206
  61.148.16.162
  61.148.199.206
+61.148.40.94
  61.148.56.158
  61.148.90.118
-61.149.8.90
  61.150.114.203
  61.150.115.117
  61.150.76.240
-61.150.88.22
  61.150.88.32
  61.152.116.107
  61.152.122.166
  61.152.93.170
  61.153.184.111
  61.153.224.158
-61.153.237.123
  61.154.164.241
  61.155.0.253
  61.155.106.101
@@ -82922,11 +82351,11 @@
  61.155.167.4
  61.155.190.250
  61.155.194.9
+61.155.2.142
  61.155.217.77
  61.155.233.227
  61.155.233.234
  61.156.208.53
-61.156.209.123
  61.156.215.57
  61.156.240.163
  61.156.31.52
@@ -82935,7 +82364,6 @@
  61.157.91.159
  61.158.114.188
  61.159.208.39
-61.160.196.102
  61.160.215.21
  61.160.216.63
  61.160.217.15
@@ -82946,16 +82374,11 @@
  61.161.250.202
  61.161.86.194
  61.162.168.8bin.sh
-61.162.181.59
  61.162.55.42
  61.163.136.104bin.sh
-61.163.140.118
-61.163.149.173
  61.163.156.160
  61.163.170.1
-61.163.179.56
  61.163.197.177
-61.163.38.30
  61.163.4.246
  61.164.145.8
  61.164.204.30
@@ -82967,16 +82390,16 @@
  61.164.96.98
  61.165.32.222
  61.166.55.153
+61.167.105.194
  61.168.139.52
-61.168.142.208
  61.168.222.143
  61.174.171.62
  61.174.212.58
  61.174.9.146
-61.176.223.8
  61.177.125.242
  61.177.144.130
  61.177.172.104
+61.177.172.13
  61.177.172.158
  61.177.172.177
  61.177.173.10
@@ -82996,9 +82419,11 @@
  61.177.173.23
  61.177.173.24
  61.177.173.25
-61.177.173.26
  61.177.173.27
+61.177.173.28
  61.177.173.29
+61.177.173.3
+61.177.173.33
  61.177.173.5
  61.177.173.6
  61.177.173.7
@@ -83008,11 +82433,7 @@
  61.179.219.114
  61.179.247.228
  61.179.247.228bin.sh
-61.179.88.173
  61.179.90.225
-61.180.184.214
-61.180.65.106
-61.180.65.237
  61.181.14.196
  61.181.80.253
  61.182.227.245
@@ -83025,19 +82446,17 @@
  61.184.196.122
  61.184.57.171
  61.185.114.130
-61.186.37.5
+61.188.178.220
  61.188.18.141
  61.188.220.206
+61.188.28.47
  61.189.43.58
-61.19.116.28
-61.19.123.42
  61.19.125.2
  61.19.127.228
  61.19.145.66
  61.19.146.5
  61.19.151.226
  61.19.154.78
-61.19.222.7
  61.19.244.78
  61.19.246.238
  61.19.249.103
@@ -83048,16 +82467,14 @@
  61.190.172.2
  61.190.91.66
  61.191.55.33
-61.191.84.182
  61.193.18.99
  61.193.242.120
  61.194.24.197
-61.2.140.193
-61.2.243.4
+61.2.214.26
  61.216.107.38
  61.216.131.31
  61.216.28.103
-61.216.39.166
+61.216.43.72
  61.218.122.198
  61.218.36.21
  61.218.40.121
@@ -83079,7 +82496,6 @@
  61.239.141.191
  61.239.162.198
  61.239.214.81
-61.239.31.134
  61.241.170.128
  61.241.170.149
  61.241.170.161
@@ -83105,9 +82521,11 @@
  61.244.114.180
  61.244.144.186
  61.244.186.33
+61.244.206.94
  61.244.70.248
  61.244.80.223
  61.245.170.52
+61.245.171.230
  61.246.38.248
  61.247.178.158
  61.247.25.22
@@ -83118,8 +82536,6 @@
  61.254.broadband2.iol.cz
  61.28.116.83
  61.3.124.147
-61.3.126.62
-61.3.127.151
  61.32.154.211
  61.32.231.155
  61.32.6.30
@@ -83127,7 +82543,9 @@
  61.33.229.139
  61.35.43.168
  61.37.212.83
+61.38.128.29
  61.38.128.30
+61.39.117.32
  61.39.130.75
  61.40.132.10
  61.41.45.83
@@ -83140,42 +82558,30 @@
  61.51.18.235
  61.52.100.125
  61.52.101.233
-61.52.102.115
-61.52.11.25
  61.52.11.87
  61.52.128.79
  61.52.131.12
-61.52.193.111
  61.52.193.53
-61.52.195.105
+61.52.211.77
  61.52.212.132
  61.52.28.126
  61.52.28.79
  61.52.43.138
-61.52.9.115
-61.52.97.102
+61.52.97.157
  61.52.98.12
  61.52.98.151
+61.52.98.158
  61.52.98.32bin.sh
  61.53.11.91
-61.53.116.92
-61.53.117.57
  61.53.119.67
-61.53.12.161
-61.53.120.123
-61.53.153.105
  61.53.241.13
-61.53.6.252
  61.53.72.40
  61.53.96.12
+61.53.98.56
  61.54.195.62
-61.54.234.48
-61.54.243.14
  61.54.248.217
  61.54.249.180
  61.54.40.78
-61.54.41.43
-61.54.43.141
  61.54.43.28
  61.54.78.161
  61.55.141.11
@@ -83185,7 +82591,10 @@
  61.6.102.116
  61.6.127.188
  61.6.147.172
+61.6.200.56
  61.6.235.228
+61.6.237.98
+61.6.247.92
  61.6.30.199
  61.6.37.23
  61.6.47.27
@@ -83202,6 +82611,7 @@
  61.67.240.189
  61.69.218.253
  61.69.235.170
+61.69.254.214
  61.7.132.237
  61.7.138.160
  61.7.138.225
@@ -83220,7 +82630,6 @@
  61.7.184.63
  61.7.184.66
  61.7.185.166
-61.7.185.20
  61.7.185.214
  61.7.188.168
  61.7.233.195
@@ -83228,9 +82637,9 @@
  61.70.104.46
  61.70.255.60
  61.72.181.146
-61.72.189.187
  61.72.211.28
  61.72.255.26
+61.72.74.10
  61.72.74.81
  61.73.191.170
  61.74.246.120
@@ -83242,29 +82651,27 @@
  61.78.78.108
  61.79.229.112
  61.79.229.112bin.sh
+61.8.222.42
  61.8.3.157
  61.8.68.238
  61.8.75.186
  61.8.78.130
  61.8.79.68
  61.80.179.118
-61.81.115.70
  61.82.31.167
  61.83.181.17
  61.84.196.50
  61.84.68.168
  61.85.141.135
  61.85.224.42
-61.9.102.169
-61.9.103.216
  61.9.48.102
  61.90.111.70
  61.90.160.204
  61.90.29.248
+61.91.178.34
  61.91.183.86
  61.91.235.226
  61.91.59.182
-61.91.60.234
  61.91.79.40
  61.91.80.107
  61.92.159.208
@@ -83272,7 +82679,7 @@
  61.93.201.198
  61.93.240.170
  61.93.240.18
-61.95.191.190
+61.95.170.147
  61.95.233.61
  61.95.254.195
  61.96.111.133
@@ -83302,7 +82709,7 @@
  61jwibhbwsif.talagaremix.com
  61z39.cn
  62.1.147.90
-62.1.194.138
+62.1.163.152
  62.100.92.2
  62.101.254.191
  62.102.148.154
@@ -83330,7 +82737,6 @@
  62.110.172.102
  62.112.11.116
  62.112.11.188
-62.112.11.231
  62.112.194.132
  62.112.9.142
  62.112.9.73
@@ -83352,8 +82758,8 @@
  62.122.201.170
  62.122.201.241
  62.122.201.246
-62.128.217.86
  62.13.193.206
+62.131.220.131
  62.133.130.122
  62.133.174.247
  62.133.194.156
@@ -83371,7 +82777,6 @@
  62.138.19.30
  62.138.2.243
  62.138.206.160
-62.138.26.28
  62.14.231.138
  62.140.23.192
  62.140.247.10
@@ -83382,9 +82787,7 @@
  62.141.50.135
  62.141.66.110
  62.143.168.255
-62.143.39.246
  62.143.85.253
-62.147.252.120
  62.149.118.150
  62.149.143.141
  62.149.175.39
@@ -83392,20 +82795,21 @@
  62.149.29.182
  62.149.29.35
  62.149.29.36
-62.149.29.38
-62.149.29.47
  62.149.29.50
+62.149.29.52
+62.149.29.55
  62.149.5.18
  62.149.7.162
  62.149.7.163
  62.149.7.165
  62.149.7.169
  62.149.7.173
-62.150.170.62
+62.152.183.4
  62.152.58.16
  62.153.103.153
+62.153.14.192
  62.153.89.22
-62.155.146.149
+62.155.202.198
  62.16.14.87
  62.16.41.210
  62.161.197.25
@@ -83416,7 +82820,6 @@
  62.163.24.180
  62.165.229.234
  62.168.57.109
-62.169.198.18
  62.169.209.105
  62.171.129.32
  62.171.133.27
@@ -83449,7 +82852,6 @@
  62.171.183.29
  62.171.185.159
  62.171.190.193
-62.171.191.120
  62.171.191.72
  62.173.145.48
  62.173.149.24
@@ -83457,14 +82859,15 @@
  62.176.1.194
  62.176.12.111
  62.176.5.93
+62.178.137.113
  62.178.138.46
+62.178.152.165
  62.182.114.164
  62.182.124.205
  62.182.124.206
  62.182.62.35
  62.182.81.163
  62.182.81.225
-62.182.84.128
  62.182.84.191
  62.183.98.181
  62.189.71.12
@@ -83483,12 +82886,15 @@
  62.195.95.229
  62.197.208.36
  62.2.98.55
+62.20.175.84
  62.201.210.134
  62.201.217.18
  62.201.233.59
-62.205.106.94
+62.201.253.66
  62.205.132.245
+62.205.248.22
  62.209.198.65
+62.210.100.129
  62.210.103.45
  62.210.104.12
  62.210.105.112
@@ -83497,15 +82903,15 @@
  62.210.107.201
  62.210.107.45
  62.210.108.225
-62.210.11.98
  62.210.111.15
  62.210.111.42
  62.210.111.45
  62.210.113.143
-62.210.113.228
  62.210.113.249
  62.210.115.133
  62.210.116.249
+62.210.12.17
+62.210.122.241
  62.210.124.248
  62.210.125.138
  62.210.125.157
@@ -83547,11 +82953,9 @@
  62.210.177.53
  62.210.178.138
  62.210.178.179
-62.210.178.191
-62.210.178.59
+62.210.178.228
  62.210.178.65
  62.210.180.146
-62.210.180.163
  62.210.180.164
  62.210.181.11
  62.210.181.123
@@ -83592,27 +82996,33 @@
  62.210.69.176
  62.210.69.211
  62.210.69.217
+62.210.7.167
  62.210.71.120
  62.210.72.181
  62.210.73.11
  62.210.75.68
  62.210.78.60
+62.210.8.195
  62.210.80.2
  62.210.80.34
  62.210.80.46
  62.210.80.66
  62.210.80.79
  62.210.82.105
+62.210.82.165
  62.210.82.173
  62.210.83.122
+62.210.83.172
  62.210.83.206
+62.210.83.4
  62.210.83.87
  62.210.83.88
-62.210.86.99
  62.210.89.128
+62.210.9.103
  62.210.90.118
  62.210.91.17
  62.210.91.20
+62.210.91.62
  62.210.94.159
  62.210.97.48
  62.210.99.100
@@ -83623,7 +83033,9 @@
  62.212.83.41
  62.213.14.166
  62.214.252.201
-62.214.255.20
+62.214.253.61
+62.214.254.247
+62.215.123.97
  62.216.81.175
  62.216.93.204
  62.219.194.210
@@ -83644,7 +83056,6 @@
  62.234.113.86
  62.234.114.180
  62.234.114.64
-62.234.116.144
  62.234.118.36
  62.234.118.61
  62.234.12.112
@@ -83669,6 +83080,7 @@
  62.234.188.157
  62.234.188.160
  62.234.193.119
+62.234.20.135
  62.234.20.222
  62.234.20.26
  62.234.21.198
@@ -83700,6 +83112,7 @@
  62.234.91.205
  62.234.94.202
  62.234.97.207
+62.238.12.157
  62.238.161.92
  62.239.8.236
  62.24.109.77
@@ -83707,8 +83120,8 @@
  62.24.181.134
  62.24.181.135
  62.24.252.133
-62.240.157.54
  62.240.2.41
+62.240.26.9
  62.240.4.4
  62.245.152.33
  62.250.183.59
@@ -83725,11 +83138,13 @@
  62.255.169.34
  62.255.175.74
  62.28.102.242
+62.28.137.98
  62.28.190.194
  62.28.217.62
  62.28.222.221
  62.28.253.197
  62.30.166.116
+62.30.2.10
  62.30.207.59
  62.30.7.67
  62.31.181.67
@@ -83741,6 +83156,7 @@
  62.33.207.201
  62.33.207.202
  62.33.207.98
+62.33.211.129
  62.34.241.167
  62.36.8.2
  62.38.75.208
@@ -83754,15 +83170,16 @@
  62.4.16.167
  62.4.18.68
  62.4.21.231
+62.4.22.222
  62.4.23.127
+62.4.54.242
  62.4.60.50
-62.44.135.55
  62.44.70.253
  62.44.82.61
-62.45.9.116
+62.45.125.47
  62.45.96.7
  62.48.215.5
-62.56.250.68
+62.56.251.124
  62.57.196.222
  62.57.90.188
  62.59.252.145
@@ -83790,9 +83207,7 @@
  62.75.202.55
  62.75.204.249
  62.75.216.136
-62.75.217.154
  62.75.217.161
-62.75.217.35
  62.75.222.59
  62.76.233.137
  62.76.96.6
@@ -83812,7 +83227,6 @@
  62.87.151.186
  62.87.195.117
  62.89.28.108
-62.90.147.250
  62.90.165.236
  62.90.175.115
  62.91.20.222
@@ -83828,6 +83242,7 @@
  62.96.251.229
  62.97.116.82
  62.97.41.107
+62.98.206.205
  62.99.178.46
  62.99.76.123
  62.99.90.10
@@ -83883,6 +83298,7 @@
  62mjwiap2b-5t0vhn5dr.vercel.app
  63.110.12.107
  63.111.67.170
+63.140.98.72
  63.141.224.106
  63.141.227.74
  63.141.236.98
@@ -83976,6 +83392,7 @@
  63.229.222.115
  63.229.223.55
  63.231.132.28
+63.231.148.56
  63.231.162.147
  63.231.163.93
  63.231.164.149
@@ -84019,7 +83436,6 @@
  63.250.47.241
  63.250.56.84
  63.250.59.50
-63.251.107.216
  63.32.134.196
  63.32.157.30
  63.32.178.253
@@ -84030,11 +83446,10 @@
  63.32.41.63
  63.32.43.101
  63.32.57.156
-63.32.65.43
  63.33.204.91
  63.41.9.210
-63.46.157.165
  63.80.184.72
+63.81.82.10
  63.81.82.100
  63.81.82.101
  63.81.82.102
@@ -84042,30 +83457,29 @@
  63.81.82.104
  63.81.82.105
  63.81.82.106
-63.81.82.107
+63.81.82.108
+63.81.82.109
+63.81.82.11
+63.81.82.110
+63.81.82.111
+63.81.82.113
+63.81.82.114
+63.81.82.115
+63.81.82.116
+63.81.82.117
+63.81.82.118
+63.81.82.119
+63.81.82.12
+63.81.82.121
+63.81.82.122
  63.81.82.123
+63.81.82.132
+63.81.82.133
  63.81.82.134
-63.81.82.14
-63.81.82.151
-63.81.82.152
-63.81.82.153
-63.81.82.154
-63.81.82.155
-63.81.82.156
-63.81.82.157
-63.81.82.158
-63.81.82.159
-63.81.82.16
-63.81.82.160
-63.81.82.161
-63.81.82.162
-63.81.82.163
-63.81.82.164
-63.81.82.165
+63.81.82.150
  63.81.82.167
  63.81.82.168
  63.81.82.169
-63.81.82.17
  63.81.82.170
  63.81.82.171
  63.81.82.172
@@ -84076,34 +83490,39 @@
  63.81.82.177
  63.81.82.178
  63.81.82.179
-63.81.82.18
  63.81.82.180
  63.81.82.181
-63.81.82.19
-63.81.82.21
+63.81.82.183
+63.81.82.184
+63.81.82.185
+63.81.82.186
+63.81.82.187
+63.81.82.188
+63.81.82.189
+63.81.82.190
+63.81.82.191
+63.81.82.192
+63.81.82.193
+63.81.82.194
  63.81.82.22
  63.81.82.23
  63.81.82.24
  63.81.82.25
  63.81.82.26
  63.81.82.27
+63.81.82.28
+63.81.82.29
+63.81.82.30
+63.81.82.31
+63.81.82.32
+63.81.82.33
  63.81.82.34
-63.81.82.35
-63.81.82.38
  63.81.82.4
-63.81.82.40
-63.81.82.41
  63.81.82.42
  63.81.82.43
  63.81.82.44
  63.81.82.45
-63.81.82.46
-63.81.82.48
-63.81.82.49
  63.81.82.5
-63.81.82.50
-63.81.82.51
-63.81.82.52
  63.81.82.53
  63.81.82.54
  63.81.82.55
@@ -84112,22 +83531,17 @@
  63.81.82.58
  63.81.82.59
  63.81.82.6
-63.81.82.67
-63.81.82.77
-63.81.82.78
-63.81.82.79
-63.81.82.80
-63.81.82.81
-63.81.82.82
-63.81.82.83
-63.81.82.84
-63.81.82.85
-63.81.82.86
-63.81.82.87
-63.81.82.88
-63.81.82.89
-63.81.82.90
-63.81.82.92
+63.81.82.60
+63.81.82.61
+63.81.82.62
+63.81.82.63
+63.81.82.64
+63.81.82.65
+63.81.82.66
+63.81.82.7
+63.81.82.75
+63.81.82.8
+63.81.82.9
  63.81.82.93
  63.81.82.94
  63.81.82.95
@@ -84135,7 +83549,7 @@
  63.81.82.97
  63.81.82.98
  63.81.82.99
-63.81.84.13
+63.81.84.31
  630068-dot-n-e-w-me-ss-age-po-rt-al.wl.r.appspot.com
  630124578416503-dot-wah-cgo-lsb.appspot.com
  6306481-0.alojamiento-web.es
@@ -84169,12 +83583,10 @@
  64.1.16.10
  64.110.24.162
  64.111.116.116
-64.111.126.80
  64.111.99.8
  64.113.18.98
  64.113.32.29
  64.118.84.7
-64.119.195.128
  64.119.197.115
  64.119.197.139
  64.120.239.130
@@ -84198,15 +83610,11 @@
  64.137.242.231
  64.137.243.127
  64.137.245.114
-64.137.62.86
-64.137.95.190
  64.139.79.35
  64.140.150.169
  64.140.169.42
  64.141.19.180
-64.145.76.129
  64.145.76.158
-64.145.94.21
  64.147.114.20
  64.147.6.186
  64.147.96.154
@@ -84221,7 +83629,6 @@
  64.15.159.171
  64.15.159.42
  64.150.176.19
-64.150.180.245
  64.156.14.238
  64.16.209.152
  64.16.209.177
@@ -84232,6 +83639,7 @@
  64.180.6.192
  64.180.80.127
  64.182.235.13
+64.183.100.166
  64.183.185.42
  64.183.73.122
  64.184.225.62
@@ -84247,7 +83655,7 @@
  64.188.44.114
  64.189.249.37
  64.190.95.59
-64.196.130.188
+64.193.92.252
  64.20.36.237
  64.20.49.154
  64.20.52.116
@@ -84277,7 +83685,6 @@
  64.225.101.61
  64.225.105.132
  64.225.109.0
-64.225.109.187
  64.225.109.91
  64.225.11.97
  64.225.111.173
@@ -84307,13 +83714,13 @@
  64.225.30.67
  64.225.36.142
  64.225.39.69
-64.225.44.22
  64.225.45.81
  64.225.47.15
  64.225.48.183
  64.225.51.115
  64.225.52.66
  64.225.53.232
+64.225.54.35
  64.225.56.47
  64.225.58.183
  64.225.58.70
@@ -84321,7 +83728,6 @@
  64.225.6.139
  64.225.60.95
  64.225.64.215
-64.225.68.194
  64.225.70.10
  64.225.71.231
  64.225.74.251
@@ -84338,7 +83744,6 @@
  64.227.10.167
  64.227.100.165
  64.227.100.204
-64.227.101.139
  64.227.104.19
  64.227.107.151
  64.227.109.20
@@ -84366,9 +83771,11 @@
  64.227.33.176
  64.227.35.148
  64.227.37.126
+64.227.44.187
  64.227.44.80
  64.227.46.1
  64.227.50.225
+64.227.53.63
  64.227.57.139
  64.227.58.145
  64.227.67.106
@@ -84393,17 +83800,14 @@
  64.233.202.252
  64.233.202.253
  64.234.246.3
-64.234.44.147
  64.235.204.98
  64.235.211.78
  64.235.243.55
-64.235.38.88
  64.237.49.68
  64.239.69.157
  64.244.93.96
  64.25.215.250
  64.250.112.70
-64.252.87.18
  64.27.10.80
  64.29.146.185
  64.31.10.194
@@ -84432,12 +83836,9 @@
  64.40.250.5
  64.42.183.66
  64.43.138.207
-64.43.28.121
  64.44.133.131
  64.44.40.66
-64.46.109.242
  64.46.4.160
-64.46.54.220
  64.46.6.37
  64.50.161.60
  64.52.84.166
@@ -84446,9 +83847,6 @@
  64.53.14.211
  64.59.71.141
  64.59.72.248
-64.59.96.71
-64.59.96.83
-64.59.96.86
  64.6.104.146
  64.6.107.34
  64.60.143.19
@@ -84462,6 +83860,8 @@
  64.62.252.163
  64.64.239.39
  64.68.115.87
+64.68.116.122
+64.68.116.123
  64.68.224.190
  64.68.224.2
  64.69.57.110
@@ -84622,15 +84022,14 @@
  64.90.52.230
  64.90.52.33
  64.90.52.47
-64.90.52.50
  64.90.52.65
  64.90.53.144
  64.90.53.149
-64.90.53.179
  64.90.53.74
  64.90.54.104
  64.90.54.115
  64.90.54.124
+64.90.54.155
  64.90.54.17
  64.90.54.172
  64.90.54.196
@@ -84642,8 +84041,8 @@
  64.91.64.242
  64.91.68.149
  64.92.112.118
-64.92.55.174
  64.94.211.11
+64.94.211.76
  64.95.102.36
  64.95.98.10
  64.95.98.11
@@ -84670,6 +84069,7 @@
  649552219977630-dot-aql-rkl-evh.appspot.com
  64afe3595b5d8be9d60b91dae8c8bac4c1d83d72.info
  64bcf0cbd205160fc348d46e26baa31239b47dfa.info
+65.0.102.97
  65.0.160.65
  65.0.3.156
  65.0.31.205
@@ -84760,7 +84160,6 @@
  65.151.177.93
  65.151.188.94
  65.151.189.73
-65.156.48.146
  65.17.190.193
  65.171.1.175
  65.172.242.149
@@ -84780,7 +84179,6 @@
  65.183.76.89
  65.184.156.234
  65.185.118.194
-65.189.210.125
  65.19.167.131
  65.19.167.132
  65.190.129.124
@@ -84790,6 +84188,7 @@
  65.21.1.190
  65.21.3.101
  65.21.3.222
+65.21.4.6
  65.21.5.184
  65.21.7.187
  65.21.7.4
@@ -84828,6 +84227,7 @@
  65.49.20.66
  65.49.201.168
  65.49.204.184
+65.49.206.125
  65.49.210.231
  65.49.218.81
  65.49.221.49
@@ -84849,7 +84249,6 @@
  65.60.53.122
  65.61.221.151
  65.64.8.59
-65.68.190.190
  65.75.128.151
  65.78.4.234
  65.78.98.124
@@ -84857,7 +84256,6 @@
  65.79.201.79
  65.79.205.104
  65.88.123.136
-65.90.11.228
  65.90.11.55
  65.94.25.216
  65.96.153.214
@@ -84929,7 +84327,6 @@
  66.118.142.60
  66.118.164.146
  66.128.32.230
-66.128.34.136
  66.132.216.24
  66.135.227.178
  66.135.227.181
@@ -84944,7 +84341,6 @@
  66.148.120.132
  66.15.76.101
  66.150.114.30
-66.150.69.215
  66.151.242.154
  66.154.105.122
  66.154.105.123
@@ -84958,8 +84354,7 @@
  66.165.225.130
  66.165.95.169
  66.168.40.18
-66.168.69.47
-66.172.109.43
+66.169.173.155
  66.172.110.160
  66.172.8.101
  66.172.98.132
@@ -84978,13 +84373,13 @@
  66.18.172.21
  66.18.4.147
  66.18.66.193
-66.181.190.176
  66.181.45.69
  66.181.94.150
  66.183.0.205
  66.183.185.14
-66.183.185.19
  66.186.10.67
+66.186.3.42
+66.187.162.130
  66.189.180.162
  66.189.47.126
  66.191.121.190
@@ -85028,12 +84423,12 @@
  66.209.69.165
  66.213.244.147
  66.214.138.114
-66.214.19.144
  66.215.102.131
  66.216.127.211
+66.220.155.136
  66.220.247.9
  66.222.252.124
-66.225.232.53
+66.225.231.59
  66.226.1.216
  66.226.77.13
  66.227.142.13
@@ -85052,6 +84447,8 @@
  66.228.57.30
  66.228.60.135
  66.229.161.86
+66.229.170.234
+66.23.252.226
  66.230.192.172
  66.230.213.52
  66.230.230.230
@@ -85062,7 +84459,7 @@
  66.234.211.82
  66.235.169.51
  66.235.172.12
-66.235.173.17
+66.235.19.148
  66.235.43.51
  66.238.70.101
  66.240.183.76
@@ -85070,8 +84467,6 @@
  66.240.219.146
  66.240.231.154
  66.240.236.119
-66.240.237.155
-66.240.237.172
  66.244.236.248
  66.248.202.132
  66.251.139.83
@@ -85082,73 +84477,115 @@
  66.27.72.94
  66.29.166.110
  66.30.252.128
+66.30.92.130
  66.31.206.21
  66.31.211.242
+66.33.208.10
+66.33.208.100
+66.33.208.130
  66.33.208.133
  66.33.208.135
  66.33.208.143
+66.33.208.145
  66.33.208.148
  66.33.208.150
  66.33.208.167
-66.33.208.181
-66.33.208.183
+66.33.208.182
  66.33.208.185
-66.33.208.217
+66.33.208.216
+66.33.208.232
  66.33.208.245
  66.33.208.25
+66.33.208.255
+66.33.208.35
  66.33.208.37
  66.33.208.38
  66.33.208.55
  66.33.209.11
-66.33.209.142
-66.33.209.150
+66.33.209.146
+66.33.209.148
  66.33.209.152
-66.33.209.157
+66.33.209.156
+66.33.209.171
  66.33.209.180
  66.33.209.19
  66.33.209.193
+66.33.209.218
  66.33.209.237
-66.33.209.243
+66.33.209.251
  66.33.209.49
-66.33.209.50
-66.33.209.68
-66.33.209.71
+66.33.209.5
+66.33.209.69
+66.33.209.70
  66.33.209.73
+66.33.209.81
  66.33.210.124
-66.33.210.148
+66.33.210.162
+66.33.210.173
+66.33.210.177
  66.33.210.180
+66.33.210.192
  66.33.210.210
  66.33.210.239
  66.33.210.241
+66.33.210.67
  66.33.210.71
  66.33.211.115
-66.33.211.120
-66.33.211.136
-66.33.211.142
+66.33.211.129
+66.33.211.140
+66.33.211.152
  66.33.211.177
-66.33.211.195
+66.33.211.22
+66.33.211.230
+66.33.211.232
  66.33.211.237
-66.33.211.27
+66.33.211.238
+66.33.211.24
+66.33.211.240
+66.33.211.244
+66.33.211.246
+66.33.211.248
+66.33.211.252
+66.33.211.255
+66.33.211.26
+66.33.211.28
+66.33.211.30
  66.33.211.4
+66.33.211.9
  66.33.212.101
+66.33.212.103
  66.33.212.113
  66.33.212.122
+66.33.212.133
  66.33.212.168
+66.33.212.188
+66.33.212.227
+66.33.212.230
  66.33.212.240
-66.33.212.252
+66.33.212.37
  66.33.212.6
+66.33.213.12
  66.33.213.125
-66.33.213.145
-66.33.213.152
-66.33.213.178
  66.33.213.210
+66.33.213.4
  66.33.213.40
+66.33.213.52
+66.33.213.64
+66.33.213.67
+66.33.213.86
  66.33.213.97
+66.33.214.100
  66.33.214.108
  66.33.214.121
  66.33.214.135
-66.33.214.19
+66.33.214.137
+66.33.214.231
+66.33.214.233
+66.33.214.25
+66.33.214.255
+66.33.214.36
  66.33.214.55
+66.33.215.147
  66.33.215.170
  66.33.215.200
  66.33.215.204
@@ -85161,9 +84598,7 @@
  66.36.242.84
  66.36.40.210
  66.37.110.238
-66.38.38.127
  66.40.25.236
-66.41.19.106
  66.41.244.120
  66.42.103.223
  66.42.105.213
@@ -85190,6 +84625,7 @@
  66.45.255.91
  66.46.188.158
  66.49.84.65
+66.54.123.102
  66.54.249.38
  66.55.152.251
  66.55.161.16
@@ -85203,6 +84639,7 @@
  66.57.6.23
  66.61.94.36
  66.63.165.7
+66.68.154.67
  66.68.187.140
  66.68.85.16
  66.69.127.115
@@ -85222,6 +84659,7 @@
  66.70.157.67
  66.70.160.187
  66.70.166.218
+66.70.170.55
  66.70.173.63
  66.70.174.27
  66.70.188.129
@@ -85241,6 +84679,7 @@
  66.71.253.10
  66.74.7.197
  66.76.58.60
+66.79.125.160
  66.79.163.22
  66.8.203.16
  66.82.22.79
@@ -85285,7 +84724,6 @@
  66.98.114.221
  66.98.115.108
  66.98.117.24
-66.98.118.13
  66.98.121.192
  66.98.126.203
  66.98.45.242
@@ -85349,6 +84787,7 @@
  67.110.215.195
  67.134.164.150
  67.134.99.117
+67.14.229.61
  67.149.208.37
  67.149.32.99
  67.149.33.239
@@ -85362,6 +84801,7 @@
  67.163.129.15
  67.163.135.106
  67.164.15.15
+67.164.41.12
  67.166.219.168
  67.167.104.190
  67.168.223.110
@@ -85374,11 +84814,11 @@
  67.172.145.70
  67.173.5.122
  67.174.205.218
-67.175.223.186
  67.176.235.114
  67.180.251.161
  67.180.97.39
  67.185.19.126
+67.186.152.42
  67.186.197.78
  67.186.247.178
  67.187.238.121
@@ -85403,7 +84843,6 @@
  67.197.155.219
  67.197.156.76
  67.197.157.169
-67.197.185.134
  67.197.205.70
  67.197.239.14
  67.197.29.233
@@ -85412,6 +84851,7 @@
  67.198.140.89
  67.198.140.92
  67.198.228.99
+67.198.237.247
  67.198.237.30
  67.199.146.71
  67.199.68.195
@@ -85482,7 +84922,6 @@
  67.205.179.170
  67.205.181.229
  67.205.181.52
-67.205.182.253
  67.205.183.125
  67.205.184.79
  67.205.186.76
@@ -85496,10 +84935,7 @@
  67.205.31.50
  67.205.38.108
  67.205.39.172
-67.205.40.201
  67.205.57.71
-67.205.58.218
-67.205.85.243
  67.206.200.42
  67.206.220.213
  67.207.147.51
@@ -85540,7 +84976,6 @@
  67.211.155.95
  67.211.208.83
  67.211.218.74
-67.211.219.146
  67.211.221.57
  67.212.186.138
  67.212.186.194
@@ -85591,6 +85026,7 @@
  67.221.193.55
  67.222.1.40
  67.222.10.47
+67.222.106.100
  67.222.109.40
  67.222.131.151
  67.222.16.112
@@ -85601,9 +85037,7 @@
  67.225.147.71
  67.225.178.114
  67.225.179.64
-67.225.188.53
  67.225.196.53
-67.225.241.126
  67.225.244.34
  67.225.31.100
  67.227.134.140
@@ -85816,7 +85250,6 @@
  67.234.179.57
  67.234.18.85
  67.234.180.169
-67.234.181.205
  67.234.182.146
  67.234.183.138
  67.234.183.193
@@ -86028,14 +85461,17 @@
  67.239.168.237
  67.239.182.157
  67.239.182.173
+67.240.241.158
  67.240.254.142
  67.241.150.89
+67.241.169.206
  67.245.47.152
  67.247.22.17
  67.247.59.94
  67.248.223.85
  67.249.107.195
  67.249.6.123
+67.250.212.149
  67.251.1.69
  67.251.64.168
  67.253.174.70
@@ -86068,7 +85504,6 @@
  67.4.104.202
  67.4.11.165
  67.4.11.203
-67.4.12.70
  67.4.13.164
  67.4.16.24
  67.4.169.128
@@ -86205,6 +85640,7 @@
  67.6.220.245
  67.6.23.117
  67.6.239.36
+67.6.245.107
  67.6.247.89
  67.6.30.147
  67.6.43.120
@@ -86228,9 +85664,8 @@
  67.6.99.195
  67.60.137.219
  67.68.28.245
-67.69.76.102
  67.69.76.167
-67.69.76.196
+67.69.76.237
  67.69.76.40
  67.7.1.175
  67.7.10.136
@@ -86342,6 +85777,7 @@
  68.0.230.118
  68.1.44.249
  68.1.45.101
+68.1.85.177
  68.10.137.56
  68.10.18.22
  68.101.62.26
@@ -86353,10 +85789,12 @@
  68.105.215.189
  68.105.80.207
  68.106.25.44
+68.108.180.60
  68.108.234.217
  68.109.233.150
  68.109.71.148
  68.111.3.250
+68.113.244.84
  68.114.229.171
  68.115.200.170
  68.116.41.6
@@ -86365,13 +85803,10 @@
  68.119.215.85
  68.12.98.161
  68.129.153.254
-68.13.6.64
  68.130.210.247
-68.130.210.249
  68.130.211.29
  68.131.72.9
  68.132.136.198
-68.132.245.84
  68.132.64.146
  68.133.75.203
  68.134.140.25
@@ -86384,10 +85819,12 @@
  68.146.99.241
  68.147.228.113
  68.148.133.128
+68.148.175.196
  68.149.107.15
  68.15.151.20
  68.15.4.29
  68.150.197.122
+68.150.203.43
  68.150.221.91
  68.166.0.184
  68.167.179.186
@@ -86395,6 +85832,7 @@
  68.168.142.29
  68.168.142.91
  68.168.176.24
+68.168.176.51
  68.168.209.8
  68.168.213.251
  68.168.213.252
@@ -86452,8 +85890,8 @@
  68.180.230.98
  68.180.231.26
  68.180.231.47
-68.182.39.188
  68.183.102.214
+68.183.104.51
  68.183.108.46
  68.183.109.234
  68.183.110.244
@@ -86472,6 +85910,7 @@
  68.183.130.158
  68.183.130.60
  68.183.131.166
+68.183.132.100
  68.183.132.72
  68.183.133.112
  68.183.134.15
@@ -86504,6 +85943,7 @@
  68.183.18.169
  68.183.18.19
  68.183.18.233
+68.183.180.222
  68.183.181.7
  68.183.182.100
  68.183.184.174
@@ -86520,7 +85960,6 @@
  68.183.190.199
  68.183.190.43
  68.183.191.39
-68.183.192.217
  68.183.192.26
  68.183.199.170
  68.183.203.140
@@ -86546,7 +85985,6 @@
  68.183.227.87
  68.183.229.95
  68.183.23.190
-68.183.231.225
  68.183.232.63
  68.183.234.169
  68.183.234.51
@@ -86566,6 +86004,7 @@
  68.183.35.255
  68.183.36.245
  68.183.38.145
+68.183.38.181
  68.183.48.80
  68.183.50.27
  68.183.52.2
@@ -86598,11 +86037,13 @@
  68.183.92.52
  68.183.94.63
  68.184.192.42
+68.185.140.76
  68.185.36.187
  68.186.33.98
  68.188.11.189
  68.188.112.97
  68.188.144.143
+68.188.212.91
  68.188.63.149
  68.189.184.40
  68.189.220.112
@@ -86632,16 +86073,12 @@
  68.228.184.215
  68.229.125.163
  68.229.210.138
-68.231.37.181
  68.231.7.169
-68.232.120.29
  68.233.22.64
  68.233.33.2
-68.235.229.112
  68.236.156.170
  68.253.255.10
  68.255.156.146
-68.32.243.30
  68.33.13.101
  68.36.139.253
  68.36.56.114
@@ -86650,24 +86087,24 @@
  68.39.235.42
  68.4.2.64
  68.4.215.225
-68.4.6.49
  68.40.11.207
  68.41.134.30
  68.41.31.115
  68.42.204.116
  68.43.185.239
  68.44.137.144
-68.46.125.83
  68.46.38.171
  68.47.41.211
  68.48.131.251
  68.48.240.245
+68.49.1.133
  68.49.83.73
  68.5.173.208
  68.5.37.81
  68.50.46.131
  68.53.195.9
  68.54.100.49
+68.55.245.140
  68.56.135.17
  68.56.203.112
  68.6.208.62
@@ -86695,6 +86132,7 @@
  68.80.60.182
  68.82.238.247
  68.89.232.80
+68.93.21.168
  68.99.177.31
  681-365.net
  68113.dojnh.com
@@ -86770,7 +86208,9 @@
  69.10.62.12
  69.10.62.78
  69.10.63.246
+69.115.254.100
  69.119.193.9
+69.119.31.84
  69.119.85.43
  69.12.28.148
  69.12.66.200
@@ -86790,8 +86230,7 @@
  69.12.88.102
  69.12.88.72
  69.12.90.242
-69.122.208.77
-69.123.129.183
+69.123.245.151
  69.124.231.110
  69.127.214.47
  69.128.154.134
@@ -86801,13 +86240,13 @@
  69.13.39.39
  69.13.39.40
  69.130.201.27
+69.130.207.107
  69.131.26.233
  69.131.5.148
  69.137.140.197
  69.137.195.210
  69.138.189.201
  69.138.220.213
-69.139.69.253
  69.14.145.75
  69.14.157.165
  69.14.208.221
@@ -86817,8 +86256,8 @@
  69.141.15.174
  69.143.214.211
  69.144.99.178
+69.145.139.114
  69.145.177.112
-69.148.169.102
  69.15.68.38
  69.150.120.253
  69.157.161.243
@@ -86827,6 +86266,7 @@
  69.16.231.139
  69.16.252.128
  69.160.38.10
+69.160.38.3
  69.162.105.66
  69.162.111.67
  69.162.69.205
@@ -86835,6 +86275,7 @@
  69.162.99.158
  69.163.160.10
  69.163.160.130
+69.163.160.135
  69.163.160.29
  69.163.160.3
  69.163.160.86
@@ -86851,9 +86292,9 @@
  69.163.161.209
  69.163.161.235
  69.163.161.236
+69.163.161.240
  69.163.161.245
  69.163.161.52
-69.163.161.58
  69.163.161.65
  69.163.161.7
  69.163.162.134
@@ -86882,22 +86323,27 @@
  69.163.163.24
  69.163.163.240
  69.163.163.26
+69.163.163.54
  69.163.164.114
  69.163.164.116
  69.163.164.254
  69.163.164.34
  69.163.164.42
  69.163.164.51
+69.163.164.68
  69.163.165.106
+69.163.165.119
  69.163.165.136
  69.163.165.149
  69.163.165.164
  69.163.165.173
  69.163.165.196
+69.163.165.204
  69.163.165.219
  69.163.165.222
  69.163.165.224
  69.163.165.232
+69.163.165.243
  69.163.165.26
  69.163.165.39
  69.163.165.58
@@ -86905,10 +86351,13 @@
  69.163.165.72
  69.163.166.122
  69.163.166.14
+69.163.166.143
  69.163.166.172
  69.163.166.18
  69.163.166.183
  69.163.166.236
+69.163.166.25
+69.163.166.61
  69.163.167.101
  69.163.167.128
  69.163.167.139
@@ -86918,7 +86367,6 @@
  69.163.169.133
  69.163.178.140
  69.163.179.6
-69.163.186.91
  69.163.234.137
  69.163.239.171
  69.163.248.109
@@ -86936,7 +86384,6 @@
  69.164.212.86
  69.165.166.122
  69.167.13.148
-69.167.136.34
  69.167.151.209
  69.169.5.87
  69.170.216.69
@@ -86973,6 +86420,7 @@
  69.176.89.147
  69.176.89.197
  69.176.89.78
+69.176.90.7
  69.178.49.209
  69.179.0.113
  69.179.1.144
@@ -86992,6 +86440,7 @@
  69.179.39.184
  69.179.4.41
  69.179.96.163
+69.18.247.123
  69.180.214.81
  69.183.32.121
  69.194.15.75
@@ -87011,7 +86460,6 @@
  69.197.179.170
  69.197.182.2
  69.197.184.114
-69.197.185.106
  69.197.186.210
  69.197.186.26
  69.197.189.27
@@ -87034,6 +86482,7 @@
  69.209.23.72
  69.21.245.58
  69.210.185.1
+69.216.103.57
  69.218.221.5
  69.22.184.249
  69.221.248.152
@@ -87041,16 +86490,16 @@
  69.228.211.56
  69.229.0.133
  69.23.123.146
+69.23.134.102
  69.237.82.158
  69.245.212.169
-69.245.45.54
  69.245.71.26
  69.246.26.72
  69.248.146.7
  69.249.137.104
  69.25.236.60
  69.250.156.161
-69.250.225.35
+69.251.93.167
  69.253.71.17
  69.254.146.8
  69.29.152.138
@@ -87130,14 +86579,10 @@
  69.4.32.137
  69.4.80.123
  69.4.88.120
-69.4.88.133
  69.4.88.138
  69.4.88.141
-69.4.89.121
  69.4.89.123
  69.4.89.125
-69.4.90.20
-69.4.90.28
  69.4.92.108
  69.4.94.142
  69.41.0.45
@@ -87146,18 +86591,17 @@
  69.47.172.7
  69.49.88.46
  69.50.181.85
-69.51.16.248
  69.51.24.27
  69.51.24.28
-69.54.29.193
+69.53.166.250
  69.55.202.185
  69.55.234.74
  69.55.35.193
  69.55.54.65
-69.55.55.155
  69.55.55.188
  69.55.62.9
  69.57.164.32
+69.58.1.31
  69.58.178.56
  69.58.178.57
  69.58.178.58
@@ -87194,7 +86638,6 @@
  69.69.179.130
  69.69.185.159
  69.69.213.3
-69.70.75.46
  69.72.169.233
  69.72.194.58
  69.72.202.238
@@ -87223,106 +86666,111 @@
  69.94.12.235
  69.94.125.100
  69.94.144.226
-69.94.147.10
  69.94.147.100
  69.94.147.101
-69.94.147.11
+69.94.147.102
+69.94.147.103
+69.94.147.104
+69.94.147.105
+69.94.147.106
  69.94.147.110
  69.94.147.111
  69.94.147.112
  69.94.147.113
  69.94.147.114
+69.94.147.115
+69.94.147.116
+69.94.147.117
+69.94.147.118
+69.94.147.119
  69.94.147.12
-69.94.147.126
-69.94.147.127
-69.94.147.128
+69.94.147.120
  69.94.147.13
-69.94.147.130
-69.94.147.131
-69.94.147.132
-69.94.147.133
  69.94.147.135
  69.94.147.136
  69.94.147.137
+69.94.147.138
+69.94.147.139
  69.94.147.14
-69.94.147.148
+69.94.147.140
+69.94.147.141
+69.94.147.142
+69.94.147.143
+69.94.147.144
  69.94.147.15
-69.94.147.150
-69.94.147.151
-69.94.147.152
-69.94.147.153
-69.94.147.154
  69.94.147.156
  69.94.147.157
  69.94.147.158
+69.94.147.159
  69.94.147.16
-69.94.147.168
-69.94.147.169
-69.94.147.171
-69.94.147.172
-69.94.147.173
-69.94.147.182
-69.94.147.183
-69.94.147.185
-69.94.147.186
-69.94.147.187
-69.94.147.188
-69.94.147.189
+69.94.147.160
+69.94.147.161
+69.94.147.162
+69.94.147.163
+69.94.147.164
+69.94.147.17
+69.94.147.174
+69.94.147.175
+69.94.147.176
+69.94.147.177
+69.94.147.18
+69.94.147.19
  69.94.147.190
  69.94.147.191
  69.94.147.192
  69.94.147.193
-69.94.147.26
-69.94.147.27
-69.94.147.28
-69.94.147.30
-69.94.147.31
+69.94.147.194
+69.94.147.195
+69.94.147.20
+69.94.147.21
  69.94.147.32
  69.94.147.33
  69.94.147.34
  69.94.147.35
  69.94.147.36
+69.94.147.37
+69.94.147.38
+69.94.147.39
+69.94.147.40
+69.94.147.41
  69.94.147.46
  69.94.147.47
  69.94.147.48
  69.94.147.49
-69.94.147.5
  69.94.147.50
-69.94.147.6
-69.94.147.61
-69.94.147.62
-69.94.147.63
-69.94.147.64
-69.94.147.66
-69.94.147.67
-69.94.147.7
-69.94.147.70
-69.94.147.71
-69.94.147.73
-69.94.147.74
-69.94.147.75
+69.94.147.51
+69.94.147.52
+69.94.147.53
+69.94.147.54
+69.94.147.55
  69.94.147.76
  69.94.147.77
  69.94.147.78
  69.94.147.79
  69.94.147.80
-69.94.147.9
-69.94.147.91
-69.94.147.92
-69.94.147.94
-69.94.147.95
-69.94.147.96
+69.94.147.81
+69.94.147.82
+69.94.147.83
+69.94.147.84
+69.94.147.85
  69.94.147.97
  69.94.147.98
  69.94.147.99
-69.94.152.157
-69.94.152.158
+69.94.152.153
  69.94.152.159
  69.94.152.161
  69.94.152.162
  69.94.152.163
  69.94.152.164
  69.94.152.165
+69.94.152.166
+69.94.152.167
+69.94.152.168
+69.94.152.169
+69.94.152.170
+69.94.152.171
+69.94.152.172
+69.94.152.173
  69.94.27.169
  69348.psdzy.com
  693bst.com
@@ -87403,6 +86851,7 @@
  7-medya.com
  7.r2dd.com
  70-40-210-173.unifiedlayer.com
+70.104.163.46
  70.106.150.91
  70.106.193.69
  70.106.219.40
@@ -87419,27 +86868,26 @@
  70.121.135.248
  70.121.172.89
  70.121.219.224
-70.121.79.245
  70.123.116.221
  70.123.125.237
  70.124.137.99
+70.124.169.33
  70.124.47.233
  70.126.196.23
  70.127.155.33
  70.131.38.109
  70.134.63.129
+70.15.153.29
  70.15.194.32
-70.15.242.21
  70.16.157.162
  70.164.0.233
-70.165.64.33
  70.165.65.233
-70.166.167.33
+70.166.167.35
  70.166.167.47
  70.166.167.48
  70.166.167.50
+70.166.167.58
  70.166.167.59
-70.166.167.60
  70.166.204.38
  70.168.249.154
  70.168.249.162
@@ -87452,6 +86900,7 @@
  70.169.70.90
  70.171.130.61
  70.172.73.188
+70.172.75.103
  70.173.251.218
  70.173.56.6
  70.177.74.63
@@ -87469,6 +86918,7 @@
  70.190.171.72
  70.191.128.190
  70.191.39.150
+70.21.191.14
  70.225.137.126
  70.226.119.80
  70.231.71.166
@@ -87498,7 +86948,6 @@
  70.35.98.12
  70.36.100.156
  70.36.101.145
-70.37.107.20
  70.37.50.171
  70.37.66.168
  70.37.75.157
@@ -87507,7 +86956,6 @@
  70.40.210.173
  70.40.213.248
  70.42.131.170
-70.45.207.5
  70.45.228.96
  70.45.30.28
  70.48.238.90
@@ -87554,7 +87002,6 @@
  70.57.99.122
  70.58.196.153
  70.58.196.199
-70.58.199.87
  70.58.200.14
  70.58.203.135
  70.58.204.112
@@ -87575,8 +87022,6 @@
  70.60.238.62
  70.61.141.138
  70.61.166.78
-70.62.168.178
-70.62.82.158
  70.63.170.86
  70.64.48.41
  70.65.175.221
@@ -87586,6 +87031,7 @@
  70.68.135.187
  70.70.194.3
  70.70.50.160
+70.71.115.9
  70.71.226.63
  70.71.236.58
  70.73.151.8
@@ -87682,6 +87128,7 @@
  71.1.30.193
  71.1.78.237
  71.1.99.146
+71.10.173.117
  71.100.48.61
  71.100.77.227
  71.105.116.2
@@ -87690,21 +87137,26 @@
  71.11.197.112
  71.112.212.196
  71.12.234.138
+71.12.94.6
  71.120.6.42
  71.122.164.51
  71.125.57.64
+71.125.72.178
  71.127.156.63
  71.13.105.122
+71.13.67.246
  71.13.87.122
  71.13.92.62
  71.136.142.246
  71.136.240.167
  71.142.245.248
  71.146.114.111
+71.15.41.74
  71.161.90.231
  71.163.243.192
  71.168.214.49
-71.172.202.127
+71.171.85.29
+71.172.198.12
  71.173.141.58
  71.174.105.126
  71.174.144.26
@@ -87716,6 +87168,7 @@
  71.183.251.75
  71.185.203.81
  71.185.31.91
+71.185.50.11
  71.186.165.41
  71.187.229.73
  71.189.180.111
@@ -87755,6 +87208,7 @@
  71.2.83.201
  71.200.70.202
  71.200.89.21
+71.202.57.207
  71.203.23.147
  71.204.154.208
  71.205.226.44
@@ -88177,7 +87631,6 @@
  71.210.37.93
  71.210.38.131
  71.210.41.204
-71.210.41.215
  71.210.42.253
  71.210.43.140
  71.210.43.89
@@ -88201,7 +87654,6 @@
  71.210.57.236
  71.210.59.176
  71.210.62.169
-71.210.63.221
  71.210.63.68
  71.210.67.230
  71.210.67.7
@@ -88220,6 +87672,7 @@
  71.210.8.242
  71.210.81.1
  71.210.82.70
+71.210.83.230
  71.210.84.41
  71.210.84.68
  71.210.86.220
@@ -88251,7 +87704,6 @@
  71.211.37.35
  71.211.39.104
  71.211.39.144
-71.211.58.100
  71.211.62.160
  71.211.64.140
  71.211.67.135
@@ -88411,7 +87863,6 @@
  71.213.225.23
  71.213.225.71
  71.213.226.108
-71.213.226.33
  71.213.228.188
  71.213.228.232
  71.213.228.87
@@ -88484,7 +87935,6 @@
  71.213.68.247
  71.213.70.121
  71.213.72.59
-71.213.74.13
  71.213.75.176
  71.213.76.70
  71.213.77.30
@@ -88874,7 +88324,6 @@
  71.215.71.56
  71.215.72.166
  71.215.74.20
-71.215.76.92
  71.215.77.64
  71.215.78.234
  71.215.78.49
@@ -89356,6 +88805,7 @@
  71.219.95.114
  71.219.95.135
  71.219.95.224
+71.219.96.240
  71.219.96.248
  71.219.97.217
  71.219.98.163
@@ -89898,12 +89348,14 @@
  71.223.98.49
  71.227.242.72
  71.229.145.95
+71.229.6.169
  71.231.145.228
  71.232.26.19
  71.235.124.243
  71.237.150.172
  71.237.167.138
  71.237.85.50
+71.239.27.37
  71.242.127.196
  71.244.185.101
  71.244.49.72
@@ -90119,7 +89571,7 @@
  71.38.189.197
  71.38.190.21
  71.38.194.56
-71.38.2.224
+71.38.20.69
  71.38.201.191
  71.38.201.95
  71.38.202.185
@@ -90224,6 +89676,7 @@
  71.43.112.11
  71.43.118.162
  71.43.53.70
+71.46.56.1
  71.47.8.120
  71.48.32.213
  71.48.33.100
@@ -90416,10 +89869,10 @@
  71.55.74.62
  71.55.75.48
  71.56.235.108
-71.57.135.102
  71.57.180.213
  71.57.241.246
  71.59.28.167
+71.59.90.148
  71.6.135.131
  71.6.146.130
  71.6.146.185
@@ -90429,12 +89882,11 @@
  71.6.167.142
  71.6.167.197
  71.6.199.23
-71.6.232.5
  71.60.192.20
+71.62.115.217
  71.62.129.30
  71.63.10.44
  71.63.116.146
-71.70.83.192
  71.72.140.136
  71.72.196.159
  71.73.5.169
@@ -90443,20 +89895,17 @@
  71.78.158.190
  71.79.11.136
  71.80.74.41
-71.81.178.244
  71.85.183.137
  71.85.218.231
  71.86.81.122
  71.87.161.184
  71.88.207.47
+71.88.42.135
  71.89.209.212
-71.9.225.162
-71.90.165.156
+71.91.66.73
  71.92.202.13
  71.93.148.59
  71.93.27.91
-71.94.198.62
-71.94.222.146
  7108329659.com
  710a6ba4667144d5a4e35f4764a5f51a.svc.dynamics.com
  710exoticcannabis.com
@@ -90476,14 +89925,12 @@
  72.11.145.8
  72.11.148.154
  72.11.166.13
-72.12.127.184
  72.128.6.3
+72.131.123.136
  72.133.177.119
  72.134.81.111
-72.135.209.214
  72.135.224.85
  72.135.232.168
-72.135.35.139
  72.136.98.149
  72.139.68.174
  72.14.164.83
@@ -90573,8 +90020,10 @@
  72.167.190.208
  72.167.190.213
  72.167.190.231
+72.167.190.234
  72.167.190.29
  72.167.190.6
+72.167.190.65
  72.167.222.102
  72.167.224.135
  72.167.232.164
@@ -90583,10 +90032,7 @@
  72.169.65.177
  72.169.66.157
  72.17.22.30
-72.173.49.153
-72.174.128.211
  72.174.254.198
-72.176.162.102
  72.18.130.41
  72.18.200.133
  72.181.50.229
@@ -90597,6 +90043,7 @@
  72.189.135.139
  72.189.179.92
  72.189.57.105
+72.189.70.209
  72.19.37.189
  72.191.113.27
  72.192.162.178
@@ -90604,6 +90051,7 @@
  72.193.56.242
  72.194.159.49
  72.194.243.15
+72.194.27.13
  72.195.114.165
  72.195.114.169
  72.195.114.171
@@ -90614,14 +90062,17 @@
  72.195.34.59
  72.196.121.4
  72.198.122.235
+72.198.170.115
  72.198.29.30
  72.20.137.133
  72.202.236.62
  72.203.86.47
  72.208.58.240
  72.208.58.48
+72.210.15.226
  72.210.252.134
  72.210.252.135
+72.210.252.142
  72.210.252.143
  72.210.252.144
  72.210.252.145
@@ -90632,48 +90083,49 @@
  72.210.252.155
  72.212.63.101
  72.212.63.102
-72.212.63.120
  72.213.167.55
-72.214.69.226
  72.217.158.194
+72.217.158.195
+72.217.158.197
  72.217.158.199
+72.217.158.202
  72.217.158.203
  72.217.158.204
+72.217.158.205
  72.217.158.206
-72.217.158.210
-72.217.158.212
  72.217.158.214
  72.217.158.215
  72.217.158.218
-72.217.158.219
+72.217.158.220
+72.217.158.221
  72.218.206.7
  72.22.247.189
  72.221.164.34
  72.221.164.35
-72.221.164.36
-72.221.164.37
  72.221.164.38
-72.221.164.44
+72.221.164.40
+72.221.164.42
  72.221.164.45
-72.221.164.46
-72.221.164.47
  72.221.164.48
+72.221.164.51
+72.221.164.56
  72.221.164.57
-72.221.164.60
+72.221.164.61
  72.221.172.205
  72.221.196.134
  72.221.196.135
+72.221.196.138
  72.221.196.150
  72.221.196.151
-72.221.196.152
-72.221.232.136
+72.221.232.135
  72.221.232.137
-72.221.232.139
+72.221.232.138
  72.221.232.141
  72.221.232.142
  72.221.232.143
-72.221.232.146
+72.221.232.144
  72.221.232.147
+72.221.232.153
  72.222.130.133
  72.223.168.80
  72.223.168.81
@@ -90683,6 +90135,7 @@
  72.225.7.80
  72.226.15.212
  72.229.230.118
+72.229.35.40
  72.229.52.101
  72.230.237.11
  72.231.243.181
@@ -90691,8 +90144,7 @@
  72.233.127.179
  72.233.36.138
  72.234.182.39
-72.234.189.228
-72.235.210.174
+72.234.202.53
  72.237.117.105
  72.237.117.106
  72.237.117.107
@@ -90713,13 +90165,13 @@
  72.240.123.84
  72.240.125.133
  72.240.126.32
-72.241.169.53
-72.241.94.221
  72.243.138.146
  72.249.108.180
  72.249.108.220
+72.249.235.124
  72.249.235.194
  72.249.235.201
+72.249.77.221
  72.250.153.47
  72.250.184.57
  72.250.42.191
@@ -90732,9 +90184,11 @@
  72.252.4.194
  72.252.4.57
  72.255.201.110
+72.255.36.157
  72.255.36.235
  72.255.5.180
  72.255.61.54
+72.255.8.190
  72.27.128.225
  72.28.240.148
  72.29.55.174
@@ -90753,8 +90207,7 @@
  72.32.69.162
  72.34.235.197
  72.34.43.74
-72.34.44.11
-72.36.18.29
+72.35.126.108
  72.37.199.41
  72.38.244.198
  72.42.162.79
@@ -90778,6 +90231,7 @@
  72.52.184.212
  72.52.216.50
  72.52.231.202
+72.52.251.1
  72.52.251.129
  72.52.255.82
  72.52.87.47
@@ -90794,7 +90248,6 @@
  72.69.68.140
  72.69.99.47
  72.71.251.161
-72.74.145.225
  72.74.160.36
  72.74.34.120
  72.76.221.220
@@ -90818,6 +90271,7 @@
  72.90.89.108
  72.91.70.103
  72.93.243.211
+72.94.205.199
  72.95.19.38
  72.95.23.83
  72.95.96.187
@@ -90849,64 +90303,60 @@
  72l.saniketaoci.com
  73.0.216.24
  73.10.75.50
-73.103.18.182
  73.107.29.176
  73.107.36.77
+73.108.207.236
  73.108.241.200
  73.11.153.150
  73.11.70.164
+73.110.102.104
+73.110.180.147
  73.111.221.162
  73.112.123.203
  73.112.84.96
  73.113.120.123
  73.113.8.68
-73.115.74.176
  73.116.193.136
  73.117.1.162
  73.119.190.120
  73.119.255.56
  73.119.50.38
  73.12.38.29
-73.123.70.198
-73.124.60.178
  73.128.186.71
  73.128.250.176
  73.13.104.201
  73.131.166.70
  73.131.78.250
+73.133.101.241
  73.138.75.151
-73.139.233.118
  73.140.142.112
-73.146.64.229
+73.147.198.220
+73.147.84.92
  73.148.23.198
  73.15.70.67
-73.150.145.210
-73.154.18.212
  73.157.231.125
  73.158.127.66
-73.162.121.160
  73.162.222.154
  73.162.253.94
  73.162.55.16
-73.164.13.142
  73.165.187.57
  73.167.2.179
  73.168.170.206
  73.170.134.121
+73.170.188.50
  73.170.66.172
-73.172.24.224
  73.175.16.198
  73.177.64.108
-73.179.71.241
  73.181.212.48
  73.184.146.247
  73.184.220.254
+73.184.77.174
  73.185.1.77
+73.185.156.5
  73.185.17.0
  73.187.102.50
  73.189.163.2
  73.189.164.139
-73.189.21.200
  73.189.248.47
  73.19.95.114
  73.192.213.22
@@ -90914,15 +90364,14 @@
  73.194.127.131
  73.194.215.65
  73.196.205.64
-73.199.65.2
-73.2.193.197
  73.200.123.136
-73.201.111.171
  73.202.118.127
  73.202.219.27
  73.205.112.214
  73.206.244.166
  73.207.112.3
+73.207.160.114
+73.207.192.158
  73.208.35.88
  73.209.116.239
  73.209.24.166
@@ -90939,13 +90388,13 @@
  73.225.8.164
  73.226.220.90
  73.229.153.51
-73.230.167.70
  73.233.235.179
  73.235.226.74
-73.238.205.184
+73.237.5.46
  73.239.107.7
  73.239.11.159
  73.239.197.175
+73.240.246.192
  73.243.163.23
  73.243.176.4
  73.243.243.50
@@ -90955,23 +90404,27 @@
  73.248.234.184
  73.251.84.166
  73.254.197.157
+73.254.255.81
  73.255.236.146
  73.26.138.42
+73.29.37.188
  73.3.250.179
+73.30.159.49
+73.31.14.186
+73.31.170.31
  73.31.210.37
  73.32.108.199
  73.34.222.4
-73.34.63.79
  73.35.60.4
  73.37.123.160
  73.38.213.196
  73.39.161.79
-73.41.100.48
  73.43.26.125
  73.43.98.10
  73.45.212.48
  73.45.37.120
  73.46.218.63
+73.47.62.222
  73.5.2.12
  73.50.110.56
  73.51.245.209
@@ -90982,34 +90435,32 @@
  73.6.191.52
  73.60.125.48
  73.60.227.128
-73.61.161.136
  73.61.6.1
-73.62.252.237
-73.63.14.98
+73.66.164.131
  73.66.228.172
  73.67.133.25
  73.7.135.222
  73.70.45.206
  73.73.137.44
  73.73.230.131
-73.74.53.250
  73.75.107.58
  73.75.199.44
  73.75.219.82
  73.78.105.172
  73.79.253.167
-73.8.149.46
  73.8.77.18
  73.83.103.79
  73.83.150.162
+73.83.235.6
  73.84.152.17
  73.84.156.242
  73.85.21.193
+73.86.112.41
  73.86.202.56
  73.88.233.108
-73.89.158.207
-73.89.52.125
+73.88.61.36
  73.90.205.30
+73.92.233.85
  73.93.252.130
  73.93.56.34
  73.96.105.70
@@ -91058,12 +90509,11 @@
  74.118.156.131
  74.118.192.251
  74.120.14.37
-74.120.14.38
-74.120.14.39
  74.120.14.40
  74.120.14.53
  74.120.14.54
  74.120.14.55
+74.120.14.56
  74.120.170.183
  74.120.172.232
  74.120.173.145
@@ -91080,10 +90530,8 @@
  74.124.198.60
  74.124.214.119
  74.124.219.29
-74.125.212.194
-74.125.212.198
  74.128.121.17
-74.128.93.202
+74.129.23.72
  74.130.83.133
  74.132.146.137
  74.132.148.190
@@ -91093,13 +90541,12 @@
  74.135.120.91
  74.137.220.142
  74.138.144.149
+74.138.26.36
  74.15.64.117
  74.192.32.213
  74.194.28.185
  74.195.162.252
-74.196.137.29
  74.196.219.52
-74.197.178.144
  74.199.111.243
  74.199.84.77
  74.200.208.146
@@ -91127,7 +90574,6 @@
  74.208.104.107
  74.208.105.217
  74.208.123.225
-74.208.128.22
  74.208.13.22
  74.208.173.53
  74.208.173.91
@@ -91179,7 +90625,6 @@
  74.4.248.59
  74.4.255.96
  74.4.51.150
-74.40.1.122
  74.40.205.197
  74.5.133.139
  74.5.134.29
@@ -91212,9 +90657,11 @@
  74.55.73.74
  74.55.90.82
  74.56.229.191
+74.56.253.128
  74.57.99.81
  74.58.215.226
  74.58.7.11
+74.58.8.196
  74.6.22.174
  74.62.154.190
  74.62.215.218
@@ -91223,6 +90670,7 @@
  74.63.209.34
  74.63.220.148
  74.63.221.49
+74.65.55.194
  74.67.240.204
  74.7.84.106
  74.70.21.65
@@ -91234,9 +90682,7 @@
  74.78.144.106
  74.78.203.230
  74.78.31.240
-74.80.13.162
  74.81.68.114
-74.81.88.114
  74.81.88.26
  74.81.88.42
  74.81.88.66
@@ -91252,7 +90698,6 @@
  74.85.156.94
  74.85.157.198
  74.85.45.254
-74.89.187.158
  74.91.23.194
  74.91.24.186
  74.91.28.228
@@ -91262,8 +90707,8 @@
  74.94.194.3
  74.94.77.18
  74.95.1.114
-74.96.223.76
  74.96.23.39
+74.97.180.91
  74.98.242.97
  7402883.weebly.com
  740931-dot-n-e-w-me-ss-age-po-rt-al.wl.r.appspot.com
@@ -91283,8 +90728,8 @@
  74fghggh.chinasaletopbuynowsale.com
  75.101.111.132
  75.101.224.25
-75.102.27.237
  75.102.39.180
+75.103.66.26
  75.103.66.9
  75.107.188.146
  75.109.111.18
@@ -91389,7 +90834,6 @@
  75.119.206.35
  75.119.206.37
  75.119.206.78
-75.119.206.98
  75.119.207.125
  75.119.207.135
  75.119.207.145
@@ -91449,12 +90893,13 @@
  75.126.153.82
  75.126.49.163
  75.126.94.66
+75.127.0.188
  75.127.1.203
  75.127.1.211
  75.127.1.225
  75.127.11.2
  75.127.14.170
-75.127.180.211
+75.127.245.190
  75.127.6.51
  75.127.68.106
  75.127.7.167
@@ -91462,12 +90907,15 @@
  75.127.7.70
  75.127.7.92
  75.128.159.46
+75.128.44.152
  75.129.34.75
  75.129.64.107
  75.13.245.193
  75.130.218.151
-75.130.225.249
+75.132.165.194
+75.133.211.28
  75.133.43.81
+75.133.96.235
  75.134.55.44
  75.136.121.230
  75.137.46.78
@@ -91540,7 +90988,6 @@
  75.163.95.247
  75.164.137.172
  75.164.151.45
-75.164.157.131
  75.164.173.39
  75.164.37.57
  75.164.69.218
@@ -91566,7 +91013,6 @@
  75.165.128.210
  75.165.128.34
  75.165.129.41
-75.165.130.240
  75.165.131.34
  75.165.132.15
  75.165.135.215
@@ -91717,7 +91163,6 @@
  75.169.110.215
  75.169.13.18
  75.169.137.77
-75.169.158.225
  75.169.167.93
  75.169.173.38
  75.170.100.60
@@ -91739,7 +91184,6 @@
  75.170.119.191
  75.170.12.125
  75.170.12.130
-75.170.120.249
  75.170.121.187
  75.170.125.180
  75.170.125.253
@@ -92090,35 +91534,37 @@
  75.183.15.12
  75.183.243.98
  75.183.46.131
+75.186.96.124
  75.188.107.174
  75.188.38.166
  75.189.232.247
-75.222.32.231
+75.190.251.61
  75.250.130.109
  75.27.150.75
  75.3.206.157
  75.32.236.142
  75.4.189.222
  75.40.139.200
+75.40.139.202
  75.40.189.179
  75.46.43.6
+75.51.34.205
  75.55.97.119
  75.56.8.205
  75.65.178.7
  75.65.31.8
  75.65.6.212
-75.67.100.2
  75.67.221.247
  75.67.227.208
  75.68.178.213
  75.68.45.136
-75.70.14.231
  75.70.181.65
  75.70.89.197
  75.71.161.216
  75.71.41.239
  75.73.90.226
  75.74.7.227
+75.74.71.56
  75.75.235.117
  75.75.235.148
  75.75.235.171
@@ -92131,10 +91577,11 @@
  75.83.186.62
  75.83.230.2
  75.83.253.194
+75.84.167.25
  75.85.186.143
  75.86.142.122
  75.87.129.134
-75.88.97.118
+75.87.15.222
  75.97.38.113
  75.98.226.29
  75.98.36.146
@@ -92231,7 +91678,6 @@
  76.1.98.229
  76.10.157.54
  76.100.17.13
-76.102.103.136
  76.103.215.236
  76.103.7.22
  76.104.80.47
@@ -92239,6 +91685,7 @@
  76.112.42.33
  76.112.56.76
  76.114.45.200
+76.116.10.243
  76.12.191.16
  76.12.235.47
  76.120.75.139
@@ -92268,14 +91715,15 @@
  76.167.150.74
  76.168.146.136
  76.168.54.203
+76.17.162.140
  76.171.101.212
  76.172.36.158
  76.173.137.100
+76.173.21.36
  76.173.238.49
  76.173.243.139
  76.174.123.147
  76.174.129.203
-76.175.140.120
  76.176.17.13
  76.178.135.121
  76.178.199.119
@@ -92283,7 +91731,7 @@
  76.18.1.104
  76.182.177.11
  76.183.211.188
-76.186.131.156
+76.185.146.131
  76.188.24.162
  76.2.178.44
  76.2.180.214
@@ -92298,23 +91746,17 @@
  76.2.45.215
  76.20.63.24
  76.204.247.110
-76.21.164.15
-76.21.92.130
-76.211.74.84
  76.214.9.223
  76.216.16.130
  76.226.169.13
  76.226.243.142
-76.23.147.186
  76.23.24.168
  76.23.58.234
  76.230.156.129
  76.230.77.161
  76.240.162.156
  76.249.155.46
-76.25.97.246
  76.250.150.193
-76.250.234.161
  76.253.0.85
  76.254.145.213
  76.254.145.225
@@ -92421,7 +91863,6 @@
  76.6.96.19
  76.64.106.82
  76.64.171.117
-76.64.171.191
  76.64.248.98
  76.65.215.21
  76.69.176.155
@@ -92462,6 +91903,7 @@
  76.76.105.218
  76.76.252.217
  76.76.83.23
+76.77.116.2
  76.79.75.82
  76.8.60.53
  76.80.210.138
@@ -92472,8 +91914,8 @@
  76.88.48.104
  76.88.51.61
  76.88.59.75
+76.90.184.220
  76.91.24.78
-76.91.74.2
  76.94.204.125
  76.95.50.98
  76.98.136.198
@@ -92501,15 +91943,14 @@
  76internet-yapkredi.com
  76srv.com
  76wzxjp.com
-77.0.220.221
+77.0.204.148
+77.1.243.29
  77.10.219.1
  77.10.27.239
-77.10.7.254
-77.10.98.230
+77.10.57.37
  77.101.132.253
+77.102.84.209
  77.105.87.97
-77.107.185.209
-77.107.28.102
  77.107.50.58
  77.107.60.227
  77.107.87.51
@@ -92521,14 +91962,14 @@
  77.108.98.68
  77.109.139.87
  77.109.173.12
-77.109.177.12
  77.109.191.149
-77.11.249.23
+77.11.121.55
+77.11.160.234
+77.11.181.173
  77.11.76.138
-77.117.250.43
  77.117.254.26
  77.119.128.158
-77.119.128.196
+77.119.128.20
  77.119.129.176
  77.119.229.106
  77.12.69.249
@@ -92540,7 +91981,6 @@
  77.120.122.114
  77.120.122.15
  77.120.122.22
-77.120.137.143
  77.120.163.103
  77.120.26.102
  77.120.93.135
@@ -92549,23 +91989,28 @@
  77.122.57.126
  77.124.121.145
  77.125.100.228
+77.125.45.33
  77.125.5.174
  77.125.56.53
+77.125.77.0
  77.126.46.142
  77.126.50.1
  77.126.68.90
  77.126.76.254
+77.127.103.2
  77.127.114.192
  77.127.56.251
  77.127.75.163
-77.128.70.50
-77.13.28.7
+77.128.71.81
+77.13.171.84
  77.130.135.14
  77.131.79.51
  77.134.172.81
  77.137.126.9
+77.137.148.223
  77.137.2.51
  77.138.170.206
+77.138.201.158
  77.140.201.98
  77.140.225.184
  77.156.242.132
@@ -92584,36 +92029,40 @@
  77.166.83.167
  77.167.245.239
  77.169.131.80
-77.169.19.45
  77.170.252.23
  77.171.142.247
  77.171.227.94
  77.174.237.229
  77.175.30.187
+77.179.135.113
  77.179.37.175
+77.179.76.92
+77.180.116.145
+77.180.252.159
  77.180.58.9
-77.181.97.153
+77.181.92.1
  77.182.51.46
-77.183.191.151
-77.183.219.152
-77.185.252.76
-77.185.64.244
+77.185.29.101
+77.189.118.206
  77.189.139.188
-77.189.194.253
+77.189.59.231
+77.189.9.131
  77.190.158.99
-77.190.181.109
+77.191.136.151
  77.191.164.197
+77.191.181.215
  77.191.218.97
  77.195.143.45
  77.199.87.64
-77.2.120.56
-77.2.5.194
+77.2.22.108
+77.2.95.139
  77.20.146.247
  77.20.171.14
+77.20.198.156
+77.20.198.200
  77.20.246.114
  77.203.110.43
  77.205.183.17
-77.205.239.9
  77.21.95.28
  77.211.170.149
  77.211.170.214
@@ -92633,14 +92082,13 @@
  77.221.145.84
  77.221.151.178
  77.221.220.133
-77.221.39.102
  77.221.52.77
+77.222.109.219
+77.222.110.177
  77.222.113.248
  77.222.115.97
  77.222.139.57
  77.222.156.112
-77.222.156.32
-77.222.156.82
  77.222.245.115
  77.222.40.169
  77.222.40.188
@@ -92648,9 +92096,9 @@
  77.222.40.63
  77.222.60.220
  77.222.61.212
-77.223.98.107
  77.228.192.191
  77.229.201.125
+77.23.183.11
  77.232.134.106
  77.232.163.5
  77.232.167.200
@@ -92662,6 +92110,8 @@
  77.234.235.174
  77.234.41.22
  77.234.89.132
+77.235.102.11
+77.235.111.126
  77.235.161.242
  77.235.8.83
  77.236.189.18
@@ -92670,13 +92120,14 @@
  77.236.206.11
  77.236.76.74
  77.236.97.247
+77.238.202.148
  77.238.212.227
  77.238.79.111
  77.239.148.134
  77.239.15.201
  77.240.230.231
+77.240.97.31
  77.241.20.215
-77.241.7.132
  77.242.107.2
  77.242.16.26
  77.242.219.206
@@ -92691,6 +92142,7 @@
  77.243.191.20
  77.243.191.21
  77.243.191.36
+77.243.191.37
  77.243.191.40
  77.243.191.44
  77.243.191.45
@@ -92702,8 +92154,9 @@
  77.244.42.178
  77.245.101.254
  77.245.112.48
-77.245.148.59
+77.245.146.152
  77.245.76.93
+77.246.158.246
  77.246.191.192
  77.247.111.98
  77.247.127.150
@@ -92731,14 +92184,15 @@
  77.27.123.197
  77.28.105.144
  77.28.255.80
+77.28.92.241
  77.28.96.196
  77.28.96.206
-77.3.194.113
+77.28.97.34
  77.3.56.13
  77.3.9.5
  77.31.161.222
+77.31.6.77
  77.34.164.221
-77.34.186.191
  77.37.131.73
  77.37.138.239
  77.37.152.104
@@ -92751,13 +92205,13 @@
  77.37.212.122
  77.37.236.10
  77.37.240.23
+77.38.203.201
  77.38.21.239
  77.38.42.145
  77.39.11.78
  77.39.117.115
+77.39.117.226
  77.39.8.64
-77.4.22.166
-77.40.103.21
  77.40.103.52
  77.40.123.115
  77.40.160.37
@@ -92775,27 +92229,33 @@
  77.40.160.51
  77.40.160.52
  77.40.178.236
+77.40.2.106
  77.40.2.46
+77.40.27.222
  77.40.3.151
  77.40.3.160
+77.40.3.165
+77.40.3.66
+77.40.42.249
  77.40.61.133
+77.40.62.146
  77.40.62.239
  77.43.1.226
  77.43.65.44
+77.45.101.138
  77.46.138.1
  77.46.138.33
  77.46.138.37
-77.46.248.248
+77.47.29.88
  77.47.90.172
-77.48.13.19
  77.48.137.3
  77.48.137.65
  77.48.187.2
  77.48.206.106
+77.50.80.43
  77.51.128.127
  77.51.189.219
  77.52.178.235
-77.52.211.148
  77.53.228.168
  77.53.246.179
  77.53.53.196
@@ -92806,10 +92266,11 @@
  77.56.6.24
  77.56.63.223
  77.56.65.5
-77.57.128.3
+77.56.68.181
  77.57.53.115
  77.58.104.89
  77.58.58.11
+77.6.21.138
  77.64.162.103
  77.64.234.44
  77.65.37.78
@@ -92819,16 +92280,14 @@
  77.67.55.219
  77.68.114.124
  77.68.115.33
+77.68.120.200
  77.68.30.105
  77.68.62.77
  77.68.82.58
  77.68.86.20
  77.68.9.178
  77.68.9.94
-77.69.170.133
-77.69.208.217
  77.69.23.183
-77.7.54.32
  77.70.16.245
  77.70.29.86
  77.70.35.87
@@ -92844,7 +92303,6 @@
  77.73.70.28
  77.73.91.146
  77.74.78.80
-77.75.125.44
  77.75.161.167
  77.75.76.160
  77.75.76.161
@@ -92895,18 +92353,20 @@
  77.75.79.95
  77.76.151.206
  77.76.151.72
+77.77.223.81
  77.78.11.235
  77.78.23.108
  77.79.103.219
  77.79.12.9
  77.79.131.207
+77.79.132.56
+77.79.181.219
  77.79.246.80
  77.79.246.81
  77.79.93.3
  77.8.100.145
+77.8.130.127
  77.8.202.135
-77.8.214.250
-77.8.3.98
  77.81.100.88
  77.81.139.35
  77.81.139.36
@@ -92919,8 +92379,8 @@
  77.81.139.44
  77.81.139.46
  77.81.142.101
-77.81.191.198
  77.81.247.72
+77.81.6.149
  77.81.7.90
  77.82.173.141
  77.82.239.26
@@ -92928,6 +92388,7 @@
  77.83.149.91
  77.83.173.188
  77.83.85.42
+77.83.87.23
  77.85.169.149
  77.85.169.19
  77.85.171.160
@@ -92937,6 +92398,7 @@
  77.87.14.63
  77.87.196.119
  77.87.246.100
+77.87.67.20
  77.87.75.12
  77.88.192.94
  77.88.47.14
@@ -92948,9 +92410,6 @@
  77.89.246.62
  77.89.248.157
  77.89.251.138
-77.89.252.65
-77.89.253.158
-77.89.254.23
  77.9.124.198
  77.90.136.129
  77.91.201.31
@@ -92974,6 +92433,7 @@
  77.94.112.234
  77.94.137.91
  77.94.250.178
+77.94.96.66
  77.95.141.193
  77.95.167.25
  77.95.225.77
@@ -93016,8 +92476,8 @@
  77rv.net
  77st.net
  78.0.112.231
-78.101.73.255
  78.102.136.61
+78.106.167.116
  78.106.209.103
  78.107.240.57
  78.108.102.3
@@ -93027,10 +92487,12 @@
  78.108.169.17
  78.108.245.211
  78.108.38.156
+78.108.38.158
  78.108.89.240
  78.109.36.36
  78.11.32.28
  78.11.32.3
+78.11.39.17
  78.11.69.3
  78.110.154.177
  78.110.50.104
@@ -93039,17 +92501,13 @@
  78.110.50.121
  78.110.50.127
  78.111.105.171
-78.111.119.123
  78.111.120.110
  78.111.250.174
  78.111.250.49
-78.111.251.20
-78.111.97.179
  78.111.99.178
  78.117.21.233
  78.119.180.62
-78.123.219.248
-78.128.113.0
+78.121.142.111
  78.128.113.66
  78.128.113.67
  78.128.113.68
@@ -93069,7 +92527,6 @@
  78.130.170.66
  78.131.115.73
  78.131.52.120
-78.131.56.112
  78.131.58.83
  78.132.226.165
  78.132.23.118
@@ -93088,7 +92545,6 @@
  78.138.157.26
  78.138.187.231
  78.138.88.236
-78.139.17.130
  78.139.216.117
  78.139.91.76
  78.14.28.76
@@ -93098,6 +92554,8 @@
  78.141.123.99
  78.141.196.180
  78.141.223.107
+78.141.236.9
+78.141.35.10
  78.142.109.84
  78.142.114.69
  78.142.18.20
@@ -93125,11 +92583,11 @@
  78.157.28.35
  78.157.4.43
  78.157.4.84
+78.157.4.93
  78.157.40.230
  78.157.91.120
  78.158.10.192
  78.158.11.226
-78.158.160.72
  78.158.191.141
  78.159.103.53
  78.159.108.204
@@ -93140,15 +92598,13 @@
  78.159.99.85
  78.161.115.242
  78.161.131.121
-78.163.172.59
-78.164.225.8
  78.164.67.9
  78.165.84.158
  78.166.101.188
  78.167.141.123
  78.167.141.4
  78.167.141.52
-78.167.188.9
+78.168.61.131
  78.17.164.171
  78.171.16.229
  78.171.20.4
@@ -93164,13 +92620,14 @@
  78.173.252.226
  78.173.48.221
  78.173.66.18
-78.173.84.115
+78.173.85.35
  78.173.89.211
  78.173.9.172
  78.175.144.33
  78.175.240.146
  78.175.243.49
  78.176.77.217
+78.179.251.243
  78.180.152.74
  78.180.153.97
  78.180.154.110
@@ -93179,6 +92636,8 @@
  78.181.103.113
  78.182.152.239
  78.182.254.231
+78.183.105.242
+78.185.99.228
  78.186.109.7
  78.186.111.109
  78.186.112.235
@@ -93192,16 +92651,14 @@
  78.187.133.26
  78.187.137.194
  78.187.156.31
-78.187.220.150
  78.187.240.125
-78.187.40.35
  78.187.42.96
  78.187.59.175
  78.188.168.64
+78.188.170.50
  78.188.188.141
  78.188.222.90
  78.188.225.105
-78.188.33.152
  78.188.4.124
  78.188.61.165
  78.188.64.92
@@ -93212,7 +92669,6 @@
  78.189.174.117
  78.189.190.196
  78.189.235.4
-78.189.26.51
  78.189.60.109
  78.189.64.42
  78.189.90.149
@@ -93225,14 +92681,17 @@
  78.197.28.46
  78.199.108.157
  78.20.135.129
+78.20.168.99
  78.20.236.28
  78.20.94.222
  78.202.190.240
+78.202.192.24
  78.204.123.164
  78.205.222.137
  78.206.229.130
  78.209.6.45
  78.21.135.248
+78.21.62.230
  78.217.36.106
  78.22.52.122
  78.223.115.69
@@ -93244,7 +92703,7 @@
  78.24.101.86
  78.24.111.198
  78.24.219.147
-78.243.183.184
+78.247.170.48
  78.249.119.122
  78.25.112.42
  78.25.120.105
@@ -93256,15 +92715,16 @@
  78.28.214.74
  78.29.32.35
  78.29.42.10
+78.3.13.195
  78.30.227.222
  78.30.37.249
-78.31.66.62
  78.31.93.49
  78.32.159.52
  78.35.120.245
  78.35.250.110
  78.35.251.85
  78.36.152.186
+78.36.158.80
  78.36.16.214
  78.36.197.146
  78.37.27.139
@@ -93285,7 +92745,8 @@
  78.41.40.16
  78.41.92.44
  78.42.170.25
-78.43.125.189
+78.43.204.223
+78.45.35.208
  78.46.109.201
  78.46.128.195
  78.46.137.232
@@ -93308,7 +92769,6 @@
  78.46.22.102
  78.46.253.40
  78.46.254.164
-78.46.40.206
  78.46.46.195
  78.46.50.246
  78.46.55.126
@@ -93331,18 +92791,18 @@
  78.47.147.223
  78.47.16.54
  78.47.201.234
+78.47.216.227
  78.47.234.246
  78.47.27.178
  78.47.41.177
  78.47.50.83
  78.47.61.83
-78.47.74.206
  78.47.87.196
  78.47.90.84
-78.49.112.191
  78.54.1.56
-78.54.189.255
-78.54.51.24
+78.54.105.146
+78.54.171.38
+78.55.136.17
  78.55.205.76
  78.56.201.4
  78.57.227.227
@@ -93353,11 +92813,13 @@
  78.62.186.157
  78.62.214.242
  78.62.233.50
+78.62.5.255
  78.63.194.215
  78.63.28.146
  78.63.73.155
  78.68.172.124
  78.72.228.239
+78.72.61.253
  78.73.134.37
  78.8.111.87
  78.8.118.115
@@ -93398,15 +92860,15 @@
  78.90.78.210
  78.90.91.220
  78.92.1.28
-78.92.225.232
  78.92.254.169
  78.92.254.9
  78.92.40.9
-78.94.118.210
  78.94.124.10
-78.94.221.189
  78.94.240.180
  78.94.31.171
+78.96.144.101
+78.97.6.117
+78.98.228.170
  78.99.119.64
  7803000.com
  78111.com
@@ -93433,17 +92895,14 @@
  78mcp.com
  78ug45egfdy089l095d.top
  79.10.148.140
-79.10.15.101
  79.10.159.73
  79.10.198.229
-79.10.250.204
  79.10.82.174
  79.100.198.122
  79.100.49.51
  79.100.49.79
  79.101.1.25
  79.101.106.74
-79.101.40.113
  79.101.40.114
  79.101.45.94
  79.101.55.161
@@ -93459,10 +92918,10 @@
  79.106.165.238
  79.106.165.30
  79.106.166.154
+79.106.209.14
  79.106.224.231
  79.106.229.51
  79.106.230.1
-79.106.231.70
  79.106.34.2
  79.106.34.4
  79.106.34.6
@@ -93476,43 +92935,37 @@
  79.106.35.62
  79.106.35.82
  79.106.45.125
-79.106.45.206
  79.106.66.25
  79.108.206.93
  79.108.207.194
  79.11.196.140
  79.11.222.106
  79.110.112.210
-79.110.134.40
-79.110.17.109
  79.110.17.21
  79.110.17.60
  79.110.17.84
  79.110.192.65
  79.110.193.67
-79.110.28.120
  79.110.28.129
  79.110.28.161
  79.110.28.164
  79.110.28.169
-79.110.28.206
+79.110.28.20
  79.110.28.212
-79.110.28.221
  79.110.28.242
  79.110.28.25
  79.110.28.50
+79.110.28.86
  79.110.52.243
  79.111.13.155
+79.114.149.116
  79.114.75.198
-79.115.208.217
-79.115.245.227
  79.115.47.249
  79.115.74.146
  79.116.28.250
  79.117.130.214
  79.117.93.38
  79.118.179.194
-79.120.11.154
  79.120.118.82
  79.120.177.106
  79.120.54.174
@@ -93525,6 +92978,7 @@
  79.124.23.9
  79.124.60.179
  79.124.62.10
+79.124.62.196
  79.124.62.250
  79.124.62.26
  79.124.7.253
@@ -93543,17 +92997,16 @@
  79.129.117.118
  79.129.135.116
  79.129.29.237
-79.129.59.118
  79.129.6.235
  79.130.130.240
  79.130.202.26
  79.130.206.78
-79.132.116.124
+79.132.117.103
  79.132.118.133
+79.132.200.133
  79.132.200.137
  79.132.201.113
  79.132.203.115
-79.132.203.130
  79.132.203.209
  79.132.205.34
  79.133.200.146
@@ -93562,8 +93015,6 @@
  79.133.6.236
  79.134.173.69
  79.134.7.134
-79.134.79.252
-79.135.45.158
  79.135.73.141
  79.136.1.41
  79.136.1.46
@@ -93585,6 +93036,7 @@
  79.137.68.161
  79.137.69.162
  79.137.70.55
+79.137.72.171
  79.137.73.76
  79.137.74.57
  79.137.77.131
@@ -93611,12 +93063,12 @@
  79.143.188.7
  79.143.225.152
  79.143.37.84
-79.143.85.228
  79.143.87.166
  79.143.87.218
  79.143.87.227
  79.143.87.240
  79.143.87.241
+79.144.12.191
  79.144.126.41
  79.144.96.182
  79.146.21.81
@@ -93624,20 +93076,22 @@
  79.147.174.172
  79.148.238.69
  79.148.44.211
+79.150.115.196
  79.150.168.125
  79.150.204.56
  79.150.214.31
  79.150.39.20
  79.154.14.4
-79.154.147.222
  79.155.8.95
-79.156.226.121
+79.156.226.116
  79.157.178.210
  79.158.182.231
  79.158.61.202
  79.159.138.37
+79.16.199.146
  79.160.166.61
  79.160.172.212
+79.161.203.25
  79.161.252.14
  79.164.171.32
  79.164.176.68
@@ -93648,18 +93102,20 @@
  79.169.137.95
  79.169.184.113
  79.169.5.17
+79.17.239.205
  79.17.97.167
  79.170.40.166
  79.170.40.168
+79.170.40.246
  79.170.44.116
  79.171.13.166
  79.171.13.182
  79.172.193.32
  79.172.201.60
+79.172.236.94
  79.172.86.139
  79.173.115.196
  79.173.124.177
-79.174.187.54
  79.174.24.137
  79.174.24.172
  79.174.72.78
@@ -93671,7 +93127,11 @@
  79.178.211.152
  79.178.38.54
  79.179.122.203
+79.179.219.132
+79.180.165.102
  79.180.195.205
+79.180.38.95
+79.181.18.89
  79.181.20.138
  79.181.83.16
  79.181.88.203
@@ -93687,56 +93147,55 @@
  79.19.73.54
  79.190.14.42
  79.191.2.19
-79.193.120.50
  79.194.167.232
-79.194.170.86
+79.195.71.206
  79.20.255.163
-79.20.54.60
-79.201.170.110
  79.201.175.119
  79.203.141.76
  79.207.17.39
  79.207.249.149
+79.208.244.133
  79.21.45.9
+79.212.56.204
+79.214.56.128
  79.216.6.176
  79.217.21.51
+79.218.132.21
  79.220.185.61
  79.222.247.96
  79.223.12.189
-79.224.60.158
+79.224.53.89
+79.225.101.4
  79.225.88.178
-79.225.89.232
-79.226.156.91
+79.229.46.145
  79.23.78.196
  79.233.100.114
+79.234.91.46
  79.235.175.228
-79.236.188.146
+79.235.241.204
  79.236.190.3
  79.24.238.169
  79.24.87.203
  79.244.122.142
  79.25.112.10
-79.253.40.185
  79.253.63.18
  79.254.8.171
  79.27.107.176
  79.27.214.141
  79.32.198.220
-79.35.122.7
  79.37.45.108
  79.41.123.117
  79.43.221.23
-79.44.219.31
-79.44.225.67
  79.49.78.176
  79.5.1.73
+79.50.189.89
  79.51.155.106
-79.52.30.6
  79.53.213.67
  79.54.115.243
+79.54.216.221
+79.56.244.159
  79.58.45.55
  79.59.153.241
-79.60.83.251
  79.61.191.231
  79.62.146.233
  79.62.15.239
@@ -93756,7 +93215,6 @@
  79.82.253.50
  79.9.102.153
  79.9.171.88
-79.9.21.146
  79.9.88.185
  79.96.175.83
  79.96.218.84
@@ -93764,9 +93222,9 @@
  79.96.73.102
  79.98.1.32
  79.98.105.138
+79.98.133.14
  79.98.159.7
  79.98.23.9
-79.98.24.39
  79.98.30.37
  79.98.31.253
  79.99.188.50
@@ -93895,9 +93353,9 @@
  8.129.172.40
  8.129.210.222
  8.135.28.152
+8.136.99.80
  8.14.146.83
  8.15.224.120
-8.208.102.227
  8.208.80.253
  8.209.71.217
  8.209.72.208
@@ -93922,6 +93380,7 @@
  8.210.214.87
  8.210.217.170
  8.210.229.68
+8.210.231.149
  8.210.32.74
  8.210.52.253
  8.210.74.141
@@ -93933,6 +93392,8 @@
  8.28.16.254
  8.30.196.204
  8.33.7.95
+8.34.30.253
+8.38.147.15
  8.38.148.43
  8.38.53.138
  8.38.89.146
@@ -93940,14 +93401,13 @@
  8.4.9.137
  8.4.9.152
  8.40.143.51
+8.43.40.20
  8.81.199.35.bc.googleusercontent.com
  8.9.40.245
  8.9.6.229
  8.dojnh.com
  80-87-45.ga
-80.0.141.86
  80.0.157.243
-80.1.223.121
  80.1.31.151
  80.100.128.128
  80.100.161.227
@@ -93959,32 +93419,29 @@
  80.102.214.69
  80.102.22.14
  80.102.50.2
-80.104.143.97
  80.106.228.1
  80.106.241.112
  80.106.247.145
  80.106.59.35
  80.107.117.210
+80.107.61.252
  80.107.71.76
  80.108.14.34
  80.108.17.214
  80.108.210.64
  80.108.82.95
  80.108.95.9
-80.108.97.2
  80.109.153.122
  80.11.131.100
  80.110.188.114
  80.111.130.189
  80.112.127.9
-80.112.137.211
  80.112.145.175
  80.114.132.16
  80.114.3.91
  80.114.89.7
  80.115.166.124
-80.116.185.169
-80.117.116.137
+80.117.106.233
  80.12.91.114
  80.120.212.14
  80.120.248.141
@@ -93995,54 +93452,55 @@
  80.123.143.202
  80.123.162.21
  80.127.116.96
-80.128.156.191
  80.129.62.174
  80.13.105.147
-80.131.64.195
  80.131.67.156
-80.132.122.83
+80.132.121.228
  80.132.123.209
  80.132.189.180
+80.132.192.147
+80.132.202.45
+80.132.204.161
  80.132.231.182
-80.133.35.19
-80.133.37.191
+80.133.170.39
+80.133.37.173
  80.133.46.81
  80.134.203.210
  80.135.119.188
  80.136.51.176
  80.137.175.16
-80.138.175.145
+80.138.173.185
  80.14.187.157
  80.14.31.191
  80.14.40.242
+80.141.32.7
  80.147.82.165
  80.149.158.186
  80.15.100.37
-80.15.14.46
  80.15.195.37
  80.150.254.184
  80.151.40.92
  80.152.186.194
  80.153.76.217
  80.162.220.72
-80.164.71.77
  80.169.143.166
  80.169.225.123
  80.17.127.226
  80.172.255.60
  80.174.199.44
-80.174.70.189
  80.175.219.102
  80.179.149.111
  80.179.42.40
  80.179.42.44
-80.180.30.181
  80.183.80.215
+80.187.100.169
  80.187.108.104
+80.187.113.152
  80.187.116.122
+80.187.120.11
  80.187.121.210
-80.187.80.49
-80.188.168.178
+80.187.97.55
+80.187.99.124
  80.188.204.250
  80.188.239.106
  80.189.118.165
@@ -94066,8 +93524,6 @@
  80.209.229.151
  80.209.231.126
  80.209.242.26
-80.21.190.42
-80.210.32.67
  80.211.102.87
  80.211.11.250
  80.211.128.5
@@ -94106,10 +93562,12 @@
  80.211.89.87
  80.211.99.98
  80.213.212.137
+80.213.245.240
+80.214.116.235
+80.215.154.194
  80.215.207.31
-80.216.100.169
-80.217.191.235
-80.219.173.135
+80.217.115.142
+80.219.113.82
  80.22.165.54
  80.221.41.1
  80.227.134.221
@@ -94126,7 +93584,6 @@
  80.231.93.159
  80.232.248.17
  80.234.14.233
-80.235.87.104
  80.236.39.33
  80.237.159.104
  80.237.2.74
@@ -94137,6 +93594,7 @@
  80.24.149.228
  80.240.129.221
  80.240.130.152
+80.240.138.115
  80.240.16.182
  80.240.19.44
  80.240.20.107
@@ -94181,6 +93639,7 @@
  80.246.31.44
  80.246.31.49
  80.246.31.50
+80.246.31.51
  80.246.31.55
  80.246.31.56
  80.247.164.121
@@ -94190,14 +93649,16 @@
  80.249.176.206
  80.25.87.49
  80.250.14.236
+80.250.55.32
  80.251.153.159
  80.251.153.207
  80.251.153.35
-80.251.153.57
  80.251.216.233
+80.251.219.111
  80.251.55.158
  80.252.133.26
  80.252.19.109
+80.252.241.145
  80.253.29.58
  80.253.92.137
  80.253.94.252
@@ -94228,7 +93689,6 @@
  80.31.238.123
  80.31.241.9
  80.31.49.209
-80.32.117.147
  80.32.195.155
  80.36.22.198
  80.37.181.60
@@ -94242,13 +93702,13 @@
  80.5.132.247
  80.5.29.196
  80.50.141.118
+80.51.70.15
  80.52.169.233
  80.53.244.214
  80.53.255.194
  80.53.57.146
  80.55.101.146
  80.55.96.118
-80.57.9.229
  80.59.98.59
  80.60.120.119
  80.60.135.139
@@ -94263,7 +93723,6 @@
  80.66.146.84
  80.66.150.238
  80.66.77.110
-80.66.83.45
  80.67.111.20
  80.67.172.162
  80.67.26.40
@@ -94274,6 +93733,7 @@
  80.68.2.100
  80.68.2.74
  80.68.76.178
+80.7.238.63
  80.70.17.209
  80.70.17.225
  80.70.17.245
@@ -94323,7 +93783,6 @@
  80.71.112.98
  80.71.113.211
  80.71.117.38
-80.71.13.138
  80.72.121.179
  80.73.13.219
  80.73.84.106
@@ -94340,6 +93799,7 @@
  80.78.248.25
  80.78.65.187
  80.78.75.59
+80.78.76.98
  80.78.77.114
  80.78.79.69
  80.79.114.34
@@ -94360,12 +93820,14 @@
  80.80.167.246
  80.80.167.249
  80.80.171.100
-80.80.172.3
  80.80.234.140
  80.81.232.149
  80.82.147.1
  80.82.147.2
  80.82.147.4
+80.82.155.39
+80.82.155.54
+80.82.184.72
  80.82.208.58
  80.82.215.152
  80.82.51.45
@@ -94393,24 +93855,26 @@
  80.82.70.24
  80.82.70.249
  80.82.70.33
+80.82.76.132
  80.82.77.139
  80.82.77.227
  80.82.77.33
+80.82.77.42
  80.82.77.66
  80.82.78.112
  80.82.78.166
  80.82.78.170
  80.82.78.38
-80.82.78.82
  80.82.78.85
  80.82.78.87
  80.82.78.9
+80.83.21.136
+80.83.21.234
  80.83.90.42
  80.85.86.175
  80.85.86.53
  80.85.87.122
  80.85.87.245
-80.86.31.32
  80.86.91.232
  80.87.184.49
  80.87.185.233
@@ -94429,11 +93893,9 @@
  80.89.150.134
  80.89.156.216
  80.90.130.9
-80.90.131.190
  80.90.228.170
  80.90.82.70
  80.90.83.163
-80.90.84.249
  80.90.86.237
  80.91.116.173
  80.91.118.61
@@ -94451,16 +93913,13 @@
  80.93.124.148
  80.93.130.50
  80.93.184.251
+80.93.212.44
  80.93.213.210
-80.93.213.213
  80.93.213.246
  80.93.217.42
  80.93.220.21
-80.93.41.244
  80.93.48.49
  80.94.118.192
-80.94.93.16
-80.94.93.31
  80.94.93.38
  80.95.109.6
  80.95.248.151
@@ -94468,6 +93927,7 @@
  80.96.150.171
  80.96.24.136
  80.98.185.104
+80.98.249.181
  8004print.com
  800emailsupport.com
  800fiabe.it
@@ -94508,22 +93968,26 @@
  81.107.197.178
  81.109.105.199
  81.109.203.182
-81.109.86.251
  81.110.170.57
-81.110.182.176
  81.111.112.45
  81.111.43.114
  81.111.91.234
+81.113.239.106
+81.117.225.245
  81.12.119.164
+81.12.119.166
  81.12.119.169
+81.12.119.171
  81.12.119.172
  81.12.119.189
+81.12.119.190
  81.12.13.152
  81.12.169.126
  81.12.169.254
  81.12.224.61
-81.12.28.34
-81.12.29.164
+81.12.28.139
+81.12.28.61
+81.12.28.96
  81.130.146.18
  81.130.234.235
  81.130.70.67
@@ -94532,12 +93996,12 @@
  81.134.179.184
  81.137.6.81
  81.138.20.196
-81.141.0.55
  81.141.23.54
  81.144.138.34
  81.145.194.114
  81.15.163.4
-81.151.52.160
+81.15.197.171
+81.150.0.229
  81.152.109.18
  81.154.182.21
  81.156.142.165
@@ -94561,15 +94025,17 @@
  81.162.57.134
  81.163.254.104
  81.163.254.107
-81.163.28.101
  81.163.35.205
  81.163.36.139
  81.163.36.210
+81.163.47.102
  81.163.57.147
  81.163.62.221
  81.163.62.33
  81.163.80.146
  81.164.70.26
+81.165.160.172
+81.165.180.252
  81.165.210.66
  81.167.175.244
  81.167.49.109
@@ -94582,7 +94048,6 @@
  81.169.167.43
  81.169.174.142
  81.169.179.225
-81.169.210.71
  81.169.217.70
  81.169.245.54
  81.169.248.38
@@ -94655,6 +94120,7 @@
  81.182.248.193
  81.182.254.124
  81.182.6.245
+81.182.93.210
  81.183.136.218
  81.183.208.244
  81.183.213.36
@@ -94662,6 +94128,7 @@
  81.183.222.181
  81.183.253.34
  81.183.98.67
+81.184.13.131
  81.184.215.161
  81.186.148.72
  81.187.171.182
@@ -94677,12 +94144,12 @@
  81.193.206.140
  81.193.45.123
  81.196.127.37
+81.196.154.13
  81.196.159.9
  81.197.110.223
  81.198.111.231
  81.198.119.241
  81.198.27.236
-81.198.69.61
  81.198.79.162
  81.198.79.164
  81.198.79.168
@@ -94701,6 +94168,8 @@
  81.200.248.145
  81.200.63.108
  81.201.50.131
+81.202.93.10
+81.203.138.33
  81.205.107.8
  81.208.34.38
  81.208.39.28
@@ -94719,6 +94188,8 @@
  81.214.39.192
  81.214.39.214
  81.214.63.228
+81.215.198.49
+81.215.200.22
  81.215.230.173
  81.218.127.187
  81.218.144.128
@@ -94754,8 +94225,8 @@
  81.242.193.55
  81.242.210.95
  81.242.91.23
+81.243.223.62
  81.245.173.127
-81.246.177.106
  81.246.225.203
  81.247.171.241
  81.25.120.224
@@ -94773,6 +94244,7 @@
  81.29.245.164
  81.3.154.235
  81.3.179.83
+81.3.207.85
  81.30.162.28
  81.30.164.221
  81.30.176.30
@@ -94782,7 +94254,6 @@
  81.30.208.30
  81.30.215.23
  81.30.6.49
-81.31.234.57
  81.31.235.213
  81.31.241.193
  81.31.241.194
@@ -94790,10 +94261,9 @@
  81.31.250.193
  81.31.251.148
  81.32.185.185
-81.32.76.190
+81.33.184.16
  81.33.19.126
  81.33.4.214
-81.34.129.27
  81.34.18.81
  81.34.32.255
  81.35.67.42
@@ -94809,27 +94279,24 @@
  81.4.110.153
  81.4.110.236
  81.4.127.228
-81.4.127.34
  81.4.207.62
  81.43.169.242
  81.43.190.249
  81.43.98.133
-81.44.146.77
  81.47.134.66
  81.47.161.135
  81.49.228.39
  81.5.103.14
-81.5.112.19
  81.56.94.102
  81.57.217.41
+81.6.39.141
  81.6.39.241
  81.6.43.167
+81.60.164.211
  81.66.123.25
-81.66.176.120
  81.68.100.138
  81.68.101.116
  81.68.102.235
-81.68.102.238
  81.68.103.135
  81.68.104.156
  81.68.105.55
@@ -94837,6 +94304,7 @@
  81.68.106.157
  81.68.107.74
  81.68.108.77
+81.68.114.182
  81.68.114.6
  81.68.116.127
  81.68.120.181
@@ -94859,7 +94327,6 @@
  81.68.136.135
  81.68.137.90
  81.68.142.128
-81.68.143.165
  81.68.144.156
  81.68.146.126
  81.68.146.199
@@ -94876,11 +94343,11 @@
  81.68.167.79
  81.68.169.2
  81.68.172.21
+81.68.176.4
  81.68.179.112
  81.68.179.203
  81.68.179.38
  81.68.180.253
-81.68.181.52
  81.68.181.60
  81.68.183.164
  81.68.183.98
@@ -94900,13 +94367,13 @@
  81.68.208.67
  81.68.209.131
  81.68.211.117
+81.68.211.124
  81.68.211.26
  81.68.214.53
  81.68.215.10
  81.68.215.181
  81.68.216.53
  81.68.217.130
-81.68.217.15
  81.68.219.65
  81.68.222.241
  81.68.223.45
@@ -94937,13 +94404,13 @@
  81.68.248.77
  81.68.250.31
  81.68.251.200
+81.68.251.58
  81.68.253.104
  81.68.253.14
  81.68.253.19
  81.68.253.95
  81.68.255.153
  81.68.65.90
-81.68.66.41
  81.68.67.193
  81.68.69.68
  81.68.70.18
@@ -94988,7 +94455,6 @@
  81.69.19.167
  81.69.19.79
  81.69.197.21
-81.69.2.35
  81.69.20.76
  81.69.21.163
  81.69.218.137
@@ -95002,6 +94468,7 @@
  81.69.242.112
  81.69.242.16
  81.69.242.220
+81.69.243.134
  81.69.243.46
  81.69.245.83
  81.69.247.142
@@ -95036,7 +94503,6 @@
  81.69.38.97
  81.69.42.199
  81.69.44.148
-81.69.44.222
  81.69.47.35
  81.69.56.253
  81.69.57.115
@@ -95046,20 +94512,23 @@
  81.69.7.105
  81.69.7.163
  81.69.8.18
-81.69.97.151
  81.7.10.238
  81.7.17.202
  81.7.7.69
  81.70.10.77
  81.70.102.35
  81.70.103.204
+81.70.103.48
  81.70.105.82
  81.70.11.106
+81.70.118.61
  81.70.13.198
+81.70.143.188
  81.70.145.250
  81.70.146.26
  81.70.147.144
  81.70.147.94
+81.70.149.55
  81.70.150.244
  81.70.152.154
  81.70.152.213
@@ -95072,7 +94541,6 @@
  81.70.155.157
  81.70.155.219
  81.70.156.134
-81.70.156.146
  81.70.156.161
  81.70.159.11
  81.70.159.196
@@ -95124,12 +94592,11 @@
  81.70.203.235
  81.70.203.246
  81.70.204.31
-81.70.204.41
  81.70.205.107
  81.70.205.137
+81.70.209.189
  81.70.21.113
  81.70.210.160
-81.70.210.219
  81.70.210.74
  81.70.211.212
  81.70.213.240
@@ -95137,6 +94604,7 @@
  81.70.216.28
  81.70.218.157
  81.70.219.145
+81.70.22.100
  81.70.22.137
  81.70.220.67
  81.70.221.178
@@ -95178,7 +94646,6 @@
  81.71.119.160
  81.71.120.65
  81.71.126.121
-81.71.128.128
  81.71.128.134
  81.71.128.135
  81.71.129.100
@@ -95196,10 +94663,11 @@
  81.71.19.202
  81.71.26.161
  81.71.28.205
+81.71.3.48
  81.71.3.99
-81.71.32.176
  81.71.32.248
  81.71.35.59
+81.71.37.37
  81.71.38.138
  81.71.38.43
  81.71.45.162
@@ -95213,12 +94681,13 @@
  81.71.84.128
  81.71.85.116
  81.71.88.53
+81.8.37.98
  81.82.201.5
  81.82.211.25
  81.82.228.134
  81.82.229.114
  81.82.82.45
-81.84.69.122
+81.83.163.65
  81.86.25.161
  81.86.82.68
  81.88.198.162
@@ -95244,11 +94713,11 @@
  81.89.48.239
  81.90.188.81
  81.91.137.44
+81.91.176.128
  81.91.208.8
  81.91.219.98
  81.92.202.202
  81.92.207.106
-81.92.207.78
  81.92.207.82
  81.92.207.98
  81.92.207.99
@@ -95262,6 +94731,7 @@
  81.95.13.51
  81.95.131.10
  81.95.226.138
+81.95.230.211
  81.95.45.234
  81.95.5.146
  81.95.7.22
@@ -95296,21 +94766,21 @@
  81cf7e.netlify.com
  81millstreet.nl
  81rc4uw1b4roh99dmn.cf
-82.0.232.117
-82.1.150.122
  82.1.4.99
  82.10.188.54
  82.10.220.141
  82.102.18.110
-82.102.18.235
  82.102.197.110
  82.102.21.185
  82.102.21.214
  82.102.25.147
  82.102.27.10
  82.102.27.118
+82.102.91.178
  82.103.116.126
+82.103.118.42
  82.103.70.227
+82.112.28.123
  82.114.248.25
  82.114.70.2
  82.114.72.218
@@ -95321,14 +94791,12 @@
  82.114.94.68
  82.114.94.69
  82.115.213.209
-82.115.215.100
  82.115.215.102
  82.115.215.106
  82.115.215.155
  82.115.215.156
  82.115.215.238
  82.115.215.48
-82.115.215.67
  82.115.215.90
  82.116.32.13
  82.116.79.5
@@ -95345,9 +94813,8 @@
  82.118.242.108
  82.118.242.25
  82.118.242.76
+82.121.207.204
  82.124.198.234
-82.127.38.115
-82.127.74.162
  82.128.141.82bin.sh
  82.131.144.38
  82.131.148.106
@@ -95373,8 +94840,9 @@
  82.142.147.174
  82.142.87.2
  82.144.207.116
+82.144.210.16
  82.144.83.152
-82.145.210.171
+82.145.209.253
  82.145.221.221
  82.145.31.212
  82.145.43.153
@@ -95406,8 +94874,11 @@
  82.148.25.100
  82.148.25.99
  82.149.123.143
-82.149.178.144
-82.149.180.56
+82.149.176.255
+82.149.179.137
+82.149.180.198
+82.149.182.89
+82.149.182.99
  82.150.140.40
  82.151.113.56
  82.151.114.197
@@ -95416,6 +94887,7 @@
  82.151.220.89
  82.155.199.3
  82.155.28.72
+82.156.110.165
  82.156.164.214
  82.156.67.62
  82.156.71.80
@@ -95429,6 +94901,7 @@
  82.161.200.117
  82.162.104.19
  82.162.120.220
+82.162.62.46
  82.165.100.150
  82.165.114.135
  82.165.117.133
@@ -95437,17 +94910,16 @@
  82.165.137.115
  82.165.140.117
  82.165.152.127
-82.165.159.13
  82.165.159.34
+82.165.159.43
  82.165.18.207
  82.165.184.192
+82.165.185.18
  82.165.186.165
  82.165.19.103
-82.165.19.48
  82.165.197.136
  82.165.198.170
  82.165.23.226
-82.165.249.198
  82.165.253.182
  82.165.48.140
  82.165.48.181
@@ -95456,27 +94928,26 @@
  82.165.80.32
  82.166.152.154
  82.166.62.243
+82.168.253.216
  82.176.164.40
  82.177.176.1
  82.177.176.24
  82.177.80.88
  82.177.87.98
  82.178.0.55
-82.178.1.72
  82.178.107.145
+82.178.157.156
  82.178.20.242
  82.179.122.250
  82.18.174.241
  82.181.218.229
  82.181.91.236
-82.192.42.42
  82.192.80.204
  82.192.81.160
  82.192.88.11
  82.193.100.83
  82.193.102.228
  82.193.103.110
-82.193.109.93
  82.193.145.123
  82.193.15.3
  82.193.151.66
@@ -95503,6 +94974,7 @@
  82.196.15.59
  82.196.2.49
  82.196.3.36
+82.196.5.194
  82.196.5.221
  82.196.5.23
  82.196.5.251
@@ -95530,17 +95002,19 @@
  82.202.167.56
  82.202.197.224
  82.202.249.86
+82.202.5.30
  82.202.68.231
  82.202.99.217
  82.204.141.94
+82.204.153.146
  82.206.222.21
-82.207.204.64
  82.207.222.41
  82.207.41.135
  82.207.56.202
  82.207.57.10
  82.207.59.154
  82.207.87.24
+82.208.101.227
  82.208.146.142
  82.208.149.161
  82.208.173.16
@@ -95551,10 +95025,9 @@
  82.209.216.156
  82.209.219.244
  82.21.164.47
-82.211.2.180
  82.211.24.242
+82.211.24.37
  82.211.31.210
-82.211.50.154
  82.211.50.186
  82.211.50.201
  82.211.50.205
@@ -95566,17 +95039,16 @@
  82.211.57.220
  82.211.57.229
  82.211.57.231
+82.211.57.241
  82.211.57.250
  82.211.58.111
  82.211.58.112
-82.211.58.16
  82.211.58.29
  82.211.58.50
-82.211.58.62
  82.211.58.71
  82.211.58.8
  82.211.9.13
-82.211.9.235
+82.211.9.175
  82.211.9.72
  82.213.78.2
  82.216.110.29
@@ -95584,8 +95056,7 @@
  82.217.169.100
  82.217.194.145
  82.217.217.110
-82.22.96.157
-82.220.5.18
+82.22.211.81
  82.221.100.229
  82.221.102.177
  82.221.102.181
@@ -95629,7 +95100,6 @@
  82.223.14.245
  82.223.198.224
  82.223.69.17
-82.223.77.225
  82.225.49.121
  82.228.6.131
  82.237.252.9
@@ -95641,30 +95111,25 @@
  82.248.146.79
  82.25.143.213
  82.252.151.64
-82.252.156.58
  82.255.203.175
  82.28.153.95
+82.28.186.158
  82.3.220.15
  82.33.148.31
-82.37.143.4
+82.33.73.159
+82.34.170.236
+82.37.141.166
  82.37.31.3
  82.38.182.164
  82.39.166.139
  82.39.38.172
-82.41.236.107
-82.43.201.20
  82.44.64.71
  82.45.166.85
  82.46.89.252
  82.48.39.246
  82.5.67.222
  82.52.171.170
-82.52.44.226
-82.52.45.11
-82.54.91.230
-82.58.61.142
  82.59.139.127
-82.59.69.150
  82.6.33.11
  82.60.7.40
  82.61.223.175
@@ -95681,6 +95146,8 @@
  82.64.206.205
  82.64.212.80
  82.64.220.36
+82.64.223.166
+82.64.223.247
  82.64.234.148
  82.64.247.247
  82.64.25.166
@@ -95689,18 +95156,21 @@
  82.64.32.76
  82.64.45.205
  82.64.49.27
-82.64.51.141
  82.64.57.228
  82.64.69.52
  82.65.108.248
  82.65.115.199
  82.65.117.46
+82.65.118.178
+82.65.118.242
  82.65.134.3
+82.65.163.242
+82.65.165.177
  82.65.166.65
  82.65.173.65
  82.65.190.68
  82.65.207.11
-82.65.210.19
+82.65.211.222
  82.65.217.237
  82.65.217.242
  82.65.27.101
@@ -95708,26 +95178,22 @@
  82.65.3.231
  82.65.42.106
  82.66.234.57
+82.67.137.64
  82.67.234.103
  82.67.68.28
  82.68.49.227
  82.69.119.77
-82.71.23.33
-82.71.47.216
  82.73.140.167
  82.73.194.143
  82.73.53.176
  82.74.87.60
-82.75.107.107
  82.76.111.249
  82.76.135.94
  82.76.153.177
-82.76.183.155
  82.77.136.160
  82.77.136.63
  82.77.55.46
  82.78.179.117
-82.79.232.109
  82.79.232.161
  82.79.35.110
  82.79.58.192
@@ -95739,10 +95205,13 @@
  82.81.4.57
  82.81.46.112
  82.81.98.51
+82.82.242.131
  82.94.216.148
  82.94.228.100
  82.94.35.199
  82.95.118.115
+82.95.145.19
+82.95.156.243
  82.96.42.138
  82.98.104.217
  82.98.141.7
@@ -95784,7 +95253,6 @@
  83.1.213.1
  83.1.215.1
  83.100.193.124
-83.102.134.70
  83.102.180.27
  83.103.147.110
  83.103.150.72
@@ -95794,24 +95262,18 @@
  83.103.206.60
  83.103.72.130
  83.11.160.187
-83.11.45.217
-83.11.50.11
-83.11.70.83
-83.11.92.216
+83.110.213.199
  83.110.223.58
  83.110.225.215
-83.114.140.240
+83.110.93.6
  83.12.171.68
  83.12.244.50
-83.122.73.200
  83.128.49.155
  83.13.19.85
  83.13.191.186
  83.13.235.245
  83.133.121.137
  83.133.127.251
-83.135.130.111
-83.135.135.109
  83.135.149.214
  83.135.193.113
  83.135.193.183
@@ -95820,6 +95282,7 @@
  83.135.197.114
  83.135.197.9
  83.135.198.245
+83.135.202.15
  83.135.202.74
  83.135.202.86
  83.135.203.157
@@ -95828,7 +95291,8 @@
  83.135.206.9
  83.135.207.227
  83.135.207.91
-83.135.84.40
+83.135.75.252
+83.135.95.230
  83.136.123.228
  83.136.126.153
  83.136.176.64
@@ -95838,26 +95302,31 @@
  83.136.45.25
  83.137.41.10
  83.137.54.101
+83.137.6.174
  83.138.48.14
  83.139.112.43
+83.14.106.49
  83.14.55.250
  83.14.56.203
  83.142.197.99
  83.142.52.170
+83.142.52.40
  83.142.53.201
-83.142.54.254
  83.142.83.21
+83.142.83.27
  83.143.134.34
  83.143.24.27
  83.143.26.34
  83.144.109.70
  83.144.117.139
  83.145.138.21
+83.146.168.160
  83.147.152.1
  83.147.153.226
  83.148.241.222
  83.149.126.98
  83.15.108.140
+83.150.215.195
  83.150.54.50
  83.150.63.208
  83.151.229.140
@@ -95879,16 +95348,18 @@
  83.164.146.86
  83.165.192.43
  83.165.237.163
-83.166.101.230
+83.166.104.27
  83.166.106.115
-83.166.107.248
  83.166.107.96
  83.166.108.13
+83.166.240.202
  83.166.241.216
+83.167.1.125
  83.167.203.174
  83.167.247.177
  83.167.73.151
  83.168.44.182
+83.168.84.123
  83.168.84.130
  83.168.84.134
  83.168.84.137
@@ -95913,7 +95384,6 @@
  83.170.193.178
  83.170.200.34
  83.171.114.92
-83.171.227.133
  83.171.252.153
  83.171.253.127
  83.171.253.180
@@ -95926,7 +95396,6 @@
  83.171.99.160
  83.172.144.31
  83.172.144.67
-83.173.138.54
  83.174.218.83
  83.174.233.94
  83.175.111.138
@@ -95936,18 +95405,19 @@
  83.19.92.133
  83.19.99.66
  83.191.163.133
+83.197.36.53
  83.198.144.132
  83.2.189.66
  83.20.207.43
+83.20.65.140
  83.202.231.25
  83.209.121.104
  83.209.240.11
+83.21.150.145
  83.211.162.198
  83.212.102.225
  83.212.111.202
-83.212.92.120
  83.213.167.112
-83.213.244.59
  83.216.160.146
  83.216.190.83
  83.217.154.155
@@ -95956,24 +95426,21 @@
  83.218.162.181
  83.219.1.201
  83.219.139.66
-83.219.149.60
  83.22.1.149
+83.22.171.201
  83.220.144.22
  83.221.163.157
  83.221.175.184
-83.221.195.72
  83.221.210.233
  83.221.211.116
-83.221.215.66
  83.221.95.83
  83.222.178.177
  83.222.5.124
  83.226.184.109
-83.226.76.197
  83.227.81.9
  83.228.102.154
-83.228.36.181
  83.228.47.75
+83.228.97.218
  83.229.84.135
  83.23.172.159
  83.231.34.133
@@ -95986,6 +95453,7 @@
  83.234.206.47
  83.234.76.155
  83.236.135.251
+83.236.18.53
  83.238.39.250
  83.239.138.38
  83.239.171.80
@@ -95995,6 +95463,8 @@
  83.24.175.39
  83.24.27.184
  83.240.242.218
+83.240.245.242
+83.242.251.36
  83.242.96.21
  83.242.96.22
  83.243.191.199
@@ -96003,31 +95473,28 @@
  83.243.59.41
  83.244.54.230
  83.248.66.194
-83.249.239.207
  83.25.14.196
  83.25.206.136
  83.25.74.34
  83.250.140.254
+83.250.212.35
  83.251.241.0
  83.252.70.43
  83.252.9.37
-83.26.98.1
+83.253.187.226
  83.26.98.74
-83.27.42.13
-83.29.175.177
  83.30.8.172
  83.31.140.216
  83.32.17.151
  83.33.235.3
-83.34.61.61
  83.35.116.81
  83.35.117.8
  83.37.10.100
  83.37.158.47
  83.37.215.129
  83.37.216.102
-83.4.53.248
  83.4.8.111
+83.40.147.131
  83.40.35.113
  83.43.153.207
  83.43.53.115
@@ -96038,9 +95505,10 @@
  83.48.97.152
  83.49.178.252
  83.51.3.206
+83.54.45.5
  83.54.61.201
  83.55.0.232
-83.56.121.116
+83.58.222.6
  83.59.103.13
  83.6.146.196
  83.6.159.151
@@ -96056,12 +95524,10 @@
  83.69.93.64
  83.70.212.143
  83.78.237.223
-83.78.56.171
  83.81.29.140
  83.82.161.243
  83.82.82.199
  83.83.155.43
-83.84.211.169
  83.85.139.94
  83.85.29.35
  83.85.9.236
@@ -96073,12 +95539,12 @@
  83.97.108.65
  83.97.108.73
  83.97.111.202
-83.97.20.153
+83.97.20.106
  83.97.20.205
  83.97.20.29
  83.97.20.31
  83.97.20.34
-83.97.20.35
+83.97.20.89
  83.97.20.90
  83.97.20.99
  83.97.23.101
@@ -96088,10 +95554,10 @@
  83.99.168.149
  83.99.19.116
  83.99.245.20
+83.99.82.28
  83.99.83.187
-83.99.83.188
+83.99.83.195
  83.99.83.197
-83.99.92.108
  83010624-96-20190711114544.webstarterz.com
  8304153-89850-dot-bles05.wn.r.appspot.com
  8322344-dot-n-e-w-me-ss-age-po-rt-al.wl.r.appspot.com
@@ -96130,6 +95596,7 @@
  84.112.60.16
  84.113.144.10
  84.113.25.238
+84.114.111.75
  84.115.129.40
  84.115.136.45
  84.115.141.72
@@ -96141,38 +95608,37 @@
  84.121.129.167
  84.121.77.31
  84.122.212.34
-84.124.254.94
+84.124.50.123
  84.126.137.181
  84.126.71.50
  84.127.40.16
-84.130.34.18
-84.136.35.198
+84.136.30.78
  84.140.144.150
  84.140.220.92
  84.142.216.108
-84.142.216.59
+84.142.216.63
  84.145.76.125
+84.148.210.189
  84.15.106.3
  84.15.112.80
  84.15.143.111
  84.15.156.185
  84.15.160.174
-84.15.176.80
-84.15.176.85
  84.15.183.1
  84.15.209.197
+84.154.250.114
  84.16.235.129
-84.16.238.1
  84.16.248.172
  84.16.38.218
  84.16.46.130
-84.160.190.87
+84.160.190.232
  84.160.54.244
-84.160.57.219
+84.164.165.242
  84.164.182.63
+84.164.190.124
  84.164.199.10
-84.164.51.58
-84.166.209.134
+84.164.202.185
+84.166.208.216
  84.166.222.200
  84.168.119.158
  84.168.254.106
@@ -96180,26 +95646,29 @@
  84.17.35.52
  84.17.36.59
  84.17.39.163
-84.17.39.176
  84.17.39.180
+84.17.43.184
  84.17.46.179
  84.17.48.142
+84.17.48.17
  84.17.48.245
-84.17.48.97
  84.17.49.101
  84.17.49.11
  84.17.49.134
  84.17.49.17
+84.17.49.186
  84.17.49.191
  84.17.49.197
  84.17.49.199
  84.17.49.21
  84.17.49.244
+84.17.49.52
  84.17.49.83
+84.17.51.104
  84.17.51.109
-84.17.51.11
  84.17.51.112
  84.17.51.114
+84.17.51.125
  84.17.51.126
  84.17.51.139
  84.17.51.209
@@ -96208,45 +95677,41 @@
  84.17.51.32
  84.17.51.36
  84.17.51.40
-84.17.51.46
  84.17.51.47
  84.17.51.52
  84.17.51.53
  84.17.51.55
  84.17.51.6
+84.17.51.66
  84.17.51.72
  84.17.51.73
  84.17.51.76
-84.17.51.8
  84.17.51.82
  84.17.51.94
  84.17.54.71
  84.17.55.103
  84.17.55.105
-84.17.55.106
  84.17.55.22
+84.17.55.25
  84.17.55.3
  84.17.55.6
  84.17.56.135
  84.17.61.225
-84.171.146.47
  84.174.216.137
  84.174.99.105
  84.180.252.33
  84.181.31.179
  84.182.157.1
-84.185.255.13
+84.185.234.243
  84.185.59.173
-84.189.88.69
  84.19.170.249
  84.19.178.210
  84.19.188.216
+84.190.136.63
  84.190.140.233
-84.190.143.28
  84.192.145.209
  84.193.223.101
  84.194.55.181
-84.195.243.66
  84.197.198.167
  84.198.0.10
  84.198.45.125
@@ -96257,13 +95722,10 @@
  84.200.14.253
  84.200.206.82
  84.200.84.220
-84.201.156.17
  84.201.183.14
  84.201.183.15
  84.201.183.30
  84.201.183.31
-84.201.183.45
-84.201.183.46
  84.201.183.47
  84.201.183.62
  84.201.183.63
@@ -96273,24 +95735,25 @@
  84.202.24.106
  84.202.88.73
  84.203.101.19
+84.203.156.154
+84.203.156.168
  84.203.65.99
+84.203.99.243
  84.204.144.174
  84.204.40.154
  84.205.15.25
  84.205.47.232
-84.208.133.87
  84.208.214.250
  84.209.1.53
  84.209.139.0
-84.209.172.134
  84.209.31.168
  84.209.48.106
  84.209.60.46
  84.21.188.230
+84.21.191.132
  84.21.191.196
-84.21.191.233
+84.21.191.207
  84.21.31.229
-84.210.178.191
  84.212.145.24
  84.212.251.204
  84.213.12.57
@@ -96299,7 +95762,6 @@
  84.214.54.186
  84.216.51.36
  84.217.32.10
-84.217.5.100
  84.217.82.227
  84.22.114.15
  84.22.116.140
@@ -96341,7 +95803,6 @@
  84.236.8.137
  84.237.198.181
  84.237.7.249
-84.237.87.8
  84.239.39.142
  84.239.39.89
  84.240.26.123
@@ -96354,10 +95815,10 @@
  84.243.108.186
  84.244.104.14
  84.244.180.102
+84.244.34.208
  84.245.219.96
  84.246.200.122
  84.246.21.243
-84.246.211.224
  84.247.236.114
  84.247.48.12
  84.247.48.14
@@ -96366,16 +95827,16 @@
  84.247.48.60
  84.247.48.61
  84.247.50.180
-84.247.50.60
  84.247.51.123
-84.248.203.226
  84.25.47.230
  84.250.13.190
  84.252.95.214
  84.254.90.125
+84.255.139.127
  84.255.194.237
  84.255.203.218
  84.255.204.59
+84.255.222.150
  84.255.242.21
  84.255.244.61
  84.255.249.179
@@ -96390,6 +95851,7 @@
  84.33.119.102
  84.33.37.150
  84.33.39.233
+84.33.6.9
  84.38.134.198
  84.38.184.216
  84.38.185.214
@@ -96410,8 +95872,6 @@
  84.43.90.54
  84.45.121.135
  84.45.38.216
-84.46.160.237
-84.46.25.62
  84.47.226.66
  84.47.226.70
  84.51.0.195
@@ -96420,6 +95880,8 @@
  84.51.0.200
  84.51.133.104
  84.51.137.124
+84.51.194.38
+84.51.223.125
  84.51.33.98
  84.51.48.186
  84.51.56.123
@@ -96447,10 +95909,13 @@
  84.54.83.254
  84.55.70.80
  84.57.171.70
+84.6.122.99
  84.61.40.68
  84.62.72.233
  84.63.136.83
  84.63.171.4
+84.64.20.75
+84.65.191.220
  84.67.122.121
  84.69.165.177
  84.7.96.195
@@ -96462,21 +95927,19 @@
  84.74.119.202
  84.75.176.24
  84.75.253.40
-84.75.71.19
  84.77.56.14
  84.80.110.196
  84.80.143.197
-84.81.131.101
  84.84.200.130
  84.85.102.113
  84.85.15.179
  84.85.90.26
  84.91.143.99
+84.91.69.150
  84.92.24.249
  84.92.92.247
  84.93.31.10
  84.94.158.214
-84.94.225.232
  84.97.22.101
  840215.servicesbpd.club
  840e4d67.ngrok.io
@@ -96519,14 +95982,16 @@
  85.10.24.40
  85.10.248.121
  85.10.53.90
+85.100.105.146
  85.100.122.211
  85.100.149.218
+85.101.101.5
  85.101.118.60
  85.101.119.249
  85.102.76.165
+85.103.110.223
  85.104.59.244
  85.105.111.166
-85.105.125.66
  85.105.156.8
  85.105.2.42
  85.105.205.77
@@ -96543,6 +96008,7 @@
  85.106.8.102
  85.108.161.221
  85.108.198.6
+85.108.231.194
  85.109.127.48
  85.109.43.176
  85.109.58.210
@@ -96550,12 +96016,12 @@
  85.109.58.222
  85.109.82.114
  85.111.12.199
+85.111.52.8
  85.112.76.58
-85.113.129.7
+85.112.87.118
  85.113.136.32
  85.113.140.196
  85.113.38.197
-85.113.48.64
  85.113.91.205
  85.114.111.43
  85.114.132.48
@@ -96564,6 +96030,7 @@
  85.114.135.126
  85.114.140.127
  85.114.141.60
+85.114.221.74
  85.114.38.206
  85.114.96.154
  85.114.98.50
@@ -96581,15 +96048,17 @@
  85.118.105.20
  85.119.108.134
  85.119.154.60
+85.119.74.212
  85.119.80.219
  85.119.83.25
  85.12.15.41
  85.12.33.30
  85.125.194.114
+85.125.194.152
  85.125.194.18
  85.125.194.24
  85.125.194.83
-85.128.142.100
+85.128.142.56
  85.128.16.46
  85.128.16.47
  85.13.134.81
@@ -96604,15 +96073,15 @@
  85.133.143.35
  85.135.155.172
  85.135.95.218
-85.136.47.215
+85.138.158.77
  85.138.240.40
-85.139.12.89
  85.14.122.191
  85.14.243.31
  85.14.79.26
  85.140.32.180
  85.142.45.77
  85.143.166.200
+85.143.198.254
  85.143.210.193
  85.143.213.2
  85.143.214.43
@@ -96620,7 +96089,7 @@
  85.144.28.175
  85.146.16.131
  85.146.208.186
-85.146.244.180
+85.146.29.58
  85.148.168.20
  85.15.179.171
  85.15.179.235
@@ -96632,6 +96101,8 @@
  85.152.162.105
  85.152.174.56
  85.152.20.146
+85.154.144.217
+85.154.67.12
  85.154.80.190
  85.158.181.41
  85.159.178.172
@@ -96647,12 +96118,11 @@
  85.163.35.2
  85.163.53.75
  85.164.4.99
-85.165.101.248
  85.165.8.86
  85.166.127.166
+85.166.155.77
  85.166.85.106
  85.167.127.116
-85.168.117.191
  85.168.131.83
  85.17.111.125
  85.17.131.134
@@ -96671,7 +96141,6 @@
  85.17.90.143
  85.170.178.143
  85.170.233.95
-85.171.17.243
  85.171.52.251
  85.172.10.95
  85.172.107.1
@@ -96680,7 +96149,7 @@
  85.172.39.174
  85.172.98.94
  85.173.165.36
-85.173.205.205
+85.173.193.140
  85.174.115.183
  85.174.204.10
  85.175.101.19
@@ -96689,7 +96158,6 @@
  85.175.252.32
  85.175.4.251
  85.175.5.6
-85.175.97.16
  85.175.97.57
  85.175.99.105
  85.175.99.117
@@ -96713,10 +96181,10 @@
  85.190.2.205
  85.190.42.199
  85.191.214.236
+85.191.78.28
  85.192.167.69
  85.192.191.6
  85.193.135.111
-85.193.194.12
  85.194.238.131
  85.195.219.168
  85.195.222.234
@@ -96740,10 +96208,13 @@
  85.2.130.99
  85.2.221.241
  85.202.194.17
+85.202.195.191
  85.202.195.92
  85.202.229.205
  85.203.22.77
  85.203.34.3
+85.203.44.132
+85.203.44.135
  85.203.44.244
  85.203.44.25
  85.204.116.111
@@ -96764,29 +96235,31 @@
  85.206.57.202
  85.207.128.82
  85.207.13.169
-85.207.21.38
  85.208.109.193
  85.208.115.241
-85.208.115.39
  85.208.184.63
  85.208.185.212
  85.208.209.226
+85.208.209.35
  85.208.209.57
-85.208.209.63
-85.208.211.60
+85.208.209.92
  85.208.213.114
  85.208.22.162
  85.208.71.18
  85.208.71.20
  85.208.76.1
  85.208.76.2
+85.208.85.140
  85.208.85.203
+85.208.86.50
  85.208.87.186
  85.208.87.222
  85.208.87.84
  85.209.0.186
  85.209.129.22
-85.209.185.27
+85.209.150.11
+85.209.150.60
+85.209.151.204
  85.209.89.243
  85.21.200.26
  85.21.63.219
@@ -96805,6 +96278,7 @@
  85.214.158.15
  85.214.161.252
  85.214.166.228
+85.214.175.234
  85.214.185.51
  85.214.187.13
  85.214.20.76
@@ -96847,14 +96321,16 @@
  85.217.137.77
  85.217.170.105
  85.217.192.39
+85.217.227.82
  85.217.236.71
  85.220.85.26
+85.221.132.249
  85.222.17.110
  85.222.206.142
  85.222.69.218
  85.222.79.178
-85.223.157.204
  85.223.214.130
+85.224.11.35
  85.225.145.83
  85.226.123.6
  85.226.181.87
@@ -96863,7 +96339,6 @@
  85.228.216.200
  85.228.232.171
  85.228.41.27
-85.228.51.221
  85.23.154.79
  85.23.51.254bin.sh
  85.23.7.190
@@ -96871,13 +96346,12 @@
  85.233.132.6
  85.233.255.46
  85.234.117.151
-85.234.126.107
  85.234.143.94
  85.234.145.132
  85.235.190.138
+85.235.64.225
  85.235.66.147
  85.236.25.18
-85.237.200.113
  85.237.201.58
  85.237.38.22
  85.237.44.125
@@ -96887,6 +96361,7 @@
  85.237.88.12
  85.238.100.48
  85.238.101.59
+85.238.103.53
  85.238.104.235
  85.238.104.82
  85.238.106.106
@@ -96902,24 +96377,24 @@
  85.240.233.220
  85.241.106.203
  85.243.134.107
+85.244.32.146
+85.245.13.155
  85.245.145.254
  85.245.19.44
  85.245.204.149
  85.245.26.67
+85.245.66.209
  85.246.168.252
  85.246.78.192
  85.247.0.210
  85.247.109.182
  85.247.144.202
-85.247.23.199
  85.248.227.163
  85.248.227.164
  85.248.227.165
  85.248.6.41
  85.249.107.197
-85.249.161.67
-85.249.162.240
-85.249.171.252
+85.249.169.28
  85.249.42.77
  85.25.118.22
  85.25.138.55
@@ -96941,22 +96416,18 @@
  85.252.123.110
  85.254.72.26
  85.254.72.27
-85.26.197.210
  85.26.199.81
-85.26.235.221
-85.28.144.228
  85.29.147.222
+85.30.198.53
  85.30.215.48
  85.30.248.210
  85.31.112.191
-85.35.32.245
  85.38.164.51
-85.38.39.122
  85.45.123.232
  85.47.31.179
  85.5.155.94
  85.52.217.114
-85.56.116.122
+85.54.59.31
  85.58.120.201
  85.62.101.113
  85.66.107.100
@@ -96970,14 +96441,13 @@
  85.72.32.44
  85.73.62.160
  85.74.163.232
-85.74.167.209
  85.74.215.180
-85.74.28.151
  85.75.17.172
  85.75.227.67
+85.76.97.48
+85.84.202.75
  85.84.212.12
  85.85.240.246
-85.9.144.123
  85.9.66.15
  85.90.105.201
  85.90.135.220
@@ -96990,6 +96460,7 @@
  85.92.144.88
  85.92.164.179
  85.92.165.225
+85.92.178.111
  85.92.183.37
  85.92.183.97
  85.92.59.59
@@ -97006,8 +96477,6 @@
  85.93.20.91
  85.93.20.92
  85.93.218.204
-85.93.49.34
-85.94.122.26
  85.94.178.144
  85.94.201.138
  85.94.33.242
@@ -97054,9 +96523,9 @@
  86.101.155.237
  86.101.159.121
  86.101.224.233
+86.102.1.255
  86.102.176.148
  86.102.24.161
-86.102.27.123
  86.104.15.20
  86.104.18.51
  86.104.194.116
@@ -97081,6 +96550,7 @@
  86.105.183.242
  86.105.183.254
  86.105.183.36
+86.105.183.4
  86.105.183.62
  86.105.187.122
  86.105.227.148
@@ -97089,12 +96559,12 @@
  86.106.102.166
  86.106.131.150
  86.106.131.207
-86.106.137.150
  86.106.74.248
  86.106.74.249
  86.106.74.253
  86.106.74.254
  86.106.92.23
+86.108.13.103
  86.109.105.151
  86.109.165.202
  86.109.170.199
@@ -97109,29 +96579,28 @@
  86.111.144.10
  86.111.146.250
  86.111.88.138
-86.120.101.159
  86.120.157.254
+86.120.191.65
  86.120.79.84
  86.122.170.50
  86.123.188.209
-86.123.75.137
-86.124.202.79
+86.123.74.137
  86.124.230.115
+86.124.241.191
  86.124.249.9
  86.125.112.230
  86.125.162.105
  86.125.169.47
  86.125.205.28
  86.125.59.56
-86.127.141.84
+86.126.201.223
+86.127.142.171
  86.127.143.176
+86.127.145.255
  86.127.64.46
-86.128.131.204
  86.130.229.7
  86.131.168.226
-86.131.60.43
  86.132.208.148
-86.134.235.140
  86.135.222.202
  86.136.185.225
  86.137.132.80
@@ -97141,12 +96610,15 @@
  86.140.134.159
  86.140.218.131
  86.141.123.144
+86.141.21.247
  86.142.241.163
  86.143.124.228
  86.144.181.215
  86.145.179.255
+86.146.107.32
  86.146.28.244
  86.150.207.88
+86.154.66.112
  86.155.32.158
  86.159.154.192
  86.16.194.177
@@ -97159,17 +96631,20 @@
  86.169.186.53
  86.17.152.159
  86.17.17.216
+86.17.204.38
+86.17.27.65
  86.172.40.22
  86.173.62.115
  86.174.38.254
+86.175.106.14
  86.177.237.106
  86.178.199.96
  86.179.165.151
-86.180.177.27
  86.184.190.186
  86.185.154.182
  86.188.246.2
  86.188.250.209
+86.189.197.223
  86.19.105.25
  86.190.93.136
  86.191.100.254
@@ -97178,14 +96653,17 @@
  86.196.103.38
  86.200.83.221
  86.206.131.154
+86.209.173.212
  86.210.71.45
  86.22.221.170
  86.229.77.118
  86.23.210.63
  86.23.4.8
-86.237.3.61
+86.236.55.45
  86.238.129.40
  86.24.173.237
+86.24.188.35
+86.24.190.158
  86.243.78.95
  86.244.202.145
  86.250.160.150
@@ -97194,25 +96672,26 @@
  86.27.53.150
  86.28.106.203
  86.28.76.189
-86.3.13.115
  86.31.163.247
  86.31.177.60
  86.34.157.3
  86.38.10.57
+86.38.207.213
  86.40.162.231
-86.40.251.56
-86.40.50.195
+86.40.251.96
+86.41.233.132
  86.42.166.147
  86.42.190.155
+86.45.5.178
  86.47.252.137
  86.49.108.37
+86.49.227.69
  86.51.26.11
  86.52.44.102
  86.53.142.50
  86.57.132.71
  86.57.167.132
  86.57.181.122
-86.57.210.110
  86.57.216.191
  86.57.216.23
  86.57.237.53
@@ -97220,6 +96699,7 @@
  86.58.206.100
  86.58.32.180
  86.60.179.136
+86.60.205.226
  86.61.66.59
  86.62.120.68
  86.7.146.132
@@ -97228,18 +96708,19 @@
  86.83.88.212
  86.84.198.19
  86.87.32.31
+86.87.50.81
  86.87.72.98
  86.88.120.250
  86.89.210.69
  86.89.77.44
-86.9.60.239
  86.9.93.60
  86.90.134.145
+86.90.56.34
  86.92.137.53
+86.94.73.194
  86.95.8.249
  86.98.21.56
  86.98.72.177
-86.99.0.142
  86.99.17.120
  860259.com
  861365365.com
@@ -97266,8 +96747,8 @@
  86buortfa86.bankofamericaslpemr.com
  86g8ur.000webhostapp.com
  86mld.com
-87.0.232.93
  87.10.143.142
+87.10.167.148
  87.101.94.67
  87.103.120.250
  87.103.126.98
@@ -97278,6 +96759,7 @@
  87.103.196.236
  87.103.204.97
  87.103.245.190
+87.105.248.5
  87.106.108.154
  87.106.133.138
  87.106.136.215
@@ -97305,22 +96787,20 @@
  87.106.89.36
  87.106.94.225
  87.107.116.255
-87.107.165.191
  87.107.165.206
  87.107.165.64
-87.11.209.236
  87.11.240.80
+87.11.243.54
  87.110.181.30
  87.110.188.59
  87.110.60.124
  87.113.182.83
  87.116.144.36
  87.116.151.237
-87.116.162.67
+87.116.176.191
  87.116.181.141
  87.116.181.95
  87.116.191.105
-87.116.191.240
  87.117.1.169
  87.117.19.29
  87.117.194.22
@@ -97342,11 +96822,9 @@
  87.118.122.51
  87.118.126.150
  87.118.158.223
-87.118.177.207
  87.118.253.155
  87.118.92.43
  87.118.96.154
-87.119.119.105
  87.120.179.74
  87.120.246.53
  87.120.254.114
@@ -97365,12 +96843,15 @@
  87.121.77.67
  87.121.98.61
  87.122.122.30
-87.122.226.239
+87.122.127.5
+87.123.101.1
  87.123.108.47
  87.123.135.221
-87.123.166.163
-87.123.170.178
-87.123.237.229
+87.123.150.199
+87.123.157.62
+87.123.171.133
+87.123.171.228
+87.123.224.2
  87.123.35.155
  87.123.40.119
  87.123.43.130
@@ -97378,74 +96859,75 @@
  87.123.43.196
  87.123.44.111
  87.123.45.252
+87.123.69.111
  87.123.70.153
-87.123.70.2
  87.123.70.34
+87.123.70.9
  87.123.76.169
  87.123.78.188
  87.124.164.13
  87.124.164.14
  87.125.107.232
+87.125.147.232
  87.125.27.169
  87.125.42.222
  87.126.64.193
+87.133.107.67
  87.134.172.12
  87.138.108.161
  87.139.127.162
  87.139.46.114
+87.14.0.68
  87.14.191.42
  87.14.81.46
  87.140.46.98
  87.140.60.37
-87.142.206.185
+87.142.200.175
+87.142.206.103
  87.144.15.40
  87.145.160.9
-87.145.83.245
+87.145.211.13
+87.146.252.128
  87.146.254.112
-87.15.243.67
-87.150.49.127
+87.147.64.23
  87.150.52.39
  87.151.11.111
  87.154.207.55
  87.156.35.225
  87.156.36.52
+87.157.180.157
  87.157.254.120
-87.159.161.188
  87.159.56.53
+87.159.56.87
  87.16.185.127
  87.16.51.10
  87.16.72.110
  87.163.105.250
  87.165.80.143
-87.166.119.98
-87.166.25.251
  87.166.26.89
  87.166.35.73
-87.166.46.191
  87.169.126.200
  87.169.240.79
+87.17.102.219
  87.17.122.3
  87.17.164.169
  87.17.218.205
  87.170.179.202
-87.171.251.175
  87.171.253.166
+87.171.253.199
  87.172.228.92
-87.172.229.207
-87.173.196.55
+87.172.229.222
  87.173.23.180
  87.173.24.166
  87.173.27.50
  87.173.29.225
-87.175.80.209
-87.177.233.5
-87.177.234.13
+87.173.31.156
+87.173.6.2
+87.175.81.38
  87.178.170.216
-87.179.67.68
-87.179.69.40
-87.179.95.4
+87.179.65.173
+87.179.75.187
  87.180.254.178
-87.180.8.82
  87.181.191.66
  87.182.231.191
  87.184.100.184
@@ -97454,12 +96936,13 @@
  87.187.155.63
  87.187.159.136
  87.188.125.211
+87.189.169.201
  87.19.161.94
  87.193.48.235
  87.196.184.69
  87.197.137.223
  87.197.163.118
-87.2.214.182
+87.202.160.210
  87.204.102.195
  87.204.220.68
  87.204.52.10
@@ -97478,13 +96961,14 @@
  87.217.163.17
  87.218.156.4
  87.218.216.239
+87.219.85.126
  87.220.212.62
-87.221.123.93
  87.225.104.117
  87.225.106.195
  87.225.108.2
-87.225.85.107
+87.225.110.160
  87.225.89.93
+87.225.91.214
  87.226.165.143
  87.227.140.10
  87.228.211.216
@@ -97498,12 +96982,13 @@
  87.230.81.124
  87.231.27.92
  87.234.138.201
-87.236.212.22
  87.237.120.219
  87.237.234.187
  87.237.238.185
  87.240.13.77
+87.240.90.215
  87.241.1.186
+87.241.165.79
  87.241.249.59
  87.241.44.41
  87.241.56.181
@@ -97525,19 +97010,20 @@
  87.246.7.210
  87.246.7.226
  87.246.7.242
+87.246.7.35
  87.246.7.43
  87.246.7.48
+87.247.102.142
  87.247.19.126
  87.247.3.234
  87.248.1.12
  87.248.171.235
  87.248.182.115
  87.248.19.119
-87.249.217.57
-87.25.3.149
  87.251.228.114
  87.251.64.125
  87.251.7.114
+87.251.7.124
  87.251.7.154
  87.251.7.246
  87.251.7.35
@@ -97548,7 +97034,6 @@
  87.252.100.28
  87.252.183.184
  87.253.135.238
-87.253.81.220
  87.254.138.170
  87.255.13.217
  87.255.193.50
@@ -97563,30 +97048,26 @@
  87.49.45.61
  87.62.100.86
  87.63.126.70
-87.64.166.201
  87.65.203.65
-87.75.104.165
+87.7.162.215
  87.75.105.186
-87.75.96.241
  87.76.11.57
  87.76.34.134
  87.76.34.63
  87.76.35.147
  87.76.35.157
  87.76.35.22
-87.76.35.250
  87.76.35.59
  87.78.7.183
  87.79.184.155
  87.79.254.225
  87.79.94.221
-87.8.109.102
  87.8.167.188
-87.8.31.186
  87.81.219.92
  87.95.250.140
  87.97.155.156
  87.97.19.91
+87.97.84.110
  87.98.143.87
  87.98.152.173
  87.98.156.62
@@ -97596,6 +97077,7 @@
  87.98.177.115
  87.98.178.115
  87.98.182.93
+87.98.217.8
  87.98.219.157
  87.98.222.18
  87.98.222.207
@@ -97645,7 +97127,6 @@
  87n3t-m3m50.com
  88-99-124-139.cprapid.com
  88.0.255.136
-88.1.116.156
  88.10.126.6
  88.100.162.153
  88.102.13.246
@@ -97654,6 +97135,7 @@
  88.114.100.214
  88.115.110.150
  88.115.212.192
+88.117.59.0
  88.118.131.30
  88.119.128.181
  88.119.17.56
@@ -97669,30 +97151,34 @@
  88.120.105.119
  88.121.22.235
  88.122.140.238
+88.123.71.214
  88.125.47.131
  88.129.235.44
  88.129.253.94
  88.129.28.55
+88.129.82.123
  88.13.122.249
  88.13.202.187
  88.13.9.239
-88.130.134.80
  88.130.220.168
-88.130.70.230
  88.132.194.239bin.sh
  88.132.217.184
  88.132.66.26
+88.134.106.177
  88.134.143.96
  88.134.149.7
  88.134.51.48
  88.135.210.179
  88.135.39.143
+88.135.40.111
  88.135.40.112
  88.135.40.187
+88.135.40.206
  88.135.40.246
  88.135.40.52
  88.135.40.85
  88.135.41.28
+88.135.42.114
  88.135.42.150
  88.135.42.158
  88.135.42.202
@@ -97713,6 +97199,7 @@
  88.146.204.49
  88.146.252.142
  88.147.142.103
+88.147.152.169
  88.147.173.157
  88.147.174.128
  88.147.174.19
@@ -97738,19 +97225,17 @@
  88.151.140.190
  88.151.243.106
  88.151.255.107
-88.151.75.42
-88.151.93.83
  88.151.99.87
  88.153.216.102
  88.153.35.32
  88.156.109.134
+88.156.133.128
  88.156.97.210
  88.157.229.58
+88.157.90.221
  88.159.128.67
  88.159.132.102
  88.162.54.93
-88.163.105.128
-88.163.173.196
  88.165.81.34
  88.17.88.100
  88.18.188.158
@@ -97779,7 +97264,6 @@
  88.191.83.36
  88.191.89.65
  88.191.94.188
-88.192.44.9
  88.198.109.4
  88.198.151.153
  88.198.16.108
@@ -97814,7 +97298,6 @@
  88.198.59.60
  88.198.91.74
  88.198.92.47
-88.199.115.25
  88.199.21.75
  88.199.42.178
  88.199.82.114
@@ -97823,6 +97306,7 @@
  88.2.219.179
  88.201.141.106
  88.201.143.117
+88.201.184.72
  88.201.242.91
  88.201.36.180
  88.202.177.242
@@ -97831,11 +97315,9 @@
  88.202.224.162
  88.202.230.221
  88.203.203.150
-88.203.218.39
  88.204.158.106
-88.204.216.142
-88.207.127.83
-88.207.61.193
+88.204.193.53
+88.207.127.244
  88.208.205.79
  88.208.220.105
  88.208.228.139
@@ -97856,12 +97338,11 @@
  88.214.11.71
  88.214.24.92
  88.214.57.95
-88.215.177.224
  88.215.2.29
  88.216.6.222
  88.217.113.112
  88.217.116.220
-88.217.120.255
+88.217.127.186
  88.217.172.165
  88.217.181.215
  88.217.45.138
@@ -97883,27 +97364,30 @@
  88.218.17.222
  88.218.17.223
  88.218.17.232
+88.218.17.24
  88.218.227.162
  88.218.65.124
  88.218.65.143
  88.218.65.162
  88.218.65.225
-88.218.67.120
+88.218.67.109
+88.218.67.146
  88.218.67.79
  88.218.92.124
  88.220.179.195
  88.220.43.198
  88.226.96.242
  88.227.171.93
-88.230.155.181
+88.230.157.187
+88.230.170.193
  88.231.61.203
  88.233.35.229
-88.233.66.184
  88.236.163.250
  88.236.187.82
-88.236.70.190
-88.238.89.33
-88.246.214.212
+88.236.65.28
+88.242.195.175
+88.246.78.46
+88.247.116.144
  88.247.138.7
  88.247.143.224
  88.247.151.51
@@ -97912,8 +97396,10 @@
  88.247.194.52
  88.247.212.56
  88.247.31.189
+88.247.89.72
  88.247.9.171
  88.247.93.137
+88.248.186.196
  88.248.23.216
  88.248.55.136
  88.249.118.13
@@ -97921,10 +97407,8 @@
  88.249.125.146
  88.249.181.198
  88.249.244.180
-88.25.153.3
  88.250.210.8
  88.250.223.190
-88.252.134.66
  88.252.242.152
  88.255.102.114
  88.255.102.119
@@ -97940,33 +97424,30 @@
  88.255.12.66
  88.255.132.179
  88.255.182.170
+88.255.185.236
  88.255.185.243
  88.255.217.102
  88.255.217.166
  88.255.236.5
  88.255.35.146
-88.255.36.37
+88.255.36.50
  88.255.95.25
  88.255.95.26
  88.26.151.85
  88.26.174.12
  88.26.181.16
  88.26.202.180
-88.26.234.59
  88.26.34.89
  88.27.20.192
-88.28.32.116
  88.36.135.138
  88.39.235.66
-88.4.81.198
  88.5.20.125
-88.57.55.218
  88.58.209.2
  88.69.34.83
  88.7.137.57
  88.7.198.4
+88.70.180.213
  88.71.172.62
-88.71.174.33
  88.72.175.175
  88.73.13.238
  88.78.137.199
@@ -97977,31 +97458,28 @@
  88.80.20.35
  88.80.20.86
  88.80.21.143
-88.80.21.164
  88.82.181.44
+88.82.95.146
  88.84.212.14
-88.84.222.252
  88.84.223.251
  88.85.97.150
  88.86.125.50
  88.86.241.192
  88.86.243.241
-88.87.69.242
  88.87.72.134
  88.87.72.72
  88.87.74.87
  88.87.84.17
  88.87.85.103
+88.88.105.184
  88.88.130.173
  88.89.52.144
  88.9.178.174
-88.91.13.191
-88.95.178.241
+88.98.232.53
  88.98.235.134
  88.98.237.182
  88.98.240.31
  88.98.88.158
-88.99.10.254
  88.99.104.135
  88.99.109.66
  88.99.115.156
@@ -98021,6 +97499,7 @@
  88.99.38.113
  88.99.4.50
  88.99.61.123
+88.99.74.138
  88.99.80.123
  88.99.81.114
  88.99.82.23
@@ -98079,7 +97558,9 @@
  89.105.202.74
  89.106.101.247
  89.106.101.247bin.sh
+89.106.109.230
  89.106.251.163
+89.107.197.118
  89.108.111.39
  89.108.118.7
  89.108.119.5
@@ -98094,11 +97575,11 @@
  89.108.66.251
  89.108.67.182
  89.108.73.84
+89.108.79.86
  89.108.84.112
+89.109.151.25
  89.109.239.183
  89.109.35.231
-89.111.104.2
-89.111.105.101
  89.111.132.132
  89.111.132.208
  89.111.132.97
@@ -98112,15 +97593,13 @@
  89.114.237.38
  89.115.120.43
  89.115.22.34
-89.12.119.168
  89.12.252.109
  89.120.146.186
  89.120.156.28
  89.120.17.179
-89.122.186.71
  89.123.12.95
+89.129.175.132
  89.130.250.155
-89.130.56.159
  89.132.116.240
  89.132.118.246
  89.132.175.246
@@ -98130,11 +97609,11 @@
  89.133.161.153
  89.133.180.150
  89.133.180.22
-89.133.242.58
  89.133.68.65
  89.133.95.177
  89.134.144.41
  89.134.239.7
+89.134.55.180
  89.134.85.129
  89.135.1.16
  89.135.150.137
@@ -98144,8 +97623,6 @@
  89.137.11.41
  89.137.246.181
  89.14.222.246
-89.14.79.102
-89.14.9.231
  89.141.67.231
  89.142.131.74
  89.142.77.30
@@ -98168,13 +97645,15 @@
  89.144.47.28
  89.149.12.188
  89.149.235.45
-89.149.9.69
+89.149.84.39
  89.151.135.90
  89.151.83.58
  89.153.123.100
  89.155.11.229
  89.155.192.121
+89.155.255.133
  89.155.39.33
+89.156.86.8
  89.157.40.103
  89.158.32.44
  89.158.62.170
@@ -98182,7 +97661,6 @@
  89.16.103.241
  89.160.49.80
  89.161.130.94
-89.161.96.188
  89.163.129.92
  89.163.132.40
  89.163.139.209
@@ -98193,8 +97671,8 @@
  89.163.151.181
  89.163.151.68
  89.163.155.202
-89.163.157.3
  89.163.206.19
+89.163.209.238
  89.163.209.26
  89.163.224.112
  89.163.224.143
@@ -98209,14 +97687,12 @@
  89.163.251.200
  89.163.251.59
  89.163.255.78
-89.164.145.83
  89.164.225.197
  89.165.156.229
  89.165.70.69
-89.166.152.123
-89.166.152.69
-89.166.156.23
-89.166.158.93
+89.166.152.97
+89.166.153.253
+89.166.154.22
  89.166.47.198
  89.169.14.19
  89.17.51.234
@@ -98234,11 +97710,14 @@
  89.176.190.207
  89.179.126.155
  89.179.244.69
+89.179.3.76
  89.179.41.211
  89.18.136.217
  89.18.168.135
  89.18.27.192
  89.182.122.246
+89.182.143.117
+89.182.92.29
  89.184.152.198
  89.184.74.45
  89.184.82.86
@@ -98255,11 +97734,9 @@
  89.187.168.145
  89.187.168.148
  89.187.168.162
-89.187.168.164
  89.187.168.170
  89.187.168.174
  89.187.168.177
-89.187.168.183
  89.187.177.100
  89.187.177.102
  89.187.177.103
@@ -98277,50 +97754,45 @@
  89.187.177.97
  89.187.177.98
  89.187.201.70
-89.187.86.97
+89.188.110.196
  89.188.117.71
  89.188.124.145
  89.189.172.88
  89.189.174.121
+89.189.181.161
  89.189.191.51
  89.189.222.150
  89.189.223.236
-89.189.53.103
  89.19.175.117
  89.19.199.152
  89.19.20.202
  89.19.7.152
  89.190.120.116
-89.190.156.38
  89.190.165.4
  89.190.19.162
  89.191.228.105
-89.191.229.35
+89.199.139.32
  89.2.68.144
+89.20.102.147
  89.20.135.204
  89.200.137.67
  89.201.145.59
  89.201.184.35
  89.201.192.104
  89.201.192.62
-89.201.192.64
+89.201.192.67
  89.201.193.116
  89.201.193.119
  89.201.193.192
-89.201.193.196
  89.201.193.201
  89.201.193.61
  89.201.194.132
  89.201.194.156
-89.201.194.158
  89.201.194.178
-89.201.194.2
-89.201.194.59
  89.201.195.10
-89.201.195.129
+89.201.195.120
  89.201.195.154
  89.201.195.202
-89.201.195.91
  89.202.127.4
  89.204.135.175
  89.205.35.133
@@ -98336,6 +97808,7 @@
  89.211.223.6
  89.212.160.214
  89.212.202.200
+89.212.240.129
  89.212.9.96
  89.212.90.179
  89.216.102.123
@@ -98352,6 +97825,7 @@
  89.218.5.108
  89.218.5.110
  89.218.72.51
+89.219.16.110
  89.219.16.149
  89.22.17.62
  89.22.187.111
@@ -98364,9 +97838,6 @@
  89.221.250.23
  89.221.250.9
  89.222.132.31
-89.223.122.166
-89.223.122.215
-89.223.122.236
  89.223.24.86
  89.223.31.237
  89.223.47.219
@@ -98379,7 +97850,6 @@
  89.23.196.60
  89.23.198.165
  89.23.230.189
-89.230.204.161
  89.230.96.42
  89.231.32.193
  89.231.66.155
@@ -98399,7 +97869,6 @@
  89.236.112.100
  89.236.17.108
  89.236.239.25
-89.237.109.148
  89.237.113.144
  89.237.32.129
  89.237.32.161
@@ -98441,21 +97910,19 @@
  89.239.65.140
  89.239.99.102
  89.24.119.126
-89.24.13.101
  89.24.221.82
  89.24.76.185
  89.242.110.185
-89.244.167.203
-89.244.230.146
+89.244.121.246
  89.244.234.194
-89.244.77.190
-89.245.242.47
-89.245.246.180
+89.244.236.255
+89.245.243.194
  89.245.254.132
  89.245.32.65
+89.245.36.129
  89.245.80.144
  89.245.81.230
-89.245.82.119
+89.245.81.92
  89.245.84.117
  89.245.86.160
  89.245.87.119
@@ -98463,31 +97930,27 @@
  89.246.117.21
  89.246.118.57
  89.246.119.203
-89.246.56.104
  89.247.10.75
  89.247.127.135
-89.247.127.203
+89.247.153.102
+89.247.34.129
  89.247.34.21
  89.247.41.6
-89.247.7.228
  89.248.111.164
  89.248.159.202
  89.248.160.132
-89.248.160.135
  89.248.160.192
  89.248.160.215
  89.248.160.217
  89.248.162.170
  89.248.162.217
  89.248.163.3
-89.248.165.109
  89.248.165.44
-89.248.165.45
-89.248.165.59
  89.248.165.70
  89.248.166.183
  89.248.167.131
  89.248.167.133
+89.248.168.112
  89.248.168.140
  89.248.168.171
  89.248.168.188
@@ -98495,7 +97958,6 @@
  89.248.168.240
  89.248.168.29
  89.248.169.103
-89.248.169.12
  89.248.170.232
  89.248.171.137
  89.248.171.139
@@ -98529,9 +97991,9 @@
  89.249.67.57
  89.249.73.162
  89.25.21.170
+89.25.21.36
  89.25.23.210
  89.25.23.212
-89.25.79.164
  89.250.148.154
  89.250.149.114
  89.250.19.173
@@ -98542,7 +98004,6 @@
  89.252.19.66
  89.252.191.187
  89.252.40.18
-89.253.160.222
  89.253.225.14
  89.253.247.144
  89.255.60.4
@@ -98560,6 +98021,8 @@
  89.29.100.217
  89.29.100.240
  89.29.213.33
+89.29.222.252
+89.3.26.46
  89.30.96.166
  89.31.126.216
  89.31.140.14
@@ -98571,6 +98034,8 @@
  89.32.227.230
  89.32.249.21
  89.32.41.79
+89.33.192.191
+89.33.193.162
  89.33.25.104
  89.33.40.70
  89.33.64.134
@@ -98589,6 +98054,7 @@
  89.34.27.57
  89.34.96.63
  89.35.178.108
+89.35.230.130
  89.35.249.105
  89.35.249.139
  89.35.249.167
@@ -98597,6 +98063,7 @@
  89.35.249.212
  89.35.249.25
  89.35.249.67
+89.35.250.199
  89.35.30.21
  89.35.30.65
  89.35.31.171
@@ -98607,14 +98074,12 @@
  89.35.62.96
  89.36.133.62
  89.36.175.10
-89.36.195.238
  89.36.212.129
  89.36.212.17
  89.36.213.13
  89.36.213.45
  89.36.213.79
  89.36.221.124
-89.36.224.10
  89.36.224.11
  89.36.224.2
  89.36.224.25
@@ -98623,7 +98088,7 @@
  89.37.122.216
  89.37.192.194
  89.37.193.44
-89.37.66.210
+89.37.66.141
  89.38.11.16
  89.38.150.129
  89.38.150.159
@@ -98641,7 +98106,6 @@
  89.39.106.94
  89.39.108.202
  89.39.174.13
-89.39.3.12
  89.40.113.141
  89.40.113.161
  89.40.114.11
@@ -98673,7 +98137,6 @@
  89.44.10.56
  89.44.103.58
  89.44.205.133
-89.44.205.137
  89.44.205.149
  89.44.205.161
  89.44.205.228
@@ -98692,25 +98155,11 @@
  89.45.94.188
  89.46.100.105
  89.46.100.144
-89.46.102.116
-89.46.105.144
-89.46.105.166
+89.46.104.181
  89.46.105.182
  89.46.105.196
  89.46.105.197
-89.46.105.229
-89.46.105.235
-89.46.106.231
-89.46.107.138
  89.46.108.165
-89.46.108.248
-89.46.109.194
-89.46.109.212
-89.46.109.223
-89.46.109.238
-89.46.109.246
-89.46.109.247
-89.46.110.212
  89.46.204.81
  89.46.82.5
  89.46.86.183
@@ -98720,14 +98169,15 @@
  89.56.21.82
  89.6.82.164
  89.64.39.142
+89.64.42.20
  89.65.244.169
+89.65.52.189
  89.67.0.87
  89.67.124.35
  89.69.179.180
  89.69.254.27
-89.7.67.223
+89.7.203.104
  89.7.91.132
-89.70.79.108
  89.70.85.189
  89.72.212.205
  89.74.28.203
@@ -98736,7 +98186,6 @@
  89.79.48.213
  89.87.240.160
  89.88.186.164
-89.95.83.154
  89.96.255.77
  89.97.218.142
  89.98.241.10
@@ -98846,6 +98295,7 @@
  8zbuofa8z.bankofamericaslpemr.com
  9-29.com
  9-35.xyz
+90.1.175.166
  90.104.116.167
  90.110.30.206
  90.116.132.248
@@ -98854,12 +98304,10 @@
  90.126.42.245
  90.127.249.192
  90.128.49.247
-90.142.55.243
  90.146.153.21
  90.146.16.34
  90.146.219.186
  90.15.95.81
-90.150.180.66
  90.150.52.45
  90.150.87.79
  90.150.90.231
@@ -98870,7 +98318,6 @@
  90.154.108.68
  90.154.108.70
  90.155.167.227
-90.156.141.32
  90.156.153.161
  90.156.196.18
  90.156.99.180
@@ -98879,8 +98326,6 @@
  90.157.197.48
  90.157.222.183
  90.160.138.175
-90.160.140.35
-90.160.146.165
  90.162.115.79
  90.168.34.174
  90.168.34.229
@@ -98896,6 +98341,7 @@
  90.183.152.178
  90.183.158.50
  90.185.249.111
+90.187.60.105
  90.187.75.113
  90.188.10.59
  90.188.115.210
@@ -98903,7 +98349,6 @@
  90.188.236.43
  90.188.255.142
  90.188.35.190
-90.189.116.152
  90.189.143.94
  90.189.165.213
  90.189.167.93
@@ -98912,13 +98357,15 @@
  90.190.170.200
  90.190.222.229
  90.190.253.254
-90.200.46.79
+90.192.223.233
  90.204.41.78
  90.205.189.200
+90.206.183.200
  90.208.97.104
  90.212.255.173
  90.217.58.1
  90.220.213.10
+90.224.117.204
  90.224.203.97
  90.224.222.108
  90.224.222.108bin.sh
@@ -98927,37 +98374,36 @@
  90.226.40.204
  90.227.1.125
  90.227.130.6
+90.231.12.142
+90.232.88.43
  90.242.109.39
+90.246.222.207
+90.249.69.86
  90.251.238.108
  90.253.77.156
  90.27.153.190
  90.3.50.161
  90.34.246.35
-90.43.10.44
  90.43.10.95
  90.45.66.58
  90.46.38.235
-90.48.24.168
+90.48.206.196
  90.49.118.54
-90.49.136.166
  90.49.95.3
  90.49.99.61
  90.50.246.32
  90.51.18.170
  90.51.20.22
+90.59.251.209
  90.71.38.63
-90.73.37.62
  90.74.52.246
  90.76.107.69
  90.76.65.9
  90.78.229.103
-90.78.53.137
  90.84.242.139
  90.84.89.54
  90.88.229.233
  90.90.51.29
-90.91.90.103
-90.95.163.208
  900800.com
  900990099009kk.000webhostapp.com
  900emtrtme00.com
@@ -98984,11 +98430,10 @@
  90a6903b-75ff-445e-893e-c69d2807dd96.htmlcomponentservice.com
  90f4uopj34.win
  90secondwebsitebuilder.com
+91.1.17.211
  91.1.29.86
-91.1.30.211
  91.102.117.212
  91.102.155.145
-91.102.155.155
  91.102.200.88
  91.102.224.50
  91.102.228.142
@@ -99003,17 +98448,15 @@
  91.105.152.168
  91.105.94.200
  91.106.131.90
+91.106.17.242
  91.106.188.229
  91.106.193.72
  91.106.199.101
+91.106.24.166
  91.107.26.202
-91.108.136.17
-91.108.137.150
-91.108.137.208
+91.107.6.115
  91.108.145.139
-91.108.145.42
  91.108.156.207
-91.108.156.50
  91.108.177.51
  91.108.178.222
  91.108.178.229
@@ -99022,10 +98465,8 @@
  91.109.26.72
  91.109.3.188
  91.109.5.170
-91.11.92.197
  91.11.93.249
  91.117.13.201
-91.117.196.148
  91.117.31.181
  91.120.21.66
  91.120.21.93
@@ -99035,7 +98476,6 @@
  91.120.7.237
  91.121.0.159
  91.121.101.78
-91.121.102.42
  91.121.104.181
  91.121.105.125
  91.121.106.15
@@ -99054,10 +98494,9 @@
  91.121.116.107
  91.121.118.201
  91.121.121.95
-91.121.122.180
  91.121.133.13
+91.121.133.162
  91.121.133.211
-91.121.134.201
  91.121.14.107
  91.121.141.219
  91.121.142.210
@@ -99101,6 +98540,7 @@
  91.121.211.59
  91.121.221.15
  91.121.221.92
+91.121.222.79
  91.121.232.214
  91.121.236.219
  91.121.242.107
@@ -99111,6 +98551,7 @@
  91.121.30.96
  91.121.31.95
  91.121.33.63
+91.121.44.10
  91.121.48.78
  91.121.5.216
  91.121.54.71
@@ -99190,17 +98631,20 @@
  91.134.177.139
  91.134.179.197
  91.134.180.0
+91.134.188.114
  91.134.201.164
  91.134.201.59
  91.134.207.16
  91.134.209.116
  91.134.221.168
  91.134.231.96
+91.134.238.153
  91.134.240.130
  91.134.242.199
  91.134.242.66
  91.134.248.230
  91.134.248.235
+91.134.248.249
  91.134.248.253
  91.134.252.221
  91.134.27.252
@@ -99215,6 +98659,7 @@
  91.138.184.109
  91.139.1.158
  91.139.140.18
+91.14.38.176
  91.142.174.224
  91.142.209.68
  91.143.46.78
@@ -99236,20 +98681,21 @@
  91.149.139.198
  91.149.157.145
  91.149.225.120
-91.149.235.106
+91.149.231.64
  91.15.75.156
  91.15.75.77
  91.15.76.169
  91.15.77.108
  91.15.77.182
  91.15.79.196
+91.150.126.74
  91.150.189.122
  91.150.75.64
  91.150.77.57
  91.150.77.58
  91.152.120.228
  91.152.8.173
-91.154.161.81
+91.154.62.196
  91.155.2.97
  91.155.25.9
  91.159.105.216
@@ -99259,13 +98705,13 @@
  91.168.145.151
  91.169.100.84
  91.17.173.153
-91.17.175.187
+91.172.213.137
  91.173.12.250
  91.173.207.5
-91.174.162.196
  91.176.123.228
  91.178.92.151
  91.18.240.161
+91.180.81.15
  91.181.235.31
  91.183.149.230
  91.183.53.241
@@ -99276,27 +98722,38 @@
  91.185.236.239
  91.185.236.24
  91.185.33.14
+91.185.54.13
  91.185.57.219
-91.185.57.90
+91.186.251.169
  91.186.8.91
  91.186.9.53
  91.186.9.54
  91.187.113.205
+91.187.51.2
  91.187.80.246
-91.187.89.18
  91.188.124.225
  91.188.124.232
  91.188.240.235
  91.188.244.204
  91.188.247.133
  91.189.123.230
-91.189.141.116
  91.189.181.22
  91.189.187.49
  91.189.201.70
  91.191.173.120
-91.191.190.110
+91.191.209.74
+91.191.209.82
+91.191.209.83
+91.191.209.85
+91.191.209.86
+91.191.209.87
+91.191.209.88
+91.191.209.89
+91.191.209.90
+91.191.209.91
+91.191.209.92
  91.191.250.142
+91.192.0.250
  91.192.103.10
  91.192.103.11
  91.192.103.15
@@ -99316,7 +98773,6 @@
  91.192.103.9
  91.192.110.40
  91.192.135.69
-91.192.136.43
  91.192.195.131
  91.192.2.168
  91.192.20.164
@@ -99332,6 +98788,7 @@
  91.193.237.116
  91.193.252.112
  91.193.252.250
+91.193.253.188
  91.193.253.248
  91.193.4.136
  91.193.7.19
@@ -99352,10 +98809,13 @@
  91.197.135.132
  91.197.135.17
  91.197.145.90
+91.197.234.184
  91.197.234.187
+91.197.235.171
  91.198.220.225
+91.2.173.53
  91.20.180.231
-91.20.184.227
+91.20.189.246
  91.200.114.243
  91.200.12.58
  91.200.12.76
@@ -99364,8 +98824,8 @@
  91.200.13.64
  91.200.14.73
  91.201.240.101
+91.201.246.220
  91.202.109.11
-91.202.240.208
  91.203.114.71
  91.203.136.162
  91.203.145.116
@@ -99386,7 +98846,6 @@
  91.204.14.236
  91.204.149.250
  91.204.149.5
-91.204.153.138
  91.204.163.19
  91.204.99.178
  91.205.123.185
@@ -99411,7 +98870,6 @@
  91.205.241.86
  91.205.48.100
  91.205.48.101
-91.205.72.182
  91.206.110.190
  91.206.14.30
  91.206.148.243
@@ -99420,6 +98878,7 @@
  91.207.102.152
  91.207.102.153
  91.207.102.157
+91.207.147.243
  91.207.172.115
  91.207.238.107
  91.207.5.102
@@ -99468,6 +98927,7 @@
  91.213.119.246
  91.213.197.15
  91.213.46.214
+91.214.128.243
  91.214.130.253
  91.214.179.39
  91.214.202.24
@@ -99479,6 +98939,7 @@
  91.215.216.13
  91.215.232.33
  91.215.25.103
+91.215.79.23
  91.215.91.254
  91.216.149.28
  91.216.164.251
@@ -99501,9 +98962,11 @@
  91.216.93.196
  91.216.93.71
  91.217.202.174
+91.217.42.2
  91.217.42.3
  91.217.76.111
  91.217.82.148
+91.218.112.91
  91.218.114.4
  91.218.114.79
  91.218.160.153
@@ -99518,26 +98981,30 @@
  91.219.29.55
  91.219.61.224
  91.219.88.121
+91.22.68.220
+91.22.69.104
+91.22.70.244
  91.22.70.71
  91.22.72.140
+91.22.73.9
  91.221.108.181
  91.221.108.182
  91.221.252.18
  91.221.70.248
  91.222.128.59
  91.222.171.246
+91.222.236.95
  91.222.239.179
-91.222.239.213
-91.222.239.218
+91.222.239.75
  91.222.92.128
  91.223.136.228
  91.223.212.208
  91.223.32.102
  91.224.20.71
+91.224.23.226
  91.224.59.14
  91.224.92.155
  91.224.92.205
-91.224.97.38
  91.224.98.206
  91.225.190.77
  91.225.208.83
@@ -99545,7 +99012,6 @@
  91.225.208.85
  91.225.208.87
  91.225.8.128
-91.226.106.181
  91.226.192.8
  91.226.212.131
  91.226.212.218
@@ -99553,12 +99019,10 @@
  91.226.45.66
  91.226.5.245
  91.227.122.167
-91.227.16.12
  91.227.182.254
  91.227.220.149
  91.227.220.154
  91.228.118.251
-91.228.147.55
  91.228.155.97
  91.228.213.43
  91.228.8.162
@@ -99573,10 +99037,12 @@
  91.230.25.200
  91.231.127.89
  91.231.213.51
+91.231.247.15
  91.231.70.61
  91.232.105.116
  91.232.105.180
  91.232.4.149
+91.233.170.13
  91.233.197.70
  91.233.250.106
  91.233.43.165
@@ -99603,16 +99069,11 @@
  91.235.143.184
  91.235.143.197
  91.235.178.161
-91.235.230.225
  91.235.237.17
  91.235.244.205
-91.235.69.191
-91.236.116.14
  91.236.12.128
  91.236.12.179
-91.236.12.203
  91.236.141.219
-91.236.172.19
  91.236.7.126
  91.236.74.121
  91.237.121.11
@@ -99623,20 +99084,22 @@
  91.237.161.87
  91.237.200.127
  91.237.248.40
-91.237.41.134
  91.237.69.17
  91.237.77.5
  91.238.134.99
  91.238.161.3
+91.238.166.136
  91.238.223.41
  91.238.244.37
  91.238.248.206
  91.238.255.71
+91.239.136.166
  91.239.18.172
  91.239.69.182
  91.240.54.254
  91.240.97.69
  91.241.131.179
+91.241.135.44
  91.241.19.107
  91.241.19.159
  91.241.19.223
@@ -99649,8 +99112,6 @@
  91.243.101.240
  91.243.101.98
  91.243.175.249
-91.243.188.166
-91.243.188.227
  91.243.200.26
  91.243.45.153
  91.243.45.39
@@ -99662,9 +99123,10 @@
  91.244.217.177
  91.244.253.66
  91.244.73.243
+91.245.204.132
+91.245.30.158
  91.245.34.95
  91.245.37.125
-91.246.209.139
  91.246.213.100
  91.246.213.104
  91.246.74.202
@@ -99674,24 +99136,27 @@
  91.250.6.108
  91.250.83.53
  91.3.169.52
-91.3.171.98
  91.3.72.238
-91.3.74.53
+91.3.74.51
  91.33.30.110
+91.35.18.168
+91.36.249.119
  91.37.223.62
  91.39.178.78
+91.42.200.47
  91.44.225.23
  91.46.219.36
  91.46.47.216
  91.5.126.198
-91.53.111.220
+91.50.247.237
  91.58.106.203
  91.58.129.44
+91.59.153.82
  91.61.51.156
-91.62.255.148
  91.64.35.46
  91.64.78.4
  91.64.86.56
+91.64.88.28
  91.65.157.200
  91.65.70.241
  91.66.80.50
@@ -99701,6 +99166,7 @@
  91.73.131.254
  91.73.197.90
  91.74.129.82
+91.75.14.125
  91.75.75.46
  91.77.130.235
  91.77.162.117
@@ -99709,31 +99175,34 @@
  91.78.79.250
  91.78.93.101
  91.78.94.46
+91.80.142.191
  91.82.40.118
  91.82.41.200
  91.82.42.2
  91.82.46.25
  91.82.48.87
+91.83.163.16
  91.83.227.153
  91.83.227.189
-91.83.227.249
+91.83.227.241
  91.83.227.62
  91.83.227.89
+91.83.92.27
  91.83.93.103
  91.83.93.105
  91.83.93.124
  91.86.183.31
  91.87.123.173
  91.87.96.138
-91.90.121.232
+91.89.125.223
  91.90.123.101
+91.90.123.12
  91.90.210.104
  91.90.237.243
  91.90.36.174
  91.90.88.5
  91.92.109.43
  91.92.115.210
-91.92.132.18
  91.92.144.166
  91.92.180.45
  91.92.191.134
@@ -99747,14 +99216,14 @@
  91.93.127.34
  91.93.132.210
  91.93.140.179
-91.93.163.188
+91.93.163.189
  91.93.163.190
  91.93.3.85
+91.93.63.187
  91.93.69.211
  91.93.73.148
  91.93.97.106
-91.96.226.242
-91.96.242.16
+91.96.168.12
  91.97.37.71
  91.98.108.189
  91.98.132.189
@@ -99771,7 +99240,6 @@
  91.98.59.117
  91.98.6.127
  91.98.63.7
-91.98.64.222
  91.98.96.76
  910-365.com
  91131994de4.xyz
@@ -99809,39 +99277,47 @@
  91ruitue.com
  91yudao.com
  92-help.com
+92.10.178.173
  92.100.156.249
+92.100.159.218
  92.101.92.69
  92.103.168.50
  92.104.111.206
  92.104.173.28
+92.104.231.182
  92.108.242.45
  92.108.31.72
  92.111.126.154
  92.111.156.14
+92.111.178.114
  92.114.35.161
  92.114.75.210
-92.115.102.133
  92.115.134.57
-92.116.145.193
  92.116.161.20
-92.116.34.209
-92.117.134.75
+92.116.180.130
+92.117.136.14
  92.117.136.150
  92.117.57.201
  92.118.149.91
+92.118.160.1
  92.118.160.13
+92.118.160.25
  92.118.160.37
-92.118.161.9
+92.118.161.29
+92.118.161.57
  92.118.190.105
+92.118.208.191
  92.118.209.115
  92.118.209.198
  92.118.209.207
  92.118.209.43
+92.118.211.100
  92.118.211.110
  92.118.211.139
  92.118.211.14
  92.118.211.163
  92.118.211.168
+92.118.211.182
  92.118.211.2
  92.118.211.200
  92.118.211.225
@@ -99851,105 +99327,100 @@
  92.119.112.62
  92.119.115.94
  92.119.159.40
-92.119.193.54
  92.124.139.1
  92.124.148.142
  92.124.153.76
-92.124.160.74
  92.126.197.108
  92.126.212.205
  92.126.222.172
  92.130.187.57
  92.137.141.251
+92.142.77.26
+92.145.79.2
  92.15.231.205
  92.151.38.47
  92.151.73.171
  92.154.89.19
  92.154.95.236
-92.157.56.229
  92.170.214.197
-92.170.67.37
-92.184.100.191
-92.184.100.206
+92.184.100.131
  92.184.100.207
-92.184.100.232
+92.184.100.214
  92.184.100.250
  92.184.100.253
  92.184.102.10
  92.184.102.140
-92.184.102.146
+92.184.102.155
+92.184.102.216
+92.184.102.224
  92.184.102.248
-92.184.102.255
+92.184.102.249
  92.184.102.73
-92.184.102.92
  92.184.104.0
  92.184.104.138
  92.184.104.151
-92.184.104.158
-92.184.104.178
+92.184.104.153
  92.184.104.207
-92.184.104.221
+92.184.104.23
  92.184.104.249
-92.184.104.29
  92.184.104.34
  92.184.104.5
+92.184.104.66
+92.184.105.155
+92.184.105.208
  92.184.105.30
  92.184.106.160
-92.184.107.167
+92.184.107.132
  92.184.107.84
-92.184.108.198
+92.184.108.82
  92.184.112.13
-92.184.112.135
+92.184.112.214
+92.184.112.221
  92.184.112.233
  92.184.112.92
-92.184.116.160
+92.184.116.102
  92.184.116.221
-92.184.116.28
+92.184.116.231
  92.184.116.35
  92.184.116.37
-92.184.124.129
-92.184.124.204
-92.184.124.239
-92.184.124.245
+92.184.116.54
+92.184.116.99
  92.184.124.253
  92.184.124.44
-92.184.124.54
  92.184.98.247
  92.185.121.178
-92.185.96.97
  92.187.228.47
  92.19.14.2
  92.19.249.3
  92.190.153.246
  92.190.177.39
-92.191.71.124
+92.190.182.62
+92.192.103.192
  92.192.116.180
+92.192.27.194
  92.192.49.54
  92.193.135.111
-92.193.151.22
  92.193.160.60
-92.193.220.139
+92.194.12.125
  92.194.60.90
-92.194.72.241
  92.195.51.78
-92.196.143.8
  92.196.181.16
  92.198.28.38
  92.2.66.72
  92.20.12.134
-92.20.177.156
+92.20.13.174
+92.20.214.77
  92.20.33.170
  92.20.74.204
  92.20.8.10
  92.20.86.49
-92.200.17.92
-92.201.86.121
+92.201.71.133
  92.204.132.78
  92.204.163.66
  92.204.164.90
  92.204.174.134
+92.204.174.88
  92.204.40.25
-92.206.153.187
  92.206.212.180
  92.207.253.226
  92.208.113.163
@@ -99964,11 +99435,9 @@
  92.208.127.72
  92.208.204.145
  92.208.207.192
-92.210.127.76
  92.219.151.94
  92.22.55.226
  92.22.60.74
-92.220.133.181
  92.220.163.15
  92.221.141.145
  92.221.166.189
@@ -99988,7 +99457,6 @@
  92.222.207.223
  92.222.207.228
  92.222.208.174
-92.222.220.220
  92.222.221.49
  92.222.64.148
  92.222.64.195
@@ -100012,6 +99480,7 @@
  92.232.198.59
  92.236.71.145
  92.237.158.97
+92.237.198.149
  92.237.242.79
  92.238.170.6
  92.238.234.158
@@ -100027,6 +99496,7 @@
  92.241.17.80
  92.241.190.214
  92.241.234.141
+92.241.59.2
  92.241.65.174
  92.241.65.38
  92.241.66.138
@@ -100035,7 +99505,9 @@
  92.241.93.154
  92.242.100.131
  92.242.126.154
+92.242.204.205
  92.242.234.6
+92.242.238.195
  92.242.240.34
  92.242.254.23
  92.242.62.123
@@ -100046,6 +99518,7 @@
  92.243.15.162
  92.243.21.182
  92.243.84.187
+92.244.247.37
  92.244.36.73
  92.244.99.229
  92.245.175.165
@@ -100067,6 +99540,7 @@
  92.247.125.229
  92.247.125.233
  92.247.125.241
+92.247.125.245
  92.247.125.249
  92.247.125.65
  92.247.126.1
@@ -100102,9 +99576,10 @@
  92.249.143.44
  92.249.148.21
  92.249.219.47
-92.249.229.57
+92.249.232.72
  92.252.151.200
  92.252.185.162
+92.252.235.27
  92.252.241.11
  92.252.241.202
  92.253.144.180
@@ -100118,6 +99593,7 @@
  92.255.196.91
  92.255.198.132
  92.255.202.72
+92.255.232.100
  92.255.248.230
  92.255.252.44
  92.255.253.59
@@ -100133,13 +99609,9 @@
  92.35.66.140
  92.35.94.126
  92.38.128.47
-92.38.136.69
-92.38.149.154
  92.38.163.44
  92.38.171.17
-92.38.173.19
-92.38.173.23
-92.38.173.24
+92.38.172.19
  92.38.225.177
  92.38.226.16
  92.38.45.68
@@ -100163,6 +99635,9 @@
  92.45.19.7
  92.45.51.207
  92.45.51.208
+92.45.51.211
+92.45.51.212
+92.45.51.216
  92.45.51.225
  92.45.51.226
  92.45.51.228
@@ -100178,10 +99653,10 @@
  92.50.143.90
  92.50.155.218
  92.50.235.198
+92.50.247.2
  92.50.249.166
  92.51.201.65
  92.51.241.168
-92.51.25.48
  92.51.73.14
  92.51.78.66
  92.51.89.126
@@ -100196,6 +99671,7 @@
  92.54.200.66
  92.54.237.196
  92.54.237.237
+92.55.194.237
  92.55.194.252
  92.55.194.55
  92.59.209.151
@@ -100205,13 +99681,11 @@
  92.61.114.103
  92.62.131.106
  92.62.139.103
-92.62.18.244
  92.62.196.66
  92.62.73.73
  92.63.111.201
  92.63.192.231
  92.63.192.96
-92.63.196.47
  92.63.197.153
  92.63.197.190
  92.63.197.60
@@ -100226,6 +99700,7 @@
  92.63.91.84
  92.64.254.225
  92.70.243.58
+92.74.34.121
  92.74.47.34
  92.79.91.147
  92.8.84.191
@@ -100239,20 +99714,23 @@
  92.85.169.16
  92.86.10.42
  92.86.127.175
+92.86.254.205
  92.86.33.126
  92.86.92.126
  92.87.123.126
  92.87.123.68
  92.87.8.192
+92.88.232.193
  92.88.5.40
  92.89.143.222
  92.91.191.172
  92.91.27.60
+92.91.6.205
  92.94.103.214
  92.94.103.214bin.sh
  92.96.172.185
+92.96.91.28
  92.97.243.144
-92.98.223.12
  92.98.243.43
  92.98.7.153
  92.99.208.52
@@ -100286,13 +99764,14 @@
  93.100.232.11
  93.100.86.40
  93.103.12.195
+93.103.130.169
  93.104.163.254
  93.104.171.249
+93.104.180.50
  93.104.210.119
  93.104.210.230
  93.104.210.29
  93.104.213.162
-93.104.99.54
  93.107.153.162
  93.108.242.140
  93.113.110.87
@@ -100302,7 +99781,6 @@
  93.113.131.129
  93.113.206.62
  93.113.49.1
-93.114.130.20
  93.114.184.56
  93.114.184.8
  93.114.234.242
@@ -100344,19 +99822,14 @@
  93.119.107.22
  93.119.123.233
  93.119.176.102
-93.119.176.143
-93.119.176.157
-93.119.176.198
-93.119.176.219
  93.119.176.231
  93.119.176.238
  93.119.176.64
-93.119.176.66
-93.119.176.90
+93.119.178.163
  93.120.217.221
  93.123.180.164
  93.123.73.123
-93.124.114.106
+93.124.48.45
  93.125.109.16
  93.125.114.97
  93.125.36.60
@@ -100372,25 +99845,29 @@
  93.126.98.242
  93.127.145.162
  93.127.145.40
+93.131.157.45
+93.131.36.171
  93.136.143.126
-93.136.63.221
-93.137.131.175
+93.136.182.151
+93.137.102.22
+93.137.130.76
  93.137.166.9
-93.137.185.232
-93.137.200.47
  93.137.217.170
+93.138.111.36
+93.138.144.91
  93.138.163.107
+93.138.32.232
+93.139.73.104
  93.141.175.161
-93.141.65.211
-93.143.202.210
+93.143.138.246
  93.145.164.6
  93.145.61.6
  93.146.143.191
+93.146.161.125
  93.146.185.139
  93.146.237.163
  93.146.48.84
  93.146.71.211
-93.146.99.125
  93.147.129.222
  93.147.141.5
  93.147.212.206
@@ -100404,6 +99881,7 @@
  93.156.165.186
  93.157.144.254
  93.157.163.66
+93.157.253.16
  93.157.62.102
  93.157.62.58
  93.158.211.196
@@ -100415,11 +99893,10 @@
  93.159.215.244
  93.167.67.69
  93.170.113.159
+93.170.124.251
  93.170.129.150
  93.170.15.177
  93.170.53.188
-93.170.53.25
-93.170.53.59
  93.171.205.34
  93.171.208.194
  93.172.212.252
@@ -100458,21 +99935,17 @@
  93.174.95.47
  93.174.95.64
  93.174.95.81
-93.175.203.124
  93.175.234.1
  93.176.84.35
  93.176.84.45
-93.177.116.139
  93.177.73.194
  93.177.82.226
  93.178.200.122
  93.179.102.31
  93.179.118.218
  93.179.197.152
-93.179.202.87
  93.180.157.61
  93.180.178.213
-93.180.51.51
  93.180.64.135
  93.180.64.220
  93.180.64.230
@@ -100481,6 +99954,7 @@
  93.182.156.25
  93.182.168.132
  93.182.168.8
+93.182.72.243
  93.183.126.111
  93.183.131.53
  93.183.184.253
@@ -100494,11 +99968,13 @@
  93.186.200.154
  93.186.201.250
  93.186.201.37
+93.187.152.218
  93.187.182.176
  93.187.200.218
  93.188.164.193
  93.188.164.198
  93.188.166.222
+93.188.2.5
  93.189.145.169
  93.189.221.253
  93.189.29.75
@@ -100517,20 +99993,16 @@
  93.190.41.97
  93.190.58.4
  93.190.93.165
+93.191.114.161
  93.196.103.122
-93.197.40.135
  93.197.41.24
  93.201.116.81
  93.201.236.52
-93.202.182.99
  93.203.35.140
-93.203.65.46
-93.203.81.93
-93.209.113.118
  93.209.123.126
-93.209.179.250
+93.209.184.83
  93.21.224.154
-93.214.168.59
+93.211.165.201
  93.22.37.164
  93.220.46.182
  93.222.181.39
@@ -100540,13 +100012,14 @@
  93.222.227.150
  93.224.119.12
  93.224.54.2
-93.228.85.201
+93.228.72.94
+93.228.82.100
+93.228.82.248
+93.228.89.193
+93.228.95.156
+93.228.95.79
  93.23.196.55
-93.231.205.209
-93.232.1.155
  93.233.227.21
-93.233.229.126
-93.236.228.86
  93.236.43.148
  93.241.53.201
  93.243.24.237
@@ -100555,7 +100028,7 @@
  93.255.124.134
  93.255.154.62
  93.28.211.232
-93.34.223.186
+93.34.147.89
  93.34.236.88
  93.35.186.155
  93.35.225.23
@@ -100563,12 +100036,12 @@
  93.38.127.179
  93.38.127.199
  93.39.27.225
+93.39.30.96
  93.41.187.209
  93.41.193.212
  93.42.196.218
  93.42.224.202
  93.42.59.225
-93.42.7.100
  93.42.78.173
  93.43.193.42
  93.43.223.61
@@ -100577,32 +100050,29 @@
  93.45.93.47
  93.46.147.47
  93.46.54.4
-93.47.217.190
-93.48.121.117
  93.48.88.51
  93.49.164.197
+93.5.133.202
  93.5.72.88
-93.50.125.249
  93.50.177.66
  93.51.199.110
  93.51.212.122
  93.51.247.104
+93.51.57.210
  93.54.116.118
  93.54.99.234
  93.55.242.131
  93.57.249.8
  93.57.81.162
  93.61.137.226
-93.61.137.46
-93.61.73.166
  93.63.173.228
  93.63.209.28
  93.63.37.231
  93.63.75.62
  93.64.183.162
-93.66.26.223
  93.67.138.66
  93.69.7.20
+93.70.84.8
  93.71.204.169
  93.72.149.200
  93.73.199.52
@@ -100615,31 +100085,31 @@
  93.75.190.194
  93.75.197.17
  93.75.48.211
-93.76.241.39
  93.77.71.235
  93.79.235.177
  93.8.133.221
-93.80.130.220
-93.81.220.42
  93.81.252.222
  93.81.9.28
  93.82.220.150
  93.83.108.58
  93.83.126.93
+93.84.166.153
  93.85.132.194
+93.86.199.66
  93.86.206.139
  93.86.49.105
  93.86.68.186
  93.87.123.245
-93.87.123.53
  93.87.17.1
  93.87.28.158
  93.87.74.202
-93.87.75.118
  93.87.92.126
+93.88.103.251
  93.88.107.125
  93.88.74.71
  93.89.159.8
+93.89.225.2
+93.89.225.92
  93.89.235.77
  93.89.68.36
  93.89.81.97
@@ -100650,6 +100120,7 @@
  93.90.207.43
  93.90.207.46
  93.90.73.137
+93.91.112.247
  93.91.146.30
  93.91.197.147
  93.92.205.180
@@ -100661,8 +100132,8 @@
  93.95.102.81
  93.95.217.45
  93.95.24.10
-93.95.88.13
-93.99.133.247
+93.99.127.26
+93.99.152.229
  93.99.153.113
  93.99.176.84
  93.99.53.201
@@ -100690,7 +100161,6 @@
  93jhwpuyranq.talagaremix.com
  94-237-53-115.uk-lon1.upcloud.host
  94.1.76.157
-94.10.161.162
  94.100.18.70
  94.100.28.179
  94.100.28.201
@@ -100704,11 +100174,11 @@
  94.102.212.234
  94.102.48.193
  94.102.49.11
+94.102.49.123
  94.102.49.164
  94.102.49.168
  94.102.49.169
  94.102.49.175
-94.102.49.190
  94.102.49.193
  94.102.49.210
  94.102.49.211
@@ -100722,14 +100192,12 @@
  94.102.5.32
  94.102.50.56
  94.102.51.155
-94.102.51.17
  94.102.51.22
  94.102.51.231
  94.102.51.238
  94.102.51.246
  94.102.51.28
  94.102.51.30
-94.102.51.95
  94.102.52.241
  94.102.53.195
  94.102.53.208
@@ -100744,11 +100212,9 @@
  94.102.63.74
  94.102.8.112
  94.103.120.173
-94.103.41.203
-94.107.162.136
+94.103.122.210
  94.11.66.237
  94.110.120.66
-94.110.203.27
  94.112.121.49
  94.112.122.212
  94.112.132.191
@@ -100759,6 +100225,7 @@
  94.113.116.24
  94.114.122.116
  94.114.158.146
+94.114.5.223
  94.123.161.86
  94.124.18.3
  94.124.193.242
@@ -100809,11 +100276,14 @@
  94.130.9.125
  94.131.14.10
  94.131.14.19
+94.131.219.3
+94.133.176.89
+94.133.20.156
  94.134.152.105
  94.134.17.74
  94.134.176.80
+94.134.81.45
  94.134.92.115
-94.134.92.196
  94.136.138.142
  94.136.154.49
  94.136.154.53
@@ -100831,6 +100301,8 @@
  94.136.69.199
  94.136.69.228bin.sh
  94.137.136.45
+94.138.143.114
+94.138.202.5
  94.139.150.45
  94.139.161.18
  94.140.114.164
@@ -100861,11 +100333,11 @@
  94.142.245.124
  94.143.43.230
  94.143.83.203
+94.145.3.38
  94.152.206.40
  94.152.214.74
  94.153.157.18
  94.153.169.22
-94.153.212.102
  94.153.224.194
  94.153.224.202
  94.153.227.14
@@ -100905,6 +100377,7 @@
  94.155.33.81
  94.155.33.84
  94.155.33.85
+94.155.33.86
  94.156.128.114
  94.156.128.69
  94.156.128.72
@@ -100917,7 +100390,6 @@
  94.156.174.201
  94.156.57.84
  94.157.141.238
-94.157.184.164
  94.158.152.248
  94.158.152.54
  94.158.165.19
@@ -100958,7 +100430,7 @@
  94.178.127.231
  94.179.133.22
  94.179.135.230
-94.18.228.213
+94.179.213.153
  94.18.231.202
  94.180.246.38
  94.180.247.20
@@ -100967,7 +100439,6 @@
  94.180.57.15
  94.181.33.149
  94.181.44.79
-94.181.46.72
  94.181.47.232
  94.182.197.202
  94.182.216.211
@@ -100976,7 +100447,9 @@
  94.185.83.100
  94.185.85.45
  94.187.0.74
+94.187.2.132
  94.188.28.106
+94.188.32.151
  94.188.39.158
  94.189.132.47
  94.19.122.13
@@ -100994,6 +100467,7 @@
  94.191.125.97
  94.191.18.28
  94.191.2.245
+94.191.61.146
  94.191.66.227
  94.191.71.246
  94.191.75.220
@@ -101002,7 +100476,6 @@
  94.195.113.109
  94.195.15.179
  94.198.1.179
-94.198.135.131
  94.198.160.31
  94.198.195.42
  94.198.215.22
@@ -101014,8 +100487,10 @@
  94.199.178.233
  94.199.181.248
  94.2.107.3
+94.2.171.2
  94.20.21.37
  94.20.233.153
+94.20.49.86
  94.200.114.162
  94.200.126.42
  94.200.17.144
@@ -101033,26 +100508,33 @@
  94.21.118.140
  94.21.120.168
  94.21.155.91
-94.21.33.196
-94.21.5.22
+94.21.26.185
+94.210.225.28
  94.211.17.129
+94.211.2.12
  94.212.219.138
  94.213.107.137
  94.216.194.14
+94.216.209.80
+94.216.73.12
+94.216.75.93
  94.218.218.255
  94.22.47.242
+94.224.179.119
  94.224.187.205
  94.226.118.211
  94.227.238.178
  94.227.40.54
  94.228.10.70
  94.228.11.6
+94.228.130.46
  94.228.180.218
  94.228.2.33
  94.228.214.5
  94.228.215.83
  94.228.253.51
  94.228.4.249
+94.229.154.21
  94.229.161.60
  94.23.1.8
  94.23.11.114
@@ -101066,6 +100548,7 @@
  94.23.179.193
  94.23.179.199
  94.23.19.147
+94.23.193.134
  94.23.195.186
  94.23.196.68
  94.23.20.159
@@ -101073,12 +100556,12 @@
  94.23.205.110
  94.23.205.32
  94.23.206.122
+94.23.209.35
  94.23.21.80
  94.23.211.60
  94.23.214.15
  94.23.216.33
  94.23.220.214
-94.23.222.84
  94.23.229.64
  94.23.236.143
  94.23.237.171
@@ -101087,6 +100570,7 @@
  94.23.250.222
  94.23.254.205
  94.23.26.146
+94.23.30.216
  94.23.33.22
  94.23.36.11
  94.23.38.191
@@ -101115,10 +100599,10 @@
  94.232.126.225
  94.232.136.126
  94.232.200.144
-94.232.41.147
  94.232.46.160
  94.232.46.227
  94.236.182.92
+94.236.212.4
  94.236.23.242
  94.236.252.139
  94.237.125.30
@@ -101128,8 +100612,8 @@
  94.239.252.253
  94.240.30.99
  94.241.165.150
-94.241.165.245
-94.241.236.84
+94.241.165.46
+94.241.167.124
  94.242.144.122
  94.242.151.28
  94.242.206.153
@@ -101150,6 +100634,7 @@
  94.242.57.57
  94.242.62.19
  94.242.62.50
+94.242.62.67
  94.243.140.162
  94.243.219.122
  94.243.24.123
@@ -101159,25 +100644,19 @@
  94.246.160.153
  94.247.134.77
  94.247.241.70
-94.248.134.248
+94.248.144.77
  94.249.160.37
-94.249.171.58
  94.249.18.104
  94.249.224.108
-94.249.224.171
-94.249.224.180
-94.249.224.201
  94.249.224.62
  94.25.104.250
-94.25.148.188
  94.25.228.74
  94.25.94.235
-94.25.95.138
-94.250.17.120
  94.250.248.75
  94.250.254.147
  94.253.15.25
  94.253.237.25
+94.254.97.68
  94.26.142.10
  94.26.193.37
  94.26.197.127
@@ -101185,9 +100664,9 @@
  94.27.233.103
  94.28.31.99
  94.30.4.22
+94.30.97.245
  94.31.100.251
  94.31.100.50
-94.31.99.58
  94.32.243.132
  94.32.66.15
  94.33.52.61
@@ -101195,7 +100674,6 @@
  94.38.254.200
  94.4.144.114
  94.40.127.166
-94.40.75.25
  94.40.87.20
  94.42.144.10
  94.43.101.161
@@ -101206,14 +100684,13 @@
  94.43.139.99
  94.43.191.27
  94.43.85.6
-94.44.110.131
  94.46.15.100
  94.46.186.242
  94.46.186.49
  94.46.3.139
  94.49.241.108
  94.5.135.197
-94.50.27.119
+94.50.169.54
  94.51.211.188
  94.51.219.30
  94.51.222.49
@@ -101225,36 +100702,33 @@
  94.56.137.88
  94.57.252.133
  94.57.252.147
+94.57.252.152
  94.59.162.165
  94.60.136.242
+94.60.201.232
  94.61.159.92
-94.62.137.251
  94.62.172.40
  94.62.201.87
  94.62.37.130
  94.64.254.217
  94.65.56.190
+94.66.171.225
  94.66.221.255
  94.66.80.40
  94.66.99.83
+94.67.2.76
  94.67.207.203
-94.67.252.68
  94.68.139.55
-94.68.141.68
  94.68.160.204
-94.69.226.48
  94.70.170.50
  94.72.143.26
  94.72.158.1
  94.72.158.129
  94.73.19.144
  94.74.124.248
-94.74.142.79
-94.74.148.132
-94.74.148.136
+94.74.142.232
+94.74.142.45
  94.74.150.196
-94.74.168.153
-94.74.181.190
  94.75.133.111
  94.75.207.99
  94.75.228.26
@@ -101265,14 +100739,15 @@
  94.75.253.85
  94.75.98.91
  94.76.247.61
+94.76.77.73
  94.76.92.10
-94.78.68.8
  94.79.4.53
  94.79.54.195
  94.9.58.78
  94.96.24.9
  94.96.96.242
  94.98.60.183
+94.99.105.90
  94.99.112.138
  94.99.133.235
  9405037.com
@@ -101321,7 +100796,6 @@
  95.104.114.50
  95.104.54.227
  95.104.7.153
-95.105.124.159
  95.105.184.58
  95.105.234.196
  95.105.253.100
@@ -101330,7 +100804,6 @@
  95.106.214.58
  95.107.163.114
  95.107.199.90
-95.107.27.222
  95.110.133.223
  95.110.153.164
  95.110.160.27
@@ -101341,13 +100814,14 @@
  95.110.224.127
  95.110.224.169
  95.110.224.30
+95.110.226.228
  95.110.226.93
  95.110.234.93
  95.111.128.185
+95.111.128.43
  95.111.234.125
  95.111.235.189
  95.111.236.142
-95.111.239.17
  95.111.242.42
  95.111.244.99
  95.111.245.205
@@ -101355,18 +100829,23 @@
  95.111.248.110
  95.111.254.160
  95.112.134.118
-95.112.27.207
+95.112.214.122
  95.114.38.196
-95.114.6.185
-95.115.104.163
  95.115.13.142
+95.115.52.66
  95.115.86.91
+95.115.93.91
  95.116.1.182
-95.118.17.101
+95.116.35.84
+95.116.9.192
+95.117.128.228
+95.117.17.49
+95.118.0.250
  95.122.154.149
  95.122.97.103
  95.128.142.76
  95.128.144.1
+95.128.162.146
  95.128.163.192
  95.128.163.228
  95.128.164.87
@@ -101400,7 +100879,6 @@
  95.130.13.147
  95.130.168.234
  95.131.70.76
-95.132.255.221
  95.133.163.58
  95.133.163.98
  95.134.130.182
@@ -101412,6 +100890,7 @@
  95.137.156.236
  95.137.240.3
  95.137.240.30
+95.138.199.193
  95.138.228.28
  95.138.33.28
  95.140.116.18
@@ -101693,32 +101172,35 @@
  95.143.192.159
  95.143.193.125
  95.143.21.107
-95.143.21.131
  95.143.21.136
-95.143.21.196
  95.143.21.201
  95.143.21.247
  95.143.21.6
+95.143.21.61
  95.143.218.179
  95.143.22.114
  95.143.22.134
  95.143.22.165
  95.143.22.171
  95.143.22.74
+95.143.22.76
+95.143.220.5
  95.144.230.245
  95.146.159.140
  95.15.140.230
  95.15.162.191
  95.152.55.190
  95.153.112.39
+95.153.117.38
  95.153.126.185
  95.153.167.63
  95.153.31.84
  95.153.31.87
-95.153.31.89
-95.153.32.94
+95.153.32.87
+95.153.99.133
  95.154.104.147
  95.154.118.97
+95.154.19.147
  95.154.197.67
  95.154.199.64
  95.154.24.73
@@ -101741,6 +101223,7 @@
  95.158.217.19
  95.158.63.46
  95.158.63.61
+95.160.156.207
  95.160.23.204
  95.160.38.59
  95.161.12.45
@@ -101769,6 +101252,7 @@
  95.165.167.37
  95.165.172.171
  95.165.174.191
+95.165.182.230
  95.165.252.94
  95.165.27.166
  95.165.28.122
@@ -101778,10 +101262,7 @@
  95.167.159.250
  95.167.178.149
  95.167.20.142
-95.167.9.218
  95.168.120.216
-95.168.120.250
-95.168.121.24
  95.168.164.220
  95.168.167.187
  95.168.170.105
@@ -101791,6 +101272,7 @@
  95.169.181.121
  95.169.213.76
  95.169.22.100
+95.169.229.84
  95.169.5.166
  95.169.6.123
  95.169.6.47
@@ -101812,19 +101294,19 @@
  95.174.0.176
  95.174.109.43
  95.174.123.14
-95.174.124.153
  95.174.15.228
  95.174.182.34
  95.174.65.232
-95.174.66.211
  95.174.8.194
  95.175.104.44
  95.175.110.131
  95.175.98.201
  95.176.228.103
+95.179.127.88
  95.179.131.110
  95.179.132.92
  95.179.138.23
+95.179.141.92
  95.179.143.34
  95.179.148.197
  95.179.149.174
@@ -101835,17 +101317,17 @@
  95.179.179.183
  95.179.183.224
  95.179.184.140
-95.179.186.232
  95.179.187.193
  95.179.188.215
  95.179.210.17
  95.179.212.50
  95.179.214.152
-95.179.225.249
  95.179.250.205
+95.18.226.21
  95.180.167.208
  95.181.131.153
  95.181.131.199
+95.181.148.199
  95.181.148.96
  95.181.151.194
  95.181.151.198
@@ -101859,25 +101341,23 @@
  95.181.37.114
  95.181.45.234
  95.182.123.194
-95.182.126.185
-95.182.126.25
  95.182.213.55
  95.183.51.24
  95.183.52.148
  95.183.55.40
-95.186.130.175
  95.187.50.31
  95.188.71.19
-95.189.218.48
  95.189.78.2
  95.19.126.128
  95.19.50.131
+95.19.50.237
  95.19.50.46
  95.19.50.90
  95.195.215.245
  95.20.162.171
  95.208.253.143
  95.209.155.91
+95.209.157.55
  95.21.243.117
  95.210.227.169
  95.211.10.160
@@ -101927,7 +101407,6 @@
  95.214.235.76
  95.214.53.154
  95.214.54.84
-95.215.1.221
  95.215.19.22
  95.215.206.244
  95.215.44.12
@@ -101958,11 +101437,10 @@
  95.216.166.168
  95.216.169.53
  95.216.17.46
+95.216.173.193
  95.216.181.107
  95.216.187.94
  95.216.19.95
-95.216.192.143
-95.216.194.33
  95.216.197.12
  95.216.198.89
  95.216.2.227
@@ -101970,6 +101448,7 @@
  95.216.207.86
  95.216.209.249
  95.216.21.47
+95.216.213.70
  95.216.219.12
  95.216.226.201
  95.216.226.218
@@ -101999,11 +101478,11 @@
  95.216.64.180
  95.216.68.44
  95.216.7.158
+95.216.70.91
  95.216.73.37
  95.216.76.224
  95.216.8.166
  95.216.9.240
-95.216.9.69
  95.216.96.167
  95.216.96.93
  95.216.97.16
@@ -102014,14 +101493,15 @@
  95.217.109.216
  95.217.109.218
  95.217.114.36
-95.217.114.88
  95.217.121.13
  95.217.121.30
  95.217.121.97
  95.217.124.148
  95.217.125.203
+95.217.13.114
  95.217.145.249
  95.217.153.97
+95.217.163.234
  95.217.179.118
  95.217.180.216
  95.217.183.221
@@ -102040,10 +101520,11 @@
  95.217.213.50
  95.217.23.149
  95.217.237.152
-95.217.3.10
+95.217.32.2
  95.217.33.109
  95.217.34.169
  95.217.35.79
+95.217.36.126
  95.217.38.60
  95.217.41.235
  95.217.41.248
@@ -102056,31 +101537,31 @@
  95.217.80.86
  95.217.93.21
  95.217.96.83
+95.219.7.151
  95.220.131.150
-95.222.190.255
  95.222.97.149
-95.223.73.193
+95.223.73.232
  95.223.73.240
  95.223.73.246
+95.223.75.255
  95.224.117.226
  95.225.157.7
  95.227.198.80
  95.227.234.14
  95.229.138.72
  95.229.138.87
+95.23.19.97
  95.231.87.112
  95.232.26.197
  95.233.68.206
  95.234.98.85
  95.235.60.135
+95.236.224.129
  95.237.32.55
-95.244.104.178
-95.245.172.169
+95.245.157.8
  95.247.233.159
-95.25.12.177
  95.25.45.35
  95.25.5.51
-95.25.69.45
  95.25.99.161
  95.251.21.64
  95.251.9.69
@@ -102089,10 +101570,7 @@
  95.253.238.77
  95.255.173.199
  95.255.69.58
-95.28.1.134
-95.28.248.49
  95.29.42.110
-95.31.119.107
  95.31.119.210
  95.31.165.210
  95.31.172.45
@@ -102109,16 +101587,18 @@
  95.47.140.42
  95.48.228.45
  95.49.232.197
+95.5.255.86
  95.50.22.78
  95.50.85.99
  95.51.180.226
-95.52.199.169
+95.52.251.210
  95.54.196.135
  95.55.95.187
  95.56.104.238
  95.56.228.2
  95.58.145.14
  95.58.145.22
+95.58.73.5
  95.59.105.179
  95.59.26.160
  95.59.26.9
@@ -102140,7 +101620,6 @@
  95.68.116.41
  95.68.70.160
  95.69.249.63
-95.70.118.50
  95.70.184.103
  95.70.220.173
  95.70.72.191
@@ -102152,6 +101631,7 @@
  95.76.25.58
  95.77.104.79
  95.77.16.197
+95.77.203.12
  95.77.98.196
  95.77.98.92
  95.78.127.226
@@ -102163,6 +101643,7 @@
  95.79.41.188
  95.79.45.205
  95.79.50.121
+95.79.55.196
  95.79.56.120
  95.79.57.206
  95.80.10.185
@@ -102173,7 +101654,6 @@
  95.80.85.33
  95.80.85.67
  95.80.89.138
-95.81.105.187
  95.82.146.70
  95.82.176.138
  95.83.73.31
@@ -102225,7 +101705,6 @@
  95.86.32.4
  95.86.37.1
  95.87.14.3
-95.87.220.176
  95.87.220.19
  95.87.226.56
  95.87.24.151
@@ -102236,15 +101715,18 @@
  95.9.194.13
  95.9.3.43
  95.9.5.93
-95.90.182.142
  95.90.198.207
  95.90.232.212
  95.90.32.63
  95.90.6.49
+95.91.193.79
+95.91.195.101
  95.91.224.158
  95.91.45.50
+95.91.75.57
  95.91.76.137
  95.92.54.180
+95.93.218.249
  95.97.209.10
  95.97.27.33
  950-365.com
@@ -102286,27 +101768,27 @@
  96.18.233.136
  96.19.0.136
  96.19.194.191
+96.2.121.118
  96.2.21.190
  96.22.82.34
  96.224.227.210
+96.224.251.104
  96.225.134.64
  96.225.173.33
  96.225.97.17
  96.227.131.249
+96.230.255.189
  96.231.141.105
  96.231.145.254
-96.231.245.19
-96.231.245.20
+96.232.88.46
  96.233.194.4
  96.233.77.159
  96.237.114.206
  96.237.231.17
  96.238.89.4
  96.239.17.242
-96.241.75.151
  96.242.147.73
  96.242.5.87
-96.244.219.200
  96.244.58.127
  96.245.74.37
  96.247.202.109
@@ -102316,6 +101798,7 @@
  96.254.171.10
  96.255.139.230
  96.255.84.96
+96.27.22.22
  96.27.249.5
  96.3.23.178
  96.30.195.215
@@ -102327,12 +101810,9 @@
  96.39.76.211
  96.41.157.101
  96.42.163.199
-96.43.106.210
  96.43.106.227
  96.43.106.239
-96.43.106.246
  96.43.106.247
-96.43.106.251
  96.44.128.250
  96.44.130.190
  96.44.133.34
@@ -102358,8 +101838,8 @@
  96.48.243.148
  96.49.63.16
  96.50.41.57
+96.52.0.53
  96.54.225.175
-96.56.213.182
  96.56.221.138
  96.57.24.186
  96.57.248.252
@@ -102386,17 +101866,17 @@
  96.8.113.206
  96.8.114.178
  96.8.116.100
+96.8.116.232
  96.8.120.113
  96.8.120.60
+96.8.122.176
  96.8.122.180
  96.80.107.217
  96.82.74.129
  96.82.74.134
-96.83.6.121
  96.84.128.196
  96.84.149.98
  96.85.35.233
-96.85.9.73
  96.86.235.11
  96.87.184.101
  96.87.188.193
@@ -102414,7 +101894,6 @@
  96.9.73.80
  96.9.74.139
  96.9.77.203
-96.9.77.226
  96.9.77.240
  96.9.77.71
  96.9.79.20
@@ -102450,7 +101929,6 @@
  96mxu.weblium.site
  97.100.102.185
  97.102.190.4
-97.102.206.250
  97.103.253.103
  97.104.107.190
  97.107.127.161
@@ -102621,7 +102099,6 @@
  97.116.51.46
  97.116.53.171
  97.116.53.3
-97.116.57.32
  97.116.63.22
  97.116.73.136
  97.116.78.58
@@ -102702,7 +102179,6 @@
  97.124.114.40
  97.124.119.212
  97.124.124.148
-97.124.153.57
  97.124.201.86
  97.124.217.47
  97.124.228.180
@@ -102810,7 +102286,6 @@
  97.69.160.248
  97.69.166.228
  97.70.66.168
-97.71.122.146
  97.73.104.2
  97.74.119.80
  97.74.215.181
@@ -102818,22 +102293,28 @@
  97.74.232.157
  97.74.237.196
  97.74.24.101
+97.74.24.112
  97.74.24.113
  97.74.24.115
+97.74.24.116
+97.74.24.132
+97.74.24.174
  97.74.24.181
+97.74.24.182
+97.74.24.189
  97.74.24.193
  97.74.24.194
  97.74.24.197
  97.74.24.198
  97.74.24.202
+97.74.24.205
  97.74.24.214
-97.74.24.220
  97.74.24.221
-97.74.24.222
  97.74.24.227
  97.74.24.42
  97.74.24.46
  97.74.24.9
+97.74.24.98
  97.74.4.42
  97.74.6.64
  97.76.170.128
@@ -102843,17 +102324,16 @@
  97.81.244.191
  97.82.79.83
  97.83.173.243
-97.84.246.39
+97.83.62.237
  97.85.36.15
  97.88.8.34
-97.88.92.46
  97.90.115.171
  97.90.49.141
  97.91.168.203
+97.92.42.135
  97.93.106.70
  97.93.25.93
-97.93.56.222
-97.94.242.112
+97.95.75.218
  97.96.199.75
  97.99.205.241
  97.99.222.71
@@ -102876,17 +102356,17 @@
  97sm.org
  98.10.200.34
  98.100.202.106
-98.100.92.218
  98.102.222.30
  98.109.133.80
  98.109.159.216
+98.109.223.98
  98.11.142.34
  98.110.234.97
  98.113.162.148
+98.113.234.162
  98.115.144.45
  98.115.159.208
  98.115.21.123
-98.115.73.219
  98.119.219.27
  98.125.104.165
  98.125.110.244
@@ -102966,22 +102446,24 @@
  98.142.141.184
  98.142.143.152
  98.142.221.132
-98.143.104.200
  98.143.148.45
+98.144.132.131
  98.145.214.112
  98.146.133.73
  98.146.212.146
  98.15.140.226
  98.151.250.238
+98.153.254.249
  98.154.3.215
  98.154.87.18
  98.155.152.218
+98.155.192.128
  98.155.92.137
  98.156.108.211
  98.156.162.236
+98.156.251.121
  98.157.100.159
  98.157.226.168
-98.157.53.1
  98.159.110.14
  98.159.110.19
  98.159.110.2
@@ -102994,6 +102476,7 @@
  98.159.110.228
  98.159.110.231
  98.159.110.232
+98.159.90.88
  98.159.99.102
  98.159.99.21
  98.159.99.212
@@ -103010,10 +102493,8 @@
  98.159.99.39
  98.159.99.58
  98.162.215.224
-98.162.223.145
-98.162.25.10
-98.162.25.15
  98.162.25.23
+98.162.25.28
  98.162.25.29
  98.162.25.7
  98.162.96.40
@@ -103033,17 +102514,15 @@
  98.172.191.218
  98.172.31.3
  98.172.69.141
+98.172.93.87
  98.174.204.209
  98.175.197.111
-98.176.99.110
  98.178.240.9
  98.179.182.136
-98.180.217.149
  98.183.37.222
  98.184.33.193
-98.184.33.208
  98.184.33.210
-98.184.33.215
+98.184.33.221
  98.185.94.76
  98.185.94.94
  98.186.166.96
@@ -103052,33 +102531,31 @@
  98.188.47.150
  98.189.109.138
  98.190.102.40
+98.190.102.45
  98.190.102.62
  98.191.71.139
  98.192.74.164
  98.193.226.113
  98.195.176.219
-98.197.167.31
  98.197.37.7
  98.197.62.37
  98.198.28.199
+98.198.58.172
  98.198.66.110
  98.199.196.197
  98.200.189.189
-98.201.121.56
  98.202.232.157
  98.202.232.200
-98.202.242.231
  98.203.158.159
  98.203.162.230
-98.203.244.40
  98.206.254.200
-98.208.111.146
-98.21.60.201
  98.213.183.28
  98.217.124.239
  98.219.121.217
  98.219.172.82
+98.219.51.89
  98.220.181.15
+98.224.29.162
  98.224.62.239
  98.226.186.214
  98.226.204.55
@@ -103087,10 +102564,10 @@
  98.231.32.93
  98.231.33.178
  98.233.39.111
+98.234.185.70
  98.234.95.214
  98.236.166.189
  98.239.128.154
-98.24.30.170
  98.243.51.139
  98.246.66.238
  98.247.106.211
@@ -103106,13 +102583,14 @@
  98.26.226.238
  98.28.200.139
  98.29.18.119
-98.29.195.204
  98.32.83.73
  98.33.38.48
  98.34.81.140
  98.35.16.77
-98.36.161.129
+98.36.148.46
+98.36.89.139
  98.37.180.23
+98.38.164.169
  98.4.24.177
  98.42.43.106
  98.42.81.46
@@ -103160,7 +102638,6 @@
  99.119.110.201
  99.123.224.151
  99.127.234.110
-99.135.183.110
  99.14.51.66
  99.148.197.14
  99.152.32.222
@@ -103252,6 +102729,7 @@
  99.195.95.147
  99.195.95.191
  99.198.118.186
+99.199.142.224
  99.199.234.140
  99.2.136.115
  99.2.22.222
@@ -103265,7 +102743,8 @@
  99.239.41.18
  99.245.178.218
  99.25.248.162
-99.251.231.95
+99.251.64.186
+99.252.183.119
  99.252.189.19
  99.252.27.6
  99.255.184.174
@@ -103273,12 +102752,10 @@
  99.33.195.164
  99.34.232.58
  99.35.17.235
-99.4.181.245
  99.40.165.203
  99.47.110.147
  99.54.134.182
  99.56.114.255
-99.56.147.242
  99.58.163.117
  99.59.120.66
  99.65.75.153
@@ -103425,6 +102902,7 @@
  9z2f.brizy5.ru
  9zg.cc
  a-0rb.jaysbrand.com
+a-1.top
  a-1806-nb.com
  a-19.ru
  a-1xw.onderhost.com
@@ -103864,6 +103342,7 @@ aarkconstruction.com
  aarm-tniad.mil.id
  aaron.com.web.ve
  aaron.fansju.com
+aaron42363.xyz
  aaronrobertsondesign.com
  aaronsburgpottery.ru
  aaronthompson.ug
@@ -104171,11 +103650,9 @@ abn-listing-host-39002.site
  abn-mobiel.top
  abn-nb.welcome-guest-julia-29-sept-10-oct.host
  abn-update.link
-abn.app-host-list-48139.icu
-abn.app-list-61282.casa
-abn.app-list-61283.casa
-abn.app-list-91783.casa
-abn.app-list-97192.casa
+abn.app-host-list-28139.icu
+abn.app-host-list-89139.icu
+abn.app-list-74192.casa
  abn.co-host-listing-24560.casa
  abn.co-host-listing-24965.casa
  abn.co-host-listing-27401.casa
@@ -104815,6 +104292,7 @@ accentuatehost.com
  acceptemailaddress.com
  acceptfleet.club
  acceptfleet.com
+acceptfloridarevenue.com
  acceptinteractfound.xyz
  acceptprocess.webcindario.com
  accer.nikanbearing.com
@@ -104859,7 +104337,6 @@ accesoverificado.zz.com.ve
  access-3.com
  access-account.xyz
  access-ama-data-ttls-mycount-update.shiningring.net
-access-app-deny.com
  access-auth-secured.com
  access-boi.com
  access-d.000webhostapp.com
@@ -104873,7 +104350,6 @@ access-login.appl.com-case-id-bhuyias879sd.kajolfitzpatrick.com
  access-mobile-fargo.com
  access-my-payee.uk
  access-onlineclients.com
-access-paypai.servehalflife.com
  access-paypal.web.westandasoneblog.com
  access-paypal285.com
  access-prepayment.serveirc.com
@@ -104906,6 +104382,7 @@ accessform.hopto.org
  accessfreight.com.np
  accessheler.com
  accesshome-secondary.z13.web.core.windows.net
+accessibiltyorgligne.weebly.com
  accessible-news-service.kiylexcm.com
  accessid-signin-verifyaccount-secure-2396.numvarg.com
  accessid875678.com
@@ -104915,7 +104392,6 @@ accesso-app-mobile.com
  accesso-app.com
  accesso-area-clienti-fcc-id3086339004431200.000webhostapp.com
  accesso-bloccato.com
-accesso-conto-web.com
  accesso-conto.eu
  accesso-conto.info
  accesso-info-portale.net
@@ -104935,6 +104411,7 @@ accessoinstagramlogin.altervista.org
  accessonliiine.com
  accessopds2.000webhostapp.com
  accessopostale.com
+accessopsd2-web.com
  accessorya.com
  accesspower.buzz
  accesspress.rdsarkar.com
@@ -106094,6 +105571,7 @@ acrwlryardlnxepe-dot-millinium.ey.r.appspot.com
  acrylglasdesigncom.shaxiaca.top
  acs-word.com
  acs00.weebly.com
+acs1-sco1ta.hciobio.com
  acsbap.com
  acsboda.com
  acsbrokerage.com
@@ -106293,6 +105771,7 @@ activityskinmobilelegends7h.gq
  activityskinnewskof.ga
  activityskinnewskof.gq
  activmarkets.com
+activsecp.tmweb.ru
  actld.org.tw
  actn34acc01.xyz
  actofrage.nl
@@ -106346,7 +105825,6 @@ acupunctureup.in
  acustica.ec
  acusticjjw.pl
  acusyposaq.gq
-acute-excited-termite.glitch.me
  acutelogisticsltd.com
  acuzajt.gikorip.net
  acvdltpcdmmkdtdh-dot-millinium.ey.r.appspot.com
@@ -106521,13 +105999,13 @@ adekit.md
  adelahidalgo.com
  adelaidehc.com.au
  adelaideparkhomes.com
-adelantedigitalbbbvaamascercadeti.com
  adelartmoveis.com.br
  adelciflik.com
  adelcirp.com
  adelfarms.com
  adelinecristina.ru
  adelis.re
+adelove.tk
  adeluvtee.com
  ademaj.ch
  ademarojaya.com
@@ -106853,7 +106331,6 @@ adocmx.com
  adoemprendedor.creatorlink.net
  adolphsrealestate.com
  adon.one
-adonaeqvcrxzrqnxonvrkquszi-dot-gl9393jan.uk.r.appspot.com
  adongbook.com
  adongcomic.com
  adoptawufperuu.000webhostapp.com
@@ -107290,7 +106767,6 @@ aelogica.com
  aeloud.ru
  aelpk.com
  aelpsrsemzwnafja-dot-millinium.ey.r.appspot.com
-aelvpglvkkzevdtlykxtlbmcmz-dot-gl9393jan.uk.r.appspot.com
  aemqcgxbsfthwrth-dot-millinium.ey.r.appspot.com
  aeneolithic-patches.000webhostapp.com
  aenesde.com
@@ -107302,7 +106778,6 @@ aeolius.net
  aeonianmedia.com
  aeonluxe.com.ph
  aeoraliat.com
-aeowmdlqusdbfher.shop
  aepamimxnvoowpko-dot-millinium.ey.r.appspot.com
  aepbexpphdllcqdf-dot-millinium.ey.r.appspot.com
  aeqjjclqbukmcdsd-dot-millinium.ey.r.appspot.com
@@ -107635,7 +107110,6 @@ agarwalrishte.com
  agazetadepiraquara.com.br
  agbanibeautycontest.000webhostapp.com
  agbmjqadhpvqxpwc-dot-millinium.ey.r.appspot.com
-agbnwlvlogmwqogwvfvgjlxlxg-dot-gl9393jan.uk.r.appspot.com
  agbo-chinaonline.com
  agbofx.goruli.com
  agboolafarms.com
@@ -107887,6 +107361,7 @@ agrarimmo24.com
  agrarwirtschaftbiz.shaxiaprivacy.top
  agratama.xyz
  agrawalpackersmovers.com
+agreeablelividuserinterface.adasdfff.repl.co
  agreehillcheek.xyz
  agreement-id019.com
  agreement-id2020.com
@@ -107988,7 +107463,6 @@ agusbatik.xyz
  agustindivide.buzz
  agutukqxtrixbptwjvvcbatogajuhdkhwckb-dot-gl494903049.wl.r.appspot.com
  agvc.goruli.com
-agvfmekjjmmqynkjugzirwueig-dot-gleow2021ja.ue.r.appspot.com
  agvizhnkzzntnddq-dot-millinium.ey.r.appspot.com
  agvjidssqclenckj-dot-millinium.ey.r.appspot.com
  agvkafygnyqlgpkd-dot-millinium.ey.r.appspot.com
@@ -108041,7 +107515,6 @@ aherngangmes.com
  ahf4ycvea439tt9rq.site
  ahgdogalpazar.com
  ahger4334.duckdns.org
-ahgklexlhlsgngbteccfbfulvw-dot-gl9393jan.uk.r.appspot.com
  ahhcydtaugkgjchcu.com
  ahhkucqqxcyvudnj-dot-millinium.ey.r.appspot.com
  ahhpjj.com
@@ -108486,7 +107959,6 @@ ajbxuvlecof.xyz
  ajchuqbpnnhniogs-dot-millinium.ey.r.appspot.com
  ajczfarnbuggoejl-dot-millinium.ey.r.appspot.com
  ajdevelopmentgroup.com
-ajecwgrhdgblvwarnllvuflsie-dot-gl9393jan.uk.r.appspot.com
  ajedrezenmorelos.com
  ajeetbisen.com
  ajexdntaakevcvsc-dot-millinium.ey.r.appspot.com
@@ -108532,7 +108004,6 @@ ajs-c.com
  ajsdwzjuuqqekouongeqchhhcn-dot-gleowayel400503.uc.r.appspot.com
  ajstudiollc.com
  ajtz9.mentriqq.com
-ajtzgjnjoidhznatlgeccfpxeb-dot-gl9393jan.uk.r.appspot.com
  ajustconta.cf
  ajuste-centraliar-meu-cadastro.000webhostapp.com
  ajuwel.com
@@ -108638,13 +108109,11 @@ akioplt.com
  akiorg.batwoqishort.top
  akioyjyzmkzilblg-dot-millinium.ey.r.appspot.com
  akitaugandasafaris.com
-akitggdpyrceeovnhejugfrnwg-dot-gl9393jan.uk.r.appspot.com
  akitus.com
  akiwdzrsxaplelue-dot-millinium.ey.r.appspot.com
  akj-crypto.com
  akjfsdrfnem.com
  akjhgfdspokjhdss.000webhostapp.com
-akjhunhgfmexwjuflcoqpiiisz-dot-gl9393jan.uk.r.appspot.com
  akjskabd.weebly.com
  akjugm.shoesmogul.com
  akkauntmax4.myjino.ru
@@ -108683,7 +108152,6 @@ akprokonaija.com
  akpx.oujevais.com
  akqmedicine.com
  akqyuqqzzskdymtj-dot-millinium.ey.r.appspot.com
-akrapo-suz.club
  akraqa.com
  akratech.com
  akrbbkciorhdbupb-dot-millinium.ey.r.appspot.com
@@ -109455,7 +108923,6 @@ aliminksrl.ml
  alimstores.com
  alina.kenshung.com
  alinaltdwkz.ru
-alindew.tk
  alinebandeira.com.br
  alinestudio.co.za
  alinhador3d.com.br
@@ -109859,7 +109326,6 @@ alopsitta.vard-forum.ru
  aloput.xyz
  aloradovettiprocedereconilprocessodiesereattivo.accesscam.org
  alordharaschool.com
-alosalamfenhadlaghborakhayghberto.blogspot.com
  alosojosdelmundo.com
  alova.in
  alova.life
@@ -109996,7 +109462,6 @@ altaikawater.com
  altaiwork.buzz
  altaja.com.py
  altanyucetas.com
-altarcebicherorestaurantmuseo.com
  altarfx.com
  altaria.in
  altbiafm.com
@@ -110107,7 +109572,6 @@ alysonhoward.com
  alzaemalazawi2000.000webhostapp.com
  alzahrani-online.com
  alzheimersacademy.org
-alzhmpndglriiqeknssnxdjexi-dot-gl9393jan.uk.r.appspot.com
  alzjlmjgdqlhdviw-dot-millinium.ey.r.appspot.com
  alzknggmhnsdpgpd-dot-millinium.ey.r.appspot.com
  am-concepts.ca
@@ -110785,6 +110249,7 @@ amazon-signinauth.servequake.com
  amazon-signinship.serveirc.com
  amazon-smile.servehalflife.com
  amazon-soporte.com.mx.74938567.cf
+amazon-suport-storejpouaskmeduiosaiuasaoukcom003.gq
  amazon-supply.aweytrhd.com
  amazon-support-sppapahiseuzc54nqsixbqpcnmmuhqst197o879oukcom.cf
  amazon-support-sppapahiseuzc54nqsixbqpcnmmuhqst497o879oukcom.ml
@@ -110888,6 +110353,7 @@ amazon.1zc.top
  amazon.214u21o120h821hhnd.tyuij.com
  amazon.4mq.top
  amazon.9qjja.top
+amazon.9zbbg8ileoyua4hk1slzo1x0pgivztst.monster
  amazon.account-servicelimit.com
  amazon.account-update.account.4560eee3feb4def7daf0619.info
  amazon.account-update.amaccount.10ef32408aa3ac141f4d.monster
@@ -112175,6 +111641,7 @@ amensalisme2.000webhostapp.com
  amenterprise.info
  ameofertassemana.com
  ameprodutos.com
+ameprodutoverao-com.umbler.net
  amepromomais.com
  amerallas.xyz
  amerarani.com
@@ -112399,7 +111866,6 @@ ameyewear.com
  amezglobal.com
  amezon-dymh.org
  amezon-fuui.cc
-amezon-restore-access.jdevcloud.com
  amezonjp.work
  amezonn-co.ooo
  amezonn-coo.oaao.ph
@@ -112592,7 +112058,6 @@ amozon.co.jp.aeabkm9567.icu
  amozon.co.jp.aghcy5455.icu
  amozon.co.jp.signine-amnzocn.in
  amozon.co.jp.sing-amonan.top
-amozon.co.jp.sing-amzonaz.top
  amozon.co.jp.sinng-amuano.in
  amozon.co.jp.sinung-aoumeon.cc
  amozon.co.jp.siung-amuzanou.cc
@@ -112607,7 +112072,6 @@ ampersandindia.com
  amphibischeswohnennet.shaxiacommittee.top
  amphibito.xyz
  ampisolabergeggi.it
-ampkgmbvtysiniozlfwpzneaex-dot-gl9393jan.uk.r.appspot.com
  amplifyonline.co.za
  ampogrewit.gq
  ampoidal.com
@@ -112619,7 +112083,6 @@ ampunnengnabillah.servebeer.com
  ampvaqourgjkjcngsofezmklcwvjkxjcnwvx-dot-cedar-code-289917.nn.r.appspot.com
  amqelendez.com
  amqkasiveongxbal-dot-millinium.ey.r.appspot.com
-amqqasocbzttpraiuwwioatkjo-dot-gl9393jan.uk.r.appspot.com
  amrcdukmhypsffbcyq.top
  amrcin-co-jpservice.xyz
  amrdlm.goruli.com
@@ -112649,7 +112112,6 @@ amsaiudhasiodhjnasuiohgdqwiofjiogjwepqfgaszdfcqaswdfqaw.asiofhunjqioaaosidhaio.s
  amsder.com
  amsdsa12dsbdl.yhrmktf.cn
  amsev.com
-amshcamcrtgeetzbxbbzigpbjr-dot-gl9393jan.uk.r.appspot.com
  amsjcwqgspidgvvi-dot-millinium.ey.r.appspot.com
  amsjeggegsd.com
  amsjeggegsdbhfg.com
@@ -112879,7 +112341,6 @@ anaokullariburada.com
  anapa-print.ru
  anapavin.ru
  anapen.ie
-anapharm-ks.com
  anaqiz.ir
  anaracademy.ir
  anarchitecturestudio.com
@@ -112922,7 +112383,6 @@ anbg.addroits.com
  anblllmpsgtbcsuecodrelolfjwyjwaydmmf-dot-cryptic-now-290917.ey.r.appspot.com
  anbtjmtcuruqqvig-dot-millinium.ey.r.appspot.com
  ancelsa.com
-anchaltest.000webhostapp.com
  anchicand.xyz
  anchordistilling.net
  anchormarineqroup.com
@@ -113327,6 +112787,7 @@ annazom.buzz
  annazom.space
  annazon-chikes-co-jp.in-actiche.top
  annazon-loginto.jp.busoi.buzz
+annazon-vpsupportinto-co-jp.isoajm-cxakl.top
  annazon.club
  annazon.co.jp.praxgkm.cn
  annazon.co.uk
@@ -113606,7 +113067,6 @@ anvexo.com
  anvietlong.com
  anvietpro.com
  anviladvantage.xyz
-anvjrqzkcahqpxmoxjbmtomiph-dot-gl9393jan.uk.r.appspot.com
  anvnifqidntmyfjn-dot-millinium.ey.r.appspot.com
  anwbxdzqinrmyvibcootvagjgfzlrffvdntm-dot-solar-vertex-285913.rj.r.appspot.com
  anwdqdpgzongugrmftnmfwsaviitnhjvvkab-dot-solar-vertex-285913.rj.r.appspot.com
@@ -113631,7 +113091,6 @@ anywhereubiquity.com
  anz-access.site
  anz-cancel.info
  anz-card-payments.com
-anz-help.info
  anz-online.xyz
  anz-reviewaccount.com
  anz-verification.info
@@ -113669,7 +113128,6 @@ aoemxuehqsdyoeax-dot-millinium.ey.r.appspot.com
  aofcdady.shoesmogul.com
  aofhpe.com
  aofnw3ew6wf11-fw-s4tv2.wtf
-aogdnfgrhbnvzsnjqagghoseqs-dot-gl9393jan.uk.r.appspot.com
  aognlumtpshczrwh-dot-millinium.ey.r.appspot.com
  aohhoopk.top
  aohrhlscmehdyibb-dot-millinium.ey.r.appspot.com
@@ -114020,6 +113478,7 @@ apkplayonline.com
  apkpure.ai
  apksimon.mrslove.com
  apkthxrofkluxqbd-dot-millinium.ey.r.appspot.com
+apktuyul.otzo.com
  apkupdatessl.co
  apkwallets.com
  apl.camdvr.org
@@ -114180,7 +113639,9 @@ app-gestaocaixaonline.com
  app-gestaodeatualizacao.com
  app-go.website
  app-halifax-mobileapp-verify.com
-app-host-list-28139.icu
+app-host-list-38139.icu
+app-host-list-48139.icu
+app-host-list-78139.icu
  app-id-verification-online-account.haustierberatung.info
  app-idserviceaccountcloudactivator12392312.boldexperiencebyme.info
  app-intesa.com
@@ -114191,13 +113652,18 @@ app-itaudigital.jdevcloud.com
  app-itaviagens.com
  app-limites.me
  app-list-29301.casa
+app-list-43281.casa
  app-list-46519.casa
+app-list-61281.casa
+app-list-61282.casa
+app-list-61283.casa
+app-list-61289.casa
  app-list-65301.casa
-app-list-77199.casa
  app-list-79301.casa
  app-list-86519.casa
-app-list-92152.casa
+app-list-91283.casa
  app-list-95301.casa
+app-list-97197.casa
  app-list-97301.casa
  app-localbitcoins.com
  app-login-verifys.com
@@ -114243,7 +113709,6 @@ app-onlinemobileappsecurehalifacxappsecure.mrtraveller.ir
  app-onlinemobileappsecurehalifacxappsecure.wikiamuz.ir
  app-paymentcancel.theworkpc.com
  app-personnalite.com
-app-portalpersonalit.com
  app-post-suisse-ch.com
  app-regularizecadastrobb.com
  app-reports.curiousmedia.com
@@ -115916,6 +115381,7 @@ applepay-mania.com
  applepay8459.webredirect.org
  applepay8818.accesscam.org
  applepaymentpartner.com
+applepayments01.ddns.net
  applepayshipping.serveirc.com
  applepie.pizza
  applepops.com
@@ -116395,6 +115861,7 @@ apps7985.nonameqwer51.live
  apps8911.nonamerav62.live
  apps9453.chksrvnewtoday50.live
  appsacountqa.servehttp.com
+appsaldaoame.online
  appsales-mextra-adminpubg.co.uk
  appsamzmaillamazon.lookingfororder.com
  appscadastro.com
@@ -116543,7 +116010,6 @@ apronreassure.co.za
  aproveedspaqesdisableds0987.gq
  aproveedspaqesdisableds4567432.gq
  aproveita-e-compra-agora.com
-aproveitandoagora.online
  aproveitaquedatempo.com
  aproveite-dia-dos-pais.online
  aproveite-essa-oferta.com
@@ -116553,6 +116019,7 @@ aproveiteamaiorlojaonline.com
  aproveiteblackoff.64-b.it
  aproveitegrandediadecomprarbarato.club
  aproveitehojee.online
+aproveitehooje.online
  aproveitemesdejulho.com
  aproveiteojavirtualofreta.com
  aproveitesempreconsciente.com
@@ -116662,6 +116129,7 @@ aquaud.ga
  aquazoneamqui.com
  aquda.cam
  aquelelanchao.com.br
+aquerquelbunm.buzz
  aquicardia.fr
  aquiferchidet.com
  aquilastudios.se
@@ -116868,7 +116336,6 @@ areablankserver.tk
  areac-agr.com
  areaclienti-ppl.net
  arealrionegro.com.br
-areaofficeonaging-com.ga
  areaparticulares-smartsantandr.com
  areashusht.com
  areasistemasbngobiper.com
@@ -117006,7 +116473,6 @@ argentum72.ru
  arghyabiswas.com
  argirioucom.chifanbob.top
  argirioucom.chifanbudget.top
-arglkacyeiwtovvutgzwpydrht-dot-gl9393jan.uk.r.appspot.com
  argogroupus-com-dot-gl494903049.wl.r.appspot.com
  argolhatitirlatq-dot-millinium.ey.r.appspot.com
  argolidafish.gr
@@ -117103,7 +116569,6 @@ arkkgveowtgvdskuvtxsyiommj-dot-gleowayel400503.uc.r.appspot.com
  arkkjasd.de
  arks.dilshantg.com
  arks.ganeshasolutionz.in
-arkservicos.com.br
  arkymdevelopmentscorp.com
  arlaghana.com
  arlaka.com
@@ -117208,8 +116673,6 @@ arpersenoa.com
  arpeysappliancerepairs.com
  arpmgfvfyvszgfjd-dot-millinium.ey.r.appspot.com
  arportfolio.rahmanmahbub.com
-arpstulqvxpwacowvojdnupqbt-dot-gl9393jan.uk.r.appspot.com
-arpztwhbussccxjvpjabvjfaew-dot-gl9393jan.uk.r.appspot.com
  arq10x.com.br
  arqdesignconstruct.com
  arquitectonicamente.com
@@ -117251,7 +116714,6 @@ arsczsas.000webhostapp.com
  arsczsps.000webhostapp.com
  arsczsvz.000webhostapp.com
  arsenel-bg.com
-arsenic-outboards.000webhostapp.com
  arsgdcxdfgh.space
  arshallhe.com
  arshermeneutica.org
@@ -117633,7 +117095,6 @@ asd71.com
  asd8uiahsdias.herokuapp.com
  asda-pranenich.ga
  asdadqwdas.tk
-asdalzkeeesxgxnexcsdlbaecl-dot-gl9393jan.uk.r.appspot.com
  asdaplus-jp.com
  asdasd.gasdasd.top
  asdasd.kahulasup.ch
@@ -118356,7 +117817,6 @@ atbuilds.info
  atbxjtockqsuybhe-dot-millinium.ey.r.appspot.com
  atccn3.it
  atcenterla.com
-atcfowihqwiawqugaxdiahtjkx-dot-gl9393jan.uk.r.appspot.com
  atchec.com
  atcq.jaysbrand.com
  atd-636-jf73-jfj6-65e.weebly.com
@@ -118590,7 +118050,6 @@ atozmfactuing.top
  atozsewa.com
  atp5.jaysbrand.com
  atphwsyxecebtpx.serveirc.com
-atplcjkkdrmxhmsesczpgsrcvt-dot-gl9393jan.uk.r.appspot.com
  atprofessional.org
  atpuddrmhtgrhyyp-dot-millinium.ey.r.appspot.com
  atqdhb.goruli.com
@@ -118858,7 +118317,6 @@ attdomainsvice.weebly.com
  attdomainupdates.weebly.com
  attdomainupdatesvsz.weebly.com
  attdomainverification.weebly.com
-attdomainwebsiteservice.weebly.com
  attdommaa.weebly.com
  attdoonnetworksercvive.weebly.com
  attdsgd.yolasite.com
@@ -119180,6 +118638,7 @@ attnijalia.weebly.com
  attnnet.weebly.com
  attnnyyytttyypp11lpl.godaddysites.com
  attnotification23oo.weebly.com
+attnotificationyouremailytirtfi65ghhgk.weebly.com
  attnowservers.weebly.com
  attntwodbdhjnshxvcfconnect.weebly.com
  attofficeadminverification.weebly.com
@@ -119401,7 +118860,6 @@ attttnetenet.weebly.com
  atttttnet.weebly.com
  attttttmaiiillliiingbox.weebly.com
  attttttt223.weebly.com
-atttttttmaff.weebly.com
  attttttttttttttttt.weebly.com
  atttttttttttttttttttt.weebly.com
  atttttttttttttttttttttttlikkknlink.weebly.com
@@ -119829,7 +119287,6 @@ aupayicloud.com
  aupvfp.com
  auq-c6opa-agora-sim-tudo-de-bom.com
  auqsuiqrfghiabjn-dot-millinium.ey.r.appspot.com
-auquafinera.tk
  auraco.ca
  aurainside.bid
  auraokg.com
@@ -119916,7 +119373,6 @@ auth-account.wells-informs.com
  auth-accountapp.com
  auth-accountstore1.servebeer.com
  auth-acessobr.club
-auth-added-payee.co.uk
  auth-amazon-customer-suspend.recoveryappamz209382.com
  auth-amazon-customer-suspend.restored.maile-revoverapp.com
  auth-amazon-customer-suspend.restored.reocver-intlp.com
@@ -120037,6 +119493,7 @@ auth.contentforyouconductper.com
  auth.dashboardchase.com
  auth.findsolutiontoyourproblems.com
  auth.instag.repl.co
+auth.lacebook.gq
  auth.myaccount-servicecaroseuverified.bustyirodx.com
  auth.netflix.logs.com.khanza.biz.id
  auth.pageid-support.appleid.apple.com.farleysbsikuit.com
@@ -120402,7 +119859,6 @@ automodelismo-rc.com.br
  automotive-group-item9340.com
  automotrizoregon.cl
  automyography.net
-autonation-excellent-page-servers.my.id
  autonews.cardaddy.com
  autoone.co.in
  autoowamail.web.app
@@ -120743,7 +120199,6 @@ avviso-cliente.com
  avvxxtjvssdhnwrt-dot-millinium.ey.r.appspot.com
  avwggdhwxehgfumqqefbmoffffomyhgqppdz-dot-cryptic-now-290917.ey.r.appspot.com
  avwggdhwxehgfumqqefbmoffffomyhgqppdz.cryptic-now-290917.ey.r.appspot.com
-avwqitjccccleaomkwiwilmaof-dot-gl9393jan.uk.r.appspot.com
  avwu.handipants.com
  avxxvxz.jpjd.xyz
  avz-pr.com
@@ -120916,7 +120371,6 @@ awxjsogo.goruli.com
  awxo.000webhostapp.com
  awxpyjtjkoquavwo-dot-millinium.ey.r.appspot.com
  awxxournowehvnrexohwjlodzg-dot-gleowayel400503.uc.r.appspot.com
-awyoojyexlducjpaltcpexrndu-dot-gl9393jan.uk.r.appspot.com
  awzevpuboaaxmqsy-dot-millinium.ey.r.appspot.com
  awzoiiuxiabjrcxl-dot-millinium.ey.r.appspot.com
  ax196.com
@@ -120956,9 +120410,7 @@ axeonerat.zapto.org
  axer82456238.xyz
  axeraan.com
  axerooms.com
-axesxceslljvlhjwhjpxxkndxn-dot-gl9393jan.uk.r.appspot.com
  axg1.awaykart.com
-axgsolutions-a.ml
  axgsolutions-authentication.gq
  axgsolutions-authentication.ml
  axgssolutions.com
@@ -120972,7 +120424,6 @@ axgxskdtpeamcfpk.top
  axhciqibbwpqccaq-dot-millinium.ey.r.appspot.com
  axhsljgoyvbowzwc-dot-millinium.ey.r.appspot.com
  axi.topkorder.su
-axijshetymczlwdxswfylmgzdw-dot-gl9393jan.uk.r.appspot.com
  axikrwgjsmloellx-dot-millinium.ey.r.appspot.com
  axisneglect.guru
  axisymmetryelegised.net
@@ -121005,7 +120456,6 @@ axqjxieudijvqzjf-dot-owaonk399399393.uk.r.appspot.com
  axrlwc.goruli.com
  axse.duckdns.org
  axset.xyz
-axsjqxvjbqkygqyncpwtrgmryc-dot-gl9393jan.uk.r.appspot.com
  axsn.goruli.com
  axstw.xyz
  axsvzdanyelsoebzommwpzlbbq-dot-gleowayel400503.uc.r.appspot.com
@@ -121195,7 +120645,6 @@ aywdjgiyuehcbcuv-dot-millinium.ey.r.appspot.com
  aywvfugqvqjlgfvolqnvufodoz-dot-gleowayel400503.uc.r.appspot.com
  ayxa.nicedayjp.com
  ayxcsfkosrzprige-dot-millinium.ey.r.appspot.com
-ayxsmlmbjjqdxkshuzyfagzari-dot-gl9393jan.uk.r.appspot.com
  ayy-85-com.preview-domain.com
  ayyappantat.com
  ayycxmzvkrulobif-dot-millinium.ey.r.appspot.com
@@ -121261,7 +120710,6 @@ azg.goruli.com
  azgwhozb.ug
  azhand-gostar.ir
  azharsultan.com
-azhmxvhuwzpcrldnrcdrmhimhz-dot-gl9393jan.uk.r.appspot.com
  azhq.svcoding.com
  azhub.us
  azhydugigfzevdyi-dot-millinium.ey.r.appspot.com
@@ -121396,7 +120844,6 @@ azvszxc.000webhostapp.com
  azvszxzs.000webhostapp.com
  azvzxsz.000webhostapp.com
  azwsza.000webhostapp.com
-azwylplgtgnftcbhrtxqyjwrba-dot-gl9393jan.uk.r.appspot.com
  azxcvb.ml
  azxde.xyz
  azxilwogjnrbzrrr-dot-millinium.ey.r.appspot.com
@@ -121937,6 +121384,7 @@ baimpaulaas.theworkpc.com
  baimpaulalivecoy.000webhostapp.com
  baimpaulauang66.000webhostapp.com
  baimwongofficial.000webhostapp.com
+baimww.duckdns.org
  baionmsans.xyz
  baiosystembiz.shuiaeat.top
  bairan.net
@@ -122119,7 +121567,6 @@ bambamli.com
  bambamsed.ml
  bambathamobileloans.co.za
  bambinos.bounceme.net
-bamboo-win.000webhostapp.com
  bamboobypanda.com
  bamboomogleyt.com
  bambudeposu.com
@@ -122161,7 +121608,6 @@ banc0estad0.cl.esmac.com.br
  banca-bpm-italia.com
  banca-electronica-cajamar.com
  banca-en-linea.personas.wtmeys.club
-banca-general01.webcindario.com
  banca-impresa.com.ru
  banca-mobile.com
  banca-mps-info.com
@@ -122773,6 +122219,7 @@ bansm.com
  bansofsameriicas.com
  bansucurcolombia.webcindario.com
  bantalguleng.000webhostapp.com
+bantengadu.otzo.com
  bantenpipa.com
  banti-rose.com
  bantil.us
@@ -123105,6 +122552,7 @@ batdongsanhuyphat68.com
  batdongsanjob.com
  batdongsanminhmanh.com
  batdongsanq9.net
+batdongsanvip.com.vn
  batdongsanvngod.com
  batech.com.pk
  bateriano.email
@@ -123410,7 +122858,6 @@ bbvavirtual.ga
  bbviners.cf
  bbwstocking.com
  bbxmail.gdoc.sercelinsaat.com
-bbydjkwpdfuwmnypeiifyynkne-dot-gl9393jan.uk.r.appspot.com
  bbypass.pw
  bbzanyfjboywxxkfoyooobujftphfrdesxii-dot-cryptic-now-290917.ey.r.appspot.com
  bbzvxcsasd.firebaseapp.com
@@ -123453,7 +122900,6 @@ bcem.ie
  bcevdncwkpprhpfs-dot-millinium.ey.r.appspot.com
  bceysigorta.com
  bcfe.awaykart.com
-bcggiuprkdidpsfbdxccyybfhi-dot-gl9393jan.uk.r.appspot.com
  bcgk.shoesmogul.com
  bchawda.com
  bchecklist.com
@@ -123984,7 +123430,6 @@ beautyscissor.com
  beautysel.com
  beautyveins.com
  beautywork.in
-beaverdamcondoms.com
  beavohroot.com
  beaware.flbanqofme.com
  beawvlgjpuqioovh-dot-millinium.ey.r.appspot.com
@@ -124015,7 +123460,6 @@ becharakam.ddns.net
  bechemical.net
  bechtelar.buzz
  bechtelarland.buzz
-becjdeymmlcwvjmyqmimiaabsd-dot-gl9393jan.uk.r.appspot.com
  becjmqxowutitycu-dot-millinium.ey.r.appspot.com
  becker-tm.org
  beckerrapid.buzz
@@ -124161,6 +123605,7 @@ beibei.xx007.cc
  beibfqywug.duckdns.org
  beicapellipdx.com
  beiercrescentapt.buzz
+beigebiodegradablebackend.josealbertoal21.repl.co
  beihai.06wi.com
  beiifightcovid.com
  beijingdelay.com
@@ -124290,7 +123735,6 @@ bellsouthupdate.weebly.com
  bellspalsy.info
  bellstechfashionshow.000webhostapp.com
  bellstore.000webhostapp.com
-bellsttattnetverify.weebly.com
  bellvada.co.id
  bellwireles.site
  bellychef.com
@@ -124483,6 +123927,7 @@ berbagivideoviral.onedumb.com
  berbagivideoxxx-wa.v-25.com
  berbagividiohot.wa-hotnew.tk
  berbagividiohotwhatsapp.holl88.com
+berbagividioviral.ikwb.com
  berbagividiowatsap.000webhostapp.com
  berbercommunicatie.nl
  berbereen-online.webboostt.com
@@ -125050,7 +124495,6 @@ betypark.serveminecraft.net
  betzq.com
  beu-hr.com
  beuiawaonxussqhc-dot-millinium.ey.r.appspot.com
-beujwkowdsfftclnjqzzcuovco-dot-gl9393jan.uk.r.appspot.com
  beurrtwvbjddvqcmshfinzlxul-dot-gleowayel400503.uc.r.appspot.com
  beutify.com
  beutifydesktop.com
@@ -125207,7 +124651,6 @@ bgaccountinggroup.com
  bgasa.com
  bgasnipnxhlvnguu-dot-millinium.ey.r.appspot.com
  bgayra.pw
-bgbiqhkbmvkgovtxmnfxcrjmbm-dot-gl9393jan.uk.r.appspot.com
  bgbzohftpn.duckdns.org
  bgcapatftvroshov-dot-millinium.ey.r.appspot.com
  bgcdhsujcoyqcmvt-dot-millinium.ey.r.appspot.com
@@ -125274,7 +124717,6 @@ bgthele.com
  bgtnw.jaysbrand.com
  bgtritjpyjtkijto-dot-millinium.ey.r.appspot.com
  bgtyw.xyz
-bgupvsqprgifftnligltuevglj-dot-gl9393jan.uk.r.appspot.com
  bgvhfnyhsgvwatt.weebly.com
  bgviscnjd.goruli.com
  bgybahxayicfsfqoruwvnazurrjokjkcvavn-dot-gl494903049.wl.r.appspot.com
@@ -125697,7 +125139,7 @@ billing-mythree.net
  billing-net1.com
  billing-netflix.me
  billing-netflixsubscription.com
-billing-o2-monthlysupport.com
+billing-o2-via.com
  billing-o2info-help.com
  billing-payment.cfahrippks.com
  billing-paymonthly.com
@@ -126305,13 +125747,11 @@ bjykb-----login.ygber.com
  bjym7.weblium.site
  bjyxsj8.com
  bjzgzjnymmkscwgsdunurgspeska.top
-bjziywguihufkjsitjmsrhitrb-dot-gl9393jan.uk.r.appspot.com
  bjzzmbhhgkczdpjk-dot-millinium.ey.r.appspot.com
  bk-4n.mentriqq.com
  bk-coin.com
  bk-gfi.com
  bk3gold.com
-bkaacwijyfatmfudkymzuusnyz-dot-gl9393jan.uk.r.appspot.com
  bkagrosprayers.com
  bkbodnboxtwugdwv-dot-millinium.ey.r.appspot.com
  bkcf-line.com
@@ -126633,7 +126073,6 @@ bllqbkjxlfhnnyjb-dot-millinium.ey.r.appspot.com
  blmihrwirdgesperrt.needyourconfirm.net
  blmrbl.space
  bln-product.com
-blnyjvorzoeruvhquukmivyptw-dot-gl9393jan.uk.r.appspot.com
  blobfeed.com
  blobim.club
  blocco.intesa-servizio.info
@@ -126912,6 +126351,7 @@ blue-port.jp
  blue-yame-5396.penne.jp
  blue.engprod.consumer.fe-spectrum.net
  blue02.club
+bluebadge-helpcenter-verify.ml
  bluebadge-instagram.epizy.com
  bluebadge-lnstagram.com
  bluebadgeinstagram2020.gq
@@ -126971,7 +126411,6 @@ bluemarble.cloud
  bluemontva.xyz
  bluemoonholidaysbd.com
  bluemooselounge.com
-bluemotos.com
  bluemttours.com
  bluemushroom.com.au
  bluenewsletter.ml
@@ -127088,7 +126527,6 @@ bmixcomunicacao.com.br
  bmjpinqtun.com
  bmkdnd.com
  bmkopjrnhmpcoppp-dot-millinium.ey.r.appspot.com
-bmldvlbnpukzgrwntfdlussapc-dot-gl9393jan.uk.r.appspot.com
  bmlkochi.com
  bmlstgngbhstlog.my.id.akknggwpstpblmrlog.my.id
  bmmihwemlyswiess-dot-millinium.ey.r.appspot.com
@@ -127098,7 +126536,6 @@ bmmufuhhdkwricds-dot-millinium.ey.r.appspot.com
  bmo.ways-to-bank.buzz
  bmoabogados.com
  bmovieapp.com
-bmpawrjdwbxcjquszdqdfzyyzi-dot-gleow2021ja.ue.r.appspot.com
  bmpsmnlrgdhkgcgl-dot-millinium.ey.r.appspot.com
  bmpssjajjtjxiguc-dot-millinium.ey.r.appspot.com
  bmpzsxdlrupwpdyr-dot-millinium.ey.r.appspot.com
@@ -127113,7 +126550,6 @@ bmskdn.com
  bmssw.org
  bmsystem.ro
  bmti.com.np
-bmtlzcqthrvibhuqwibhboozrd-dot-gl9393jan.uk.r.appspot.com
  bmttcbari.com
  bmub.goruli.com
  bmvdsisqqqhjatojsxqbdzmftd-dot-gloff849483.uk.r.appspot.com
@@ -127464,7 +126900,6 @@ bofa-wna.com
  bofa-wqs.live
  bofa-www.com
  bofa2317.webcindario.com
-bofa3709l6824.secure-datainfo.in
  bofaappsystemds.com
  bofaasjgfj.outdoorvaseproducts.top
  bofabusiness.us
@@ -127608,7 +127043,6 @@ bokep18.boom27.gq
  bokep18.group-whatsapp-zz.cf
  bokep18chat.wikaba.com
  bokep18join.send20.gq
-bokep18nibos.000webhostapp.com
  bokep2020.ocry.com
  bokep2020gratis.zyns.com
  bokep2020hot124.000webhostapp.com
@@ -127625,7 +127059,6 @@ bokepbangbang.000webhostapp.com
  bokepbaruviral.servemp3.com
  bokepbos.new9.my.id
  bokepchat.wa-18.com
-bokepchatgruop1.ml
  bokepchinahot.xxuz.com
  bokepcrott00.bokep-ind.com
  bokepdewasa.whatsapp77.my.id
@@ -127645,7 +127078,6 @@ bokephot18xxterbaru.000webhostapp.com
  bokephotdijamin.crotsz.com
  bokephotterbaru18.event16.com
  bokephotwhatsappgrup2020.fiwvw.ml
-bokephusus18.000webhostapp.com
  bokepind18.000webhostapp.com
  bokepinddo.gq
  bokepindo-grupgadis-vcs-gratis-cewekindonesia.000webhostapp.com
@@ -127692,7 +127124,6 @@ bokepspecialcovid19.event-indo.com
  bokepsugionogan.xxxy.biz
  bokepterbaru-whatsappindonesiahot.wa-xxx18.ga
  bokepterbaru1.tk
-bokepterbaru18keatas.000webhostapp.com
  bokepterbaru2020.xvip.my.id
  bokepterbaru2020grubnew.getsviip7.com
  bokepterbruviral2020indonesialih.000webhostapp.com
@@ -127859,7 +127290,6 @@ bonitamagia.cl
  bonjourinternet.000webhostapp.com
  bonlines.000webhostapp.com
  bonmarartleewik.com.au
-bonmayromer.tk
  bonn-arte.co.uk
  bonneausc.buzz
  bonniebinary.co.uk
@@ -127996,7 +127426,6 @@ boozekrewes.com
  boozzdigital.com
  bop.binaryoptionsprofitmachine.com
  bopheloclub.org
-bopnsosdfleztwxzsuazpomrox-dot-gl9393jan.uk.r.appspot.com
  boquan.net
  boqvl.417mcp.com
  bor-demir.com
@@ -128237,6 +127666,7 @@ boxberry-safepayment.ru
  boxberry-sends.ru.com
  boxberry-to.ru
  boxberry-webpage.ru
+boxberry-xpay.live
  boxberry-yshop.ru
  boxberry.or-pay.ru
  boxberry.order-safety.ru
@@ -128431,7 +127861,6 @@ bqrhfdnwoqjczavg-dot-millinium.ey.r.appspot.com
  bqtvunkiyhrbzikg-dot-millinium.ey.r.appspot.com
  bqtzgrbdcbzqcjry-dot-millinium.ey.r.appspot.com
  bqvkzzmtlxbifrfd-dot-millinium.ey.r.appspot.com
-bqwreornkqhrintjovrejzjjps-dot-gl9393jan.uk.r.appspot.com
  bqwrqoujurgbfetm-dot-millinium.ey.r.appspot.com
  bqxyc.com
  bqzgqdkjsfschupjst.top
@@ -129184,8 +128613,6 @@ brpak.com
  brpuwuocznmqbywo-dot-millinium.ey.r.appspot.com
  brrlolrb.info
  brroduvnaatlwncbimgzuevjfqntkhnfyxlf-dot-cryptic-now-290917.ey.r.appspot.com
-brrtqgrrlcarphkpuxrnmisglc-dot-gl9393jan.uk.r.appspot.com
-brrvjofjinkyhbzyvixzpslieq-dot-gleow2021ja.ue.r.appspot.com
  brsbrosker.ml
  brsemprepresente.com
  brsydl.cn
@@ -129312,6 +128739,7 @@ bsgui.com
  bsgye.xyz
  bsh3uy.xyz
  bshbayjqpajqi.com
+bshdnewj.mdfhnewjyqfrelpafd.shop
  bsheg.xyz
  bshsw.xyz
  bshu31.xyz
@@ -129331,9 +128759,7 @@ bsknz.ga
  bskpwjueqpjqsfre-dot-millinium.ey.r.appspot.com
  bsllock.zzuxx.my.id
  bslmdgevnsuceozd-dot-millinium.ey.r.appspot.com
-bslofxlppmqribqybdsundqbzz-dot-gl9393jan.uk.r.appspot.com
  bsltd059.net
-bslyxqakhqlastsohwlwthihef-dot-gl9393jan.uk.r.appspot.com
  bsm-be.firebaseapp.com
  bsmart-solutions.com
  bsmcqgstedmcegnwaczpyapauxzrduyubisr-dot-glegen303939423233.ue.r.appspot.com
@@ -129531,7 +128957,6 @@ btwwwfs.icu
  btx.goruli.com
  btxl.goruli.com
  btxmail.uk.r.appspot.com
-btxrsbjwehktchelgmxrbvekbl-dot-gl9393jan.uk.r.appspot.com
  btyiuskahserves.weebly.com
  btynmorilvaujefl-dot-millinium.ey.r.appspot.com
  btyqsbngoliyhueyufmswoifzn-dot-gloff849483.uk.r.appspot.com
@@ -130071,7 +129496,6 @@ butyconversesklep.com
  butyniketanio.pl
  buulyoponjpiwgcikx.top
  buuwong-watts-project.bftrtdfg.com
-buuybnhifcoextapaniqdxorxv-dot-gl9393jan.uk.r.appspot.com
  buvdclgkccmxhplw-dot-millinium.ey.r.appspot.com
  buwong-puyuh.dungvkci.com
  buxdoxmytmdalfdh-dot-millinium.ey.r.appspot.com
@@ -130194,7 +129618,6 @@ bvfqfphhk.xyz
  bvfufqjexicpqiwtiifpukfkqacypbuwvhmn-dot-glegen303939423233.ue.r.appspot.com
  bvgvoyehxrrughbw-dot-millinium.ey.r.appspot.com
  bvhcrzwzppeopnadpprrwihhao-dot-gleowayel400503.uc.r.appspot.com
-bvhpxdddxalbgpavogmrlxlzlq-dot-gl9393jan.uk.r.appspot.com
  bvirtuouswear.com
  bvjaxokraphkqxqzgoobyutduw-dot-gl9393jan.uk.r.appspot.com
  bvjdgxvzegpfackydb.top
@@ -130216,7 +129639,6 @@ bvsbi.com
  bvshzdffgixkzmcr-dot-millinium.ey.r.appspot.com
  bvsxuumuexojhils-dot-millinium.ey.r.appspot.com
  bvtai.dhhlch.club
-bvtgcfpknkjahoyezikkjdcutk-dot-gl9393jan.uk.r.appspot.com
  bvuyeiaflygqpytwsxmlgqfupoiaujrdgnxy-dot-glxcel49934343434.rj.r.appspot.com
  bvvosmpgfubihgut-dot-millinium.ey.r.appspot.com
  bvvsnet.com
@@ -130230,6 +129652,7 @@ bw0ds.mentriqq.com
  bwaez.xyz
  bwbnhhjtoawzshsktaktfcndok-dot-gleowayel400503.uc.r.appspot.com
  bwbskmpvlsmbeovw-dot-millinium.ey.r.appspot.com
+bwdoutyovftlqqxdaqevbzexfr-dot-gleow2021ja.ue.r.appspot.com
  bwe8.byethost12.com
  bweam.app.link
  bweaqvmxakxugfcq-dot-millinium.ey.r.appspot.com
@@ -130301,7 +129724,6 @@ bxnjggghshwjotky-dot-millinium.ey.r.appspot.com
  bxogfbyxdoyepwollgoyfhhvcu-dot-gl9393jan.uk.r.appspot.com
  bxp0.svcoding.com
  bxpaffc.com
-bxplaoipllmbyrmllivmqdhrbi-dot-gl9393jan.uk.r.appspot.com
  bxpsdamgucjyaqkm-dot-millinium.ey.r.appspot.com
  bxqbactellkbgptudfwtzmneefjbmtvvsjac-dot-cedar-code-289917.nn.r.appspot.com
  bxqnlo.goruli.com
@@ -130395,7 +129817,6 @@ byukattie.top
  byuroperevodovonline.work
  byuyoxryzbszzeyixtcwtwfyqj-dot-gleowayel400503.uc.r.appspot.com
  byvfhjarbrhkqkkmihlgtkbuvtrmbrtxqzda-dot-cryptic-now-290917.ey.r.appspot.com
-byvhrsgksrmzmgwgtjbuuqkrae-dot-gl9393jan.uk.r.appspot.com
  bywgbxaxvdqkrlin-dot-millinium.ey.r.appspot.com
  bywiuwhqjasdf.com
  bywn397.top
@@ -130412,7 +129833,6 @@ bzblfppdpefpmwid-dot-millinium.ey.r.appspot.com
  bzbomvvuexsjulgg-dot-millinium.ey.r.appspot.com
  bzdcbqtylmfcwozk-dot-millinium.ey.r.appspot.com
  bzdh.hamhonar.com
-bzdpismpkobsjiqpqptsfgvemj-dot-gl9393jan.uk.r.appspot.com
  bzenncdhqukbluph-dot-millinium.ey.r.appspot.com
  bzew48iricq0a.000webhostapp.com
  bzfbpaulmaeefrvivpsqtylzqkcarfzbcvye-dot-cedar-code-289917.nn.r.appspot.com
@@ -130424,7 +129844,6 @@ bzgjhpdcdujkjdxx-dot-millinium.ey.r.appspot.com
  bzgmbaryziwrgdzw-dot-millinium.ey.r.appspot.com
  bzhhc.shoesmogul.com
  bzhovb.rogagot.com
-bzhtsmejsurkakdqhfmwbznuok-dot-gl9393jan.uk.r.appspot.com
  bzhw.com.cn
  bzhxhbijzb.ml
  bzhxvacmdsyobscxeybqtqvthltyxvwntnns-dot-cryptic-now-290917.ey.r.appspot.com
@@ -130463,6 +129882,7 @@ bzxuhrnvtjrwmbks-dot-millinium.ey.r.appspot.com
  bzyevrowrmfdvayt-dot-millinium.ey.r.appspot.com
  bzzgcwnfioxwzqgw-dot-millinium.ey.r.appspot.com
  bzztcommunicatie.nl
+c-1.top
  c-41.lawapass.com
  c-8nf.svcoding.com
  c-a.co.in
@@ -130760,7 +130180,6 @@ cacarrier-int.com
  cacatbalas.com
  cacbiihrtbvdlhpc-dot-millinium.ey.r.appspot.com
  cacerolazocol.com
-cacgkowijrbyybhqoeeoidaqif-dot-gl9393jan.uk.r.appspot.com
  cacgucfipptgilreqsgxlwnnhtdpkgdknqgs-dot-cryptic-now-290917.ey.r.appspot.com
  cache-0147l45bwfg345ml8ydb344pwdf75sd32zifoe83wm356pad.info
  cache-mskmar05.cdn.yandex.net
@@ -130896,7 +130315,6 @@ caixa-aviso.ml
  caixa-banking.hopto.org
  caixa-clientepj.site
  caixa-consulta-fgts.com
-caixa-es.umbler.net
  caixa-fgts-consulta.com
  caixa-gov-acesso.joomla.com
  caixa-informa.gov-br.life
@@ -131283,12 +130701,12 @@ cancel-newdevice.co.uk
  cancel-newid.com
  cancel-online.com
  cancel-onlinepayee.com
+cancel-orderpaypal.servebeer.com
  cancel-orders.serveirc.com
  cancel-outgoingpayee.com
  cancel-payee-haii.com
  cancel-payee-halifax.info
  cancel-payee-hs.com
-cancel-payee-info.com
  cancel-payee-request.com
  cancel-payee-service.com
  cancel-payee-verify.com
@@ -131310,6 +130728,7 @@ cancel.nflxus-8658573371.profilepitstop.com
  cancel.nflxus-9550242602.profilepitstop.com
  cancela.netlify.app
  cancela.netlify.com
+cancelanz.org
  cancelation.applieidappsintl.confirmatedinfo.sabyangambus-03.com
  cancelationacc-web.servehttp.com
  cancelauth.com
@@ -132140,7 +131559,6 @@ case-review2244.xyz
  case-review483.xyz
  case-review484.xyz
  case-review5204.xyz
-case-review596.xyz
  case-sw.sourceforge.io
  case.gonukkad.com
  case09-problem-account-48gh4dfhd7.graphicnovelreview.com
@@ -132360,11 +131778,11 @@ catatuan.com
  cataxrefcd19.com
  catchallcreative.com
  catchmywav.com
-catchpoolshetlands.co.uk
  catdiscdriggle.com
  cate-taker.sgp1.digitaloceanspaces.com
  categorycheap.com
  categoryfactor.com
+catelyndevlin.com
  cateonudy.com
  caterinacongi.ch
  caterincas.from-ri.com
@@ -132448,7 +131866,6 @@ cawqeeqbkywunwsucf.top
  cawzxlqaeylyqqdpptzi-dot-gleowyel040493443434989.wl.r.appspot.com
  caxbnee.com
  caxg.xyz
-caxnkubgqhwrsqmahbjqvuhvwe-dot-gl9393jan.uk.r.appspot.com
  caxrejnstisfedii-dot-millinium.ey.r.appspot.com
  cayahanshaj.com
  caycerichardson.com
@@ -132539,6 +131956,7 @@ cbre-securityplace.com
  cbrqxszzeedxnhwn-dot-millinium.ey.r.appspot.com
  cbsalhq.goruli.com
  cbsgktjbgcstez.top
+cbsh.ca
  cbsmun.org
  cbsnbase.com
  cbsnbus.com
@@ -132565,7 +131983,6 @@ cbvinylrecordart.com
  cbvmbzordtyzfzzs-dot-millinium.ey.r.appspot.com
  cbvpiulwnrgmpphl-dot-millinium.ey.r.appspot.com
  cbwimkwgdz.duckdns.org
-cbwlqoopevaoxjjtnxllhviuer-dot-gl9393jan.uk.r.appspot.com
  cbxttdgcmrnlysvd-dot-millinium.ey.r.appspot.com
  cbyiifkyvjvrzwfd-dot-millinium.ey.r.appspot.com
  cbyulecheng.tavmo.com
@@ -132590,7 +132007,6 @@ cc87487.tmweb.ru
  cc8848.xyz
  ccadminn.com
  ccandcbrand.com
-ccaofqsnmjcaactsckmaxcugvg-dot-gl9393jan.uk.r.appspot.com
  ccaqauvu.topkorder.su
  ccarhcgkjelwuokarbxkobtvkl-dot-gleowayel400503.uc.r.appspot.com
  ccash.xyz
@@ -132703,7 +132119,6 @@ ccxbnwwbwqpygyoewrxymhimbmmxzakhdprm-dot-solar-vertex-285913.rj.r.appspot.com
  ccxbnwwbwqpygyoewrxymhimbmmxzakhdprm.solar-vertex-285913.rj.r.appspot.com
  ccxvmxqsyyqtncwjofoberdueaxbocypnvoe-dot-cedar-code-289917.nn.r.appspot.com
  ccycny.com
-ccyfyvgqpzyopweqhftuuruwmc-dot-gl9393jan.uk.r.appspot.com
  cczpzfrfpelmuagv-dot-millinium.ey.r.appspot.com
  cd-08-verify.cf
  cd-shl.com
@@ -133036,6 +132451,7 @@ cek123123.000webhostapp.com
  cekdpyizaipgxvyw-dot-millinium.ey.r.appspot.com
  cekfborang.000webhostapp.com
  cekilisciniz.net
+cekilisonuclarimiz.com
  cekir.ga
  cekln11.ddns.net
  cekmekoy.forkliftkiralama.web.tr
@@ -133066,7 +132482,6 @@ celebsdetail.com
  celebshine.com
  celebtravelandevents.co.za
  celeclub.org
-celenggus.000webhostapp.com
  celengle.xyz
  celensecurity.com
  celeratured.xyz
@@ -133183,7 +132598,6 @@ centerofbiopolitics.com
  centeroflifechurch.com
  centeroflightyoga.com
  centerofmetro.com
-centerofsupport.gq
  centerpontosmultipresente.center
  centerpontosmultipresente.live
  centerpontosmultipresente.space
@@ -133278,7 +132692,6 @@ centrunn24.eu
  centurionadvisorscom.chifanassume.top
  centuriotcom.shaxiaabove.top
  century21property.us
-century21propertyc2181830034.com
  century901.webcindario.com
  centuryfuelproducts.xyz
  centuryrs.com
@@ -133507,7 +132920,6 @@ cft6.addroits.com
  cft8.awaykart.com
  cftg8.likesyou.org
  cftqz.com
-cftwkurbtyujscwuxvswlqrvgo-dot-gl9393jan.uk.r.appspot.com
  cfvevcbloqyzoqvdmxrgrdivqxpqalqlekbz-dot-solar-vertex-285913.rj.r.appspot.com
  cfvwwwbmxkwqkqtmhv.top
  cfwc-deanzadistrict.org
@@ -133605,6 +133017,7 @@ ch-a.top
  ch-b.top
  ch-colis-post-ch.com
  ch-mailpost.blogspot.com
+ch-online-dhl.gq
  ch-paquette-post-swiss.info
  ch-po-st-tracking.com
  ch-post-service.net
@@ -133646,7 +133059,6 @@ ch4s3-s3crt22.com
  ch4s3-secure-dashboard-r3port.eventosideal.com.br
  ch4z3-s3cur7y.com
  ch77067.tmweb.ru
-ch79847.tmweb.ru
  cha.6888ka.com
  cha.jameslanska.biz
  cha.ypytws.tk
@@ -133777,7 +133189,6 @@ channelhelp.xyz
  channelingwiki.com
  channelprofessional.info
  channigreenwall.com
-chanokcy.com
  chanpangab.com
  chansfound.com
  chantale.e-monsite.com
@@ -134168,6 +133579,7 @@ chaseme.theworkpc.com
  chasenotifications.xyz
  chasenotify.xyz
  chaseoip.gotdns.ch
+chaseoluwa.ml
  chaseon-lineservices.securesmyaccount.com
  chaseon.sytes.net
  chaseonline-chase-comlogon-aspxlobcollogon.programmals.com
@@ -134381,6 +133793,7 @@ chat-whatsapp-bdddgxi0dkryxifzsr.4dq.com
  chat-whatsapp-bdddgxi0dkryxipil.4dq.com
  chat-whatsapp-bdddgxi8odkrtkwi0oip1.ygto.com
  chat-whatsapp-bdddgxi8odkrtkwi0oip2.ygto.com
+chat-whatsapp-bdddgxi8odkrtkwicob6.duckdns.org
  chat-whatsapp-bdddgxi8odkrtkwicok3.ygto.com
  chat-whatsapp-bdddgxi8odkrtkwipa.ygto.com
  chat-whatsapp-bogel-grubinvitr8.2waky.com
@@ -134410,6 +133823,7 @@ chat-whatsapp-group.wasap8.tk
  chat-whatsapp-groupbudi.budi01.ml
  chat-whatsapp-groupinvite.ff-id.gq
  chat-whatsapp-groupinvite.joins37.ga
+chat-whatsapp-groups-ngehe.ml
  chat-whatsapp-groups.mrclaim.gq
  chat-whatsapp-grub-bokep.grup67.ml
  chat-whatsapp-grub.almostmy.com
@@ -134424,6 +133838,7 @@ chat-whatsapp-grub.xxuz.com
  chat-whatsapp-grub.zzux.com
  chat-whatsapp-grup.dynamic-dns.net
  chat-whatsapp-grup.mefound.com
+chat-whatsapp-grupbokep19.gq
  chat-whatsapp-grups.xxuz.com
  chat-whatsapp-h75mgqbkd0m6wpsiojfrig.25u.com
  chat-whatsapp-hgjagu2c8qjcncghadsqjsd.3-a.net
@@ -134435,7 +133850,6 @@ chat-whatsapp-join-grub-bokep.join-bkeps10.cf
  chat-whatsapp-kp1jlr5pzer0nb4o1jutmc.3-a.net
  chat-whatsapp-kpr0nb4o1jut5.onmypc.org
  chat-whatsapp-kpr1djlrg5pzegfr0nb4o1jutmc.mynumber.org
-chat-whatsapp-notnot-join-grup-mabar.evnt-gratis078.ml
  chat-whatsapp-sexyyhott18.wa-gruops.ml
  chat-whatsapp-tantemuda-v281g28.zzux.com
  chat-whatsapp-viral5.ourhobby.com
@@ -134570,7 +133984,6 @@ chat-whtasapp132.wikaba.com
  chat-whtasapp166.wikaba.com
  chat.grup.whatsappp.workzs.com
  chat.joypage.xyz
-chat.klikbsi.id
  chat.qwhatsapps.com
  chat.whaksapp.com
  chat.whatsa4bp.com
@@ -134696,7 +134109,6 @@ chatjoin-wa.qhigh.com
  chatmusic.xyz
  chatnewwhatsap.ooguy.com
  chatntalk.club
-chatnw-99.000webhostapp.com
  chatnya-up.claim654.com
  chatours.ru
  chatoursclub.com
@@ -134795,6 +134207,7 @@ chatwhatsapp-ahye6gahwkxb.mantapp2020.ga
  chatwhatsapp-bokep.myzroct.cf
  chatwhatsapp-com.viralls6.tk
  chatwhatsapp-hotviral18.itemff-holls99.tk
+chatwhatsapp-hw8hrkgh88en3l.my03.com
  chatwhatsapp-invitegroup69.2waky.com
  chatwhatsapp-newgrup-dewasa.ff-71.gq
  chatwhatsapp-sahur2020.otzo.com
@@ -136020,6 +135433,7 @@ citati1.dusti.tj
  citationvie.com
  citbnks.com
  cite-mopa.web.app
+cite.ctiaspire.com
  cite4me.org
  citextremonlin.cf
  citextremonlin.ml
@@ -136070,7 +135484,6 @@ citizensofindustry.com
  citizenssnf-org.tk
  citkeonline.com
  citmarkets.com
-citr.io
  citrades.com
  citrag.ci
  citrajatiagung.com
@@ -136085,6 +135498,7 @@ cittainfinite.eu
  city-banks.com
  city-news.dkonto.pl
  city-realtor-item9390.com
+city.ctiaspire.com
  city.dogedice.me
  city24.you2.pl
  cityapothecary.com.au
@@ -136149,7 +135563,6 @@ civso0qas.appspot.com
  civtkonqetbdzbloxfetzbaequ-dot-gleowayel400503.uc.r.appspot.com
  ciwckltqhlfjncpt-dot-millinium.ey.r.appspot.com
  ciwcvqsxlojumxxx-dot-millinium.ey.r.appspot.com
-ciwfcsewcdwulogxestyblhylo-dot-gl9393jan.uk.r.appspot.com
  cixshtwrmuxonqjl-dot-millinium.ey.r.appspot.com
  cixz.goruli.com
  cixzserxfsmmxesl-dot-millinium.ey.r.appspot.com
@@ -136225,7 +135638,6 @@ cjwbzl.shoesmogul.com
  cjwmebnuwiuavjav-dot-millinium.ey.r.appspot.com
  cjwpropertygroup.com
  cjwtwhucyoobuvawtyvrnoerec-dot-gleowayel400503.uc.r.appspot.com
-cjwzejuuntzxiuxzaewydhmojc-dot-gl9393jan.uk.r.appspot.com
  cjx7r.mentriqq.com
  cjxtjsrueryygihboezncoxpze-dot-gloff849483.uk.r.appspot.com
  cjxzhsad.uygfdzmk.top
@@ -136269,7 +135681,6 @@ ckonuttpvy20.000webhostapp.com
  ckosafqy.tanglescanner.com
  ckpnigflsxnsadni-dot-millinium.ey.r.appspot.com
  ckpoemyqgslntpgw-dot-millinium.ey.r.appspot.com
-ckpuxypyseyvhilsyqqmseistf-dot-gl9393jan.uk.r.appspot.com
  ckqadxgimwqlhppymvqoqxdkryqmanftpeqd-dot-cryptic-now-290917.ey.r.appspot.com
  ckqadxgimwqlhppymvqoqxdkryqmanfxpeqd-dot-cryptic-now-290917.ey.r.appspot.com
  ckqn3.anahkedm.com
@@ -136336,7 +135747,6 @@ claimcaz4.zzux.com
  claimcaz5.zzux.com
  claimdailyspins.club
  claimdollars.000webhostapp.com
-claimetro.boxfreeuc.com
  claimevent-freefire.ygto.com
  claimevent.dvrlists.com
  claimevent33.garenanew.ffevent-246.cf
@@ -136385,7 +135795,6 @@ claims16.com
  claimsekali.000webhostapp.com
  claimsff.my.id
  claimskin-mlnew78.wikaba.com
-claimskin.in
  claimskinfree.gleeze.com
  claimskinfree24.wikaba.com
  claimskinm4now.com
@@ -136508,7 +135917,6 @@ clck.ru
  clconfirmpayment.us
  cld7m.codesandbox.io
  cldbx.goruli.com
-cldimanrtiwhprhttwxbxiyktn-dot-gl9393jan.uk.r.appspot.com
  cle-secure.net
  clean-cut.co.uk
  clean24k.com
@@ -136541,11 +135949,11 @@ cleanpro.guru
  cleanrashblockchain--five-nine.repl.co
  cleanrd.com
  cleanreviewi.website
+cleanteath.casa
  cleanupcongresspac.com
  cleanwelllitconference.cartoomy.repl.co
  cleanwindow.top
  clear-4020accyt.000webhostapp.com
-clear-headed-dimens.000webhostapp.com
  clear-lb.com
  clear-translations.com
  clearakrepall.kozow.com
@@ -136599,7 +136007,6 @@ clever-bhabha.netlify.app
  clever-blackwell-b81e70.netlify.com
  clever-clever-appea.000webhostapp.com
  clever-ibis.cloudvent.net
-clever-kowalevski-3c481f.netlify.app
  clever-morse-8cf2a8.netlify.app
  cleveradds.com
  clevercarrepairs.com
@@ -136869,7 +136276,6 @@ clks67.oa.r.appspot.com
  clkyvzqh.goruli.com
  cllhadddrrmwimvx-dot-millinium.ey.r.appspot.com
  cllocasemvvlmpmt-dot-millinium.ey.r.appspot.com
-cllxflkxcwtzhoxncuykxckprm-dot-gl9393jan.uk.r.appspot.com
  clmmtddyasvomeqd-dot-millinium.ey.r.appspot.com
  clmn.shoesmogul.com
  clmywzyatcbmqiug-dot-millinium.ey.r.appspot.com
@@ -137054,7 +136460,6 @@ clurebranch.buzz
  clureports.buzz
  clusauganda.co.ug
  clustergriyaagung.com
-clustersaude.com
  clutchinc.net
  cluttersfrees.top
  clwknife.fun
@@ -137084,8 +136489,6 @@ cmasempresa.com
  cmb-bois.best
  cmb-company.xyz
  cmb-secureweb.com
-cmbaohpyvtfitmiwxhxrshseyn-dot-gl9393jan.uk.r.appspot.com
-cmbexmfnnlppowdkwfyphigewe-dot-gl9393jan.uk.r.appspot.com
  cmbifxdhk.rogagot.com
  cmc-me.com
  cmck4vve6e24wdktsc9n8l1izi7eb9.biz
@@ -137123,7 +136526,6 @@ cmnb.cam
  cmnivaria.com
  cmnss21.000webhostapp.com
  cmonsieurs.com
-cmoqukicmrrwfiwnpjmqeewhba-dot-gl9393jan.uk.r.appspot.com
  cmowlrdveyfqknkt-dot-millinium.ey.r.appspot.com
  cmp.haiwei007.com
  cmpdwccgubbzexus-dot-millinium.ey.r.appspot.com
@@ -137421,7 +136823,6 @@ coatsgroup.com
  coausmgos.org
  coba.servebeer.com
  cobaaainmasuk.000webhostapp.com
-cobaajadisiniykyk.000webhostapp.com
  cobaem.edu.mx
  cobajalani.com
  cobaltbd.mnhd.com
@@ -137447,7 +136848,6 @@ cocktailcontent.com
  cocktailpayment.com
  cocky-chandrasekhar-72cffa.netlify.app
  cocky-galileo-fb18bb.netlify.app
-cocky-nightingale-40ccb8.netlify.app
  cocky-solder.000webhostapp.com
  cocky-wescoff-aac502.netlify.app
  cocnguyetsanlincupsg.com
@@ -137575,7 +136975,6 @@ cogitype166.com
  cogiutil53.com
  cogmyboazfvvqaqotcjfoufofshzexhyoaiv-dot-glxcel49934343434.rj.r.appspot.com
  cognerium.com
-cognitional-caves.000webhostapp.com
  cognitiveoutlaw.org
  cogqjefxuumkkbaumzzmexdnwlwrmieeylqm-dot-glxcel49934343434.rj.r.appspot.com
  cogstateconstructions.com.au
@@ -137729,7 +137128,6 @@ collection.wzzwn.com
  collectionofartists.com
  collectionofvideos.000webhostapp.com
  collectionslinkzimbrahome.000webhostapp.com
-collective-techniqu.000webhostapp.com
  collectiveagency.co
  collectivedigitalmarketing.com
  collectiveenterprises.com
@@ -138133,6 +137531,7 @@ commbank-payments.net
  commbank-review.com
  commbank-review.net
  commbank-secure.app
+commbank-security.com.au
  commbank-transactions.net
  commbank-transfers.net
  commbank.au-cl18.com
@@ -138293,8 +137692,7 @@ compagnons-alzheimer.com
  compagnonvoyage.com
  companhiaitaunense.com.br
  companieshouseonlinedownload.com
-company-11326489780965443.tk
-company-11326489780965444.tk
+company-11326489780965446.tk
  company-partenariat-investissement.com
  company.motopays.com
  company01.sutoweb.com
@@ -138324,7 +137722,6 @@ compassionate-downg.000webhostapp.com
  compassionate-dubinsky-013951.netlify.app
  compassionate-elion-c7cf66.netlify.app
  compassionate-engelbart-fc46a8.netlify.app
-compassionate-lovelace-693fc9.netlify.app
  compassionatecarejupiter.com
  compasslisting10726505.com
  compasslisting26706585.com
@@ -138338,7 +137735,6 @@ compesat.com
  competaprint.com
  competencialeal.com
  competent-agnesi-e535b5.netlify.app
-competent-bartik-cd47e7.netlify.app
  competent-borg-190248.netlify.com
  competent-heisenberg-c2c3b9.netlify.app
  competent-wing-ccdf5b.netlify.app
@@ -138346,6 +137742,7 @@ competition1322.redirect-servers95.live
  competition5579.chksrvnewtoday12.life
  competition8571.nonamevar30.live
  competitionalertie.000webhostapp.com
+competitions2020.xyz
  compila-ora-per-i-nuovi-certificati.net
  compila-ora.com
  compilazione-modulo-web-online.com
@@ -138390,7 +137787,6 @@ compliance-central.com
  complianceattestation.com
  complianceceo.com
  compliancesolutionsstrategies.com
-compliant-armful.000webhostapp.com
  complored.xyz
  compmold.com
  component.pw
@@ -138453,7 +137849,6 @@ compte-interdit-bancaire.net
  compte-labanquepostale.fr
  compte-pour-tous.fr
  compte.at
-comptecibcap06.000webhostapp.com
  compteclient.cagrico-servicecms.fr
  compteiikg.000webhostapp.com
  comptenetlfix-update.com
@@ -138623,11 +138018,9 @@ confidenceforbid.com
  confidenceswell.com
  confidencetumble.com
  confident-brattain-61219f.netlify.app
-confident-fermat-82200a.netlify.app
  confident-fermi-1e9947.netlify.app
  confident-hoover-947da2.netlify.com
  confident-hoover-e7a38c.netlify.app
-confident-kirch-8ba712.netlify.app
  confidentialite-profils.webnode.cr
  confidentiality.info
  confidesac.com
@@ -138676,6 +138069,7 @@ confirm-accounts-support-reporting.my.id
  confirm-anymention.net.pl
  confirm-apple.sytes.net
  confirm-auth-payee.link
+confirm-bill-info-auth.com
  confirm-chase.com
  confirm-cl-payment.us
  confirm-code.com
@@ -138696,7 +138090,6 @@ confirm-my-netflix.com
  confirm-my3.info
  confirm-myrecent-transfers.com
  confirm-needed.com
-confirm-new-payee-authorization.com
  confirm-new-payee.cc
  confirm-newpayee.com
  confirm-onlinepayments.com
@@ -138705,8 +138098,6 @@ confirm-payee-ref8920.com
  confirm-payee-reference006.com
  confirm-payee-reference1721.com
  confirm-payee-security.com
-confirm-payeeactivity.com
-confirm-recipientactivity.com
  confirm-secured-department.com
  confirm-transfer-reference00821.com
  confirm-transfer-reference11772.com
@@ -138714,6 +138105,7 @@ confirm-update.com
  confirm-user.services
  confirm-verify.me
  confirm-your-identity-wells-fargo.com
+confirm-your-new-payee.com
  confirm.bill-app.ru
  confirm.bisiakintayo.com
  confirm.fbookus-06043290.gruppotiozzo.it
@@ -138808,7 +138200,6 @@ confirmatioonthink.my.id.help-12354hagk4762.my.id
  confirmbfa.xyz
  confirmbluebadge.com
  confirmcl-payment.us
-confirmclpostingdetails.us
  confirmdados.com
  confirmdevices.com
  confirme.atualizacaocadastro.ga
@@ -139114,7 +138505,6 @@ construtorasempre.com.br
  consubcencheden.xyz
  consuelawilliams.com
  consuetudinary-spec.000webhostapp.com
-consulentewebaccesso.com
  consulenza-aggiornamento-app.com
  consulenza-web-online.com
  consulmuseum.ca
@@ -139304,12 +138694,10 @@ content-71757835.voltoq.com
  content-724169532.helenquan.ca
  content-72436611.latuka.com.bo
  content-755417093355.keegan21.com
-content-75832817.keegan21.com
  content-77749454.interiorholic.net
  content-796468717.helenquan.ca
  content-80692424.bidsolutions.cl
  content-808801491.helenquan.ca
-content-812162152761.keegan21.com
  content-821961247.helenquan.ca
  content-837936425.helenquan.ca
  content-844948014.helenquan.ca
@@ -139430,12 +138818,6 @@ continentsnb.com
  continexd.com
  continu.hu
  continuant-misalign.000webhostapp.com
-continue-fb-10622364.tk
-continue-fb-10622365.tk
-continue-fb-10622366.tk
-continue-fb-10622367.tk
-continue-fb-10622368.tk
-continue-fb-10622369.tk
  continue.updateamazon.icu
  continuer-identifiez-vous.webador.com
  continuer-ldentifiez-vous.webador.com
@@ -139694,6 +139076,7 @@ copyright-media-page-review.com
  copyright-mediasupports.com
  copyright-objectives.com
  copyright-report-detect-check.my.id
+copyright-security-help-form.ml
  copyright-service-live.com
  copyright-serviceform.com
  copyright-servicies.com
@@ -139759,7 +139142,6 @@ copyrights-lnstagram-verification.com
  copyrights-notice.com
  copyrights-objection-instagram.cf
  copyrights-securitys.com
-copyrights-violation-help.com
  copyrightsbusiness.com.instagram-helpteam.tk
  copyrightscenter.net
  copyrightscentersupport.ml
@@ -140284,7 +139666,6 @@ count.mail.163.com.upgrademailquota.xyz
  count.mail.163.commsk.count.fkc.count.mail.163.com.wedge-ksa.com
  count.office.emailsrvr.spgas.com.au
  count.secured.emailsrvr.villacorfu.com.au
-countdomaailpartdatae.ga
  counteractive-digit.000webhostapp.com
  counterbend.xyz
  counterclockwise-fo.000webhostapp.com
@@ -140710,7 +140091,6 @@ cpanelpourcontinuerhqnfghjkackmailercom.000webhostapp.com
  cpawhy.com
  cpaybr.com
  cpazimbabwe.co.zw
-cpbatlxqgjefgkecbbqugxxkvk-dot-gl9393jan.uk.r.appspot.com
  cpbmfidnvkjaqkrk-dot-millinium.ey.r.appspot.com
  cpc.cx
  cpc.mashresearchb.com
@@ -140981,7 +140361,6 @@ cpdsalerno.com
  cpextech.com
  cpf-th.com
  cpgaznttlzvhunfn-dot-millinium.ey.r.appspot.com
-cpgfdjbggyshdigsbxbyylswyj-dot-gl9393jan.uk.r.appspot.com
  cphannut.be
  cpi-istanbul.com
  cpickard.com
@@ -141046,7 +140425,6 @@ cq9.jaysbrand.com
  cq94166.tmweb.ru
  cqae.svcoding.com
  cqaimhxtyljscgql-dot-millinium.ey.r.appspot.com
-cqajzmhwugvclobwvcliaqkdam-dot-gl9393jan.uk.r.appspot.com
  cqasnbnscvihibkuivkdwevsfn-dot-gl9393jan.uk.r.appspot.com
  cqaxz.club
  cqbano.ddns.net
@@ -141095,7 +140473,6 @@ cqswuvlbxqmnm.000webhostapp.com
  cqt2019.com
  cqtev.club
  cqtspj.com
-cquickbrookn102nnnn11na21ann02nh0hn.ams3.digitaloceanspaces.com
  cquwr.biogenicherb.com
  cqvoxwbvbypdaulg-dot-millinium.ey.r.appspot.com
  cqwblhofcahheeop-dot-millinium.ey.r.appspot.com
@@ -141334,7 +140711,6 @@ craneindo.com
  crankisdg.servepics.com
  cranky-bose-78b530.netlify.app
  cranky-liskov-a0842b.netlify.app
-cranky-mahavira-4f42e4.netlify.app
  cranky-sinoussi-aa196d.netlify.app
  cranleighscoutgroup.org
  craonline-registration.com
@@ -141467,6 +140843,7 @@ creb-app-dep.com
  crechendo-asso.fr
  crechendofr.chifanbudget.top
  crechendoorg.shaxiaasian.top
+cred-agricole-secur-pass.firebaseapp.com
  credagri28.temp.swtest.ru
  credasuina.ga
  credcomerenlinea.info
@@ -141896,7 +141273,6 @@ cs-alertappleid.serveirc.com
  cs-amazonid3153.servebeer.com
  cs-analyzer.tk
  cs-assistamazon.servecounterstrike.com
-cs-bnk.app.link
  cs-dazzler.com
  cs-empire.ga
  cs-free-skins.xyz
@@ -141947,7 +141323,6 @@ cscasedrop.xyz
  csccambodia.com
  cscclabs.com
  cscdlsalnvgzdcdsnixadnvvzi-dot-gleowayel400503.uc.r.appspot.com
-cscentralcard.com.br
  csceyynbceucfndn-dot-millinium.ey.r.appspot.com
  csckwxfiguxaewub-dot-millinium.ey.r.appspot.com
  cscobejxkjbpekux-dot-millinium.ey.r.appspot.com
@@ -142256,6 +141631,7 @@ csrf.awaykart.com
  csrich.xyz
  csrpnl.razmek.in
  csrrb.goruli.com
+csrs.dynu.net
  csrun.ru
  css.digestcolect.com
  css.servepics.com
@@ -142379,7 +141755,6 @@ cu-gong.com
  cu1-org.be
  cu1org.be
  cu26494.tmweb.ru
-cu27228.tmweb.ru
  cuacuonsieure.com
  cuadi.com.mx
  cuadros.pe
@@ -142428,6 +141803,7 @@ cuentaddominiodelsistemarpido.moonfruit.com
  cuentanetflix.disenlaser.co
  cuentarut-online.top
  cuentarutusuarios.cl
+cuepxidwuyqruodmfzmlreipqn-dot-gleow2021ja.ue.r.appspot.com
  cueu0.app.link
  cueva-de-sal.changeland.com
  cueword.tk
@@ -142895,7 +142271,6 @@ custsomer.com
  custsupport1000.com
  custumetanet-uttbedbr.mzbomboniere.it
  custupdates.com
-cusupgoigwusbooxlexxjyweah-dot-gl9393jan.uk.r.appspot.com
  cusuppmyworldfosupp13.com
  cuszoulouiseje.gq
  cut-out-pails.000webhostapp.com
@@ -142973,7 +142348,6 @@ cvdfeyt.cf
  cvetisbazi.ru
  cvetochniy-buket.ru
  cvetolenta.ru
-cvfqtcftxfrxgxyhzcfczutqms-dot-gl9393jan.uk.r.appspot.com
  cvg.smtbkw.cn
  cvgmamuviguwfuqc-dot-millinium.ey.r.appspot.com
  cvgpoyayqhtvajcl-dot-millinium.ey.r.appspot.com
@@ -142994,7 +142368,6 @@ cvndschwb.ml
  cvnfr.xyz
  cvnjknife.fun
  cvnty.ga
-cvormqvbihcnpueknfmofgxwxb-dot-gl9393jan.uk.r.appspot.com
  cvowlgqeszewrnsm-dot-millinium.ey.r.appspot.com
  cvphyypngclippny-dot-millinium.ey.r.appspot.com
  cvpipaeatzpivzlf-dot-millinium.ey.r.appspot.com
@@ -143100,7 +142473,6 @@ cxezgnncnacmyded-dot-millinium.ey.r.appspot.com
  cxezrofpsfjgoqxpjhmvfxcfzy-dot-gleowayel400503.uc.r.appspot.com
  cxf-art.com
  cxfnlokheiwwsxdnmkyawujkuy-dot-gleowayel400503.uc.r.appspot.com
-cxfxcclgjcyaqurckuemddfyyi-dot-gl9393jan.uk.r.appspot.com
  cxghdsf.yegdnmtd.top
  cxghzatyeizbetbf-dot-millinium.ey.r.appspot.com
  cxgxfdwxepehgizhbdhycwalesrjjpswrtdv-dot-cryptic-now-290917.ey.r.appspot.com
@@ -143113,7 +142485,6 @@ cxlofrtg.com
  cxmazrvvzspcvvwj-dot-millinium.ey.r.appspot.com
  cxmfxjtwdxbrfqnx-dot-millinium.ey.r.appspot.com
  cxmx2020atualizacao.com
-cxmxmninodlyhoyfrizpwvgwqp-dot-gl9393jan.uk.r.appspot.com
  cxnabqecxpawvhmilcqockguoo-dot-gleowayel400503.uc.r.appspot.com
  cxnfdefreqmidjhr-dot-millinium.ey.r.appspot.com
  cxpprfp.mapstore.su
@@ -143225,7 +142596,6 @@ cyclopean-margins.000webhostapp.com
  cycy.198424.com
  cydfkyryfnnlesfiltpwickaeidgimwukagt-dot-cryptic-now-290917.ey.r.appspot.com
  cye-fscp.com
-cyeemznvnxntnlqqowugvqemwv-dot-gl9393jan.uk.r.appspot.com
  cyejzdfwuiamcegcsbgwizyakqlaobrqhpmp-dot-cryptic-now-290917.ey.r.appspot.com
  cyeumsmmmyancbdsdfllhieyzf-dot-gloff849483.uk.r.appspot.com
  cygcomputadoras.com
@@ -143266,7 +142636,6 @@ cypressbrook.com
  cyprus.in.ua
  cyqozznahctqocqz-dot-millinium.ey.r.appspot.com
  cyrela-imoveis.blogspot.com
-cyrwdletlumpjraoahuxgggkcz-dot-gl9393jan.uk.r.appspot.com
  cysnu.dermals.org
  cysyonetim.com
  cyszbqcvnjesckmy.top
@@ -143318,7 +142687,6 @@ czmedium.com
  czmlmrpkdyrjewgy-dot-millinium.ey.r.appspot.com
  czmmvogaacdqynte-dot-millinium.ey.r.appspot.com
  cznxk.goruli.com
-czohvwnqbxfyrnzruamkosdull-dot-gl9393jan.uk.r.appspot.com
  czp3j.addroits.com
  czqaxeccsyoixrxa-dot-millinium.ey.r.appspot.com
  czqhfzt.goruli.com
@@ -143669,7 +143037,6 @@ dailypossitivehamervirus.club
  dailyrevelationzambia.com
  dailysavings-finder1.cf
  dailysavings-finder2.cf
-dailysfestival.com
  dailyshoping.org
  dailyshops.co.in
  dailysortlogs.bounceme.net
@@ -144328,13 +143695,11 @@ davinciworldshoppingmall.com
  davismgt.com
  davisra.com
  davitherbal.com
+davivienda-enlinea-wp.com
+davivienda-enlinea-wp.net
  davivienda.cualquier-cosa.com
-davivienda.enlinea-wps.cc
-davivienda.enlinea-wps.com
-davivienda.enlinea-wps.net
+davivienda.enlinea-wps.co
  davivienda.icu
-davivienda.ingresospersona.online
-davivienda.ingresowps.co
  davivienda.inversionesargos.net
  davivienda.link
  davivienda.portalpersonas.com
@@ -144380,7 +143745,6 @@ dawoodmarafie.com
  daxex.pro
  daxuesen.com
  daxuminc.com
-daxxdjiveynqlaxgqvxxvzjwuz-dot-gl9393jan.uk.r.appspot.com
  day.dimaq.pl
  dayahblang.id
  dayakpoker.club
@@ -144418,7 +143782,6 @@ dazzling-agnesi-0258e7.netlify.app
  dazzling-calculating.ga
  dazzling-dijkstra-742e18.netlify.app
  dazzling-goldberg-17f6fe.netlify.app
-dazzling-wescoff-8b60dc.netlify.app
  dazzlingskill.com
  db-office365.000webhostapp.com
  db-phototan-wiederherstellen.de
@@ -144437,11 +143800,11 @@ dba-dk.link
  dba-dk.live
  dba-gmbh.de
  dba.dk.erhverv-annonce-21833657.cloud
+dba.dk.erhverv-annonce-315732.art
  dba.dk.erhverv-annonce-35476815.xyz
  dba.dk.log-ind.co
  dba.dk.log-ind.email
  dbbc3db0c32eb6fd59cb18e51be1ada7af017b86.ph
-dbbmvnqzlcszsloocxpyavdpid-dot-gleow2021ja.ue.r.appspot.com
  dbbpohyisnfqylim-dot-millinium.ey.r.appspot.com
  dbcfd.xyz
  dbcomestic.com
@@ -144473,9 +143836,7 @@ dborg.kepoteman.xyz
  dbowfljwciscgljb-dot-millinium.ey.r.appspot.com
  dbperfection.com
  dbqgzi.deklareraspanien.se
-dbqjopmgnqlemaxsykkykfjifk-dot-gl9393jan.uk.r.appspot.com
  dbresorts.si
-dbs-digitaltoken.com
  dbs-fslchy.com
  dbs-internet.digital
  dbs-interntbakiing-sg.com
@@ -144654,7 +144015,6 @@ ddhost.ro
  ddhpztpmsspnwjwvxd.top
  ddimobile.deliriumcg.com
  ddjewellers.co.zw
-ddkgapdhkehktzxhwnfyebvscw-dot-gl9393jan.uk.r.appspot.com
  ddkoo.com
  ddl.okgoodmobi.com
  ddl7.data.hu
@@ -144730,7 +144090,6 @@ de-register-halifax.com
  de-register-newdevice.co.uk
  de-register-newdevice.online
  de-register-uk.com
-de-register-unauthorised-mobile-auth.live
  de-registerdevice.com
  de-registered-device.link
  de-sparkasse1334.000webhostapp.com
@@ -144896,7 +144255,6 @@ debragunter.com
  debrah5434262.xyz
  debrawright-profile.info
  debraxjones-bazemore.com
-debrn10.000webhostapp.com
  debt-conflict.ru
  debtfreelaunch.com
  debtschedule.buzz
@@ -144909,7 +144267,6 @@ decamerous-displays.000webhostapp.com
  decasos.com
  decaturilbgc.com
  decaty.xyz
-deccadmysdumtbfawvgfopfxey-dot-gl9393jan.uk.r.appspot.com
  deccanmarket.com
  decembergun0.com
  decemberrushing.us
@@ -144920,7 +144277,6 @@ decibeliosmagazine.com
  decide.keishin.icu
  decide7dayretourn.com
  deciduate-pot.000webhostapp.com
-deciduous-energetic-hydrogen.glitch.me
  decifra.com.br
  decillionth-motions.000webhostapp.com
  decimalsqueakyconfiguration--five-nine.repl.co
@@ -145016,7 +144372,6 @@ deeasrewomsabsubttop.tk
  deedprogress.co.za
  deeds.yolasite.com
  deeehuhhuv.duckdns.org
-deefntteydrlxvhrbmafyuqsya-dot-gl9393jan.uk.r.appspot.com
  deehyiqirvecxykn-dot-millinium.ey.r.appspot.com
  deekartmobile.com
  deeksis.info
@@ -145227,6 +144582,7 @@ deliciasdvally.com.pe
  deliciosapasion.com
  delicious-pcannuts.xyz
  delicioushabitat.com
+deliciousillfatedapplicationstack.sdsdsdsd77dsdsd.repl.co
  deliciousrecipees.com
  delifoodie.com
  delightfull.co.kr
@@ -145404,7 +144760,6 @@ demoliticism.info
  demolscorp.com
  demoluckyspinv1.jnrpanel.xyz
  demoluckyspinv3.jnrpanel.xyz
-demon12.000webhostapp.com
  demonbets.ru
  demondkapjesman.nl
  demonesia.net
@@ -145438,7 +144793,6 @@ denieepohio.cloudaccess.host
  denifl-consulting.at
  denis-99bg.com
  denise-booth.com
-denise-brooks.xyz
  denisetdavis.com
  denisgroy.com
  denizalticafe.com.tr
@@ -145532,7 +144886,6 @@ depascoalcalhas.com.br
  depatmentmanage.com
  depaulaetitaraadvogados.com
  depaulafestas.com.br
-depbjeuimlfbqpghtytnxfbvtw-dot-gl9393jan.uk.r.appspot.com
  dependentobreality.com
  dependication.com
  depenvnvces-confirm.serveirc.com
@@ -145590,7 +144943,6 @@ deregister-device.org
  deregister-devicevalidate.com
  deregister-hali.co.uk
  deregister-info-secured.com
-deregister-lloyd-unauthorisedaccess.com
  deregister-mobile-secured.com
  deregister-mobilebanking.com
  deregister-mobiledevice-secure.com
@@ -145600,7 +144952,6 @@ deregister-newdevice-secured.com
  deregister-newdevice.co.uk
  deregister-newmobile-secure.com
  deregister-newmobile-secured.com
-deregister-newmobiledevice.co.uk
  deregister-now.cc
  deregister-online-account.com
  deregister-online-payee.com
@@ -145617,7 +144968,7 @@ deregister-payeeaccount.com
  deregister-secure-online.com
  deregister-secure.com
  deregister-securelloyd-device.com
-deregister-securelloyd-unknown.com
+deregister-securelloyd-devices.com
  deregister-signin.com
  deregister-unsecuredevice-security.co.uk
  deregister-unverifieddevice.com
@@ -145691,7 +145042,6 @@ dertesta.serveirc.com
  dertierfotografde.chifanbudget.top
  dertuyuwo.cam
  deruiterstaalkabel.nl
-derupidvirygajehewzialfwta-dot-gl9393jan.uk.r.appspot.com
  dervosipniarubainc.com
  derwahnsinn.at
  derxone.ug
@@ -145754,7 +145104,6 @@ descripticism.info
  descriptive-disasse.000webhostapp.com
  descubraseuproposito.com
  descubrecartagena.com
-descubreinfidel.000webhostapp.com
  desdeelamor.com
  desdeelfondo.mx
  desdelguardarrail.com
@@ -145837,7 +145186,6 @@ desinfectercoronavirus.com
  desing.co
  desintox.site
  desinytravel.com
-desireless-elapse.000webhostapp.com
  desiringhands.com
  desite.gr
  desjardins-2fraudalert.com
@@ -145902,8 +145250,6 @@ destek-turkiye-2020.ml
  destek1498tl.com
  destekekibipandemisorgulama-tr.com
  destekzamani.ml
-destenprojpass11.000webhostapp.com
-destenprojpass5.000webhostapp.com
  desterilization.xyz
  destfrtdsferdfterd.com
  destgrena.at
@@ -145985,7 +145331,6 @@ deutschland-ebay.de.europe-location.club
  deutschland-ebay.de.europe-location.fun
  deutschland-ebay.de.europe-location.icu
  deutschland-eu-amz.website
-deuupmwbstupobnhvzxmidkfrx-dot-gl9393jan.uk.r.appspot.com
  deuxiemeclasse.fr
  deuyiezfihyrqbde-dot-millinium.ey.r.appspot.com
  dev-app.carolinainsuranceschool.com
@@ -146038,6 +145383,7 @@ dev.ezgovopps.com
  dev.gci.exoret.com
  dev.gllit.com
  dev.harmonique.co
+dev.homecuisine.pk
  dev.hooliv.com
  dev.indianroom.co.uk
  dev.inovtechsenegal.com
@@ -146059,7 +145405,6 @@ dev.old.xn--kaken-tbb.com
  dev.omniroom.ru
  dev.onechicagoresidences.com
  dev.pasticceriapitti.com
-dev.payeeservices.org
  dev.paypal.com-informationaccounts.com
  dev.previewmysite.co.za
  dev.prometall.cat
@@ -146189,7 +145534,6 @@ device-registeredalert.com
  device-registration-advanced-security.com
  device-registration.co.uk
  device-removal-halifax.com
-device-removal-uk.com
  device-remove-halifaxinfo-plc.com
  device-removealert-h-plc.com
  device-secure-account.link
@@ -146393,18 +145737,19 @@ dfddfg4df.ru
  dfdfaxvb.ddns.net
  dfdfttfdnj.matulaitis.org
  dfdgdgdgfhgbbb.000webhostapp.com
+dfdprivateme9082.gotdns.ch
  dfdsfadfsd.com
  dfdtjrkhmybkmcicbhkmedbgjznilnxkpsuk-dot-offglen.uk.r.appspot.com
  dfe396370d.nxcli.net
  dfefzxc.xyz
  dfehg.xyz
  dferwedv.ddns.net
+dferwgfdsewaf.email
  dfess.xyz
  dff.kf6tc.cn
  dffdfdsaffdsfd.000webhostapp.com
  dffesigninatt.weebly.com
  dffg.co.za
-dffmfgprzjipmrzfbxyyrhsudh-dot-gl9393jan.uk.r.appspot.com
  dffssdyt.weebly.com
  dfg.16rn00.cn
  dfg.wankdqr.cn
@@ -146537,7 +145882,6 @@ dgc5.com
  dgcwnvcxnoukukvhrgvqehjtdjvakrzdwbpr-dot-solar-vertex-285913.rj.r.appspot.com
  dgdaerxing.com
  dgdfasddfs.ru
-dgdggdgdhwwootlowlkk.ibx.lat
  dgds54h1b65rf41ehjn6t8e74j8rt74j8t5er47j8rtj747-56ej4tr4j46t4g7.buzz
  dge.mbtrkb.cn
  dgecolesdepolice.bf
@@ -146567,7 +145911,6 @@ dgirlsvideos2.xyz
  dgirlsvideos4.xyz
  dgirlsvideos5.xyz
  dgiusghusegya363.xyz
-dgiwzfbeetauniwbtaduqfqlkn-dot-gl9393jan.uk.r.appspot.com
  dgkhj.ru
  dgkjdsghjrghjg.weebly.com
  dgkpkvlgivrozncd-dot-millinium.ey.r.appspot.com
@@ -146775,7 +146118,6 @@ dhxparggflvhxeoh-dot-millinium.ey.r.appspot.com
  dhyanmitra.com
  dhyarwhabcihdzuv-dot-millinium.ey.r.appspot.com
  dhybwe-nctwvm-ocuam.netlify.app
-dhyuhvwewmawrcpevrmegnhtms-dot-gl9393jan.uk.r.appspot.com
  dhzwg.awaykart.com
  dhzwoyqbkkokpysuqiiuonzlcdldhuqnuqix-dot-solar-vertex-285913.rj.r.appspot.com
  di-1.icu
@@ -146945,7 +146287,6 @@ diaxejlriewjkhcj-dot-millinium.ey.r.appspot.com
  diazavendano.cl
  diazepo.com
  diazfoods32176invoicedoc.uc.r.appspot.com
-diba-diensterichtlinie.com
  dibaholding.com
  dibankae.com
  dibidalcycle.com
@@ -146973,7 +146314,6 @@ dichvuvnpt.com
  dichvuvnpt.com.vn
  dickenshandchimes.com
  dickenspark.buzz
-diclcwucnnnxbozygocqklvoua-dot-gl9393jan.uk.r.appspot.com
  dicoli.in
  dict.ekitistate.gov.ng
  dictatorialness.xyz
@@ -147092,7 +146432,6 @@ dighvqutagtgqzxfwueapnwbvg-dot-gleowayel400503.uc.r.appspot.com
  digi-sec.top
  digi-shop.fr
  digi-talents.com
-digi-veilig.info
  digi.management
  digianhffhyzgscy-dot-millinium.ey.r.appspot.com
  digiarmedia.com
@@ -147252,7 +146591,6 @@ digresseyebrow.com
  digrup.gq
  digua.club
  dih.gov.al
-dihfdpihdildrfuwiredyjpwht-dot-gl9393jan.uk.r.appspot.com
  dihnlihuvwnfpjaturambtvcry-dot-triple-upgrade-293822.rj.r.appspot.com
  dihnlihuvwnfpjaturambtvcry.triple-upgrade-293822.rj.r.appspot.com
  dihocthem129.000webhostapp.com
@@ -147264,7 +146602,6 @@ diiw.dermals.org
  diiwkgxnazmlzkxo-dot-millinium.ey.r.appspot.com
  dijaminn-crotttt-enjoyyyy.000webhostapp.com
  dijari.com
-dijbgyqfsptrpbafcgiujfvfqb-dot-gl9393jan.uk.r.appspot.com
  dijital-btk-duyurular-giris.ml
  dijital-esubem-cep.com
  dijitalbaskicenter.com
@@ -147516,7 +146853,6 @@ disercom.es
  disferonline.com.br
  disfrazplanet.com.mx
  dishdashaex.com
-disheartened-crime.000webhostapp.com
  dishnchips.com
  dishsouq.com
  disinfectantdoctor.com
@@ -147773,7 +147109,6 @@ djdjcharm.com
  djdjdjdjdjdjdklsl.weebly.com
  djdjrubyapp.com
  djdjsa.bounceme.net
-djdusgqibeestvbxyhcmnlwqfd-dot-gl9393jan.uk.r.appspot.com
  djeane.com.pe
  djeffries.com
  djeshwxzsiz.biz
@@ -147816,7 +147151,6 @@ djsrecord.com
  djsywjj.xyz
  djtcbaedjtzfbauj-dot-millinium.ey.r.appspot.com
  djtuttherzicbzlk-dot-millinium.ey.r.appspot.com
-djugzevfiqvnibfoqbrxgcfjpv-dot-gl9393jan.uk.r.appspot.com
  djulmatov.uz
  djuzoiwvpqcpexnh-dot-millinium.ey.r.appspot.com
  djvii.codesandbox.io
@@ -147932,12 +147266,10 @@ dktkzpkrrmyyuntz-dot-millinium.ey.r.appspot.com
  dktlnomgvzodbymw-dot-millinium.ey.r.appspot.com
  dktmhxfbohjkrlsc-dot-millinium.ey.r.appspot.com
  dktuku.com
-dkudqqyihtrvllscctfkhhpcde-dot-gl9393jan.uk.r.appspot.com
  dkw-engineering.net
  dkwheels.com.br
  dkxnne-----login.ygber.com
  dkxvqeqbsnrkgqqo-dot-millinium.ey.r.appspot.com
-dkyakposqaseyqtkejfihpsjvp-dot-gl9393jan.uk.r.appspot.com
  dkyogacentre.com
  dkzcugposexizgbp-dot-millinium.ey.r.appspot.com
  dkznyysudomwkwlkjaifinrxotggnuztrpnz-dot-gl494903049.wl.r.appspot.com
@@ -147975,7 +147307,6 @@ dl2.soft-lenta.ru
  dlagplc.com
  dlahidspnvacjuxhgisiakgicihbykipmazr-dot-cedar-code-289917.nn.r.appspot.com
  dlawgist.com
-dlbcdzilrkbtkklajwajuwfkmo-dot-gl9393jan.uk.r.appspot.com
  dlbktkqwzbstcwym-dot-millinium.ey.r.appspot.com
  dlc.berlin
  dld.jxwan.com
@@ -148083,7 +147414,6 @@ dmlqvyutcmxgrnwh-dot-millinium.ey.r.appspot.com
  dmmaakkkordii.com
  dmminox.com
  dmnaslpkple.com
-dmnzlvqifibmelzucihltxcxyb-dot-gl9393jan.uk.r.appspot.com
  dmobgprnwmiancfl-dot-millinium.ey.r.appspot.com
  dmosefen.com
  dmpmarketinggroup.com
@@ -148173,7 +147503,6 @@ dnraviations.com
  dnrfmrklnzsbcbpy-dot-millinium.ey.r.appspot.com
  dnrmabcegyuywufkkwanlcgjei-dot-gleowayel400503.uc.r.appspot.com
  dnrwvmpwotvlgdiq-dot-millinium.ey.r.appspot.com
-dnrykxwtrlvtudvdspxcprjkqo-dot-gl9393jan.uk.r.appspot.com
  dns.alibuf.com
  dns.fanta222.xyz
  dns.proactiveads.be
@@ -148851,7 +148180,6 @@ dontsweattit.com
  donuttacopalaceinaustin.com
  donweeseinc.com
  donwload-file-id.tk
-donwqhpickmyghegsejfgpslka-dot-gl9393jan.uk.r.appspot.com
  donya-almesmar.com
  dooball-live.com
  doodahlabs.com
@@ -148864,7 +148192,6 @@ doohs11111.000webhostapp.com
  doolaekhun.com
  doom.cl
  doomaidnfb.net
-doomainatt.weebly.com
  doomcup.info
  doomtown.zywiol.org
  doonefitness.com
@@ -149109,6 +148436,7 @@ dovecs.com
  dovercurling.com
  doverdezz.buzz
  dovermahealth.org
+dowaba-s2dhl.blogspot.com
  dowadh.com
  dowholding.com
  dowlasz.com
@@ -149222,7 +148550,6 @@ doze.odinstitute.org
  dozerdays.org
  dozfg.goruli.com
  dozhgvcdpqighwjt-dot-millinium.ey.r.appspot.com
-dozoqfdkunbfoyvpecocembjxf-dot-gl9393jan.uk.r.appspot.com
  dp5lga4akzjg.talagaremix.com
  dpacewhw.shoesmogul.com
  dpbh.info
@@ -149270,7 +148597,6 @@ dpnykrmyfrjbgfnfylfajujxov-dot-gleowayel400503.uc.r.appspot.com
  dpo-as-a-service.com
  dpparki.or.id
  dppgwghaqahpiwpiloetcfpllohummvtmshz-dot-cryptic-now-290917.ey.r.appspot.com
-dppoxpyrjokbtkeyttukdullme-dot-gl9393jan.uk.r.appspot.com
  dpqlhwdclpvxddsghcaztkqbtalxnwgrswpp-dot-gl494903049.wl.r.appspot.com
  dprince.org
  dprisuzavkaurlea-dot-millinium.ey.r.appspot.com
@@ -149308,7 +148634,6 @@ dqjulius.com
  dqkyaxrfhrouhpwz-dot-millinium.ey.r.appspot.com
  dqlzzxipmmfhycsw-dot-millinium.ey.r.appspot.com
  dqmiefurtnwbxfyf-dot-millinium.ey.r.appspot.com
-dqmmiouzxbypnfuaqhbwvsyedx-dot-gl9393jan.uk.r.appspot.com
  dqnat-gulf.com
  dqnfgvrefdyfnocf-dot-millinium.ey.r.appspot.com
  dqngmladiwfkgmfwjshshmqwqk-dot-gloff849483.uk.r.appspot.com
@@ -149360,6 +148685,7 @@ dr8jt.mentriqq.com
  draalexania.com.br
  draanaalice.com.br
  draanapaulabeck.com.br
+drabaquansah.info
  drabzen.com
  drac.jaysbrand.com
  draceci.com.ar
@@ -149520,7 +148846,6 @@ drfxxagjnuihhljy-dot-millinium.ey.r.appspot.com
  drg.tervam.ru
  drgchadgreen.com
  drgh.r7yxz.cn
-drghwblxaulqfvgywxasdkvhgn-dot-gleow2021ja.ue.r.appspot.com
  drh4x.ddns.net
  drhalaelsaid.com
  drheidimist.com
@@ -149534,7 +148859,6 @@ dribblingorder.com
  dribought.nl
  dricki.com
  drift.skywebindustries.com
-driftbreed.info
  drillcompany-mx.com
  drillknife.club
  dringendeamazon-mail.com
@@ -149702,6 +149026,7 @@ dropbox.tartanridge.org
  dropbox2.xyz
  dropboxccdn.com
  dropboxcloud.co
+dropboxdownloads.com
  dropboxfolder.xyz
  dropboxmaill.weebly.com
  dropboxon-lineusdocpdf.cfapps.io
@@ -149774,6 +149099,7 @@ drtvmove.com
  drucker.com.ar
  druckingmaster.weebly.com
  drugdevice.org
+drugmonkey.ctiaspire.com
  druiumin.com
  drukdeothjung.bt
  drukkombucha.com
@@ -149795,13 +149121,11 @@ drweb.ddns.net
  drwskincarejogja.com
  dry-saga-5349.jellybean.jp
  dryaquelingrdo.com
-dryaquelingrdo.softdesigns.org
  drydenva.xyz
  drydwcmokkrmcwmf-dot-millinium.ey.r.appspot.com
  dryhu.xyz
  drykit.de
  drylinkers.site
-dryphggesmxtrupcickjqfvfqz-dot-gl9393jan.uk.r.appspot.com
  dryproservices.com
  drzamindarseyecentre.com
  drzawgrzas.com
@@ -149817,7 +149141,6 @@ ds45x1.com
  ds7.main.jp
  ds851.addroits.com
  ds8f7g98asfill-informations.com
-dsabefbgtbymwfzqxqljvkyeqo-dot-gl9393jan.uk.r.appspot.com
  dsacsacsadcsadcsdac.sportsontheweb.net
  dsadasq1.xyz
  dsadoors.com
@@ -149949,7 +149272,6 @@ dt49.onderhost.com
  dtauuqxsdigjhpim-dot-millinium.ey.r.appspot.com
  dtechgov.com
  dtechsynergy.com
-dteovyksbvntqwrqpugrkustsb-dot-gl9393jan.uk.r.appspot.com
  dtepdiwivgsmcdmn-dot-millinium.ey.r.appspot.com
  dterhnwpdyszohfr-dot-millinium.ey.r.appspot.com
  dtes9tomain.ga
@@ -149984,8 +149306,6 @@ dtours.si
  dtowjfohj.goruli.com
  dtparnian.ir
  dtpfuxpqslfnqlaj-dot-millinium.ey.r.appspot.com
-dtpodyjcqamxndguryzzyvbfyx-dot-gl9393jan.uk.r.appspot.com
-dtqpafijtnzipbqugemfkhagwh-dot-gleow2021ja.ue.r.appspot.com
  dtrendz.site
  dtsawdh.com
  dtsay.xyz
@@ -150369,12 +149689,12 @@ dvla.hmrc-claim.xyz
  dvla.motortax-refund.co.uk
  dvla.mytaxrefund-online.co.uk
  dvla.mytaxrefund-online.com
+dvla.myvehicle-rebate.com
  dvla.myvehicle-tax.com
  dvla.overdueuk.com
  dvla.pendingrefund-tax.co.uk
  dvla.rebate-tax.link
  dvla.rebate-tax.ltd
-dvla.ref2119.com
  dvla.refund-mytax.com
  dvla.refund-roadtax.co.uk
  dvla.refund-tax.ltd
@@ -150422,7 +149742,6 @@ dvloriihqswuixod-dot-millinium.ey.r.appspot.com
  dvmquy.enexbyte.com
  dvncx.goruli.com
  dvnfmdykftftzeff-dot-millinium.ey.r.appspot.com
-dvngdtzrcymyigvesrczvfhnpg-dot-gl9393jan.uk.r.appspot.com
  dvolwrgtmmeuntdb-dot-millinium.ey.r.appspot.com
  dvonlinenotificationsuwpal.com
  dvpont.com
@@ -150438,7 +149757,6 @@ dvtcgafg.rogagot.com
  dvthut.com
  dvtibfngdegxmtrhzifzmgumxj-dot-gleowayel400503.uc.r.appspot.com
  dvtiqxi.cabanova.com
-dvtlpseexzypjmahtiufqoxrpc-dot-gl9393jan.uk.r.appspot.com
  dvwpmavyefxlaljhzgargqtgom-dot-gleowayel400503.uc.r.appspot.com
  dvyatkitotrsctoa-dot-millinium.ey.r.appspot.com
  dvychhqsqjnodpcw-dot-millinium.ey.r.appspot.com
@@ -150472,7 +149790,6 @@ dwgdtuxnuvskdswv-dot-millinium.ey.r.appspot.com
  dwhkkh.ph
  dwifyubwnwcpbxab-dot-millinium.ey.r.appspot.com
  dwillow100bc.com
-dwisqtghmbzmxakmkshpyrfana-dot-gl9393jan.uk.r.appspot.com
  dwistl.net
  dwjrbbbnwbvrgiuorqxxrkiegymcqhggbwdf-dot-glenxpecial3009493.ey.r.appspot.com
  dwkmchivdkgtgucsnzdptdlsugfvdkfjzsbj-dot-cryptic-now-290917.ey.r.appspot.com
@@ -150518,7 +149835,6 @@ dwvrfbbuthzeujby-dot-glexcel1.ue.r.appspot.com
  dwvwigmmogtjhgfjznxiirxeac-dot-gleowayel400503.uc.r.appspot.com
  dwwnrzgawpnacujydyb.top
  dwz.lefu.run
-dwzefpegzcxxcngumwikncmjkj-dot-gl9393jan.uk.r.appspot.com
  dwzkztrkdyjvysdavzogrsybrksjbufxkbyv-dot-gl494903049.wl.r.appspot.com
  dx.198174.com
  dx.198424.com
@@ -150692,7 +150008,6 @@ dzinestudio87.co.uk
  dzipluyurinjuvqg-dot-millinium.ey.r.appspot.com
  dzirkstelite.lv
  dziwne-zdjecia.24f.eu
-dzjywbzfflwocfguxsunhbkadb-dot-gl9393jan.uk.r.appspot.com
  dzktfpfsnperwijb-dot-millinium.ey.r.appspot.com
  dzlc7xp7tenv.talagaremix.com
  dzmxfmbsgetnrkfwyhbavjaxnsfnkpluiczf-dot-cedar-code-289917.nn.r.appspot.com
@@ -151495,8 +150810,6 @@ ebay-payment-issues.com
  ebay-power-service.com
  ebay-promotion.free-listings-over-months.live
  ebay-rechnung-jetzt-online.mariagianinawillroth.de
-ebay-seller.negative-feedback-archive.xyz
-ebay-seller.negative-feedback-log.xyz
  ebay-sellers-promotion.free-listings-starting-today-02.live
  ebay-sellers.free-10000-listings-over-months.live
  ebay-sellers.free-10000-listings-promote-todays.live
@@ -151699,7 +151012,6 @@ ebaymotors.de.ekauferschutz-session37106094.de
  ebayupdatebilling.com
  ebbayr.com
  ebbindrum.de
-ebbkcoucuoeddoqjimybdikbjt-dot-gl9393jan.uk.r.appspot.com
  ebblackenterprise.com
  ebbvdkdehqlxxvhy-dot-millinium.ey.r.appspot.com
  ebcijwynwwlbrxrj-dot-millinium.ey.r.appspot.com
@@ -151906,7 +151218,6 @@ eclubsettingsinfo.com
  ecmeinmediterranean.com
  ecmqfxmgcezrafxptrbcgokegrptjrkfecaz-dot-glxcel49934343434.rj.r.appspot.com
  ecmtabu.com
-ecmuhkgghqngsmzrjnzdlijnmr-dot-gl9393jan.uk.r.appspot.com
  ecngx256.inmotionhosting.com
  ecngx270.inmotionhosting.com
  ecngx279.inmotionhosting.com
@@ -152220,6 +151531,7 @@ eduamazon.top
  eduamazonmonste.monster
  eduardo926737.xyz
  eduardoconill.blog.br
+eduardomendescanal.000webhostapp.com
  eduardovilacadesigner.com
  edubloc.com
  educacaoemvideo.com.br
@@ -152312,6 +151624,7 @@ ee-accountinfo-secure.com
  ee-accountinfo.co.uk
  ee-accountinfo.net
  ee-accountmanaging.com
+ee-accountreview-validation.com
  ee-accountsecure.com
  ee-accountservice.com
  ee-accountsupdate.com
@@ -152496,6 +151809,7 @@ ee-id-payment.com
  ee-id-uk.org
  ee-info-upadtesalert.com
  ee-infoaccounts.com
+ee-infohub.co.uk
  ee-infohub.com
  ee-issues.com
  ee-limited.com
@@ -152612,6 +151926,7 @@ ee-secureinfo-account.com
  ee-secureinfo-billing.com
  ee-securepay.com
  ee-securepayment.com
+ee-securereview.me
  ee-securesafe.com
  ee-secureservice.com
  ee-securesupport.com
@@ -152719,7 +152034,6 @@ ee.co.uk.billing-updates.limited-3ds.info
  ee.co.uk.billing.june2020.icu
  ee.co.uk.cgi-bin.icu
  ee.co.uk.cgi-bin.link
-ee.co.uk.confirm-statement.com
  ee.co.uk.ref7946.link
  ee.co.uk.ref895.com
  ee.co.uk.secure-auth.ir
@@ -152731,6 +152045,7 @@ ee.failedbill-payment.com
  ee.failedbilling-details.com
  ee.failedbilling-payment.com
  ee.failedpayment-details.com
+ee.failurebill-resolve.com
  ee.failurebill-update.com
  ee.gov-repayment.com
  ee.help-login.net
@@ -152740,6 +152055,7 @@ ee.incorrectbill-update.com
  ee.info.billing-xz.com
  ee.initiate-verify.com
  ee.invalidbilling-info.com
+ee.latestbill-failure.com
  ee.monthly-billing-payment.co.uk
  ee.monthly-billings.com
  ee.monthly-directdebit-error.com
@@ -152766,7 +152082,6 @@ ee.ref3176.co.uk
  ee.renew-account.co.uk
  ee.securbilling.help
  ee.securbillingreview.help
-ee.securing-details.com
  ee.services-paybill-online.co.uk
  ee.support.update-billing.mobi
  ee.uk-alerts.com
@@ -152799,7 +152114,6 @@ ee.unsucessfulpayment.com
  ee.update-bill.com
  ee.update-billing.net
  ee.update-detail.net
-ee.updatebill-failure.com
  ee.updatebilling-details.com
  ee.updatebilling-method.com
  ee.verification-paymonthly.com
@@ -152826,6 +152140,7 @@ eearw.xyz
  eeaz-71.ml
  eebestei.com
  eebill-failedpayment.com
+eebill-failure.co.uk
  eebill-secureupdate.com
  eebilleruk.com
  eebillhelpdesk.com
@@ -152927,7 +152242,6 @@ eenjoy.live
  eenotice.com
  eenswrlfppfgwqshretymxrjhy-dot-gleowayel400503.uc.r.appspot.com
  eeodzywkiwpl.ru
-eeohfdyofvdnxwtvpptnwtszid-dot-gl9393jan.uk.r.appspot.com
  eeonline-billsupport.com
  eeonline-customerbill.com
  eeonlineadd.link
@@ -152945,7 +152259,6 @@ eeredirect-update.com
  eeredirect.info
  eerna.com.bd
  eernejd-diskl.com
-eerswuwnglchztmyodqvcjbzxt-dot-gl9393jan.uk.r.appspot.com
  eertfd.com
  eesecure-accountbill.com
  eesecure-accountinfo.com
@@ -153017,6 +152330,7 @@ efcavuhmmbukchrw-dot-millinium.ey.r.appspot.com
  efctnwzdtnuvytttyhzvhdfychckbqstrbww-dot-cryptic-now-290917.ey.r.appspot.com
  efcycwkicsthzxwi-dot-millinium.ey.r.appspot.com
  efdefsfweafsfelive.com
+efdewe-indo.ml
  efdsvse3s.dns05.com
  efe5teh6.gb.net
  efeatasoy.com
@@ -153047,7 +152361,6 @@ efis.top
  efkbnnkzfhbfjogy-dot-millinium.ey.r.appspot.com
  eflom.app.link
  efloscdhgfpasqcmibzmpregcuojsqqgjmbf-dot-cryptic-now-290917.ey.r.appspot.com
-eflroqeudnxccrhayaxrkukafv-dot-gl9393jan.uk.r.appspot.com
  eflugvvprdhamaevnuvnncixdzbqmwvddyqx-dot-cryptic-now-290917.ey.r.appspot.com
  efmgecbsotlljvgq-dot-millinium.ey.r.appspot.com
  efmny.org
@@ -153088,7 +152401,6 @@ efvzkvszfkrbtlti-dot-millinium.ey.r.appspot.com
  efwdrzvmvfoelmqe-dot-millinium.ey.r.appspot.com
  efwvrged.weebly.com
  efxdesigners.com
-efxwstgtvgarysqwrkxecojpaj-dot-gl9393jan.uk.r.appspot.com
  efyyf-376r-hfejf-3r3r3-fjh3-3hhfj.weebly.com
  eg-dota.com
  eg4c.mentriqq.com
@@ -153148,7 +152460,6 @@ eglantiers1180.site-officiel.be
  eglb5.egdemo.info
  eglectonk.online
  eglobletrade.com
-eglypppzyhiiqrjblbyxujcrni-dot-gl9393jan.uk.r.appspot.com
  egmgrupo.com
  egmontair.co.nz
  egnbloqt.rogagot.com
@@ -153271,7 +152582,6 @@ ehyqtazdopfmfjmj-dot-millinium.ey.r.appspot.com
  ei-rbcroyalbank.com
  eiadelerhizmetbasvurun.tk
  eiadetalep-turkiyegovtr.com
-eiakffafvdaubcmcprbxjcovmh-dot-gl9393jan.uk.r.appspot.com
  eiba-center.com
  eichmannforest.buzz
  eichnnpvyvgklyag-dot-millinium.ey.r.appspot.com
@@ -153291,7 +152601,6 @@ eiffelmx.com
  eig-kristinjangro.com
  eigher.info
  eightkimomedicura.info
-eigjsutvxagppxmlygbvaljilu-dot-gl9393jan.uk.r.appspot.com
  eigoeb.com
  eiimquc.goruli.com
  eiitadfswxafdkjsxmipuhlnpx-dot-gleowayel400503.uc.r.appspot.com
@@ -153381,7 +152690,6 @@ ejercitodemaquinas.com
  ejewelbox.com
  ejfdnjgsjbppehxrzpafdulsaayvadwujseh-dot-solar-vertex-285913.rj.r.appspot.com
  ejgbzqaplwmyhxkt-dot-millinium.ey.r.appspot.com
-ejikpnydoohgqykvasldvukoqd-dot-gl9393jan.uk.r.appspot.com
  ejjpeuqebtxrsflmekzxohnjvebsrxkcjiko-dot-cedar-code-289917.nn.r.appspot.com
  ejkpkznchsirkfpdetsnozbgtjlekcukqxew-dot-cedar-code-289917.nn.r.appspot.com
  ejmdnsbhfl.com
@@ -153456,7 +152764,6 @@ ekramuzzaman.com
  ekrhqcaxeqtrwynu-dot-millinium.ey.r.appspot.com
  ekrkoprojthvdbso-dot-millinium.ey.r.appspot.com
  ekruhwier.mrbasic.com
-ekrvfkarzywcrkmnluejyhvxrj-dot-gl9393jan.uk.r.appspot.com
  ekseyazilim.com
  eksiegowa.online
  eksioglu.tv
@@ -153525,7 +152832,6 @@ elastic-objects.000webhostapp.com
  elastic-poincare-1fdcbc.netlify.app
  elastic-swirles-d4fab0.netlify.app
  elastic.paypal.com-informationaccounts.com
-elasticbeanstalk-us-east-2-95newbeie.s3.us-east-2.amazonaws.com
  elasticbeanstalk-us-west-2-371481629042.s3-us-west-2.amazonaws.com
  elastim.netlify.app
  elasun.com
@@ -153732,7 +153038,6 @@ eliminatory-materia.000webhostapp.com
  elimupi.com
  elinazium.online
  elinkco-com.ga
-elinorestreet.buzz
  eliobkahwrocypdy-dot-millinium.ey.r.appspot.com
  eliomagico.com
  eliotecae-my.sharepoint.com
@@ -153822,6 +153127,7 @@ ellieboutique.000webhostapp.com
  ellinika-proionta.net
  elliotgibbs.com
  elliott-songs.xyz
+ellipticaldishonestmodels--five-nine.repl.co
  elliteempregos.com
  ellmuhyselyteogkhoqpyvxoqffupaqletld-dot-glegen303939423233.ue.r.appspot.com
  ellor45.com
@@ -154053,7 +153359,6 @@ embracinghiscall.com
  embramedica.com.br
  embrava.eu
  embroity.com
-embryo-nests.000webhostapp.com
  embunpajar.com
  embusducet.topkorder.su
  embutec.com.br
@@ -154090,6 +153395,7 @@ emeraldcstudio.com
  emeraldessencefarms.com
  emeraldglobaltrust.com
  emeraldsaferappleiso.club
+emeraldsuites.gd
  emercenten.com
  emergency2020-response01.com
  emergencydrug.com
@@ -154490,7 +153796,6 @@ encryption-src.com
  encuesta08964.000webhostapp.com
  encuesta59228-fb.000webhostapp.com
  encuestafinaltrabajo.000webhostapp.com
-encuestainfomx.000webhostapp.com
  encuestainiciosecion.000webhostapp.com
  encuestandopsico.000webhostapp.com
  encuestapolish.000webhostapp.com
@@ -154686,13 +153991,11 @@ enkaypastri.com
  enkelaar.eu
  enkennedy.com
  enkilswvlydrnhdp-dot-millinium.ey.r.appspot.com
-enkpwwtufyhwlvzbemqdwsskwc-dot-gleow2021ja.ue.r.appspot.com
  enkqlcnz.goruli.com
  enkzshcaeskzeoto-dot-millinium.ey.r.appspot.com
  enlacesrp.com.mx
  enlalucha.org
  enlbhg6ogw6cagi.e8273.pro
-enldwigpusehyqghfaslfpzrrv-dot-gl9393jan.uk.r.appspot.com
  enlegeas.com
  enleude.chifanbackground.top
  enlhesa.com
@@ -154719,7 +154022,6 @@ ennqqnonivrtugdtrryvsamaxk-dot-gleowayel400503.uc.r.appspot.com
  ennrc.com
  eno.si
  enodablork.ru
-enoiytrywnyaceidlfawocimud-dot-gleow2021ja.ue.r.appspot.com
  enomicrowler.xyz
  enonanik.ml
  enophksydrees.cf
@@ -154766,6 +154068,7 @@ ensure-7paypal.com
  ensurgeiansclaiminsurer.com
  ensutouchsirimmalaysia.com
  ent-covid19-gouv.info
+ent-free.gq
  entasystem.online
  entatilly.info
  entechco.com.vn
@@ -154778,7 +154081,6 @@ enterfools.net
  enterlogin-chase.app
  enternetnow.com
  enterppal.xyz
-enterprise.shephertz.com
  enterpriseadmins.com
  entersocial.site
  entertaincomtomar.com
@@ -154828,11 +154130,8 @@ enturarts.com
  entzuxtdvs.duckdns.org
  enucpzfiicljjltgsamcknqtiw-dot-gleowayel400503.uc.r.appspot.com
  enulfhqbjughzafpqzzymgxkgieaopzkexwj-dot-off94032393204.uk.r.appspot.com
-enumerable-print.000webhostapp.com
  enunclic.mx
  enunclick.uno
-enunkeoqlhpeiahngsvvtbhemv-dot-gl9393jan.uk.r.appspot.com
-enunomuxfdnelbptsnxxozbqax-dot-gl9393jan.uk.r.appspot.com
  enuonoe.xyz
  enuyguned.ru
  env-3421506.cloud-fr1.unispace.io
@@ -154922,8 +154221,6 @@ eoshj.blob.core.windows.net
  eoslead.com
  eosouthasia.showtimemobileapp.com
  eostechnologies.net
-eoszwpyqsqzgroelhbcnzlainx-dot-gl9393jan.uk.r.appspot.com
-eotsoumgnvimhykdlpkkkapzrv-dot-gl9393jan.uk.r.appspot.com
  eotya-71.ml
  eoueqlaivekqcbsdxilmmeqaggfmbotanvxk-dot-glegen303939423233.ue.r.appspot.com
  eoufpzemogibytupwpdpffoizfdiyzrckexu-dot-cedar-code-289917.nn.r.appspot.com
@@ -154931,7 +154228,6 @@ eouryfvioeurfoevri.xyz
  eovjzzxugcnommeihbayprt.top
  eowkankalnfwupvj-dot-millinium.ey.r.appspot.com
  eowyyyfpmtradhzw-dot-millinium.ey.r.appspot.com
-eoztxxvpcclfqmhidhgptdkmxq-dot-gl9393jan.uk.r.appspot.com
  ep1.marionteams.com
  ep1b.jaysbrand.com
  ep4italiacom.chifanblock.top
@@ -155007,7 +154303,6 @@ epl.paypal-communication.lavieresorts.com
  epl.paypal-communications.prohandicraft.com
  epmzjdfryudogtgo-dot-millinium.ey.r.appspot.com
  epntjdtbfkuwgcuwkrkv.top
-epnxrixjiiidypgtzlfgruvbee-dot-gl9393jan.uk.r.appspot.com
  epocztapolska.pl
  epocztapolska24.net
  epoivpjtshkyrjhuptpeodtpfdakipxeioxt-dot-glenxpecial3009493.ey.r.appspot.com
@@ -155064,7 +154359,6 @@ epworthlocalboard.co.zw
  epwritescom.wordpress.com
  epxivazrxv.duckdns.org
  epxtfpauyuudavpxqv.top
-epybrqipcqnvskkirdcjqpnmrt-dot-gl9393jan.uk.r.appspot.com
  epyieovsnzxatewy-dot-millinium.ey.r.appspot.com
  epyorke.edu.bz
  epzlaepehptjhzenlzvubxqusz-dot-gleowayel400503.uc.r.appspot.com
@@ -155081,7 +154375,6 @@ eqcozbyftbsqdksuxbhjyrdkfu-dot-gloff849483.uk.r.appspot.com
  eqcytxnslsfjzhgcnszewjyvwk-dot-gleowayel400503.uc.r.appspot.com
  eqd.sovereignty2020.com
  eqdzrxhyyftifqxujbvkguedjaaslduoaixx-dot-off94032393204.uk.r.appspot.com
-eqdzxjxwmynrenlaesolldepce-dot-gl9393jan.uk.r.appspot.com
  eqett13assz.appspot.com
  eqfaqvzbodiotyqk-dot-millinium.ey.r.appspot.com
  eqgoeridgowiedgzcobeid0-0975188970co.com.dskweh.cn
@@ -155170,7 +154463,6 @@ erbbwvljatiojkgm-dot-glexcel1.ue.r.appspot.com
  erbria.xyz
  ercey.com.tr
  erchasbnlkjptzoy-dot-millinium.ey.r.appspot.com
-erciilrlxuxidcqimwlconyyic-dot-gl9393jan.uk.r.appspot.com
  ercops.com
  erdabeaghcomp.tk
  erdch.xyz
@@ -155269,7 +154561,6 @@ erkbil.com
  erkekatlet.site
  erkjgcbbrgdjubcfyv.top
  erkmuhval.ru
-erlaxzlrhtgooeaiectseljodi-dot-gl9393jan.uk.r.appspot.com
  erlzchuwr.wang
  erma-systemsoft.de
  ermatiko.ee
@@ -155324,6 +154615,7 @@ error-0m3ls.cf
  error-492x71-support.xyz
  error-connect-online.network
  error-ee-billing.com
+error-ee-payment.com
  error-no-notification-6744.xyz
  error-no-notification-8548.xyz
  error-pages-about-unlocked-perl.reqakfgd.com
@@ -155405,6 +154697,7 @@ eruquantum.com
  erusuconsultants.com
  erw9.addroits.com
  erwerwed.com
+erwin35648.xyz
  erwmdtwlfnkbzvzm-dot-millinium.ey.r.appspot.com
  erwq-71.ga
  erwteyruthfdg.azurewebsites.net
@@ -155576,11 +154869,9 @@ eslamea1.space
  eslammamd3.xyz
  eslammamd8.xyz
  eslammame13.xyz
-eslfaceb00k.000webhostapp.com
  eslickcreative.com
  eslkatowice.com
  esloekqokef.com
-eslwyaxcaqkzpqoggqmqpwtgmp-dot-gl9393jan.uk.r.appspot.com
  esma-edu.com
  esmce.nrru.ac.th
  esmeralda.buzz
@@ -155669,7 +154960,6 @@ esquirefinecleanerscornwall.ca
  esquso.com
  esrahanum.com
  esranagsaddlful.ml
-esrhxbwvwuooczkguuavvvrsyy-dot-gl9393jan.uk.r.appspot.com
  esrmotors.com
  esryd.xyz
  ess1.info
@@ -156212,7 +155502,6 @@ eujlfomaif.duckdns.org
  eujyoecxsqfmsbdx-dot-millinium.ey.r.appspot.com
  euk.lt
  eukbkxljweewawnydomzkcqmltjfdzpkmgnp-dot-glegen303939423233.ue.r.appspot.com
-eukhdxpuouncxalfwzrmvxefwo-dot-gl9393jan.uk.r.appspot.com
  eukpkujhncvmkyqx-dot-millinium.ey.r.appspot.com
  eulawfirmsp.eu
  eulx.goruli.com
@@ -156371,7 +155660,6 @@ evaproekt.ru
  evaskincomplex.com
  evasqlnuoxalwteq-dot-millinium.ey.r.appspot.com
  evavcexmypssohgmstsuwhbtmlqolumrgtqi-dot-glenxpecial3009493.ey.r.appspot.com
-evbkbfwasiuasbwlygumjsotxi-dot-gl9393jan.uk.r.appspot.com
  evcoches-carfactory.net
  evdekal-turkiyegov-tr.com
  evdekal8gbkazan.com
@@ -156453,6 +155741,7 @@ eventcheckin.ca
  eventcherry.com
  eventclaims13.qhigh.com
  eventclaimspubg13.zyns.com
+eventcodashop-mlbb21.ga
  eventcomp.com
  eventdeskguruorg.batwoqisep.top
  eventdiamondskinfree.mrbasic.com
@@ -156503,6 +155792,7 @@ eventpoint-ready20a-web.azurewebsites.net
  eventpressecom.batwoqisep.top
  eventpubg-s13.000webhostapp.com
  eventpubg.itemdb.com
+eventpubg.my.id
  eventpubg71.zzux.com
  eventpubgesport.com
  eventpubgfree14.com
@@ -156671,6 +155961,7 @@ evmodi0.ddns.net
  evmomsblog.com
  evmvdnrbro.duckdns.org
  evnt-garena-ff.skins99.com
+evnt-jn14.tk
  evnt.com.br
  evntspubgmoble.000webhostapp.com
  evoadministrador.com
@@ -156766,7 +156057,6 @@ ewfxgtvrmzobjjbi-dot-millinium.ey.r.appspot.com
  ewges38c.beget.tech
  ewh5t.jaysbrand.com
  ewheydkool.com
-ewhjnayikdplvbnsiwfopqjetu-dot-gl9393jan.uk.r.appspot.com
  ewhyqunanfzzqauk-dot-millinium.ey.r.appspot.com
  ewhzxiqy.goruli.com
  ewillstrin.com
@@ -156817,7 +156107,6 @@ ewtte.xyz
  ewtyreturytuyi13582docfile.rj.r.appspot.com
  ewubo.net
  ewuvpkryxtlzfofc-dot-millinium.ey.r.appspot.com
-ewviazvjmxwynkrbyubgcsfmpq-dot-gl9393jan.uk.r.appspot.com
  ewvrqhjlbysfxilg-dot-millinium.ey.r.appspot.com
  ewwd.82ykza.cn
  ewwsa.xyz
@@ -156955,7 +156244,6 @@ exijbevsrtwwtxye-dot-millinium.ey.r.appspot.com
  exilic-attention.000webhostapp.com
  exilic-sill.000webhostapp.com
  exilum.com
-eximious-thoughts.000webhostapp.com
  eximme.com
  exineconstruction.com
  exinstaima.com
@@ -157040,7 +156328,6 @@ expertlogisticsindian.com
  expertsteelset.pl
  expertswebservices.com
  expiable-hopes.000webhostapp.com
-expire-o2-billingplan.com
  explathe.xyz
  explcisms.com
  expleffienal.info
@@ -157239,7 +156526,6 @@ eymzjxriauhvirmcjkuulocvlhuyotaahurd-dot-cryptic-now-290917.ey.r.appspot.com
  eynbr.vipsnapchatsexting.com
  eynet.biz
  eynriseao.tk
-eynzffyunjcgazjxkducucjpta-dot-gl9393jan.uk.r.appspot.com
  eypcazxgnhtybeqf-dot-millinium.ey.r.appspot.com
  eypdrvkssjujgbug-dot-millinium.ey.r.appspot.com
  eyrherrhereh.tcp4.me
@@ -157277,7 +156563,6 @@ ez2nvpets.com
  ezacol.com.br
  ezankedglaucoma.com
  ezbusiness.co
-ezbydwokyvxkbfvabtqdvljpsa-dot-gl9393jan.uk.r.appspot.com
  ezcjlzjynyvxrrno-dot-millinium.ey.r.appspot.com
  ezdesigns.net
  ezdrtcqpw.goruli.com
@@ -157316,7 +156601,6 @@ ezootampcraez.com
  ezoskficoxjxpnuamjogleqmcg-dot-gleowayel400503.uc.r.appspot.com
  ezottlinggrow.com
  ezpanz.com
-ezpkledivqbmpgrkahpyqegqpp-dot-gl9393jan.uk.r.appspot.com
  ezprofitfx.com
  ezpxfwexfnjtejxloxgetetukcypzusvtrqf-dot-gl494903049.wl.r.appspot.com
  ezratisrael.org.il
@@ -157344,7 +156628,6 @@ ezwks.app.link
  ezwmrlfywoomruhgfuesyuxippoccdrijymd-dot-glenxpecial3009493.ey.r.appspot.com
  ezworks.nl
  ezwpzyhtuabursux-dot-millinium.ey.r.appspot.com
-ezxdotbckgtkjxkivqlmmlncef-dot-gl9393jan.uk.r.appspot.com
  ezy2tax.com
  ezyfintech.com
  ezymilswksmqvsoy-dot-dbenitonline.ey.r.appspot.com
@@ -157529,6 +156812,7 @@ f0486646.xsph.ru
  f0487671.xsph.ru
  f0490078.xsph.ru
  f0490470.xsph.ru
+f0497256.xsph.ru
  f04qvvbwwhmxc09y.com
  f0509826.xsph.ru
  f0b.casa
@@ -157728,7 +157012,6 @@ facbook-authenticaon.000webhostapp.com
  facbook-freefiree.000webhostapp.com
  facbook-moderator-community-issue.my.id
  facbookauthantication.000webhostapp.com
-facbookine.000webhostapp.com
  facbooksecuritytips.000webhostapp.com
  facbooksupp0rt.000webhostapp.com
  facbookvoteownbuisnescontest-uk.000webhostapp.com
@@ -158560,6 +157843,7 @@ facebook.com-08203199.superprimavera.pt
  facebook.com-42661120.mezcalunion.com
  facebook.com-account.security.smahost.ro
  facebook.com-ads-id-588515710.facebooik-ads.com
+facebook.com-agreement-update.vslcomputers.com
  facebook.com-au-personal-login.growmaxmedia.com.au
  facebook.com-check-2579600192.kranti-india.org
  facebook.com-check-3134306713.kranti-india.org
@@ -158764,6 +158048,7 @@ facebook.karmadlazwierzaka.eu
  facebook.kingsky32.co.kr
  facebook.lattam.com.mx
  facebook.lauritodomenico.com
+facebook.letsauth.org
  facebook.lidia39.club
  facebook.lifecenter.ca
  facebook.listing.cars.fx214.xyz
@@ -158776,7 +158061,6 @@ facebook.login.facebook.com.meetmeatmamas.com
  facebook.login.grogiant.com
  facebook.login.inferarchitecture.com
  facebook.login.vvipx20.ml
-facebook.mailus.ovh
  facebook.majusehati.com
  facebook.markeetplacee.pro
  facebook.market.fireequipmentservicecenter.com
@@ -159180,6 +158464,7 @@ facebuokgarinaff.000webhostapp.com
  facecompanyalert000.000webhostapp.com
  facecooks2.com
  facecovid.000webhostapp.com
+facecovr.casa
  facecup.space
  facedekarikatur.0fees.us
  facedesolutions.co.za
@@ -159190,6 +158475,7 @@ facee.fr
  faceeb00k.xyz
  faceebk.cf
  faceebk.xyz
+faceebok-id97524-manage.listing-item5942762295482.com
  faceebok-page59137502-id56718935238856.rauchethanding.com
  faceebok.com-id57621935374568.item585192057859215782.com
  faceebok.listing-ad7238575259-item571629254784.com
@@ -159420,7 +158706,6 @@ fajas89.club
  fajbwzuijhazcksmfemukqwcvfovwiozwrac-dot-gl494903049.wl.r.appspot.com
  fake-wimpern.de
  fakebok.blogcu.com
-fakebook-co.000webhostapp.com
  fakebook.com.mx
  fakebook.my.id
  fakebook.romainlenoir.fr
@@ -159429,7 +158714,6 @@ fakebook4u.byethost7.com
  fakebookanees.000webhostapp.com
  fakebooknew.000webhostapp.com
  fakebuck.masakoteam.repl.co
-fakecontact.top
  fakeebook.0fees.us
  fakeformalityshowoff.com
  fakeframes.xyz
@@ -159910,7 +159194,6 @@ fateffir.com.br
  fateful-sentry.000webhostapp.com
  fateh.com.my
  fateweaver.tech
-fatfdagqnrlujtnscyieikmugc-dot-gl9393jan.uk.r.appspot.com
  fatfoodfetish.com
  fatfreezingmachines.com
  fatg3so.info
@@ -160045,6 +159328,10 @@ fb-254586-marketplace.com
  fb-2565222262669-com.preview-domain.com
  fb-28635461-com.preview-domain.com
  fb-2a5sd8f693-marketplace.com
+fb-2k21.cf
+fb-2k21.ga
+fb-2k21.ml
+fb-2k21.tk
  fb-2wq15gt8y4op8-marketplace.com
  fb-32146112112331-com.preview-domain.com
  fb-364521336359-com.preview-domain.com
@@ -160339,6 +159626,9 @@ fb-mobilemarketplace.com
  fb-msg.com
  fb-msgconcurso-de-parejas-enamoradas123.000webhostapp.com
  fb-mx.com
+fb-newss1.ga
+fb-newss1.gq
+fb-newss1.ml
  fb-notice.com
  fb-object.com
  fb-one.com
@@ -160508,7 +159798,6 @@ fb-sales-marketplace.com
  fb-saless521458.com
  fb-scarlet273-photography.com
  fb-secuerity-protect.000webhostapp.com
-fb-secure-data.000webhostapp.com
  fb-security-department.mobi
  fb-security-review.com
  fb-security-rules.ml
@@ -160771,7 +160060,6 @@ fb6853552-item-photos8674341.online
  fb68872-page35469-real-estate-item96733.com
  fb68924-page56784-real-estate-item56785.house
  fb68974-page23897-real-estate-item23564.house
-fb7-executive-reality-item6-page298.marketing
  fb73456-page23345-real-estate-item89354.house
  fb73645-page78624-real-estate-item46578.house
  fb76645-page67339-real-estate-item28644.house
@@ -160817,11 +160105,8 @@ fbauthenicate.000webhostapp.com
  fbauthenticate86.000webhostapp.com
  fbauthorized.000webhostapp.com
  fbaylejrg.co.cc
-fbb-20k21.gq
-fbb-20k21.tk
  fbb-858.com
  fbb-logtrye.cf
-fbb-logtrye.gq
  fbb-logtrye.ml
  fbbejeycmpygcfazwa.top
  fbbookxyzo.000webhostapp.com
@@ -161197,8 +160482,6 @@ fbook.com-32462567.mrubens.mx
  fbook.com-33754973.mrubens.mx
  fbook.com-35348450.vochtplekken.be
  fbook.com-35446891.vochtplekken.be
-fbook.com-35474287.vochtplekken.be
-fbook.com-36006432.vochtplekken.be
  fbook.com-36089326.logintek.ma
  fbook.com-36735265.mrubens.mx
  fbook.com-36781994.logintek.ma
@@ -161227,7 +160510,6 @@ fbook.com-43668364.mrubens.mx
  fbook.com-43966418.mrubens.mx
  fbook.com-43986281.mrubens.mx
  fbook.com-45166289.mrubens.mx
-fbook.com-45919072.vochtplekken.be
  fbook.com-46289094.vochtplekken.be
  fbook.com-46439695.mrubens.mx
  fbook.com-46479288.mrubens.mx
@@ -161254,7 +160536,6 @@ fbook.com-63354233.betterdeal.pk
  fbook.com-63942987.mrubens.mx
  fbook.com-64525421.mrubens.mx
  fbook.com-64915981.mrubens.mx
-fbook.com-66960216.vochtplekken.be
  fbook.com-67767254.mrubens.mx
  fbook.com-68325712.mrubens.mx
  fbook.com-68879492.mrubens.mx
@@ -161461,6 +160742,7 @@ fbpandemi.com
  fbpass2500.000webhostapp.com
  fbpassport.com
  fbpeintures.com
+fbperingatan71.weebly.com
  fbplsagratis.000webhostapp.com
  fbpolicy-review.com
  fbpolicy-update.us
@@ -161912,7 +161194,6 @@ feggg.7jtba3.cn
  fegrp-download.com
  fegytxmqxkbzmxkrnxkliykbnxorixssnred-dot-off94032393204.uk.r.appspot.com
  fehler-siegen.de
-fehnsolafsmmhcdsrrsgpsnyfq-dot-gl9393jan.uk.r.appspot.com
  feiashao.space
  feicuixue.com
  feieo.com
@@ -161943,13 +161224,11 @@ fejs.ga.dnsfordomains.ru
  fejs.ml
  fejs.ml.dnsfordomains.ru
  fekctjhutkasswcgkidhjouipc-dot-gleowayel400503.uc.r.appspot.com
-fekdxpvnubbxwtianefipelnzp-dot-gl9393jan.uk.r.appspot.com
  fekegnrgvfxcbcbqlcuznfvddye-dot-gl9393jan.uk.r.appspot.com
  fekilopol.xyz
  fekilozi.beget.tech
  felaggeislafraedinga.is
  felavcaqyvjxpxtm-dot-millinium.ey.r.appspot.com
-feldspathic-trims.000webhostapp.com
  felemax.com.ar
  feleskehg.com
  felicia0918.digital
@@ -162439,7 +161718,6 @@ fhhtax.com
  fhhw1u.webwave.dev
  fhibuwepcslxzenprhdntkpmhhnekscwkhxwf-dot-solar-vertex-285913.rj.r.appspot.com
  fhingyzechilrtdc-dot-millinium.ey.r.appspot.com
-fhiuwettodsbxlpzipivjalomv-dot-gl9393jan.uk.r.appspot.com
  fhivelifestyle.online
  fhjhjhgdkhub.com
  fhkab.mentriqq.com
@@ -162486,12 +161764,12 @@ fiaya.webout.life
  fibankoiad-loading.myddns.me
  fibeex.com
  fibercel-latam.com
-fibercheck.xyz
  fibergratifiedv.com
  fiberjalon.com
  fiberspotqatar.com
  fibertectelecom.com.br
  fibill.com
+fibranet.mx
  fibresat.co.za
  fibrofolliculoma.info
  fibromapp.com
@@ -162502,7 +161780,6 @@ ficaemcas4nosentregamossgrtiss.com
  ficaemcasa-magalu.com
  ficaib.com
  ficdehypmider.ml
-ficebooak.000webhostapp.com
  ficeboukco.000webhostapp.com
  ficeofice.com
  fiching-irk.ru
@@ -162522,7 +161799,6 @@ fidapeyzaj.com
  fiddlemarches.com
  fidelit.com.br
  fidelity-access-gh.com
-fidelity-veri-0.000webhostapp.com
  fidelityguide.com
  fidelityplans.com
  fidelitysecure.azurewebsites.net
@@ -162575,7 +161851,6 @@ fifthelement.be
  fiftolkf.cf
  fiftyy42.beget.tech
  figexorcit.com
-figfbwcgtprxlbqtmjlwmogmye-dot-gl9393jan.uk.r.appspot.com
  fighttechsports.com
  fightvscorona.com
  fightwithcapitalism.com
@@ -162584,7 +161859,6 @@ figuig.net
  figura.team
  figurkowy.pl
  figzbgtqoicgefhfcqwgdbsgkspcflqsbbfe-dot-gl494903049.wl.r.appspot.com
-fihrfgnzouuqysuvusrjelkhio-dot-gl9393jan.uk.r.appspot.com
  fiirst-ohst.kozow.com
  fiisttechfed.com
  fij-projet3.be
@@ -162600,7 +161874,6 @@ fil.tools
  filagusta.com
  filam.ihmbrentwood.com
  filaportugal.com
-filar-focuses.000webhostapp.com
  file-attachment.app.link
  file-dropbox.info
  file-rebate.com
@@ -163121,7 +162394,6 @@ firuvet.com
  firuzblog.ir
  fis-lab.com
  fisberpty.com
-fiscal-altitude.000webhostapp.com
  fiscaldopovo.online
  fiscalia.ga
  fiscalsort.com
@@ -163295,7 +162567,6 @@ fjfpyrqsbfaykkag-dot-millinium.ey.r.appspot.com
  fjfqyc.com
  fjgfoknf.com
  fjggfhf.bl18.cn
-fjgmnwwmdhdxduoooyzgfsqqvf-dot-gl9393jan.uk.r.appspot.com
  fjgypqafv.goruli.com
  fjhmdt.com
  fjhygqstataowmrjqoiqavdnuy-dot-gleowayel400503.uc.r.appspot.com
@@ -163344,7 +162615,6 @@ fkgjkfh.ga
  fkgjkfh.ml
  fkgmrgbwlpfztepm-dot-millinium.ey.r.appspot.com
  fkgxijz.goruli.com
-fkiimygeibgdkforeqmyzmzgcq-dot-gl9393jan.uk.r.appspot.com
  fkip.unrika.ac.id
  fkj8.com
  fkjdfdfjrrhref.com
@@ -163391,6 +162661,7 @@ flag-144425820.amarilisperu.com
  flag-156037398.amarilisperu.com
  flag-161206939.amarilisperu.com
  flag-161647309.amarilisperu.com
+flag-19436048.royal-eng.ps
  flag-215870544.amarilisperu.com
  flag-235727965.amarilisperu.com
  flag-24167805.royal-eng.ps
@@ -163716,6 +162987,7 @@ floppyvitreous.com
  flopseptum.com
  flora4567.com
  floradna.com
+floralwhitelazymp3.fernando45.repl.co
  florance92830.club
  florapansiyonotel.com
  floraselfcom.nckifrance.gdn
@@ -163908,7 +163180,6 @@ fmt06.web.com.ph
  fmtc2go.com
  fmtrader.com
  fmufbzgtytmfwzkg.top
-fmvariedades.com.br
  fmvfroh.newhotstore.su
  fmwab.lawapass.com
  fmwc.org
@@ -164158,7 +163429,6 @@ footytube.top
  footzyflipflops.com
  foozoop.com
  fopckwboqvndntbe-dot-millinium.ey.r.appspot.com
-foqfsvihnvpqxmacjqhbcgreow-dot-gl9393jan.uk.r.appspot.com
  for-me.design
  for-realestate-page-736171177.com
  for-remont.ru
@@ -164170,7 +163440,6 @@ foraproletarianparty.org
  foraystrumem.xyz
  forb-fbookcom-04601903.ctiaspire.com
  forb-fbookcom-079648419309.ctiaspire.com
-forb-fbookcom-195550868.ctiaspire.com
  forb-fbookcom-216608940.ctiaspire.com
  forb-fbookcom-381203219364.ctiaspire.com
  forb-fbookcom-43648030414.ctiaspire.com
@@ -164292,6 +163561,7 @@ form-iglivesupport.com
  form-lnstagramverificationbadge.com
  form-lnstagramverificationbadges.com
  form-lnstagramverificationbadges.ml
+form-online-identity-verification.my.id
  form-refund-mar20.info
  form-securepay.com
  form-support.com
@@ -164303,6 +163573,7 @@ form.ref10-return.com
  form.support-updateaccid.bnlpes.com
  form.typeform.com
  form8.sadek-webdesigner.com
+formacao.org.br
  formacioncis.com
  formacionz.com
  formafitness.com.br
@@ -164324,7 +163595,6 @@ formcrafts.com
  formcsi.com
  forme.com.ua
  formedbyme.com
-formedlicensing.com
  formelev3.srphoto.fr
  forming-a.com
  forming-ma.web.app
@@ -164513,11 +163783,6 @@ foulturrin.com
  found-witnesses.000webhostapp.com
  found.new-in.us
  found.sing-us.com
-founder-admin-ck-18896331864589076.tk
-founder-admin-ck-18896331864589077.tk
-founder-admin-ck-18896331864589078.tk
-founder-admin-ck-18896331864589079.tk
-founder-admin-ck-18896331864589080.tk
  foundlity.com
  fountainofhope.com
  four-by-four.club
@@ -164597,6 +163862,7 @@ fpqkl.com
  fpqnstvuiukqokak-dot-millinium.ey.r.appspot.com
  fpqvu8fp.firebaseapp.com
  fpqwlybynyjomwqw-dot-millinium.ey.r.appspot.com
+fprofil-contactdirect.firebaseapp.com
  fps1w.svcoding.com
  fpsdz.net
  fpstjxtzjleqczrc-dot-millinium.ey.r.appspot.com
@@ -164639,7 +163905,6 @@ fqnvtmqsywublocpheas.com
  fqnvtmqsywublocpheas.eu
  fqohiqxzjzxnkgui-dot-millinium.ey.r.appspot.com
  fqovrnjzrodjzpqbnppxqrqmwyprifbxovkp-dot-cedar-code-289917.nn.r.appspot.com
-fqpxgcrtcqgyhgastuwfutesfj-dot-gl9393jan.uk.r.appspot.com
  fqqnnrabtqznquqc-dot-millinium.ey.r.appspot.com
  fqr5us00.firebaseapp.com
  fqrlmkhsvuyspgss-dot-millinium.ey.r.appspot.com
@@ -164777,7 +164042,6 @@ frasi.online
  fratirloktarlitmalr.blogspot.com
  frattighmygamac.cf
  fraud-mobile-device.com
-fraud-mobile-natwest.com
  fraud-payee-alert.com
  fraud-payeealert.com
  fraud.bpcbankingtech.com
@@ -165050,6 +164314,7 @@ freemaintance110qqeddzxxyaki.xyz
  freemanhunt.ml
  freemanps.com
  freemaster.online
+freematerialmetroroyale.com
  freembyeasgc.000webhostapp.com
  freembyeaslla.000webhostapp.com
  freemindtherapy.org
@@ -165350,7 +164615,6 @@ frimaus.shuiaecho.top
  frin.ng
  frindowsberyllium.com
  frindshipp.org
-fringillid-crust.000webhostapp.com
  friofresh.cl
  friscotrailministorage.com
  friseursekretariatcom.nckiaccounting.gdn
@@ -165437,14 +164701,12 @@ frortimy.com
  froshnationng.com.nsgl.xyz
  frospubgm.com
  frostbill.com
+frosteams.com
  frostmorg.com
-frostmrewerds.com
-frostpubgm.com
  frosty-ardinghelli-2fad11.netlify.app
  frosty-benz-329e5d.netlify.app
  frosty-bore.netlify.com
  frosty-curie-82a6dc.netlify.app
-frosty-fermat-051f1b.netlify.app
  frosty-nobel-ca7f68.netlify.app
  frosty-ramanujan-09342d.netlify.app
  frosty-visvesvaraya-23af8b.netlify.app
@@ -165507,7 +164769,6 @@ fryingpanboson.com
  fryktis.ru
  frzltptmharczkimdewzziibsn-dot-triple-upgrade-293822.rj.r.appspot.com
  fs-11.com
-fs-one.com.br
  fs.nfdngx.club
  fs01n1.sendspace.com
  fs01n2.sendspace.com
@@ -165547,7 +164808,6 @@ fse2020.com
  fsecurity-authenticate.000webhostapp.com
  fseerere.bodybydesignfl.com
  fsefsfeg.xyz
-fsemvdgdrvokmxqdkfjluftpva-dot-gleow2021ja.ue.r.appspot.com
  fsf4t4gd.club
  fsfiyusbxfhuokps-dot-millinium.ey.r.appspot.com
  fsgeg.xyz
@@ -165573,7 +164833,6 @@ fspzdjbgpvjxfipv-dot-millinium.ey.r.appspot.com
  fsqnvuyparkzavastkploqveuq-dot-gleowayel400503.uc.r.appspot.com
  fsr.goruli.com
  fsr2ojyz3asfgu-g7rxvsvvm.vercel.app
-fsseddufwlfjgjkhpgglmlhhpa-dot-gl9393jan.uk.r.appspot.com
  fsslg.com
  fsslptljsxktuzgq-dot-millinium.ey.r.appspot.com
  fssrnvrbboztitdy-dot-millinium.ey.r.appspot.com
@@ -165583,7 +164842,6 @@ fstfafphjdqvqiai-dot-millinium.ey.r.appspot.com
  fstudio.co.nz
  fstuoao.com
  fstzl.com
-fsumvwxqydsdppuswvybnmqiqu-dot-gl9393jan.uk.r.appspot.com
  fsvslxgdglijnottocrlhafrzxppcqhwfgas-dot-solar-vertex-285913.rj.r.appspot.com
  fswgqt.vteexcx.com
  fswisqrtrvszqzpl-dot-millinium.ey.r.appspot.com
@@ -165606,6 +164864,7 @@ ftbvcyarftnwhdku-dot-millinium.ey.r.appspot.com
  ftcgyvhubj4.com
  ftcr2.codesandbox.io
  ftcyaf.tanglescanner.com
+ftdbbssotfixnkvrjltcmvzvij-dot-gleow2021ja.ue.r.appspot.com
  ftdcaluhsbpdhaml-dot-millinium.ey.r.appspot.com
  ftdfad347r.6e3t.mwmt.xyz
  ftdgh.yqmmwh.cn
@@ -165617,6 +164876,7 @@ ftflirjdxqcuwhpf-dot-millinium.ey.r.appspot.com
  ftg-refunds.com
  ftgbewwaqw.accurateemployee.net
  ftgbvdewsqa17.vinouno.net
+ftgqdnshmdtzqflcajlvtkquvi-dot-gleow2021ja.ue.r.appspot.com
  fti10021588711003-com.preview-domain.com
  ftik.iainkediri.ac.id
  ftintoro.netlify.app
@@ -165632,7 +164892,6 @@ ftlyrqcwescvdfgb-dot-millinium.ey.r.appspot.com
  ftlzk.goruli.com
  ftmb.ailacabs.com
  ftmuhcolfcbhyvih-dot-millinium.ey.r.appspot.com
-ftnbvtfuuyxorctravrqjlqfzw-dot-gl9393jan.uk.r.appspot.com
  ftnxnx2.000webhostapp.com
  ftook.000webhostapp.com
  ftop9000.com
@@ -165675,7 +164934,6 @@ ftryu.tk
  ftsrscujutpzsumj-dot-millinium.ey.r.appspot.com
  fttzysqbhfupawhhtkclqbzycistlctuablf-dot-cryptic-now-290917.ey.r.appspot.com
  ftu.goruli.com
-ftvriposfvlzifwzkxwrkfxfzv-dot-gl9393jan.uk.r.appspot.com
  ftvyiihbnhojwbda-dot-millinium.ey.r.appspot.com
  ftwbbb.serviceorder.su
  ftwork.co.uk
@@ -165761,7 +165019,6 @@ fuliestone.com
  fuliginous-approach.000webhostapp.com
  fuling.06fv.com
  full-bodied-relays.000webhostapp.com
-full-mouthed-handfu.000webhostapp.com
  full-out.net
  fullappz.pk
  fullassistance.cl
@@ -166107,7 +165364,6 @@ fxtradecompany.top
  fxtradingtactics.com
  fxuenc4tbqtk6xuzgjhph3am6y-adwhj77lcyoafdy-www-paypal-com.translate.goog
  fxvfwocmozylftil-dot-millinium.ey.r.appspot.com
-fxvgrwlndkxdjnkuvhdvgmhtfn-dot-gl9393jan.uk.r.appspot.com
  fxvipmaster.com
  fxw01.jaysbrand.com
  fxwhjlxhxtmlbnrhlmsfhmnclggulxqutjxf-dot-cryptic-now-290917.ey.r.appspot.com
@@ -166206,7 +165462,6 @@ fzwise.com
  fzwjsbzfvrfsgmcuay.top
  fzwjwzqkruracthc-dot-millinium.ey.r.appspot.com
  fzwxluze.goruli.com
-fzxgfcwphqtwyombdwsqdzxfco-dot-gl9393jan.uk.r.appspot.com
  fzxxpwlghbzsztev-dot-millinium.ey.r.appspot.com
  fzyrnlgoxvbmtfvy-dot-millinium.ey.r.appspot.com
  fzywqfcatjpamwmu-dot-millinium.ey.r.appspot.com
@@ -166259,7 +165514,6 @@ g0mj.jaysbrand.com
  g0n-d.mentriqq.com
  g0ogle.free.fr
  g0rj1om33t.ru
-g0uxvvzzmu0utgixmhhhvmyj.fra1.cdn.digitaloceanspaces.com
  g0vdvlalicensi-g0vsupporttaxpaymentseeuyfw.sue-cape.co.uk
  g0vpaymettaxrefund.ifossw.com
  g0y.95mcp.com
@@ -166356,6 +165610,7 @@ gabriela.ct8.pl
  gabrieldumortier.be
  gabrielfelipe.com
  gabrielinsg-001-site1.htempurl.com
+gabrieljpatti.com
  gabrielkrail.com
  gabriellesrestaurant.com
  gabrielsan.com
@@ -166662,6 +165917,7 @@ gamemechanics.com
  gameonlinedoithuong.com
  gamepit.mobi
  gameplay303.com
+gamepoinblank.xyz
  gamerbingo.com
  gameroll.xyz
  gamerpros.club
@@ -166855,6 +166111,7 @@ garenaffindonesia.opendm.net
  garenaffl.com
  garenafreefire.skingratis24.cf
  garenafreefirevn2020.top
+garenalff.com
  garenamenagakaneventskinmp40incubatorgratis.000webhostapp.com
  garenanow.myvnc.com
  garenanow4.myvnc.com
@@ -167139,7 +166396,6 @@ gcare-support.com
  gcash-fcebook.000webhostapp.com
  gcashoperator.website
  gcavmtukgmstfcrp-dot-millinium.ey.r.appspot.com
-gcbe-connmm.tk
  gcbhwzwpkkd2jqxscrox.us-south.cf.appdomain.cloud
  gcbmarketing.com
  gcbtofrebvpkyvva-dot-millinium.ey.r.appspot.com
@@ -167151,7 +166407,6 @@ gcesab.com
  gcfnyxxhailyazjg-dot-millinium.ey.r.appspot.com
  gcftdrds.m3ikp3.cn
  gcg-corp.com
-gcgexyexxqfrfkoilpsngwgtoi-dot-gl9393jan.uk.r.appspot.com
  gch7.com
  gciciqpswepiwhwm-dot-millinium.ey.r.appspot.com
  gcirsa.com
@@ -167168,7 +166423,6 @@ gcoronag.000webhostapp.com
  gcorpsa.com
  gcowntlxasuhadfe-dot-millinium.ey.r.appspot.com
  gcpfs.info
-gcqdexsdodkbnxnkqvdenpooex-dot-gl9393jan.uk.r.appspot.com
  gcqjx.com
  gcqpoyokibsccivh-dot-millinium.ey.r.appspot.com
  gcradiology.com.au
@@ -167239,11 +166493,9 @@ gdmsemea.caas4u.com
  gdmusic.net
  gdnamesg.firebaseapp.com
  gdnbklwvyzosntkp-dot-millinium.ey.r.appspot.com
-gdnccosyimvwxspvpimabkpzns-dot-gl9393jan.uk.r.appspot.com
  gdockierock.us
  gdonedoc.retailcube.eu
  gdorxhookzkpkeef-dot-glexcel1.ue.r.appspot.com
-gdoyantfytnnbjgebasevnvhsu-dot-gl9393jan.uk.r.appspot.com
  gdpr-giffgaff.network
  gdpr-law-giffgaff.support
  gdr01-supports-account-security-card-amazon.org
@@ -167267,13 +166519,13 @@ gdthot.info
  gdthtgf.com
  gdtsolutions.vn
  gduahmjguvqlhxvg-dot-millinium.ey.r.appspot.com
+gdugytcwkepvymewrmus.com
  gdupdneyhwhsxtnpotrd.com
  gduploads.com
  gdv.stomp.digital
  gdvdjsyd.com
  gdviacrumvcbxodmxpvpsnhxqugvuefsagxy-dot-cedar-code-289917.nn.r.appspot.com
  gdvucfkspaytczqgersbtunjxsar.top
-gdxgktiydrpypcamkrixvydmzu-dot-gl9393jan.uk.r.appspot.com
  gdyaxf.com
  gdyblvjmwrmnmnmj-dot-millinium.ey.r.appspot.com
  gdynia-fakt24.pl
@@ -167596,6 +166848,7 @@ georoc.co.za
  georqecourey.com
  geos1.cf
  geosealf.com
+geosigma.cl
  geosrt.com
  geotechnic.co.uk
  geotexsas.com
@@ -167857,6 +167110,7 @@ getsee-soft.site
  getsee.services
  getsees.xyz
  getsharktank.com
+getskinfree.com
  getskinmobilelegends.ml
  getskinpubgs13.loseyourip.com
  getskinrewardpubg.freeddns.com
@@ -167891,7 +167145,6 @@ gettingreadycom.000webhostapp.com
  gettingwebpage.billing-update3248769.xyz
  gettjoingruopswhatpss.xxuz.com
  gettnews11.ocry.com
-getuc17.com
  getuniques.buzz
  getupandcboz.com
  getupandcycle.com
@@ -167925,7 +167178,6 @@ getz5.shop
  geuhw.xyz
  geuka.org
  gevkzojcniieqmlx-dot-millinium.ey.r.appspot.com
-gevxnhlgezuysliuwbjevppeko-dot-gl9393jan.uk.r.appspot.com
  gew63.svcoding.com
  gew9axd89-6xvvf7480.vercel.app
  gewcaaqarelouine.com
@@ -167933,7 +167185,6 @@ gewe.tech
  gewhhewweq.mypi.co
  gewtt.xyz
  gexgyxglylmpvern-dot-millinium.ey.r.appspot.com
-geyxdhhzljkrfmppqptqxaoehq-dot-gl9393jan.uk.r.appspot.com
  gezewgsvrsfknrnk-dot-millinium.ey.r.appspot.com
  gezrerrt-support.net
  gf2b.ailacabs.com
@@ -168001,7 +167252,6 @@ gfsdfd.hfsjkdf.xyz
  gfshyjy.com
  gfsjkqgooblbqktq-dot-millinium.ey.r.appspot.com
  gfsn.com.mx
-gfsrjsrhpbxuxvejoiephpwskp-dot-gl9393jan.uk.r.appspot.com
  gfssecurities.com
  gfstcrates12.otzo.com
  gfstw.xyz
@@ -168140,6 +167390,7 @@ ghadtanter.ml
  ghadtanter.tk
  ghaeumofpeyntsoxbc.top
  ghafarbooss.ddns.net
+ghalysaqqal.com
  ghanbypfutgwufpqdr.top
  ghancommercialbank.com
  ghanhhsy.cam
@@ -168293,7 +167544,6 @@ gibsonhennigan.com
  gibsonhomesva.com
  gicdjnxlppvozamg-dot-millinium.ey.r.appspot.com
  giclima.gr
-gicvpycktpqbmrzupmfmyicjsg-dot-gl9393jan.uk.r.appspot.com
  gidazkepxhvkfbvifulccacihz-dot-gleowayel400503.uc.r.appspot.com
  giddyupmedia.com.au
  gidirmegala.com
@@ -168548,6 +167798,7 @@ giumaithanhxuan.com
  giumednt.com
  giuseppev.ug
  giuuijhjhujhk.rf.gd
+giv-piotw.duckdns.org
  giv3away-eventhpv1.ddnslive.com
  giva-karakter-gratis-ff-2020.000webhostapp.com
  give-350ba.loseyourip.com
@@ -168670,7 +167921,6 @@ gjousf.les3h9.cn
  gjoyivxweuybklndkttnvecrtv-dot-gleowayel400503.uc.r.appspot.com
  gjr8.loveapple911.com
  gjrdtzrmuyjyhxomchswxrucnufymxgoyrjm-dot-gl494903049.wl.r.appspot.com
-gjrxhbwkkijkujtyepnwogmfll-dot-gl9393jan.uk.r.appspot.com
  gjsskveippuwhyqp-dot-millinium.ey.r.appspot.com
  gjst.svcoding.com
  gjtcrkkab.goruli.com
@@ -168679,6 +167929,7 @@ gjtshabvlpcjqduk-dot-millinium.ey.r.appspot.com
  gjttaamibpysxadlgatx.com
  gjulenbpaphqkywpolhjbxbtdz-dot-gleowayel400503.uc.r.appspot.com
  gjusvoqmkddfahvoccst.com
+gjutoixpvcqrnvkqemzdyijbzp-dot-gleow2021ja.ue.r.appspot.com
  gjv28ylgxyii.talagaremix.com
  gjvpuipydmnsckco-dot-millinium.ey.r.appspot.com
  gjvtri.org
@@ -168711,7 +167962,6 @@ gkh-psp.ru
  gkhdwewhwdricuyw-dot-millinium.ey.r.appspot.com
  gkilpatrick.town.ie
  gkjao02kgml12dhfaffgw537hvfs.top
-gkjuvboxlskgcphusacohkvzgd-dot-gleow2021ja.ue.r.appspot.com
  gkjx168.com
  gkkgorzow.pl
  gkldl.godaddysites.com
@@ -168733,7 +167983,6 @@ gkvmcybpckeggwwg-dot-millinium.ey.r.appspot.com
  gkwrkzrhpjoxpocb-dot-millinium.ey.r.appspot.com
  gkx8.addroits.com
  gkxntlgrtwxagehqhrbqknnfia-dot-gleowayel400503.uc.r.appspot.com
-gkyykzqzhxoxilbuyljuajsrtp-dot-gl9393jan.uk.r.appspot.com
  gkz9877oj.gq
  gkzdzzgcvi.duckdns.org
  gkznvxbnhoghmknm-dot-millinium.ey.r.appspot.com
@@ -168824,7 +168073,6 @@ glf.wwthkx.cn
  glfgaxyojzrwsvcs-dot-millinium.ey.r.appspot.com
  glfgepnpsqsnnutspjstqazzlimunvimsykd-dot-glxcel49934343434.rj.r.appspot.com
  glfo.eu
-glfsugvsqyzsadgauvshotpchy-dot-gl9393jan.uk.r.appspot.com
  glgtnuxqfwcoaumu-dot-millinium.ey.r.appspot.com
  glibonlinewebapps.com
  gliclof.org
@@ -169119,7 +168367,6 @@ gmpategofr.nckiwomen.gdn
  gmpbfsroioaddwuotodvdxxawv-dot-gloff849483.uk.r.appspot.com
  gmpfwoywfguwyxfwgpbogyjzwd-dot-gleowayel400503.uc.r.appspot.com
  gmpwqczfgtdgdjvtnp.top
-gmqqqvjlwicfsrtogzvggxfaix-dot-gl9393jan.uk.r.appspot.com
  gmr.az
  gmrs-roanoke.com
  gms2006.de
@@ -169177,7 +168424,6 @@ gnimelf.net
  gninvest-ag.com
  gnitzerqcgbldfnq-dot-millinium.ey.r.appspot.com
  gnizxvtorwcjsrzopubfvkgcmudzkjrzonle-dot-solar-vertex-285913.rj.r.appspot.com
-gnjaiunhioafklpjudjwxfyunm-dot-gl9393jan.uk.r.appspot.com
  gnlmfgpyoqbvampn-dot-millinium.ey.r.appspot.com
  gnnqbhsjnoxwvjgekbfoaunedavcxccmuafe-dot-cedar-code-289917.nn.r.appspot.com
  gnoddrc.org
@@ -169409,7 +168655,6 @@ gojuryukarate.co.za
  gok.wladyslawow.pl
  gokdenizz.com
  goklerlastikkaplama.com
-goktbnuhadlwxazeqaeuqmhzrf-dot-gl9393jan.uk.r.appspot.com
  gokulnath.me
  gol4apple.com
  golaantsystem.xyz
@@ -169479,7 +168724,6 @@ goldenstarkos.gr
  goldenstatetow.com
  goldentigerphotocircuit.com
  goldentimepattaya.com
-goldentop.info
  goldentouchevents.com
  goldenwestsetupservice.yolasite.com
  goldenwing.co.ke
@@ -169669,7 +168913,6 @@ goofglte.com
  goofy-brown-edae5e.netlify.app
  goofy-heisenberg-024343.netlify.app
  goofy-heisenberg-557073.netlify.app
-goofy-mcclintock-8f7dcf.netlify.app
  goofy-mcclintock-a02634.netlify.app
  goofy-shannon-7573c7.netlify.app
  googeoffice.netlify.app
@@ -169739,7 +168982,6 @@ googlecloudupdatescenter.com
  googlecoronavieus.com
  googlecoronvirus.com
  googlecroonavirus.com
-googledoc.data1chwels-reset.gb.net
  googleele.ddns.net
  googlefitbit.guru
  googlefoundation.somee.com
@@ -169885,7 +169127,6 @@ goulivazaruba.com
  goupdate-info.net
  goupwhatsappsange2020.whatsapp-bokep.tk
  gouro-b.com
-goutnutsrtcnsfksmurdvcasvs-dot-gl9393jan.uk.r.appspot.com
  gouttieresboivin.com
  gouv-federalsubsidiescovid-19crisis.com
  gouv-impot.cemerbas.com
@@ -169894,7 +169135,6 @@ gouv1-0billd.com
  gouvcanada-covid19.com
  gouvernementrdc.com
  gouvref456216verifauthentification.com
-gouwtmcvoxcgfrjetpohxxvvde-dot-gl9393jan.uk.r.appspot.com
  gov-24.com
  gov-az.herokuapp.com
  gov-ca-covid19.org
@@ -170040,7 +169280,6 @@ gov.uk-auth-v98.com
  gov.uk-auth-v99.com
  gov.uk-dvla-vehicle.com
  gov.uk-dvla.ltd
-gov.uk-dvla.org
  gov.uk-idverify.com
  gov.uk-idverify.info
  gov.uk-rebates1.com
@@ -170280,11 +169519,11 @@ gqsbqxhtsgqbhynr-dot-millinium.ey.r.appspot.com
  gqtwqatpeomadhny-dot-millinium.ey.r.appspot.com
  gqtxnfqsjdppohywtuwsqaibcssehqmeizdb-dot-glenxpecial3009493.ey.r.appspot.com
  gquijiayap.duckdns.org
+gqumeqekjvgrxrtkyvwmmmhphg-dot-gleow2021ja.ue.r.appspot.com
  gqutbaaymgemoxgshgtjavjzuz-dot-gl9393jan.uk.r.appspot.com
  gquy4.app.link
  gqvngvvbxoyekoyawmmrjrvgqqxhbkvqoavr-dot-cedar-code-289917.nn.r.appspot.com
  gqvvrrvhheboqdmaoafwfxusbf-dot-gleowayel400503.uc.r.appspot.com
-gqwbaymuwxnokpyixkmqbkksep-dot-gl9393jan.uk.r.appspot.com
  gqwhyjh.com
  gqyjixnnffwwvsnz-dot-millinium.ey.r.appspot.com
  gqzdqdgolu.duckdns.org
@@ -170503,7 +169742,6 @@ graymarshwound.com
  graztrty.net
  grb-inter.com
  grbbectsklcgnludvmvbotilir-dot-gleowayel400503.uc.r.appspot.com
-grbqbuqjtfhrkqilmqfondfvva-dot-gl9393jan.uk.r.appspot.com
  grbrahasiaxxtah.000webhostapp.com
  grcollins.co.uk
  grdjynmvcok.top
@@ -170612,7 +169850,6 @@ greenhackersonline.com
  greenhill-action-group.co.uk
  greenhillactiongroup.co.uk
  greenhome-geo.com
-greenhues.co.in
  greeniesociety.com
  greenifiber.com
  greenikonmspl.org
@@ -170840,7 +170077,6 @@ groteandsons.com
  grotta-di-sale.changeland.com
  grottedisaledesenzano.com
  grotyr.organiccrap.com
-groub-bokep-perawan-sma-indo-da-vcs.000webhostapp.com
  groub-bokep.asia
  groub-chat-whatapp11.wikaba.com
  groub-chat-whatapps20.gets5.com
@@ -170989,7 +170225,6 @@ groupe-assurance.blogspot.com
  groupe-cets.com
  groupe-frayssinet.fr
  groupe-kpar3.com
-groupebarakat.com
  groupebinary.com
  groupecamelfinance.com
  groupelalapo.blogspot.com
@@ -171374,6 +170609,7 @@ grub-mabar-freefire.gleeze.com
  grub-mabar.my.id
  grub-mabarbarengyoutuber.newwww.my.id
  grub-rea.jkub.com
+grub-sexy-member22.cf
  grub-wa-bok3p18.000webhostapp.com
  grub-wa-bokep-18-keatas-no.000webhostapp.com
  grub-wa-bokep73.000webhostapp.com
@@ -171763,6 +170999,7 @@ grup-wabudi01-gaming.000webhostapp.com
  grup-wahtsapp18.hot49.ml
  grup-wathsapp18.idwa8.cf
  grup-watsaap-dewasa.000webhostapp.com
+grup-watsapp-notnot.ikwb.com
  grup-webwhatsapp.guied17.my.id
  grup-whaatsaap.000webhostapp.com
  grup-whastapp01.sex-wa.ga
@@ -171828,7 +171065,6 @@ grup-whatsappsviral.ftp1.biz
  grup-whatsappx.xnxxx.my.id
  grup-whatshap-free-fire-2020.000webhostapp.com
  grup-whatspp-bokep-indo18.000webhostapp.com
-grup-youtubee.000webhostapp.com
  grup-youtuber.holds20.com
  grup.18pluss.frezas.my.id
  grup.bokep.wa.crotdsx.ygto.com
@@ -171865,7 +171101,6 @@ grupameliabuhay.000webhostapp.com
  grupanakmudawajamincrott.000webhostapp.com
  grupanksma2020.newgroups13.ml
  grupasikterbaruni.000webhostapp.com
-grupb0kep1ndo.000webhostapp.com
  grupbagibagiakunff.000webhostapp.com
  grupberbagi-video18plus.000webhostapp.com
  grupberbagi.2waky.com
@@ -171876,7 +171111,6 @@ grupberbagividiodewasa18.000webhostapp.com
  grupberbagividioenakenak.000webhostapp.com
  grupberbagividioenakenak120.000webhostapp.com
  grupberbagividioenakenak130.000webhostapp.com
-grupberbagividiowikhwikh.000webhostapp.com
  grupbf18.whatsap-gr33.tk
  grupbfvirallll.000webhostapp.com
  grupbk3p.000webhostapp.com
@@ -172119,6 +171353,7 @@ grupjoin.zyns.com
  grupjoinnew.join452.net
  grupjoinwhatsap.wa-hotnew.gq
  grupjoinwhtsapp.dumb1.com
+grupkentu18.jkub.com
  grupkhusus18-indo.wa-sex.com
  grupkhususdewasa.2waky.com
  grupkhususdewasabocildilarangmasuk.000webhostapp.com
@@ -172283,7 +171518,6 @@ gruppefef.asli20.com
  gruppisphomepage.000webhostapp.com
  gruppo-bnl.com
  gruppo-bpm-italia.com
-gruppo-intesa-isp.com
  gruppo-isp-normativa.com
  gruppo-mps.com
  gruppo-mps.it
@@ -172381,7 +171615,6 @@ grupsexviral2020.vh5.xyz
  grupsexwa.event55s.com
  grupsexwaanaksmadanbo.zyns.com
  grupsexwhatsapp.4dq.com
-grupsexxywhatsapp.wikaba.com
  grupsexycewe.000webhostapp.com
  grupsispersonalstop.com
  grupsjoinwadewasa.join-viip.com
@@ -172546,7 +171779,6 @@ grupwasap.viyy7.com
  grupwasap011.000webhostapp.com
  grupwasaptbokepfreejj.000webhostapp.com
  grupwasapyoutuber.trickip.net
-grupwasaya.2waky.com
  grupwascrim.com
  grupwasekolah.000webhostapp.com
  grupwasexy.verif69.com
@@ -172757,7 +171989,6 @@ gsagsa-71.ml
  gsbc.gr
  gsbedcvjshjs.weebly.com
  gsbh.shoesmogul.com
-gschqpcjmzbayewgmphhwagvdv-dot-gl9393jan.uk.r.appspot.com
  gscrow.com
  gscustomeerslocloud0.com
  gsddfsfasa.pw
@@ -172800,7 +172031,6 @@ gskoummczkdahzds-dot-millinium.ey.r.appspot.com
  gslmjlrxnzcjuafu-dot-millinium.ey.r.appspot.com
  gslspiritassociation.org
  gslstion.com
-gsmaduoxzciizjhfaklekrrbim-dot-gl9393jan.uk.r.appspot.com
  gsmadvisors.co.in
  gsmaige.com
  gsmdenfeukfhdmix-dot-millinium.ey.r.appspot.com
@@ -172915,7 +172145,6 @@ gthnhmerrv.web.app
  gtigtex.info
  gtimarkets.com
  gtitco.com
-gtjevekyvnsjwrgnghmljvdzyl-dot-gleow2021ja.ue.r.appspot.com
  gtjjrcmwxcxgemzo-dot-millinium.ey.r.appspot.com
  gtjypro.com
  gtkvrytbyqbrrkta-dot-millinium.ey.r.appspot.com
@@ -173034,17 +172263,17 @@ guide-09263233.zjlions.org
  guide-13548252.zjlions.org
  guide-20922961.zjlions.org
  guide-25862689.zjlions.org
-guide-31972066.zjlions.org
+guide-26644759.zjlions.org
  guide-33638921.zjlions.org
  guide-35053861.zjlions.org
  guide-35309792.zjlions.org
  guide-43661525.zjlions.org
-guide-45493304.zjlions.org
  guide-45612749.zjlions.org
  guide-55264331.zjlions.org
  guide-57747925.zjlions.org
  guide-58187148.zjlions.org
  guide-60399268.zjlions.org
+guide-62943643.zjlions.org
  guide-68190176.zjlions.org
  guide-69042808.zjlions.org
  guide-81027605.zjlions.org
@@ -173152,7 +172381,6 @@ guose.intsungroup.com
  guoseu.com
  guotao.winmail01.cn
  guoxiaorui.cn
-gupivooocdgwamevzhlvosdrck-dot-gl9393jan.uk.r.appspot.com
  gupoty.aninik.me
  gupovipteamsos.com
  guppon.com
@@ -173184,11 +172412,9 @@ gustavocosta.pt
  gustavodcampos.com
  gustochain.com
  gustosoesemplice.com
-gusyozqyjwtlakehznaxovuypn-dot-gl9393jan.uk.r.appspot.com
  gutachter-kanzlei.de
  gutasiergo.com
  gutasiergo1.com
-gutblessyou.com
  gutbrod-kunkler.ch
  gutesvonhierorg.batwoqiseries.top
  guteunterhaltung.de
@@ -173226,10 +172452,10 @@ gvecqomdicpknfglyovphvpoqvlfslhwqxei-dot-gl494903049.wl.r.appspot.com
  gveejlsffxmfjlsfbllq.com
  gvexcelsior.nl
  gveywmvcqo.firebaseapp.com
+gvfdg.ucoz.es
  gvfoundation.com
  gvghwoedcnyorgao-dot-millinium.ey.r.appspot.com
  gvglfcwwdyitbldopmwugkdedkczyvqlcdyj-dot-glegen303939423233.ue.r.appspot.com
-gvgovzrmfrgpxoayjkzymhtpxx-dot-gl9393jan.uk.r.appspot.com
  gvgvvgvvjjh.weebly.com
  gvgxgzenraldqfmj-dot-millinium.ey.r.appspot.com
  gvhybvyd3.com
@@ -173313,13 +172539,11 @@ gwictoxjdxzvkqho-dot-millinium.ey.r.appspot.com
  gwigxmgoztzdeedxnrtxxeyvxobcoyelrzvs-dot-cedar-code-289917.nn.r.appspot.com
  gwinxx.com
  gwisalltrack.com
-gwixwlgoczlqkotycwgrluutef-dot-gl9393jan.uk.r.appspot.com
  gwjbtbcawbpyzefj-dot-millinium.ey.r.appspot.com
  gwkaqtfaufyrrncfhdzaenpzld-dot-gleowayel400503.uc.r.appspot.com
  gwlbnin.goruli.com
  gwmpdtveuxwamqfl-dot-millinium.ey.r.appspot.com
  gwnfsdlhjnyjycvbijabilvahdbzqtanwfaj-dot-solar-vertex-285913.rj.r.appspot.com
-gwnqjficunfgzfqnhraigmqqbe-dot-gl9393jan.uk.r.appspot.com
  gwqr.onderhost.com
  gwqxrscggodvvzfb-dot-millinium.ey.r.appspot.com
  gwrd.hq1.best
@@ -173352,7 +172576,6 @@ gxfbkj.com
  gxffny.com
  gxgfnm.com
  gxghsy.com
-gxgizzvroadmfykdhvfkgcumim-dot-gleow2021ja.ue.r.appspot.com
  gxhaoyouhh.com
  gxirvjfiqirmiwtd-dot-millinium.ey.r.appspot.com
  gxkaishan.com
@@ -173416,7 +172639,6 @@ gykiotocukqdjaua-dot-millinium.ey.r.appspot.com
  gylabtwj.shoesmogul.com
  gylcvlizuaecpbmkkboomwrgmggkgababorw-dot-glegen303939423233.ue.r.appspot.com
  gyligsvlzycdnmbthozknzhqtx-dot-gleowayel400503.uc.r.appspot.com
-gylkzfmbrkqphglrapcpvhssnd-dot-gl9393jan.uk.r.appspot.com
  gyltwsbenrcjdzesvswyeybyixtxqoeevztm-dot-cedar-code-289917.nn.r.appspot.com
  gylvqcvfvrnniuwc-dot-millinium.ey.r.appspot.com
  gym.marvin.tech
@@ -173745,7 +172967,6 @@ hadiyaacoub.com
  hadiyecekilis.xyz
  hadoweggplant.com
  hadre.xyz
-hadteunion.weebly.com
  hadybook.com
  haeacokzchwhipdt-dot-millinium.ey.r.appspot.com
  haeal.ru
@@ -174945,6 +174166,7 @@ halisecure-online.com
  halisecure-request.com
  halisecure-verifypayee.com
  halisecure.co.uk
+halisecureauth-proceed.com
  halisecuredevice.com
  halisecurity.com
  haliuk-secure-device.com
@@ -175073,6 +174295,7 @@ handsomef8.com
  handsonbeautysalon.co.uk
  handstandbuffer.com
  handyman.macleannsw.com
+handynearhypercard.dthsesrerf.repl.co
  handyphoto4.com
  handystarlet.com
  handystepcom.shuiabox.top
@@ -175243,7 +174466,6 @@ haremnick.com
  hareshawwise.com
  haresoku.com
  harfordervet.net
-harimaukita.or.id
  haringeystopandsearch.co.uk
  haringmedia.casa
  hariominvestment.com
@@ -175510,7 +174732,6 @@ hbd.svcoding.com
  hbejedilyf.sweetwprice.su
  hbes.amzaoe.top
  hbetngdgtvltrfqh-dot-millinium.ey.r.appspot.com
-hbeyizdgmlukzbqejjhwgsvhxl-dot-gl9393jan.uk.r.appspot.com
  hbeywdxtctkinpbmobibmxkgqltlgjcmbcny-dot-glenxpecial3009493.ey.r.appspot.com
  hbfhdaooxlvdthxdogmzvqsqcukkmysntxla-dot-solar-vertex-285913.rj.r.appspot.com
  hbfiauqcfcvehryb-dot-millinium.ey.r.appspot.com
@@ -175562,7 +174783,6 @@ hbweiner.org
  hbwqz.ml
  hbwuu.weebly.com
  hbxcubb9.ml
-hbxwwzqhblinmhjiqhoujzusce-dot-gl9393jan.uk.r.appspot.com
  hbxyqfairjaswqyf-dot-millinium.ey.r.appspot.com
  hbyfyxh.com
  hbyoubu.com
@@ -175675,7 +174895,6 @@ hdkhdjkdhdsd.yolasite.com
  hdlinkslist.site
  hdmediahub.club
  hdmmlrqcdrytjwye-dot-millinium.ey.r.appspot.com
-hdoemoqtnpqzlxlckhoplriiam-dot-gl9393jan.uk.r.appspot.com
  hdoetwzhavnddswhcidchuheyulgfdum.com
  hdokfjrgxcnrxrbeiuuudbkxhp-dot-gloff849483.uk.r.appspot.com
  hdpbsnshlprcvrysrvce01.my.id
@@ -175683,7 +174902,6 @@ hdplayer9.site
  hdplaygirl.club
  hdposter.com
  hdpqzeclgnlcajaa-dot-millinium.ey.r.appspot.com
-hdqctjmogtghfqzvhmlkipybif-dot-gl9393jan.uk.r.appspot.com
  hdqnacguyvufqezx-dot-millinium.ey.r.appspot.com
  hdrgs.xyz
  hdrops.fun
@@ -176167,7 +175385,6 @@ help-lnstagramverified-service.com
  help-login.co
  help-m2c.eccang.com
  help-media-fb.info
-help-mediacrew.com
  help-mobileapp.com
  help-netflix-pago.com
  help-netflix-ro.info
@@ -176221,7 +175438,6 @@ help-xszsfd.tk
  help.account.center.paypal.com.reff89890606.email
  help.andrewssoftware.com
  help.authenticate-removal.com
-help.copyrightform-help.tk
  help.facebooksecured.com
  help.facebooksecuredhelp.my.id
  help.fb34638559.fghr33.com
@@ -176426,7 +175642,6 @@ helpsupport-contact.xyz
  helpsupport-netfli.com
  helpsupport3.live
  helpsupportlin3.org
-helpsupportofcenter.gq
  helpsupportverification.com
  helpsuspend-account.serveirc.com
  helpteam-center-instagram-copyright.ml
@@ -176754,7 +175969,6 @@ hg76ytsdas.appspot.com
  hgaldiddn.000webhostapp.com
  hganny.com
  hgapps.com.br
-hgasjsh.tk
  hgazjp.rogagot.com
  hgbirkcvwglagqazhczkpygaoh-dot-gleowayel400503.uc.r.appspot.com
  hgbse.xyz
@@ -176785,7 +175999,7 @@ hggwvrhwzuqrjakrxmyezkfiojgoxjaqhgtu-dot-glxcel49934343434.rj.r.appspot.com
  hghdefined.com
  hghdhsdgsupport.net
  hghdhsdgsupport.org
-hghdrieyuxitspdanfalchwkot-dot-gl9393jan.uk.r.appspot.com
+hghghg.ucoz.es
  hghltdpendin-gemail.imfast.io
  hghpskvvboiivacr-dot-millinium.ey.r.appspot.com
  hgj8.svcoding.com
@@ -176803,7 +176017,6 @@ hgniuxcjptgdlslbdcutnnllom-dot-gleowayel400503.uc.r.appspot.com
  hgo.vipsnapchatsexting.com
  hgpe.addroits.com
  hgpnmmfiqmpzmlptrapp-dot-gleowyel040493443434989.wl.r.appspot.com
-hgpsdhlgiashdwqfczyhnwmmpe-dot-gl9393jan.uk.r.appspot.com
  hgsatrwqsaz6a.com
  hgscicjb2epf9xn.e8273.pro
  hgsgukkowgzkcocznitbocinsz-dot-gloff849483.uk.r.appspot.com
@@ -177029,7 +176242,6 @@ higdghxkcwemogxcxgraxldecc-dot-gloff849483.uk.r.appspot.com
  higgsdominocomunity.000webhostapp.com
  high-alert24x7.com
  high-handed-flags.000webhostapp.com
-high-octane-tracker.000webhostapp.com
  high-principled-dig.000webhostapp.com
  high-voltage-surfac.000webhostapp.com
  highaltitudes.net
@@ -177160,6 +176372,7 @@ himdeal.xyz
  himel.co.za
  himertern.com
  himexen.com
+himikasultana.github.io
  himkon.cf
  himkon.ga
  himnmkukxhevljuq-dot-millinium.ey.r.appspot.com
@@ -177195,7 +176408,6 @@ hinodeshop.net
  hinsorn.ac.th
  hinter-den-schlagzeilen.info
  hinterface.com
-hintgalzrlpxqqelzlkomeppjc-dot-gleow2021ja.ue.r.appspot.com
  hiohgtr.gq
  hiolouinqare.com
  hiontrendy.com
@@ -177332,6 +176544,7 @@ hjertevennlig.no
  hjesseseafoods.co.uk
  hjfeyu.club
  hjg.aqzsqsu.cn
+hjg.cdwjaly.cn
  hjg.dbjrowq.cn
  hjg.dbprdrn.cn
  hjg.eaebacc.cn
@@ -177340,8 +176553,12 @@ hjg.jdxgwv.com.cn
  hjg.jfpbdn.com.cn
  hjg.jxlxtvh.cn
  hjg.khesxpk.cn
+hjg.kssxlw.cn
  hjg.nkkhmxn.cn
+hjg.ocjlryl.cn
  hjg.pjtdpjl.cn
+hjg.prkhetu.cn
+hjg.uhbvmqi.cn
  hjg.uygwjjq.cn
  hjg.xpdfrlz.cn
  hjg.xqbkqye.cn
@@ -177521,7 +176738,6 @@ hlrlluckclssllmw-dot-millinium.ey.r.appspot.com
  hlse.sovereignty2020.com
  hlsquared.ca
  hlss.jigsy.com
-hlszbsjlkcipwzjslxpbluewss-dot-gl9393jan.uk.r.appspot.com
  hlthyeqdbkyzmuft-dot-millinium.ey.r.appspot.com
  hltps-wwv-bancoestado-cl.clinicadentistar489.com
  hltps-wwv-bancoripley-cl.publicidadtechtre.com
@@ -177679,7 +176895,6 @@ hmrc-return.com
  hmrc-return.uk
  hmrc-returncalculate.com
  hmrc-returnsuk.me
-hmrc-secure-taxrebate.com
  hmrc-secure.com
  hmrc-securetaxreturn.com
  hmrc-security-authorise-user9403811.net
@@ -177981,7 +177196,6 @@ hmutkwvjvkhkyyie-dot-millinium.ey.r.appspot.com
  hmuv2.blob.core.windows.net
  hmvcri.com
  hmvjofabqfgzgipr-dot-millinium.ey.r.appspot.com
-hmwtxetfpzsbmldlumlsxenvbq-dot-gleow2021ja.ue.r.appspot.com
  hmxwczhmhewisoim-dot-millinium.ey.r.appspot.com
  hmyahymgbwpvsbyo-dot-millinium.ey.r.appspot.com
  hmyj.cc
@@ -177999,7 +177213,6 @@ hnase.duckdns.org
  hnbeu.xyz
  hnbrfglcyhioawfz-dot-millinium.ey.r.appspot.com
  hnbse.com
-hnbslbxqvjbycjvlwqdvsicmgl-dot-gl9393jan.uk.r.appspot.com
  hnc-cm.rodevdesign.com
  hncirm.com
  hndoficialmexico.com.mx
@@ -178023,7 +177236,6 @@ hnjwybwbciffxwkm-dot-millinium.ey.r.appspot.com
  hnkhvb.com
  hnlfaxzfkljeaasz-dot-millinium.ey.r.appspot.com
  hnmdnd.com
-hnnpnqiakmwnexopjsiirgkvub-dot-gl9393jan.uk.r.appspot.com
  hnnrci.com
  hno-bremennord.de
  hnohiaaewe.duckdns.org
@@ -178135,7 +177347,6 @@ hoga-consulting.de
  hogar-dulceh-inc.ga
  hogarymas.es
  hoghooghonline.legal
-hoghplpiphlenbyxcnrstnjodu-dot-gl9393jan.uk.r.appspot.com
  hognalsezpnbzwmieapqfxyvfebsuorbwloy-dot-cedar-code-289917.nn.r.appspot.com
  hogoscarstudio.com
  hogvet.com
@@ -178870,6 +178081,7 @@ hotelmerina.com
  hotelmontanus.com.br
  hotelmontiazzurri.com
  hotelolive.al
+hotelpacificorisort.com
  hotelpalaciosantacruz.com
  hotelpapagalos.com
  hotelplazazacapoaxtla.com
@@ -178970,9 +178182,7 @@ hottestklusin.ga
  hottestxxxvideo.com
  hotto.duckdns.org
  hottsevents.ml
-hotupdatev19.com
  hotwa.join-now.net
-hotwagrup-hothot.000webhostapp.com
  hotwagrup-wa.000webhostapp.com
  hotwaindo.000webhostapp.com
  hotwhatasapp.is-slick.com
@@ -179134,7 +178344,6 @@ hplaptopservicecentermumbai.com
  hplc-remove-device.com
  hplgwlrvsfdakkpm-dot-millinium.ey.r.appspot.com
  hpllf.vipsnapchatsexting.com
-hplxjleaqimehdxtowfjebnoha-dot-gl9393jan.uk.r.appspot.com
  hpmaytinhtaophongcach.com
  hpqgfglpllxovgds-dot-millinium.ey.r.appspot.com
  hpqiijfnynhwoseysmejnugrrhflvymlinqn-dot-cryptic-now-290917.ey.r.appspot.com
@@ -179215,7 +178424,6 @@ hqyellow.com
  hqz-it.tech
  hqzbdkcijxatnaiq-dot-millinium.ey.r.appspot.com
  hqzit.com
-hqzzsyqeiczxnhorynovoisgol-dot-gl9393jan.uk.r.appspot.com
  hr.atilimited.net
  hr.ellipsonic.a2hosted.com
  hr.mediaprongr.com
@@ -179438,7 +178646,6 @@ hsbc-check-payment-uk.com
  hsbc-confirm-payee.com
  hsbc-dashboard.duckdns.org
  hsbc-decline-payee.com
-hsbc-deviceconfirm.newpayeerequestsystem.com
  hsbc-gr.000webhostapp.com
  hsbc-help-uk-payee-removal.com
  hsbc-mobileapp.advance-proof.com
@@ -179643,7 +178850,6 @@ hsbcplc.uk-supportgb.com
  hsbcplcuk.internetbanking-support.com
  hsbcsecur2281.trickychats.com
  hsbcsecurity-payee.com
-hsbcuk.paye-requestupdated.com
  hsbcukplc.securitygb-centre.com
  hsbcverification.itstudynepal.com
  hsbcverifications.com
@@ -179715,7 +178921,6 @@ hspayee-alert.com
  hspayee.cc
  hspaymentshelp.com
  hspersonal-onlinebanking.com
-hsprzylcybpfdwmpedblrvxsys-dot-gl9393jan.uk.r.appspot.com
  hspwjsehshuqygrz-dot-millinium.ey.r.appspot.com
  hsrfjgkytvzeiddtsonwscnwqs-dot-gleowayel400503.uc.r.appspot.com
  hsrmic.com
@@ -179748,7 +178953,6 @@ hsuk-paymentverify.com
  hsukpayments.com
  hsuse.xyz
  hsuukrtsrgkwhphnabnudpyqjqofortrqvoy-dot-gl494903049.wl.r.appspot.com
-hsvbwopccyhgucqrqbfvqoiqsx-dot-gl9393jan.uk.r.appspot.com
  hswajqsucgggeuclnsustodtia-dot-gloff849483.uk.r.appspot.com
  hswawuo7c8axfxw3.com
  hswgs.xyz
@@ -179926,7 +179130,6 @@ huaian.06rl.com
  huaibangchina.com
  huaihua.06rl.com
  hualish01.com
-hualplamxbvddmgdknwfoyundh-dot-gl9393jan.uk.r.appspot.com
  huananzixun.com
  huangao6.com
  huangjiaduchangyulecheng.tavmo.com
@@ -179998,7 +179201,6 @@ hufz.vipsnapchatsexting.com
  hugecloud.is-a-techie.com
  hugeroll.ru
  hugesumlily.000webhostapp.com
-hugfxnvywroqtbhwmjfcxckpts-dot-gl9393jan.uk.r.appspot.com
  hughesnet.club
  huginyazarkasa.com
  hugomartinez.lopedevega.es
@@ -180009,7 +179211,6 @@ huhucow.com
  huhucow2.com
  huhuhue.net
  huhwg.xyz
-huhxteacthldrpbivbnvrdgxkf-dot-gl9393jan.uk.r.appspot.com
  huiascdoy.cn
  huices.xyz
  huichengshebei.com
@@ -180104,7 +179305,6 @@ hungertriathlon.com
  hunggiang.vn
  hunghuhuhjij1.duckdns.org
  hungry-hawking-475114.netlify.app
-hungry-lovelace-af9734.netlify.app
  hungry-shockley-48c31c.netlify.app
  hungry-spence-11dfff.netlify.app
  hungry4more.be
@@ -180130,7 +179330,7 @@ huntersolano.com
  hunterwellies.co.uk
  hunteryouthcheerleading.com
  huntingomar.com
-huntington-secure23.duckdns.org
+huntington-onlinesecure23.duckdns.org
  huntington.clothnfurnitures.com
  huntington.digital
  huntington.mypi.co
@@ -180242,7 +179442,6 @@ huzucoxloqlvgixu-dot-millinium.ey.r.appspot.com
  huzurdansi.com
  huzurdugunsalonu.com
  huzurunkalbi.net
-huzyytxnhmxzewejfgklyoenvg-dot-gl9393jan.uk.r.appspot.com
  hvac-retrofits.com
  hvacprosplus.com
  hvacrheritage.ca
@@ -180281,7 +179480,6 @@ hvuwnzispjbatlym-dot-millinium.ey.r.appspot.com
  hvwaxkbgnykzecgh-dot-millinium.ey.r.appspot.com
  hvwenivurremuspweyuetfemhjpufwxckckd-dot-solar-vertex-285913.rj.r.appspot.com
  hvwyrylvhsrdolpy-dot-millinium.ey.r.appspot.com
-hvxpsgkkfqwumfhyudzxiwlprg-dot-gl9393jan.uk.r.appspot.com
  hvzkmehwglojsvjb-dot-millinium.ey.r.appspot.com
  hw3leonardand.000webhostapp.com
  hw591.com
@@ -180342,7 +179540,6 @@ hxensonwenqroxwlufccucaqbvvflofuqznr-dot-gl494903049.wl.r.appspot.com
  hxev888.com
  hxfgg.cn
  hxgdrfhfttgovgus-dot-millinium.ey.r.appspot.com
-hxgxgtflhsmqeqapzlokkujkzu-dot-gl9393jan.uk.r.appspot.com
  hxjqbcnjdiolciet-dot-millinium.ey.r.appspot.com
  hxjspcafjpipttqkmuxdxpbqgizffyvmiyfo-dot-offglen.uk.r.appspot.com
  hxjxvfkkyczqbyvsxkiayjtaxsgmrflqyqjx-dot-cedar-code-289917.nn.r.appspot.com
@@ -180534,7 +179731,6 @@ hzbfhejzhizhlfsg-dot-millinium.ey.r.appspot.com
  hzbot2.5v.pl
  hzbyqeufxnxdlqdi.top
  hzcp0.onderhost.com
-hzdlrqegokhkdovvbcsiafbcwk-dot-gl9393jan.uk.r.appspot.com
  hzejsellxaetjhbw-dot-millinium.ey.r.appspot.com
  hzfryyccyldktbyg-dot-millinium.ey.r.appspot.com
  hzgatdfxkdcobgpxfblcgvrstn-dot-gloff849483.uk.r.appspot.com
@@ -180547,7 +179743,6 @@ hzhz.trade
  hzjhyenlmbtrtmcp-dot-millinium.ey.r.appspot.com
  hzjlievphzxncnef-dot-millinium.ey.r.appspot.com
  hzjm.dimaflix.com
-hzjvvspakxowtwrkvyldgxmcne-dot-gleow2021ja.ue.r.appspot.com
  hzksg.sovereignty2020.com
  hzkvxcbcjfxpjtrq-dot-millinium.ey.r.appspot.com
  hzkxxkavtbvypbmleugefeefabyfizqgveuf-dot-offgl8876899977678.uk.r.appspot.com
@@ -180562,7 +179757,6 @@ hzq9a.mentriqq.com
  hzqdhytcables.com
  hzr6a.jaysbrand.com
  hzss.xtechspro.com
-hztcxihkwvdmiadvwcywiwxzre-dot-gl9393jan.uk.r.appspot.com
  hztvt.goruli.com
  hztwfiyupaphetvy-dot-millinium.ey.r.appspot.com
  hzvgvqzmucjhagbs-dot-millinium.ey.r.appspot.com
@@ -180707,7 +179901,6 @@ iailcnsiyz.duckdns.org
  iais.ac.id
  iajsd-av-adf-afs-av-d-ve-fs.uk.r.appspot.com
  iakarnataka.com
-iakqccgrisfdnrhovbnoucoqbk-dot-gl9393jan.uk.r.appspot.com
  ialanhugs.com
  ialoioaldan.tk
  ialwayscapitaling.icu
@@ -180750,7 +179943,6 @@ iapepmunvjmzquwqbblzirvcomizeywgcjoi-dot-glegen303939423233.ue.r.appspot.com
  iapple-support.net
  iarf-religiousfreedom.net
  iargiv9r72kz.talagaremix.com
-iarlkohvhsbgogrrgkljmqwyum-dot-gl9393jan.uk.r.appspot.com
  iarozijcaahdnsgh-dot-millinium.ey.r.appspot.com
  iarpp.ro
  iasdjundiai.org.br
@@ -180826,7 +180018,6 @@ ibibjpafytqhwjuw-dot-millinium.ey.r.appspot.com
  ibidfsquecou.buzz
  ibijbdtajblkrwhlzxrttmsmwxxikhjudpty-dot-cryptic-now-290917.ey.r.appspot.com
  ibis-budget-jakarta-daan-mogot.com
-ibixjfjhpzjmibabiciaktzgtj-dot-gl9393jan.uk.r.appspot.com
  ibizafilmproduction.com
  ibkbamca-porinternetpe.com
  ibkffxzxsowkgaiw-dot-millinium.ey.r.appspot.com
@@ -180955,7 +180146,6 @@ icfeosejkkpphliaipfmnnlvuopqhrsfiyay-dot-gl494903049.wl.r.appspot.com
  icfgroupe.pro
  icfotidtkvbqbxde-dot-millinium.ey.r.appspot.com
  icfuaozdqnkkkbqf-dot-millinium.ey.r.appspot.com
-icfzmttjigcjgfzmvvchnxfnfl-dot-gl9393jan.uk.r.appspot.com
  icg-conseil.com
  ich-bin-es.info
  ichauszeit.de
@@ -181384,6 +180574,7 @@ icloudsign-find.com
  icloudt.cyou
  icloudto.cn
  icloudtracking.com
+icloudur.top
  icloudxr.cn
  iclouod.000webhostapp.com
  icluod.ios098.cn
@@ -181456,7 +180647,6 @@ ictzfmyu.co.cc
  ictzj.com
  icu-netq.net.ng
  icuuqyhymuqmxeai-dot-millinium.ey.r.appspot.com
-icvjixhaehjbkdsjotovnhbtjd-dot-gl9393jan.uk.r.appspot.com
  icvrqywmxhofnknbmclxirfytywvqabnaekf-dot-cryptic-now-290917.ey.r.appspot.com
  icwjeecdxdcddzgj-dot-millinium.ey.r.appspot.com
  icxufvibzhhdyqgw-dot-millinium.ey.r.appspot.com
@@ -181808,7 +180998,6 @@ idkf-gps.cn
  idklearningcentre.com.ng
  idklever.com
  idklolhh1.ddns.net
-idkpqlcqmrlwqgdsolqduqeqra-dot-gl9393jan.uk.r.appspot.com
  idlcloud.icloud-y.com
  idlewoodproductions.com
  idliters.com
@@ -182037,7 +181226,6 @@ ieowlpro.com
  iepnfgcbudsdcqtclivbqffklr-dot-gleowayel400503.uc.r.appspot.com
  iepogybznocunrlu-dot-millinium.ey.r.appspot.com
  ieq.net.cn
-ieqiceayyvebrvtibqktjujiha-dot-gl9393jan.uk.r.appspot.com
  ierdorjtohiyyvjl-dot-millinium.ey.r.appspot.com
  ies-cura-valera.000webhostapp.com
  iesanjosedetelembi.edu.co
@@ -182184,6 +181372,7 @@ ig-clientservice.cf
  ig-communitycenter.com
  ig-copyright-defense.com
  ig-copyright-feedback.com
+ig-copyright-help-support.cf
  ig-copyright-violation-support.ga
  ig-copyrightform-support.cf
  ig-copyrightform.com
@@ -182466,7 +181655,6 @@ iinstrgam.000webhostapp.com
  iiooilooi.ru.com
  iiovrxqhfieyqirz-dot-millinium.ey.r.appspot.com
  iiphpbgzdbxyvdbvwtvoeufiecpsdjhhvljb-dot-solar-vertex-285913.rj.r.appspot.com
-iipilpsqjfydkfejzqpudtjzxc-dot-gl9393jan.uk.r.appspot.com
  iips.edu.iq
  iiqiefloqmzeyhjv-dot-millinium.ey.r.appspot.com
  iiranair.com
@@ -182495,7 +181683,6 @@ ijdfbnzvzcxhcadx-dot-millinium.ey.r.appspot.com
  ijegcyfccebafooa-dot-millinium.ey.r.appspot.com
  ijegwzuippfuwhdmatudclcsdvxavwpcfbdx-dot-offglen.uk.r.appspot.com
  ijelevine.ru
-ijgzdwztcvfjyfbgyhhqeapuaf-dot-gl9393jan.uk.r.appspot.com
  ijiankang99.com
  ijikc.co.in
  ijincuodao.com
@@ -182507,7 +181694,6 @@ ijlfbhsgzqwelysdajuhtviaohloeeucjgfh-dot-glenxpecial3009493.ey.r.appspot.com
  ijlkgkqqlqmwxafl-dot-millinium.ey.r.appspot.com
  ijncjnvtbk.web.app
  ijnesher.com
-ijnflmrfewpkqdcfkbclkuwhjx-dot-gl9393jan.uk.r.appspot.com
  ijnsozxjsycsggoxnsyjqtorgx-dot-gloff849483.uk.r.appspot.com
  ijobs.vn
  ijoiwpbgiplllghrblvvgnnvze-dot-gl9393jan.uk.r.appspot.com
@@ -182877,7 +182063,6 @@ immbanjarbaru.com
  immediateresponses.link
  immediax.com
  immediencient.com
-immeebfmqxijsjwkbzxxdmndtu-dot-gleow2021ja.ue.r.appspot.com
  immenseholiday.com
  immersion.link
  immersionisland.org
@@ -183332,7 +182517,6 @@ indianjobs.info
  indiankitchenfood.com
  indianlegalwork.com
  indianolawa.buzz
-indianpepper.de
  indianredpristinemineral--five-nine.repl.co
  indiansteamrailwaysociety.in
  indianweddingdecorators.com.au
@@ -183899,6 +183083,7 @@ infousa.news
  infoverif.com
  infoverify-ee.com
  infoweb-aggiorna-ora.000webhostapp.com
+infowebs-ca.com
  infowebservclient.justns.ru
  infowhatsapp-grubasian.dumb1.com
  infowisata-kulonprogo.atspace.com
@@ -183987,6 +183172,7 @@ ing.verlengtoegang-nl.website
  ingacceso.com
  ingamer.000webhostapp.com
  ingaveiculos.creatorlink.net
+ingbanco.site44.com
  ingbankieren.controleomgeving.website
  ingbe-online-ebank.com
  ingbe-online.com
@@ -184137,7 +183323,6 @@ inland.revenue.nz-tax.dlscollege.com
  inlandrevenues.com
  inlead.site
  inlesb.com.my
-inlevqcqvlcmkpxdufgklvbdno-dot-gl9393jan.uk.r.appspot.com
  inlicunamma.tk
  inlight.spb.ru
  inlightfoundation.com
@@ -184157,7 +183342,6 @@ inmarsat.servehalflife.com
  inmayjose.es
  inmeayjnmcevchjqkdupackwrr-dot-gleowayel400503.uc.r.appspot.com
  inmed.vn
-inmetroexodus.com
  inmicade.tk
  inmobicenter.net
  inmobiliaria-lex.com
@@ -184404,7 +183588,6 @@ inspiredwindows.com.au
  inspirelaw.ca
  inspiring-allen-c6367a.netlify.app
  inspiring-mcclintock-a45b4f.netlify.app
-inspiring-meitner-1746b9.netlify.app
  inspiring-noyce-1c2b6d.netlify.app
  inspiring-panini-3fa481.netlify.app
  inspocoach.com
@@ -184424,7 +183607,6 @@ insta-drole.000webhostapp.com
  insta-followerincrease.000webhostapp.com
  insta-genuine.000webhostapp.com
  insta-gram-contest-modelling-authentication.000webhostapp.com
-insta-gram-generator3.000webhostapp.com
  insta-gram-photos.000webhostapp.com
  insta-gram.fr
  insta-gramweb.000webhostapp.com
@@ -184492,6 +183674,7 @@ instageverify.0fees.us
  instagfran.000webhostapp.com
  instagggrame876.000webhostapp.com
  instaggram.icu
+instagizlihesap.us
  instagoceleb.000webhostapp.com
  instagr0msecurlty.000webhostapp.com
  instagraam.club
@@ -184539,6 +183722,7 @@ instagram-copyright-form-2462971937.cf
  instagram-copyright-form.tk
  instagram-copyright-help-service.ml
  instagram-copyright-helpeu.com
+instagram-copyright-media-center.gq
  instagram-copyright-objection.cf
  instagram-copyrightbusiness.com
  instagram-copyrightbusiness.org
@@ -184739,7 +183923,6 @@ instagram.com-93293203283729172.hdaynch.xyz
  instagram.com.account.login.security.yesil.xyz
  instagram.com.authenticator.ga
  instagram.com.copyrights-login-verify.com
-instagram.com.frigotechdelperu.com
  instagram.com.instogram.site
  instagram.com.iogin.cf
  instagram.com.login.s5df46ss21s.oficinasylocalesfiore.com
@@ -184860,7 +184043,6 @@ instagrambluetickhelp.instaenjoy.com
  instagrambusiness-service.com
  instagrambusinessteam.cf
  instagrambusinnes.gq
-instagrambussinesactiveform.ml
  instagrambussineshelpcenter.com
  instagrambussinesofficecenters.com
  instagrambussiness.com
@@ -184962,7 +184144,6 @@ instagramhelpcenterbluetick.com
  instagramhelpcentercopyright.ga
  instagramhelpcenterfroms.ml
  instagramhelpcentres.com
-instagramhelpcervies.gearhostpreview.com
  instagramhelpcn.0fees.us
  instagramhelpcoppiyrght.com
  instagramhelpcopyright.org
@@ -185026,7 +184207,6 @@ instagramorsupport.com
  instagramoutnumber.co.kr
  instagrampassword.aresweb.de
  instagrampatentsupportbadges.com
-instagramphoto.net
  instagramphotos.0fees.us
  instagramphotos.epizy.com
  instagramprivacys.com
@@ -185106,8 +184286,6 @@ instagramverifity.instagramverifity.tk
  instagramverifity.tk.instagramverifity.tk
  instagramverify-badge.ml
  instagramverify.phpnet.us
-instagramverifyaccountcopyright.ml
-instagramverifyacoountcopyright.ml
  instagramverifybadge-fb.ml
  instagramverifybadgess.com
  instagramverifybadgest.ml
@@ -185163,7 +184341,6 @@ instaherseyim.000webhostapp.com
  instahilesi.net
  instahram.zzz.com.ua
  instaindia03.000webhostapp.com
-instainstainstainstainstainstainstainsta777.000webhostapp.com
  instaiogpage.000webhostapp.com
  instalacaodearsplitbh.com.br
  instalator-amazonaccount.babasadga.com
@@ -185248,7 +184425,6 @@ instaqram.5v.pl
  instaqram.icu
  instaquake.000webhostapp.com
  instaqwerty0987.000webhostapp.com
-instaqwertyuiop.000webhostapp.com
  instareset.com.hmrcvalidation.com
  instaresetlebanon.000webhostapp.com
  instargam.kz
@@ -185273,7 +184449,6 @@ instasupportaccount.ml
  instasupporti.0fees.us
  instasve.000webhostapp.com
  instatakip.0fees.us
-instatest077.000webhostapp.com
  instatkpguvenl.0fees.us
  instatokyo.000webhostapp.com
  instatron.net
@@ -185421,7 +184596,6 @@ intelservecovid.com
  intelz.duckdns.org
  intemar2020.com
  intense-reason-280011.nw.r.appspot.com
-intensifydignity.com
  intentional-writing.000webhostapp.com
  inter-acao-com-voce.000webhostapp.com
  inter-deposit.com
@@ -185501,7 +184675,6 @@ intercontinentalmarkets.com
  intercontradiction.club
  intercra.com
  interdentepe.com.br
-interdependent-rail.000webhostapp.com
  interdigital-ground.000webhostapp.com
  intere.com.br
  interessati.net
@@ -185545,7 +184718,6 @@ intermatico-comt.webcindario.com
  intermatico-comx.webcindario.com
  intermatico-enlinea.com
  intermatico-intr.webcindario.com
-intermatico-ks.webcindario.com
  intermatico-log.webcindario.com
  intermatico-new.webcindario.com
  intermatico-nif.webcindario.com
@@ -185600,7 +184772,6 @@ internet-analog932.ga
  internet-baking-dbs.com
  internet-bankiing.shop
  internet-banking-dbs.com
-internet-banking-dbs.gq
  internet-banking-dbs.shop
  internet-banking.ch-creditsuisse.com
  internet-bankingdbs.store
@@ -185977,7 +185148,6 @@ invoice.meddelivery.info
  invoice.payment-mnageppid.alwydna7wd.com
  invoice000.beget.tech
  invoice193019.com
-invoice4.godaddysites.com
  invoice7mukszq9nbpa7online.ru
  invoice931923.com
  invoice9kat5ggmml0c6online.ru
@@ -186040,7 +185210,6 @@ iocauekjnkcdajrk-dot-millinium.ey.r.appspot.com
  iocgdqwhrvewvvtrvymm-dot-gleowyel040493443434989.wl.r.appspot.com
  ioci2chae.agency
  iocid.goruli.com
-iocnafqjlenyyahrqrcdwgzfme-dot-gl9393jan.uk.r.appspot.com
  iocsyyljtlzogbok-dot-millinium.ey.r.appspot.com
  iocxqwvazkxesjzw-dot-millinium.ey.r.appspot.com
  iodnznrjiiabddtcxwaylidqsr-dot-gleowayel400503.uc.r.appspot.com
@@ -186214,7 +185383,6 @@ ipko.space
  ipkrzn.mystockclub.su
  ipl2019tickets.com
  iplanmyself.com
-ipmdipnzmsdsnpnseakmspsjfj-dot-gl9393jan.uk.r.appspot.com
  ipmedia.info
  ipmes.ma
  ipnfbqg2raz3asn4j631ha453bbr4h.biz
@@ -186292,7 +185460,6 @@ iqiiqiqiq.cf
  iqj.dermals.org
  iqjdrvtqdiwafazb-dot-millinium.ey.r.appspot.com
  iqjzvexejtgrbrs.duckdns.org
-iqkhzxhymyllvaawtajytehpes-dot-gl9393jan.uk.r.appspot.com
  iqlwodkw.com
  iqmailiq.000webhostapp.com
  iqman.org
@@ -186623,7 +185790,6 @@ isiphephelocon.co.za
  isispickens.com
  isitcode.red
  isiwarasiritha.com
-isjoiwtgwzovkmwtlemcwftwti-dot-gl9393jan.uk.r.appspot.com
  isjsjsjhjjnaknsjbskns.weebly.com
  isjtgyrbimwdnlrq-dot-millinium.ey.r.appspot.com
  isk-yokohama.com
@@ -186634,6 +185800,7 @@ islamabadtrafficpolice.gov.pk
  islamiadsk.com
  islamic-literacy.org
  islamicposters.co.uk
+islamoradaonthefly.com
  islamsadaqah.com
  islandboyrecords.co
  islandhustlesociety.com
@@ -186644,7 +185811,6 @@ islem-kira-tr-gov.gq
  islemlerim2020-bedavasi.org
  islhfiwiyqhuevoy-dot-millinium.ey.r.appspot.com
  islsntszistssd.com
-islxuiwvzxwaclhptxzgrespro-dot-gl9393jan.uk.r.appspot.com
  ism-capital.com
  ism.edu.ng
  ismail-ceylan.com
@@ -186657,7 +185823,6 @@ ismse.isa-geek.org
  ismwkfihwgcjmwxe-dot-millinium.ey.r.appspot.com
  ismybeauty.com
  isnjp.goruli.com
-isnljygzzctdlxzxonvwcpdktu-dot-gl9393jan.uk.r.appspot.com
  isnlpmnttxyoxglt-dot-millinium.ey.r.appspot.com
  isntaagramm.000webhostapp.com
  isntjylrysuwrjzl-dot-millinium.ey.r.appspot.com
@@ -186675,7 +185840,6 @@ isorina.com
  isosneham.com
  isotachsdecennia.com
  isotonic-order.000webhostapp.com
-isoxlkjqijuwowoxqgaqttmbmv-dot-gl9393jan.uk.r.appspot.com
  isp-gruppo-sicurezza.000webhostapp.com
  isp-gruppo-web.000webhostapp.com
  isp-maier.de
@@ -186683,7 +185847,6 @@ isp-psd2.com
  ispartatr.com
  ispel.com.pl
  isphubcpzpymsdtxlhxnczkwbybpcmypnlsk-dot-solar-vertex-285913.rj.r.appspot.com
-ispsuvukzlumkracxtvedinezd-dot-gl9393jan.uk.r.appspot.com
  ispyaspy.co
  isq.gr
  isqctvdqwsveeevz-dot-millinium.ey.r.appspot.com
@@ -186705,7 +185868,6 @@ isspinvad.club
  issr.cc
  issue-billing-o2.com
  issue-ca1026.com
-issue-processing-bill-o2.com
  issue-repport.000webhostapp.com
  issue-security.com
  issue10.xyz
@@ -187175,7 +186337,6 @@ itemlisting-70089148.sitesap.gr
  itemlisting-81676026.sitesap.gr
  itemmarketplace.xyz
  itemnewgets11.4dq.com
-itemold-free--net.ga
  itempermanentfree.com
  itemproperties3fde485f3ag3a2vy-realtygrouppage-p2047675l2557.net
  itempubgfree.otzo.com
@@ -187404,7 +186565,6 @@ iuudryddsryyaand-dot-millinium.ey.r.appspot.com
  iuvhgbvhdfv.myddns.com
  iuvys81.com
  iuwtmfcuywgrohhefcswtoxziy-dot-gleowayel400503.uc.r.appspot.com
-iuxxzprryyowxhorfqllckyfkt-dot-gl9393jan.uk.r.appspot.com
  iuxzlkkundazcflw-dot-millinium.ey.r.appspot.com
  iuyse.com
  iuytfu.al1av.com
@@ -187449,7 +186609,6 @@ ivisitmobi.shaxiabeauty.top
  ivivo.es
  ivixtbrttpcgrhbwzzgwuwbwza-dot-gloff00403993445.uk.r.appspot.com
  ivkiqcamxusjzpkq-dot-millinium.ey.r.appspot.com
-ivkptkppwnnrkwjaovflldzlkb-dot-gl9393jan.uk.r.appspot.com
  ivluizyhoqdquayw-dot-millinium.ey.r.appspot.com
  ivmksxdvokbtlpfg-dot-millinium.ey.r.appspot.com
  ivobfuqhsqgsarjy-dot-millinium.ey.r.appspot.com
@@ -187521,7 +186680,6 @@ iwmalomtgbt002.top
  iwmalomtgbt006.top
  iwmalomtgbt007.top
  iwncjkfhjka.weebly.com
-iwnptqokbwberqxhrbqlipkwwy-dot-gl9393jan.uk.r.appspot.com
  iwomjuypyjmylydj-dot-millinium.ey.r.appspot.com
  iworknab.com
  iworms.pl
@@ -187558,7 +186716,6 @@ ixora.global
  ixorboxclien.yolasite.com
  ixosbxsow.ml
  ixpcgvpqlqqcothz-dot-millinium.ey.r.appspot.com
-ixqiqtzosgxcziywynnhzmesqo-dot-gl9393jan.uk.r.appspot.com
  ixrszpblepzgccut-dot-millinium.ey.r.appspot.com
  ixrtkimkojiakuxqzqrwbhxupl-dot-gloff849483.uk.r.appspot.com
  ixs01ybm.firebaseapp.com
@@ -187614,7 +186771,6 @@ izctyzwo.shoesmogul.com
  izdeharalbasrah.com
  izfiqclqwzxzjtpywdnxxldfkoderyjgsgoq-dot-cryptic-now-290917.ey.r.appspot.com
  izgerlh.rogagot.com
-izgfvhyejwezlvopixjwblmuun-dot-gleow2021ja.ue.r.appspot.com
  izgotovlu.ru
  izi-jobs.net
  izishop.info
@@ -187742,7 +186898,6 @@ jaberevents.com
  jabeyt.com
  jabezrealtyservices.com
  jabkzahrimasjoun.blogspot.com
-jabnnbvnqgjqdnoblmomwhjbox-dot-gl9393jan.uk.r.appspot.com
  jabrealtylc.com
  jac.sa
  jacar.lv
@@ -187774,6 +186929,7 @@ jackspatelweb.000webhostapp.com
  jackyvillaruel.000webhostapp.com
  jaclinleonanie.ru
  jacob228.tmweb.ru
+jacobiprairie.buzz
  jacobivillage.buzz
  jacobsondevelopers.com
  jacobspublishers.com
@@ -187963,6 +187119,7 @@ jamssquaremsl.com
  jamupasakbumi.com
  jamurkepalabut-1nc18hbc18obc818oc81oc1.sarapanpag.com
  jamwilzoon.com
+jamy-pam.today
  jamz47341.uc.r.appspot.com
  jan-van-eijck.nl
  janainademorais.com
@@ -187976,7 +187133,6 @@ janavenanciomakeup.com.br
  janbassed.com
  janberger.ch
  janbklein.com
-jancintareg.weebly.com
  janda-duda.freepubg.org
  jandaanakdua.kozow.com
  jandahobicolmek.zzux.com
@@ -188145,6 +187301,7 @@ jasx.atalizinq.com
  jatahmakan.com
  jatahpreman.ewp-sa.com
  jatakavedhan.com
+jaten-jaten.karanganyarkab.go.id
  jatkit.gq
  jatland.000webhostapp.com
  jaucpeozodvmpbmw-dot-millinium.ey.r.appspot.com
@@ -188261,7 +187418,6 @@ jbenmvzqlrijptcixbrvuiemovjixobpfdvs-dot-gl494903049.wl.r.appspot.com
  jbexttjawhrdvoze-dot-millinium.ey.r.appspot.com
  jbfacilitymanagement.net
  jbfd8699nia.com
-jbfpgeswghslmkqcbxwyknypbz-dot-gl9393jan.uk.r.appspot.com
  jbfrryrbambhqgsw-dot-millinium.ey.r.appspot.com
  jbfzuckmdacfgyop-dot-millinium.ey.r.appspot.com
  jbgjerrxbbzjbdvl-dot-millinium.ey.r.appspot.com
@@ -188276,7 +187432,6 @@ jbj7.onderhost.com
  jbkbchvhkpelszychhzebzbkcluvedfvschj-dot-solar-vertex-285913.rj.r.appspot.com
  jbkh.000webhostapp.com
  jbkutkmbnyzwdhbx-dot-millinium.ey.r.appspot.com
-jblfonjdssaxasmlyxopwpmzlh-dot-gl9393jan.uk.r.appspot.com
  jblogstackers.com
  jblproperties.net
  jbmiefekcnxcbfua-dot-millinium.ey.r.appspot.com
@@ -188286,7 +187441,6 @@ jbnkloading.com
  jbnkuser.com
  jbnortonandco.com
  jbnw.onderhost.com
-jbqcnnywdlpoqlhjdxfhurjudd-dot-gl9393jan.uk.r.appspot.com
  jbqs.awaykart.com
  jbqzpqkvullvkeqg-dot-millinium.ey.r.appspot.com
  jbrealestategroups.com
@@ -188369,7 +187523,6 @@ jcsgt.codesandbox.io
  jcspender.com
  jcsportsnutrition.com
  jctyxk.dermals.org
-jcupchtxxfgvujbbjsennrxhso-dot-gl9393jan.uk.r.appspot.com
  jcvksdf.ug
  jcwarrick.com
  jcways.com
@@ -188403,7 +187556,6 @@ jdhjggrjg.weebly.com
  jdhxoxuhwhuarrhj-dot-millinium.ey.r.appspot.com
  jdiascabeleireiros.com
  jdih.sambas.go.id
-jdjdjdjdjdj.tk
  jdjjegellowd.duckdns.org
  jdjsikks-kjensa.ru
  jdkkfkdkf.du.r.appspot.com
@@ -188529,7 +187681,6 @@ jelly-pacific-nannyberry.glitch.me
  jellybaby.zapto.org
  jelo001.000webhostapp.com
  jelouslaodnn.org
-jelpbhabbygoraaehosikrzngb-dot-gl9393jan.uk.r.appspot.com
  jeltalk.info
  jemafrikcreations.com
  jemambosutxflsos-dot-millinium.ey.r.appspot.com
@@ -188683,7 +187834,7 @@ jetzt-handwerker-finden.de
  jetzworld.com
  jeu-insta.000webhostapp.com
  jeubhuqozlbkzrvq-dot-millinium.ey.r.appspot.com
-jeuqsqywrbupfscwqmkshcjqgp-dot-gl9393jan.uk.r.appspot.com
+jeuxhtml5-orangefr.com
  jevans912-profile.online
  jevn.in
  jevoxfcdyozpjuek-dot-millinium.ey.r.appspot.com
@@ -188696,7 +187847,6 @@ jewelzink.com
  jewerlocrm.com
  jewishunitedstates.com
  jewkhgfdyidhoiggkkfnluzkhv-dot-gleowayel400503.uc.r.appspot.com
-jewntcouefqtxfcjbxamagsrvm-dot-gl9393jan.uk.r.appspot.com
  jewoosystem.co.kr
  jex1.addroits.com
  jex1lejc9iujcdwh4.gmz.cc
@@ -188725,7 +187875,6 @@ jffttkzahixjmfod-dot-millinium.ey.r.appspot.com
  jfgrnzsvkwxecbkbgq.top
  jfhlnhmoxmehvfrynqtelovblk-dot-gleowayel400503.uc.r.appspot.com
  jfi3.ru
-jfihtzpldfmtzbkpfgjblugvop-dot-gl9393jan.uk.r.appspot.com
  jfimstrkbevqldtg-dot-millinium.ey.r.appspot.com
  jfkcwtjhjp.duckdns.org
  jfkx996.com
@@ -188741,7 +187890,6 @@ jfriedmanlaw.com
  jfsincorp.com.br
  jfteabd.com
  jftwtlobisqwguyrgkkpaxrymn-dot-gloff849483.uk.r.appspot.com
-jfuyrfysufphopukjhqwmflace-dot-gl9393jan.uk.r.appspot.com
  jfvbiizoznzbpgxv-dot-millinium.ey.r.appspot.com
  jfwshtvtljuxxwoynwsqemfausuubsogpgvd-dot-glegen303939423233.ue.r.appspot.com
  jg-trading.com
@@ -188892,7 +188040,6 @@ jiaxwl.com
  jiayoumei.com.cn
  jib.qa
  jibecctkhuijqbtn-dot-millinium.ey.r.appspot.com
-jibhxfvjucjupjsseoqeucrnul-dot-gl9393jan.uk.r.appspot.com
  jiblico.com
  jibrelcloe.bounceme.net
  jibun-ta.com
@@ -189136,7 +188283,6 @@ jjofvvbwrgxctsrx-dot-millinium.ey.r.appspot.com
  jjpadkswgtzskchj-dot-millinium.ey.r.appspot.com
  jjpxopvcpxbg.rzf.futbol
  jjqcdsyhignhrjfd-dot-millinium.ey.r.appspot.com
-jjqvmvbskuqbksxacxqfqdrmge-dot-gl9393jan.uk.r.appspot.com
  jjr.shoesmogul.com
  jjrackmountcom.chifanblow.top
  jjrenovationmart.com
@@ -189170,7 +188316,6 @@ jkbrenovation.ca
  jkdba77u62.firebaseapp.com
  jkdlifk.com
  jkdlkfk.com
-jkdyqofutqiwbyjqbfxtauvvhe-dot-gl9393jan.uk.r.appspot.com
  jkedunews.com
  jkfqttcuxfjgsqedopitrglqjgccehhrsyik-dot-gl494903049.wl.r.appspot.com
  jkhagsdiuweqjhspaypal.berlrbiimon.com
@@ -189213,7 +188358,6 @@ jkwardrobe.com
  jkwhqeoei-apple.serveftp.com
  jkwiiojgxhwvvxkw-dot-millinium.ey.r.appspot.com
  jkwvjunjykzpsunl-dot-millinium.ey.r.appspot.com
-jkxrbdqnaeyzvsuxdfsntzryac-dot-gl9393jan.uk.r.appspot.com
  jkxsrwgwxadpmxupsft.top
  jkyisyprnuonxpsdmskn.com
  jkypkogfreerenvd-dot-millinium.ey.r.appspot.com
@@ -189244,7 +188388,6 @@ jljk.bvw2.cn
  jlk-comercial.com
  jlkhhtxmjhpgkrts-dot-millinium.ey.r.appspot.com
  jlkxdlwtllslwqzb-dot-millinium.ey.r.appspot.com
-jllglrbbiydbcgwvjmumquslnc-dot-gl9393jan.uk.r.appspot.com
  jllhszjlqpebjpep-dot-millinium.ey.r.appspot.com
  jlmbokatkacnifdsflqamjbnwyktbefbesir-dot-cryptic-now-290917.ey.r.appspot.com
  jlmszs.com
@@ -189300,7 +188443,6 @@ jmjbvjttehnutdfq-dot-millinium.ey.r.appspot.com
  jmjfamilyfashion.com
  jmjfkstkmpboadwamxztaaofwsynfpkfddgn-dot-gl494903049.wl.r.appspot.com
  jmk4.awaykart.com
-jmkedoyezbplayzviycpghjqvq-dot-gl9393jan.uk.r.appspot.com
  jmlandscapingservice.com
  jmljefdywjpngwre-dot-millinium.ey.r.appspot.com
  jmmdgkcblipankfb-dot-millinium.ey.r.appspot.com
@@ -189325,7 +188467,6 @@ jmtcevyqpmqdutim-dot-millinium.ey.r.appspot.com
  jmtixyeiuhxhsjvn-dot-millinium.ey.r.appspot.com
  jmtoomey.com
  jmucha.fun
-jmunqurckicobxxubeatgwyzxu-dot-gl9393jan.uk.r.appspot.com
  jmw-ms.net
  jmwebspace.com
  jmxjmvxtdpputlkb-dot-millinium.ey.r.appspot.com
@@ -189361,10 +188502,10 @@ jnbloding.com
  jnblryhjnippmzfw-dot-millinium.ey.r.appspot.com
  jncdbvongfhbyuxk-dot-millinium.ey.r.appspot.com
  jncit.me
+jnckjsndchdshfewfdc.ams3.digitaloceanspaces.com
  jndasaas.com
  jndexpertservices.com
  jndud8.com
-jndwwxctajqtwzmuaibrwegrrk-dot-gl9393jan.uk.r.appspot.com
  jne-exprres.000webhostapp.com
  jneajuikpvwcmodh-dot-millinium.ey.r.appspot.com
  jnfbsuhszeirmymx-dot-millinium.ey.r.appspot.com
@@ -189609,6 +188750,7 @@ joiinn-gruppwhattsapp-dewasaa18.hol3.me
  joiins-whastapp.jav22.org
  joimgrupbkphotid.ffitem6.cf
  join-----wa.000webhostapp.com
+join---grup1.ml
  join--grupwa18--2020.000webhostapp.com
  join-18-grup-whatsap.sexy5.gq
  join-2020.000webhostapp.com
@@ -189786,6 +188928,7 @@ join-grup-bokep-wa18-auto-crot383.000webhostapp.com
  join-grup-bokep-wa18tahun-autocroot282.000webhostapp.com
  join-grup-bokep-whatsapp-new2020.dynamic-dns.net
  join-grup-bokep972.000webhostapp.com
+join-grup-bokepp8.ga
  join-grup-bokepwa-indo.000webhostapp.com
  join-grup-brbgi18uowa.000webhostapp.com
  join-grup-budi-01-gaming-66ywgeyy.000webhostapp.com
@@ -189855,6 +188998,7 @@ join-grupwhatsapp-bokep-terbaru2020.xnxxx.my.id
  join-grupwhatsapp.my03.com
  join-grupwhatsapp18.tk
  join-grupwhatsappbkpnew2020.vidio-hotme17.cf
+join-grupwhatsappbokep.zzux.com
  join-grupwhatsappjounchtyuk.tk
  join-grupwhatsapps7.dubya.us
  join-gtubwamabarfff.ns02.info
@@ -190126,7 +189270,6 @@ joingroupsex-new.viiptv.com
  joingroupssexxx.otzo.com
  joingroupstreaming.000webhostapp.com
  joingroupswhatsapp4646.nows88.ga
-joingroupterbaru.sytes.net
  joingroupvfwa.gq
  joingroupviral123.000webhostapp.com
  joingroupwa-18.itemdb.com
@@ -190144,6 +189287,7 @@ joingroupwhatsap.gabung-grup20.tk
  joingroupwhatsap8762.000webhostapp.com
  joingroupwhatsapp-new.mrbasic.com
  joingroupwhatsapp.freejoin78.tk
+joingroupwhatsapp.lflink.com
  joingroupwhatsapp.movie20.net
  joingroupwhatsapp.new55.ml
  joingroupwhatsapp18.mynetav.com
@@ -190158,6 +189302,7 @@ joingroupwhatsappbokepterbaru2020.gamees.my.id
  joingroupwhatsappbokepterbott2020.getz-claim06.my.id
  joingroupx.jkub.com
  joingroupxsex.25u.com
+joingroupxx21.4dq.com
  joingrouwhatsapp.vvipz5.ml
  joingrpbokpwa.zzux.com
  joingrrub.20.itsaol.com
@@ -190186,7 +189331,6 @@ joingrubbokep18pluss.000webhostapp.com
  joingrubbokep2020autocrotr.000webhostapp.com
  joingrubbokep2k2k.000webhostapp.com
  joingrubbokep32terbaru.000webhostapp.com
-joingrubbokep49.000webhostapp.com
  joingrubbokep701.000webhostapp.com
  joingrubbokepchubby.000webhostapp.com
  joingrubbokepfull.000webhostapp.com
@@ -190231,6 +189375,7 @@ joingrubwhatsapp2020new.zzux.com
  joingrubwhatsappnew.sosmed-90.cf
  joingrubwhatsapprendygrub2547.maung42.ml
  joingrubwhsats18.000webhostapp.com
+joingrubxx.ga
  joingrubxxxwhatsapp.vip3z.net
  joingrubyutuberff.tk
  joingrulwhatsapterbaru25.asli20.com
@@ -190321,6 +189466,7 @@ joingrupbokep.69.mu
  joingrupbokep.mrbasic.com
  joingrupbokep.qpoe.com
  joingrupbokep.wisezk.com
+joingrupbokep01.ml
  joingrupbokep09348.000webhostapp.com
  joingrupbokep13-000we.000webhostapp.com
  joingrupbokep17.zzux.com
@@ -190394,10 +189540,13 @@ joingrupmabarff2020coy.000webhostapp.com
  joingrupmabarfreefire-indonesia.000webhostapp.com
  joingrupmabarsamabangbudi01geming.000webhostapp.com
  joingrupmantapmantappokoknya.000webhostapp.com
+joingrupme-vip.gq
  joingrupmemberwa.dumb1.com
  joingrupmemek.grup-invite18.ml
  joingrupnobarbokepbersama.000webhostapp.com
  joingrupnokep2k2018.000webhostapp.com
+joingrupnow1.ezua.com
+joingrupnoww2.ezua.com
  joingruppbokepp18.000webhostapp.com
  joingruppswatsapp.serveuser.com
  joingruppwa.get05.com
@@ -190421,7 +189570,6 @@ joingrupwa.guied7.my.id
  joingrupwa.hot8.shop
  joingrupwa18.gameburigdm.tk
  joingrupwa18dewasaindo.tk
-joingrupwa18newme.000webhostapp.com
  joingrupwa18plus2020.000webhostapp.com
  joingrupwa18terbaru2020.000webhostapp.com
  joingrupwa20.4dq.com
@@ -190583,7 +189731,7 @@ joinngruupp.wa-21.com
  joinninggroup18.0xz.org
  joinnmeet.me
  joinnow-whatsapp18.wa-groups.ml
-joinnowsss.000webhostapp.com
+joinnowfree.whmalpha.com
  joinnwdgrupswhatsappdewasa.zyns.com
  joinofficialgroupwhtspp.tk
  joinporngroup.net
@@ -190688,6 +189836,7 @@ joinwhatsapp.joinbkp78.ga
  joinwhatsapp.misecure.com
  joinwhatsapp.xx.ygto.com
  joinwhatsapp18.wtf-kntl.gq
+joinwhatsapp18sex.ddns.net
  joinwhatsapp18video.25u.com
  joinwhatsapp98.zapto.org
  joinwhatsappbokep.log-12.tk
@@ -190793,7 +189942,6 @@ jooinn-grupkuindocrot4.gifttsnow.com
  joomla3.fauser.edu
  joomliads.in
  joouashpduuaimmlgtvnvbywpdpcargjbpgy-dot-solar-vertex-285913.rj.r.appspot.com
-joouowmqtuyxkhmuqtgtbmzzer-dot-gl9393jan.uk.r.appspot.com
  joovy.ga
  joovy.pro
  jopedu.com
@@ -190951,7 +190099,6 @@ joyed-bin.com
  joyeggplante.com
  joyeriainternacional.com.ve
  joyeriaorindia.com
-joyfulbreathyoga.com
  joyfullmove.xyz
  joyfullyme.org
  joyhome.my
@@ -190972,11 +190119,12 @@ jp-amazon-team-fsvh3jh2ghstudio.xyz
  jp-amazon.0d2.xyz
  jp-amazon.4ng.xyz
  jp-amazon.6so.xyz
-jp-amazon.b1p.top
+jp-amazon.a1u.top
  jp-amazon.nvf.xyz
-jp-amazon.o1b.top
+jp-amazon.p-0.top
  jp-amazon.qy4.xyz
  jp-amazon.uj6.xyz
+jp-amazon.v1x.top
  jp-apple-com-175fj6oc.nln365.com
  jp-apple-com-1se9nqer.getvvy.com
  jp-apple-com-55g3t166.hpfart.com
@@ -191028,17 +190176,10 @@ jp-morgan.tech
  jp-portal.connect.auone-mobile021.com
  jp-rakuten-in.cyou
  jp-rakuten-login.ga
-jp-rakuten.a-1.top
  jp-rakuten.b-3.top
-jp-rakuten.b1t.top
  jp-rakuten.buzz
-jp-rakuten.c-1.top
-jp-rakuten.g-1.top
  jp-rakuten.j-1.top
-jp-rakuten.k-1.top
-jp-rakuten.l-1.top
  jp-rakuten.net
-jp-rakuten.o-1.top
  jp-rakutenlogin.arocaproducciones.com
  jp-rakuteo-co.icu
  jp-review.online
@@ -191416,7 +190557,6 @@ jq2.dilshantg.com
  jq3qcqjcnofiowa.ts.r.appspot.com
  jqaagbvixlxbwwld-dot-millinium.ey.r.appspot.com
  jqalok.shoesmogul.com
-jqbduvbhjprrgozhbozundeung-dot-gl9393jan.uk.r.appspot.com
  jqbecpgdofyynwzfmcqwvgxigzetqzzoolnu-dot-solar-vertex-285913.rj.r.appspot.com
  jqbmqxnbecirfycoqeveccvsjzqdmnyklymh-dot-glegen303939423233.ue.r.appspot.com
  jqcfijxyqrrnqbfproaexiokbg-dot-gloff849483.uk.r.appspot.com
@@ -191433,7 +190573,6 @@ jqlcoudtjiwtlqaxzfkktbdctnmhprlpzgcc-dot-glenxpecial3009493.ey.r.appspot.com
  jqnasacfqybwhdvhux.top
  jqnmvf.rogagot.com
  jqpu179.cn
-jqqkalanopkizvhictafrrmwff-dot-gl9393jan.uk.r.appspot.com
  jqryqchowwiywkds-dot-millinium.ey.r.appspot.com
  jqsbypetgndebksl-dot-millinium.ey.r.appspot.com
  jqtkxbiyxrcxwvuc-dot-millinium.ey.r.appspot.com
@@ -191459,7 +190598,6 @@ jquigfdgnsnyvbdrekbqqtbtridfikehiqrr-dot-offgl8876899977678.uk.r.appspot.com
  jquughcysgjkyairzdoaktdhbrwhylczinyh-dot-cryptic-now-290917.ey.r.appspot.com
  jqvkupnyembxhacttwghabozfm-dot-gleowayel400503.uc.r.appspot.com
  jqw.dermals.org
-jqwjqkhjvykleulpumxrddxyzp-dot-gl9393jan.uk.r.appspot.com
  jqwzhsbhpjsrbbajmz.top
  jqxawfavcb.duckdns.org
  jqxgyfzenhhkyeve-dot-millinium.ey.r.appspot.com
@@ -191487,7 +190625,6 @@ jreg99.com
  jrehplgjoncnkaywcelaxnpokp-dot-gleowayel400503.uc.r.appspot.com
  jrfoppucahgjejnnhghdjgyvpv-dot-gloff849483.uk.r.appspot.com
  jrgm.com.mx
-jrgxvakkyseyosohzoiglysgqb-dot-gl9393jan.uk.r.appspot.com
  jrhwafoioeszsgbymyvyhokvgk-dot-gleowayel400503.uc.r.appspot.com
  jrimrshijwzeccnfqczpweoxcl-dot-gleowayel400503.uc.r.appspot.com
  jrinstitutions.in
@@ -191611,7 +190748,6 @@ jspconsultants.co.uk
  jsplivenews.com
  jspspesstor.com
  jsq.m.dodo52.com
-jsqwujusfredbkpdnsrylngdej-dot-gl9393jan.uk.r.appspot.com
  jsr.org.cn
  jsrftyhertyayghfdhstrhyrtfdg.ewgjhsrfgjhjtr.top
  jsrhjweb.com
@@ -191628,7 +190764,6 @@ jstvirus.ddns.net
  jstyubhqmlzzpcsq-dot-millinium.ey.r.appspot.com
  jsuujyhncwylxkch-dot-millinium.ey.r.appspot.com
  jsvm.ilramodellestreghe.it
-jsvovrsqwwwfizkorktmbvymvq-dot-gl9393jan.uk.r.appspot.com
  jsvshipping.co.in
  jswfr.someantics.com
  jsxjzn.com
@@ -191711,7 +190846,6 @@ jubilengua.com
  jubiskincare.com
  jubkecbwboakcjsx-dot-millinium.ey.r.appspot.com
  jubpszgvikzkoozlyrdhvwsnjm-dot-gleowayel400503.uc.r.appspot.com
-jubzdfckikorusdhnpmslbnqey-dot-gl9393jan.uk.r.appspot.com
  jucabas.000webhostapp.com
  juchetu.com
  judaye.host
@@ -191770,11 +190904,9 @@ juicemangga20.xyz
  juicer.buzz
  juicestroberi.com
  juicygg-skin.com
-juidahuxdogsfjtghkbuuiogao-dot-gl9393jan.uk.r.appspot.com
  juiflwhtpoynrshc-dot-millinium.ey.r.appspot.com
  juiia.tk
  juiib.tk
-jujkjohplkrovshchuvkvaztdd-dot-gl9393jan.uk.r.appspot.com
  jujlpuefxagqdpmywfuscbqpei-dot-gleowayel400503.uc.r.appspot.com
  jujqqmivydwxlsdv-dot-millinium.ey.r.appspot.com
  jujuflix.com
@@ -192135,8 +191267,6 @@ jxjnnlvojzulljkkytdngltpavwjtecaovgx-dot-solar-vertex-285913.rj.r.appspot.com
  jxjygfkfltcezylv-dot-millinium.ey.r.appspot.com
  jxlbfowi.goruli.com
  jxmjyl.com
-jxngakxsvpexwirzrpzegktdhe-dot-gl9393jan.uk.r.appspot.com
-jxnotwwyddomqijnuelducgbqj-dot-gl9393jan.uk.r.appspot.com
  jxnzxx.com
  jxqiohetayrhhrap-dot-millinium.ey.r.appspot.com
  jxqkh.dogestocks.com
@@ -192161,7 +191291,6 @@ jydown.yyzmxcnxh.com
  jyeiodf.com
  jyekonuieihyokcn-dot-millinium.ey.r.appspot.com
  jyellowl.serveftp.com
-jyfmeqyehpbxdfbmqrosvljtgw-dot-gleow2021ja.ue.r.appspot.com
  jygasoft.com
  jygfvbdjjkgjnvfdv.weebly.com
  jygxr.svcoding.com
@@ -192184,7 +191313,6 @@ jyothykkart.com
  jyotsacademy.co
  jypzpmrzatyymclu-dot-millinium.ey.r.appspot.com
  jyqcicxjbkhbkpiaffpcnuiqzfembbkoaasi-dot-solar-vertex-285913.rj.r.appspot.com
-jyqdzujwspkyctdqqcdzrnfxtm-dot-gl9393jan.uk.r.appspot.com
  jyqhdrpevkgrauzd-dot-millinium.ey.r.appspot.com
  jyrtockltqdzsrse-dot-millinium.ey.r.appspot.com
  jyrvhx.goruli.com
@@ -192229,7 +191357,6 @@ jzpejvldlycynvep-dot-millinium.ey.r.appspot.com
  jzpsu43p7fu4mgl.cc
  jzqd2.svcoding.com
  jzqsk.jaysbrand.com
-jzqvxwnjwtnaalzxhwsmezpnap-dot-gl9393jan.uk.r.appspot.com
  jzqwadijeemkxhkk-dot-millinium.ey.r.appspot.com
  jzrzgpcctegixiin-dot-millinium.ey.r.appspot.com
  jzsefyfaeherequu-dot-millinium.ey.r.appspot.com
@@ -192499,7 +191626,6 @@ kakorioo.cam
  kakoro.mcdir.ru
  kakprosto.media
  kakprostoyes.ru
-kaktjzmekpxsuaxvxqfnwrgmmd-dot-gl9393jan.uk.r.appspot.com
  kaktosh.com
  kakucsiwlp.com
  kakudobno.ru
@@ -192608,7 +191734,6 @@ kampzamanimiz.com
  kamranhaqqani.com
  kamsotttynytijwh-dot-millinium.ey.r.appspot.com
  kamu-hizmeti-aidat-iadeleri-cimer.com
-kamufotografpaylasim.com
  kamxocllo.tk
  kamy.addroits.com
  kanada-ns-urlaub.de
@@ -192668,7 +191793,6 @@ kanyewest-shoes.com
  kanzlei-hermes.com
  kao.at
  kao3131.info
-kaodkvhtguhwvejtwvvqpghogb-dot-gl9393jan.uk.r.appspot.com
  kaoliao.ac.th
  kaorishiina.it
  kaoshila.cc
@@ -192908,6 +192032,7 @@ katieejohnston.com
  katiekerr.co.uk
  katieygraves.com
  katiliw.com
+katina534745.xyz
  katiuoshiletinen.xyz
  katja9.xxuz.com
  katjaundfelix.de
@@ -192995,7 +192120,6 @@ kazanin20gbturkiye.com
  kazasafaris.com
  kazdaglariorganik.com
  kazeevkablues.star-go.ru
-kazimacosmetics.com
  kazimoto.sytes.net
  kaziriad.com
  kazlcomposite.com
@@ -193030,7 +192154,6 @@ kbfvzoboss.bid
  kbgc.com.hk
  kbgdvslzbppytyln-dot-millinium.ey.r.appspot.com
  kbgh.com.tr
-kbgmvhgwqyaptovyecihhbotan-dot-gl9393jan.uk.r.appspot.com
  kbhgyqtsfafvklsf-dot-millinium.ey.r.appspot.com
  kbhmat.dk
  kbimperial.com
@@ -193059,7 +192182,6 @@ kbt-store.com
  kbtech.cl
  kbtedzhuafpkhaewwb.top
  kbtfoyfvkoealojbqybneuntkp-dot-gleowayel400503.uc.r.appspot.com
-kbtvmpduujdruwahhfdgsbgime-dot-gl9393jan.uk.r.appspot.com
  kbukubxwpeythoxyrqjhaekkod-dot-gleowayel400503.uc.r.appspot.com
  kburtdesigns.com
  kbutqebhj.vipsnapchatsexting.com
@@ -193093,7 +192215,6 @@ kcgwtjgiayvszxtk-dot-millinium.ey.r.appspot.com
  kcjhrqpsycqmhvkv-dot-millinium.ey.r.appspot.com
  kcjjbbkfpddovkya-dot-millinium.ey.r.appspot.com
  kck9f.awaykart.com
-kckgfhxaasdtavnlwymmpykiln-dot-gl9393jan.uk.r.appspot.com
  kcksecurity.000webhostapp.com
  kcllqsmkzrgeygxu-dot-millinium.ey.r.appspot.com
  kcmaggwofddhkktobbghhwkuqf-dot-gleowayel400503.uc.r.appspot.com
@@ -193101,7 +192222,6 @@ kcnibyusbjermsxrplgzqmxiuw-dot-gleowayel400503.uc.r.appspot.com
  kcntv.org
  kcobngqsmjspcuyrgrmfybhyeskidqfofrlr-dot-cryptic-now-290917.ey.r.appspot.com
  kcomaegjqfkmnuct-dot-millinium.ey.r.appspot.com
-kcopdrcqkmwdsrwnrvttsscjpg-dot-gl9393jan.uk.r.appspot.com
  kcosmetics-bd.com
  kcpl.info
  kcpzgvttsgldfkuyxxsfgggcxu-dot-gleowayel400503.uc.r.appspot.com
@@ -193111,7 +192231,6 @@ kcsbrssnkwpebsnm-dot-millinium.ey.r.appspot.com
  kcsoftstats.com
  kcsonanr.org.ru
  kcspesaxlpbtlpfh-dot-millinium.ey.r.appspot.com
-kcujxtowjkukmofodvokccsorw-dot-gl9393jan.uk.r.appspot.com
  kcviajtjtwpltizw-dot-millinium.ey.r.appspot.com
  kcwkjtrqzpybslhbzsjpgsjnzk-dot-glowablu03049033.du.r.appspot.com
  kcxe.net
@@ -193142,7 +192261,6 @@ kdi.org.ng
  kdipoqta.shoesmogul.com
  kdjf.guzaosf.com
  kdjredw.com
-kdjubivicswnohqweuuqckencn-dot-gl9393jan.uk.r.appspot.com
  kdkaamixjklkuvrq-dot-millinium.ey.r.appspot.com
  kdkpztzefdxqdyas-dot-millinium.ey.r.appspot.com
  kdmfacilityservices.com
@@ -193214,7 +192332,6 @@ kedkekk.co.cc
  keeblerplain.buzz
  keel.work
  keen-brahmagupta-cec944.netlify.app
-keen-lewin-867ae6.netlify.app
  keen-mclean-b4780a.netlify.app
  keen-pare-000b9f.netlify.app
  keen-ride-52e1b9.netlify.app
@@ -193253,7 +192370,6 @@ kefelharis.com
  kefflee.net
  kefqthngihwpmtlz-dot-millinium.ey.r.appspot.com
  kefybcxaduolgdxq-dot-millinium.ey.r.appspot.com
-kegcvcvqmhuofbrfptsdbqmuza-dot-gl9393jan.uk.r.appspot.com
  kehagia.gr
  kehjkbklbgtvrdoq-dot-millinium.ey.r.appspot.com
  kehutanan.umuslim.ac.id
@@ -193478,7 +192594,6 @@ ketab-88.cf
  ketalycoffee.com
  ketanggungan.desabrebes.id
  ketapang.bawaslu.go.id
-ketarfjsjovqclajwfqbbvnrlg-dot-gl9393jan.uk.r.appspot.com
  ketchupsnool.com
  kethellysquevedo.com
  ketinca.temp.swtest.ru
@@ -193654,7 +192769,6 @@ kgtgxlmrobbpvciemvcilgmdjcaxtgaulbjf-dot-offgl8876899977678.uk.r.appspot.com
  kgu.goruli.com
  kgusfufdcfbdycvvjomkqiidknyattbowgfv-dot-glegen303939423233.ue.r.appspot.com
  kgutjgdjdmlthice-dot-millinium.ey.r.appspot.com
-kgwfvehdhbuvhhecwkwqbqwohp-dot-gl9393jan.uk.r.appspot.com
  kgwhzpespzcmmbkvplswgyiypd-dot-gloff849483.uk.r.appspot.com
  kgwoool.com
  kgwr.tianyilin.cn
@@ -193774,7 +192888,6 @@ khdmatqatar.com
  khdsaz.com
  khdubeuwpixsrmve-dot-millinium.ey.r.appspot.com
  khdyhgkyskxddmmc-dot-millinium.ey.r.appspot.com
-khebbrkjsqjxrfxmpdhzvllatd-dot-gl9393jan.uk.r.appspot.com
  khebstveekriedle-dot-millinium.ey.r.appspot.com
  khefws.vipsnapchatsexting.com
  kheiriehsalehin.com
@@ -193871,7 +192984,6 @@ kia-sorento-problem.com
  kiabongo.ru
  kiabuhcsfpqpodyq-dot-millinium.ey.r.appspot.com
  kiacops.com
-kiaks.tk
  kialovuigene.com
  kiamobaim.theworkpc.com
  kiana-leather.com
@@ -194048,7 +193160,6 @@ kind-davinci-b4f5be.netlify.app
  kind-jones-5c3725.netlify.app
  kind-mclean-2e4c71.netlify.app
  kind-meitner-91e0a2.netlify.com
-kind-pike-cd6bdd.netlify.app
  kind-spence-b0840b.netlify.app
  kindapal.com
  kinder-camp.com.ua
@@ -194058,6 +193169,7 @@ kindermusikwithgosiacom.shaxiapotential.top
  kindersitze-vergleich.de
  kinderstubetomundjenny.com
  kindertagespflege-arcoiris.de
+kindheartedanchoredcgi.adasdfff.repl.co
  kindingme.sfo2.digitaloceanspaces.com
  kindled-buffer.000webhostapp.com
  kindleedxded.ru
@@ -194173,7 +193285,6 @@ kipliani.com
  kippies.org
  kippo.eu
  kipqrgogpcsbplxfhexkbgjhha-dot-gloff849483.uk.r.appspot.com
-kiqjdaegopdkonbillksdxtwxe-dot-gl9393jan.uk.r.appspot.com
  kiqwlqwkggyriegc-dot-millinium.ey.r.appspot.com
  kiraamora.000webhostapp.com
  kiradz3.ddns.net
@@ -194305,7 +193416,6 @@ kj3t.svcoding.com
  kj6n.jaysbrand.com
  kjahjsahj.tk
  kjajkcmnklla.weebly.com
-kjarhhvabvxmpeodfdhzzsxiff-dot-gl9393jan.uk.r.appspot.com
  kjarjpaoudeoepzkhfbzuykqen-dot-gleowayel400503.uc.r.appspot.com
  kjasblka.weebly.com
  kjavikcraven.xyz
@@ -194353,7 +193463,6 @@ kjtp0.svcoding.com
  kjtshswajbjvivxk-dot-millinium.ey.r.appspot.com
  kjwdkyglqwsduznl-dot-millinium.ey.r.appspot.com
  kjwgjdkj.weebly.com
-kjxijgbbckcvlsthytoqpmizhz-dot-gl9393jan.uk.r.appspot.com
  kk-0t.jaysbrand.com
  kk1793.com
  kk68.lishuny3.cn
@@ -194474,6 +193583,7 @@ kleinanzeigen890-001-site1.etempurl.com
  kleinanzeigens-001-site15.ctempurl.com
  kleincorners.buzz
  kleinendeli.co.za
+kleinisd-net-auth-doc.tk
  kleinkram.ch
  kleitmotion.xyz
  klem.com.pl
@@ -194628,7 +193738,6 @@ kmwoygdkvcgvaxnz-dot-glexcel1.ue.r.appspot.com
  kmxjrsezgnhxptjexv.top
  kmyubxsbplugcpkw-dot-millinium.ey.r.appspot.com
  kmyxbfawqbieowpckcsadjxenmrkbuptgbof-dot-cryptic-now-290917.ey.r.appspot.com
-kmyzgbnwmpffvevnjaqisxuzhj-dot-gl9393jan.uk.r.appspot.com
  kmz-3.svcoding.com
  kmzfqseatijxvrgbingmqmcgtmigvnxmarix-dot-offglen.uk.r.appspot.com
  kmzhoubianyou.com
@@ -194750,7 +193859,6 @@ knwosay-71.ga
  knxhpbrixgjswsmcsubeahpofw-dot-gleowayel400503.uc.r.appspot.com
  knypbxnvakayrbej-dot-millinium.ey.r.appspot.com
  knzdzkrqrf.duckdns.org
-knzphagzmoljafoehdywcoglsj-dot-gl9393jan.uk.r.appspot.com
  ko-racingshop.com
  ko4k12baou6avli.e8273.pro
  ko52.com
@@ -194816,7 +193924,6 @@ koght.co
  kogjaigj.ml
  kognitus.com.br
  kogohohkkh.buzz
-kogpxmdvexrfqjpiessgfzpvav-dot-gl9393jan.uk.r.appspot.com
  kohfaih.com
  kohinoorpearl.com
  kohnaninews.ir
@@ -195054,7 +194161,6 @@ konzeptprint.com
  koodaktv.ir
  koof.com.au
  koohsportsfoundation.com
-kookie-movement.000webhostapp.com
  koolahivqruibesk-dot-millinium.ey.r.appspot.com
  koolergazishop.ir
  koolpiquillov.com
@@ -195230,14 +194336,12 @@ kpohrzjnhz.duckdns.org
  kponnerte.bluehoststaff.com
  kpop-official.000webhostapp.com
  kpoplove0111.000webhostapp.com
-kposetu.gq
  kpprdolccjkzeuoa-dot-millinium.ey.r.appspot.com
  kppzdxdajxrsorbsacxxxrcybucbiexttaod-dot-glegen303939423233.ue.r.appspot.com
  kpqk5lt6u5op4kf.web.app
  kprealtors.com
  kprfkro.ru
  kpsbwjdjxqwovvhwgqtpdphccjeefsytfjxs-dot-solar-vertex-285913.rj.r.appspot.com
-kpsjvfhacghonmgegqtcjmzefa-dot-gl9393jan.uk.r.appspot.com
  kpsynfsmquawolgwrlhedpkxjjurmgbizeum-dot-cryptic-now-290917.ey.r.appspot.com
  kpt1m6i.gmz.cc
  kptnkgdipugtvmumrqkcgttaqw-dot-gloff849483.uk.r.appspot.com
@@ -195271,8 +194375,6 @@ kqnnuplnwbqvbjgm-dot-millinium.ey.r.appspot.com
  kqpxndrqdm.duckdns.org
  kqqgegowbnnabooqzldjahtyxb-dot-gleowayel400503.uc.r.appspot.com
  kqrjxgqqkrcwxvbb-dot-millinium.ey.r.appspot.com
-kqtmhgwprdjevxtfccscllkorp-dot-gl9393jan.uk.r.appspot.com
-kqtnwhlacmtlmmzpfhkwxeawds-dot-gl9393jan.uk.r.appspot.com
  kqtzlfgemajpugohgiwussvfcbnwwxktqqgm-dot-solar-vertex-285913.rj.r.appspot.com
  kqupyryhvjqnyagitgmfimluvm-dot-gleowayel400503.uc.r.appspot.com
  kqvrmvfgmlxzmjsh-dot-millinium.ey.r.appspot.com
@@ -195331,7 +194433,6 @@ krayker.com
  krazyfoxx9.xyz
  krbanpagehlpsrvce01.my.id
  krbkcavojfvcxjvv-dot-millinium.ey.r.appspot.com
-krbwqifxyoiwwsifssgtecciar-dot-gleow2021ja.ue.r.appspot.com
  krcove-zily.eu
  kre-8.co.za
  kre8ives.com
@@ -195409,7 +194510,6 @@ kritikalinc.com
  krivistechnologies.com
  krizasrednjihgodina.in.rs
  krjpl.com
-krjtzgrqrxmpnqrfnkshalwdzq-dot-gl9393jan.uk.r.appspot.com
  krkgdcaddanki.ac.in
  krkrteam.ddns.net
  krky8.svcoding.com
@@ -195437,6 +194537,7 @@ krowozofpvystmvxphwyikrchntgfpgbscig-dot-solar-vertex-285913.rj.r.appspot.com
  krrbywwkntusserhqc.top
  krrnyrmjbxivbekd-dot-millinium.ey.r.appspot.com
  krrnzwdcarrptmxi-dot-millinium.ey.r.appspot.com
+krsrvresort.com
  krsw-paypalservis5g.servebeer.com
  krt1.site
  krt2.site
@@ -195514,7 +194615,6 @@ kslanrung.com
  kslmembers.spiconsulting.com.au
  kslmmuenxjdbzjoiatwfkceldi-dot-gloff849483.uk.r.appspot.com
  kslwappihslpvpherwirlzkoyxlysupqcxek-dot-cryptic-now-290917.ey.r.appspot.com
-kslzsdlmlodwcbtipeuvpenhex-dot-gl9393jan.uk.r.appspot.com
  ksmaskfastigheterab.com
  ksmhtmvzfyujjcsjdglawlfthtcnugqhadug-dot-solar-vertex-285913.rj.r.appspot.com
  ksmne.duckdns.org
@@ -195526,7 +194626,6 @@ ksojjsoj.000webhostapp.com
  ksokdofoskf.ml
  ksoncrossfit.com
  ksongoieng.aokwolferv.com
-kspahhnpqvqwytszdyxqpjbqeu-dot-gl9393jan.uk.r.appspot.com
  kspipes.com
  ksppdaehkekuwtlcfgvpvzidqnrlrsdgpkme-dot-glegen303939423233.ue.r.appspot.com
  kspvdrhalyaqfldq-dot-millinium.ey.r.appspot.com
@@ -195559,7 +194658,6 @@ ktjijhoolahumxsymwlfsgbpkt-dot-gl9393jan.uk.r.appspot.com
  ktkjnpbjokfggdik-dot-millinium.ey.r.appspot.com
  ktktst.com
  ktlxn.dermals.org
-ktmdartdapnofydasqnutvsplx-dot-gl9393jan.uk.r.appspot.com
  ktml.org
  ktnsbavfig.duckdns.org
  kto-kruche.fun
@@ -195654,7 +194752,6 @@ kultfitness.com
  kultour-mv.com
  kulturens.org
  kumaontalc.in
-kumar1298.000webhostapp.com
  kumaralok.in
  kumarprodesign.com
  kumfqoiigafjcbirqreytdmwtxurfgwngiej-dot-solar-vertex-285913.rj.r.appspot.com
@@ -195684,7 +194781,6 @@ kumqdyhuuwzybcrz-dot-millinium.ey.r.appspot.com
  kumudlily.com
  kumutjdwreihmwrbpwkuusljifevyaguftgw-dot-glxcel49934343434.rj.r.appspot.com
  kumykoz.com
-kunbwdgalqttbqcrhgsqvntztv-dot-gl9393jan.uk.r.appspot.com
  kunci-sistem-id.webnode.com
  kuncidomino.com
  kunden-ebay.de
@@ -195834,7 +194930,6 @@ kvark1905.siteme.org
  kvartura.vn.ua
  kvav.in
  kvbswivyinwhagly-dot-millinium.ey.r.appspot.com
-kvbthfovbwrdfbycfjxvgyonik-dot-gl9393jan.uk.r.appspot.com
  kvctmwximalxuere-dot-millinium.ey.r.appspot.com
  kvene1z.info
  kvfmxmjsgd.duckdns.org
@@ -195865,7 +194960,6 @@ kvmappsciod272861.fjrmmk.com
  kvmappsciod643662.fjrmmk.com
  kvmappsciod911562.bgromenicheak.com
  kvmappsciod99053.bgromenicheak.com
-kvmcekwlfcyyuxxdwphtfjxfqj-dot-gl9393jan.uk.r.appspot.com
  kvmhostedcloud-id202948.losdolaknjut.com
  kvmmawxlrlefifar-dot-millinium.ey.r.appspot.com
  kvmmrkrkksaugwzkjbdlwfqqtijppnyftquv-dot-glegen303939423233.ue.r.appspot.com
@@ -195937,7 +195031,6 @@ kwprxsijamcjiignfzofyiovvlhwizmlmote-dot-solar-vertex-285913.rj.r.appspot.com
  kwqufatxcybvzpgy-dot-millinium.ey.r.appspot.com
  kwrdzbitihghsfmm-dot-millinium.ey.r.appspot.com
  kwrealty2015.mobi
-kwrorvxgkpfizuucvnadeocigq-dot-gl9393jan.uk.r.appspot.com
  kwsg.awaykart.com
  kwtkkevkybaavjcj-dot-millinium.ey.r.appspot.com
  kwtr.svcoding.com
@@ -196006,7 +195099,6 @@ kykegvqjoovmkedp-dot-millinium.ey.r.appspot.com
  kykeon-eleusis.com
  kykofcdmkbhmudqf-dot-millinium.ey.r.appspot.com
  kykywka.xyz
-kylaskyway.buzz
  kylebeard.com
  kylepetersenmusic.com
  kyleriffic.com
@@ -196075,6 +195167,7 @@ kzvhfexdkzsfijut-dot-millinium.ey.r.appspot.com
  kzvvvayqkktmbwjx-dot-millinium.ey.r.appspot.com
  kzwscywhjytyhjie-dot-millinium.ey.r.appspot.com
  kzyenpjxsaizfplg-dot-millinium.ey.r.appspot.com
+l-1.top
  l-81-22-32-8881.ga
  l-amazon.top
  l-banorte.com
@@ -196090,7 +195183,6 @@ l.www.dyamm.com
  l0.lonlydra.ru
  l000888457covid.online
  l00c25cf32.temp.swtest.ru
-l010.cf
  l09162020-fixmailhelpdesk.web.app
  l09d56a7.justinstalledpanel.com
  l0g1nn-rec0v3rdata.com
@@ -196123,12 +195215,12 @@ l6fd96ca.justinstalledpanel.com
  l7n2.com
  l83cwgpr.firebaseapp.com
  l84c6a7c.justinstalledpanel.com
-l850.gq
  l8b6a671.justinstalledpanel.com
  l94d6f63.justinstalledpanel.com
  l968905q.beget.tech
  l9a3de36.justinstalledpanel.com
  l9e93cf7.justinstalledpanel.com
+l9mcode.ru
  l9oheathj.com
  la-637-qj7-com-e-para-voce.com
  la-alert.com
@@ -196776,7 +195868,6 @@ latinotrade.ru
  latinotravel.cz
  latiprantz.com
  latisiotheohm.xyz
-latitudinal-launche.000webhostapp.com
  latmasoud.persiangig.com
  latouche-eco.fr
  latovfbjscuekfkpuspjsjlnlp-dot-gloff00403993445.uk.r.appspot.com
@@ -196833,7 +195924,6 @@ laurentbernardaquarelles.com
  laurentchipaux.com
  laury.co
  laus538wov.firebaseapp.com
-lausd-ignn.ga
  lausebpro.com
  lausellv.com
  lausinexamenes.com
@@ -196878,11 +195968,9 @@ lavitaworld.com
  lavoixdesmots.free.fr
  lavorosubordinatosmartw.org
  lavrin.pl
-law-abiding-seesaws.000webhostapp.com
  lawang88view01.my.id
  lawerencesfranklin.com
  lawetasandomierz.pl
-laweuqkomqsuboybevyblymbmo-dot-gl9393jan.uk.r.appspot.com
  lawfirm-int.online
  lawful-pokes.000webhostapp.com
  lawinternship.000webhostapp.com
@@ -196919,7 +196007,6 @@ layagroup.net
  laydomain.cf
  layemfoods.com
  layerdry.cyou
-layered-dears.000webhostapp.com
  layerstiont.xyz
  laylachotty.com
  laylalanemusic.com
@@ -197010,7 +196097,6 @@ lbr.gov.lr
  lbrfirycjopqhtru-dot-millinium.ey.r.appspot.com
  lbrimzyrvarmmyshjahi-dot-level-elevator-279110.nw.r.appspot.com
  lbsinfo.shaxiabuy.top
-lbskyaurdcjdyxhstpobisfzyg-dot-gl9393jan.uk.r.appspot.com
  lbtlgpxlouhbgvqi-dot-millinium.ey.r.appspot.com
  lbubzqasipnyjejw-dot-millinium.ey.r.appspot.com
  lbugfrfwsdrljzid-dot-millinium.ey.r.appspot.com
@@ -197036,10 +196122,8 @@ lcd365de.shaxiaadd.top
  lcdecor.ru
  lce.goruli.com
  lcen66xr.firebaseapp.com
-lcenwhjekchpajhevxqmijonuf-dot-gl9393jan.uk.r.appspot.com
  lcevgmyimquqhoabvskwmzxyhpnjxdubefwd-dot-glegen303939423233.ue.r.appspot.com
  lcfbcerbxkhbhpov-dot-millinium.ey.r.appspot.com
-lcfpqfodwuumdqhnzysjwluegt-dot-gl9393jan.uk.r.appspot.com
  lcga.net.cn
  lcgcintemag.ru
  lcgdsorg.shaxiabed.top
@@ -197049,9 +196133,7 @@ lcimqznscoqvoile-dot-millinium.ey.r.appspot.com
  lcisoft.it
  lcivfvexozrxhamweqyeefgwrxjgqdsfyltu-dot-gl494903049.wl.r.appspot.com
  lcjwquyamvfqdosh-dot-millinium.ey.r.appspot.com
-lckyspinpubg.com
  lcl-fr-access-compte-particulier-verification.acd-getraenke.de
-lcl-pro-espace-fr.web.app
  lcloud-id-apps.live
  lcloud-id.support
  lcloud-server.us-south.cf.appdomain.cloud
@@ -197083,6 +196165,7 @@ lcozo.com
  lcpublicidades.com.br
  lcqxnqwauthpxyou-dot-millinium.ey.r.appspot.com
  lcroud.com
+lcrsaeca.com
  lcs-consumentenpagina.info
  lcs-page.info
  lcs-securitycheck.de
@@ -197126,7 +196209,6 @@ ldfsgc.com
  ldgcorp.com
  ldgfip-appcontact.link
  ldgqwovkrnfbkbulurrwcikredhtovbjnnrm-dot-cryptic-now-290917.ey.r.appspot.com
-ldhqcoaexkttidetbvduaojesw-dot-gl9393jan.uk.r.appspot.com
  ldibxfvwtrybedrfaqisqjbbae-dot-gleowayel400503.uc.r.appspot.com
  ldireproprintingllc.for-more.biz
  ldjbsgcqmaqnfoyg-dot-millinium.ey.r.appspot.com
@@ -197156,7 +196238,6 @@ ldrmercury.casa
  ldrpeset.casa
  ldrtango.casa
  ldrtoyota.casa
-ldryoxgbrclvbkzuwtynvevmoi-dot-gleow2021ja.ue.r.appspot.com
  ldsplanettt.yolasite.com
  ldtaempresanostra.com.br
  ldtvkkzmdvknrsrn-dot-millinium.ey.r.appspot.com
@@ -197448,6 +196529,7 @@ leger-abraham.com
  leggingscom.com
  legioncoaching.top
  legioncrest.com
+legionnaires.com
  legionservicesonline.com
  legit9ja.com
  legitaseta.com
@@ -197473,7 +196555,6 @@ legzjsjt.shoesmogul.com
  lehavregenealogie2017.fr
  lehraagrotech.com
  lehsa.com
-lehsjwjxcvsiayiooiaggjxkvh-dot-gl9393jan.uk.r.appspot.com
  lehuopai.com
  lehygdhiyusjidjusbhfiaod.live
  lehzig.com
@@ -197496,7 +196577,6 @@ leipzigagency.baerseventake.top
  leipziger-schrippe.de
  leitersadvogados.com.br
  leixiayiran.com
-lejasvukdtrmnklzfwapyasxta-dot-gl9393jan.uk.r.appspot.com
  lejintian.cn
  lejkjnfpepqviujb-dot-millinium.ey.r.appspot.com
  lejkmrcclkwvsmac-dot-millinium.ey.r.appspot.com
@@ -197568,6 +196648,7 @@ leniomontalverne.com
  lenjerii-pilote.ro
  lenkinabasta.com
  lennarz.org
+lenniesquaresapt.xyz
  lennophthalmia.info
  lennycleaning.com
  lennysdeals.com
@@ -197840,9 +196921,9 @@ lfkdkfdfdflfkfk.com
  lfkdkfdkfdjkfd.com
  lfknmqovagmzeqdb-dot-millinium.ey.r.appspot.com
  lfkycsdatnyflqvb-dot-millinium.ey.r.appspot.com
-lflwkcqugcvpatlqxgqjucdodd-dot-gl9393jan.uk.r.appspot.com
  lfmdmlfmdfder.com
  lfmultiformas.com
+lfoqvwnkbjowipioawuuvdulds-dot-gleow2021ja.ue.r.appspot.com
  lforgot-en.us
  lfpfotoway.com
  lfqqfvyfuemerggh-dot-millinium.ey.r.appspot.com
@@ -197869,7 +196950,6 @@ lgc-wine.com
  lgcopyrightform.com
  lgcopyrighthelpsupport.tk
  lgdayxbaggzbyqwk-dot-millinium.ey.r.appspot.com
-lgdfjqtgzcnpdunrmcbiynosoa-dot-gl9393jan.uk.r.appspot.com
  lgdrzbmfzihytcdi-dot-millinium.ey.r.appspot.com
  lgdtrngkhegwwkcyzouqqouubjxeqpfzuqwk-dot-solar-vertex-285913.rj.r.appspot.com
  lgexnwtkiufmpfuuscinnzokjw-dot-gleowayel400503.uc.r.appspot.com
@@ -197884,7 +196964,6 @@ lginaccntntflixss.com
  lgintflixsc.com
  lgioginpage45662123.000webhostapp.com
  lgjmcaz.cn
-lgkmzmoblxtczagkwmxpngjwir-dot-gl9393jan.uk.r.appspot.com
  lgkpwqxasagsyptq-dot-millinium.ey.r.appspot.com
  lglaoiteohybkhrgpleofaivmy-dot-gleowayel400503.uc.r.appspot.com
  lglistjnb.com
@@ -197921,7 +197000,6 @@ lgunxlajidubjxzx-dot-millinium.ey.r.appspot.com
  lguwvacjoktparygwfioudfhcs-dot-gleowayel400503.uc.r.appspot.com
  lguzxapqdaogxkcf-dot-millinium.ey.r.appspot.com
  lgvhfbqwmfpdpugz-dot-millinium.ey.r.appspot.com
-lgvmkxrpjgmbwljvpodgqkglxn-dot-gleow2021ja.ue.r.appspot.com
  lgxnmhfaspejuumsmnavryiwsapkewhnonzn-dot-glxcel49934343434.rj.r.appspot.com
  lgxx8.cn
  lh-broker.com
@@ -197942,7 +197020,6 @@ lhelp.pl
  lhf0e.cn
  lhfkgyriaepntxme-dot-millinium.ey.r.appspot.com
  lhfpavcznedqludr-dot-millinium.ey.r.appspot.com
-lhfxavfflcrnpuuyutjzqnvlse-dot-gl9393jan.uk.r.appspot.com
  lhhetvkc.goruli.com
  lhicddbjcsdhrbniwhurjjvjgzmlrbimoxni-dot-glxcel49934343434.rj.r.appspot.com
  lhiscpztunheqeaw-dot-millinium.ey.r.appspot.com
@@ -198143,7 +197220,6 @@ lifecycleeng.com
  lifedive.gr
  lifeful-numeral.000webhostapp.com
  lifegiveaway.com
-lifeguardglobal.com
  lifeinsurancenew.com
  lifeisbetternow.ml
  lifeiswhatyoumakeofit.com
@@ -198203,8 +197279,6 @@ ligfebacktolife.us
  lighjetagend.tk
  light-architecture.fr
  light-boy.top
-light-handed-animal.000webhostapp.com
-light-headed-indica.000webhostapp.com
  light-headed-minimu.000webhostapp.com
  light.brwrqweo.uk
  light.fakesemoca16.com
@@ -198228,6 +197302,7 @@ lightou-71.cf
  lightpressprint.co.zw
  lightreach53.com
  lights-craft.net
+lightsalmondecentopposites--five-nine.repl.co
  lightscafe.com
  lightscrawnyoutcomes--five-nine.repl.co
  lightspeedassociation.info
@@ -198943,7 +198018,6 @@ littleturtle.com.sg
  littlewoods.in
  littory53.com
  litttrzattmarzch.com
-litusrumscaze.cf
  liubaozi.cn
  liugong.tk
  liulibug.com
@@ -199144,7 +198218,6 @@ lj65.com
  lja93bqw.firebaseapp.com
  ljalwpnjckhgeijkikxvbpqpihwyzewlhxci-dot-cedar-code-289917.nn.r.appspot.com
  ljaocdezkibhmkta-dot-millinium.ey.r.appspot.com
-ljaowtiwrttwujnnqsfwfznlsc-dot-gl9393jan.uk.r.appspot.com
  ljbbx.de
  ljbfmkudgzmpiwefofclsvxdjbkflpqgpkkc-dot-cedar-code-289917.nn.r.appspot.com
  ljbfmkudgzmpiwefofclsvxdjbkflpqgpkkc.cedar-code-289917.nn.r.appspot.com
@@ -199163,16 +198236,12 @@ ljjqmrwvzqcxedziofzvnzdrcquzvzsotdtt-dot-solar-vertex-285913.rj.r.appspot.com
  ljjsizlcmfwxrmig-dot-millinium.ey.r.appspot.com
  ljkhjkkjg.org.ru
  ljkuqzlemiwrkyfespfjducall-dot-gleowayel400503.uc.r.appspot.com
-ljltixmdwcakjodvszlpaxsysg-dot-gl9393jan.uk.r.appspot.com
-ljmwjsnvyulhwiocvqvdrkuzrg-dot-gl9393jan.uk.r.appspot.com
  ljogcaiwbxmvbyfvzpgptajxfnsvrxqbwcej-dot-glegen303939423233.ue.r.appspot.com
  ljoihohb.gb.net
  ljp9neothtzc.com
  ljrabeuftqmymvml-dot-millinium.ey.r.appspot.com
-ljtdsikefomdovnwxmqcnyokcn-dot-gl9393jan.uk.r.appspot.com
  ljtlkyzanfftftkfjautiuubxi-dot-gleowayel400503.uc.r.appspot.com
  ljusbxyunjgbhsqczibrpoivfp-dot-gleowayel400503.uc.r.appspot.com
-ljxgpmqqwvbapzrgjbgkqkfltt-dot-gl9393jan.uk.r.appspot.com
  ljyvszkjuscqwdizcjxsjcvercnzvgjnqbpq-dot-cedar-code-289917.nn.r.appspot.com
  ljyxx.com
  lk.seva-online.com
@@ -199250,7 +198319,6 @@ llanteradelcentro.com
  llarion.pp.ua
  llasse.cam
  llbb88.com
-llbnk2secure.com
  llbonline-cancel-access.com
  llbonline-personal-manage.com
  llbzy.com
@@ -199291,23 +198359,24 @@ lloyd-newpayee.net
  lloyd-newpayments.net
  lloyd-online.login-online-support.com
  lloyd-payee-cancel.net
+lloyd-payeeassist.com
  lloyd-personal.onlinebankinguk.net
  lloyd-securebank.com
  lloyd-verify.com
  lloyd.groupplc-supportgb.com
  lloyd.new-secure.co.uk
  lloyd.unauthpayee.com
+lloyd53474.xyz
  lloydalert.com
  lloydbank-cancel.com
  lloydbank-login.com
-lloydbank-payeereview.com
+lloydbank-securemanagedevice.com
  lloydbank-securemanagepayee.com
  lloydbank.com.compliance-user.services
  lloydbank.new-secure.co.uk
-lloydbanking-managepayees.com
+lloydbanking-payeemanage.com
  lloydcancelpayee.com
  lloydconstruction.com
-lloydgb-newdevice-online.com
  lloydolb.com
  lloydonline-eservices.com
  lloydonlinesecure.loginpayeesecure.com
@@ -199494,7 +198563,6 @@ lloydsbank.com.login-review-4453.info
  lloydsbank.com.login-review-976.info
  lloydsbank.com.submit-application.services
  lloydsbank.contacts-help.co.uk
-lloydsbank.deregister-secure-payee.com
  lloydsbank.deregister-unknown-payee.com
  lloydsbank.device-auth-new-verify.com
  lloydsbank.device-login-verify-auth.com
@@ -199526,6 +198594,7 @@ lloydsbank.new-review-auth-device.com
  lloydsbank.new-secure.co.uk
  lloydsbank.newly-login-attempted-access-gained.com
  lloydsbank.online-auth-device-verify.com
+lloydsbank.online-auth-secure-verified.com
  lloydsbank.online-auth-secure-verify.com
  lloydsbank.online-login-auth-device.com
  lloydsbank.online-login-auth-verify-device.com
@@ -199536,7 +198605,6 @@ lloydsbank.online-personal-login-info.com
  lloydsbank.online-personal-login-verify.com
  lloydsbank.online-personal-logon-uk.com
  lloydsbank.online-personal-validate.com
-lloydsbank.online-security-auth-verify.com
  lloydsbank.online-validate-device.com
  lloydsbank.online-validate-login-info.com
  lloydsbank.online-verify-auth.com
@@ -199553,7 +198621,6 @@ lloydsbank.personal-profile-login.com
  lloydsbank.personal-secure-payee-request.com
  lloydsbank.personal-security-payee-request.com
  lloydsbank.personal-user-device.com
-lloydsbank.personal-user-shield.com
  lloydsbank.personal-user-verify.com
  lloydsbank.prevention-auth-device-login.com
  lloydsbank.register-mobilebanking.com
@@ -199576,6 +198643,7 @@ lloydsbank.secured-logins-auth-devices.com
  lloydsbank.security-auth-new-dev.com
  lloydsbank.security-new-dev.com
  lloydsbank.security-payee-request-login.com
+lloydsbank.security-personal-devices.com
  lloydsbank.tel
  lloydsbank.uk.id-payee.com
  lloydsbank.uk.payments-confirmation.com
@@ -199703,7 +198771,6 @@ lmpulsefashion.net
  lmpvjicjvvfuyhefmggs.com
  lmqauyjfzywkwkkubfiduusrlj-dot-gloff00403993445.uk.r.appspot.com
  lmqgijbrdkzvlhru-dot-millinium.ey.r.appspot.com
-lmqhnckidswqwbgjywlbnbhaip-dot-gl9393jan.uk.r.appspot.com
  lmrcaorgukdy.cf
  lmrpcxbgrnerkdsq-dot-millinium.ey.r.appspot.com
  lms.latrobe.aroe.me
@@ -199736,7 +198803,6 @@ lncherr-facebook.com.villa-evelyn.com
  lnchzhqcnvfumhzwuoyleighjccfflczmzxk-dot-solar-vertex-285913.rj.r.appspot.com
  lnefsrpozm.duckdns.org
  lneqqkvxxogomu.eu
-lnfbbdhkilrgvukfyiqveiazce-dot-gl9393jan.uk.r.appspot.com
  lnfo-appmobile.com
  lnfo-instgram-center.ml
  lnfo.web-chat.eu
@@ -199764,7 +198830,6 @@ lnhhpxnotgsticvc-dot-millinium.ey.r.appspot.com
  lnhoa6bz4vxs.talagaremix.com
  lniciosucursal.site
  lniclkhalaxpkoiqfbdzlwbaen-dot-gloff849483.uk.r.appspot.com
-lnjmdujnolrqpgvncfigpmodai-dot-gl9393jan.uk.r.appspot.com
  lnk.jecool.net
  lnk.pmlti-etai-2.ovh
  lnkaqvwowakoflei-dot-millinium.ey.r.appspot.com
@@ -199794,7 +198859,6 @@ lnstaglams.com
  lnstagram--verify.ml
  lnstagram-about.com
  lnstagram-approves.com
-lnstagram-auth-users.000webhostapp.com
  lnstagram-badge-confirm.com
  lnstagram-badge-team.tk
  lnstagram-blue-badge-form.tk
@@ -199833,7 +198897,6 @@ lnstagram-copyrighthelpcenter.com
  lnstagram-copyrighthelpig.ml
  lnstagram-copyrightrules.com
  lnstagram-copyrights-center.com
-lnstagram-copyrights-central.cf
  lnstagram-copyrights-supports.ga
  lnstagram-copyrightvioalation.com
  lnstagram-copyrightvioalation.tk
@@ -200003,7 +199066,6 @@ lnstagramcopyrightsystem.com
  lnstagramcopyrightveryfy.cf
  lnstagramcopyrightviolationcenter.com
  lnstagramcopyrightviolationhelps.com
-lnstagramcopyrightviolationreports.ml
  lnstagramcopyrighty.ml
  lnstagramcopyrright.ml
  lnstagramcourtappeals.com
@@ -200040,7 +199102,6 @@ lnstagramhelpcopyrightservice.ml
  lnstagramhelpcopyrightsupports.com
  lnstagramhelpcopyrightsupports.net
  lnstagramhelpcopyrigts.com
-lnstagramhelpedteams.cf
  lnstagramhelpercenters.cf
  lnstagramhelpers.com
  lnstagramhelperscenter.ml
@@ -200085,7 +199146,6 @@ lnstagramscopyright.life
  lnstagramscopyright2020.com
  lnstagramscopyrightservices.tk
  lnstagramsecure.tk
-lnstagramsecurehelp.ml
  lnstagramsecurhelpaccounts.000webhostapp.com
  lnstagramsecuritycopyright.cf
  lnstagramsecurityhub.com
@@ -200104,7 +199164,6 @@ lnstagramsupport.club
  lnstagramsupportaccount.com
  lnstagramsupportbadge.cf
  lnstagramsupportcenter.com
-lnstagramsupporter.ga
  lnstagramsupportforumx.com
  lnstagramsupporthelpcenter.epizy.com
  lnstagramsupportlive.tk
@@ -200189,7 +199248,6 @@ lnv0lce06855.com
  lnvaetpne.dermals.org
  lnvkbagsprwcagpb-dot-millinium.ey.r.appspot.com
  lnvoice82673.com
-lnvydjhoutuzmguwcscalhyikd-dot-gl9393jan.uk.r.appspot.com
  lnwoevmfraeuywrntsggvhqfvz-dot-gleowayel400503.uc.r.appspot.com
  lo-bank.com
  lo-localbltcoins.com
@@ -200265,6 +199323,7 @@ locagroup.club
  locaibtcoins.net
  local-banks.com
  local-coinpsd.com
+local-dealership.com
  local-dispositivo.com
  local-t-mobile.com
  local1bi1coins.com
@@ -201218,6 +200277,7 @@ loginfb2020.ml
  loginfb2020.tk
  loginfbonline.loginfacebookonline.com
  loginfo-tkconf.web.app
+loginfreeclaiimnow.gq
  loginfreemembergroups.ml
  loginfreemembergroups.tk
  loginfreememberjoins.cf
@@ -201458,7 +200518,6 @@ lojasinvernobahia.com
  lojasmagazinelu.com
  lojasmc.net
  lojaspromo-com.umbler.net
-lojaspromoverao-com.umbler.net
  lojaxgrowup.com
  lojin-inst.000webhostapp.com
  lojkqy.vipsnapchatsexting.com
@@ -201614,7 +200673,6 @@ lonnie534645.xyz
  lonosoneteams.blogspot.com
  lonrsurf.com
  lont.co.in
-lonxvcufxjxbeulkvqjgyzfrch-dot-gl9393jan.uk.r.appspot.com
  look-com.cabanova.com
  look-downloads.ga
  look.in
@@ -201733,7 +200791,6 @@ losoftemer.temp.swtest.ru
  losososdesign.com
  lospequenines.com
  losras25s.weebly.com
-losrecuerdosperduransiempre.000webhostapp.com
  lost-icloud.live
  lost-log.icloud-y.com
  lostacntwuexcmhxklwliuchwbwdhbopwpdt-dot-solar-vertex-285913.rj.r.appspot.com
@@ -201755,7 +200812,6 @@ lotlee.com
  loto041219.blogspot.com
  loton.com.pl
  lotpgyvievygejmmujcimfjlxqczspsxpjma-dot-cryptic-now-290917.ey.r.appspot.com
-lotrhwrmvnlmavknczeylwdgab-dot-gl9393jan.uk.r.appspot.com
  lotrqkwihhoyjicq-dot-millinium.ey.r.appspot.com
  lotsarecipes.com
  lotsforsalellc.com
@@ -201886,9 +200942,7 @@ loveyou01.000webhostapp.com
  loveyou01couple.000webhostapp.com
  loveyourvalentine.icu
  lovienmorelos.ru
-loving-bhaskara-7def90.netlify.app
  loving-northcutt-368286.netlify.app
-loving-swanson-b55ac6.netlify.app
  lovinggleamingargument.angueluisreyama.repl.co
  lovinghandsayurveda.com
  lovmesdkiunrgbouvyxmjqxiig-dot-gleowayel400503.uc.r.appspot.com
@@ -201918,7 +200972,6 @@ lowthercastle-views.com
  lowvoltage.ro
  loxien2.com
  loxliver.com
-loxqnaykpbdqflobujgqxlmnwb-dot-gleow2021ja.ue.r.appspot.com
  loyalbinary.com
  loyaldeliriousautoresponder--five-nine.repl.co
  loyaler.ga
@@ -201949,7 +201002,6 @@ lp0766.ddns.net
  lp2m.umsu.ac.id
  lp4jzf1e.web.app
  lpacwsbjpyjkoktd-dot-millinium.ey.r.appspot.com
-lpalcdhixfpuycdyxynjrlbljo-dot-gl9393jan.uk.r.appspot.com
  lpaozvnngzobn.icu
  lpatrick.com
  lpbhtrulmhxctemb-dot-millinium.ey.r.appspot.com
@@ -201999,13 +201051,10 @@ lqadmuszkgyaqamw-dot-millinium.ey.r.appspot.com
  lqayjfngjocnyvwv-dot-millinium.ey.r.appspot.com
  lqbfyeljoasfbnnu-dot-millinium.ey.r.appspot.com
  lqclrvrglqjrtazucezpepgxxzkxkiroqkhn-dot-gl494903049.wl.r.appspot.com
-lqcumeoeimgxswochqxpfovwtc-dot-gl9393jan.uk.r.appspot.com
  lqczvrkilhidgjwk-dot-millinium.ey.r.appspot.com
-lqdmxhajrhmbyrhddiprjjcfaq-dot-gl9393jan.uk.r.appspot.com
  lqg8u8.webwave.dev
  lqhuxvgkoozwxfxt-dot-millinium.ey.r.appspot.com
  lqixqpuwwqlhndqo-dot-millinium.ey.r.appspot.com
-lqkmdgwngqnnhthkekjzwmbwre-dot-gl9393jan.uk.r.appspot.com
  lqlpobqzukbpsccxvfyxboruun-dot-gloff849483.uk.r.appspot.com
  lqlxgsqklxlelaltekomuyfrtbtrwynunfug-dot-cryptic-now-290917.ey.r.appspot.com
  lqmnnfacsgshgowfowhoubqnntaoqjhfjorf-dot-solar-vertex-285913.rj.r.appspot.com
@@ -202039,18 +201088,15 @@ lrgxxsboznlwvtlk-dot-millinium.ey.r.appspot.com
  lrhalowsrnbgorka-dot-millinium.ey.r.appspot.com
  lrilnbsvcdngmfrsbrclvcdsrj-dot-gleowayel400503.uc.r.appspot.com
  lrn.goruli.com
-lromcjzjlfatqegijzeizruopk-dot-gl9393jan.uk.r.appspot.com
  lronman4x4.com
  lrowetu.ga
  lrrgxycofhguqbvc-dot-millinium.ey.r.appspot.com
  lrservice.com.ua
  lrslwsthrzmtbnsgompamejpphcuvyumqixk-dot-solar-vertex-285913.rj.r.appspot.com
  lrtcqcfksnzmewycmyisapzryfsdjncipayx-dot-cryptic-now-290917.ey.r.appspot.com
-lrterwxeklzzhkbflupuwqatpr-dot-gl9393jan.uk.r.appspot.com
  lrtt.re
  lruzpian.com
  lrwngnkjrhlfsppnoiaoifntigxvqhpbitvn-dot-solar-vertex-285913.rj.r.appspot.com
-lrwqjzsaiozwkpjomnhewcfdhp-dot-gl9393jan.uk.r.appspot.com
  lrzqcqiiuqsvumdg-dot-millinium.ey.r.appspot.com
  ls.airseal.com
  ls.gucac.com
@@ -202161,7 +201207,6 @@ lterbisjyougds.buzz
  lteseguros.com.br
  ltfqsntijkelkkem-dot-millinium.ey.r.appspot.com
  ltggtdsirerive.com
-ltguhhobedqpbjvjwvgrwqipgc-dot-gl9393jan.uk.r.appspot.com
  lth.goruli.com
  lthost.club
  lti.com.ng
@@ -202194,7 +201239,6 @@ lttrjayxytyvdjxdjqexpshddpsyhdtntrca-dot-gl494903049.wl.r.appspot.com
  ltujagcepzoxtdqnmqawbymjlghueozglmqi-dot-cedar-code-289917.nn.r.appspot.com
  ltuvvosxpwdopsxlxthquecptv-dot-gleowayel400503.uc.r.appspot.com
  ltwvdb.webwave.dev
-ltxurmlhhvyftxrhltimnwrnkx-dot-gleow2021ja.ue.r.appspot.com
  ltyqpqyyqzfyynqn-dot-millinium.ey.r.appspot.com
  ltyuye.com
  ltzmfkeryczbvlzg-dot-millinium.ey.r.appspot.com
@@ -202238,7 +201282,6 @@ lucianodelarco.com.br
  lucianoweb.com.br
  luciatle-71.tk
  lucid-brahmagupta-91bfd6.netlify.app
-lucid-sinoussi-f1726c.netlify.app
  lucid.kiev.ua
  lucidfestival.com
  lucidinvestbank.com
@@ -202306,12 +201349,10 @@ luckyspin.vyxz09.com
  luckyspin01.com
  luckyspin13s.com
  luckyspin2020.jetos.com
-luckyspin77.ga
  luckyspinews.dnset.com
  luckyspinfrees13.myvnc.com
  luckyspingetx.duckdns.org
  luckyspinhallowekss16.com
-luckyspinmetro.net
  luckyspinmetro16.com
  luckyspinn13.com
  luckyspinner.25u.com
@@ -202415,7 +201456,6 @@ lulla.duckdns.org
  lulu.breful.us
  lulufabllc.com
  luluvipco.com
-luluzwsfqsttkeeiskhqcqqetr-dot-gl9393jan.uk.r.appspot.com
  lum4.com
  lumanaridecorative.com
  lumao.org
@@ -202517,11 +201557,11 @@ luxedollz.com
  luxedrive.fr
  luxeinvesting.com
  luxembourg-capital-finance.com
-luxgormwapuiguuccnhyrvdehh-dot-gl9393jan.uk.r.appspot.com
  luxgsyjrfqdczmhg-dot-millinium.ey.r.appspot.com
  luxi.06wi.com
  luxiyouyue.club
  luxjewelleries.com
+luxlogics.ml
  luxmomentumbiz.shaxiareason.top
  luxmomentumweihnachtsbeleuchtungcom.shaxiapussy.top
  luxorarabians.com
@@ -202619,9 +201659,7 @@ lwizbzaenytfnxjcvhkmshiknl-dot-gleowayel400503.uc.r.appspot.com
  lwkufjerqsgxrock-dot-millinium.ey.r.appspot.com
  lwmvysjhptvckwchqriolklxuzbsqgwmvibt-dot-cryptic-now-290917.ey.r.appspot.com
  lwohwvpnofdcrjbv-dot-millinium.ey.r.appspot.com
-lwpwrmdphkuvugfdcqmyeoxjqh-dot-gl9393jan.uk.r.appspot.com
  lwqfypiyk.goruli.com
-lwrvjybjysntslzwnlqaarhenc-dot-gl9393jan.uk.r.appspot.com
  lwrxtuixfugewegj-dot-millinium.ey.r.appspot.com
  lwsovetnyk.ru
  lwsrxubjvlruyrgq-dot-millinium.ey.r.appspot.com
@@ -202629,7 +201667,6 @@ lwsuspgkddrtuaoy-dot-millinium.ey.r.appspot.com
  lwszyrvvp.goruli.com
  lwubsjmxflzfttswumelcsrbvf-dot-gleowayel400503.uc.r.appspot.com
  lwwmffokktidwbkr-dot-millinium.ey.r.appspot.com
-lwyappnismbhgjakbkuflyakiy-dot-gl9393jan.uk.r.appspot.com
  lwyrojbpwurvokkj-dot-millinium.ey.r.appspot.com
  lwzauaqpiwslctfl-dot-millinium.ey.r.appspot.com
  lwzlwzgame.com
@@ -202641,15 +201678,12 @@ lxdrwbolkxunxfrcyarambaopu-dot-gleowayel400503.uc.r.appspot.com
  lxduexapwhszclxz-dot-millinium.ey.r.appspot.com
  lxersjbxzraamyvdldpeavzecc-dot-gleowayel400503.uc.r.appspot.com
  lxeyneyxulfhnswr-dot-millinium.ey.r.appspot.com
-lxgxhrotmdjxrbalfdfypcowvr-dot-gleow2021ja.ue.r.appspot.com
  lxhrjxulobjtbsvq-dot-millinium.ey.r.appspot.com
-lxkyuhagonwevtctmfbklltnxn-dot-gl9393jan.uk.r.appspot.com
  lxldjupikdxvxfar-dot-millinium.ey.r.appspot.com
  lxnpjuhrosiokwdv-dot-millinium.ey.r.appspot.com
  lxoaix.sytes.net
  lxpqevteobjosuuh-dot-millinium.ey.r.appspot.com
  lxpzwgxqlwaxzofw-dot-millinium.ey.r.appspot.com
-lxsurromhttwamcmvcxeaweeuc-dot-gl9393jan.uk.r.appspot.com
  lxsz.duckdns.org
  lxvbiamsrweaejnp-dot-millinium.ey.r.appspot.com
  lxvkvviftycljkwjczvhkfvwqickikhqdtva-dot-offglen.uk.r.appspot.com
@@ -202765,7 +201799,6 @@ lzurfwdtruotpunq-dot-millinium.ey.r.appspot.com
  lzvqsazzmrgdfhev-dot-millinium.ey.r.appspot.com
  lzvzs.codesandbox.io
  lzwqhxptbziano.serveirc.com
-lzwqwtjwuloqwwlnilpfvkkvaz-dot-gl9393jan.uk.r.appspot.com
  lzxkvwzjatfvzfom-dot-millinium.ey.r.appspot.com
  lzxlmy.com
  lzxsw100.com
@@ -203131,7 +202164,6 @@ m.facebook.com.fbtltl.com
  m.facebook.com.fbxdfkjh.com
  m.facebook.com.fisioleste.com.br
  m.facebook.com.fsbhstats.com
-m.facebook.com.jessbotq.com
  m.facebook.com.jessicaanderson.live
  m.facebook.com.jessicalesters.com
  m.facebook.com.jessicassmith.com
@@ -203274,7 +202306,6 @@ m.geniushomes.in
  m.genovesevanderhoof.com
  m.ginosofportwashington.com
  m.gmailmx.com.qdmai.xyz
-m.gpt55.com
  m.gucac.com
  m.ham9222.com
  m.haojiedq.com
@@ -203293,12 +202324,12 @@ m.hf278.com
  m.hf295.com
  m.hf298.com
  m.hf301.com
-m.hf305.com
  m.hf331.com
  m.hf356.com
  m.hf378.com
  m.hf387.com
  m.hf392.com
+m.hf502.com
  m.hf503.com
  m.hf505.com
  m.hf587.com
@@ -203344,6 +202375,7 @@ m.kvl3963.com
  m.kvm9723.com
  m.lkm8995.com
  m.lkp2333.com
+m.lkq8599.com
  m.lks2983.com
  m.lmax-china.xyz
  m.login.facebook.com.khayamandi.co.za
@@ -203437,7 +202469,6 @@ m0h.net
  m0hf.mentriqq.com
  m0nanza843.xyz
  m0pedx9.ru
-m0qx0.app.link
  m0rn2g9j.firebaseapp.com
  m0rx1.nicedayjp.com
  m0s3b.mentriqq.com
@@ -204123,7 +203154,6 @@ magsafe-apple.com
  magseal.com
  magungappsstore.manximanzsu.com
  magusenergia.com.br
-magwstfxbltxjtrttkdhopajba-dot-gl9393jan.uk.r.appspot.com
  magzsummary.ga
  mah0ney.com
  maha.co.il
@@ -204283,7 +203313,6 @@ mail.aggiornamento-dati-utenza-web.com
  mail.agricareseeds.com
  mail.ahcindia.com
  mail.airsoftguns.sk
-mail.ajericoff.bluehoststaff.com
  mail.alerts-americanexpress.com
  mail.alferesbh.com.br
  mail.aliton.ru
@@ -204325,7 +203354,6 @@ mail.ayojoin.whatsapp-100266.tk
  mail.bangkokbankltd.net
  mail.bank-info-verify.com
  mail.bankingloginersystem.com
-mail.bankprotectionuk.com
  mail.bapakkau-kali555.asli20.com
  mail.barmaestros.com
  mail.bbglowfrance.fr
@@ -204682,14 +203710,13 @@ mail.mlbbskineventpromo07.webredirect.org
  mail.mlbbskineventpromo14.webredirect.org
  mail.mlbbskineventpromo18.webredirect.org
  mail.mobielupdate-mijning.top
+mail.mobilebnksecure.com
  mail.mrdizi.com.au
  mail.msnllc.com
  mail.mxonline23.com
  mail.my-appleid.in
  mail.mydevice-authorisation.com
  mail.myee-billing-verify.com
-mail.myee-updateinfo-billing.com
-mail.myo2-billing-error28.com
  mail.myo2-billing-error83.com
  mail.mypayee-cancel.com
  mail.mypayee-login.com
@@ -204937,6 +203964,7 @@ mail.user-id9140.com
  mail.user-portal-secure.com
  mail.users-app.services
  mail.valetparkingschiphol.com
+mail.validatepayees.com
  mail.verification-auth-update.com
  mail.verification-netflix-accounts-com.giize.com
  mail.verifications-blockir.tk
@@ -205003,7 +204031,6 @@ mail.whatsappsex.69.ocry.com
  mail.whatshaapjoingrupnew.freeseason.asia
  mail.wildepedique.nl
  mail.willowspringspackaging.com.au
-mail.wintools.com.cn
  mail.wire-mesh-fence.net
  mail.workplacesanitation.com
  mail.wpmarketing.alumnostrazos.com
@@ -205052,7 +204079,6 @@ mail11928.xyz
  mail138995.buzz
  mail14a-cox.webcindario.com
  mail163inboxlogin.dumb1.com
-mail2.royal-eng.ps
  mail23918.icu
  mail28282.icu
  mail28827.icu
@@ -205117,7 +204143,6 @@ mailbox31update.xxuz.com
  mailboxclient80979.uc.r.appspot.com
  mailboxflixsupp.com
  mailboxportal21063.uc.r.appspot.com
-mailboxsecureboitevocaleauth.webador.com
  mailboxverification.network
  mailbroadbandservice.us
  mailbroject83584.uc.r.appspot.com
@@ -205167,7 +204192,6 @@ maillssuio.cam
  mailmarketingworlddoc.live
  mailmarketingworldmax.info
  mailmatt.weebly.com
-mailmboya.eu-gb.cf.appdomain.cloud
  mailmejoresvendedores.com.ar
  mailms.yolasite.com
  mailmustang.com
@@ -205480,7 +204504,6 @@ mal-42574997.itugolhelp.com
  mal-62116981.itugolhelp.com
  mala-riba.com
  malachite-rural-gander.glitch.me
-malachyobodo.000webhostapp.com
  malagaminibus.com
  malaisewheelchairfitness.com
  malajsie.webzdarma.cz
@@ -205826,6 +204849,7 @@ manage.locked.service.11verfctiontlsappsecjfklapx.com
  manage.lwrsawa.com
  manage.microsoft.com.office.o365-prod-demo.mvccasbdemo.myshn.net
  manage.microsoft.com.office.o365v4.nripoc.myshn.net
+manage.morissalakante.com
  manage.purchase.appstore.com.jgntempix.com
  manage.purchase.myappleid.fhfdghfdgh.com
  manage.recovery-id.cloudrestricted-tct.com
@@ -206039,7 +205063,6 @@ maneger-amazonsecureteam999847234434.gleeze.com
  manegers-amazonsecurecodeplay88897544521.gleeze.com
  manejfsztgsmatio-dot-millinium.ey.r.appspot.com
  manerck.com
-maneuverable-freeze.000webhostapp.com
  manextrapro.buzz
  manferesquadrias.com.br
  manfith.com
@@ -206057,7 +205080,6 @@ mangasaurgames.com
  mangateon.com
  mange-gode-blogs.dk
  mange.google.com.brunocpa.com
-mangeractivityalerthomeconnectmailsuppertygugugu.000webhostapp.com
  mangero.xyz
  mangiamoresto.com
  mangiest-son.000webhostapp.com
@@ -206178,7 +205200,6 @@ mantepsayang.000webhostapp.com
  manthosmountain.com
  mantini.duckdns.org
  mantis.co.ug
-mantlesecurity.com
  mantneer.com
  mantoloking.info
  mantoolmanufacturing-my.sharepoint.com
@@ -206208,7 +205229,6 @@ manuscript.ge
  manutencaodigital-app.com
  manutencaoitauchecks.com
  manutenzione-anagrafica.com
-manutenzione-web-conto.com
  manutouchmassage.com
  manuyala.com
  manxen.com
@@ -206220,7 +205240,6 @@ manygoats.fun
  manymanycrotahiahi.000webhostapp.com
  manzana-gray-smith-burlon.vercel.app
  maoazmn.cc
-maoism-torque.000webhostapp.com
  maokaicom.batwoqisellers.top
  maolixin.com
  maoljovlbghjdftx-dot-millinium.ey.r.appspot.com
@@ -206509,8 +205528,6 @@ markedtree.buzz
  markeettit.email
  markelbroch.com
  markelliotson.com
-markeplace-item-7547.realestate-post.com
-markeplace-post-22811.carnivalguide.co
  markeplacesaleitem78856245646589.com
  markeplacesaleitem8563667845.com
  markerplace34f232u23.com
@@ -206803,7 +205820,6 @@ marketplace-item-458659.com
  marketplace-item-47362462.com
  marketplace-item-4754762.com
  marketplace-item-485738.com
-marketplace-item-523121.cndigisol.com
  marketplace-item-5473621.com
  marketplace-item-5676523.com
  marketplace-item-5745874.com
@@ -207393,6 +206409,7 @@ martinsburg.buzz
  martinsmodels.com.ar
  martinstec.be
  martinus.privatezone.net
+martinvales.net
  martlight.com
  martuis-frdstyds.com
  marturiinuntabotez.ro
@@ -207713,7 +206730,6 @@ matongjia.com
  matorolamagalu.myvnc.com
  matphilip.com
  matque.com
-matrialupweapon.com
  matrin.com.au
  matriskurs.com
  matrix-partners.theworkpc.com
@@ -208019,8 +207035,6 @@ mblgypesrbawtezk-dot-millinium.ey.r.appspot.com
  mbmaquila.com.py
  mbmarquitectos.com.pe
  mbmfirepyn.top
-mbmicc.org
-mbmywaaukbwswcqofhsoicycxb-dot-gl9393jan.uk.r.appspot.com
  mbnbowwjnjfqssso-dot-millinium.ey.r.appspot.com
  mbnd.svcoding.com
  mbniorhdmsnqsxsilvydcywvbp-dot-gleowayel400503.uc.r.appspot.com
@@ -208184,7 +207198,6 @@ mddesqifmbhiffbm-dot-millinium.ey.r.appspot.com
  mdeaankrdtpxeiuzmjmwidisnu-dot-gleowayel400503.uc.r.appspot.com
  mdeletro.com.br
  mdevents.in
-mdfltlpayoakatqpsvxubdggba-dot-gl9393jan.uk.r.appspot.com
  mdgopbpyqwqrlnmaoxknhsotwj-dot-gleowayel400503.uc.r.appspot.com
  mdgphotos.com
  mdgretailer.com
@@ -208213,9 +207226,9 @@ mdnnqobxotabbyyjvdsmdmqdov-dot-gleowayel400503.uc.r.appspot.com
  mdnvbberiu.gb.net
  mdp.mg
  mdp11.000webhostapp.com
+mdpofcpfsusdjnzxdocvtpaomt-dot-gleow2021ja.ue.r.appspot.com
  mdprobuilders.com
  mdqassessing.co.za
-mdqsrcpfcmpzcnvctyydnzmvso-dot-gl9393jan.uk.r.appspot.com
  mdqylnxapiqlawdwrcwozvjcmtpxxhpzdfmx-dot-cryptic-now-290917.ey.r.appspot.com
  mdrcqa.shoesmogul.com
  mdrealtor.in
@@ -208795,7 +207808,6 @@ membranced.xyz
  membrunescape-bonds.com
  memdrops.com
  memeklaudha.takonjebol.com
-memeklia.000webhostapp.com
  memekmerah.000webhostapp.com
  memeksienakskalicok.linkthroughapple.com
  memeofalbanians.000webhostapp.com
@@ -209275,7 +208287,6 @@ meu-itaunet4-sempre-com-voce-nesse-momento.000webhostapp.com
  meu-porta-net1-itauweb3-portal-a-p-p-net.000webhostapp.com
  meu2-portal-facil-itaunet-web3.000webhostapp.com
  meuacesso-app.com
-meuacessodigital-app.com
  meuandnv.goruli.com
  meuauxilio.com
  meubbfacesage.ga
@@ -209410,7 +208421,6 @@ mfingers.com
  mfj222.co.za
  mfjfhfjfkghgfgfhf.weebly.com
  mfkj02.top
-mfkjkrezutqhmycwjngjilqpne-dot-gl9393jan.uk.r.appspot.com
  mflogistics-my.com
  mflswbfbidjdsjby-dot-millinium.ey.r.appspot.com
  mfm-ca.com
@@ -209498,7 +208508,6 @@ mgv-unterschoenmattenwag.eu
  mgvpbqhyesfdeuzwbtrwuuixrf-dot-gleowayel400503.uc.r.appspot.com
  mgvrqweeaatisdu.top
  mgxoqtgncbdphpqn-dot-millinium.ey.r.appspot.com
-mgxxwkevsknbmafzgvrnpyrldd-dot-gl9393jan.uk.r.appspot.com
  mgy.yiq.me
  mgyuefgzoxeqwawb-dot-millinium.ey.r.appspot.com
  mgzfdkeiovwyeoqd-dot-millinium.ey.r.appspot.com
@@ -209539,7 +208548,6 @@ mhmwypnighdwotsj-dot-millinium.ey.r.appspot.com
  mhncms.com
  mhni.xyz
  mhnrw.com
-mhobeyrcgvmlkfwhsmpmuhntnn-dot-gl9393jan.uk.r.appspot.com
  mhodols-dhoangksh13.3utilities.com
  mhomemklocosseer.com
  mhoptions.com
@@ -209798,7 +208806,6 @@ microsoft-store.sytes.net
  microsoft-trojan-warning.cf
  microsoft-verify.ddns.net
  microsoft-word.duckdns.org
-microsoft.licensing-servicecenter.com
  microsoft.loginoauth2.com
  microsoft.office365.outlook.owa.tradestarexports.com
  microsoft.officedocuments.me
@@ -209810,7 +208817,6 @@ microsoft365faxxx.weebly.com
  microsoft365voicemails.weebly.com
  microsoft47.yolasite.com
  microsoftaccountsecurityportal.wl.r.appspot.com
-microsoftadminhelpdesk.000webhostapp.com
  microsoftbillingsys.com
  microsoftcenter.co
  microsoftcloud.yolasite.com
@@ -210525,7 +209531,6 @@ miseguro10.com
  misejouraccount.com
  misewanadoo.weebly.com
  misformed-research.000webhostapp.com
-misha-now.today
  mishaks.cam
  misharialafasy.net
  mishhyyu.cam
@@ -210591,7 +209596,6 @@ mistcinemas.com
  mistercertified.net
  misterix.duckdns.org
  mistermiragerecordings.com
-misterpearl.com
  misterpi.at
  mistikmarket.com
  mistimbas.com
@@ -210793,7 +209797,6 @@ mkenlee250.000webhostapp.com
  mkfaoieplu.topkorder.su
  mkfiuozihphfigjt-dot-millinium.ey.r.appspot.com
  mkfpaxpfku.duckdns.org
-mkfxcnngkvnnjuwwwsewyujaqo-dot-gl9393jan.uk.r.appspot.com
  mkgbcsnacazextsohyjfjqyaugzgfwxxtztv-dot-solar-vertex-285913.rj.r.appspot.com
  mkgsqmplyh.duckdns.org
  mkhi.stxbamt.cn
@@ -211033,7 +210036,6 @@ mmnaggtstg.duckdns.org
  mmnresort.com
  mmnrsmrdyuycdxko-dot-millinium.ey.r.appspot.com
  mmnskehnbbbs.in
-mmnwbcnvzqrudelexvqgmfggho-dot-gl9393jan.uk.r.appspot.com
  mmo.martinpollock.co.uk
  mmobillbahis233.com
  mmobilleitaucardonline.com
@@ -211385,7 +210387,6 @@ mobile.ifacebock.com
  mobile.lnstagram.com.toufikk.com
  mobile.mfrga3inlakmok.com
  mobile.sccom.cn
-mobile.virgin-bill.com
  mobile.virginmedia-ecare.com
  mobile.virginmedia.auth-v.com
  mobile.wellsfargo.com-account.verif.singinwfs.xyz
@@ -211456,7 +210457,6 @@ mobileapp-security.com
  mobileapp.help
  mobileapplicationdevelopment.co.uk
  mobileappupdatehalifaonlinesecure.app
-mobileat-fb-item279809010.com
  mobileatualizacao.com
  mobileauth.co
  mobileauto-services.co.uk
@@ -211498,6 +210498,7 @@ mobilefinanceiro.com
  mobilehelpcenter.com
  mobilehousepiky.com
  mobilehsbcuk-verify.com
+mobilelegend-m2.ml
  mobilelegend.1stwinner.asia
  mobilelegend.getsevents.asia
  mobilelegend.prizes14.com
@@ -211546,6 +210547,7 @@ mobileora.yolasite.com
  mobilepayee-help.com
  mobilepayeeholdverify.com
  mobilepresentepravoce.com
+mobileprevent-signin.com
  mobilepro-tm.online
  mobilepromoc-ef.info
  mobileprosweden.com
@@ -211560,6 +210562,7 @@ mobileservice04.mobi
  mobileserviceonline.serveirc.com
  mobileshelving.com
  mobileslocator.info
+mobilesuperstacks.josealbertoal21.repl.co
  mobilesuporte.com
  mobiletech.net
  mobilethemesnlivewallpaper.com
@@ -211684,7 +210687,6 @@ modernofficedecor.com
  modernrattan.com
  modernsfoodproducts.com
  modeschmuckankaufcom.chifanassume.top
-modest-colden-5017d6.netlify.app
  modest-murdock-a959b2.netlify.app
  modest-yonath-531225.netlify.app
  modestclouds.eu
@@ -212150,7 +211152,6 @@ mooha.002.sh.cn
  mooithailand.nl
  moolchi.com
  moon-giveaways.gq
-moon-light-oasis.net
  moon-oreoo-92.com
  moon.leasevps.com
  moonactive2k.ml
@@ -212201,7 +211202,6 @@ moqsocial.com
  moquite.ga
  moradikermani.oilyplus.ir
  moragphotography.co.uk
-moral-crown.000webhostapp.com
  moraniz.co.il
  morasergiox.ac.ug
  moratdss.spiekermann-porzellan2.de
@@ -212583,16 +211583,13 @@ mpmlco.com
  mpmyejy3.firebaseapp.com
  mpn.org.in
  mpnamnbbxeymlkzc-dot-millinium.ey.r.appspot.com
-mpnnsjoigqexfgyhusvlbzvdmk-dot-gl9393jan.uk.r.appspot.com
  mpnutaxcsdbbnaavzt.top
-mpomxsgmycvkdlzhtettpqefvq-dot-gl9393jan.uk.r.appspot.com
  mpoodsine.com
  mpounta-donuts.gr
  mppaccche.com
  mpparagon.com
  mppowerservices.com
  mpress.com.br
-mprhnkmqgwkijlfhwwjgbrmdgm-dot-gl9393jan.uk.r.appspot.com
  mps-attiva-sicurezza.000webhostapp.com
  mps-gruppo.com
  mps-italy-cartetitolari.ssl443.org
@@ -212797,9 +211794,6 @@ msdjkhjcv.ug
  msdos1.com
  msdpharmaceuticals.com
  msdtcupdate.com
-msdwt-k12-in-us-authadobe-doc.ml
-msdwt-k12-in-us-authadobe-doc.tk
-msdwt-k12-in-us-naj.gq
  msecure03c-csupport.serveirc.com
  msecurity.ro
  msenterpriseverifysecure.glitch.me
@@ -213106,7 +212100,6 @@ muezoogubyqamofr-dot-millinium.ey.r.appspot.com
  muffdiver.za.net
  mufg-ac.com
  mufg-ad.com
-mufg-jp.cc
  mufg.iggplus.com
  mufg.jp-bankq.com
  mufg.kay56.com
@@ -213491,10 +212484,10 @@ mwebp11.plala.or.jp.qatartraining.com
  mwedesignwfi.ru
  mwen.com
  mwenhbpdhmwiczalbmuwmyzqnyyrnenxpyhl-dot-cryptic-now-290917.ey.r.appspot.com
+mwfbb.ctiaspire.com
  mwfvrqhphpwwgzwi-dot-millinium.ey.r.appspot.com
  mwgjmcuohzvhhyrt-dot-millinium.ey.r.appspot.com
  mwgjqtmbaetmcctrkd.top
-mwgzeowxooexksnjqhmzqwenxi-dot-gl9393jan.uk.r.appspot.com
  mwhdprbqpiarhgbwnoavtjjdlgrjmoowftya-dot-cedar-code-289917.nn.r.appspot.com
  mwhite.ru
  mwjhb.dilshantg.com
@@ -213512,7 +212505,6 @@ mwrc.ca
  mwreyejbbjsqetsgcj.top
  mwvauhexxqvevbxuat.top
  mwvbxtrlhfabonto-dot-millinium.ey.r.appspot.com
-mwvsbhvfniyxjrpilmbbvifrxh-dot-gl9393jan.uk.r.appspot.com
  mwww.ecure.runescape.com-xu.top
  mwxbuptyzasqfpowklhlkvriotpjewxxszzj-dot-glxcel49934343434.rj.r.appspot.com
  mwyxoeenttpailsd-dot-millinium.ey.r.appspot.com
@@ -213639,6 +212631,7 @@ my-ee-webhelp.000webhostapp.com
  my-ee.com
  my-ee.org
  my-eeaccount.com
+my-eebilling-service.self-assesment-service.link
  my-emsdeliver.ownip.net
  my-faccbook-page-24.000webhostapp.com
  my-faccbook-page-26.000webhostapp.com
@@ -213683,7 +212676,6 @@ my-metanet-12030290-login-account.amministrazioniguglielmin.com
  my-metanet-ch-1074b887.reverse-systems.com
  my-metanet-ch-382e3661.reverse-systems.com
  my-metanet-jgun9e66-account.hotelunalido.it
-my-monthly-payment.com
  my-nab.app
  my-new-payees-cancel.com
  my-newpayments.com
@@ -213708,6 +212700,7 @@ my-payees.org
  my-paypal-verification.com
  my-paypal.asia
  my-pending-debate.com
+my-piano.ctiaspire.com
  my-platinum-service.info
  my-platinum-wallet.su
  my-pp-unusal-activity.com
@@ -213748,7 +212741,6 @@ my-threenumber.com
  my-threeupdate.link
  my-transactions.com
  my-ts3-cubic-login.bocadelmarcarpetcleaning.com
-my-unicredlt.com
  my-unionbankph.com
  my-userpaypal.serveirc.com
  my-vehicle-tax-refund.com
@@ -213782,6 +212774,7 @@ my.commbank.com.au.australia.code.netbank.confirm.laxmiagroco.com
  my.commbank.com.au.australia.netcode.confirmation.shailungpower.com
  my.commbank.com.au.netcode.account.netbank.code.nichesitesecrets.com
  my.commbank.com.au.netcode.accounts.netbank.code.consciousholisticliving.com
+my.ctiaspire.com
  my.cyon.ch.editinglibri.it
  my.dundee1.unee.me
  my.ee-billingfailed.com
@@ -213875,7 +212868,6 @@ my3-billing-check.com
  my3-billing-id226.net
  my3-billing-issue.com
  my3-billing-issue.online
-my3-billing.uk
  my3-billing238.com
  my3-billingerroruk.xyz
  my3-billinghelp.com
@@ -213996,6 +212988,7 @@ my3.verify-billing.org
  my3.verify-path.com
  my3.verify-payment.org
  my3account-id234556.com
+my3account-update.com
  my3account.net
  my3accountupdate.com
  my3alerts-accountbilling.com
@@ -214199,7 +213192,6 @@ myattmailcenter.weebly.com
  myattmailupdate-newmaillookinterface.weebly.com
  myattmyhomepaehddh.weebly.com
  myattnlf.com
-myattnow.weebly.com
  myattonlineservices.weebly.com
  myattonlineverification.weebly.com
  myattonlinverificationcenter.weebly.com
@@ -214391,7 +213383,6 @@ myee-id.co.uk
  myee-info.co.uk
  myee-infosup-port.com
  myee-infoupdate.com
-myee-manage-billing.com
  myee-mobile.com
  myee-online.com
  myee-onlineverify.com
@@ -214460,7 +213451,6 @@ myeebillingupdate.com
  myeebills.billingsuk-ee.net
  myeebillupdate.com
  myeehelp.000webhostapp.com
-myeeonline-account.com
  myeeonline.cc
  myeeonlinelogin.com
  myeeprotect.com
@@ -214568,6 +213558,7 @@ mygridironstuff.com
  mygroke.com
  mygroupwhatsapsexy.mrslove.com
  mygrowseeds.com
+myguitar1.ctiaspire.com
  myguru.us
  mygwyl.shop
  myh-la.com
@@ -214596,6 +213587,7 @@ myhost228228.ddns.net
  myhostcloud.com
  myhostedrat.ddns.net
  myhostest.ug
+myhotsexygrupwhatsapp.wikaba.com
  myhr.accesshub.work
  myhtwxvdagtzbsgkhu.top
  myhub-verifyeeonline.com
@@ -214612,7 +213604,6 @@ myinfo741.cf
  myinfoart.online
  myinfobill-ee.co.uk
  myinfoee-secure.com
-myinfoo721.tk
  myinformatonalityu.club
  myinformatonalityu.win
  mying-login.com
@@ -215140,6 +214131,7 @@ myvoicelinkedinapp.com
  mywasta.com
  mywayeg.info
  myweb-update.dynamic-dns.net
+myweb.ctiaspire.com
  mywebarticle.com
  mywebcoupon.com
  mywebnerd.com
@@ -215155,7 +214147,7 @@ mywifestore.liputan06x.com
  mywonderfulpregnancy.com
  mywoods.by
  mywordes.com
-myworkingthing.fofohot169-ewtwegwe-gawegwetwer-gwetwaet.workers.dev
+myworkingthing.t7193i-caqw-vqb-beb9-acgeq.workers.dev
  myworldatt.weebly.com
  mywp.asia
  mywuh.xyz
@@ -215181,7 +214173,6 @@ mzcynaih.shoesmogul.com
  mzd.dermals.org
  mzdb.gulfhirings.com
  mzdbselbxnwxaqqyuccwmrghfb-dot-gloff849483.uk.r.appspot.com
-mzdulxcllhbuxfmstuopsuztmh-dot-gl9393jan.uk.r.appspot.com
  mzet.svcoding.com
  mzh86.saytanet.com
  mzhgtsas.ml
@@ -215434,7 +214425,6 @@ nabagejec1893.blogspot.com
  nabagejec1893.blogspot.sg
  nabali.ps
  nabaud.com
-nabaus.online
  nabaustralialogin.com
  nabbesglass.com
  nabecases.live
@@ -215601,7 +214591,6 @@ nakedlove.co.uk
  nakhonsawangames.com
  nakitrade.com
  nakrutkavk.live
-nakrytkains1.000webhostapp.com
  nakshadekho.com
  nakupenda.ml
  nakupnikartarka.cz
@@ -215777,7 +214766,6 @@ nascar-info.net
  nascentayur.com
  nasekaxtjrldmyxerhrrjblaytcefhwqybxi-dot-glegen303939423233.ue.r.appspot.com
  nashauiuii.cam
-nashc.net
  nashikehayuomu.xyz
  nashikproperty.tk
  nashobmenfiles.com
@@ -215820,7 +214808,6 @@ naszpolskiswiat.icu
  naszpolskiswiat.site
  naszpolskiswiat.xyz
  nat-auth.net
-nat-west-payment.com
  nat-west-securemyaccount.xyz
  nat.west-secnotice.com
  natalconsorcio.com.br
@@ -216249,6 +215236,7 @@ nbs0.mentriqq.com
  nbsghana.org
  nbsgs.xyz
  nbshe.top
+nbsmylwocrvwfvbbecgwpcgfoq-dot-gleow2021ja.ue.r.appspot.com
  nbstm.com
  nbtluikmmsqbqmyd-dot-millinium.ey.r.appspot.com
  nbtreeservice.com
@@ -216305,7 +215293,6 @@ ncid.bc.ca
  nciwc.us
  ncj.shoesmogul.com
  ncjaqbmpjzbdxtuj-dot-millinium.ey.r.appspot.com
-ncjrdqtnqyglawcjcbqwktfxzx-dot-gl9393jan.uk.r.appspot.com
  ncjxmgemhraxvpdt-dot-millinium.ey.r.appspot.com
  nckeajgpwzbfpjvxfpcsqmcqawcv.top
  nckfle0095275raydl0394832020.nn.r.appspot.com
@@ -216403,7 +215390,6 @@ ndronhqhiwalmbth-dot-millinium.ey.r.appspot.com
  ndrs.cloud
  ndsaert768.cloudaccess.host
  ndsfeo.com
-ndsmodecmjnwdahqnliwlgnhiu-dot-gl9393jan.uk.r.appspot.com
  ndt-college.kz
  ndtgt.in
  ndtpwbjayljgwxnbrbezfmgukvfpgiixraqg-dot-offgl8876899977678.uk.r.appspot.com
@@ -216681,7 +215667,6 @@ nerve.com.pl
  nerverenew.buzz
  nervosanguineous.xyz
  nervous-kilby-bf83ba.netlify.app
-nervous-kirch-92ee6e.netlify.app
  nervous-payne-346c04.netlify.app
  nervousdeserve.com
  nervouslydarg.com
@@ -216736,6 +215721,7 @@ net3-renew21.com
  net4um.com
  net4work0999.info
  net6jsolvfix45.com
+netadapt.casa
  netadapterupdate.r1-de.storage.arubacloud.de
  netal10gbkampanyanet.com
  netanswerplu-saisoncard.me
@@ -216939,7 +215925,6 @@ netflix-paymentplan.com
  netflix-paymentrenew.com
  netflix-paymentreview.com
  netflix-paysupport.serveirc.com
-netflix-payuk.com
  netflix-pe.com
  netflix-peru-oferts.com
  netflix-planrenew.com
@@ -216977,7 +215962,6 @@ netflix-securepage.com
  netflix-securesubscription.com
  netflix-secureverify.com
  netflix-security-help.com
-netflix-security.fr.web78bf8aeee87a.my-phsite.com
  netflix-securlty.com
  netflix-service-uk.com
  netflix-service.club
@@ -217200,7 +216184,6 @@ netflixsoportes.com
  netflixsr.com
  netflixsu.com
  netflixsubscribersbillingissues.com
-netflixsupport.fr
  netflixsupport.info
  netflixsupport.serveirc.com
  netflixsupportgroup.me
@@ -217409,7 +216392,6 @@ neurotransmitter.xyz
  neurotropic-dips.000webhostapp.com
  neuschelectrical.co.za
  neusoftware.com
-neuswrjfpegancqrbodykxgqyt-dot-gl9393jan.uk.r.appspot.com
  neutralsources.com
  neutrondad.com
  neutrum.pl
@@ -217443,20 +216425,19 @@ new-attempted-login.link
  new-center-fargo.work
  new-coronavirusmask.com
  new-credit.space
-new-dataregistration-hali.co.uk
  new-deregistered-device.com
  new-device-activity.link
  new-device-added.live
  new-device-authentication.com
  new-device-authenticator.com
  new-device-authorisation.com
-new-device-cancel.com
  new-device-login.com
  new-device-login.link
  new-device-secure.com
  new-device-unsecure.com
  new-device-unusual.link
  new-devicealert.com
+new-devices-alert.com
  new-eebill.com
  new-evenst-pubg-royalepas13.000webhostapp.com
  new-facebook.de
@@ -217494,6 +216475,7 @@ new-payee-alerts.com
  new-payee-authorisation.com
  new-payee-decline.com
  new-payee-device.com
+new-payee-devices-confirmation.com
  new-payee-nwolb.com
  new-payee-online.com
  new-payee-online.ltd
@@ -217509,6 +216491,7 @@ new-recipient-online.cc
  new-rfp-group.com
  new-secure-device.com
  new-secure-login.link
+new-secured-hali.com
  new-sig-in-fb.zi13.tk
  new-sig-in.ga
  new-sig-in.ml
@@ -218080,7 +217063,6 @@ newupdate-alldomain.web.app
  newupdateappleid-apple.loseyourip.com
  newupdatelinksmoreyes.calcivicenginee.net
  newupdatemy3info.com
-newupdiatethroo1.000webhostapp.com
  newuploadswift.pw
  newupvaledateng.000webhostapp.com
  newuvolume2.com
@@ -218200,7 +217182,6 @@ nfis.com
  nfisq.ithd-flixconto.shop
  nfkyyohziitbhkxq-dot-millinium.ey.r.appspot.com
  nflby.com
-nflfkniinbnkrtiqkeidxuyudu-dot-gl9393jan.uk.r.appspot.com
  nflix-billing.com
  nflix-mybillinfo.com
  nflix-verify-billing.com
@@ -218220,7 +217201,6 @@ nfsi.biogenicherb.com
  nfsports.biz
  nftlixsupps-019.myvnc.com
  nfvohxudnjzndenomxwkqqwzdk-dot-gleowayel400503.uc.r.appspot.com
-nfvqgeemzjwaymqhjzacruixyp-dot-gl9393jan.uk.r.appspot.com
  nfvztcrrkjejagup-dot-millinium.ey.r.appspot.com
  nfx-mgmteam.com
  nfx1-acc647.info
@@ -218272,7 +217252,6 @@ ngeweenak.sorehtrss.com
  ngeweyuk.join-wa.net
  ngezen.com
  ngfczzapsgntvrppdv.top
-ngflqmzcfvolbxtgybxxewrthc-dot-gl9393jan.uk.r.appspot.com
  ngfomwrnlewurgfw-dot-millinium.ey.r.appspot.com
  nggkfdxtfpdejzilwivrzrqsprnxawoavkdi-dot-solar-vertex-285913.rj.r.appspot.com
  nggt6c22.firebaseapp.com
@@ -218290,7 +217269,6 @@ ngiveu.com
  ngjwknphozmloqyndcgaiammcc-dot-gleowayel400503.uc.r.appspot.com
  ngkidshop.com
  ngm.svcoding.com
-ngmnvedqiyzvmjayibqyshoslr-dot-gl9393jan.uk.r.appspot.com
  ngmpbzgvcptegqhean.top
  ngnbxtffafkastde.top
  ngndff.com
@@ -218362,6 +217340,7 @@ nhadatquan2.xyz
  nhadatthienthoi.com
  nhahangdaihung.com
  nhakhoahiromi.com
+nhakhoathammydanang.com.vn
  nhakhoavieta.com
  nhanqua-pubgm.com
  nhanquaff2020.top
@@ -218407,7 +217386,6 @@ nhlan.com
  nhlbqkbsrkzihlzv-dot-millinium.ey.r.appspot.com
  nhlnk.com
  nhms.solutions
-nhnlucpwtfhehxmcwcsxmsjbda-dot-gl9393jan.uk.r.appspot.com
  nhoanjrfjymrengp-dot-millinium.ey.r.appspot.com
  nhomkinhlongxuyen.com
  nhomtoan.net
@@ -218575,7 +217553,6 @@ nieuwe-betaalpas.nl162.ir
  nieuwe-ing-pas.online
  nieuweberichten.info
  nieuwste-info.nl
-nieuwtjeswebonline.eu
  nieversefa.com
  niewiarygodnie-zdarzenia.xyz
  niezezlepouldn.com
@@ -218691,6 +217668,7 @@ nimbasia.com
  nimble.press
  nimbleclass166.com
  nimbledesign.miami
+nimblegivingcase.sfsfffff.repl.co
  nimblemachines.beta.webenza.in
  nimbleoffice.org
  nimblescarceadware--five-nine.repl.co
@@ -218739,7 +217717,6 @@ ninnyhammersupinator.com
  ninoeggplante.com
  ninovaeczadeposu.com.tr
  ninratzesqewsggn-dot-millinium.ey.r.appspot.com
-niobean-drill.000webhostapp.com
  niobic-roars.000webhostapp.com
  nionmatoms.net
  niophologtimale.tk
@@ -218821,7 +217798,6 @@ nivhvtfnvu.duckdns.org
  nivis.gr
  nivnpwpgrrwzavrxrwgfulndin-dot-gloff849483.uk.r.appspot.com
  niwa.oconavi.com
-niwrekrsdqqkbbowtrrjonsffk-dot-gl9393jan.uk.r.appspot.com
  nix4e.com
  nixamorealestateagent.com
  nixkbeyaxfvnlkwh-dot-millinium.ey.r.appspot.com
@@ -218908,7 +217884,6 @@ nkap.global
  nkausyrsbnmxaqfb-dot-millinium.ey.r.appspot.com
  nkax.svcoding.com
  nkbanks.com
-nkbkfjkelhsczkmxphlfyhajtq-dot-gl9393jan.uk.r.appspot.com
  nkcceuin2udd.talagaremix.com
  nkcoupon.com
  nkdctrust.in
@@ -219049,7 +218024,6 @@ nmdservices.com
  nmediiehwhzvxcqrkvgupjtqjhzonapeaeoq-dot-glxcel49934343434.rj.r.appspot.com
  nmetqrubkuxhgucpowcwcuwwpd-dot-gleowayel400503.uc.r.appspot.com
  nmfggt.com
-nmgfhqpisuethlpdqntowtqkyy-dot-gl9393jan.uk.r.appspot.com
  nmhsu.xyz
  nmiec.com
  nmjvcvtgptltppul-dot-millinium.ey.r.appspot.com
@@ -219070,7 +218044,6 @@ nmplluc.cn
  nmpp.com.ua
  nmqvzsx.cn
  nmqxs.goruli.com
-nmrgadhenozgufibxvacmcbwne-dot-gl9393jan.uk.r.appspot.com
  nmsin292o4k3ju2yvkap7p.creativetutors.com
  nmsoia.duckdns.org
  nmsuh.xyz
@@ -219115,6 +218088,7 @@ nnilll9998.000webhostapp.com
  nniyjslmfgurfbly-dot-millinium.ey.r.appspot.com
  nnj.addroits.com
  nnjastudio.com
+nnjuezeldipjqkevtjpqwdmjly-dot-gleow2021ja.ue.r.appspot.com
  nnklykwtsdafattiogqvpxvkwckcdyqajvwh-dot-cryptic-now-290917.ey.r.appspot.com
  nnkqtvwjbpajpdfk-dot-millinium.ey.r.appspot.com
  nnkxhpgmvzmjzeiydfwtrao.top
@@ -219266,6 +218240,7 @@ nocontent-sqqkmkyw.velocityhub.com
  nocontent-sxoxffei.velocityhub.com
  nocontent-syrxvomx.velocityhub.com
  nocontent-tnxsqiil.velocityhub.com
+nocontent-tyvnrwno.velocityhub.com
  nocontent-uibuwpss.velocityhub.com
  nocontent-upjhiolu.velocityhub.com
  nocontent-uvkquxnm.velocityhub.com
@@ -219504,7 +218479,6 @@ noonasimo.cloudaccess.host
  noonbir.com
  noonle.xyz
  nooo11.ddns.net
-noops-stil.web.app
  noor.me.ke
  nooragifts.com
  noorrik.com
@@ -219588,13 +218562,11 @@ norbellahair.com
  norbert23323.xyz
  norbert2545467.com
  norbertwaszak.pl
-norbetodaywestartthishustleqwemustmakeambadman.s3.us-east-2.amazonaws.com
  norbikurier.org
  norcaltc-my.sharepoint.com
  nord.novalex.co
  nordebk.com
  nordeclairwbe.ru
-nordenlifescience.com
  nordenlifesciences.com
  nordesteirrigacao.com
  nordestmedical.ro
@@ -219631,7 +218603,6 @@ noreplypaypalus.serveirc.com
  noreplysecure-account.info
  noreplysignin.weebly.com
  noreplysigninatt1092.weebly.com
-noreplysupportattservice.weebly.com
  noreplyttehhdg.weebly.com
  noreportsapp.stallbrand.com
  norges-online.com
@@ -219726,9 +218697,7 @@ nossaslojas.tintasmc.com.br
  nossocentrogamek.com
  nossocombatecontraocorona.com
  nossocomecodesemanafeliz.com
-nostalgic-leavitt-6cfeb9.netlify.app
  nostalgic-lichterman-1412e9.netlify.com
-nostalgic-liskov-b4d36c.netlify.app
  nostalgic-sinoussi-6bc12b.netlify.app
  nostalgic-tin-heart.glitch.me
  nosub-3447084040.maylexdecor.com
@@ -219873,6 +218842,7 @@ notificacion-colpatria6712.000webhostapp.com
  notificacionesbacolombia.com
  notificacionesbamcolonbia.com
  notificacionesdavivienda.com
+notification-identity-checking-page-recovery.ga
  notification-mise-a-jour.webnode.be
  notification-office-suporrt-recovery-identity.my.id
  notification-paypalupdatestransaction41usd.latticeinn.com
@@ -220109,13 +219079,13 @@ npnoulggxxezdfeh-dot-millinium.ey.r.appspot.com
  npoexcellence.com
  npppolytechnic.org
  nppvnouohchdnrai-dot-millinium.ey.r.appspot.com
+nppwcpqvpsjvelzzjxpcaummcz-dot-gleow2021ja.ue.r.appspot.com
  nprvaspsoscpizbc-dot-millinium.ey.r.appspot.com
  nprvfhzbrpfvyorj-dot-millinium.ey.r.appspot.com
  npsgxdkfndxhhiuvohpqfwfnvynvfcebmsmg-dot-glenxpecial3009493.ey.r.appspot.com
  npsjfcmcytlqbzvhnyvgigsuoixdgoroexxy-dot-glenxpecial3009493.ey.r.appspot.com
  nptedu.go.th
  nptvpypxnuxxvjuu-dot-millinium.ey.r.appspot.com
-nptyydlhcqvutrjbvsxgkesifo-dot-gl9393jan.uk.r.appspot.com
  npurysoedxdlywdl-dot-millinium.ey.r.appspot.com
  npwl2w.com
  npxxwcnbnavsrxog-dot-millinium.ey.r.appspot.com
@@ -220123,7 +219093,6 @@ npyhimipmkvlkebm-dot-millinium.ey.r.appspot.com
  npyifjb.biogenicherb.com
  npzejbxlvvqdijjldbsnivaxpickirhwkohp-dot-solar-vertex-285913.rj.r.appspot.com
  npztech.com
-npzytdwqxjzhpwzgwpcrvsqwmq-dot-gl9393jan.uk.r.appspot.com
  nqaqu9zlqtvynaf8.vercel.app
  nqbulvjqjcvqscrr-dot-millinium.ey.r.appspot.com
  nqchdjmdiequzkyq-dot-millinium.ey.r.appspot.com
@@ -220157,7 +219126,6 @@ nqwaciyryyuhhslc-dot-millinium.ey.r.appspot.com
  nqwonmhcugyniwbfaqirgprrvcwlcmbiacry-dot-cryptic-now-290917.ey.r.appspot.com
  nqwonmhcugyniwbfaqirgprrvcwlcmbiacry.cryptic-now-290917.ey.r.appspot.com
  nqy7p.awaykart.com
-nqybbfqvvtxrrilykxxzmaltab-dot-gl9393jan.uk.r.appspot.com
  nqzoyvrhjrnhvfes-dot-millinium.ey.r.appspot.com
  nr.com.pk
  nr01petitieonline-covid19byfacebook.gq
@@ -220341,6 +219309,7 @@ nsuhiizb.goruli.com
  nsuqotmyxfwfdxyq-dot-millinium.ey.r.appspot.com
  nsweb.nissenren-scort.co.jp.cd0e6d0e59a07e4d68c21a9c5b12d0d0e67a8.net
  nswhjwhjd6q.com
+nswylgntytrrjzsylvgkjblvwq-dot-gleow2021ja.ue.r.appspot.com
  nsxgqnobc.shoesmogul.com
  nsxsh.xyz
  nt-entreprises.com
@@ -220415,7 +219384,6 @@ nttglvbncbzdkbku-dot-millinium.ey.r.appspot.com
  nttnjiucksrguuhb-dot-millinium.ey.r.appspot.com
  nttqrevdsktwqosx-dot-millinium.ey.r.appspot.com
  nttsigosqdxnzdpc-dot-millinium.ey.r.appspot.com
-ntukrzglrodprwsqymjhluaahs-dot-gl9393jan.uk.r.appspot.com
  ntuu.duckdns.org
  ntvbnfhdramjolzn-dot-millinium.ey.r.appspot.com
  ntvdpygahkyqqrjjwvwsesctom-dot-gleowayel400503.uc.r.appspot.com
@@ -220478,10 +219446,10 @@ nuigalway-pdf.azurewebsites.net
  nuiiiopsss.cam
  nuiso.vot.pl
  nujmjeltndvqxzricfckibaaaeosspywosir-dot-cedar-code-289917.nn.r.appspot.com
-nukedfence.com
  nuklrajwfioptvqxxghfedsvmn-dot-gloff849483.uk.r.appspot.com
  nukqzndfnuzzlqpzyoko.top
  nukumorinoie.com
+nukwfejxdhzmqdrskbdrghczjn-dot-gleow2021ja.ue.r.appspot.com
  nulinepcs.org
  nullifyrearend.com
  nullmblematicv.com
@@ -220564,7 +219532,6 @@ nuru0147.website2.me
  nusbpvjhbhhdkqsu-dot-millinium.ey.r.appspot.com
  nusinhhanoi.ml
  nusinhvlll.tk
-nusltaeogizjqeychplcqyzwlq-dot-gl9393jan.uk.r.appspot.com
  nusratjdiana.com
  nutbkhxadxfyslox-dot-millinium.ey.r.appspot.com
  nutcrackercastle.com
@@ -220673,7 +219640,6 @@ nvwoodwerks.com
  nvwpyymjyohowgkt-dot-millinium.ey.r.appspot.com
  nvxabbpwrlpvwegpiyddqmaapx-dot-gloff849483.uk.r.appspot.com
  nvxgitbsgyxmmkag-dot-millinium.ey.r.appspot.com
-nvzqqamkswcmlmeehnbbqhbazy-dot-gl9393jan.uk.r.appspot.com
  nw-industries.co.id
  nw-resources.com
  nw-secured.co.uk
@@ -220687,7 +219653,6 @@ nwcd.dimaflix.com
  nwcsfbcff.com
  nwcsvcs.com
  nwcxlgit.biogenicherb.com
-nwdmsxtxozxjjqdewheilgewzb-dot-gl9393jan.uk.r.appspot.com
  nwer.hyperphp.com
  nwesss-001-site1.ctempurl.com
  nwets.com
@@ -220728,7 +219693,6 @@ nwolb.com.payee-review-4918.info
  nwolb.com.payee-review-5193.info
  nwolb.com.payee-review-5845.info
  nwolb.com.review-payee-2746.info
-nwolb.newpayeesetup.com
  nwolb.v3riify.com
  nwolbalerts-payee-added.com
  nwolbsecure-login.com
@@ -220738,7 +219702,6 @@ nwoudnnrfbmbsrcp-dot-millinium.ey.r.appspot.com
  nwraye789123klm-com.preview-domain.com
  nwrcdivayezdk6ztputrlw-on.drv.tw
  nws.timeztchacnged.ru
-nwsecure-newdevice-iproceed.com
  nwstargeneralconstruction.com
  nwstormvaultfiltersreplacementandcleaning.com
  nwsystem.co.kr
@@ -220784,7 +219747,6 @@ nxolpass.com
  nxpme.com
  nxpnthyfscdatmod-dot-millinium.ey.r.appspot.com
  nxpsatnbebhivvofhhhaigszty-dot-gleowayel400503.uc.r.appspot.com
-nxqhubvdhzydzsqtjkgsnknvoz-dot-gl9393jan.uk.r.appspot.com
  nxqidtygpaqtzljv-dot-millinium.ey.r.appspot.com
  nxraxkkdqckkdrsg-dot-millinium.ey.r.appspot.com
  nxrtts.com
@@ -220841,7 +219803,6 @@ nyh8.jaysbrand.com
  nyhinqqysbogdwtk-dot-millinium.ey.r.appspot.com
  nyidpv.com
  nyifdmacyzechariah.top
-nyihxuvgzqeyovqlkjgefejawz-dot-gl9393jan.uk.r.appspot.com
  nyjzcfvrcbmcgjzw-dot-millinium.ey.r.appspot.com
  nykfxejyofijbkhz-dot-millinium.ey.r.appspot.com
  nykn.jaysbrand.com
@@ -220863,7 +219824,6 @@ nysgreenhemp.com
  nysos.se
  nystep.hatakaprokinretshish.com
  nytsa.cn
-nyugfxjbbfwkewibvryiingfwm-dot-gleow2021ja.ue.r.appspot.com
  nyvfc.com
  nyvfc.net
  nyvrvhmeuuimazwf-dot-millinium.ey.r.appspot.com
@@ -220930,6 +219890,7 @@ nzyllyylly.duckdns.org
  nzyspozixrzmucbi-dot-millinium.ey.r.appspot.com
  nzyxeqtjmfgmgdcb-dot-millinium.ey.r.appspot.com
  nzzyteulgepmazia-dot-millinium.ey.r.appspot.com
+o-1.top
  o-amazon.top
  o-f-f-c.s3.amazonaws.com
  o-f-f-f-f-i-i-i-i-c-c-c-c-e-e.nn.r.appspot.com
@@ -221006,6 +219967,7 @@ o2-secureverify.com
  o2-securityteam.com
  o2-support.net
  o2-updatebilling.com
+o2-updatebilling21.xyz
  o2-updatebillinginfo.com
  o2-updateinformation.com
  o2-verify-billing.net
@@ -221016,9 +219978,9 @@ o2.account-bill1.com
  o2.account-billing1.com
  o2.account1-service.com
  o2.bill-alert.net
-o2.bill-failure.uk
  o2.bill-uk1.com
  o2.billing-1account.com
+o2.ebill-confirm.live
  o2.failed-info.com
  o2.invoice093.com
  o2.mobilebilling01.com
@@ -221073,6 +220035,7 @@ o2central.com
  o2info-billing-support.com
  o2infobilling.com
  o2j01.weblium.site
+o2login.com
  o2myaccount-info.com
  o2ocreative.o2o.my
  o2owebdesign.o2o.my
@@ -221122,11 +220085,9 @@ oafcmfizrptmdgrf-dot-millinium.ey.r.appspot.com
  oafqgrpkjdeqgakiwrnucazzwvbilteszzax-dot-glegen303939423233.ue.r.appspot.com
  oaha.berlin
  oahmmosalnxgidfh-dot-millinium.ey.r.appspot.com
-oahurcbgbvjunjqoigpgeshnth-dot-gl9393jan.uk.r.appspot.com
  oaibaby.cn
  oajdasnndkdahm.com
  oajfxzrnvwhekts.top
-oajqhbwohembwzmgihctfmfeya-dot-gl9393jan.uk.r.appspot.com
  oakbaylawnmowing.com
  oakcrestfarmsllc.com
  oakdalelad.buzz
@@ -221224,7 +220185,6 @@ obeellor.xyz
  obeikanprojects.tech
  oberiba.pl
  obes.shoesmogul.com
-obfsvdojqkzqtuddvojbaszvtx-dot-gl9393jan.uk.r.appspot.com
  obgeogjxabsteawcvnllrroema-dot-gleowayel400503.uc.r.appspot.com
  obgynonthepark.com
  obgynresults.com
@@ -221256,7 +220216,6 @@ objenet.batwoqisent.top
  objetivoatingido.life
  objew.xyz
  obkejxnbravpgjsk-dot-millinium.ey.r.appspot.com
-obkjjdbspwghutsmccwszbquht-dot-gl9393jan.uk.r.appspot.com
  obkkzgllcywkuuzv-dot-millinium.ey.r.appspot.com
  oblacheniya.ru
  oblseaquioscumponsboassemanas.com
@@ -221460,7 +220419,6 @@ odfxwtozhhfzabei-dot-millinium.ey.r.appspot.com
  odhikar.com
  odhn.ldayl.com
  odhn.www.ldayl.com
-odhnphiyrbojkhqnrjmegpntuu-dot-gl9393jan.uk.r.appspot.com
  odhumanity.com
  odiaespecial.com
  odibfxsaedjukytoqawjvgvtya-dot-gleowayel400503.uc.r.appspot.com
@@ -221563,12 +220521,9 @@ oesvzsaz.000webhostapp.com
  oetc.in.th
  oetker-com-au.info
  oeuf38bui-6pyt2jamu.vercel.app
-oeuyzrjhglnaejrjmrjjqoxwhp-dot-gl9393jan.uk.r.appspot.com
-oeuyzrjhglnaejrjmrjjqoxwhp.gl9393jan.uk.r.appspot.com
  oew9spasa.appspot.com
  oewtwgnktdoyxmp.vercel.app
  oexslbnwavsshbhpmcribapgkqjmaxxrnlkd-dot-solar-vertex-285913.rj.r.appspot.com
-oeyzgkffxbqyuhhjlxwbmiiplh-dot-gl9393jan.uk.r.appspot.com
  oezbsazuzcrowldcjmttuqwfdh-dot-gleowayel400503.uc.r.appspot.com
  oezeyoujwoilfpwxiuqofrlhpvnupabhfuju-dot-solar-vertex-285913.rj.r.appspot.com
  oezpiauooqeuozbr-dot-millinium.ey.r.appspot.com
@@ -222198,6 +221153,7 @@ officialpubgm13.com
  officialpubgmseason16.com
  officialramacherone.chifanaudit.top
  officials.pubgcompany.com
+officialservice1.000webhostapp.com
  officialsupportdesk.weebly.com
  officialtancentgames.com
  officialtempo.com
@@ -222249,7 +221205,6 @@ oficina-bankia-eses-support.com
  oficina24.online
  oficinadenatacao.com.br
  oficionado.com
-oficlsnhtbxxyobbanyqpmuxph-dot-gleow2021ja.ue.r.appspot.com
  oficnna.sytes.net
  oficsqxxznqyxnke-dot-millinium.ey.r.appspot.com
  ofiosisdf.net
@@ -222264,7 +221219,6 @@ ofldznceawlokgel-dot-millinium.ey.r.appspot.com
  oflwz.sitebuilerguide.com
  ofm-it.com
  ofmrchyk.store
-ofnwhdwwtupfdklzuksgmmktzj-dot-gl9393jan.uk.r.appspot.com
  ofnzwccwgukmjhhyltcqxmr.biz
  ofobxihxcmumfzxu-dot-millinium.ey.r.appspot.com
  ofoghistanbul.com
@@ -222273,11 +221227,9 @@ ofoleteadms.icu
  ofozu.gikorip.net
  ofpampglwqfmzwcuuwrrfjsflhaacmnajqgh-dot-solar-vertex-285913.rj.r.appspot.com
  ofpfzhckrcnyzawnrcavjgupxamcqxzjraxg-dot-cryptic-now-290917.ey.r.appspot.com
-ofpmohxufnusmmqdbgoawrxoec-dot-gleow2021ja.ue.r.appspot.com
  ofpubgmobile.com
  ofqzi3.mxp4037.com
  ofsboacnrtokvywqcdttotpzvnbbbdrvlpdv-dot-gl494903049.wl.r.appspot.com
-ofsbqdxgatwmbttfkstqltkypb-dot-gl9393jan.uk.r.appspot.com
  ofsd.goruli.com
  ofspymk.rogagot.com
  oftalmoday.com.br
@@ -222291,7 +221243,6 @@ ofu.dermals.org
  ofudtnsgmyzwpkfk-dot-millinium.ey.r.appspot.com
  ofvwjtfqinhbcpsmgwoaozpvetqsvvfcrxxp-dot-cryptic-now-290917.ey.r.appspot.com
  ofwobdsmnneilujp-dot-millinium.ey.r.appspot.com
-ofymiosjizqgrupiiuglpzjxbk-dot-gl9393jan.uk.r.appspot.com
  og-solutions.com
  ogadonet.chifanbackground.top
  oganiru.in
@@ -222418,7 +221369,6 @@ ohuqlervcovslapv-dot-millinium.ey.r.appspot.com
  ohvzfnoxywudpjse-dot-millinium.ey.r.appspot.com
  ohwcfzttvbpmxwrzvxrlfdyfyy-dot-gleowayel400503.uc.r.appspot.com
  ohxai.goruli.com
-ohxqqvdylkebkrlunsbqkghkvv-dot-gl9393jan.uk.r.appspot.com
  ohxzvuyvuspkqppeixvqsyqgfw-dot-gleowayel400503.uc.r.appspot.com
  ohyei.topkorder.su
  ohywiwdayizilyar-dot-millinium.ey.r.appspot.com
@@ -222489,10 +221439,8 @@ oiyuyturt.xyz
  oizfkhzlbxorsghk-dot-millinium.ey.r.appspot.com
  oj8pwt8e2molvjpwsi1m8de1lrpt6rn8j9mijgp2ohkj1700q8wj.buzz
  ojabjlonghtensojsytbtfmhgi-dot-gleowayel400503.uc.r.appspot.com
-ojaudjjnvcyiurvbwidmiwyyhe-dot-gl9393jan.uk.r.appspot.com
  ojavnlipnzxwzaix-dot-millinium.ey.r.appspot.com
  ojbrbsnsngssczrm-dot-millinium.ey.r.appspot.com
-ojbvwxhcfqfoymsraduevusjnd-dot-gl9393jan.uk.r.appspot.com
  ojcconseil.com
  ojcegfnimbkvctop-dot-millinium.ey.r.appspot.com
  ojdopffanwstqzusmepnsovikmrcefhtjbjr-dot-glegen303939423233.ue.r.appspot.com
@@ -222553,7 +221501,6 @@ okboptions.com
  okbqdbkyklzonqoofqqplswboookgpcbygjy.gl494903049.wl.r.appspot.com
  okbro.zapto.org
  okbuilding.ge
-okcistvggngpqzjmimbpbwwwfr-dot-gl9393jan.uk.r.appspot.com
  okclick2.ac.ug
  okdipyzgyinzcqohdnndwvftwlunetchcyfi-dot-cryptic-now-290917.ey.r.appspot.com
  okdvcqz.shoesmogul.com
@@ -222569,7 +221516,6 @@ okfwlcfmwosddiip-dot-millinium.ey.r.appspot.com
  okgets.25u.com
  okglnmrqnhiiziatsbusmsqdalixujbkglbi-dot-off94032393204.uk.r.appspot.com
  okgvvvvvvvv.000webhostapp.com
-okgynbbhxnqabwtokvtvsthdrv-dot-gl9393jan.uk.r.appspot.com
  oki.si
  okiguest.com
  okissoebom.tk
@@ -222577,7 +221523,6 @@ okivdknrhaytrhnknvdpqpxvsx-dot-gleowayel400503.uc.r.appspot.com
  okjsdvkjwho.top
  okjuns.com
  okkfdvbsuovy.serveirc.com
-okkgytinngacdjohgkeoswdsgw-dot-gl9393jan.uk.r.appspot.com
  okknbtc.co.vu
  okkolitalia.info
  okkuwait.com
@@ -222635,9 +221580,7 @@ okwnpgahessatkez-dot-millinium.ey.r.appspot.com
  okxcrjnyygzjgwgj-dot-millinium.ey.r.appspot.com
  okxlnzwvodtijrzf-dot-millinium.ey.r.appspot.com
  okykhqmbuqflandf-dot-millinium.ey.r.appspot.com
-okzkaurwmoqsmzsmlqholjdwcn-dot-gl9393jan.uk.r.appspot.com
  okzozwrlqrotanxs-dot-millinium.ey.r.appspot.com
-okzxwpczfwrvapolugctbtiwku-dot-gleow2021ja.ue.r.appspot.com
  ol1u.ru
  ol2.ir
  ola-muito9-bombastaaproveita.com
@@ -222857,6 +221800,7 @@ oluxgroup.com
  oluyamachine.xyz
  olvedps.live
  olvhdiaeapylfmdd-dot-millinium.ey.r.appspot.com
+olvishaouvvtjbrdjiucwquapt-dot-gleow2021ja.ue.r.appspot.com
  olvxrqeaihkbgjhc-dot-millinium.ey.r.appspot.com
  olwenenergy.com
  olwgvvwpkumjcinl-dot-millinium.ey.r.appspot.com
@@ -222956,7 +221900,6 @@ omgmarketplace.com
  omgp11601.uc.r.appspot.com
  omgpssolution.in
  omgsharks.com
-omgtxuptdychrnfvizfjtpxefk-dot-gl9393jan.uk.r.appspot.com
  omgzone.co.uk
  omhlc66.com
  omid1shop.com
@@ -222968,7 +221911,6 @@ omimmogimor.cf
  omimoau.topkorder.su
  ominous-minutes.000webhostapp.com
  ominous-radio.000webhostapp.com
-omise.site
  omitecresourcescom.nckichat.gdn
  omitikrqayuzbvgvfcxdnyvxdj-dot-secret-argon-296111.uk.r.appspot.com
  omizngv9x9fg.talagaremix.com
@@ -222998,21 +221940,15 @@ omnwbchvsatcyaqwxybxpivzeoinmqjlxdxe-dot-glenxpecial3009493.ey.r.appspot.com
  omnydistribution.com
  omodbsbzjlxrjhbxjukspitwue-dot-gleowayel400503.uc.r.appspot.com
  omodollar.com
-omofhoxndhpwwkrvlegewnfdek-dot-gl9393jan.uk.r.appspot.com
  omoide.jp
  omomentive.extraomnes.it
-omosebi.weebly.com
  omrftfr.serviceorder.su
  omronby.uno
  omrtw.com
  omrunheukfcantrb-dot-millinium.ey.r.appspot.com
  oms.theonlinereserve.com
  omsd-auth-net.cf
-omsd-auth-net.ga
  omsd-auth-net.ml
-omsd-auth-org.gq
-omsd-dis.gq
-omsd-igniteii.gq
  omshjijgxtlsesgn-dot-millinium.ey.r.appspot.com
  omsigroup.net
  omsoetxawtqrrlie-dot-millinium.ey.r.appspot.com
@@ -223114,7 +222050,6 @@ onedayintaiwan.com
  oneddrive-dot-j3k8j7g5.appspot.com
  onedgrgwsrdzgshop.com
  onedikerrnnahswwwaw.blogspot.li
-onedirectiondraw2.000webhostapp.com
  onedlveserver.firebaseapp.com
  onedocsb.atwebpages.com
  onedollerstore.com
@@ -223492,7 +222427,6 @@ online-secure-check-boa.com
  online-secure-info-login.com
  online-secure-login-account.com
  online-secure-wells-fargo.com
-online-secure01b-webmail-spectrum.000webhostapp.com
  online-secure01c-chase.000webhostapp.com
  online-secure01r-chase.000webhostapp.com
  online-secure02y-chase.000webhostapp.com
@@ -223800,7 +222734,6 @@ onlineonedriv.netlify.app
  onlineorder11.000webhostapp.com
  onlinepakistandramas.com
  onlinepasvervangen.info
-onlinepayee-deregister.com
  onlinepayee-new.com
  onlinepayee-secure.com
  onlinepayementventeachat.000webhostapp.com
@@ -223875,6 +222808,7 @@ onlinetoday33.xyz
  onlinetoday34.xyz
  onlinetoday36.xyz
  onlinetrainingservices.co.uk
+onlinetransacachatventedirect.000webhostapp.com
  onlinetransactionachatvente.000webhostapp.com
  onlinetransactionventeachat.000webhostapp.com
  onlineugyvitel.hu
@@ -223953,7 +222887,6 @@ onpointmotors.com
  onpremisely.xyz
  onprime.com.br
  onpsfzswgslhohkxtzpouwvrqa-dot-gleowayel400503.uc.r.appspot.com
-onqmjcxrpvemowiqmjfjjwsnhj-dot-gl9393jan.uk.r.appspot.com
  onqotufsikcsmlox-dot-millinium.ey.r.appspot.com
  onroads.co.in
  onsearch.es
@@ -224002,7 +222935,6 @@ onydaxdfhylcchpufavhyfrqrzkliulppiiq-dot-gl494903049.wl.r.appspot.com
  onylgipldyckbkod-dot-millinium.ey.r.appspot.com
  onylolly.cc
  onyourleftracing.com
-onyssvtiousgzzysygpgcymvrz-dot-gl9393jan.uk.r.appspot.com
  onyukvpbnbkarjnx-dot-millinium.ey.r.appspot.com
  onyx-it.fr
  onyx-o.co
@@ -224037,7 +222969,6 @@ oolag.com
  ooliab.org
  oolmxqqzsirmbngk-dot-millinium.ey.r.appspot.com
  oolqrlgxvmaymzxx-dot-millinium.ey.r.appspot.com
-oomislxhiwzhtdixhlhwhtnrge-dot-gl9393jan.uk.r.appspot.com
  oonavvufwvfhpreo-dot-millinium.ey.r.appspot.com
  oonedriveooutlook-docs.online
  oonetech.tech
@@ -224103,7 +223034,6 @@ opcxeapsnrpeirykpllefcqemninaaoapvay-dot-off94032393204.uk.r.appspot.com
  opdatering016278.live
  opdatter-norge.com
  opdracht-service.noez.me
-opdxqsohtrbsvntznkeqxrkugd-dot-gl9393jan.uk.r.appspot.com
  ope.co.ke
  opel.km.ua
  open-applestore.com
@@ -224370,8 +223300,6 @@ oqahmrsioydseued-dot-millinium.ey.r.appspot.com
  oqahntrqtgilsoma-dot-millinium.ey.r.appspot.com
  oqakbhnp.vipsnapchatsexting.com
  oqamwrrrwsamkbnl-dot-millinium.ey.r.appspot.com
-oqbamwogwevqbjmxtogydzlaer-dot-gl9393jan.uk.r.appspot.com
-oqbfxdgxinrwzilbokmhtnahgf-dot-gl9393jan.uk.r.appspot.com
  oqbx.goruli.com
  oqcxpnonisemrcglfecdxzrrfhjlrgxdwyeu-dot-cedar-code-289917.nn.r.appspot.com
  oqdfrogoljkvarko-dot-millinium.ey.r.appspot.com
@@ -224764,7 +223692,6 @@ oruchestgo.temp.swtest.ru
  orumber.flywheelsites.com
  oruxdqhhy.goruli.com
  orvesimizer.flywheelsites.com
-orvhrxbqpbzggvamuvqtchyxyl-dot-gl9393jan.uk.r.appspot.com
  orwellvt.xyz
  orwhdcv.shoesmogul.com
  oryano.us
@@ -224808,7 +223735,6 @@ oscontinental.online
  oscore2.com
  osct.kabinetdigital.com
  oscusiece.com
-oscztsqgixixwbffsqduuyzrzk-dot-gl9393jan.uk.r.appspot.com
  osdsoft.com
  ose.lazyeight.tech
  oseguroseciabahia.com.br
@@ -224836,6 +223762,7 @@ osimhfe.ml
  ositseguro.com
  osjnoemfpunmelmp-dot-millinium.ey.r.appspot.com
  oski.aprendiendoaver.com
+oski.one
  osliwknujmfdjzcobhdzjssvbc-dot-gleowayel400503.uc.r.appspot.com
  oslomf.no
  osman.tw
@@ -224969,7 +223896,6 @@ otonamdinh5s.com
  otonet.nl
  otontlatz.com
  otopit.xyz
-otorxckkcpikgaywmhyzlrqebt-dot-gl9393jan.uk.r.appspot.com
  otosinh.vn
  otospot.pl
  otosude.com
@@ -225009,7 +223935,6 @@ otumbaonline.webredirect.org
  otumbauyhhggggs.webredirect.org
  otupage1.web.app
  otuwytfkfzlqrbbr-dot-millinium.ey.r.appspot.com
-otvavuuqxcmfsbqedqoxrukcsk-dot-gl9393jan.uk.r.appspot.com
  otvl.services
  otxhydyc.gikorip.net
  otxzusvgdfkcndalwugcjqukerlqrlbakrnh-dot-cryptic-now-290917.ey.r.appspot.com
@@ -225056,7 +223981,6 @@ ouiyg.mefound.com
  oujhmqvjgqzkwqwv-dot-millinium.ey.r.appspot.com
  oukmd.com
  oulhndmoorfoycdf-dot-millinium.ey.r.appspot.com
-oulpwgbgnpuusjqsfgmfoxjbpx-dot-gl9393jan.uk.r.appspot.com
  oulrwvhnuwpmnnxf-dot-millinium.ey.r.appspot.com
  oulschurlishnes.icu
  oult.ml
@@ -225282,7 +224206,6 @@ outlukupdated.netlify.app
  outlulk.neards.xyz
  outlupdateinv.netlify.app
  outlyingcalmoctagon.figueroaads123.repl.co
-outmail.royal-eng.ps
  outmailingoutlook.netlify.com
  outmazx.ml
  outmost-disks.000webhostapp.com
@@ -225374,7 +224297,6 @@ overseasmentors.net
  overseasstudycouncil.com
  overstockmiami.com
  oversupportflix.com
-overt-total.000webhostapp.com
  overthebag.com
  overthebarr.club
  overton3026385.xyz
@@ -225455,7 +224377,6 @@ owa.voicecloudlinks.ml
  owa.yottamo.net
  owa2k10xchange.moonfruit.com
  owa545web30958.web.app
-owa978743435464645.000webhostapp.com
  owaappssoft.nw.r.appspot.com
  owaaproject378344.du.r.appspot.com
  owaaudiostoarge.ntooitivedigita.repl.co
@@ -225539,7 +224460,6 @@ owqvqiwntkzryyhtsoeafcnziu-dot-gloff849483.uk.r.appspot.com
  owtntpckaeuvszfu-dot-millinium.ey.r.appspot.com
  owtpsisoikzlmzpw-dot-millinium.ey.r.appspot.com
  owtyrgwmyjdtwuykeqontzutbijvmzebpreh-dot-cryptic-now-290917.ey.r.appspot.com
-owuudubhngunnoudymflkzdckp-dot-gl9393jan.uk.r.appspot.com
  owva.cf
  owxagkorykwvsvan-dot-millinium.ey.r.appspot.com
  owzeqzruolklqctv-dot-millinium.ey.r.appspot.com
@@ -225569,7 +224489,6 @@ oxidanticing.com
  oxidized-private-song.glitch.me
  oxiger.com.br
  oxiinc.com
-oximedica.com
  oxivjpgiveqvlaly-dot-millinium.ey.r.appspot.com
  oxnmcxzzsudmzofkeoeblefaar-dot-gleowayel400503.uc.r.appspot.com
  oxnzgvwmsgqoijmnnyzdpzigto-dot-gleowayel400503.uc.r.appspot.com
@@ -225694,7 +224613,6 @@ ozricasupport.com
  ozrupmihfyntihfyyyymnrqhcm-dot-gleowayel400503.uc.r.appspot.com
  ozsscorvqczwkdudwfvsyswxldeaxacezvmz-dot-offglen.uk.r.appspot.com
  oztogsrysobtokfh-dot-millinium.ey.r.appspot.com
-oztptylxxppwqeawnaftwjzixp-dot-gl9393jan.uk.r.appspot.com
  ozturcanakkale.com
  oztwiqydxehhouln-dot-millinium.ey.r.appspot.com
  ozuxluhvdrxlto.serveminecraft.net
@@ -225754,7 +224672,6 @@ p2pweltcom.shaxiaput.top
  p3.yizimg.com
  p30qom.ir
  p37r0ffv1ckt.pw
-p3ai.unpas.ac.id
  p3cx.blob.core.windows.net
  p3ep.jaysbrand.com
  p3ixq.weblium.site
@@ -225818,6 +224735,7 @@ pa-arso.go.id
  pa-cpc.org
  pa-jakartapusat.go.id
  pa-per-doc.ew.r.appspot.com
+pa-schoolwear.co.uk
  pa-t.mentriqq.com
  pa-y-pa-l-vrfy-onlinne-acct-1098738293.000webhostapp.com
  pa.5thdigital.com
@@ -225843,6 +224761,7 @@ pa.thejerkparade.com
  pa.transformationartist.info
  pa.trvlmd.net
  pa0s.cloudns.asia
+paaayeeerpaaal.000webhostapp.com
  paachpumpiaon.com
  paaqrxufncpyrotdpwkb-dot-gleowyel040493443434989.wl.r.appspot.com
  paargolbal.in
@@ -226007,6 +224926,7 @@ padmagld.com
  padministamps.in
  padovanimalta.com
  padprintingpadsonline.com
+paeeeeyrpaaal.000webhostapp.com
  paegrooiqhxtxkuy-dot-millinium.ey.r.appspot.com
  paelladick.com
  paellassupremas.com
@@ -226113,7 +225033,6 @@ page-review-login.info
  page-securiityy.000webhostapp.com
  page-signpoliticy.servebeer.com
  page-support62021.info
-page-unde-review2913.com
  page-under-appeal1192.xyz
  page-under-preview-5528.info
  page-under-preview-7452.info
@@ -226125,7 +225044,6 @@ page-under-preview6277.info
  page-under-preview8245.info
  page-under-preview9213.info
  page-under-review-184.com
-page-under-review2913.com
  page-under-reviews74.com
  page-user-block3.ga
  page-vide0.yolasite.com
@@ -226434,7 +225352,6 @@ pallati.com.br
  palletforce.com.au
  palletsolutions.ca
  pallypal.000webhostapp.com
-palmary-passivation.000webhostapp.com
  palmbeachresortcebu.com
  palmconstructions.com
  palmeronicorp.com
@@ -226859,6 +225776,7 @@ partage.rc2c.fr
  partalamericahelado.com
  partelier.com
  partersolred.com
+partetyeyuyruepaaal.000webhostapp.com
  partetyryryryepaaal.xyz
  partglaucomaz.com
  partial-curvatures.000webhostapp.com
@@ -226937,7 +225855,6 @@ partycovere.com
  partydonkeyplace.com
  partyeventrentalshollywood.com
  partyflix.net
-partyplansson0.com
  parvatanchal.com
  parvati.net.in
  parvbzmjolaoyioxwpqptbapymwxcugbqijt-dot-cryptic-now-290917.ey.r.appspot.com
@@ -227073,7 +225990,6 @@ pathologie-rosenheim.homepage.t-online.de
  pathypothesis.com
  patiboro.ga
  patiencecondition.club
-patillameriidamodelaje.000webhostapp.com
  patinhodomal.duckdns.org
  patio.com.br
  patiohene.com
@@ -227346,7 +226262,6 @@ pay.pallogin-access.com
  pay.pallogin.com
  pay.paluk.personalgb.co.uk
  pay.palverify.com
-pay.payeeservices.org
  pay.phonepartstore.com
  pay.poczta-polska24.com
  pay.pwbook.ir
@@ -227486,7 +226401,6 @@ payee.id
  payee.ru.com
  payeeaccountsecure-help.com
  payeeadd-hsalert-info.com
-payeeadd-unauthorised.com
  payeealert-deregister.live
  payeealert-security.com
  payeealerts-security.com
@@ -227525,6 +226439,7 @@ payeercrypto.site
  payeeref-help.com
  payeeregistration-lloyds.com
  payeeregistration.net
+payeeremove-authverify.live
  payeeremove-online.com
  payeereview-protection.cc
  payeereview-protection.link
@@ -227669,6 +226584,7 @@ payment729newcoda.kozow.com
  paymentaccount.kadhost.com
  paymentapply.xyz
  paymentauth-lloydsplc.com
+paymentauth-payees.com
  paymentauthorisation.com
  paymentbest.club
  paymentcancellation.net
@@ -227685,6 +226601,7 @@ paymentmethodbygroup.colouredmonkeys.io
  paymentofficialin.000webhostapp.com
  paymentpal.cf
  paymentprotectionlog.000webhostapp.com
+paymentprotectionredirect.000webhostapp.com
  paymentprotectiontab.000webhostapp.com
  paymentprotectionuser.000webhostapp.com
  paymentreview-netfllx.com
@@ -229097,6 +228014,7 @@ paypalice.com
  paypalid-online.serveftp.com
  paypalid-verifedmyaccount.inspirasikita.org
  paypalii.tk
+paypalil.ga
  paypalinc1.com
  paypalinc54.com
  paypalinc762.com
@@ -229413,6 +228331,7 @@ payqal-secure-ezslove-probleme-id-1245564165.arturortega.com
  payqal.net
  payqalc.000webhostapp.com
  payqalertonline.com
+payqijcxrzqzkpsyyjekfpocfo-dot-gleow2021ja.ue.r.appspot.com
  payresolver.com
  payrol.pay.s3-website.us-east-2.amazonaws.com
  payrpal-services.com
@@ -229432,7 +228351,6 @@ payspal1.000webhostapp.com
  paystermanjapayprokolkepayin.com
  payt.it
  paytmal.xyz
-paytmsupport.000webhostapp.com
  paytolink.co
  paytouch-free.online
  paytowish.com
@@ -229492,7 +228410,6 @@ pbmtsckdzlzftmyfhpdbgtllawtkksxramzf-dot-glegen303939423233.ue.r.appspot.com
  pbmultikarya.com
  pbndemo2.costapbn.com
  pbnfyt.xyz
-pbnkvtjtgegxswmptifylijoti-dot-gl9393jan.uk.r.appspot.com
  pbntumgryfbikvre-dot-millinium.ey.r.appspot.com
  pbogdydqjvpcenxnsrfftpoalegnsxrumctr-dot-cryptic-now-290917.ey.r.appspot.com
  pbpcbpbgtu.duckdns.org
@@ -229509,7 +228426,6 @@ pbufzjcjdbjcfrkd-dot-millinium.ey.r.appspot.com
  pbujfeqbyoeeyewnjptemmdkuyiamwimqaxk-dot-solar-vertex-285913.rj.r.appspot.com
  pbvwwohtgsmlrkpazrcfqlktaavpfitxwxtq-dot-solar-vertex-285913.rj.r.appspot.com
  pbwf.addroits.com
-pbwpeeqjmhszfsvyftsatcbzzf-dot-gl9393jan.uk.r.appspot.com
  pbxtybkokzkywoufmegxghuslo-dot-gleowayel400503.uc.r.appspot.com
  pc-care365.net
  pc-hardware.xyz
@@ -229531,7 +228447,6 @@ pcd50.shoofgoal.com
  pcdesigns4you.com
  pcdlnfcntpeiujuudmdawpenitpgepmpqpmp-dot-solar-vertex-285913.rj.r.appspot.com
  pcdlnfcntpeiujuudmdawpenitpgepmpqpmp.solar-vertex-285913.rj.r.appspot.com
-pcdnbfbhxbbvjscabtkhilzauy-dot-gl9393jan.uk.r.appspot.com
  pcdown.ttrar.com
  pceaxcfabggwxdzdqlqnuvbmddohnlonukwu-dot-cryptic-now-290917.ey.r.appspot.com
  pcebs.com
@@ -229619,7 +228534,6 @@ pcwibovhzjcwownl-dot-millinium.ey.r.appspot.com
  pcwizbiz.com
  pcxful.com
  pcxrzugjugnrbbqp-dot-millinium.ey.r.appspot.com
-pcyhvrntfgnlxqojwmfbsltzhq-dot-gleow2021ja.ue.r.appspot.com
  pczltdxjfexnctxn-dot-millinium.ey.r.appspot.com
  pd-iskra-lj.si
  pd2i.pw
@@ -229832,7 +228746,6 @@ peifna.cam
  peinture-marseille.com
  peinture.flautre.fr
  peiyina.com
-peiywilgbvltmrjsyumahztqad-dot-gl9393jan.uk.r.appspot.com
  pejaguide.com
  pejesdb.com
  pejhh.goruli.com
@@ -229863,7 +228776,6 @@ pelicanbeach.live
  peliculasparami.000webhostapp.com
  pelikadal.org
  pelislatino3gp.biz
-peljaopqnmjlkbwuxfuxezjwey-dot-gl9393jan.uk.r.appspot.com
  pellandelemanor.info
  pelleaneigeleducetfils.ca
  pellero.ir
@@ -229920,6 +228832,7 @@ pemblokiranakunfacebook.gffi18.tk
  pemblokiranfacebook1.free-ni.ml
  pemblokiranfacebookresmi.pemblokiran-facebok.tk
  pemblokiranfacebookterbaru.rcodest.my.id
+pemblokiranfb.ddns.net
  pemblokiranfbresmi1.gq
  pemblokiranfbresmi1.tk
  pembrokega.buzz
@@ -229939,13 +228852,6 @@ penambahberatbadan.info
  penasafa.com
  pencegahanblokirfb.cf
  pencegahanblokirfb.ga
-pencegahanfacebook.cf
-pencegahanfacebook.ga
-pencegahanfacebook.gq
-pencegahanfacebook.ml
-pencegahanfacebooks.cf
-pencegahanfacebooks.ga
-pencegahanfacebooks.gq
  pencil300.com
  pencilgovern.top
  pencioneru.ru
@@ -229976,7 +228882,6 @@ pengh123.top
  penghilangpenat.viyy.tk
  pengpeng2.xyz
  penhewerkli.gq
-penial-vouchers.000webhostapp.com
  penicenterprises.com
  penielspiritual.com
  peninsulals.com
@@ -230062,7 +228967,6 @@ pepto.cf
  pepto.ga
  pepxazyengcudysh-dot-millinium.ey.r.appspot.com
  peqg4.svcoding.com
-peqhyijjovlqeznltlzbmorsts-dot-gl9393jan.uk.r.appspot.com
  peqlkecnaggacrfc-dot-millinium.ey.r.appspot.com
  per-amazonprime.eatuo.com
  perabetgirs.blogspot.com
@@ -230437,7 +229341,6 @@ petshappyhome.com
  petsittingexcellence.com
  petter8358227.xyz
  pettisvilleoh.xyz
-pettybluekeychanger.elmazoprieto.repl.co
  pettyrosso.it
  peturreja1971.blogspot.be
  peturreja1971.blogspot.com
@@ -230499,7 +229402,6 @@ pfcxqkxomxtayfku-dot-millinium.ey.r.appspot.com
  pfczjqmhtzokhqrgphmhvutmjq-dot-gleowayel400503.uc.r.appspot.com
  pfd4g.qiuvienr.com
  pfeifferandson.net
-pfemuznqvxqjkthjnfxojtweiw-dot-gl9393jan.uk.r.appspot.com
  pferdebiester.de
  pferdeopcom.nckicollege.gdn
  pffemcqicyvdscnu-dot-millinium.ey.r.appspot.com
@@ -230539,7 +229441,6 @@ pftvcjb.goruli.com
  pftyrylobvsibdqt-dot-millinium.ey.r.appspot.com
  pfuegscsyjysprpsvydiqoekrxvrehmxfzcu-dot-solar-vertex-285913.rj.r.appspot.com
  pfuse.net
-pfwuexrgcbykrgwawktvpdmwuo-dot-gl9393jan.uk.r.appspot.com
  pfyawdhmyvnyglympiggkrpqvslnqzawzatn-dot-cedar-code-289917.nn.r.appspot.com
  pg-series-atendimento.joomla.com
  pg17.ailacabs.com
@@ -230565,7 +229466,6 @@ pghsystsrwdfqgasd.com
  pgihgwnol.biogenicherb.com
  pgjtqycnpngvzhci-dot-millinium.ey.r.appspot.com
  pgjyiqvjwfmdmwqh-dot-millinium.ey.r.appspot.com
-pglwxikfksdkahempclrlnpyzp-dot-gleow2021ja.ue.r.appspot.com
  pglxtjufqhfadyhq-dot-millinium.ey.r.appspot.com
  pglxtxbrjgqgfpdy-dot-millinium.ey.r.appspot.com
  pgm-patrimoine.com
@@ -230573,7 +229473,6 @@ pgmessindia.com
  pgmm.club
  pgnig-24.pl
  pgnigonline.pl
-pgnodwahtncbdegeajqnzstmno-dot-gl9393jan.uk.r.appspot.com
  pgoasfxvdmehbtfg-dot-millinium.ey.r.appspot.com
  pgpmkpunqrrndetm-dot-millinium.ey.r.appspot.com
  pgqwwrdxcoelojhtrjjxntvmxu-dot-gleowayel400503.uc.r.appspot.com
@@ -230608,7 +229507,6 @@ phaeremnhes.ddns.net
  phaetus.com
  phaimanhdanong.com
  phaisionworld.casa
-phallvebnjefbarcgqdovswaqn-dot-gl9393jan.uk.r.appspot.com
  phaltemnuoontzii-dot-millinium.ey.r.appspot.com
  pham.duchieu.de
  phamchilong.com
@@ -230699,7 +229597,6 @@ phfsfeayqeeqovmnprgvwchngnltyhtifyah-dot-solar-vertex-285913.rj.r.appspot.com
  phgty.xyz
  phi.com.pe
  phiheatings.ir
-phiikzkrykjbwztxxqpontahta-dot-gl9393jan.uk.r.appspot.com
  phil-ecar.com
  philadelphiaarchitecturalphotography.com
  philandhollythewedding.com
@@ -230914,7 +229811,6 @@ pianopartes.com
  pianostore.pl
  piaoakl.000webhostapp.com
  piatpusa.com
-piatwfjphjjodmtddmqucbmptq-dot-gl9393jan.uk.r.appspot.com
  piavee.com
  piavuifhaqomopdt-dot-millinium.ey.r.appspot.com
  pibuilding.com
@@ -231004,6 +229900,7 @@ piesolubni.com
  piestemrhkolnaxr-dot-millinium.ey.r.appspot.com
  pieszyce24net.shaxiaarea.top
  pietro5661.000webhostapp.com
+pietroelucia.com
  piewxqkezjenvlqn-dot-millinium.ey.r.appspot.com
  piflogistics.in
  pifo.shoesmogul.com
@@ -231028,7 +229925,6 @@ pikisrndvsabngbp-dot-millinium.ey.r.appspot.com
  pikkaly.com
  pikpeppercom.shuiadeal.top
  pikrcqefvknpjbxu-dot-millinium.ey.r.appspot.com
-pikvyvzpwqaxrxfdnuehbgaprj-dot-gl9393jan.uk.r.appspot.com
  pikycbqnouvcatkc-dot-millinium.ey.r.appspot.com
  pilatesforeverybody.org
  pilewitene.com
@@ -231359,7 +230255,6 @@ pkulpzoqnmilmxdosdgpbxggooyerdrqburd-dot-glenxpecial3009493.ey.r.appspot.com
  pkuz.xyz
  pkvdex.tk
  pkvgjnsgfgkwgnnsjk.top
-pkvzqneqqnbzfizsezlhatvrqy-dot-gl9393jan.uk.r.appspot.com
  pkwdiebstahlschutzde.shaxiaput.top
  pkwjrqdjrfgwvecyxopwywmwqjyofvdpzqbo-dot-cryptic-now-290917.ey.r.appspot.com
  pkwmobilede.de
@@ -231402,7 +230297,6 @@ placexx.weebly.com
  plachisternm.info
  placidocn.com
  placimexitac.tk
-plafoxwqlkhabxdgelgncnsiam-dot-gl9393jan.uk.r.appspot.com
  plagading.edufa.id
  plairyexpressionless.com
  plala.or.jp.rsacourier.com
@@ -231457,8 +230351,6 @@ planosecuritycameras.icu
  planosperfeitomagalluuh.com
  planospreventsenior.net.br
  planowanie-spadkowe.pl
-plans-att.com
-plansatt.com
  plantag.de
  plantationhousevanuatu.com
  plantationqatar.com
@@ -231989,9 +230881,9 @@ pnjuexeqkhbqnladtxmnyxgdxf-dot-gloff849483.uk.r.appspot.com
  pnkdmlsizslchfzs-dot-mnospot.ts.r.appspot.com
  pnkjg.mentriqq.com
  pnl17.ddns.net
-pnlnzokzsvcjqthfbkdtlovazs-dot-gl9393jan.uk.r.appspot.com
  pnm.dermals.org
  pnmuauxyrzwnfptqau.top
+pnnspwdcvacigralejjghmrjwc-dot-gleow2021ja.ue.r.appspot.com
  pnny.kommanditgesel.icu
  pnp-th.com
  pnpboxes.com
@@ -232422,6 +231314,7 @@ pooretrem.com
  poorie.temp.swtest.ru
  poorly-ability.000webhostapp.com
  poorlyexecuteddragqueens.com
+poostatamindope.myq-see.com
  pooyahamahang.com
  pop3.newhavenrestoration.org
  popaddress.com
@@ -233170,6 +232063,7 @@ powerexpress.in
  powerfrog.net
  powerful-invited-marscapone.glitch.me
  poweringinfluence.com
+powerlessseriousbrace.adasdfff.repl.co
  powerline-groups.com
  powerlinkaudio.com
  powerlinks.info
@@ -233362,6 +232256,7 @@ ppdgombak.net
  ppdgovskwjeyzjtgfvjxjnxpyr-dot-gleowayel400503.uc.r.appspot.com
  ppdiamonds.co
  ppdigidocsverifiy-restore.xyz
+ppds.anestesi.ulm.ac.id
  ppe-secure.com
  ppe-secured.com
  ppeasxcvjp.com
@@ -233462,7 +232357,6 @@ ppqws.cam
  ppr-plk.xyz
  ppr.goruli.com
  pprakr-71.ga
-pprdbnaodjpnsoisdggeqsnmjr-dot-gl9393jan.uk.r.appspot.com
  ppresolutioncentre.com
  pprestore-limit.com
  pprestore-secure.com
@@ -233513,6 +232407,7 @@ pq-tk.pqrs.info
  pq372.svcoding.com
  pq4hm.addroits.com
  pq8t9.jaysbrand.com
+pqaqexyesnuejejccnepdydrca-dot-gleow2021ja.ue.r.appspot.com
  pqaxkffjrmnwgmem-dot-tetete-app.ue.r.appspot.com
  pqaxkffjrmnwgmem.tetete-app.ue.r.appspot.com
  pqbdytdrhxyvrkykdf.top
@@ -233531,6 +232426,7 @@ pqfxfxoknijqjpuq-dot-millinium.ey.r.appspot.com
  pqgaowidnthwlnbewvbhgivromkgcgnygfwu-dot-solar-vertex-285913.rj.r.appspot.com
  pqghtqjylztyafwn-dot-millinium.ey.r.appspot.com
  pqjqymzglqivooqh-dot-millinium.ey.r.appspot.com
+pqjxrpbcsolyugqthzcpqbcexn-dot-gleow2021ja.ue.r.appspot.com
  pqjylbnvalmlecgmfybalknxcstafyxbjbaj-dot-solar-vertex-285913.rj.r.appspot.com
  pqk.rogagot.com
  pqmgnvbrdwhfnjyleqljtnhzevbfhvolyhwy-dot-offglen.uk.r.appspot.com
@@ -233575,7 +232471,6 @@ practical-hodgkin-b109a8.netlify.app
  practical-perlman-550e2f.netlify.app
  practical-shockley-f451be.netlify.app
  practical-volhard-e1a3ca.netlify.app
-practical-wright-8f14e0.netlify.app
  practicalpeso.com
  practiclick.xyz
  practicum.botfactory.pro
@@ -233818,7 +232713,6 @@ prepared3d.serveirc.com
  preparedplans.com
  preparedsecurity.com
  preparorit.website
-prepaydatt.com
  prepheri.com
  prepperslistreview.com
  prepqnetworks.net
@@ -234839,7 +233733,6 @@ promo-sube.com
  promo-tododia.ml
  promo-willmarket.com
  promo4kjaneiro.bounceme.net
-promoallgame.com
  promobesarbesaransmartphonee.000webhostapp.com
  promobrasil.club
  promocao-6meses.com
@@ -234884,7 +233777,6 @@ promohinotruck.com
  promoimpresos.com
  promoitau30desconto.tk
  promokonyara.ru
-promoliquidalojas-com.umbler.net
  promomagalu.tk
  promomaglu-semprebem.com
  promomay2020billcredit.xyz
@@ -235107,6 +233999,7 @@ protedabao.com
  proteger.at
  proteggiti-ora.com
  protegiendotumundo.com.ar
+proteinic-welder.000webhostapp.com
  protejseg.com.br
  protelmessagerie.web.app
  protenfo.com
@@ -235243,7 +234136,6 @@ pruebashack2020.zapto.org
  pruebixxx.webcindario.com
  prukia.000webhostapp.com
  prunescape.com.au
-pruordgbgnsfwgfcwjfyvknkur-dot-gl9393jan.uk.r.appspot.com
  pruprioritas.net
  prusinfo.shaxianovember.top
  pruvit.com.co
@@ -235303,7 +234195,6 @@ ps8002.top
  psa-sec.de
  psaa.am
  psafseminaireaboisso.000webhostapp.com
-psakaqibtfdayriukuzrcsrsto-dot-gl9393jan.uk.r.appspot.com
  psamlrdtecgzezqwoqx.top
  psarxojp.com
  psas.pw
@@ -235343,10 +234234,8 @@ pseudomonadales.info
  pseudonymsniper.com
  pseudoparalysis.xyz
  pseudosyllogism.xyz
-psexdfarwglfqgkiimklyijqno-dot-gl9393jan.uk.r.appspot.com
  psey.www.tianyilin.cn
  psfcczfswxdbxoga-dot-millinium.ey.r.appspot.com
-psfvveiitrigobakleydeonimj-dot-gl9393jan.uk.r.appspot.com
  psgdoverleadership.com
  psgeconfimrs777-com.preview-domain.com
  psgindustriescom.shaxiaaustralia.top
@@ -235529,7 +234418,6 @@ ptysq.addroits.com
  ptzz360.com
  ptzznnofejjyigvtpdepvdfjfnavfqdpjedf-dot-off94032393204.uk.r.appspot.com
  pu9g.com
-puahfmhdxaeifwyqfjwcxcloqm-dot-gl9393jan.uk.r.appspot.com
  puamprrreuddhfgazmuirrfohmxwcbrgphjb-dot-solar-vertex-285913.rj.r.appspot.com
  puaol.weebly.com
  pub-789654-com.preview-domain.com
@@ -235730,6 +234618,7 @@ pubgmcentralreward.com
  pubgmclaimseason16.ezua.com
  pubgmcol.com
  pubgmcolect.com
+pubgmcollectmetro16.com
  pubgmcrates12.ocry.com
  pubgmcrats12.zzux.com
  pubgmcyberweek.com
@@ -235860,7 +234749,6 @@ pubgmpluss.com
  pubgmpmco.com
  pubgmredeemcode.com
  pubgmretrohl.com
-pubgmrewads16.com
  pubgmreward.my03.com
  pubgmrewardseason.com
  pubgmroyal.com
@@ -236317,6 +235205,7 @@ purpuraclothes.com
  purpurnchai.site
  purrcenter.com
  purrpurr.eu
+purrssrccrusareuuppsesuuowq.sfo2.cdn.digitaloceanspaces.com
  pursemtb.com
  pursepee0095.ddns.net
  purshakar.recordraisers.in
@@ -236377,7 +235266,6 @@ puwellwy.buzz
  puxcngdjvejrlrwbzoihuzdtrz-dot-gleowayel400503.uc.r.appspot.com
  puxscvofybdbnkas-dot-millinium.ey.r.appspot.com
  puygmczcfvwcrcdupx.top
-puygnkkuneuxwsbxyeohvtordy-dot-gl9393jan.uk.r.appspot.com
  puygspkk67.company
  puyjhyvkfnssmotj-dot-millinium.ey.r.appspot.com
  puzzlez.co
@@ -236398,6 +235286,7 @@ pvewigzaaeqklmpyhpdvgjiwsa-dot-gleowayel400503.uc.r.appspot.com
  pvexxbhrrevwqexktufgzdugag-dot-gloff849483.uk.r.appspot.com
  pvflqvuogfllnpmr-dot-millinium.ey.r.appspot.com
  pvhuwmrudkxsycph-dot-millinium.ey.r.appspot.com
+pview-fymupnsdbt.arcinovationz.com.au
  pvigazcydffnfdovgbtlkxnzpc-dot-gloff00403993445.uk.r.appspot.com
  pvinselanlagencom.chifanbudget.top
  pvisack.free.fr
@@ -236417,7 +235306,6 @@ pvokrvrulwdubxra-dot-millinium.ey.r.appspot.com
  pvpgame.ga
  pvpvideos.website
  pvpyxweiannvnszuytpe.top
-pvqzpyhtrpzjuqkacxpyaqlpio-dot-gl9393jan.uk.r.appspot.com
  pvrdesignstudio.in
  pvrpmaflqrsrtvzr-dot-millinium.ey.r.appspot.com
  pvsddjaayz.duckdns.org
@@ -236457,7 +235345,6 @@ pwgyommjgamsakiamllaawvebdhyurhrfryi-dot-glenxpecial3009493.ey.r.appspot.com
  pwhaemonetics.com.awanlalu.com
  pwieurc.godaddysites.com
  pwitknltjhzxrkxi-dot-millinium.ey.r.appspot.com
-pwiwgmzlgvjhwjfbfybvihjjik-dot-gl9393jan.uk.r.appspot.com
  pwizxjbsbsymwjeo-dot-millinium.ey.r.appspot.com
  pwj-g.svcoding.com
  pwjpcwdafxfvthlr-dot-millinium.ey.r.appspot.com
@@ -236539,6 +235426,7 @@ pxqpiomxxqivgwnkcxietzacvanlfohcdodu-dot-solar-vertex-285913.rj.r.appspot.com
  pxqpiomxxqivgwnkcxietzacvanlfohcdodu.solar-vertex-285913.rj.r.appspot.com
  pxqxsmylwororknd-dot-millinium.ey.r.appspot.com
  pxrey.goruli.com
+pxsbox.com
  pxscpwnnqujq.net
  pxsistemas.com
  pxtpfacmqovcwcegexzwsdehcjqulxuukqku-dot-solar-vertex-285913.rj.r.appspot.com
@@ -236636,10 +235524,8 @@ pzaid0944-001-site1.atempurl.com
  pzbhhc.dermals.org
  pzbxwcoqeixyxodd-dot-millinium.ey.r.appspot.com
  pzcejkgkrwzwrpetwwapolxwrq-dot-gleowayel400503.uc.r.appspot.com
-pzdbkgrixdadimzbikrdzxvhhc-dot-gl9393jan.uk.r.appspot.com
  pzdlwjcbmyteirosedndjmsatiofoqpsemhe-dot-offgl8876899977678.uk.r.appspot.com
  pzdlwjcbmyteirosedndjmsatiofoqpsemhe.offgl8876899977678.uk.r.appspot.com
-pzezpekmhryjxkjemqhibunzwy-dot-gl9393jan.uk.r.appspot.com
  pzfkdlcjxfjrnxvk-dot-millinium.ey.r.appspot.com
  pzfpwfykqsjxnqiicsbdbfncmssdzvxfrzhj-dot-solar-vertex-285913.rj.r.appspot.com
  pzhv.goruli.com
@@ -236868,8 +235754,6 @@ qcnwhwikm.dermals.org
  qcoexxltglpblnwixgfaqvfvee-dot-gleowayel400503.uc.r.appspot.com
  qcqwaabjvggxphdi-dot-millinium.ey.r.appspot.com
  qctyu.tk
-qcuziqnkzebgrofmeunwnqvymp-dot-gl9393jan.uk.r.appspot.com
-qcvzotohytgpiygylygqjarwyq-dot-gl9393jan.uk.r.appspot.com
  qcwvbysucewkidmi-dot-millinium.ey.r.appspot.com
  qcytzahena.topkorder.su
  qczwgvmnduzkuzsjvs.top
@@ -236979,7 +235863,6 @@ qf82.jaysbrand.com
  qfasfzhjcfivlynu-dot-millinium.ey.r.appspot.com
  qfav.goruli.com
  qfddhesuenvkgxzm-dot-millinium.ey.r.appspot.com
-qfdieiwlouagbquoxbdrbtkdnf-dot-gl9393jan.uk.r.appspot.com
  qfdoucpmqgecylcy-dot-millinium.ey.r.appspot.com
  qfgiaolhloirrxvz-dot-millinium.ey.r.appspot.com
  qfgvbhguyvnjtrrer.weebly.com
@@ -236989,7 +235872,6 @@ qfiw.goruli.com
  qfjqelsbvhburdss-dot-millinium.ey.r.appspot.com
  qfjtflamzpitfatp-dot-millinium.ey.r.appspot.com
  qfjys.com.img.800cdn.com
-qflijnnplteeuxkmyqtmxfhori-dot-gl9393jan.uk.r.appspot.com
  qfnhfwmdammpngnm-dot-millinium.ey.r.appspot.com
  qfpcwfkfpsxsrkayyddktkfdph-dot-gloff00403993445.uk.r.appspot.com
  qfpiabyolofivlmw-dot-millinium.ey.r.appspot.com
@@ -237063,15 +235945,12 @@ qhsiqcoppkxzkraw-dot-millinium.ey.r.appspot.com
  qhst.yunlanit.com
  qhuqgphigivjrnhojpgfvfezosozguuvhixj-dot-solar-vertex-285913.rj.r.appspot.com
  qhuuvsxlagzs.saihjucardatos.com
-qhvdltiavizbvhapvtnluqabjo-dot-gl9393jan.uk.r.appspot.com
  qhvm.goruli.com
  qhwhqlxaewhmhxhh-dot-millinium.ey.r.appspot.com
  qhxcdmdmfriswpmj-dot-millinium.ey.r.appspot.com
  qhxjjjlukyfvbgim-dot-millinium.ey.r.appspot.com
  qhxtnsbfpyqzzhrt-dot-millinium.ey.r.appspot.com
  qhyrhflokrrqkdih-dot-millinium.ey.r.appspot.com
-qhyryhvvadxtkttpswwdgzelji-dot-gl9393jan.uk.r.appspot.com
-qhzkeaneugmvocwkbwerpbvgwn-dot-gl9393jan.uk.r.appspot.com
  qi.jjconcreteseattle.com
  qi1xap6nsguh.talagaremix.com
  qi8ymuiiito-otimo-e-top.com
@@ -237088,7 +235967,6 @@ qiemoqie.com
  qieyhflkjdl.gq
  qif.ac.ke
  qifhhrlloqmxvbik-dot-millinium.ey.r.appspot.com
-qifocuyryxxdilezqdwpbdmqgg-dot-gl9393jan.uk.r.appspot.com
  qifp35o.kempongkenyot.info
  qigong-gironde.fr
  qigupzplmlhezeuxvxrwavaeysfqeqqyikke-dot-cedar-code-289917.nn.r.appspot.com
@@ -237140,7 +236018,6 @@ qjd39.mentriqq.com
  qjdax.mentriqq.com
  qjdhnusmgcazrmknshccgqrlol-dot-gleowayel400503.uc.r.appspot.com
  qjdpjy.goruli.com
-qjgcbxcdqiqoioydqffpodsjrx-dot-gleow2021ja.ue.r.appspot.com
  qjgvohyphohcgqrg-dot-millinium.ey.r.appspot.com
  qjgwfnmjnedmecks-dot-millinium.ey.r.appspot.com
  qjgwtrkdqawbqglr-dot-millinium.ey.r.appspot.com
@@ -237165,6 +236042,7 @@ qjyqn.svapofit.com
  qjyxdeiovbmxglobehlqywpvhh-dot-gloff00403993445.uk.r.appspot.com
  qka.pota.qi.nanen.qe.pe.kshyr.albamatrix.ch
  qkahqaopqtjxvnbbqkgkipgzxdrqphearzco-dot-glenxpecial3009493.ey.r.appspot.com
+qkaqeihoziutgpsqqsuqebvxcf-dot-gleow2021ja.ue.r.appspot.com
  qkcehlnkcuts.fr
  qkd6m.oujevais.com
  qkddxctliodbtjyzhmcwwvtejpsquofogezj-dot-solar-vertex-285913.rj.r.appspot.com
@@ -237185,7 +236063,6 @@ qkslvstelcvyoqot-dot-millinium.ey.r.appspot.com
  qkvnekeeqhtqtrymxdkjsutwyf-dot-gleowayel400503.uc.r.appspot.com
  qkx3yieuufh5.talagaremix.com
  qkycz.onderhost.com
-qkzsbeswcgzxhjtofsfvubtrrm-dot-gl9393jan.uk.r.appspot.com
  qla.shoesmogul.com
  qlaston.net
  qlczvuwnkesltavi-dot-millinium.ey.r.appspot.com
@@ -237297,7 +236174,6 @@ qofrmxzjkjwydcdmdjrzmdyvafzfzwtqkssr-dot-solar-vertex-285913.rj.r.appspot.com
  qofrmxzjkjwydcdmdjrzmdyvafzfzwtqkssr.solar-vertex-285913.rj.r.appspot.com
  qogoyxphhjmjxswouaxyvfhvpy-dot-gleowayel400503.uc.r.appspot.com
  qohevmqbjrjlhhtvntsrowtgqe-dot-gleowayel400503.uc.r.appspot.com
-qohroiktwxjamdsmddvoecqvam-dot-gl9393jan.uk.r.appspot.com
  qojkkfqotdihvcyi-dot-millinium.ey.r.appspot.com
  qoljhmpdfnwtsnvvumxthjtmmb-dot-gleowayel400503.uc.r.appspot.com
  qombrvplxglhlbpp-dot-millinium.ey.r.appspot.com
@@ -237373,7 +236249,6 @@ qpycbie.goruli.com
  qpzdpbaxmwozgeokdeksbxzsuj-dot-gleowayel400503.uc.r.appspot.com
  qpzfxkzwuvydwvce-dot-millinium.ey.r.appspot.com
  qpzgviukwjutjtae-dot-millinium.ey.r.appspot.com
-qpzvsvnhhfnvgodvxjjacrmulj-dot-gl9393jan.uk.r.appspot.com
  qq274314920.top
  qq461677041.f3322.org
  qq522455.mfzj.1377.xyz
@@ -237434,6 +236309,7 @@ qrbjvobmwgsoqdxs-dot-millinium.ey.r.appspot.com
  qrc-valves.com
  qrch.healthygenez.club
  qrcqdordmzekdyqwhnvimvjtxfcluvxdgsmg-dot-cedar-code-289917.nn.r.appspot.com
+qrcsvxmyjprrdpydjzrekmuxzl-dot-gleow2021ja.ue.r.appspot.com
  qrdhsuxzczxbtngmyhyxtctdrfnldpquqwqt-dot-solar-vertex-285913.rj.r.appspot.com
  qrdocqcnsaapuyxi-dot-millinium.ey.r.appspot.com
  qreenmaple.com
@@ -237704,7 +236580,6 @@ quelandro.temp.swtest.ru
  quemargrasa.net
  quemonezneza.000webhostapp.com
  quemviuissoegay.ddns.net
-quenched-sweeps.000webhostapp.com
  quenshud.nahbwsyh.top
  quentinberra.fr
  queoro.net
@@ -237806,6 +236681,7 @@ quip.onedrivefaxmail.club
  quipertise.com
  quirky-clarke-d15627.netlify.app
  quirky-johnson-c4a60c.netlify.app
+quirky-noether-5c0860.netlify.app
  quirky-noether-cd4453.netlify.app
  quiropraxia.grupokeithmar.com
  quirurgicamente.com
@@ -237832,7 +236708,6 @@ quizzical-blackwell-df290c.netlify.app
  quizzical-lamport-2bde27.netlify.app
  quizzical-leakey-647bbb.netlify.app
  quizzical-ptolemy-1e6d7f.netlify.app
-quizzical-wing-b03752.netlify.app
  quizzigquiz.000webhostapp.com
  quizzingbee.com
  qujedvbiikqvwuljmenftyyiiebfuaurdmwx-dot-cedar-code-289917.nn.r.appspot.com
@@ -237900,7 +236775,6 @@ qvbnafzuigxwjapl-dot-millinium.ey.r.appspot.com
  qvdbdgd.duckdns.org
  qvdpkytcaantuviddvhwnqlzohinsmiv-1rf71aktc.vercel.app
  qvercdzkunralxkp-dot-millinium.ey.r.appspot.com
-qveyippaufhlspcjsfkwwhrean-dot-gl9393jan.uk.r.appspot.com
  qvfftmornmxerrgy-dot-millinium.ey.r.appspot.com
  qvfoxcfdqunx.in
  qvggngrizsovkvglkyfrnaeowk-dot-gleowayel400503.uc.r.appspot.com
@@ -237922,7 +236796,6 @@ qvu2z.app.link
  qvucjdwpdgutxinihesxyxehuaxigqjybwuh-dot-glegen303939423233.ue.r.appspot.com
  qvvdusjfaaxzqgrb-dot-millinium.ey.r.appspot.com
  qvvkhpyscqvrqchfetinbvqyvoktciuatjrp-dot-cedar-code-289917.nn.r.appspot.com
-qvyaqzqnhzzoflhbkeyirjuarv-dot-gl9393jan.uk.r.appspot.com
  qvzshjwxefpzceig-dot-millinium.ey.r.appspot.com
  qw-1.eurmonitor.co
  qw-2-2-2.glitch.me
@@ -238077,7 +236950,6 @@ qz-2.jaysbrand.com
  qz1c.pritiritobo.ru
  qzag.ailacabs.com
  qzbiclaelxudgtcn-dot-millinium.ey.r.appspot.com
-qzcahlrmzcnoxggqhsvlntjhuc-dot-gl9393jan.uk.r.appspot.com
  qzdfjbsmsazfipzm-dot-millinium.ey.r.appspot.com
  qzdvereyqynsovuxqrtbtaeggflidvyszqvj-dot-glxcel49934343434.rj.r.appspot.com
  qzfsvessgpmnsnvo-dot-millinium.ey.r.appspot.com
@@ -238437,7 +237309,6 @@ radiodouradacd.com.br
  radioebwu.com
  radioecos.com
  radioeska24.com.pl
-radiolac.ch
  radiolibri.it
  radiologyhanoi.com
  radiomisterio.cl
@@ -238852,9 +237723,6 @@ rakuten-jp-co.top
  rakuten-jp-login.tk
  rakuten-jp.buzz
  rakuten-jp.monster
-rakuten-lll.buzz
-rakuten-lll.cyou
-rakuten-lll.icu
  rakuten-login.top
  rakuten-lotte-jp.top
  rakuten-ma.com
@@ -239066,7 +237934,6 @@ rakuten.co.jp.c2rk38.cn
  rakuten.co.jp.cardemaill.xyz
  rakuten.co.jp.cardinfo.cf
  rakuten.co.jp.cardloan.top
-rakuten.co.jp.cardmail.buzz
  rakuten.co.jp.cardmaill.xyz
  rakuten.co.jp.cfsuppportnorplya.xyz
  rakuten.co.jp.cfsuppportnorplyc.xyz
@@ -239343,6 +238210,7 @@ rakuten.co.jp.rakuetnsdfwewemcasmlwefasd.xyz
  rakuten.co.jp.rakugen.xyz
  rakuten.co.jp.rakuitan.xyz
  rakuten.co.jp.rakuiten.xyz
+rakuten.co.jp.rakukln.xyz
  rakuten.co.jp.rakulpn.xyz
  rakuten.co.jp.rakulten.xyz
  rakuten.co.jp.rakumtn.xyz
@@ -239748,7 +238616,6 @@ rakuten1011.top
  rakuten11.monster
  rakuten123.xyz
  rakuten1q3y6.com
-rakuten2.buzz
  rakuten2.pengpeng3.xyz
  rakuten2.raku3.xyz
  rakuten2.raku5.xyz
@@ -240087,7 +238954,6 @@ randomsage.work
  randomstranger.com
  randomstring.fiesta.it
  randomstring.yujtrewtrey.from-ms.com
-randomstuff-dot-gl9393jan.uk.r.appspot.com
  randomtuto101.ddns.net
  randopaysdumontblanc.com
  randpassconsulting.co.za
@@ -240470,7 +239336,6 @@ rbjhvjkjbkj.top
  rbji.com
  rbjlifqhrebzlototmuctytiarcwtjxiwswz-dot-gl494903049.wl.r.appspot.com
  rbjoeaefpiwvntrf-dot-millinium.ey.r.appspot.com
-rbjowknyuhnpqgfubltkszjsxt-dot-gl9393jan.uk.r.appspot.com
  rbk-de.net
  rbk-ie.net
  rbkfzvwbibzbfmgavxshjwkxnl-dot-gleowayel400503.uc.r.appspot.com
@@ -240603,14 +239468,12 @@ rcone.kvhkosher.org
  rconfig.pqrhosting.nl
  rcpt-orderinappstoreacc.ohifig.com
  rcptqqehkyldjpwd-dot-millinium.ey.r.appspot.com
-rcqejmcyulpzvsiawfvkuxnoga-dot-gl9393jan.uk.r.appspot.com
  rcqhumhyorddqlxugbncglpvfnidqgmvbxmx-dot-gl494903049.wl.r.appspot.com
  rcqyzpyxtguosboz-dot-millinium.ey.r.appspot.com
  rcrqyqgsdzpwgwixkoetkuxfhx-dot-gleowayel400503.uc.r.appspot.com
  rcscaaa.com
  rcscewjjafjpupsq-dot-millinium.ey.r.appspot.com
  rcsdeliveryservice.com
-rcsfypckybcrktzidvbyfuctma-dot-gl9393jan.uk.r.appspot.com
  rcsharmacollege.com
  rcsic.technocloudtech.com
  rct0aaslr2m8rsl9mpylqtrs.infoaxewa.repl.co
@@ -240748,9 +239611,7 @@ reactivacionperubcp.cilonss.com
  reactivalbcponline.on-pops.com
  reactivaonlinebcpzonasegura.000webhostapp.com
  reactivaperuconbcponline.rec-tosw.com
-reactivaperuzonasegurabcponline.000webhostapp.com
  reactivarperubcpenlinea.rec-tivsps.com
-reactivasperuconbcp.cardio-rd.com
  reactivassnt-online.preview-domain.com
  reactivate-3.com
  reactivate-account-support.000webhostapp.com
@@ -240803,6 +239664,7 @@ read-14953324.bid-digital.com
  read-15241106.bid-digital.com
  read-15648891.bid-digital.com
  read-16342249.bid-digital.com
+read-16409972.ht-egypt.com
  read-17045524.bid-digital.com
  read-17608546.bid-digital.com
  read-17903797.bid-digital.com
@@ -241053,6 +239915,7 @@ realestate-page-id1565125.com
  realestate-page-id15729380.com
  realestate-page.us.alapinta.com
  realestate-page1265623.com
+realestate-page1275683.com
  realestate-page5174612.live
  realestate.estatedeeds.com
  realestate.page-2000075874.credmillions.com.br
@@ -241541,7 +240404,6 @@ rede-de-novidades.com
  redecaminhodosaber.com.br
  redeem-magic-cube-gratis-fre-fire.000webhostapp.com
  redeem-taxrepayment.com
-redeemee-coodeee.000webhostapp.com
  redeemerssports.com
  redeemlace.cyou
  redeempubgms15.zyns.com
@@ -241674,7 +240536,6 @@ redsonitjobs.com
  redsrev.com
  redsswou.ml
  redstoneklazomaniac.com
-redsxqjjozogfcfptefwzzqzly-dot-gl9393jan.uk.r.appspot.com
  redtv.top
  reducedeputize.com
  reductioniststudios.com
@@ -241856,7 +240717,6 @@ regattaxiamen.info
  regdev-new.com
  rege.opriessnig.at
  regeimaging.in
-regency-pacific-a.gq
  regency-pacific-auth.cf
  regencymyanmar.com
  regencyship.info
@@ -241900,7 +240760,6 @@ register-device.com
  register-device.link
  register-facebook.ga
  register-fca-orguk-shpo-firm-details-page-001f00n1lsuee.org
-register-handheld-auth.co.uk
  register-mydevice.com
  register-participatecoronafreecoins300.mrbonus.com
  register-payee.cc
@@ -241909,7 +240768,6 @@ register-secure.co.uk
  register-setting-online.webnode.com
  register-singup.com
  register-vanillascard-zipcode.com
-register-yourdevice.com
  register.amazon.update-co-jp.top
  register.amz.account.update-co-jp.top
  registerbnzonasegura1online.com
@@ -241939,7 +240797,6 @@ registreer.mijn-verificatie.noez.me
  registro-falabe.info
  registro-seguro-c.com
  registrobdserver.com
-registrobn1-multired.xyz
  registrobn1clients.com
  registrobnservicios.com
  registrobnservicios1.com
@@ -242128,7 +240985,6 @@ relax1.dyndns.dk
  relaxbikes.com
  relaxbodys.buzz
  relaxed-goldstine-ece9e8.netlify.app
-relaxed-jepsen-a80f45.netlify.app
  relaxed-notice.000webhostapp.com
  relaxed-pike-29ccd7.netlify.app
  relaxed-pike-9dcd69.netlify.app
@@ -242266,6 +241122,7 @@ rembreg.com
  remcakram.com
  remdes.casa
  remdesilv.pp.ua
+remdinlog.ga
  remdrifta.gearhostpreview.com
  remedialbodywork.com.au
  remediesforstuff.com
@@ -242360,7 +241217,6 @@ remove-gb.cc
  remove-halifax-payee.com
  remove-ipayees.com
  remove-mobile-auth.co.uk
-remove-new-device-halifax-bank.com
  remove-new.com
  remove-newdevice-halifax.com
  remove-newdevice-halifaxinfo.com
@@ -242412,12 +241268,12 @@ removenewmobile-security.co.uk
  removenewpayee-help.world
  removenewpayeeadd.com
  removepayee-auth.com
+removepayee-auth.net
  removepayee-authenticatehelp.com
  removepayee-info.com
  removepayee-securely.com
  removepayee-security.com
  removepayee.co.uk
-removepayee032.com
  removepctrojan.com
  removepop.co
  removesecure-payee.com
@@ -242690,13 +241546,21 @@ repondeursfr-vocale-box.yolasite.com
  report-01673202.nabalifares.ps
  report-04719599.nabalifares.ps
  report-05254850.bnrc.bz
+report-06352561.nabalifares.ps
  report-07727674.nabalifares.ps
+report-09320449.nabalifares.ps
+report-09630838.nabalifares.ps
  report-14178777.nabalifares.ps
  report-15043066.nabalifares.ps
+report-20882209.nabalifares.ps
+report-29863712.nabalifares.ps
+report-34261538.nabalifares.ps
  report-56982800.bnrc.bz
  report-59347730.bnrc.bz
+report-64245034.nabalifares.ps
  report-83047937.nabalifares.ps
  report-84256296.nabalifares.ps
+report-99888812.nabalifares.ps
  report-abuse.studio.site
  report-apple-mail-sevice-account.serveirc.com
  report-appleld.apple.secureaccount-id.bdsadf.ga
@@ -242852,14 +241716,12 @@ resetlink9206001000.cc
  resetpasswordinstagram.com
  resetpolicy.com
  resetting-defend-accounts-support-amazon.com
-resetting-device.com
  resettowellness.com
  resgatandomeuspontos.allowed.org
  resgatandomeuspontos.jumpingcrab.com
  resgatapontoslivelobb.com
  resgatar-alianca.com
  resgatar-premio-tv.com
-resgatardescontos.online
  resgate-70milmilhas.ml
  resgate-hoje-conosco-seguro.online
  resgate-pontos-seguro-hoje-conosco.site
@@ -242917,7 +241779,6 @@ resolutioncenters.paypal.com.mxlimted.com
  resolutioncommunityservices.com.au
  resolutionelectric.com
  resolutionhomesales.com
-resolve-bill-error-09.com
  resolve-fraud-help.com
  resolve-issues-with-account.com
  resolve-limit-issues.com
@@ -243231,9 +242092,6 @@ retourxvente.info
  retransform.xyz
  retratoitinerante.com.br
  retreatparadox.com
-retribution-admin-1991153264987087.tk
-retribution-admin-1991153264987088.tk
-retribution-admin-1991153264987089.tk
  retrievals.000webhostapp.com
  retrieve-update.gq
  retrievepaypal.com
@@ -243324,10 +242182,8 @@ revenuecra-auth02.gleeze.com
  revenueemployementinterac.com
  revenueqc-interac.ca
  reverenddiameters2284.000webhostapp.com
-reverent-darwin-9eedc5.netlify.app
  reverent-goldwasser-b61599.netlify.app
  reverent-mclean-37a573.netlify.app
-reverent-mestorf-e3b099.netlify.app
  reverify-access.com
  reverify-devices.cc
  reverify-netflixbilling.cc
@@ -243428,6 +242284,7 @@ revifolhairlossduisydiu.us
  revisarseupagamento.online
  revisedpayroll08.000webhostapp.com
  revisedsalaryschedule2.000webhostapp.com
+revisedsalaryschedule3.000webhostapp.com
  revisepayee.com
  revisionaccount.ooguy.com
  revisional-pokes.000webhostapp.com
@@ -243478,6 +242335,7 @@ revolutionbroadhead.com
  revolutionpropertiesllc.com
  revolutuk.info11.co.uk
  revolvingly.xyz
+revolvingsimplisticlaws--five-nine.repl.co
  revopilte3.club
  revovercortytems.000webhostapp.com
  revrzz.com
@@ -243577,10 +242435,8 @@ rf4w4.com
  rfanews.sslport.work
  rfaqdejtmewfwcjymgtbclhwxr-dot-gleowayel400503.uc.r.appspot.com
  rfarm.net
-rfbutkzhkuqyjflnglwivsztjk-dot-gleow2021ja.ue.r.appspot.com
  rfd-royalight.com
  rfeybtjrlcdturzj-dot-millinium.ey.r.appspot.com
-rffaclsgjnkmbmznjkgabipmka-dot-gl9393jan.uk.r.appspot.com
  rffrvdgkckjwuizd-dot-millinium.ey.r.appspot.com
  rffsa.jiahaitao.cn
  rfg.dez3.cn
@@ -243595,7 +242451,6 @@ rfheoiopfoipeodwojdhjkwdkl.weebly.com
  rfhgs.1r7dkb.cn
  rfhsg.xyz
  rfidhr.tk
-rfihtqqfaclxgbjkywnybfcxxp-dot-gl9393jan.uk.r.appspot.com
  rfilqtypyscbdyfy-dot-millinium.ey.r.appspot.com
  rfjtumostvds.cf
  rfjzk.mentriqq.com
@@ -243651,7 +242506,6 @@ rgggsg.xtwprc.cn
  rghyjkos.com
  rgiatlsdafguqonx-dot-millinium.ey.r.appspot.com
  rgilabfgmycammsckmxefwrlmw-dot-gleowayel400503.uc.r.appspot.com
-rgilqsqdinuksiuysbfqcnrlbe-dot-gl9393jan.uk.r.appspot.com
  rgjqmtj2wqif.talagaremix.com
  rgkpgftg.pcchvud.cn
  rglrilwlgvjxgeaf-dot-millinium.ey.r.appspot.com
@@ -243681,12 +242535,10 @@ rguvsxhdvhgoxsqq-dot-millinium.ey.r.appspot.com
  rgvgnk391hiu.talagaremix.com
  rgviixkxvqczmdpr-dot-millinium.ey.r.appspot.com
  rgwwcuoyxtyjqtnk-dot-millinium.ey.r.appspot.com
-rgxhvniedeyshghtlcjuuzaxce-dot-gleow2021ja.ue.r.appspot.com
  rgyg.rl2078.cn
  rgyolo.2fa637.cn
  rgys.muhuangshi.cn
  rgz6y.addroits.com
-rgzhhnqmimyjrzxnihvrlcapma-dot-gl9393jan.uk.r.appspot.com
  rh0tpostadikka.xyz
  rh2j6r3dcs2njy96fgsb.party
  rh6s.addroits.com
@@ -243762,7 +242614,6 @@ rhqnrkms.rogagot.com
  rhqtgrwrznwhbwgwzu.top
  rhshowkhin.com
  rhsp.svcoding.com
-rhujonbdfinhimtfdlznxeinse-dot-gl9393jan.uk.r.appspot.com
  rhurkukexgognnswwkcmdnhnue-dot-gleowayel400503.uc.r.appspot.com
  rhvodjdjjipsfgkt-dot-millinium.ey.r.appspot.com
  rhvqpyscsmxmhvyb-dot-millinium.ey.r.appspot.com
@@ -244152,7 +243003,6 @@ rj6bq.addroits.com
  rjanneman.nl
  rjaytech.com
  rjbsplzk.rogagot.com
-rjcuacokiyersxhcadguoqqpwu-dot-gl9393jan.uk.r.appspot.com
  rjenmzux.goruli.com
  rjgflsqsl.gulfhirings.com
  rjglbsla.tanglescanner.com
@@ -244172,11 +243022,11 @@ rjqqwxqgwtdistjvznitemhhps-dot-secret-argon-296111.uk.r.appspot.com
  rjqqzyffnrmvfnzdwsetsvkpon-dot-gleowayel400503.uc.r.appspot.com
  rjs-2.mentriqq.com
  rjsoft.nl
+rjssvwleydomiusnasqvblwofx-dot-gleow2021ja.ue.r.appspot.com
  rjstdkhhpamixxtndomladbfnxxqyjvysmwb-dot-cryptic-now-290917.ey.r.appspot.com
  rjujebgmgwsqmsbk-dot-millinium.ey.r.appspot.com
  rjvbtxpdhfxtcztvth.top
  rjwd.jaysbrand.com
-rjwstnnwpmydncavruwysnkzmk-dot-gl9393jan.uk.r.appspot.com
  rjxaodkjezdbpufihwcxahhrfw-dot-gleowayel400503.uc.r.appspot.com
  rjxz7.gds.name
  rjyw.awaykart.com
@@ -244273,14 +243123,12 @@ rlnashracing.com
  rlphcwirefqwgmhnpiphftvbcblxfhleqrvl-dot-solar-vertex-285913.rj.r.appspot.com
  rlsgitovlwopdvka-dot-millinium.ey.r.appspot.com
  rlteaid.com
-rlthulembmxfieyhnphvlfmeuj-dot-gl9393jan.uk.r.appspot.com
  rlvoknihzxeoqsnu-dot-millinium.ey.r.appspot.com
  rlwhvtqu.top
  rlwqrxcplhnbwhfkmhaeknqibmiekfifrhyq-dot-solar-vertex-285913.rj.r.appspot.com
  rlwxfcjqzhcqgjet-dot-millinium.ey.r.appspot.com
  rlwyfokqtszipgngcgeohcwlrlbixaqvckqe-dot-glegen303939423233.ue.r.appspot.com
  rlxdcourixzlipbvwnxpmgrkut-dot-gleowayel400503.uc.r.appspot.com
-rlzczzkauxxxcmjqjiaqvvhkyy-dot-gl9393jan.uk.r.appspot.com
  rlzvpndubgmdahkcliyfyxokumiddykjpmqi-dot-cryptic-now-290917.ey.r.appspot.com
  rm.facebookus-07423148.cleansol.lk
  rm4w.lawapass.com
@@ -244339,7 +243187,6 @@ rmtigszxmtmvmgks-dot-millinium.ey.r.appspot.com
  rmtottawa.ca
  rmtz-amazonservis9k.servebeer.com
  rmutcon2018.rmutsv.ac.th
-rmuwxaiumrbndzuflfzivctldn-dot-gl9393jan.uk.r.appspot.com
  rmv-01760142.detalhesmusical.com.br
  rmv-03520176.detalhesmusical.com.br
  rmv-08773627.detalhesmusical.com.br
@@ -244407,6 +243254,7 @@ rmv-84731173.detalhesmusical.com.br
  rmv-85274614.detalhesmusical.com.br
  rmv-85384300.detalhesmusical.com.br
  rmv-87080337.detalhesmusical.com.br
+rmv-871838391.adventistgh.org
  rmv-887957336.adventistgh.org
  rmv-89534989.detalhesmusical.com.br
  rmv-899999877.adventistgh.org
@@ -244469,12 +243317,10 @@ rns-coaching.fr
  rnsewa.com.np
  rnsmazon.com
  rnt99.com
-rnteeed.000webhostapp.com
  rntlnz.cam
  rntlr.goruli.com
  rnuffrnhdwgyqdvanz.top
  rnuganbank.com
-rnugnziusflvcpdixufvpxzpbm-dot-gl9393jan.uk.r.appspot.com
  rnumfscsdsbhncpb-dot-millinium.ey.r.appspot.com
  rnviftfpqcgznrhk-dot-millinium.ey.r.appspot.com
  rnvrxw68.firebaseapp.com
@@ -244496,7 +243342,6 @@ roadtripkiddos.icu
  roadubettlapi.tk
  roadwarrior.app
  roajic.goruli.com
-roalmsteghkpcoctioygcmorcm-dot-gleow2021ja.ue.r.appspot.com
  roan-slash-pomelo.glitch.me
  roannestanislausolimpia.casa
  roar-cbd.com
@@ -244926,7 +243771,6 @@ roomycars.com
  rooney.access.ly
  rooneyelectric.com
  rooony.000webhostapp.com
-roooolejhrpnoiwwvkjnzesvlb-dot-gl9393jan.uk.r.appspot.com
  roopakbabu.com
  roorthie.com
  roosteralan.000webhostapp.com
@@ -245099,7 +243943,6 @@ routrackerlinefx.ml
  rouxlive.tk
  rovaconstruction.com
  rovegania.ro
-rover-bts.000webhostapp.com
  rover-chm.000webhostapp.com
  rover-mxn.000webhostapp.com
  rover-ps30.000webhostapp.com
@@ -245142,7 +243985,8 @@ royalalpaca.com
  royalbaks.com
  royalbank-reset--7839384993.com
  royalbank.com.0sf-50tg05-f54t.com
-royalbank.com.cgi-bin-rbaccess-rbcgi3m01f51f-f23ibrequest.info
+royalbank.com.cgi-bin-rbaccess-rbcgi3m01f61f-f21ibrequest.top
+royalbank.com.cgi-bin-rbaccess-rbcgi3m01f61f-f22ibrequest.top
  royalbank.com.wkoj4vg72vt.doggoneracing.com
  royalbank.com.xa-mxv.com
  royalbank.com.xtudocapela.com.br
@@ -245178,6 +244022,7 @@ royaljokar.000webhostapp.com
  royalland.com.tr
  royalmail.support
  royalmaill.top
+royalmailpackages.co.uk
  royalmedicpharma.com
  royalmeds.in
  royalmess.art
@@ -245316,7 +244161,6 @@ rqhqhyqylgsjbcbs-dot-millinium.ey.r.appspot.com
  rqhtrylhtyzjtyde-dot-millinium.ey.r.appspot.com
  rqicnclmxavccnqqvvegmujokz-dot-owaonk399399393.uk.r.appspot.com
  rqijaglnfnchpefr-dot-millinium.ey.r.appspot.com
-rqinartbyeawzbiycjvwdnxnkq-dot-gl9393jan.uk.r.appspot.com
  rqitgedsmpjurpunrqcolmkhulzieyupkjeu-dot-cryptic-now-290917.ey.r.appspot.com
  rqkbntwjfavhhunu-dot-millinium.ey.r.appspot.com
  rqkowhlfai.duckdns.org
@@ -245324,7 +244168,6 @@ rqkyuiwgsbgfkvih-dot-millinium.ey.r.appspot.com
  rqllgeauzylkqnfw-dot-millinium.ey.r.appspot.com
  rqmgsbszfhsoplbn-dot-millinium.ey.r.appspot.com
  rqmiampkvledtwfj-dot-millinium.ey.r.appspot.com
-rqnpxvvcotgivdccogmksjjdmg-dot-gl9393jan.uk.r.appspot.com
  rqnzycof.tanglescanner.com
  rqoestorecpaqe.000webhostapp.com
  rqoykqkfwcjwxaky-dot-millinium.ey.r.appspot.com
@@ -245450,7 +244293,6 @@ rsglwsjwlfiuyfot-dot-millinium.ey.r.appspot.com
  rsgqmtposdmiqpaknnnicehcdhpiqezixcyr-dot-cedar-code-289917.nn.r.appspot.com
  rshack.ddns.net
  rshalbrlobafiarjmajxjrklpjdnzhdoljhq-dot-glenxpecial3009493.ey.r.appspot.com
-rshtiuobyyjtcwpogzsrqkvkuy-dot-gl9393jan.uk.r.appspot.com
  rsibxky.goruli.com
  rsimadinah.com
  rsiuhs7vyfvz9ntbw.gmz.cc
@@ -245788,6 +244630,7 @@ runawaysecliptic.top
  runda-wygranych.eu
  runderfulthailand.com
  rundll.co.in
+rundownpositiveapplications.sdsdsdsd77dsdsd.repl.co
  runescape-benefits.club
  runescape-benefits.com
  runescape-bonds.com
@@ -245887,7 +244730,6 @@ runtimebroker.pw
  ruohvnqwiopioftn-dot-millinium.ey.r.appspot.com
  ruon1on.ru
  ruoungoai.online
-ruououailwryxyhrjfoldshidv-dot-gl9393jan.uk.r.appspot.com
  rupaq.com
  rupayangroup.com
  rupcgyfotpcqsxrb-dot-millinium.ey.r.appspot.com
@@ -246078,12 +244920,10 @@ rwkqtvbbmf.top
  rwkuten.xyz
  rwlqjimpzwlcaktr-dot-millinium.ey.r.appspot.com
  rwlwlngpvevqxgak-dot-millinium.ey.r.appspot.com
-rwlysfwbiylbyabehviwhvwiey-dot-gl9393jan.uk.r.appspot.com
  rwmaz1ewk6lk18.com.de
  rwnqjiadsbbwzybmwuvxhokxybdhktxvogvt-dot-glegen303939423233.ue.r.appspot.com
  rwokm.app.link
  rwozjbdegrnlrlal-dot-millinium.ey.r.appspot.com
-rwpegdudiyolhozelflrbqknve-dot-gl9393jan.uk.r.appspot.com
  rwpyrwlpmhrgvxyj-dot-millinium.ey.r.appspot.com
  rwrrvwnvxmgbnlwi-dot-millinium.ey.r.appspot.com
  rwrwnmphvyxdlsmpqiibqkvocf-dot-gloff849483.uk.r.appspot.com
@@ -246108,7 +244948,6 @@ rxgnvdlfornuuajn-dot-millinium.ey.r.appspot.com
  rxifihxfosugwkxtoemawshqjx-dot-gleowayel400503.uc.r.appspot.com
  rxizkulnyptuqlthatrmgcluov-dot-gleowayel400503.uc.r.appspot.com
  rxknap.newhotstore.su
-rxlaegcltsbjlrgshignzfobgf-dot-gl9393jan.uk.r.appspot.com
  rxlensbuhiomhkdg-dot-millinium.ey.r.appspot.com
  rxmedstores.com
  rxnmcldtxnpydfhjfbtnuubqkm-dot-gleowayel400503.uc.r.appspot.com
@@ -246123,7 +244962,6 @@ rxwnxpvspslzyxkcdwdbuxxwqz-dot-gleowayel400503.uc.r.appspot.com
  rxwpukdcfywnvxdhdp.top
  rxwsterzuzpekqzaqa.top
  rxxroll.fun
-rxyuorcmoljtdemjithjcyqzyo-dot-gl9393jan.uk.r.appspot.com
  rxzbrcdatadwuwnp-dot-millinium.ey.r.appspot.com
  rxzkiwag.goruli.com
  ry.valerana44.ru
@@ -246150,7 +244988,6 @@ rybinskbarhat.ru
  rybkamoya.club
  rybkewirbqplklnuyiqgrwqinb-dot-gleowayel400503.uc.r.appspot.com
  rybnoemesto.net.ua
-rybruniueltsarvksuznjzdwks-dot-gleow2021ja.ue.r.appspot.com
  rybzp.goruli.com
  rycbradgvedzlxiqhhzrpvukptwvuzhrvvmt-dot-offglen.uk.r.appspot.com
  ryccaslvs.parahcenah.com
@@ -246209,7 +245046,6 @@ rytys.xyz
  ryug.uk
  ryugakusite.biz
  ryuoy.weebly.com
-ryurlqdxjcagrmgcwfyyohjzdn-dot-gl9393jan.uk.r.appspot.com
  ryvan000.xyz
  ryvcqelxqmlubloo-dot-millinium.ey.r.appspot.com
  ryvrs.com
@@ -246255,7 +245091,6 @@ rznmarket.ru
  rznp4.oujevais.com
  rzp1y.awaykart.com
  rzpgqpdlcqggdgol-dot-millinium.ey.r.appspot.com
-rzphddinjcmipyyafljzbifzta-dot-gl9393jan.uk.r.appspot.com
  rzqnxgqehevumqaz-dot-millinium.ey.r.appspot.com
  rzrcd.svcoding.com
  rzroll.xyz
@@ -246484,7 +245319,6 @@ s8u913f0fed42f3c6a45b3.net
  s8vhs21.com
  s8wqph7m.firebaseapp.com
  s92673tu.beget.tech
-s973454980238668645789827366497203975890547864598033674329.fra1.digitaloceanspaces.com
  s97n3.svcoding.com
  s9agency.com
  s9bd37d6a8af0619cbd37d6.info
@@ -246753,6 +245587,7 @@ safepaymentpayee-help.com
  safeproed.casa
  safer.com.gt
  saferakuten.top
+saferelsecure.casa
  saferways.com
  safesecure-payee.com
  safesecurepayee-mobile.com
@@ -246779,7 +245614,6 @@ safetyapplecareservices.com
  safetyb14lling.servebeer.com
  safetyconsultantehs.com
  safetyharborhomestore.com
-safetyprotection.co.vu
  safetyrun.xyz
  safetytechspy.com
  safeyouform.com
@@ -246941,6 +245775,7 @@ sairaku.net
  sairamschool.edu.in
  saiscon-crard.top
  saismiami.com
+saisoncard-co-jp.com
  saissco.com
  saistuquee.com
  saitamashiyuuta.xyz
@@ -247438,7 +246273,6 @@ santaanahuesca.ru
  santaander-appmvil.ovh
  santaftpuser.unifiedmarketingsolutions.com
  santaideaoficial.com
-santainfancia.com.br
  santaisarobot.com
  santaliny.net
  santaliny.org
@@ -247508,7 +246342,6 @@ santanderway.servehttp.com
  santanderwaycliente.ooguy.com
  santandewayonline.com
  santandor.mx-reti.com
-santanservices-mydevice.com
  santaremplay.com.br
  santaskey2recovery.com
  sante.ge
@@ -247540,6 +246373,7 @@ santoveli.com
  santrasaferd.com
  santrest-acrt.webcindario.com
  santrnder.com-sernu.com
+santshelp-mydevice.com
  santuarioaparecidamontese.com.br
  santyago.org
  sanumbra.com
@@ -248301,7 +247135,6 @@ scotlabans.com
  scotlabanxmx.net
  scotncolpn.com
  scotriabank.online
-scott.services
  scott6103598.xyz
  scottbhale.com
  scottbnx.com
@@ -248430,7 +247263,6 @@ scxugosports.com
  scxza.top
  scylex.com
  scyzm.net
-sczdhmxlazovjlpvpllfowgwcy-dot-gl9393jan.uk.r.appspot.com
  sd-2-d.glitch.me
  sd-asd-s.glitch.me
  sd-products.info
@@ -248450,7 +247282,6 @@ sdaheaf.com
  sdallzfqvlkrkhupnagjrdedzjlbcfmdnrua-dot-cryptic-now-290917.ey.r.appspot.com
  sdaqt.xyz
  sdast.xyz
-sdawadxzc2322x48s4dd.xyz
  sdawqe.myddns.rocks
  sdayhaneql.tastypriceo.su
  sdboatstore.com
@@ -248639,9 +247470,7 @@ seafarerconsulting.com
  seafees.surge.sh
  seafoflexpenn.xyz
  seafood.sa.gp
-seaforgame.000webhostapp.com
  seagalology.xyz
-seagamebbss.000webhostapp.com
  seagatesthreecharters.com
  seahorsesource.com
  seahoss.com
@@ -248704,6 +247533,7 @@ season14pubg.com
  season16dailyevents.com
  season16metroexodus.com
  season16pubg.com
+season17pubgm.zzux.com
  seasonalharsh.com
  seasonalhostage.com
  seasonallayer.com
@@ -248732,6 +247562,7 @@ seaward-fathom.000webhostapp.com
  seaworldsly.com
  seb-com-dot-gl494903049.wl.r.appspot.com
  sebastianehinger.de
+sebat-dhl.blogspot.com
  sebayu.com.my
  sebfdf.com
  sebherforth.com
@@ -249025,6 +247856,7 @@ secure-biling-login.com
  secure-bill-details.com
  secure-billing-account.com
  secure-billing-auth2.com
+secure-billing-o2.com
  secure-bnpparibas.at
  secure-boa.servebeer.com
  secure-bofa.servebeer.com
@@ -249094,7 +247926,6 @@ secure-document-viewer-login.du.r.appspot.com
  secure-docusign.net
  secure-dynamic.serveirc.com
  secure-ee.digital
-secure-eeuk-updateinfo.com
  secure-etransfer.serveirc.com
  secure-excel-file.glitch.me
  secure-faceb00k.ad64987-photo948hd3654.com
@@ -249171,8 +248002,6 @@ secure-halifaxonline-login.cc
  secure-halifaxonline-login.com
  secure-halifaxonline.net
  secure-halipayee.link
-secure-handset-pairing.co.uk
-secure-handset-unpaired.co.uk
  secure-helpme.com
  secure-helponline.misecure.com
  secure-helwan22.com
@@ -249280,7 +248109,6 @@ secure-network-web.com
  secure-new-device.link
  secure-new-login.link
  secure-new-online.com
-secure-new-payee-deactivation.com
  secure-newdevice-cancellation.com
  secure-newdevice-deregister.com
  secure-newonline-payee.com
@@ -249340,7 +248168,6 @@ secure-payment.servehalflife.com
  secure-payment221.serveirc.com
  secure-payment222.axagufniman.com
  secure-payment234.gomanxis.com
-secure-payne-pp-marchand.000webhostapp.com
  secure-paypailine.serveirc.com
  secure-paypal-service-review-dashboard2.casacam.net
  secure-paypal-verification-review-dashboard.ddnsfree.com
@@ -249387,6 +248214,7 @@ secure-recipient.co.uk
  secure-recover-page.ratiofamily.com
  secure-recovery.xyz
  secure-recprftsecu.cc
+secure-redirection-api.000webhostapp.com
  secure-registered-device.com
  secure-reminder-endpoint.link
  secure-remove-newpayee.co.uk
@@ -249402,7 +248230,6 @@ secure-runescape.com.se
  secure-runescape.xyz
  secure-safeguardpayee.net
  secure-safety-org.site
-secure-securitycheck.co.uk
  secure-server.link
  secure-serveur.serveirc.com
  secure-serveurservice.com
@@ -249604,7 +248431,6 @@ secure.financeweb.cyou
  secure.financework.live
  secure.financework.monster
  secure.gov-refunduktax.org
-secure.hali-confirm.com
  secure.halifax-cancel.co.uk
  secure.halifax-deregister.co.uk
  secure.halifax-mobile.co.uk
@@ -249954,6 +248780,7 @@ secure.tokyojp.xyz
  secure.unlock-apple.appleid.com.serviceinfoappsid.com
  secure.update-securityid.manage-account-verification.com
  secure.update.appleld-pay.com.forteforsheriff.com
+secure.update3account.com
  secure.updatemybill-netflix.elscreumnoew.com
  secure.v2logintokenvrify.masihrasakan.com
  secure.veri-space.xyz
@@ -250533,7 +249360,6 @@ secured-device.com
  secured-devicederegister-uk.com
  secured-devicederegister.com
  secured-deviceprotection.com
-secured-deviceverify.com
  secured-docusign.com
  secured-dot-p7q8y6t5.uc.r.appspot.com
  secured-facebook-marketplace.listing.ad-id238281909.com
@@ -250694,14 +249520,12 @@ securefixes.com
  securefox.guru
  securegate04a-chase.theworkpc.com
  securegate05b-banking.dns05.com
-securegroupdevice.co.uk
  securehalifax-login.com
  securehalifax-portal.com
  securehalifax.com
  securehalifax.online
  securehalifaxapp.com
  securehalifaxbanking.com
-securehalifaxonline-account.com
  securehalifaxonline.com
  securehalifaxonline.net
  securehalifaxpayee.com
@@ -250745,6 +249569,7 @@ securekey-activity-safegaurd.com
  securekey-app-protection.com
  securekey-device-removal.com
  securekey-remove-payee.com
+securekey-securitylogin.com
  securekey-sitelogin.com
  securekey-unknown-device.com
  securekoliume.000webhostapp.com
@@ -251134,6 +249959,7 @@ security-cancelpayment.com
  security-center-accountid.telekampretloh.com
  security-chase.myvnc.com
  security-check-team.com
+security-clientlogin.com
  security-confirm-payee.com
  security-confirmdevice.com
  security-confirmdevices.com
@@ -251238,11 +250064,11 @@ security-removal-halifax.com
  security-removeapayee.com
  security-removemobile.co.uk
  security-removepayees.com
-security-removeunauthpayee.com
  security-reply.serveirc.com
  security-restriction.com
  security-safe.tk
  security-secureaccount.com
+security-securelogins.com
  security-service.freeddns.org
  security-services-card.top
  security-servicesid.icu
@@ -251360,7 +250186,6 @@ securitydataprotection.co.uk
  securitydev.guru
  securitydia.com
  securitydigitalgov.sytes.net
-securityebillingerror.co.uk
  securityee.net
  securityfacebook.zapto.org
  securityfeature.000webhostapp.com
@@ -251511,6 +250336,7 @@ seelenauftragcom.shaxiaaustralia.top
  seelokkyou.song9991.monster
  seemasartworkhalt.com
  seemlue.com
+seemyboobs.ctiaspire.com
  seencompany.com
  seenext.com.pk
  seenurbo.us
@@ -251654,7 +250480,6 @@ selaronpedacosdomundo.com.br
  selberschoen.net
  selbstinszenierungnet.shaxiaadd.top
  seldefence.work
-seleb.whatsapp-grub.tk
  selebtop.xyz
  seleccionsodimac.ru
  select-wines.org
@@ -251664,7 +250489,6 @@ selected-interchang.000webhostapp.com
  selectedhomesfutureclaims.com
  selectfreshproduce.co.ke
  selectit.biz
-selective-bolder-fireplace.glitch.me
  selectortv.com
  selectpinl.site
  selectqcstaffing.com
@@ -251747,7 +250571,6 @@ sellstant.com
  selltnow.com
  sellularbd.com
  sellusedgym.com
-selma.thagard.net
  selopet.co.uk
  selrverette.tk
  seltecasiacom.nckila.gdn
@@ -251867,7 +250690,6 @@ sendmail.aldo007.com
  sendmail003.apps-apple-id.com
  sendmenw.beget.tech
  sendmonneyaccptwebhose.000webhostapp.com
-sendoffice365docx.ddns.net
  sendoutcards.jamesmontgomerylaw.com
  sendtlgrf-com.preview-domain.com
  sendunsolicitedemails.com
@@ -252000,7 +250822,6 @@ serben.mywire.org
  serce.info.pl
  sercodemanagesocial.bounceme.net
  sercommunity.com
-serconosgawuhnnesrvwofzlfc-dot-gl9393jan.uk.r.appspot.com
  sercovid.fun
  sercs-banrillines.servehalflife.com
  sercure-accounthelpmail.com
@@ -252490,7 +251311,6 @@ service.account.apps.com.auth.support-clientinformation1.com
  service.account.information.ngalandsthoba.com
  service.account.kedealogia.business
  service.accountid-verification-info.appsadvs.com
-service.acount.missing.watersun.com.br
  service.amazon.com-update-my-account.nabsayioi726.net
  service.amazon.com.disama-ewu.com
  service.amazon.com.klingermash.com
@@ -253299,7 +252119,6 @@ sezionemobile.com
  sezk.svcoding.com
  sezop.com
  sezoxrcvmmmnksv.serveirc.com
-sezuiwabtezawahiqkbfphmghf-dot-gl9393jan.uk.r.appspot.com
  sezujqjmucqjwufrsb.top
  sf-2007.official-org.com
  sf-express-delivery.herokuapp.com
@@ -253310,7 +252129,6 @@ sf6p9.onderhost.com
  sf976.addroits.com
  sfabfgurfxbysbtemfj.top
  sfahmedco.org
-sfanjimwlqmccnfsbsmzshlzvi-dot-gl9393jan.uk.r.appspot.com
  sfarthkadeway.com
  sfasfjklj.yhmefnsz.top
  sfawjqratxqlbdsjcybsqxbgccwtdyqhpcaz-dot-spyexc3093493.ey.r.appspot.com
@@ -253446,7 +252264,6 @@ sglre.ga
  sglzyrddxkixvrlcidcfmvsijmwmfxhguxmh-dot-gl494903049.wl.r.appspot.com
  sgm0c.alnawwar.com
  sgmoneycollections.com
-sgmptukbibdkjfzwuytovehccq-dot-gl9393jan.uk.r.appspot.com
  sgmslw3ac.verify-accountdkas.informationskdws2s.gastipiss1.com
  sgmueaepir.duckdns.org
  sgnaturn.com
@@ -253487,7 +252304,6 @@ sgxst.xyz
  sgxza.xyz
  sgyvolashfddjkbgmjcllpplbeychbfhyyws-dot-cedar-code-289917.nn.r.appspot.com
  sgywap.servegame.org
-sgzunlkfvqsqacqikcgqhqcmhi-dot-gl9393jan.uk.r.appspot.com
  sh-sunq.com
  sh-sunvvard.com
  sh-womensstore.com
@@ -253894,6 +252710,7 @@ shcyxbyxgs.002.sh.cn
  shdbshi.com
  shdevotion.com
  shdlxjtyxgs.002.sh.cn
+shdnewku.lsdnehqwjwyoasde.shop
  shduffy93marrie.000webhostapp.com
  shdysbcyxgs.002.sh.cn
  sheaddazzle.com
@@ -253984,7 +252801,6 @@ shewanted.com
  shfgyg.fkumq1.cn
  shfkcjoniwjeupxnlgiihvaxmqedhqvhbndw-dot-gl494903049.wl.r.appspot.com
  shflow.com
-shfontlpnqnuqwdglzndargxtz-dot-gl9393jan.uk.r.appspot.com
  shg3nf.xyz
  shgbyuuttupsponbrvcerds.work
  shgdofikrnlueicxanbeuasahh-dot-gleowayel400503.uc.r.appspot.com
@@ -254072,7 +252888,6 @@ shinseico.chifanbob.top
  shinshu-u-phn.net
  shinsotsublog.icu
  shiny-tulip-william.glitch.me
-shiny-vent.000webhostapp.com
  shinycoins.pro
  shinynickel.000webhostapp.com
  shinywiy.com
@@ -254130,7 +252945,6 @@ shivshaktiyog7777.com
  shivshyaminfocom.xyz
  shivsons.info
  shiwanba.cc
-shiwqaofuwrfhqsgscynmnbvuk-dot-gl9393jan.uk.r.appspot.com
  shiyan.yfqzdfd.com
  shizizmt.com
  shjgxroqdpycakbhodnwlwcnya-dot-gleowayel400503.uc.r.appspot.com
@@ -254501,7 +253315,6 @@ shslgssbyxgs.002.sh.cn
  shsqjdcjsypxyxgs.002.sh.cn
  shsthepapercut.com
  shstxszpyxgs.002.sh.cn
-shswsfyvogajudcnnpturifikk-dot-gl9393jan.uk.r.appspot.com
  shswywrururehsdfherueruru34773473473477.internal-social-advanced.my.id
  shsxxxjsyxgs.002.sh.cn
  shszwyjtyxgs.002.sh.cn
@@ -255855,7 +254668,6 @@ sissz.site
  sistaqui.com
  sistasinsuccess.info
  sistelligent.com
-sistelti.com
  sistem-apps.com
  sistem-in-kunci.webnode.com
  sistem-kuncii-indo.webnode.com
@@ -256060,7 +254872,6 @@ sjhsk.app.link
  sjhy123.com
  sjkd.duckdns.org
  sjmp.co.in
-sjnlurdqtkkcbnczaghjxscyqh-dot-gl9393jan.uk.r.appspot.com
  sjnykoghcx.duckdns.org
  sjomfpyj.goruli.com
  sjpharmacycollege.org
@@ -256180,7 +254991,6 @@ skinezy.fun
  skinfinish.ru.com
  skinfood.fun
  skinformula.buzz
-skinfree.claimx13.com
  skinfree89.my.id
  skinfreepubgm.giize.com
  skinfreereward.theworkpc.com
@@ -256191,7 +255001,6 @@ skingfts12.dns04.com
  skingfts12.my03.com
  skingfts12.xxuz.com
  skingfts13pubg.25u.com
-skingiftnew60.ml
  skingo.ru.com
  skingohome.xyz
  skinharman.fun
@@ -256260,7 +255069,6 @@ skinssjars.com
  skinstrading.top
  skinsupply.shop
  skinsutter.com
-skint-rings.000webhostapp.com
  skintosneosenzo.tk
  skinu-navifreecase.xyz
  skinuc13.hot1.shop
@@ -256438,7 +255246,6 @@ slashdb.com
  slashed-lid.000webhostapp.com
  slashingdelegator.win
  slasquareup.com
-slateblueoutgoingmathematics.elmuto00otrogit.repl.co
  slatenctionnit.xyz
  slaterarts.com
  slausonswapmeet.net
@@ -256469,7 +255276,6 @@ sleepy-noether-eea1cb.netlify.app
  sleepy-ramanujan-e4f52c.netlify.app
  sleepybearcreations.com
  sleepyshop.ru
-sleet-far.glitch.me
  sleevekneel.buzz
  sleighttaff.com
  slenderishere.ddns.net
@@ -256597,14 +255403,12 @@ slsmiamihydecom.shaxiaact.top
  sltgx.goruli.com
  sltorg.ru
  sltru.org.uk
-sltvatozfltsrjofdawrjqupcf-dot-gl9393jan.uk.r.appspot.com
  slucky.giize.com
  slugger.de
  slumberingamerica.com
  slumkeytastefule.com
  slumkeytastefult.com
  slumtourismuscom.shaxiacenter.top
-sluoarfigatavszhbogrgwxodi-dot-gl9393jan.uk.r.appspot.com
  slupetzky.at
  sluplutkip.com
  slurrbokepyangpentibgyakinlahhayuuuk.000webhostapp.com
@@ -256926,6 +255730,7 @@ smbc-card.com.yfsau.shop
  smbc-card.cxzzc.com
  smbc-card.dongcheba.com
  smbc-card.edbckq.com
+smbc-card.egfhj.com
  smbc-card.emaiduo.com
  smbc-card.evtss.com
  smbc-card.fgjdgsmbc.monster
@@ -257008,6 +255813,8 @@ smbc-cardsa.xyz
  smbc-cardw.monster
  smbc-cardw.xyz
  smbc-cc.best
+smbc-ccad.cc
+smbc-ccad.vip
  smbc-ccrd.com.ckmairu.top
  smbc-cecd.com
  smbc-cn.com
@@ -257030,7 +255837,6 @@ smbc-crd.best
  smbc-help.co
  smbc-jdauw.com
  smbc-jdauw.me
-smbc-jp.cc
  smbc-jp.club
  smbc-pa.com
  smbc-qasd.myalloy.org
@@ -257107,7 +255913,6 @@ smbc.services
  smbc.smcvndcz.monster
  smbc.snzxvmb.buzz
  smbc.szmbc.xyz
-smbc.tk
  smbc.uwogieqwrrqwer.com.6bkb89.cn
  smbc.vip
  smbc.woosz.com
@@ -257121,6 +255926,7 @@ smbcc-card.com.jndlv.top
  smbcc-card.top
  smbcc.kutternytg.xyz
  smbcc.lonewoaini.shop
+smbcc.lonewoaini.work
  smbcc.top
  smbcc.xyz
  smbccao.xyz
@@ -257269,7 +256075,6 @@ smcsistemas.com.br
  smcvbardi.monster
  smcz.buzz
  smdaudio.in
-smdc-cacd.vip
  smdc-ccdd.gtamclass.com
  smdc-ccrd.yuguiwl.com
  smdc-ccrr.fsdfgweb.xyz
@@ -257609,11 +256414,9 @@ snet101.weebly.com
  snet2020supportserviceupgrade.weebly.com
  snetonlineservice.weebly.com
  snewells.bounceme.net
-snewjihlyiyjharhmplghvuaor-dot-gl9393jan.uk.r.appspot.com
  snficokd.dermals.org
  snginntflsxzs.com
  snhc.org
-snhygkdgncpttdtujwvjvdrkxh-dot-gl9393jan.uk.r.appspot.com
  sniodoliss.com
  snip.li
  sniperdz.com
@@ -257660,7 +256463,6 @@ snnbcwebs.bcxnaksdsal.xyz
  snnbcwebs.oerujdmasmcvnsd6fdgfd1a.xyz
  snnbcwebs.xyz
  snnmnkxdhflwgthqismb.com
-snnwwunduhkkgvocstacvbjfeo-dot-gl9393jan.uk.r.appspot.com
  snoginei.com
  snome.tk
  snomoln.se
@@ -257703,6 +256505,7 @@ snsn6.000webhostapp.com
  snsn7.000webhostapp.com
  snsn8.000webhostapp.com
  snsn9.000webhostapp.com
+snsreaal-portaal.info
  snsrhmkvhm.duckdns.org
  snstechnicalsupport.com
  sntsadvogados.com.br
@@ -257983,7 +256786,6 @@ softprintt.ga
  softrino.com
  softsale.ie
  softsproductkey.com
-softtouch.life
  softtricksmedia.com
  softtube.cn
  softupdate1.me
@@ -258008,6 +256810,7 @@ sogemadgestion.com
  soggerfpt.com
  soggyjampackedbrackets.olivercaba.repl.co
  soggyparchedspreadsheets--five-nine.repl.co
+soggysparsefan--five-nine.repl.co
  sogiitx.org
  sogive.net
  sohailmujffar.000webhostapp.com
@@ -258375,7 +257178,6 @@ soportedefirmadigital.co
  soportedigitalcr.co
  soportedinamic.webcindario.com
  soportefimacrgo.com
-soporteidlphone.000webhostapp.com
  soporteline.webcindario.com
  soportemasterconsultassocios.000webhostapp.com
  soportempresa.com
@@ -258412,7 +257214,6 @@ sorteiodasemana.org
  sorteo-bcpzonasegura.club
  sorteo-viabcpzonasegura.com
  sorteointranet.ml
-sorteozapatillascl.000webhostapp.com
  sortini.bharatbioscience.in
  sortoshvac.com.41114-webdesign.info
  soruoka-daftar.000webhostapp.com
@@ -258500,6 +257301,7 @@ soundline.com.cn
  soundproofingsurvey.000webhostapp.com
  soundsations.net
  soundspod.shop
+soundvibe.casa
  soundyahfcewsoft.club
  sountecaweb.na4u.ru
  sououzilrggrewyrvrnowcuakvuwkhsehoqd-dot-cryptic-now-290917.ey.r.appspot.com
@@ -258592,7 +257394,6 @@ sowkinah.com
  sowlef.com
  sowr-paypalservis5g.servebeer.com
  sowseglass.com
-sowtaqqmqbofgjtzkdoodgmfym-dot-gleow2021ja.ue.r.appspot.com
  soxlablengdiumenet.xyz
  soxmi.vipsnapchatsexting.com
  soxzc.000webhostapp.com
@@ -259155,7 +257956,6 @@ sportybetgames.000webhostapp.com
  sportykonfigurtions-app896345.cf
  sportystreamhd.com
  sportyzetots.com
-sporyarismamiz.com
  spot-realestate.com
  spot-travel.com
  spot.sale.dicksender.org
@@ -259193,8 +257993,6 @@ sppenterprises.in
  sppiscina.com
  spplue2.duckdns.org
  spprtlgnntflixs.com
-sppuort.rr.gg.rolulentaraten.com
-spqfodxessejuixhqtodoasslf-dot-gl9393jan.uk.r.appspot.com
  spqlobal.info
  spr6m.mentriqq.com
  sprachwerk.at
@@ -259251,7 +258049,6 @@ spsshomeworkhelp.com
  sptconstruction.co.za
  spunkyhealthylife.com
  spunkyvids.com
-spuqbdawylqiolzquqjramnrlw-dot-gl9393jan.uk.r.appspot.com
  spurious.io
  spurknetliknztv.com
  spurting-thermocoup.000webhostapp.com
@@ -259295,7 +258092,6 @@ sqgsfkxjwj.duckdns.org
  sqiakser.com
  sqiuaresmail.com
  sqjakreps.com
-sqjcrldotgmbjymsmnewycerli-dot-gl9393jan.uk.r.appspot.com
  sqjyvxfntylvnhbnesnwvskucn-dot-gleowayel400503.uc.r.appspot.com
  sqkijwuvolqexzvkydbdokqlzpdpkdcouirj-dot-gl494903049.wl.r.appspot.com
  sqkumzuhunpqfbqbsbixupoajakjozobnezc-dot-offgl8876899977678.uk.r.appspot.com
@@ -259322,6 +258118,7 @@ sqreply1.org
  sqrresrvce.org
  sqrtey.com
  sqrure-mee.com
+sqsguiporosxyqbpzwbidzvuxj-dot-gleow2021ja.ue.r.appspot.com
  sqsupportuare.com
  sqtcfy.tanglescanner.com
  sqtry.com
@@ -259605,6 +258402,7 @@ sruedlqzbdeglfvgmebwhsgfqz-dot-gleowayel400503.uc.r.appspot.com
  srushtiinstitutemncl.com
  srv-amazonservic9k.servebeer.com
  srv-applelckdservpa.serveirc.com
+srv-auth.web.app
  srv-cluster02.com.br
  srv-externaluserlogin-amazon.gleeze.com
  srv.cybesys.com
@@ -259915,6 +258713,7 @@ ssrai.org
  ssrrxgzmgqiyvrfuoejerlzuwippecocfiyg-dot-cedar-code-289917.nn.r.appspot.com
  sssamidcom.temp.swtest.ru
  ssshost.viewdns.net
+sssmbc-card.tk
  sssqumaild.com
  ssssss-pxp29khud.vercel.app
  ssssssdomenb.tk
@@ -259933,12 +258732,10 @@ ssupportervicespartners.ml
  ssuse.com
  ssuyturwelve.cn
  ssvinterior.com
-sswfbrhbsdztdcyyuthxpociam-dot-gl9393jan.uk.r.appspot.com
  sswxa.xyz
  sswxq.top
  sswz78.com
  ssx6152.su
-ssybmiqbfottjjvrmziozezuyk-dot-gl9393jan.uk.r.appspot.com
  st-92.svcoding.com
  st-amu-cz.my-free.website
  st-andrews.ac.uk.mailchkmessageb.icu
@@ -260071,6 +258868,7 @@ stamentstoreprime8326373953appleidap.duckdns.org
  stametcurug.com
  stamfordvt.buzz
  stampagrafica.es
+stampasegnaletica.com
  stampduty.sampleplan-vim.club
  stampile-sibiu.ro
  standard.sglobal-service.com
@@ -261079,10 +259877,8 @@ stopweedtoday.com
  storage.googleapis.com.statics.alliantccreditunion.org
  storage.googleapis.com.statics.ibcaserv.xyz
  storage.nett00n.org
-storagedatagobig.000webhostapp.com
  storageshared.000webhostapp.com
  storagesharedcdsxo.dnsabr.com
-storageteacher.com
  storamericas.info
  store-acess.com
  store-product-id-20395726.mayencoshop.com
@@ -261179,7 +259975,6 @@ stowmatchst.com
  stpatricks.com
  stpetersburglimocompany.com
  stpresuppport.com
-stqqgnmoshgafefncwkveviaxb-dot-gl9393jan.uk.r.appspot.com
  str.shoppclick.com
  stradious.com
  straffreeks.xyz
@@ -261461,7 +260256,6 @@ stunninglearning.com
  stunomar.com
  stuntrover.com
  stupbratt.no
-stupefied-feynman-1b134a.netlify.app
  stupefied-kowalevski-af6362.netlify.app
  stupefied-liskov-f5f339.netlify.app
  stupendous-garnet-motion.glitch.me
@@ -261641,7 +260435,6 @@ subscription.auth5e8w8wzwog4ccwjwksinetflix.com
  subscription.authqjmny0diqa9inpeofynn2xlpixmwnetflix.com
  subscription.authygwr5ie7pd5hmutwyteoj1t4yxnetflix.com
  subscription.vngstore.com
-subscriptionalert-online.com
  subscriptionauthjc7lyvetknxte8zfc8yzgsnynyuz.info
  subscriptionayment-accountnetflix.telufdj.com
  subscriptionnotice.com
@@ -261726,6 +260519,7 @@ sucurl.net
  sucurlacctivo.online
  sucurlvirtualesx.xyz
  sucursa1-virtual.webcindario.com
+sucursal-ayudapp.webcindario.com
  sucursal-bancolombia.com
  sucursal-bancolombia.zz.com.ve
  sucursal-personas.com
@@ -261997,7 +260791,6 @@ suimmitobobank-cardissure.xyz
  suinfotech.net
  suining.06rl.com
  suisjkf.ga
-suisseark.000webhostapp.com
  suit-able.com
  suitablefoodsja.com
  suitcasecollect.cyou
@@ -262007,7 +260800,7 @@ suitsforseniors.com
  suivi-post-ch.info
  suivi-secure-pcs.fr
  suivis-packets-ag-diepost-ch.com
-suizjdcjbpjapbelmpfrjaaejc-dot-gleow2021ja.ue.r.appspot.com
+suixinniubi.tk
  sujalappliances.co.in
  sujet-du-bac.com
  sukababysite.000webhostapp.com
@@ -262144,7 +260937,6 @@ summittaxandpayroll.com
  summmarychecks23456.ga
  summmarychecks777666.ga
  summofgifts.ga
-summonable-electron.000webhostapp.com
  sumptuous-sky-geranium.glitch.me
  sumpybadland.com
  sumswell.guru
@@ -262299,7 +261091,6 @@ suparmany.com
  supastitioness.com
  supaypal.com
  supcenterspubgv.serveftp.com
-supdorting.flywheelsites.com
  supen-fcl.com
  supengocr.com
  super-arraia-de-ofertas.com
@@ -262413,6 +261204,7 @@ superstartart.xyz
  superstartimes.icu
  supersupremebeautycenter.com
  supertechbuilder.in
+supertop2.duckdns.org
  supertopok.tk
  supertopup.000webhostapp.com
  supertudo.com
@@ -262579,6 +261371,7 @@ support-billing-issue-o2.com
  support-billing-o2.com
  support-billingauth.servehttp.com
  support-billingo2.com
+support-blockpayment.com
  support-boom.xyz
  support-cancelpayee.com
  support-case35.com
@@ -262599,7 +261392,8 @@ support-center3.com
  support-center5.com
  support-centre-uk.info
  support-chase03.serveirc.com
-support-confirmmynewpayee.com
+support-confirm-my-newpayee.com
+support-confirm-new-payee.com
  support-connexion.com
  support-contact010022.com
  support-customer-amazonlogin.securessl.honzy.net
@@ -262637,7 +261431,6 @@ support-infosecure.com
  support-instagram-team.com
  support-instagram-verification.com
  support-ionos.tk
-support-jxe1xvya-league-of-legends.000webhostapp.com
  support-liquidx.com
  support-lng.pro
  support-log-in-check-up.000webhostapp.com
@@ -262658,6 +261451,7 @@ support-netflix.ca
  support-netflix.info
  support-netflixx.xyz
  support-notif3.com
+support-notification-mobile.com
  support-office365.date
  support-office365.dns.army
  support-online-wells-fargo-bank.com
@@ -262719,7 +261513,6 @@ support-wells-fargo-notice.work
  support-wells-fargo-verify.com
  support-wells-online01.mobi
  support-wysf1t3ooo6pytkibkpszisthur8b1zx.65ujhf76.uk.com
-support-yegz8-league-of-legends.000webhostapp.com
  support-you.in.net
  support.account-id.golaughtussermanage.com
  support.account-updates.servicescompanycenters.casa
@@ -262886,6 +261679,7 @@ supportclientid.serveirc.com
  supportcloudapp.com
  supportcopyright-form.com
  supportcopyrightform.com
+supportcopyrighthelpform.com
  supportcopyrightinstagram.ga
  supportcustomer-revisionbillingupdatecentre.com
  supportcustomer4.com
@@ -262897,6 +261691,7 @@ supportedbychase.com
  supportedname.com
  supporterpaypal1.com
  supportfacbook.instarkspa.com
+supportfacebook.fr
  supportfbmexico.000webhostapp.com
  supportforcopyrighteam.com
  supportforhaptic.com
@@ -262921,6 +261716,7 @@ supportinc7.com
  supportinc8.info
  supportindiepodcasts.com
  supportinfo-checks.com
+supportinfo-ppupdate.from-id.com
  supportinfo-societegenerale.com
  supporting-instagram.com
  supportinterpoints.com
@@ -262967,7 +261763,6 @@ supportpaypal8.serveirc.com
  supportpgepp-manage.forumz.info
  supportproblempaymentfanfaonfjenfmdf.com
  supportprotect.pw
-supports-att.com
  supports-boi.com
  supports-confrimesu22.cf
  supports-confrimesu4.ml
@@ -262997,6 +261792,7 @@ supportshelps.000webhostapp.com
  supportssystemsviolations12.ml
  supportsumba.nl
  supportt.magix.net
+supporttcopyrighthelpform.com
  supportteam-bpiactionreupdate.duckdns.org
  supportteamlink.com
  supporttech281012.tk
@@ -263112,7 +261908,6 @@ surol.lk
  surona.ca
  suroyalost.id
  surplusapples.com
-surpriseplanner.com.bd
  surpule.com
  surrealism-beginner.000webhostapp.com
  surrel-data-login.cf
@@ -263233,7 +262028,6 @@ suspgercvrysrvce01.my.id
  suspicious-activity-paypal.vrfd-arz-sppt4.com
  suspicious-austin-cd8033.netlify.app
  suspicious-euclid-2b302b.netlify.app
-suspicious-hermann-96a46b.netlify.app
  suspicious-login-attempt.com
  suspicious-online-payment.com
  suspiciousactivity.xyz
@@ -263369,7 +262163,6 @@ svsorgaccesinter.weebly.com
  svtgyubaznyalctmtlfnpgmcbskfgvnubejq-dot-glxcel49934343434.rj.r.appspot.com
  svuotastock.com
  svveden.com
-svvmiftqbvqllnmyjdlahyvmwr-dot-gl9393jan.uk.r.appspot.com
  svwqc.org
  svxewrjrwdrrztdcyaundwvantpxmjpewbxn-dot-glenxpecial3009493.ey.r.appspot.com
  svxfbthbrbsfvf.duckdns.org
@@ -263528,7 +262321,6 @@ swingcommerce.com
  swingersdance.com
  swingmastersgolf.com
  swingproof.com
-swingy-screw.000webhostapp.com
  swionesw.com
  swipefools.com
  swipenearn.com
@@ -263576,7 +262368,6 @@ switzerladencom.shuiacarry.top
  switzerland-capital.com
  switzerlandrental.top
  swka59kdf.com
-swlbhzhkxbjtngnzqyvwnxjuzo-dot-gl9393jan.uk.r.appspot.com
  swlfrpqb.firebaseapp.com
  swltc-inv-auth.com
  swltc-inv-auth.org
@@ -263631,7 +262422,6 @@ sxianfen.com
  sxjlf.goruli.com
  sxjmxy.com
  sxjtys.com.cn
-sxjupkjhrdmjumfobdyxyigupy-dot-gleow2021ja.ue.r.appspot.com
  sxkyh.addroits.com
  sxlbzgmbmnp8i.edal.cc
  sxmcigars.com
@@ -263653,7 +262443,6 @@ sxyxflix.com
  sxzca.000webhostapp.com
  sy.gxvis.cn
  syacs.syp.ac.in
-sybdflyhiuyexuwkduwctgnalu-dot-gl9393jan.uk.r.appspot.com
  syberenterprise.com
  sybn9otct42ni7.gmz.cc
  sycamoresc.xyz
@@ -263675,7 +262464,6 @@ sygges.kazkgi.cn
  sygnalizujemy.pl
  sygnifai.com
  syh25pnphdcq-i8q6wbnx4.vercel.app
-syhbypnkhzxbkrcopnwbwcavzw-dot-gl9393jan.uk.r.appspot.com
  syhrjofoth.duckdns.org
  syindex.com
  syjhz.jaysbrand.com
@@ -263949,6 +262737,7 @@ szybkikurier.org
  szybko.fun
  szzhongzhuang.com
  szzlwx.cn
+t-1.top
  t-1yk.svcoding.com
  t-app.ddns.net
  t-bagnation.com
@@ -264309,7 +263098,6 @@ takeprofits.in
  takeshykurosavabest.com
  takeskins13.com
  taketheredone.top
-takeuabmqnuvxijcxacayyttcf-dot-gl9393jan.uk.r.appspot.com
  takewingsllc.com
  takeyour-prize6.com
  takeyourprize.ucgift13.com
@@ -264895,7 +263683,6 @@ tbtc.com.my
  tbttmyt.yolasite.com
  tbuild.2tstelecom.com
  tbwysx.cn
-tbyrmunpzmbojhhivftimlgenc-dot-gl9393jan.uk.r.appspot.com
  tbz.onderhost.com
  tbzgmpfqtysiqddafmfuvzwrauqsgfqcqaxu-dot-offglen.uk.r.appspot.com
  tc-eknomi-bakanligi-kayit-basvuru-form.tk
@@ -265029,7 +263816,6 @@ tdsua.com
  tdupdtcn.com
  tdvcxwaqwfcoigfnkgbecreqxw.club
  tdvpprint.com
-tdvtjtefzikbjmrfjqpddgxijq-dot-gl9393jan.uk.r.appspot.com
  tdwcocooiedpbiyudknttzjqhbvdjpbdfgru-dot-cedar-code-289917.nn.r.appspot.com
  tdxl.rogagot.com
  tdzy.lawapass.com
@@ -265536,7 +264322,6 @@ telmobilitydata.com
  telomedic.com
  telorjambans.com
  telotenemos.cl
-telpesbxlvgnthkdnupwzvtbxa-dot-gl9393jan.uk.r.appspot.com
  telros.ru
  telsandalyesi.com
  telse01.000webhostapp.com
@@ -265690,7 +264475,6 @@ tennispot.gr
  tenntechs.com
  tenpor12snkj12k.antihoax.net
  tenrougroup.com
-tensest-haste.000webhostapp.com
  tentandoserfitness.000webhostapp.com
  tentationliye.com
  tentcots.co.uk
@@ -265893,6 +264677,7 @@ test-compomill.w-software.se
  test-explorelanka.sensefeelit.com
  test-scampaypal.servebeer.com
  test-service012505.com
+test.1947restaurant.com.au
  test.38abc.ru
  test.acdlec.be
  test.altipiani.net
@@ -266189,6 +264974,7 @@ tfgs.mobilesuns.com
  tfgs.ynmtzs.cn
  tfhconline.net
  tfjburyeuusdfxcsmmcg-dot-gleowyel040493443434989.wl.r.appspot.com
+tfjsrypvwdudgrofdwzaqdsdab-dot-gleow2021ja.ue.r.appspot.com
  tflfkkh0avp2.talagaremix.com
  tflpj.com
  tfnaeplsg.handipants.com
@@ -266248,7 +265034,6 @@ tgsweksrgy.duckdns.org
  tgteamcom.shuiabudget.top
  tgtlgrfzmk.duckdns.org
  tgu-kouenkai.org
-tgukjyhdbnwvqmyerklepzcexu-dot-gl9393jan.uk.r.appspot.com
  tgvbvgnmuytrvytyf.weebly.com
  tgvglieyrppqfivflzwqvhbdae-dot-gleowayel400503.uc.r.appspot.com
  tgvuahcnargmeysbaaznefqtygmydnmqwgeo-dot-off94032393204.uk.r.appspot.com
@@ -266352,7 +265137,6 @@ thc420world.com
  thccamera.com
  thcscapes.com
  thcsminhduc.edu.vn
-thcxmebndwbsyayblghevnqiig-dot-gl9393jan.uk.r.appspot.com
  thdatt.weebly.com
  thdnxvhdptjwexcwqgwwvoxmeu-dot-gleowayel400503.uc.r.appspot.com
  thdyprivatecloudshareandfileprotectgent.duckdns.org
@@ -266849,6 +265633,7 @@ themanforgood.ddns.net
  themanorcentralparknguyenxien.net
  themarlinfishandchips.co.uk
  themasterchef.in
+themasterworks.info
  thematchinterim.top
  thematkaking.com
  thematrix-one.info
@@ -267183,6 +265968,7 @@ thevoice24.com
  thevoiceoforthodoxy.com
  thevolsteadjax.com
  thew3web.com
+thewaduk.otzo.com
  thewatchtrend.com
  thewayactor.serveftp.com
  thewayofthemagic.ddns.net
@@ -267266,7 +266052,6 @@ thinigia.info
  thinkablestencil.com
  thinkbank.hirecentric.com
  thinkbigsecrets.com
-thinkbrief.cn
  thinkcube.design
  thinkdebt.buzz
  thinkfishmedia.nl
@@ -267302,6 +266087,7 @@ thismonspoppove.info
  thistleworthlesspatterns.rafi9898.repl.co
  thithpt.edu.vn
  thiture.xyz
+thiyltkkwudqkjypsfgkuqjqna-dot-gleow2021ja.ue.r.appspot.com
  thjcfsj.dynssl.com
  thkiqbudhxdwgipgmuwinkbpje-dot-gleowayel400503.uc.r.appspot.com
  thoatran.000webhostapp.com
@@ -267358,6 +266144,7 @@ thottchalnerosbo.ml
  thoublimmanis.xyz
  thoucamixers.xyz
  thoughtfulfunctionalpostscript--five-nine.repl.co
+thoughtfulwiryinstances.omarbaez.repl.co
  thoughtscombined.com
  thoughtstopaper.com
  thoughtwax.com
@@ -267733,7 +266520,6 @@ thuysinhvoiviet.com
  thuytienacademy.com
  thvevmtmhpztdpkapluntjizvt-dot-gleowayel400503.uc.r.appspot.com
  thwembteze.duckdns.org
-thwjtwdcbwqhnbmdtqjaimorhr-dot-gl9393jan.uk.r.appspot.com
  thwqqmhaumvuzmmqxqtpkblghb-dot-triple-upgrade-293822.rj.r.appspot.com
  thwsf.awaykart.com
  thxhb.com
@@ -267898,7 +266684,6 @@ tiktokersolmak.xyz
  tiktokpopuleracounts.ml
  tiktoktakipci.xyz
  tikview.xyz
-tikxsdkjvmdmfypeaoruzjsxtu-dot-gl9393jan.uk.r.appspot.com
  tilamaito.info
  tilapustar.info
  tilbudssko.dk
@@ -267993,6 +266778,7 @@ timelinelimitless.000webhostapp.com
  timelinemaintenance.ae
  timelyrain.top
  timenergysrl.it
+timenow.pw
  timeofcars.icu
  timeoffclub.com
  timeoffer.site
@@ -268060,7 +266846,6 @@ timplex.my
  tims-webb.000webhostapp.com
  timwarren.tv
  tin-melodious-shingle.glitch.me
-tin.phapluatdoisongonline.com
  tina575profile.online
  tinac.wedding
  tinaecotton.com
@@ -268206,7 +266991,6 @@ tivaly.com
  tiviz.net
  tivoli.nu
  tiwe.xyz
-tixhmqiekrnrarvongkntbrisy-dot-gl9393jan.uk.r.appspot.com
  tixon.mooo.com
  tixon.website
  tiyait.com
@@ -268263,7 +267047,6 @@ tkcvgjszqafissjgqifguicgqzwclahheyfv-dot-cryptic-now-290917.ey.r.appspot.com
  tkdkornik.pl
  tkdtosanacademy.ir
  tkexhibits.com
-tkfshflmsuvihgclmfzzlantsi-dot-gl9393jan.uk.r.appspot.com
  tkfsvqatnjyzchpzdjlbtktvugtqvdfttedw-dot-glenxpecial3009493.ey.r.appspot.com
  tkhsqaefpkypwxrddbxslnlhazvslwneqbvg-dot-cedar-code-289917.nn.r.appspot.com
  tking.com.tn
@@ -268309,7 +267092,6 @@ tlftdaduzy.duckdns.org
  tlg.40eb.com
  tlgramsenfb-com.preview-domain.com
  tlhblogs.com
-tlhguitdfkmpvluoqvppocjtmp-dot-gl9393jan.uk.r.appspot.com
  tlidigital.net
  tljytfffdycgymhoqnegqlnuas-dot-gleowayel400503.uc.r.appspot.com
  tlkshow.com
@@ -268352,13 +267134,11 @@ tmcaa526j4.firebaseapp.com
  tmcarthur.com
  tmcdataservices.com
  tmcintyre.com
-tmcqvqbxtjtuepwoqnhpnxwqac-dot-gleow2021ja.ue.r.appspot.com
  tmd827264.000webhostapp.com
  tmdemo.in
  tmdggjzhachlwpbpnhlggruzhecsaxfxbunx-dot-glenxpecial3009493.ey.r.appspot.com
  tmdkckaymkbxdarbxp.top
  tmdl.pro
-tmdwmxxxfnxdbxgrbnjbddehhx-dot-gl9393jan.uk.r.appspot.com
  tme7dmhjnzhmjeswyvpe.us-south.cf.appdomain.cloud
  tmeu.ir
  tmf.gk-yug23.ru
@@ -268533,7 +267313,6 @@ togkhd.com
  togmoupamcemhpcaxrnbctezyp-dot-gleowayel400503.uc.r.appspot.com
  togras.si
  togroow.com
-togymhpzayiwrsflhgxcwcafmg-dot-gl9393jan.uk.r.appspot.com
  toh.handipants.com
  toholdplan.temp.swtest.ru
  tohomeroom.com
@@ -268551,7 +267330,6 @@ token-desbloqueio.com
  token-mobile30hs.ddns.net
  tokendigital-bn1multired.com
  tokendigital.registrosmvltired.xyz
-tokendigital.segurazonaclientes1bn-corn-pe.xyz
  tokendigital.zonasegvraperu1bn.com
  tokendigitalbnsegura.com
  tokengamblers.icu
@@ -268823,7 +267601,6 @@ topikoki.com
  topinbruthsxx.000webhostapp.com
  topingoparagua.com
  topinvoce.nl
-topiylkvunuseczhasimnhxnsd-dot-gl9393jan.uk.r.appspot.com
  topjewelrymart.com
  topkadry.com.ua
  topkaufcom.shaxiaact.top
@@ -268845,7 +267622,6 @@ topmilk.com.vn
  topmodelbiz.batwoqishop.top
  topmodelbiz.shaxiacash.top
  topmothers.com.mx
-topndfhgeapbxtexpkchnpyseq-dot-gl9393jan.uk.r.appspot.com
  topodesia.com.pe
  topografi-minilidar.com
  topologic-giant.000webhostapp.com
@@ -268881,7 +267657,6 @@ topsecrets.com.pl
  topsecuritysys.com
  topselectedtours.com
  topserge.com
-topshelfglasspoolfence.com.au
  topshelfmarijuanadispensary.com
  topshopbrand.com
  topskin.xyz
@@ -269211,6 +267986,7 @@ trabajoss2020.000webhostapp.com
  trabalhadormerece.com
  trabalhodeconclusaodecurso.000webhostapp.com
  trabeoffers.org
+trabetristin.casa
  trabuegentry.com
  trabzonprefabrik.net
  tracacexleglua.tk
@@ -270201,10 +268977,8 @@ tsad.goruli.com
  tsatest-812.tk
  tsatwg2bdst4.000webhostapp.com
  tsavo.ke
-tsb-demo.tuga.tools
  tsb-online.auth5s.com
  tsb-online.payee-add-online.com
-tsb-secure-online.com
  tsb-security-issue.com
  tsb.derestrictedpayee-auth.com
  tsb.new-loginattempt.com
@@ -270232,7 +269006,6 @@ tsfjd.com
  tsgalleria.com
  tsgesg.jdim.com.cn
  tsgfc.cn
-tsgyjcthoizvnzgirjhxrlwvwo-dot-gl9393jan.uk.r.appspot.com
  tshaku-news.net
  tshirt-factory.eu
  tshirtkampanya.tk
@@ -270277,7 +269050,6 @@ tsrv3.ru
  tsrv4.ws
  tss.4buyuklergazete.com
  tsshshop.xyz
-tssqxvxykglnmzceszzcodkabm-dot-gleow2021ja.ue.r.appspot.com
  tst.tynda.ru
  tstaffing.nl
  tstg.000webhostapp.com
@@ -270386,7 +269158,6 @@ tubepchiunuoc.com
  tubestore.com.br
  tubjymafjjzdmntxfhk.top
  tuchnitaro.gq
-tuckrghflrketzldobrtpcgpsz-dot-gl9393jan.uk.r.appspot.com
  tuco-salamanca.dynamic-dns.net
  tucondominioenlinea.com.ve
  tucontaweb.com
@@ -270395,7 +269166,6 @@ tucsonballroomdanceacademy.com
  tucsoncrimelawyers.com
  tucsonpilawyer.com
  tudavi-viendacom.com
-tudddnusehtbjvuqbdyrmgbyss-dot-gl9393jan.uk.r.appspot.com
  tudialactate.ro
  tudo-para-vce-agora.net
  tudo-que-voce-mais-esperou-esta-aqui.com
@@ -270497,7 +269267,6 @@ tunisiamall.xyz
  tunisianabalone.com
  tunlanpa.privateimport.jp
  tunlearn.com
-tunmfqyfssexxkdiixlbfkvaiy-dot-gleow2021ja.ue.r.appspot.com
  tunnabelly.ug
  tunnel.kelikerica.com
  tunnelwell.com
@@ -270694,14 +269463,12 @@ tvbildirim.com
  tvbtgj.yolasite.com
  tvcc-pdf.com
  tvchda.healthygenez.club
-tvdjenertopnwqwuriepltsckq-dot-gl9393jan.uk.r.appspot.com
  tveebsorg.su
  tvffans.org
  tvh.31117n.cn
  tvhkkbfidfzidmpkdvehhhhlxx-dot-gleowayel400503.uc.r.appspot.com
  tviewer.ga
  tvinfo-24.online
-tvkcydvkelmrkwgnlizmspovnw-dot-gl9393jan.uk.r.appspot.com
  tvktjldkayrwtlzlnfdxrqywvgmjxtvyagvz-dot-cryptic-now-290917.ey.r.appspot.com
  tvl.billing-xz.com
  tvlicence-renew.com
@@ -270821,7 +269588,6 @@ twjdz.com
  twksupply.com
  twlove.ru
  twltch.fun
-twmmmujrxegthufyvikjwwyfeq-dot-gl9393jan.uk.r.appspot.com
  twnjzsaykcvpwzlfxcvqfxafeguifsidmmsp-dot-gl494903049.wl.r.appspot.com
  two-a-penny-hats.000webhostapp.com
  two-hitchhikers.ru
@@ -270869,7 +269635,6 @@ twtw.toh.info
  twuw.gikorip.net
  twv3w46verhz6awkyux6c.buzz
  twwse.xyz
-twwwwpmhtyuoonolwwbyrijfrc-dot-gl9393jan.uk.r.appspot.com
  twzhcxtn.biogenicherb.com
  tx-markets.com
  tx-returns.org
@@ -270904,7 +269669,6 @@ txjvpimiqotzxkjzhlqmtnyrjm-dot-gleowayel400503.uc.r.appspot.com
  txklhcycacqskbhnjrombhtecy-dot-gleowayel400503.uc.r.appspot.com
  txlmnqnunppnpuq.ru
  txmvakzdvmzujgbs.top
-txocoljfuowqgnnqnkgaondsle-dot-gl9393jan.uk.r.appspot.com
  txoecaolgjcvocnwhkrougfhad-dot-gloff849483.uk.r.appspot.com
  txpjvxfnps.duckdns.org
  txrebate-gov.com
@@ -270951,7 +269715,6 @@ tyh.shoesmogul.com
  tyhhjsyy.com
  tyhjgrftrt.xyz
  tyhjsod.tk
-tyhonauvbmouygeltnlvxympyi-dot-gl9393jan.uk.r.appspot.com
  tyhotel.vishou.net
  tyieoqxsoeucwosinzbaulcspapwjqmddxyy-dot-glegen303939423233.ue.r.appspot.com
  tyiesek.com
@@ -270970,7 +269733,6 @@ tyllietruite.com
  tyloumangonfairs.com
  tyowfh.com
  typal-hate.000webhostapp.com
-typdaygpkvcwsurinqhrssaaeo-dot-gleow2021ja.ue.r.appspot.com
  type-dcument-request.mypi.co
  type.officeseries.xyz
  type.setamazon.cyou
@@ -271072,7 +269834,6 @@ u0999907.cp.regruhosting.ru
  u0lmailserver.ddns.net
  u1.xainjo.com
  u100586.test-handyhost.ru
-u100694.test-handyhost.ru
  u1016927.cp.regruhosting.ru
  u1018739.cp.regruhosting.ru
  u10188899.ct.sendgrid.net
@@ -271197,13 +269958,10 @@ uaeluxuryhotels.icu
  uaeneeds.com
  uaerhqjthiropcteuzfxhlpklseuqwimdnnc-dot-solar-vertex-285913.rj.r.appspot.com
  uafinty3f552sda.serveirc.com
-uaftjkzthqaoxemqbpauvxodus-dot-gl9393jan.uk.r.appspot.com
  uagdztech.org
  uagritech.com
-uaikpxdkvpfjoygooyxkgehdfn-dot-gl9393jan.uk.r.appspot.com
  uaisoftware.com.br
  uaixsuam.web.app
-uakrkcgpqqmqfgajxtolhtawzk-dot-gl9393jan.uk.r.appspot.com
  ualocal787.org
  ualocal853.org
  ualsi.test3d0.it
@@ -271233,7 +269991,6 @@ ubagroupci.in.net
  ubahlfjlqkoexkdw-dot-dbenitonline.ey.r.appspot.com
  ubayrldc.vipsnapchatsexting.com
  ubber.ga
-ubbhbobwruwvoujdqnidlhatvj-dot-gl9393jan.uk.r.appspot.com
  ubect.org
  ubee.co.kr
  ubekzmjonw.com
@@ -271358,6 +270115,7 @@ ucdv.org
  ucdyjksidjefbwuajptdzojwtf-dot-gleowayel400503.uc.r.appspot.com
  uceludym.gikorip.net
  ucf.org.in
+ucfreedoms.com
  ucgifts14.com
  ucgipzkq.goruli.com
  uch.my.to
@@ -271383,6 +270141,7 @@ ucpredzy.rogagot.com
  ucpubg22.com
  ucpubgms.qhigh.com
  ucpubgms13.com
+ucpubgtops.com
  ucpubgxmobile.com
  ucrackeditwefixit.com
  ucs.unmuha.ac.id
@@ -271399,7 +270158,6 @@ ucup.com.tw
  ucuzdonanim.com
  ucuzrehber.com
  ucuzyemektarifi.com
-ucvjyhvrzoirvuqrtiqzwazzgu-dot-gl9393jan.uk.r.appspot.com
  ucx12.com
  ucxdim.com
  ucxdis.com
@@ -271452,14 +270210,15 @@ ueasoi.com
  ueathlorturetr.xyz
  ueber55.de
  uebllymqxbrachytpuhksiswfbltuopegdwi-dot-gl494903049.wl.r.appspot.com
+uecdkypkfnjdudewdvyodtvchy-dot-gleow2021ja.ue.r.appspot.com
  uecl.shop
  uedahospitalcom.shaxiamarketing.top
  uedayuichicom.chifanblow.top
  uedayuichicom.shaxiapurpose.top
+uedbnhskwidbhfewp.shop
  uefdtswwcbyfdfevye.top
  uegenesaret.000webhostapp.com
  uehdyte.duckdns.org
-ueljxnjbpcuuiobdacqciuerzv-dot-gl9393jan.uk.r.appspot.com
  uemasul.edu.br
  uemaweb.com
  uemoa.africasys.com
@@ -271472,7 +270231,6 @@ ueoevhuhhkbdcvkvggbxqwmyps-dot-gleowayel400503.uc.r.appspot.com
  uepl.com.pk
  ueprnynmjzuychqzyf.top
  ueqtmovbtumwipiylbphgamyjm-dot-gloff849483.uk.r.appspot.com
-ueqxdliqvrcpecevbzhmfozafl-dot-gl9393jan.uk.r.appspot.com
  uer.reiykiq.ir
  uetac.goruli.com
  uetech.com.my
@@ -271511,6 +270269,7 @@ ufogmbhinfo.shaxiaact.top
  ufohomnggphlqjnb-dot-glexcel1.ue.r.appspot.com
  ufonrpg.info
  ufowqolfazirgujjxefocbhlqa-dot-gleowayel400503.uc.r.appspot.com
+ufszzbebvdeqpnseafymrbhvfb-dot-gleow2021ja.ue.r.appspot.com
  uftetxgzqjpettwhswrnihdmyg-dot-gleowayel400503.uc.r.appspot.com
  ufungamano.org
  ufxqwrfysmpxaqkf.top
@@ -271525,7 +270284,6 @@ ugan.ga
  ugcnet-coaching.com
  ugdgfvciokdmnvhha2vxfsbv9hgfn0jdhv3bxc7hvb1vz.000webhostapp.com
  ugenauto.bt
-ugetvekbkoaiottxxgpqlffatx-dot-gl9393jan.uk.r.appspot.com
  uggaustraliawebsite.com
  uggbootsoutlet.cn
  uggjsghuvevwgvbkgpzzlanmyblqrwrowffi-dot-cedar-code-289917.nn.r.appspot.com
@@ -271595,7 +270353,6 @@ uiebqbus.cbudnfni.cnuid.fbuqhiosnkklfnm.top
  uieines.com
  uiensewes.com
  uierhtureit.000webhostapp.com
-uifakfghmnphlbyxlgxidjmozw-dot-gl9393jan.uk.r.appspot.com
  uigsg.rogagot.com
  uiguvgaywyxkbdazxrywywzokhfjpqxrrxwg-dot-cryptic-now-290917.ey.r.appspot.com
  uihgjsyegkzwgywglqacghckga-dot-gleowayel400503.uc.r.appspot.com
@@ -271625,7 +270382,6 @@ uivhdilfynkaxklydarwbsxqczcaudxeokcf-dot-solar-vertex-285913.rj.r.appspot.com
  uivskbdn8klp.talagaremix.com
  uivwntfsbjmtswxdmlvnodekng-dot-gleowayel400503.uc.r.appspot.com
  uiwet.goruli.com
-uixfcholdfefehkxagfdsmeglz-dot-gl9393jan.uk.r.appspot.com
  uizjyrwikriggszzchpsdlbkkwdrlbghjtrw-dot-gl494903049.wl.r.appspot.com
  uizneuyackucrobywaeekjkxryyqjjhxxayb-dot-glegen303939423233.ue.r.appspot.com
  uj.jjconcreteseattle.com
@@ -271641,7 +270397,6 @@ ujkhggsgs.kwaidian.com.cn
  ujkhhss.com
  ujocqmadeczp.talagaremix.com
  ujqbofpegocysthbzlcbzkppnmyxnulynnfl-dot-cryptic-now-290917.ey.r.appspot.com
-ujqcqdhnfldgxgcnzmjomtuzus-dot-gl9393jan.uk.r.appspot.com
  ujrvjdbeivxutwkafjxeqskoda-dot-gleowayel400503.uc.r.appspot.com
  ujrvjezrkbfzqvebsb.top
  ujs612.activehosted.com
@@ -271673,7 +270428,6 @@ uk-grantpartner.zapto.org
  uk-grants.com
  uk-halifax-account.com
  uk-halifax-secure.com
-uk-help-centre.co
  uk-hmrc-tax-refund.com
  uk-hmrclog.info
  uk-hmtaxrefund.com
@@ -271731,7 +270485,6 @@ uk.returns-log11.com
  uk.returns-ref03.com
  uk.returns-ref09.com
  uk.returns-ref11.com
-uk.taxclaim-gov.com
  uk.tv-licences1.com
  uk.ucmingshi.com
  uk01.kuda-axis.com
@@ -271791,7 +270544,6 @@ ukhiamkhdigxtbp-dot-charming-sky-2700.appspot.com
  ukhmer.com
  ukhmrebates.com
  ukhmrefunds.com
-ukhsbcplc.helphsverify.com
  ukhscbc-service.com
  ukhscbc-services.com
  ukhtinada.com
@@ -271805,7 +270557,6 @@ ukks.net
  uklidovka.eu
  uklimitationspaypal.com
  uklimitspp.com
-ukmdculijsrdgkfpyzfxpvidit-dot-gl9393jan.uk.r.appspot.com
  ukmedm.com
  ukmgnvdscor.top
  ukmkarate.unsil.ac.id
@@ -271954,8 +270705,6 @@ ulusoylogistics.com
  uluyyrwzywdvqoxxfeobsjvorootmullfqoc-dot-cryptic-now-290917.ey.r.appspot.com
  ulvis.net
  ulvlibvsjcxuhvkfvrzaiowyef-dot-gleowayel400503.uc.r.appspot.com
-ulvrhwkykrpfreznfvhtzzsxfh-dot-gleow2021ja.ue.r.appspot.com
-ulwtdmybzuwjgzrghiwsjcxlva-dot-gl9393jan.uk.r.appspot.com
  ulxsa.shoesmogul.com
  ulyssemarketing.com
  ulyt.vipsnapchatsexting.com
@@ -271980,7 +270729,6 @@ umcg.world
  umconnectumt-my.sharepoint.com
  umctech.duckdns.org
  umdbamlab.com
-umebaebqtsrymauplxkjrelrcw-dot-gl9393jan.uk.r.appspot.com
  umeed.app
  umeedupvanfoundation.com
  umekq.rogagot.com
@@ -272024,7 +270772,7 @@ umuugbmalw.duckdns.org
  umwelt-kirchhof.de
  umweltreportcom.shaxiaprimary.top
  umwlifkboygteuotnyfhknagui-dot-gl9393jan.uk.r.appspot.com
-umzzkrgtnahsivpvhxtrukqyoi-dot-gl9393jan.uk.r.appspot.com
+umxxstkkpivsijrrnolcixshjd-dot-gleow2021ja.ue.r.appspot.com
  un-538059170.letsfitworld.com
  un-702152396.letsfitworld.com
  un-905474697.letsfitworld.com
@@ -272033,7 +270781,6 @@ un5pcj8j0pkyemnr3jaj8.avlto.host
  una-studios.com
  unaccpetable.publicvm.com
  unadd-newpayee.com
-unadmonished-highwa.000webhostapp.com
  unagi-eu.amazon.aws-sec-ure.loseyourip.com
  unallied-stand.000webhostapp.com
  unamak.com
@@ -272550,6 +271297,7 @@ unoppressive-notati.000webhostapp.com
  unoppressive-operat.000webhostapp.com
  unoswap.xyz
  unovaanywingpqtgdoxikdlvmn-dot-gleowayel400503.uc.r.appspot.com
+unpair-auth-device.co.uk
  unpair-device-faculty.co.uk
  unpairing-device.cc
  unpairing-newdevice.cc
@@ -272561,7 +271309,6 @@ unpobanhugh.tk
  unprofessor.xyz
  unprohibited-zips.000webhostapp.com
  unprophetic-chains.000webhostapp.com
-unprovident-safegua.000webhostapp.com
  unprovocative-round.000webhostapp.com
  unpurchasable-propo.000webhostapp.com
  unpurified-worth.000webhostapp.com
@@ -272802,12 +271549,10 @@ uomioin.com
  uooleunfljlaguriuhbswnsvhx-dot-gleowayel400503.uc.r.appspot.com
  uopredsaubga.gq
  uosnesa.sbxqpezcarnn.top
-uoswxxbybokhrirlqlnirrauln-dot-gl9393jan.uk.r.appspot.com
  uou293que-otima-e-top-semana.com
  uowedu.moonfruit.com
  uowioseave.ga
  uownleave.tk
-uozajgbxwrukvygokdzfeytcmy-dot-gl9393jan.uk.r.appspot.com
  up-liner.ru
  up-login-after-pay.com
  up-pro.apps-repository.net
@@ -272832,7 +271577,6 @@ upbeat-kalam-2d873c.netlify.app
  upbraiding-recapitu.000webhostapp.com
  upbzivot.com
  upcarpets.com
-upcgxzngcavxqjbxhquwhwdjmk-dot-gl9393jan.uk.r.appspot.com
  upchaselog66.webcindario.com
  upcom-pro.be
  upcoming100.com
@@ -273093,6 +271837,7 @@ updatechasebank.bizgrow.host
  updatechasebankdetails.updatedomainchasebankinfo.com
  updatechaseonlinebanking.bankingserverupdate.com
  updated-3info.com
+updated-ee-billling.com
  updated-information.account-locked.rahmandner.info
  updatedaily.in
  updatedata.salesconinc.ml
@@ -273231,7 +271976,6 @@ updatesrv2.bounceme.net
  updatesuport.com
  updatesystem.linkpc.net
  updatesysteml.ddns.net
-updatetaxrefunddetails.com
  updatetaxtermquickaccesssite09874321.fortunaseriquezas.com.br
  updateteam210.weebly.com
  updatetemp.temp.swtest.ru
@@ -273354,7 +272098,6 @@ upgradinglevel.weebly.com
  upgradnocst.tk
  upgradskill.com
  upgrdmailw.com
-upgrdmemberwellsship10.000webhostapp.com
  upheldharpy.com
  uphokety.com
  uphxuxcuqchlqqqtzsvkqdpiyc-dot-gleowayel400503.uc.r.appspot.com
@@ -273450,7 +272193,6 @@ upzpage.000webhostapp.com
  upzuy.417mcp.com
  upzvaladating.000webhostapp.com
  uqcafzerqguyypgket.top
-uqcsihipkbquvcewtqfmpjyeen-dot-gl9393jan.uk.r.appspot.com
  uqeuwdnsuhaajfoabgygrnhlylnpuztatmxe-dot-cedar-code-289917.nn.r.appspot.com
  uqgjbqprvwbxlhwdvtilznrihgigtqchyykk-dot-cryptic-now-290917.ey.r.appspot.com
  uqhaeuohi.weebly.com
@@ -273587,14 +272329,12 @@ urogyn-workshops.com
  urokzqwdljjctiagnbbzyzegknrvzowpkazz-dot-glegen303939423233.ue.r.appspot.com
  urologysocietypune.com
  urquilam.com.ar
-urrkpfzmopdawirohxmfojhoqi-dot-gl9393jan.uk.r.appspot.com
  ursreklam.com
  ursulamalls.cf
  urteste.com
  urtnzxmanfpqywbzmg.top
  urtoothfairy.com
  urtut.ru
-urtvutsiynztziszmacqtwonpl-dot-gl9393jan.uk.r.appspot.com
  urtx.ilramodellestreghe.it
  urubnk.com
  urutbersalinmama.com
@@ -274095,7 +272835,6 @@ usmilitaryleaveboard.co
  usnamzone.lzhhsbsjy.top
  usnetflixbills.com
  usnflx-deijhwavay.millennialj.com
-usnkbkejkeiopcpzatbxdyxdzy-dot-gl9393jan.uk.r.appspot.com
  usnqllrrcsisybetsjpzetzzsz-dot-gleowayel400503.uc.r.appspot.com
  usolutionz.com
  usomilhas.com
@@ -274106,7 +272845,6 @@ uspeshnybusiness.ru
  uspsdelvery-001-site1.atempurl.com
  uspsworldwide.com
  usqazt.cn
-usquikqrrqqqrvkqyv00vkqvyqx3vauthport.fra1.cdn.digitaloceanspaces.com
  usr-d892441e6392cbd3aaf41015.000webhostapp.com
  usr-sanpetru.ro
  usr.org.ua
@@ -274231,7 +272969,6 @@ utransilvania.ro
  uttarakhandghoomo.com
  uttarakhandvarta.com
  utting.org
-uttqvitttjnsnuyzprdlgyajyt-dot-gl9393jan.uk.r.appspot.com
  utvjhkpvbuaivuthtadpwaoxiy-dot-gleowayel400503.uc.r.appspot.com
  utyr.gearhostpreview.com
  utzjdwntawovgzbtazjnmlhazeplpzrgjbvr-dot-offgl8876899977678.uk.r.appspot.com
@@ -274249,7 +272986,6 @@ uuldoktxzffetlihiidsebtdyl-dot-gloff849483.uk.r.appspot.com
  uumove.com
  uundreeme02020-life.tk
  uuq.biogenicherb.com
-uuqpvdnjbryuuqcydzvdltyhkc-dot-gl9393jan.uk.r.appspot.com
  uurfgbbvjbfkhmoprxbsletehx-dot-gleowayel400503.uc.r.appspot.com
  uuspold.ee
  uusprun5.azurewebsites.net
@@ -274282,7 +273018,6 @@ uvnvrxhswoihkubdiyjxztpneyyfqlxkflim-dot-solar-vertex-285913.rj.r.appspot.com
  uvoq.gikorip.net
  uvsgodtbzlgfogunrsistvhhcw-dot-gleowayel400503.uc.r.appspot.com
  uvsrvfssjhjmuafbpb.top
-uvualybdvcafnhjvtetxszhrec-dot-gl9393jan.uk.r.appspot.com
  uvurinestl.com
  uvwxi.cn
  uvykhfdxekfxueznnhz.top
@@ -274356,7 +273091,6 @@ uxlsfxdevcstmpuomiiidxlbtw-dot-gleowayel400503.uc.r.appspot.com
  uxlylzesvw.duckdns.org
  uxmks.com
  uxmmuifcvdeiprfwnydgujjfmw-dot-gl9393jan.uk.r.appspot.com
-uxngumkhxwlfacemwcqnwrcxgk-dot-gl9393jan.uk.r.appspot.com
  uxomevsrhoiofvylgpqemlgiagalhcbujngo-dot-cryptic-now-290917.ey.r.appspot.com
  uxqfzkniae.rfzzkmmtoa.top
  uxqqkord.vipsnapchatsexting.com
@@ -274381,7 +273115,6 @@ uyhqtddgfzxhdyxprpydxuwqkinqgwefwsiw-dot-solar-vertex-285913.rj.r.appspot.com
  uyhtlobrvtvcowzazqcbbuqbipflhehrwiau-dot-cryptic-now-290917.ey.r.appspot.com
  uyikjtn.eu
  uyl9so2ddlulwtrg4.com
-uynytmtmybvgamjmrzoupahnef-dot-gl9393jan.uk.r.appspot.com
  uyrsghb.goruli.com
  uyrt.hushenzhen.cn
  uyrtcgrfgbchnrjer.weebly.com
@@ -274622,7 +273355,6 @@ valiance.uk
  valiantlogistics.org
  valiantmarkets.info
  valid-billing.com
-valid-dev-auth.com
  valid-paxful.com
  validacao-acesso01.zapto.org
  validacion-garena-diamantes.com
@@ -274709,7 +273441,6 @@ valtergrass.com
  valterviana.com.br
  valuablesbells.top
  valuecheep53.com
-valueesgdkzkipypgajzcqbutq-dot-gleow2021ja.ue.r.appspot.com
  valueeurocoins.altervista.org
  valuescaucus.org
  valuesys166.com
@@ -274981,7 +273712,6 @@ vbiicnelmibqlsjxujyjiildbt-dot-gleowayel400503.uc.r.appspot.com
  vbivngfkoioeryyrbtwniabmgd-dot-gleowayel400503.uc.r.appspot.com
  vbizaudyiaud.com
  vbizemail.com
-vbjeuougqpngnmpytlqrcaljiy-dot-gl9393jan.uk.r.appspot.com
  vbkrdrpqmzefesfpesghaudvdpwpdltlkezn-dot-solar-vertex-285913.rj.r.appspot.com
  vbkw.vipsnapchatsexting.com
  vblpeor.com
@@ -274993,7 +273723,6 @@ vbntpwcu.goruli.com
  vbntrolopokowi.tk
  vboglcom.nckiregister.gdn
  vbpgodpvybhvfpusikokwpgvgw-dot-gloff849483.uk.r.appspot.com
-vbpnnmugpttjtrawpmnaffjfyw-dot-gleow2021ja.ue.r.appspot.com
  vbqxrdmzywejnef.top
  vbr4-5886958.xyz
  vbrxhftyhgptsnloutpvwqudhafwfcpexsav-dot-glenxpecial3009493.ey.r.appspot.com
@@ -275008,7 +273737,6 @@ vbtwwztzpadwlfwcgwdgnhwzkj-dot-gloff849483.uk.r.appspot.com
  vbuhaisd.com
  vbujyxybqnqgujeang.top
  vbwfbaezngwncamknotlwkpyvagpkskklocm-dot-cryptic-now-290917.ey.r.appspot.com
-vbwrncjjeuzggzxmsrwjawbsbh-dot-gleow2021ja.ue.r.appspot.com
  vbxdrs.com
  vbxfdgrt.cf
  vbyaudyiaud.com
@@ -275035,14 +273763,10 @@ vcf45df.com
  vcfh4wsdxxc.appspot.com
  vcfyf.kpzsom.cn
  vchosting.ddns.net
-vcjjjqnoutohhmfikymeqbofab-dot-gl9393jan.uk.r.appspot.com
-vcjxrbadjphiotxbbpgulxnlfh-dot-gl9393jan.uk.r.appspot.com
  vclmemos.surge.sh
  vclmmsorg.yolasite.com
-vclnegckukxgpfiiebeafcvixd-dot-gl9393jan.uk.r.appspot.com
  vcloud.exchangevoiceapps.ga
  vcmessagehelp.com
-vcmwsnpqajdioqmvvcggcisvzr-dot-gl9393jan.uk.r.appspot.com
  vcnxvbcx.000webhostapp.com
  vcol.000webhostapp.com
  vcom.vipcentr.ru
@@ -275054,9 +273778,7 @@ vcpxzbnmoplrtfs.host
  vcqwxaeuyrpplnvrdcxaqswif.club
  vcroyal.com
  vcrvdff.com
-vcs-bokep-gratis-full-movie-tante-basah-hd-06.000webhostapp.com
  vcs-bokep-gratis-memek-basah-full-hd-movie-61.000webhostapp.com
-vcs-gratis-dan-vidio-bokep-indo-japan.000webhostapp.com
  vcs-janda-memek-basah-bokep-gratis-movie-hd-0.000webhostapp.com
  vcs-janda-memek-basah-bokep-gratis-movie-hd-8.000webhostapp.com
  vcs-janda-memek-basah-bokep-movie-hot-anal-97.000webhostapp.com
@@ -275065,7 +273787,6 @@ vcs-video-bokep-gratis-khusus-indo.000webhostapp.com
  vcsfs.com
  vcsgratisdangruopvidiobokepindoterbaruhdd.000webhostapp.com
  vcsgrupwhatsapp.kuotaku-gratis.gq
-vcxcbemczvgowgyeibqbuaazaw-dot-gl9393jan.uk.r.appspot.com
  vcxcdrt54dfs.000webhostapp.com
  vcxg1e45e21ewgym.monster
  vcxlcyqielvrmjumimsagnwqzemxfmzbjusi-dot-solar-vertex-285913.rj.r.appspot.com
@@ -275230,6 +273951,7 @@ vellz0n.com
  velo2.mon-application.com
  velodomm.ru
  veloelectriqueassurancecom.nckifitness.gdn
+velostation.ml
  velozlubrificantes.com.br
  veltz3d.com
  velve20.ml
@@ -275483,7 +274205,6 @@ verif-ppl.serveftp.com
  verif-probox11.yolasite.com
  verif-probox3.yolasite.com
  verif-your-account.applevalide.com
-verif.copyright-instagramid.ml
  verif.pp-recouvrement-paiement.com
  verif.services
  verif1-ac0nt.com
@@ -275574,7 +274295,6 @@ verificartbcponline.lalipos.com
  verificartbcpsmovil.cola-ge.com
  verificartbcpsonline.cub-rocv.com
  verificarvialbcpenlinea.est-bcps.com
-verificasicurezza-lnformazione.com
  verificasosislogino.com
  verificasteya.zz.com.ve
  verificasucuenta.moonfruit.ml
@@ -275938,7 +274658,6 @@ verify-att.com
  verify-auone.com
  verify-b-c-p.dns-cloud.net
  verify-b-c-p.perucomer.com
-verify-bill-ee.com
  verify-billing-address.jadibikin-pede.club
  verify-billing-details.com
  verify-bluebadge.ga
@@ -275972,7 +274691,6 @@ verify-ee.update-eebilling.mobi
  verify-fb-account.com
  verify-fbinfo.com
  verify-gov.com
-verify-hali.com
  verify-halifax-devices.com
  verify-halifax-payee.com
  verify-halifax.com
@@ -276025,6 +274743,7 @@ verify-new-payee.com
  verify-newdevice.cc
  verify-newdevice.com
  verify-newdevices.com
+verify-newrecipient.com
  verify-notice-wells.network
  verify-notice.network
  verify-o2-billing.com
@@ -276328,7 +275047,6 @@ verifysecure.me
  verifysupport-aib.com
  verifytax-refund-gov.com
  verifyteam-instagram.ml
-verifytheaccounts.com
  verifythreebilling.com
  verifytickforms.com
  verifyuk-govonline.com
@@ -276368,10 +275086,8 @@ veritificartbcpmovil-peru.cola-ge.com
  veritress.info
  veritynova.com
  veritype166.com
-verivikasi-pemblokiran-fb07.ga
+verivikasi-pemblokiran-fb05.tk
  verivikasi-pemblokiran-fb07.gq
-verivikasi-pemblokiran-fb07.ml
-verivikasi-pemblokiran-fb07.tk
  verivikasi.fego-xfb.cf
  verixon.co.uk
  verizon-3support.com
@@ -276496,7 +275212,6 @@ very-actapt.000webhostapp.com
  very-app.com
  very.ruvmp.ru
  veryclocksiet.ddnsfree.com
-veryfi-neww.cf
  verynickfbcom.000webhostapp.com
  veryplushhair.com
  veryspec.co.uk
@@ -276596,11 +275311,9 @@ vfhdebjwk5.com
  vfhsnzwmuqclhfswwxgtsdnwqp-dot-gleowayel400503.uc.r.appspot.com
  vfixarqwxdwtbgrmppthervrab-dot-gleowayel400503.uc.r.appspot.com
  vfk.000webhostapp.com
-vfldojxovhavmbdjjrzypdtflz-dot-gl9393jan.uk.r.appspot.com
  vflhvavyllbswjeugroyqutjjh-dot-gleowayel400503.uc.r.appspot.com
  vfocus.net
  vfootcare.com
-vfphptssycvwjrkomwlitgzvtw-dot-gl9393jan.uk.r.appspot.com
  vfsds.com
  vftgrf.kozow.com
  vftrrytdtf.net
@@ -276898,7 +275611,6 @@ videobokep-terbaru-hot.000webhostapp.com
  videobokep2020gratisxha.000webhostapp.com
  videobokepgrupwhatsapljoin.000webhostapp.com
  videobokephott.000webhostapp.com
-videobokepmahasiswidanvcshd001.000webhostapp.com
  videobokepskandalterbaru2020pastinyaenak.free-myovl.tk
  videobokepterbaruloh.000webhostapp.com
  videobokepterhot.000webhostapp.com
@@ -276992,7 +275704,6 @@ videoviral.wikaba.com
  videoviral778.site
  videoviralaku.site
  videoviralbikinbasah.000webhostapp.com
-videovirall.my03.com
  videowhattsapterbaru.000webhostapp.com
  videox18.ooguy.com
  videoxx18wahatsapp.25u.com
@@ -277009,7 +275720,6 @@ vidio-bokep-dwasa-www.000webhostapp.com
  vidio-bokep-indo-www.000webhostapp.com
  vidio-bokepviral-2020.000webhostapp.com
  vidio-dewasa-jepang-www.000webhostapp.com
-vidio-hot-sexs.000webhostapp.com
  vidio-sex-18plus.000webhostapp.com
  vidio-sexy-bokep-indo-www.000webhostapp.com
  vidio-viral19.wikaba.com
@@ -277085,7 +275795,6 @@ view-fbmsg.review-messenger.ga
  view-halifx.me
  view-instgram-iogin.000webhostapp.com
  view-item.shop
-view-my3-co-uk.000webhostapp.com
  view-mypayees-login.com
  view-mypayees.co.uk
  view-mypayees.com
@@ -277140,7 +275849,6 @@ viewmypayee.co.uk
  viewmypayees-online.com
  viewmyphotos.plantarinapoli.com
  viewnepal.com
-viewoffice365docx.myftp.biz
  viewonline-payees.com
  viewpayee.co.uk
  viewpayees-online.co.uk
@@ -277401,7 +276109,6 @@ viphostindustries.info
  vipi.co.ke
  vipitalycom.batwoqisellers.top
  vipitalycom.nckicruise.gdn
-vipixcreative.com
  vipkeycb.ae
  vipkon.com.tr
  viplight.ae
@@ -277412,6 +276119,7 @@ vipmein.com
  vipmerchantclub.com
  vipmom.000webhostapp.com
  vipnetworkonline.com
+vipnewhatsappgrupsexyy.wikaba.com
  vipno.cf
  vipoutdoorsportsjapmarket.club
  vipplusavlu.com
@@ -277583,7 +276291,6 @@ virtualsynopsis.com
  virtualwebdata.com
  virtualworldprojectcom.batwoqiseller.top
  virtudepaisefilhos.com.br
-virtueless-grass.000webhostapp.com
  virtueless-multipli.000webhostapp.com
  virtulavpilotuds.us
  virtuosoagency.com
@@ -277624,7 +276331,6 @@ viseny.com
  viservice0.from-fl.com
  vishald24.000webhostapp.com
  vishalkalptaru.in
-vishalpaper.com
  vishwakarmaacademy.com
  vishwasanket.com
  visiativ-industry.fr
@@ -277698,6 +276404,7 @@ visualeyestuscaloosa.com
  visualfirewall.com
  visualhome.cl
  visualhorsepowerserver.com
+visualizar.recptsclientes.com
  visualized-schedule.000webhostapp.com
  visualizzamovimenti.com
  visuallychallenged.com
@@ -277748,7 +276455,6 @@ vito.sspu.sumy.ua
  vitoriamodaintima.com.br
  vitorydasdhrig.com
  vitproupdatess.com
-vitqogtlstbautqelccmhkpfmy-dot-gleow2021ja.ue.r.appspot.com
  vitranphotography.com
  vitrescible-attract.000webhostapp.com
  vitrinejb.com.br
@@ -277810,7 +276516,6 @@ vixim.com.mx
  vixpwenfq.goruli.com
  vizagsource.com
  vizertv.xyz
-vizgemgbyvpeeaoggfxhcuryov-dot-gl9393jan.uk.r.appspot.com
  vizor.cloud
  vizpoets.com
  vizzamedia.com
@@ -278139,7 +276844,6 @@ vmphotograph.com
  vmpzdsbnztmycvmztp.top
  vmracing507.com
  vmrbuildcon.com
-vmrwbyczbqkqaqoqaaiufbeanz-dot-gl9393jan.uk.r.appspot.com
  vmsconstructions.in
  vmsecityurevz.pw
  vmsecuritysolutions.com
@@ -278323,7 +277027,6 @@ voiced-exhausts.000webhostapp.com
  voiceduration1.website
  voicedxtel.azurewebsites.net
  voicefax98877645678.club
-voiceful-broadcast.000webhostapp.com
  voicehello.z22.web.core.windows.net
  voicelsp.com
  voicemail.sytes.net
@@ -278353,6 +277056,7 @@ voiceutil166.com
  voicevoipmessage.com
  voicewebmailweb.com
  void.messangerhosting.com
+voidemodems.casa
  voilaparisinterior.com
  voip-server.voced-mxd.xyz
  voip96.ru
@@ -278427,7 +277131,6 @@ vonunger-representaciones.cl
  voobzfreight.co.za
  vood8zp5kg8e.talagaremix.com
  voodoo4tactical.com
-voomzytqpumqqvksqlxriwdkeh-dot-gl9393jan.uk.r.appspot.com
  voorzorgmaatregel.info
  vootseries.gq
  vootseries.tk
@@ -278498,6 +277201,7 @@ votre-smsvocale-telephone.web.app
  votre-telfixe-appelorange.web.app
  votreboitemail.com
  votrecomptepay.000webhostapp.com
+votreportailvocaleinfo.firebaseapp.com
  votresecupass.is-great.org
  votresecuripass.is-great.org
  votresmsvocaleprosecur.firebaseapp.com
@@ -278544,7 +277248,6 @@ vpass.club
  vpass.site
  vpassecojp.com
  vpayrupay.com
-vpbynhtvgujuseyxbtrmvrssua-dot-gl9393jan.uk.r.appspot.com
  vpcbnxlflipkryqxcwahjnxvwgguvkmnqokr-dot-solar-vertex-285913.rj.r.appspot.com
  vpdhfq.shoesmogul.com
  vpe01rvry01srvcepge01.my.id
@@ -278640,7 +277343,6 @@ vra-srl.com
  vra4.com
  vraag-nu-aan-online.eu
  vraagaan.space
-vrachinformy.ru
  vrachogan.cloudaccess.host
  vrajexports.com
  vrankendiamant.co.kr
@@ -278692,7 +277394,6 @@ vrtxx64uo.com
  vru1zyf6.firebaseapp.com
  vruiolbpaeajrdwmthrxqpaegq-dot-gleowayel400503.uc.r.appspot.com
  vrukshstore.com
-vrwacrjyahqxcrotvmfpjbcagr-dot-gl9393jan.uk.r.appspot.com
  vrxcmvzlcmngjfokydinnbuakczpmeiahqgk-dot-cedar-code-289917.nn.r.appspot.com
  vryxtctpuehkqxsngzyjhpobsqqejygetpuz-dot-cedar-code-289917.nn.r.appspot.com
  vrz-recycle.info
@@ -278771,7 +277472,6 @@ vtk-group.xyz
  vtlduwqgudiqwsqbyhipstaadmkgwevaqqwb-dot-solar-vertex-285913.rj.r.appspot.com
  vtm.olastech.com
  vtnbapizsymnjfcqjivfmxicjh-dot-gleowayel400503.uc.r.appspot.com
-vtnfsqdyfuxgqctzxcjoqpuoge-dot-gl9393jan.uk.r.appspot.com
  vto-netflix.com
  vtoroe-mnenie.ru
  vtorrancekx59.com
@@ -278783,11 +277483,10 @@ vtscomputers.com
  vtsjythatuhxotqmmkbkvmisiz-dot-gleowayel400503.uc.r.appspot.com
  vtvstudio.com
  vtxmail2018.myfreesites.net
+vtxojkmjfbtfqluqlxgxlylyvo-dot-gleow2021ja.ue.r.appspot.com
  vtxwtpuixfjzqyjixfmrcvvfbv-dot-gleowayel400503.uc.r.appspot.com
  vtyllllyxl.duckdns.org
  vtzgr13l.firebaseapp.com
-vtzqsykanwqfgrbqsrkmemynhe-dot-gl9393jan.uk.r.appspot.com
-vtzswzpwkhydskwqnbrjzpvjjp-dot-gl9393jan.uk.r.appspot.com
  vuaekfyw.goruli.com
  vuatritue.com
  vuavu.elhyel.xyz
@@ -278821,7 +277520,6 @@ vuotolauta.tk
  vuqebnzsipjkqtdecdcskfjolp-dot-gleowayel400503.uc.r.appspot.com
  vuqshvswcvpktagkorazhjmdpbpseuuhwslf-dot-cedar-code-289917.nn.r.appspot.com
  vuqxlbgjphxuvfmnfvel-dot-gleowyel040493443434989.wl.r.appspot.com
-vurihdzmbltcyprzdmmcwgqrcl-dot-gl9393jan.uk.r.appspot.com
  vurl.bz
  vuuhhuihhh.duckdns.org
  vuurwerkhallen.nl
@@ -278852,6 +277550,7 @@ vvhjrew.goruli.com
  vvho-dropb0xcloud.selfip.com
  vvhsd.com
  vvhsecityurvs.pw
+vviop-grupmabar-2021.cf
  vvip864.ml
  vvipidm.com
  vvipx.net
@@ -278905,7 +277604,6 @@ vvww-cdek.ru
  vvww1royallbank.com
  vvwwbcpzonasegurabeta.com
  vvwwrolox.com
-vvybxeefvueluyrptxycusoljp-dot-gl9393jan.uk.r.appspot.com
  vvyucgyyeqwjzynkyevd.top
  vvzsipvqqelkgbvxhzcxsvzglk-dot-gl9393jan.uk.r.appspot.com
  vw.perlqw.net
@@ -278918,14 +277616,11 @@ vwets.ooguy.com
  vwfmpoemc.goruli.com
  vwgbmftwovlgbfxzxxbybnfwyb-dot-gleowayel400503.uc.r.appspot.com
  vwgwvsyjmtxqulkedvmqsbpyicvqpjpxttug-dot-glxcel49934343434.rj.r.appspot.com
-vwhigkjspbesupjvkcemgzfpro-dot-gl9393jan.uk.r.appspot.com
-vwjttckusqowmcksfkivohwbvq-dot-gl9393jan.uk.r.appspot.com
  vwkslhuujclbtxahxvvbpbdqzp-dot-gleowayel400503.uc.r.appspot.com
  vwmaster.hu
  vwmdqvjrdechabwxze.top
  vwnekb.goruli.com
  vwopeyiwqtkvdjrhzcdvdlckzq-dot-gloff849483.uk.r.appspot.com
-vwqufehzbyblswzjczaifcsfiy-dot-gl9393jan.uk.r.appspot.com
  vwrtbkcvkdcblgxyezytinngzy-dot-gleowayel400503.uc.r.appspot.com
  vwsplmail.com
  vwtmvqkerogeubcwlzbbpzewrgjycweppopf-dot-cryptic-now-290917.ey.r.appspot.com
@@ -278935,7 +277630,6 @@ vwvdqut.mapstore.su
  vwvios.pw
  vwvw.xn--znsgrb1-lwaf5g4c7b1e.clan.ec
  vwvwseguridadbbvidigital.com
-vwvwvconti-aletaseguridadpe.com
  vww-be.firebaseapp.com
  vww-garantibbva.org
  vww.bcpviabetazonasegura.com
@@ -278955,14 +277649,12 @@ vxcznbvbzcxn.servecounterstrike.com
  vxcztta.cam
  vxgdft.shoesmogul.com
  vxgqejudtcxyhwxz.top
-vxhwrwqswtsitdhcmdarktuhux-dot-gl9393jan.uk.r.appspot.com
  vxikjexwwnoaggkxewrbmxemxygzufubcrmq-dot-glegen303939423233.ue.r.appspot.com
  vxneczocizlbnxvflbzmtucxun-dot-gleowayel400503.uc.r.appspot.com
  vxojeldzonjlqzrfeolxpatjiilduxvphnyz-dot-solar-vertex-285913.rj.r.appspot.com
  vxptecwkptoevzzv-dot-millinium.ey.r.appspot.com
  vxqghurwhvineepy.oragondesignstudio.com
  vxqkhzourygtzxanxalrjnsjjxelxzxgzcme-dot-solar-vertex-285913.rj.r.appspot.com
-vxqmydlockcygminkoyokmvbyz-dot-gl9393jan.uk.r.appspot.com
  vxser.com
  vxssarhqelaonaedtbnpwlduqrxkywgswjta-dot-glegen303939423233.ue.r.appspot.com
  vxswqefit.com
@@ -278990,7 +277682,6 @@ vyojkgvwxephfjevkevcqjnslyjwfbveakfj-dot-offglen.uk.r.appspot.com
  vyrlksauqzrsvnlflbrhteudgjxjeqvfashn-dot-glenxpecial3009493.ey.r.appspot.com
  vyroba-plotov-bran.sk
  vyrtfcadclhbjfeqwnpcptpwzwkyxtyhxdfh-dot-cedar-code-289917.nn.r.appspot.com
-vysibmdlctbtcloigbscimfzax-dot-gl9393jan.uk.r.appspot.com
  vysimopoulos.com
  vysix.nl
  vysokepole.eu
@@ -279088,6 +277779,7 @@ w1-amazon-co-jp.buzz
  w1.aplicativomobile.me
  w1.digitalquarentena.com
  w16pq.alnawwar.com
+w1bmo.xyz
  w1dag.mentriqq.com
  w1etvrvo5p.vercel.app
  w1glv.com
@@ -279187,11 +277879,11 @@ wa-joined.grubb-whatsapp.cf
  wa-joingrup188.ezua.com
  wa-logs.ml
  wa-mabar-freefire.zzux.com
+wa-masuk-grup.tk
  wa-porninvt.xxx-wa.com
  wa-porninvt3.xxx-wa.com
  wa-producoes.com.br
  wa-youtuber-freefire.tk
-wa-youtuberr.tk
  wa.event-indo.com
  wa.userka.com
  wa10.trickip.net
@@ -279232,7 +277924,6 @@ wachten-moment.com
  wachtopverbinding.com
  wachtsgroups.frezze.ml
  wacingid.000webhostapp.com
-wacjpcrpmnvjbuyuesvanujkwf-dot-gl9393jan.uk.r.appspot.com
  waco365.org
  wacochamber.com
  wacstderypasgzlrlosjmxpgeslxigbvshkh-dot-solar-vertex-285913.rj.r.appspot.com
@@ -279623,7 +278314,6 @@ wastebilliest.com
  wasteraq.com
  wasteraq.net
  wastewatertreatmentplantscom.chifanblood.top
-wasting-rod.000webhostapp.com
  wastrumermity.xyz
  wasxe.xyz
  wasze-info3.x9.eu
@@ -279760,7 +278450,6 @@ waynela.com
  waynemarketingenterprisesinc.com
  waynencjscjsdcjlkbasm.yolasite.com
  waynes.com.br
-wayone12.000webhostapp.com
  wayrestylephotoblog.com
  waysbanking.com
  waystoneentertainment.com
@@ -279809,7 +278498,6 @@ wbservicingforelsh73d.xyz
  wbsfty6in.com
  wbstormer.com
  wbstudiodesigns.com
-wbtikyutwytqceybrbvmyipcsu-dot-gl9393jan.uk.r.appspot.com
  wbtseerverjs.weebly.com
  wbusinessquare.com
  wbw.acelebrationoflove.net
@@ -279852,7 +278540,6 @@ wcurrentlyattyahoo.weebly.com
  wcustormsigns.com
  wcutmywajrtgxbaydhipyyajcijmpnjqtnab-dot-gl494903049.wl.r.appspot.com
  wcvxbvf.ug
-wcwsdsseiqtigfynlrafrltipz-dot-gl9393jan.uk.r.appspot.com
  wcx666.com
  wcxfaf.rogagot.com
  wcxxppnmriysclhjoumgdwyzojxrqmvzqhfh-dot-solar-vertex-285913.rj.r.appspot.com
@@ -279962,7 +278649,6 @@ wdjhb.mentriqq.com
  wdjkk73.tw
  wdjrq.awaykart.com
  wdkdwq.is-a-financialadvisor.com
-wdlvfjmhgprftibqreoctyjnei-dot-gl9393jan.uk.r.appspot.com
  wdmcs.avantgardeservices.in
  wdnmd.lovemiku.me
  wdovfstiklxxvrrnzpysecwzqonptizknkwt-dot-cedar-code-289917.nn.r.appspot.com
@@ -280144,6 +278830,7 @@ web-page-amzn-account-verificationj.com
  web-page-amzn-account-verifications.com
  web-paypai.com-secure.verlfyapps-loginfodestlnity.com
  web-paypal.com
+web-proxy.io
  web-reactiveacc0unt.idealseries.info
  web-rechungbetrag-domain.de
  web-registrosonasegvrabnonline1.club
@@ -280685,6 +279372,7 @@ webq.ch
  webq.wikaba.com
  webqdex.com
  webqoder.com
+webradioluterana.com
  webrank.ws
  webrankingsolutions.com
  webrealtorhomes.site
@@ -280797,7 +279485,6 @@ webuyscrapvalves.com
  webuzz.com.pt
  webverif-pp.com
  webverifica.com
-webview-user-auth.000webhostapp.com
  webvk.pp.ua
  webvome.com
  webwhatsapp.business
@@ -280874,7 +279561,6 @@ weeksin-projectmailserver.web.app
  weekskypp.hopto.org
  weenal.info
  weeniecat.com
-weeny-buckle.000webhostapp.com
  weesh.xyz
  weessence.com
  weetmoglen.com
@@ -280949,7 +279635,6 @@ welcome776.000webhostapp.com
  welcomehomerealtyhsv.com
  welcomehouse.ca
  welcomemainoyahoo.weebly.com
-welcomemay.000webhostapp.com
  welcomemidia.com.br
  welcomepage01.hu
  welcometosouthernmd.com
@@ -281204,6 +279889,7 @@ wendeng.yfqzdfd.com
  wendhahmabis1983.blogspot.be
  wendi--toys.com
  wendingzx.com
+wendoun.com
  wendy3217523.xyz
  wendy34564234.xyz
  wendy878347.xyz
@@ -281221,7 +279907,6 @@ wenti.000webhostapp.com
  wentuomachinery.com
  wenusemeee.com
  wenzhou.06wi.com
-weoillsfargonewssth.000webhostapp.com
  weorder-xrs.000webhostapp.com
  weowx.com
  weplayaem.com
@@ -281337,7 +280022,6 @@ westchesterpestcontrolpros.com
  westcoast437.club
  westcoastcharities.com
  westcoastsustainable.com
-westcode.tk
  westconsumernews.com
  westcopy.weebly.com
  westcountygold.com
@@ -281541,14 +280225,12 @@ wfdazhutou.ltd
  wfdons.ru
  wfendo.com
  wferreira.adv.br
-wffsirpajpoalbuuodexswrcrm-dot-gl9393jan.uk.r.appspot.com
  wfg3.blissgood.ru
  wfgk.awaykart.com
  wfiufsyxgitg.top
  wfjmbf.vip
  wflecdmsnydxkrekjjaxrnhvmp-dot-gleowayel400503.uc.r.appspot.com
  wfljzg.cn
-wfmswhrntrigyxugauynlrjpal-dot-gl9393jan.uk.r.appspot.com
  wfmw.onderhost.com
  wfnjwrqufkfrqpdphudezengrcobiuduknyz-dot-glxcel49934343434.rj.r.appspot.com
  wfnoioteinnfweswsbbuxbyqhg-dot-gleowayel400503.uc.r.appspot.com
@@ -281742,6 +280424,7 @@ whatsap-invite-groupberbagi8.2waky.com
  whatsap-invitex12-videos2.2waky.com
  whatsap-youtuber.ff-new1.cf
  whatsap.burik-event1.my.id
+whatsap.fun
  whatsap.hol21.design
  whatsap.ionexusa.com
  whatsap01.lflink.com
@@ -282160,6 +280843,8 @@ whatsappgroup19.linkk.ml
  whatsappgroup20.ddns.net
  whatsappgroupbokep.dynamic-dns.net
  whatsappgroupchatjoin8382.squirly.info
+whatsappgrouphotlovers.xxuz.com
+whatsappgroupinviett.jetos.com
  whatsappgroupinvite.ml
  whatsappgroupinvite95.ga
  whatsappgroupinvithot17.jetos.com
@@ -282181,7 +280866,6 @@ whatsappgroupx.ddns.net
  whatsappgrp.joinsgruphot.ml
  whatsappgrpup.myftp.biz
  whatsappgrpup2020.myvnc.com
-whatsappgrub-invite.cf
  whatsappgrub-mabarfreefire-budi01gaming.zzux.com
  whatsappgrub.25u.com
  whatsappgrub.asia
@@ -282238,6 +280922,7 @@ whatsapphot.dumb1.com
  whatsapphot.mywa18.cf
  whatsapphot2020.dynamic-dns.net
  whatsapphotgrup.wa-18.com
+whatsapphotgrup.wikaba.com
  whatsapphotvid.zyns.com
  whatsappindinesia.login-09.gq
  whatsappinvetgroupsexymex.mrslove.com
@@ -282471,7 +281156,6 @@ wheelhousesocial.com
  wheeliebinorg.chifanavoid.top
  wheelwrightky.xyz
  wheezy-drills.000webhostapp.com
-wheljwacstaohkyxcatrzxouyd-dot-gl9393jan.uk.r.appspot.com
  wheltoninsurancecom-dot-phpapp-shshh.df.r.appspot.com
  whenandwheretravel.com
  whenigoalup.net
@@ -282614,6 +281298,7 @@ whosemobilenumberisthis.com
  whsaatsppsxx.ezua.com
  whspiybyokejtlkspiwhurqyqfjajarbouth-dot-cryptic-now-290917.ey.r.appspot.com
  whstappgroupinvitebokep.otzo.com
+whstappgroupjoin18.wikaba.com
  whsx.svcoding.com
  whsyearbook.com
  whtasapp-join-hhtfy.000webhostapp.com
@@ -282627,9 +281312,11 @@ whtsapxnnx162.dynamic-dns.net
  whtsapxnnxx.jetos.com
  whtsaztjaiauztaywnekaiauztztqhqkaozoxndbdjd.000webhostapp.com
  whtsppgrupsharemom.tk
+whtssapp-grupviral2.tk
  whtssapp.ga
  whtssapp.gq
  whtssapp.ml
+whttsaptgrup.25u.com
  whttsaptgrup.ezua.com
  whxjunpwidjysarnbrlsgdwmucaybkgquyfx-dot-solar-vertex-285913.rj.r.appspot.com
  whxoualxllnmvqexmnyogfnwdy-dot-gleowayel400503.uc.r.appspot.com
@@ -282713,8 +281400,6 @@ wielkilukwarty.pl
  wien-mitte.co.at
  wiendle.com
  wiesengrundbayern.shaxiaapril.top
-wieunjtepyxvhzjesvbvaggqub-dot-gl9393jan.uk.r.appspot.com
-wieurqlusdgxhcvrxbncyhvntu-dot-gl9393jan.uk.r.appspot.com
  wiewjdmkfjn.com
  wifeimpact.com
  wifemimi.com
@@ -282727,7 +281412,6 @@ wig-out.org
  wigan-builder.co.uk
  wigfhuipjs.duckdns.org
  wigglez-productions.com
-wigsbmdtvdendxdadbhjxclarw-dot-gl9393jan.uk.r.appspot.com
  wihanstudio.com
  wihnldjgfduflsxfmiqfzuptjrtfwhtfhjzo-dot-cedar-code-289917.nn.r.appspot.com
  wihumanld.com
@@ -282816,6 +281500,7 @@ wildcard.mezcalunion.com
  wildcard.mls-d2-f4-sdd.com
  wildcard.mms-c4d-2w3.com
  wildcard.motakalim.com
+wildcard.nabalifares.ps
  wildcard.newsmedia77.com
  wildcard.oidjwoidj84.com
  wildcard.pawsaccesories.com
@@ -282965,7 +281650,6 @@ wilthywatong.ml
  wilyam30.ddns.net
  wimbert.nl
  wimiliorg.chifanbob.top
-wimlfztwhorcjxnxbrxqqeiina-dot-gl9393jan.uk.r.appspot.com
  wimp-oreoo-43.com
  wimverhuur.be
  win-d-9e817.web.app
@@ -283287,7 +281971,6 @@ wizbiz.online
  wizbiz.today
  wizcountinvests.com
  wizcraftagencies.com
-wizened-type.000webhostapp.com
  wizenedteifi.com
  wizlynxgroup.cn
  wizmozinteractive.com
@@ -283300,11 +281983,8 @@ wj4k.onderhost.com
  wj9xr.addroits.com
  wjamtecadwbgsgpztp.top
  wjanrokttshhwusdoozgfohuhhhzjfesicpg-dot-cryptic-now-290917.ey.r.appspot.com
-wjbgvgxdgmzpjacmgyeznvpill-dot-gl9393jan.uk.r.appspot.com
  wjbnvpsaayhquxfned.top
  wjcctf.com
-wjebhnovsckspjwsxdrzjjtmkc-dot-gl9393jan.uk.r.appspot.com
-wjgfaavnvmrihpgamqikhnlnnh-dot-gl9393jan.uk.r.appspot.com
  wjglvuezaaclvnrcjophktnununjqjiwweiq-dot-glenxpecial3009493.ey.r.appspot.com
  wjjjvzdwfmrygldq-dot-glexcel1.ue.r.appspot.com
  wjjprlmbqubxvngkkdtajewppg-dot-gleowayel400503.uc.r.appspot.com
@@ -283312,7 +281992,6 @@ wjknifeq.fun
  wjknifer.fun
  wjkq2.awaykart.com
  wjkukirzndeucqdkcnoflfdgnsaebroaoodf-dot-cryptic-now-290917.ey.r.appspot.com
-wjkvlbcpapgdxxoaxdiiykefrb-dot-gl9393jan.uk.r.appspot.com
  wjlenezubfhlmztcruyfytaqexvhamgvklyl-dot-glegen303939423233.ue.r.appspot.com
  wjmkswezxkwkpdumqrr.top
  wjoll.goruli.com
@@ -283343,7 +282022,6 @@ wkoenferofilctxwhpxqdzfzwe-dot-gloff849483.uk.r.appspot.com
  wkoreaw.com
  wkp9.svcoding.com
  wkprojekt.lwtrakszhona.com
-wkqpdzbqmqbgxvxapwhourinti-dot-gl9393jan.uk.r.appspot.com
  wkralbvzhkxikgniqvsqndodys-dot-gloff849483.uk.r.appspot.com
  wkreation.com
  wkrprime.com.br
@@ -283585,7 +282263,6 @@ womans-blog.000webhostapp.com
  womansonly.de
  wombat-jab.com
  womboperating.co.za
-womdrdjvtpaxnjlvqwcqvmgyxo-dot-gl9393jan.uk.r.appspot.com
  womenatwebug.online
  womenempowermentpakistan.com
  womenfilmnet.icu
@@ -283710,7 +282387,6 @@ wordpresssetstraight.com
  wordpressthemeplugin.com
  wordpubg.com
  wordsgrowere.com
-wordsworthian-deser.000webhostapp.com
  wordsyouwant.com
  work.digitalvichar.com
  work.jonwillchambers.co.uk
@@ -283971,6 +282647,7 @@ wpr.ams3.digitaloceanspaces.com
  wpracing.com
  wprhz.svcoding.com
  wprt.anahkedm.com
+wpsapk.com
  wpsavmltvsrskovromjrddvzzy-dot-gleowayel400503.uc.r.appspot.com
  wpse.000webhostapp.com
  wpsenlinea.com
@@ -283982,7 +282659,6 @@ wptest.demo-whiterabbit.it
  wptm.instamate.com
  wptp.lianjiewuxian.com
  wpwala.net
-wpwavyyyzrfnmikdkhkwfkofgq-dot-gl9393jan.uk.r.appspot.com
  wpyk.jaysbrand.com
  wpyqh.app.link
  wpywgikfekfbriangfgouakygfdzxpudoykg-dot-offgl8876899977678.uk.r.appspot.com
@@ -284061,7 +282737,6 @@ wrk44.ddns.net
  wrkngspam.ooguy.com
  wrkngspamcasacam.net.eventml.my.id
  wrkngspm01.ooguy.com
-wrkshnomcpnauknlnwgdgqtonv-dot-gl9393jan.uk.r.appspot.com
  wrmlavdojebkkeobebmmwmuakhaczdlchxdj-dot-offglen.uk.r.appspot.com
  wroft-fd.club
  wromedia.co.uk
@@ -284087,7 +282762,6 @@ wrwerer-71.cf
  wrwlyxahvinv5j7.e8273.pro
  wryinfo.info
  wryoilcsrdjetebpdihmgokhlxxctxomjkdn-dot-cryptic-now-290917.ey.r.appspot.com
-wrzjnxprhfdbxakrtmlamwaquw-dot-gl9393jan.uk.r.appspot.com
  wrztnchpouldn.com
  ws-ebavisapia01-dll.ir
  ws.stivenfernando.com
@@ -284131,7 +282805,6 @@ wsquareaccount.com
  wsquareaccountw.com
  wsqy.vipsnapchatsexting.com
  wsrjobrzcgocayyonyaatdpojzbbrwpkcdif-dot-cedar-code-289917.nn.r.appspot.com
-wsrufrjlksjmcpoytnziavowgs-dot-gl9393jan.uk.r.appspot.com
  wss.autotradingservices.com
  wssa-ceeflivves.bounceme.net
  wsspaq.com
@@ -284143,7 +282816,6 @@ wstria.jp
  wstrzymana-paczka-paczkomat.xyz
  wstrzymana-paczka.in.net
  wstx.onderhost.com
-wsulddvmuxpujsghatwjacdkog-dot-gleow2021ja.ue.r.appspot.com
  wsus.ga
  wsxhost.net
  wsxqlmpmytpydicshhuvjkkzur-dot-gloff849483.uk.r.appspot.com
@@ -284178,7 +282850,6 @@ wtbvrcylv.goruli.com
  wtc-noida.website
  wtcacoh.topkorder.su
  wtcfa.wtc-demo.net
-wtcilzowmybqkjatlaloacmnsp-dot-gl9393jan.uk.r.appspot.com
  wtcsurabaya.com
  wtdpcb.com
  wteas.xyz
@@ -284196,7 +282867,6 @@ wtherss.club
  wthpeokihvtlbtudldofmhrdoo-dot-gleowayel400503.uc.r.appspot.com
  wthwkdeegk.duckdns.org
  wtitrzdcurzitn.com
-wtkebnwdxagchciiximwrwlavz-dot-gl9393jan.uk.r.appspot.com
  wtmrktdbg.goruli.com
  wtn6738hwrt38mnxy.mattsenior1.repl.co
  wtonjdrlaiiksffekxcqnaalmy-dot-gleowayel400503.uc.r.appspot.com
@@ -284291,7 +282961,6 @@ wvobvyitai.topkorder.su
  wvougdkzwdxfhhghbjrggxmktuufastsupwx-dot-cryptic-now-290917.ey.r.appspot.com
  wvrmq5xtoygs.talagaremix.com
  wvuo-okes-gwtj-opvx.benwalek.com
-wvuyequimfaxiuykgiphxaufeb-dot-gl9393jan.uk.r.appspot.com
  wvv-rakuten-co-jp-billingupdatekey69.ngascjxq.com
  wvvvv.rakuten-cder.top
  wvvvv.telecreditoweb.me
@@ -284486,13 +283155,11 @@ wwsvvayixy.bestserviceo.su
  wwswa.xyz
  wwt90huau2.theliberates.tech
  wwttmm.com
-wwusplwmxiihcdrftedkupbnjq-dot-gl9393jan.uk.r.appspot.com
  wwv-facebook.com
  wwv.amazon.co.jp-manageaccount.3julishiyutreshipolisht.com
  wwv.chase-online.verify-secured-server.com.infoart.com.br
  wwv.comindexmangerinfoverfiyupdte.com
  wwv.scotiabank.online03scotia.com
-wwvbjklzifcojrarnxyhrubekp-dot-gl9393jan.uk.r.appspot.com
  wwvv-paypal.serveirc.com
  wwvv.bancoestado.cl.alertamovilcl.com
  www---cdek.ru
@@ -284924,7 +283591,6 @@ wx.hu-wo.com
  wx84.svcoding.com
  wx8g.hyperphp.com
  wxapp.vishou.net
-wxbxlxwwgriebniachjsbkiwjs-dot-gl9393jan.uk.r.appspot.com
  wxc5w.svcoding.com
  wxcvddaozc6y4n.com
  wxdgut.cn
@@ -285218,7 +283884,6 @@ xbcnndm.ga
  xbdh66.com
  xbdh6688.com
  xbdqzj.com
-xbedhrhegxqcpjuprpcivsoaea-dot-gl9393jan.uk.r.appspot.com
  xbf.dojnh.com
  xbfrr.xyz
  xbgnwersajqnmlzswkwhrjthpzaxjabvateo-dot-glegen303939423233.ue.r.appspot.com
@@ -285342,7 +284007,6 @@ xe-logistics.com
  xe7nikkij.email
  xebc7.jaysbrand.com
  xebh.goruli.com
-xeceohprgdoyrtckjsnzgsmztc-dot-gl9393jan.uk.r.appspot.com
  xecgrlrcokrknahxzbcnqfgxgnmfszfnpuft-dot-solar-vertex-285913.rj.r.appspot.com
  xecliallandin.xyz
  xecogioisg.com
@@ -285403,8 +284067,6 @@ xescuto.com
  xetaimt.com
  xetgnrjusyxyrlmjacfnjyogjc-dot-gleowayel400503.uc.r.appspot.com
  xetrytv.gb.net
-xeuablwzmmhmcfofayxctsareg-dot-gl9393jan.uk.r.appspot.com
-xeufmsridccqizoaixxmygubgv-dot-gleow2021ja.ue.r.appspot.com
  xexex.duckdns.org
  xexsigukmdiholxuqhvnubwlvdzcqynsvnhg-dot-glegen303939423233.ue.r.appspot.com
  xeynhzaoqu.brandstorey.su
@@ -285441,13 +284103,11 @@ xfinunipextrade.webcindario.com
  xfkeduxutt-4mj6kgk31.vercel.app
  xfmhbpbrvulmazxrsznybdskua-dot-gleowayel400503.uc.r.appspot.com
  xfnzcnedersqiwytvopkagm.top
-xfqrxyipmohbvbipiykgqnbgpo-dot-gl9393jan.uk.r.appspot.com
  xfr-financial.com
  xfreeluckyspin.myvnc.com
  xfroptions.com
  xfspzgxkgtaaphua-dot-millinium.ey.r.appspot.com
  xfthcctcahnfspnydr.top
-xfvhrpmlyccncyknnkdfpsnfva-dot-gl9393jan.uk.r.appspot.com
  xfxcxcvxcvxdfscvcvxfdssfsdfses4w.000webhostapp.com
  xfxiu.vipsnapchatsexting.com
  xfydy.top
@@ -285457,10 +284117,8 @@ xg7wvp3d50qj9tx.gmz.cc
  xgadgetshub.com
  xgbdimdhrjavydbtqvynjkvsaa-dot-gleowayel400503.uc.r.appspot.com
  xgcgonngl.com
-xgebwhztzqfswyaqypnaehukxd-dot-gl9393jan.uk.r.appspot.com
  xgfi.handipants.com
  xgflepvdibpnubdwgwurzhtxupozcsrlpgjv-dot-cedar-code-289917.nn.r.appspot.com
-xgfzwafgvccgyjryjgdvqxiwax-dot-gl9393jan.uk.r.appspot.com
  xggcasex.fun
  xghuacbh.com
  xghyywvutcoq.com
@@ -285476,7 +284134,6 @@ xgolb.com
  xgov.online
  xgqzcmhtzs.duckdns.org
  xgreesti.club
-xgrmxqeznmtkcndhnygpbzjiuk-dot-gl9393jan.uk.r.appspot.com
  xgroup-whatsapp69.zzux.com
  xgsnvqayt.vipsnapchatsexting.com
  xgv.goruli.com
@@ -285504,7 +284161,6 @@ xholls2.ml
  xhost-secure07c-chase.com
  xhot.eventfreex.com
  xhptdckenqtowidpqpjgvqvtxi-dot-gl9393jan.uk.r.appspot.com
-xhpymnpkkskspiophfoduceufx-dot-gl9393jan.uk.r.appspot.com
  xhqaurnoaalyrwhuxkcggwuwqsejnelcdemj-dot-glegen303939423233.ue.r.appspot.com
  xhqsysp.com
  xhsdxm.com
@@ -285532,6 +284188,7 @@ xiangxiang.06rl.com
  xiangxiang.yfqzdfd.com
  xiangxiinfo.ac.cn
  xiangyin.yfqzdfd.com
+xianikol.com
  xiantao.06fv.com
  xiaobihu.top
  xiaocen.com
@@ -285660,7 +284317,6 @@ xk1hz.svcoding.com
  xk2ck.accpt-informtionsjw2r.optus-account.com
  xk7.jmafs.com
  xkaubaashhqxqwqcocrmqyackngxouqwtvsj-dot-solar-vertex-285913.rj.r.appspot.com
-xkbarwzrduejfpulgpmppmwocg-dot-gl9393jan.uk.r.appspot.com
  xkbniorlxhcbzfofweefjyorpi-dot-triple-upgrade-293822.rj.r.appspot.com
  xkedx.jaysbrand.com
  xkesbwgtghzjpgftsgiqigljso-dot-gleowayel400503.uc.r.appspot.com
@@ -285680,12 +284336,9 @@ xkvdlim.dermals.org
  xkyi.shoesmogul.com
  xlarge.at
  xlcsus0815dk1gpzp.xyz
-xldixselhjejafxxevjhaevxin-dot-gl9393jan.uk.r.appspot.com
-xleiqtxpapyxcegynetkrqrvvu-dot-gl9393jan.uk.r.appspot.com
  xlightcx.ddns.net
  xlightcx.myftp.biz
  xlightsfaces.com
-xliseqiqpfuesoxjhuowsdtcqa-dot-gl9393jan.uk.r.appspot.com
  xlix.site
  xljkpsrhv.gulfhirings.com
  xljzexeavrhkcdobtqgvxboprugdqdfihbam-dot-cedar-code-289917.nn.r.appspot.com
@@ -285695,7 +284348,6 @@ xlpxmvjoqgrvlsnqatkikrylhfdllachelec-dot-cedar-code-289917.nn.r.appspot.com
  xlsinvoices.sytes.net
  xltc-dta.be
  xltdwn4788hfj87298eyh.mattsenior1.repl.co
-xltjrvoepnunqtbaaadczhhxnc-dot-gl9393jan.uk.r.appspot.com
  xltyu.com
  xluck.giize.com
  xlucky.giize.com
@@ -285907,7 +284559,6 @@ xn--bnkofmerc-qcbee85c.vg
  xn--bnkofmeric-j9c424eea.ph
  xn--bobleslring-g9a.dk
  xn--borsaliman-6ub.com
-xn--boxbrry-uya.com
  xn--bstchange-03a.net
  xn--bstchange-v4a.net
  xn--bstchange-vf7d.com
@@ -286236,7 +284887,6 @@ xnxxtanpavpnfree.zyns.com
  xnxxterbarudaripemerintahgratis.dnset.com
  xnxxxfreedwn.tftpd.net
  xnxxxxx.wikaba.com
-xnznkriceiqsiffovjwkkhobsn-dot-gl9393jan.uk.r.appspot.com
  xnzrn3x32.urest.org
  xo57.com
  xo611.com
@@ -286263,7 +284913,6 @@ xoomera.us
  xoomla.xyz
  xoomserver.com
  xoomz.hk
-xoonifsxrmntlshkzilqpiswoa-dot-gl9393jan.uk.r.appspot.com
  xoot.host
  xopq.top
  xopvfcqe.shoesmogul.com
@@ -286327,7 +284976,6 @@ xprti.xyz
  xprtii.xyz
  xpslwfeau.goruli.com
  xpssa.000webhostapp.com
-xptmllkwzybtyzwoafntqaecfp-dot-gl9393jan.uk.r.appspot.com
  xpto.ga
  xptvbawkqpgtybsdaj.top
  xpubgluckyspin.myvnc.com
@@ -286356,7 +285004,6 @@ xratfrd.duckdns.org
  xrbcsbzpeiewszakholmmyamjomkqnsmlklr-dot-cryptic-now-290917.ey.r.appspot.com
  xrbcsbzpeiewszakholmmyamjomkqnsmlklr.cryptic-now-290917.ey.r.appspot.com
  xrbmyixwavtarwsrzsmozrooilgcnwcgvqns-dot-solar-vertex-285913.rj.r.appspot.com
-xrfchmjcnyculyrffqnuaekuew-dot-gl9393jan.uk.r.appspot.com
  xrfzblpkdrroduacswbtlqixyvwpeowyljpp-dot-cryptic-now-290917.ey.r.appspot.com
  xrgwxmb.goruli.com
  xrhgstukqmnnaea.top
@@ -286413,7 +285060,6 @@ xspin16.com
  xspins.tencenters.com
  xsqd.awaykart.com
  xsr.hamhonar.com
-xsrwbggnjhfksuatcqwsvadecl-dot-gl9393jan.uk.r.appspot.com
  xsryx.xyz
  xsso.anbtr.com
  xssyuqosqlspqt.org
@@ -286421,10 +285067,7 @@ xstmqwhcfgqixdpvtjhapxshme-dot-gleowayel400503.uc.r.appspot.com
  xstradepro.com
  xsvc.000webhostapp.com
  xsvdexbnu.goruli.com
-xsvlbemrmrpkzsjhsqvuntfzzv-dot-gleow2021ja.ue.r.appspot.com
-xsvlheqqefmgmvlwiktvyzpkte-dot-gleow2021ja.ue.r.appspot.com
  xsvnywtvlqjpxzhlvivflmabskpwfnrgwliu-dot-cedar-code-289917.nn.r.appspot.com
-xswdewpyvzwmfkfxkflrxdaict-dot-gl9393jan.uk.r.appspot.com
  xswkcojaomudjyvnmb.top
  xswse.com
  xswxbhdkystwkkikkoemjerodbjvivysozcf-dot-solar-vertex-285913.rj.r.appspot.com
@@ -286434,10 +285077,8 @@ xsykrbnunndjoosuhknkekfultiiyghnwjax-dot-glegen303939423233.ue.r.appspot.com
  xsykrygakonbt.com
  xt.boxerleads.dog
  xtbesqwkbpfonahxjfbtfsnwvphghdcxnhzu-dot-cedar-code-289917.nn.r.appspot.com
-xtbnbsbwmohknncxeandhbvtet-dot-gl9393jan.uk.r.appspot.com
  xtchawd.goruli.com
  xtcovdswgnfjgeknwkoohkuyzd-dot-gleowayel400503.uc.r.appspot.com
-xtdblvmancngfwawqywmqjyvfb-dot-gl9393jan.uk.r.appspot.com
  xtdskggjsrzingnkglmjkesnjw-dot-gloff00403993445.uk.r.appspot.com
  xtecheletronicos.com.br
  xtecsoft.com
@@ -286454,7 +285095,6 @@ xtkbp.awaykart.com
  xtmks.com
  xtmvizmnpdamgwaxzoyalciwlnmxnofutakf-dot-glegen303939423233.ue.r.appspot.com
  xtovin.cn
-xtpfddzrfxyafiyrknswffxlcn-dot-gl9393jan.uk.r.appspot.com
  xtptrack.com
  xtqgs.com
  xtqizu.com
@@ -286470,7 +285110,6 @@ xtronbikewear.co.uk
  xtrtyeyvpzhradhsfhjslcafmxlfdmmcnkcr-dot-cryptic-now-290917.ey.r.appspot.com
  xtsecityurppw.pw
  xtsecityurszh.pw
-xtttlnfvcgystgphequznrmxne-dot-gl9393jan.uk.r.appspot.com
  xtur.pl
  xtxgsx.com
  xtyejcvyxmkijqmxaxmzbhcviulhgqhzsjty-dot-offgl8876899977678.uk.r.appspot.com
@@ -286482,7 +285121,6 @@ xuanvu1409.000webhostapp.com
  xuanwoyc.com
  xucudddsaquzbzlsfoqelrciyp-dot-gleowayel400503.uc.r.appspot.com
  xudhluedtfpaxhnljrizypkfdv-dot-gleowayel400503.uc.r.appspot.com
-xuehdbaj.lasdnheajwrsdghs.xyz
  xuelisz.com
  xueran588.com
  xuexing.org
@@ -286659,7 +285297,6 @@ xy3js.jaysbrand.com
  xy9t1.jaysbrand.com
  xybghc.com
  xybzq.goruli.com
-xycczvvctenkdadtyexciiflpj-dot-gl9393jan.uk.r.appspot.com
  xyekavpdvmoawexzcqsfbyjcck-dot-gleowayel400503.uc.r.appspot.com
  xyem.shoesmogul.com
  xyguilin.com
@@ -286671,7 +285308,6 @@ xyloid-foot.000webhostapp.com
  xylontoken.com
  xymlhxg.com
  xyqdilpsjemfhzztrrvplssqsymxkhpctnoc-dot-solar-vertex-285913.rj.r.appspot.com
-xyqsecxztjezfqvxkahiyscbdy-dot-gl9393jan.uk.r.appspot.com
  xyrmbb.jaysbrand.com
  xyshbk.com
  xyskyewhitedevilexploitgreat.duckdns.org
@@ -286682,7 +285318,6 @@ xytongda.com
  xyuj.goruli.com
  xyvnacwkzucdvrcpewskouvzexbmeqotwkan-dot-solar-vertex-285913.rj.r.appspot.com
  xyvnacwkzucdvrcpewskouvzexbmeqotwkan.solar-vertex-285913.rj.r.appspot.com
-xyvvysgvusiiwriuukjoymwezz-dot-gleow2021ja.ue.r.appspot.com
  xyxb.jaysbrand.com
  xyxyxt.net
  xyxyxyxyxyxyxywkworkforworldwifewide.duckdns.org
@@ -286741,7 +285376,6 @@ xzvw.xyz
  xzw8.jaysbrand.com
  xzwcjegna.goruli.com
  xzwq.000webhostapp.com
-xzwqgkjhmjeiokyxpsmpshvwaj-dot-gl9393jan.uk.r.appspot.com
  xzxgay-71.ga
  xzxycmfwhkbiyzikiylcrbruxqaejdymviht-dot-solar-vertex-285913.rj.r.appspot.com
  xzxzrqbgzwmuolteiibczcwhox-dot-gloff849483.uk.r.appspot.com
@@ -286938,6 +285572,7 @@ yahoodomainservicee.weebly.com
  yahoodomainsvice.weebly.com
  yahooimail.weebly.com
  yahooinc.admindomainserveronline.tpnggroup.com
+yahoolinkdomainz.weebly.com
  yahoolkwfwywfqdq.weebly.com
  yahoologin.site.bm
  yahoologincurentlymail.weebly.com
@@ -287151,7 +285786,6 @@ yanuotianxia.org
  yanvqcxwgkunrghzvlyagmmczuycosuikakk-dot-spyexc3093493.ey.r.appspot.com
  yaod1.com
  yaoii.org
-yaoixxqbydxnppdmhmuodtdkcw-dot-gl9393jan.uk.r.appspot.com
  yaojiyulecheng.tavmo.com
  yapea.me
  yapi-kredi-76-cekilisim.com
@@ -287163,7 +285797,6 @@ yapikredi-world-ozel.com
  yapikredi-world-xc90-ozel.com
  yapikrediinternetsubeniz.ml
  yapikrediozel-bmwm3.com
-yapmewycsobojoheuqlojlbqpk-dot-gl9393jan.uk.r.appspot.com
  yaralviscrap.com
  yarawp.com
  yardgirlz.com
@@ -287258,15 +285891,12 @@ yc.jbl22.com
  ycbn.info
  yccmbd.com
  ycdswpwvzyjzzrhcur.top
-ycetitvjdpmlolqbifqodxvmbp-dot-gl9393jan.uk.r.appspot.com
  yceybff.1ekefsrlznyc.troublevirgin.com
  ycfuse.com
  ycglnjkbifyopvhaxudquqpptydlxbgafqzf-dot-cryptic-now-290917.ey.r.appspot.com
  ychat.somee.com
-yciotegecowobtnmtizilvvunr-dot-gl9393jan.uk.r.appspot.com
  ycipl.com
  ycis.co
-ycjhnsqqpbxoyirzwgzirjnkjj-dot-gl9393jan.uk.r.appspot.com
  ycjlqlkbrgcfjpvcpdevmeubvmgvloejjozw-dot-gl494903049.wl.r.appspot.com
  yckswwhrqjhrssqchsz.top
  yclasdy.cf
@@ -287320,7 +285950,6 @@ yditrust.org
  ydjzkcapuqhfcytcxkausvwyasxyqrcrtlza-dot-glxcel49934343434.rj.r.appspot.com
  ydn.1kzz.cn
  ydone.site
-ydonqdpeuhwhviunvwqqlveset-dot-gl9393jan.uk.r.appspot.com
  ydreefffkx.duckdns.org
  ydrool.me
  ydsdhsf.2vs5hg.cn
@@ -287378,6 +286007,7 @@ yehuaguo.com
  yehukamakaer.xyz
  yeichner.com
  yeito.tk
+yeivtp.tk
  yekdaryek.ir
  yekih21957.wixsite.com
  yektapich.ir
@@ -287484,7 +286114,6 @@ yfnzrluoakwjpyqsurcynqnpetrhayrpaqmq-dot-cryptic-now-290917.ey.r.appspot.com
  yfpmwerdaqhwayotxraiujztbk-dot-gleowayel400503.uc.r.appspot.com
  yfq87.svcoding.com
  yfrcckigfcd.hopto.org
-yfrjwlmjguofvubqmvpiqgmbbf-dot-gl9393jan.uk.r.appspot.com
  yfrscsddkkdl.in
  yfsmg.svcoding.com
  yftqmaweuwdmjvryjdixfazhuu-dot-gleowayel400503.uc.r.appspot.com
@@ -287532,9 +286161,7 @@ yh04er.xyz
  yh7zp5zg.firebaseapp.com
  yhaoonjhhg.weebly.com
  yhbgtrfavagad.top
-yhcbavufnomgpzqctoaozmkzkv-dot-gl9393jan.uk.r.appspot.com
  yhdebljqgx.top
-yheaekshhuvyrfflvybfxlsnmw-dot-gl9393jan.uk.r.appspot.com
  yhedg.xyz
  yhffgvccklmjhnhn.weebly.com
  yhfuhmhvgbnwmvzuswgvyqqnyz-dot-gleowayel400503.uc.r.appspot.com
@@ -287572,7 +286199,6 @@ yi2vtt9iuyf.ua1dw0qk.ga
  yi7qlaice.cf
  yi8qco8z.firebaseapp.com
  yi9pzxosadz.appspot.com
-yiazglxoxvovfwyesmvtcmvhxc-dot-gl9393jan.uk.r.appspot.com
  yibpshop.com
  yicai66.net
  yichang.06rl.com
@@ -287585,7 +286211,6 @@ yieldingsailors.com
  yieldmblematicy.com
  yifennart.com
  yifewgklnaaupdlthfgnbuzsgx-dot-gleowayel400503.uc.r.appspot.com
-yigleyjdynvkqjgkjjwzxkdqqk-dot-gl9393jan.uk.r.appspot.com
  yihaotui.com
  yihe.fcglobal.com.cn
  yihus.cq-zhihui.com
@@ -287637,7 +286262,6 @@ yiwu.06wi.com
  yiwudeals.com
  yixing.06rl.com
  yixuecourse.com
-yixybirmdzowkrusagaiwjseyz-dot-gl9393jan.uk.r.appspot.com
  yiyamu.com
  yiyang.yfqzdfd.com
  yiyou180.com
@@ -287656,7 +286280,6 @@ yjs.rappbdh.cn
  yjs.tnknqf.com.cn
  yjvaazzlls.duckdns.org
  yjvwdomx.goruli.com
-yjwzjxnsdvawximvayrzeuenvo-dot-gleow2021ja.ue.r.appspot.com
  yjxmcrrqmddiax2.e8273.pro
  yjyvpnovkkzqtjzx-dot-millinium.ey.r.appspot.com
  yjzygz.com
@@ -287664,7 +286287,6 @@ yk-2.jammyads.com
  ykbastonmartin2020.com
  ykd.goruli.com
  ykdqbrsxgk.top
-ykhpqxkclovtppdrnigeuttxyp-dot-gleow2021ja.ue.r.appspot.com
  ykjzmhthjblmrdakyzolfkputryvivfvwwak-dot-glenxpecial3009493.ey.r.appspot.com
  ykkgkgyugykkygkg.xyz
  ykpl.shoesmogul.com
@@ -287713,13 +286335,11 @@ ymb6it1mrtqjlvekqu19.oidjwoidj84.com
  ymca-cw.org.uk
  ymcaminya.org
  ymcgroup.eduardohypolito.com
-ymddiijrwlfydfflzgeumjqwws-dot-gl9393jan.uk.r.appspot.com
  ymddna.com
  ymdnbrktxd.top
  ymehgo.com
  ymep.svcoding.com
  ymevobec.gikorip.net
-ymgawimhjnizyhjyifrpsyfuuj-dot-gleow2021ja.ue.r.appspot.com
  ymgsaaqlxoncugioleuyyuyujf-dot-gleowayel400503.uc.r.appspot.com
  ymhdexakiby.gikorip.net
  ymhsptcffopjulmyarrlvwupih-dot-gleowayel400503.uc.r.appspot.com
@@ -287745,7 +286365,6 @@ ynblaccount.com
  ynbm.awaykart.com
  ynefefyopqvu.com
  ynetmail.weebly.com
-ynexnehwujjwlyjivvzjisvynx-dot-gl9393jan.uk.r.appspot.com
  yngp4.addroits.com
  ynhq.addroits.com
  ynhzhxqhojhreutnjvwrieytlf-dot-gleowayel400503.uc.r.appspot.com
@@ -287759,7 +286378,6 @@ ynowiowjovnjhqllfaucatirsr-dot-gleowayel400503.uc.r.appspot.com
  ynpfp.csb.app
  ynpzskzffaxqkdihdeqkidnbfy-dot-gloff849483.uk.r.appspot.com
  ynrenai.net
-ynuiskrufaujgcywraewtqslpw-dot-gl9393jan.uk.r.appspot.com
  ynvnwvvbgxushtgbzrjmgwwedb-dot-gleowayel400503.uc.r.appspot.com
  ynwl.uk.com
  ynxl9-id0applepay.com
@@ -287767,7 +286385,6 @@ ynylyw.com
  ynzlrxuxjfhzomworeawvhesfjnocyahutji-dot-solar-vertex-285913.rj.r.appspot.com
  yo.soylegal.es
  yobrit.com
-yobysvcuxzwpenrvdiesxaerxk-dot-gl9393jan.uk.r.appspot.com
  yocrea.fr
  yod.vteexcx.com
  yoder.vkcsites.org
@@ -288048,7 +286665,6 @@ youstamptitle.club
  youstore21.com
  yousubmis.restartrakuten.xyz
  youtbook.xyz
-youthful-spence-ca0d09.netlify.app
  youthguarantee.org.cy
  youthindiaassociation.com
  youthplant.org
@@ -288124,7 +286740,6 @@ ypggdpzhyqfkwssqyhxohfqdss-dot-gleowayel400503.uc.r.appspot.com
  yphzfcozswbmnusmrlopxowmtsreqthduaen-dot-solar-vertex-285913.rj.r.appspot.com
  ypirangaagricola.com.br
  ypjuzdxoktnnnfbrzkmiixfmmq-dot-gleowayel400503.uc.r.appspot.com
-ypjyisrgbbmvdcvympwjptwuac-dot-gl9393jan.uk.r.appspot.com
  ypjzbinvuwanaivzufsasoeubyglpsustzwr-dot-gl494903049.wl.r.appspot.com
  ypko-55.gq
  ypl0207.theworkpc.com
@@ -288134,11 +286749,9 @@ yppaydvxnvcfxbshnmadtsscuv-dot-gleowayel400503.uc.r.appspot.com
  yprwndilzavjoqdg-dot-millinium.ey.r.appspot.com
  ypschool.cn
  ypsmko.com
-ypugacaagijznfxhqdkzkrziug-dot-gl9393jan.uk.r.appspot.com
  ypuyrhztjjqwayvg.top
  ypvcbuvewrvtkjrysceanmhvud-dot-gleowayel400503.uc.r.appspot.com
  ypw1.dilshantg.com
-ypzmnewljwqkywkbagvtpdbnza-dot-gl9393jan.uk.r.appspot.com
  yq32.jaysbrand.com
  yq964.addroits.com
  yqdfbqchxv.top
@@ -288167,7 +286780,6 @@ yrfezuansizyeplwdshmuwtwarqjneusunnu-dot-cryptic-now-290917.ey.r.appspot.com
  yrfhjkgsdfeiyfamazon.hiinmo.com
  yrfiew.info
  yrfvideos.ml
-yrgndlfkdsgoeucanvcycmdmyr-dot-gl9393jan.uk.r.appspot.com
  yrhealth.life
  yrimeamazon.icu
  yrimeamazon.monster
@@ -288182,7 +286794,6 @@ yrtdmmq.cam
  yrtgefvcasedcf.weebly.com
  yrtq.goruli.com
  yrtuhf.frewdsjcvykiyiktjl.ml
-yrufjjaiibevmythtwgumvmtry-dot-gl9393jan.uk.r.appspot.com
  yrupymezlematic.com
  yruttandpaw.live
  yrwrgdbvxaewamwysmgvnofdafrpwgkpfxzz-dot-glegen303939423233.ue.r.appspot.com
@@ -288209,7 +286820,6 @@ yspihdy.cf
  yspublish.co.kr
  yspyropoulos.gr
  ysrqibuwxpxx.in
-yssuqpbrzuvjtgajbjpfavjhlr-dot-gl9393jan.uk.r.appspot.com
  ystconstructor.cl
  ysti.eu
  ysu3hs.xyz
@@ -288232,7 +286842,6 @@ ytarerstioner.com
  ytarerstionet.net
  ytbufidckjo1.com
  ytcdtndpncnupzck.top
-ytceufafcbxqbzvalnjucomaar-dot-gl9393jan.uk.r.appspot.com
  ytco.in
  ytcqmqavpjuhloyabvbadutoct-dot-gleowayel400503.uc.r.appspot.com
  ytcvhrdbmmtmykwstezxmfyjdp-dot-gleowayel400503.uc.r.appspot.com
@@ -288396,6 +287005,7 @@ yusomsfidfg.net
  yusufmeherally.org
  yusufpaintings.com
  yutfshgas.unclecheese.top
+yutibs.tk
  yutryrty.xyz
  yuttttttttttttttttrrrrrrhhhhhhvbhjgfhj.xyz
  yuu.deteti.cn
@@ -288423,10 +287033,8 @@ yvevaefihpbzzujodtsiedndvktevwimamow.solar-vertex-285913.rj.r.appspot.com
  yvfnumccqzhfeiyskezmjazklvptquqeuvjh-dot-cedar-code-289917.nn.r.appspot.com
  yvfpqsjao7oamofd3wtmwecvz5n8pvjvv1.musicwodfjoapws.club
  yvhgxumeicnewwnqqksxqwquyb-dot-gleowayel400503.uc.r.appspot.com
-yvicuzwcbnmuadtvqmdkpxbivp-dot-gl9393jan.uk.r.appspot.com
  yvjjxkkkxx.duckdns.org
  yvotoliverbooks.dynamic-dns.net
-yvpbhdxlionkhkkbvpujzgazej-dot-gl9393jan.uk.r.appspot.com
  yvpvlh.com
  yvqkumwvertedvaqnohjciuuupgeqyahdkjk-dot-cryptic-now-290917.ey.r.appspot.com
  yvtpueuxcdyczcnbcmajspshlf-dot-gloff849483.uk.r.appspot.com
@@ -288467,13 +287075,11 @@ yx.m.dodo52.com
  yx0y.awaykart.com
  yx1.duckdns.org
  yxbtpwnynb.duckdns.org
-yxbyptghjgpslkxykqhcjdiuhs-dot-gl9393jan.uk.r.appspot.com
  yxchczdy.cf
  yxelgqpgcbpsyydl-dot-millinium.ey.r.appspot.com
  yxfigvzcedarizwyymjdrmyinj-dot-triple-upgrade-293822.rj.r.appspot.com
  yxfq0.ailacabs.com
  yxg999.vip
-yxgtdimampcopkoyjewcawarym-dot-gl9393jan.uk.r.appspot.com
  yxh.goruli.com
  yxhktrcvgkflwtpqwdtwwctrpzyogozxslko-dot-cedar-code-289917.nn.r.appspot.com
  yxirlwizz.tastypriceo.su
@@ -288483,7 +287089,6 @@ yxmrnlnprultjqdrrxavkelcbaphirzhfdpd-dot-offgl8876899977678.uk.r.appspot.com
  yxmsb.shoesmogul.com
  yxnhsbuhvboopmvykoxlyhhnpbrsnqkivhng-dot-cryptic-now-290917.ey.r.appspot.com
  yxokmgwqznocixbwmzcxfmtfuxjmotmyahag-dot-gl494903049.wl.r.appspot.com
-yxpcuavxqkhtzvdiquhvtzyadw-dot-gl9393jan.uk.r.appspot.com
  yxpcwvmsxkmmsyvzrwht.top
  yxpjz.top
  yxqt9.saytanet.com
@@ -288512,7 +287117,6 @@ yyevw.gulfhirings.com
  yyfyyyutyjuemndaad.top
  yygavcvmpvpznofvfgvitznnvv-dot-gloff849483.uk.r.appspot.com
  yygelbbkauxnbcqliovy-dot-level-elevator-279110.nw.r.appspot.com
-yygerchsgpfavjxnudkhqvblfi-dot-gl9393jan.uk.r.appspot.com
  yygvdaewuhjbhrbfbujipuqtzqbidqqbjzad-dot-off94032393204.uk.r.appspot.com
  yyhbnhg.com
  yyhbnhg2.com
@@ -288584,7 +287188,6 @@ z-lab-company.com
  z-ncg.jaysbrand.com
  z-runescape.com.ua
  z-sc.svcoding.com
-z-showers.000webhostapp.com
  z-w6p.jaysbrand.com
  z-x4.alnawwar.com
  z.89fk.top
@@ -288869,6 +287472,7 @@ zapooi.cf
  zappingtv76.000webhostapp.com
  zapps.in
  zapslskk.tk
+zaqkpdupebawzglklwsexyktyz-dot-gleow2021ja.ue.r.appspot.com
  zaqta-71.tk
  zaqwsxcde.sportsontheweb.net
  zara-shops.ru
@@ -288977,9 +287581,7 @@ zcomunicacion.com
  zcpjtvgoalxrfnqhnfwvfyitroufxbrrztwc-dot-cryptic-now-290917.ey.r.appspot.com
  zcq-s.svcoding.com
  zcq.goruli.com
-zcqsgirbtcbnryjanmnmwynzqr-dot-gl9393jan.uk.r.appspot.com
  zcqwyyjywubheksewulzrqdvpc-dot-gleowayel400503.uc.r.appspot.com
-zcrmimeqjegeprygoikaroicmi-dot-gl9393jan.uk.r.appspot.com
  zcs.sk
  zcsbucvunbhmuocpwjfczjrgqy-dot-gleowayel400503.uc.r.appspot.com
  zctnw.rogagot.com
@@ -289025,7 +287627,6 @@ zdrowie-blog.pl
  zdrp.jaysbrand.com
  zduufouuanwcmishvtfhslhsxn-dot-gleowayel400503.uc.r.appspot.com
  zdwallcoveing.com
-zdwzxtbeazxuslqexcdiojacmf-dot-gl9393jan.uk.r.appspot.com
  zdxj3.jaysbrand.com
  zdy6.hyperphp.com
  ze-irs.website
@@ -289113,7 +287714,6 @@ zems-skins.ml
  zen-clarke-60eae9.netlify.app
  zen-indonesia.com
  zen-kalam-c40101.netlify.app
-zen-kirch-688697.netlify.app
  zen-rosalind-ccfd2a.netlify.app
  zen-wilson-5f6257.netlify.app
  zenaddevis.com
@@ -289229,7 +287829,6 @@ zeyadigital.com
  zeytinyagisabun.com
  zeyxhcsnmbxkjepcskxsbufyrbxlcrdypvcs-dot-glegen303939423233.ue.r.appspot.com
  zezewifi.000webhostapp.com
-zezkwdczxvgzsakohggglwneea-dot-gl9393jan.uk.r.appspot.com
  zeztuk.ga
  zf-ka.svcoding.com
  zf-zl.snprobbx.pbz.r.de.a2ip.ru
@@ -289246,6 +287845,7 @@ zfmayaynik.duckdns.org
  zfnodpiiyqivzxfadekrmydidl-dot-gloff849483.uk.r.appspot.com
  zfo60g9jj15ztb.gmz.cc
  zfplmscnlzxqauiqmbaccikxobzghdyloart-dot-solar-vertex-285913.rj.r.appspot.com
+zfree-com.ga
  zfreefblite.ml
  zfrewrpvecgwqtffqh.top
  zfrmz.com
@@ -289267,7 +287867,6 @@ zgc.com.cn
  zgdiyydgmmkcsuzlyfehzhajvjhsldwhyjpr-dot-solar-vertex-285913.rj.r.appspot.com
  zgeuurpkqztwuusjpt.top
  zghshmw.com
-zghzsbscjrlhmaoejupsaqgtry-dot-gl9393jan.uk.r.appspot.com
  zgipsucwlpdyhxiwrbwopkprrizlgmhwpozs-dot-cryptic-now-290917.ey.r.appspot.com
  zgitjmdwsusnfvvkbszimllvys-dot-gleowayel400503.uc.r.appspot.com
  zgjyzqctoatax.serveirc.com
@@ -289560,7 +288159,6 @@ zjbiting.com
  zjegssdrjbzxuzymmj.top
  zjez.mentriqq.com
  zjfmywqfhzeeiitystulseweuovpvnnduaiq-dot-cryptic-now-290917.ey.r.appspot.com
-zjgrlcloatbzdvwmuocxoarrfy-dot-gl9393jan.uk.r.appspot.com
  zjgsyds.cn
  zjhnyz.com
  zjhuashi.net
@@ -289598,7 +288196,6 @@ zkdevelopers.com
  zke.usacomment.com
  zked.addroits.com
  zkj-z.svcoding.com
-zkoassxblxgzvsddfdvhhvwjlr-dot-gl9393jan.uk.r.appspot.com
  zkqpnjxjwkqvqonvxwqowegsul-dot-gleowayel400503.uc.r.appspot.com
  zkrbox.com
  zkrxplzuy.vipsnapchatsexting.com
@@ -289612,7 +288209,6 @@ zlayla20.com
  zlduejbjcmcfsjmjfjymigfsvcsmuhtzutut-dot-solar-vertex-285913.rj.r.appspot.com
  zleycgkicnygbmizlpzycvifibwwscsszmgj-dot-cryptic-now-290917.ey.r.appspot.com
  zlgic.goruli.com
-zlhoayyjeqmronxlidzmuiexjw-dot-gl9393jan.uk.r.appspot.com
  zlhq8.com
  zliuxhdu.goruli.com
  zlkjqizjxrxzuarpbnshgcaiwsorjbkbnlds-dot-glenxpecial3009493.ey.r.appspot.com
@@ -289688,14 +288284,12 @@ znexrgvatcyngsbez.tbbtyr.pbz.r.nl.a2ip.ru
  znexrgvatcyngsbez.tbbtyr.pbz.r.us.a2ip.ru
  znfvzmobi.shoesmogul.com
  zni1.com
-znitvnbxqydiuzxlblsuyulwcw-dot-gl9393jan.uk.r.appspot.com
  znmkan81.lcrintegratedsystems.com
  znmricqctretybachamiqmetna-dot-gleowayel400503.uc.r.appspot.com
  znmyoj.dermals.org
  znnogmkafanmazkhthrmfdmbaziuanlldjet-dot-glegen303939423233.ue.r.appspot.com
  znnx01.me
  zno-garant.com.ua
-znpncwvxkxjyqdmjmiuhrnrpcg-dot-gl9393jan.uk.r.appspot.com
  znrdm73sh.fastestcdn.net
  znrgsheeggucqkniwfayvopkmkuozbrtidlx-dot-cedar-code-289917.nn.r.appspot.com
  znrqewkksufnqegfrwirgmixyd-dot-owaonk399399393.uk.r.appspot.com
@@ -289706,7 +288300,6 @@ znymall.cn
  znyqerei.rogagot.com
  znz.psdzy.com
  zoahotel.com
-zoaiqesocbcuqadcgpsnnqsebn-dot-gl9393jan.uk.r.appspot.com
  zoam.shop
  zob-orion.com
  zodbzsdyqogwbubzvgufydgack-dot-gleowayel400503.uc.r.appspot.com
@@ -290098,7 +288691,6 @@ zpeagqw.shoesmogul.com
  zpenvjqu.goruli.com
  zpeny.svcoding.com
  zpeo.vipsnapchatsexting.com
-zperehcmayearkreitbsroizld-dot-gl9393jan.uk.r.appspot.com
  zpg.com.br
  zpgajipsgopsyejuxwzizmwmun-dot-triple-upgrade-293822.rj.r.appspot.com
  zpgajipsgopsyejuxwzizmwmun.triple-upgrade-293822.rj.r.appspot.com
@@ -290107,12 +288699,10 @@ zpidsiewtsoeyypopihljwdbhc-dot-gloff849483.uk.r.appspot.com
  zpindyshop.com
  zpitqybgymhrcyws.top
  zpjugrad.shoesmogul.com
-zpkaygzmttwkafinurkcnurnhh-dot-gleow2021ja.ue.r.appspot.com
  zplcaccounting.icu
  zpmagura.com
  zpmcudocdfd37a9x.mxp4037.com
  zpnrywfxnaqbprfugq.top
-zpolflqxaqztqstvdhmfpupwck-dot-gl9393jan.uk.r.appspot.com
  zppasfdntcraujehrolcpzheqgqlpxwlyffy-dot-glegen303939423233.ue.r.appspot.com
  zpr.io
  zpsehtdvhxlmvrfqrmigmsulyf-dot-gl9393jan.uk.r.appspot.com
@@ -290145,7 +288735,6 @@ zqfrstlggonuomefchsxiudweqnysaowmwjk-dot-cedar-code-289917.nn.r.appspot.com
  zqgbv.app.link
  zqgqwzpwimdqbwtscvtzzamqub-dot-gleowayel400503.uc.r.appspot.com
  zqhe.mentriqq.com
-zqijuctzsaeohcydaddnknrvbh-dot-gl9393jan.uk.r.appspot.com
  zqjh.mentriqq.com
  zqk7x.alnawwar.com
  zqkjn.svcoding.com
@@ -290155,7 +288744,6 @@ zqmdm.com
  zqmjsfds.goruli.com
  zqmltfqisiiwcoeqkeendxurrffzcfdjacfl-dot-gl494903049.wl.r.appspot.com
  zqmojrmvajkewwphsuggmtahfchxlayqwqzs-dot-spyexc3093493.ey.r.appspot.com
-zqohluttbhkjznyfkgmfivcpne-dot-gl9393jan.uk.r.appspot.com
  zqpmzwjbfwybwhptjgwtfxhvbz-dot-gl9393jan.uk.r.appspot.com
  zqptmrujxlruiatyqylexbfdmnwtvsuallik-dot-solar-vertex-285913.rj.r.appspot.com
  zqsafnww.goruli.com
@@ -290177,7 +288765,6 @@ zre.dermals.org
  zrgupdwnb.goruli.com
  zrhkviknid.duckdns.org
  zrhqewxgaysnmndkcuoaziv.top
-zricrmrulzoiosbtdknxfvxycy-dot-gl9393jan.uk.r.appspot.com
  zrjn2.weblium.site
  zrlutttapk.duckdns.org
  zrno.co.rs
@@ -290185,7 +288772,6 @@ zrnonzun.zkwqvkr.cn
  zromedia.com
  zrq2y.weblium.site
  zrqgtpjojvbomfkhokdipdhjhm-dot-gleowayel400503.uc.r.appspot.com
-zrqwxvuvpxwfdwexieogmqheze-dot-gl9393jan.uk.r.appspot.com
  zrusebery.com
  zrutaedu.com
  zrxmfcugfmsmbvglwanmyetmlv-dot-gleowayel400503.uc.r.appspot.com
@@ -290217,7 +288803,6 @@ zspedgshjmxfdrfwwd.top
  zspilica.webd.pro
  zspinpubg13.com
  zsplubaszcq2.nazwa.pl
-zsqvvqzgwuhryamokxvijothxh-dot-gl9393jan.uk.r.appspot.com
  zsqwwxcgtyu.cf
  zsqwwxcgtyu.ml
  zsqwwxcgtyu.tk
@@ -290263,8 +288848,6 @@ zucks.comprihensiveprove.xyz
  zucraft.com
  zuevmnpgswrplavarkawommxrk-dot-gloff00403993445.uk.r.appspot.com
  zuhbjbhtcafjgrbytbbtvdhvmbjpikdvojng-dot-solar-vertex-285913.rj.r.appspot.com
-zuhhqlsdmibyusxjzratzwkils-dot-gl9393jan.uk.r.appspot.com
-zuhpyiwmacagtkxsvbuzokgudu-dot-gl9393jan.uk.r.appspot.com
  zuisarch.top
  zujgyjoplcstrjtdgrmevsnemu-dot-gleowayel400503.uc.r.appspot.com
  zukmobile.cc
@@ -290342,7 +288925,6 @@ zwfcnxcgcacgfujcuy.top
  zwfxiieabnecjkgkbmebcnsykfeqdennpaaw-dot-glegen303939423233.ue.r.appspot.com
  zwgweb.000webhostapp.com
  zwinglian-goggles.000webhostapp.com
-zwrmgylzwmkxrutqwpyyreilth-dot-gl9393jan.uk.r.appspot.com
  zwset.xyz
  zwuomfeanram.sytes.net
  zwvkmkzmpkfyqkbdteyi-dot-gleowyel040493443434989.wl.r.appspot.com
@@ -290371,7 +288953,6 @@ zxdubljsdpwtjzrsxivczvdhgfvllzyfuucf-dot-cedar-code-289917.nn.r.appspot.com
  zxe32szefr3.000webhostapp.com
  zxe9tmtff3.com
  zxes.goruli.com
-zxfolyhoquexmtnbowwvemakty-dot-gl9393jan.uk.r.appspot.com
  zxha01.com
  zxhbxozdvrps.talagaremix.com
  zxhsqsnu.healthygenez.club
@@ -290384,7 +288965,6 @@ zxmewvguuwrdhswwxmslwykyygncgowzkjps-dot-gl494903049.wl.r.appspot.com
  zxmme.cam
  zxmvagysjo.topkorder.su
  zxmyaibxxnccyfrbzxhpsgbxsp-dot-gleowayel400503.uc.r.appspot.com
-zxofdufsjlexgnyuryzhcnsmzg-dot-gl9393jan.uk.r.appspot.com
  zxozpdtonwavortgtryolgzaht-dot-gleowayel400503.uc.r.appspot.com
  zxq4.onderhost.com
  zxqyrzwapp.cqhc.net
@@ -290399,7 +288979,6 @@ zxsse.xyz
  zxtiandao.com
  zxulu.shoesmogul.com
  zxuoqneouhjlkbcgwseeiwawmg-dot-gleowayel400503.uc.r.appspot.com
-zxuqslatrrutlsaqbgmhagedxt-dot-gl9393jan.uk.r.appspot.com
  zxvcm.ug
  zxvhidsnr.goruli.com
  zxwhatasspgrub.pbz-cc.ga
@@ -290407,7 +288986,6 @@ zxwva.rogagot.com
  zxxohwbeyfkfvswddvqnxvjlnimercukvdsg-dot-glegen303939423233.ue.r.appspot.com
  zxxuxyzbgnsosgiowiinolufjg-dot-gleowayel400503.uc.r.appspot.com
  zxyongheng.com
-zxytcyzfvmyfyuuhfbmdsaxywy-dot-gl9393jan.uk.r.appspot.com
  zxzascvbvfdcdcfcmnhn.000webhostapp.com
  zy-an.addroits.com
  zy0p.dimaflix.com
@@ -290468,7 +289046,6 @@ zzha.net
  zzhaitian.cn
  zzhalm.goruli.com
  zzhare12345.hopto.org
-zzhbcfxbytmmlcyeiekweeotxj-dot-gleow2021ja.ue.r.appspot.com
  zzhhc.cn
  zzi.bellevilledc.com
  zzjph.com
diff --git a/blacklists/malware/urls b/blacklists/malware/urls

index c13317a16d115fe0d560a744c3d0e3b75a1316d6..ab231739eff09b9541136329004f451eec883b48 100644 (file)
--- a/blacklists/malware/urls
+++ b/blacklists/malware/urls
@@ -2,10 +2,7 @@
  0i.is/CpAq
  0i.is/IqWc
  103.141.138.118/bin_jzbvYfwP234.bin
-103.143.73.155/signin/
-10ksurf.com/chs/bb6ee33553cbd975d08aee923a85ed25/envoi-carpostal.html
  116.106.39.10/.i
-122.116.17.187/.i
  123formbuilder.com/form-5559915/microsoft-team
  123formbuilder.com/form-5580797
  138.68.20.95/a-r.m-4.GHOUL
@@ -20,24 +17,21 @@
  138.68.20.95/s-h.4-.GHOUL
  138.68.20.95/x-3.2-.GHOUL
  138.68.20.95/x-8.6-.GHOUL
-143.95.100.74/.drp
-143.95.100.74/.drp/login.php
  147.135.210.70/fffffs/wifi.exe
  148.66.24.187/ap/signin
-162.241.115.133/oauth/2.0/yahoo
-162.241.115.133/oauth/2.0/yahoo/login.php
-162.241.121.32/xdd/
-162.241.121.32/xdd/confirmation-infos.php
-162.241.121.32/xdd/mot-de-passe.php
-162.241.70.248/interac/interac/lnterac/directing/bmo
-162.241.70.248/interac/interac/lnterac/directing/bmo/secquestions.php
-162.241.70.248/interac/interac/lnterac/directing/royalbank
-162.241.70.248/interac/interac/lnterac/directing/royalbank/index.html
-162.241.70.248/interac/interac/lnterac/directing/simplii
-162.241.70.248/interac/interac/lnterac/directing/simplii/index.html
-177.103.247.17/.i
+176.31.95.231/Finance/bnc
+176.31.95.231/Finance/bnc/index.php
+176.31.95.231/Finance/desj
+176.31.95.231/Finance/desj/index.php
+176.31.95.231/Finance/mobilesco
+176.31.95.231/Finance/tang
+176.31.95.231/Finance/tang/antibot.php
+176.31.95.231/Finance/tang/index.php
+176.31.95.231/interac
+176.31.95.231/interac/index.php
  18.218.243.55/WellsFargo/session
  18.218.243.55/WellsFargo/session/reset_account.php
+189.79.118.149/.i
  192.227.209.21/bins/akuma.arm
  192.227.209.21/bins/akuma.arm5
  192.227.209.21/bins/akuma.arm6
@@ -49,15 +43,20 @@
  192.227.209.21/bins/akuma.sh4
  192.227.209.21/bins/akuma.spc
  192.227.209.21/bins/akuma.x86
-194.15.36.204/a-r.m-4.Sakura
-194.15.36.204/a-r.m-7.Sakura
-194.15.36.204/i-5.8-6.Sakura
-194.15.36.204/p-p.c-.Sakura
+193.239.147.32/OBBBOP.exe
+193.239.147.32/obbbb.exe
+193.239.147.32/pppp.exe
+193.239.147.32/sppp.exe
  1drv.ms/xs/s
-2vn.ru/APAPA/dhl_cpanel/
-3.124.3.141/working/KYC%20DOCS.exe
-3.124.3.141/working/regasm.exe
-3.124.3.141/working/svch.exe
+207.46.132.127/customer.support.ebay.de
+23.227.207.253/naki/vbc.exe
+27976a9732.nxcli.net/account
+27976a9732.nxcli.net/account/
+27976a9732.nxcli.net/account/fb.php
+2834321.mediaspace.kaltura.com/user
+2834321.mediaspace.kaltura.com/user/login
+37.120.222.43/assailant.m68k
+37.120.222.43/assailant.ppc
  37.120.222.68/bxdlmi
  37.120.222.68/eoxmkb
  37.120.222.68/ghpmuy
@@ -71,39 +70,30 @@
  37.120.222.68/wkomqp
  37.120.222.68/yeansn
  37.120.222.68/yuwenb
-39.89.145.144/+-O+/tmp/netgear;sh+netgear&curpath=/&currentsetting.htm=1
+45.130.138.17/arc
+45.130.138.17/arm
+45.130.138.17/arm5
+45.130.138.17/arm6
+45.130.138.17/arm7
+45.130.138.17/i586
+45.130.138.17/i686
+45.130.138.17/mips
+45.130.138.17/mipsel
+45.130.138.17/sh4
+45.130.138.17/x86_64
+45.134.171.230/pc/
  47.157.97.71/.i
-5.101.204.22/CookieAuth.dll
-51.89.246.80/arm4Komodo
-51.89.246.80/arm5Komodo
-51.89.246.80/arm7Komodo
-51.89.246.80/armv6lKomodo
-51.89.246.80/i586Komodo
-51.89.246.80/m68kKomodo
-51.89.246.80/mipsKomodo
-51.89.246.80/mipselKomodo
-51.89.246.80/pp-cKomodo
-51.89.246.80/ppcKomodo
-51.89.246.80/sh4Komodo
-51.89.246.80/x32Komodo
-51.89.246.80/x86Komodo
-69.176.89.151/ap/signin
+52.229.88.149/Finance/bmo-mobile
+54.212.76.135/view-signin.php
  69.176.89.211/ap/signin
-77.83.117.225/snype.arm4
-77.83.117.225/snype.arm5
-77.83.117.225/snype.arm6
-77.83.117.225/snype.mips
-77.83.117.225/snype.mpsl
-77.83.117.225/snype.ppc
-77.83.117.225/snype.sparc
-77.83.117.225/snype.x86
-85.96.178.233/.i
-8y5kt9pgkjm6.wixsite.com/my-site/
+69.176.89.217/ap/signin
+78.188.106.235/.i
+8hhsbehelpsupport.id6134589516.com/8hhsbe/lock
  91.208.245.201/ReportServser.exe
  91.208.245.201/SQLAGENTIHC.exe
  91.208.245.201/SQLSerase.exe
  91.208.245.201/fdlaunchera.exe
-91.211.245.185/Welcome
+95.111.238.174/~frenky/
  95.216.5.242/a-r.m-4.Logicnet
  95.216.5.242/a-r.m-5.Logicnet
  95.216.5.242/a-r.m-6.Logicnet
@@ -118,52 +108,49 @@
  95.216.5.242/x-8.6-.Logicnet
  aaccount-netflixse.servehttp.com/en
  aaccount-netflixse.servehttp.com/en/Sign.php
-aafpr.org//C-Agricole/ac1646a9edf165f
-aafpr.org//C-Agricole/ac1646a9edf165f/region.php
+abissnet.net/se12y5vm.zip
  abre.ai/as0p
  abre.ai/bLoA
  abre.ai/caixacx
  abre.ai/seguranca-app
-ad.cezmika.com/css/newLin/LinkedinAUT/
-adminssit.ga/secure/wgbground
-adyug.com/database/factories/review7809/8d032
-adyug.com/database/factories/review7809/8d032/signin.php
-airlite.ch/.well-known/F004f19441
-airlite.ch/.well-known/F004f19441/11644210b.php
-aksfleet.com/mailbox/cpsess0757610916/
-alliance4consumersusa.org/enroll/
-alliance4consumersusa.org/enroll/ver.pdf.html
+actextrading.com/verification/frontend/login/update/
+admin.swisscom.ch-customer-shop.buy-53b51f56a.ais-it.org/YXJBYlBCeFhJb04zUEE1NlpLQjJ0dz09/
+alhazmico.com/assets/fonts/codropsicons/METRO/METRO
+alinteriors.com/net/Netf-lix/zomebot
+alinteriors.com/net/Netf-lix/zomebot/login
  allowcopy.com/open
  allowcopy.com/open/
  alturl.com/tdhf4
-amancarrental.com/joy/rowan/
-amaznn.co.jp.coj8albq.cc/pc
-americanas-tododia.redirectme.net/tv/samsung/simple-basket.php
+amaznn.co.jp.bukuit8h.cc/pc
  ams3.digitaloceanspaces.com/ams1
  ams3.digitaloceanspaces.com/ams1/click.html
  ams3.digitaloceanspaces.com/newvm
  ams3.digitaloceanspaces.com/newvm/index.html
+andaluciabeach.net/image/network.exe
  angelfire.com/games/gamez3
  angelfire.com/games/gamez3/facebook.htm
+annlee2642.dothome.co.kr/assets/global/plugins/jquery-file-upload/server/bit
+annlee2642.dothome.co.kr/assets/global/plugins/jquery-file-upload/server/bit/ol.html
  annlee2642.dothome.co.kr/assets/global/plugins/jquery-file-upload/server/contact/fr/root/id
  annlee2642.dothome.co.kr/assets/global/plugins/jquery-file-upload/server/contact/fr/root/id/login/phpredir.php
  anon.to/H2jGQ0
  anon.to/uRnAyx
-antifraud-securepayees.com/hsbc/
-appbsnshlpscr.live/m.recover.htm
+aphomes.in/img/clients
  arnazon.oo.ip.qmjidym.cn/pc/
  aspuzna20.iesmariamolinerinformatica.com/haproxy-https-4povf/64fzoeSNbAkVM0NWqR0m2Vuht
-ausmigrate.net.au/image/yh-phishing/66ccff64e8b90d3b284ea06789421347
-ausmigrate.net.au/image/yh-phishing/66ccff64e8b90d3b284ea06789421347/
-ausmigrate.net.au/image/yh-phishing/66ccff64e8b90d3b284ea06789421347/enter_password.php
-authenticatemy-new-payee.com/lloyds
-authenticatemy-new-payee.com/lloyds/Login.php
-bancaporinternetinterbanpe.com/doc
-bancaporinternetinterbanpe.com/doc/login.php
-bancolombiaveri.webcindario.com/vorife/
-barbohoricounselling.com/prop/int/banks/sco/
-billetterie.angers-sco.dspsport.com/Dsp/web/site/packages/Payment
-billetterie.angers-sco.dspsport.com/Dsp/web/site/packages/Payment/info3Dsecure.htm
+authenticate-my-newly-added-payee.com/lloyds
+authenticate-my-newly-added-payee.com/lloyds/Login.php
+banc-7d5f06.ingress-comporellon.easywp.com/ss/es/ing
+banc-7d5f06.ingress-comporellon.easywp.com/ss/es/ing/
+banc-7d5f06.ingress-comporellon.easywp.com/ss/es/ing/step1.php
+bancapointernetimterbankspe.com/doc
+bancapointernetimterbankspe.com/doc/login.php
+bancaporinternet-interbanpe.com/doc
+bancaporinternet-interbanpe.com/doc/login.php
+believable16442130.blob.core.windows.net/zilpah184585361121
+believable16442130.blob.core.windows.net/zilpah184585361121/login.html
+billingerrorhelp-ee.com/account/12
+billinghelp-myee.com/account/12
  biolinky.co/legendarycontract
  biolinky.co/luckyxspin
  biolinky.co/tencentmetro
@@ -413,7 +400,6 @@ bit.ly/3lvHSNF
  bit.ly/3m0AIRm
  bit.ly/3m4oE1w
  bit.ly/3nhYaK7
-bit.ly/3psvn6X
  bit.ly/3pvPGRe
  bit.ly/Actualiza-ViaBcp
  bit.ly/Atualizar-SMS-iToken
@@ -460,67 +446,43 @@ bitly.com/3kXAhXj
  bitly.com/3oFHKMQ
  bitly.com/3p4HWWh
  bitly.com/PAYPAL-LOGIN-IL
-blancobusquets.com/laravel/vendor/phpunit/sys/wells/
-bluefridam.com/produtos/Utilidades/Jogo-de-Panelas-Tramontina-Antiaderente-de-Alum%C3%ADnio-Vermelho-10-Pe%C3%A7as-Turim/
-bridgemessage.com/bin/Priv8/Priv8
-bridgemessage.com/bin/Priv8/Priv8/index.html
-bss.edu.ge/transhome
-bss.edu.ge/transhome/index.php
-bss.edu.ge/wetransfer
-bss.edu.ge/wetransfer/index.php
+bitz.co.za/files
+bitz.co.za/files/NediBarlars.htm
+bitz.co.za/files/NediBarlars~STROKE~SPONONO~PASSY.htm
+brain-trigger.com/netcologne.de/netcologne.de/
+buck-wild.shop/view-signin.php
  buildartinnovations.com/nk/
-bwavec.com/jh19x7dnrtlvz2a/v1tngimebsxtje/gf17c6pldufkzpb/hu1lv7u6iw4742x/eeq216dl5yg3j3j2j/fd17f6pclr6130m/gs34bngka7k9dz
-cabondhome.com/Drive/Drive
-cabralissa.com/bbbbb/wgbground
+byc-ksa.com/vqmod/absa
+byc-ksa.com/vqmod/absa/AbsaOnline.htm
  cakeurl.com/sw3zY
-camada.ca/ping/absa
-camada.ca/ping/absa/AbsaOnline.htm
+cancel-personal-payee1.com/reg
+cancel-personal-payee1.com/reg/spec
+cancel-personal-payee1.com/spe
  cancellationfornewpayee.net/hsbc/reg
  cancellationfornewpayee.net/hsbc/reg/info
-cancellationfornewpayee.net/hsbc/reg/spec
  cancellationfornewpayee.net/hsbc/spe
  cancelpayee-attempt.com/Lloyds
-cancelpayee-attempt.com/Lloyds/
  cancelpayee-attempt.com/Lloyds/Login.php
  capesandbox.com/file/sample/2582/8729e52104ec08ca7002b217c42c3ec12262badbb3f11faaab1829eba505c3cb
-capital0ne.36o-bk.com/en/signin/
-cateroo.id/assets/fonts/nn/1und1/
-causalitybrew.com/OMMOM/OM9u8
-cbdhealthreviews.org/ad/1
-cbdhealthreviews.org/ad/1/code.html
-ccbangla.org/admin/
-cdbntrgff5566.onelink.me/sLeQ/810f6c15
+ccelshaddailv.org/aclkub5.zip
  cdn.discordapp.com/attachments/680977014139650072/681241009618681896/n.exe
  cdn.discordapp.com/attachments/788792529372839956/791041217654947910/fatnigger.x86
-ceofloral.com/sessions/files-logs/logs/update-your-account-information/security-measure/log-in/
-changaosports.com/cfg
-changaosports.com/cfg/index.php
-ciscondecor.com/product/m
-ciscondecor.com/product/m/index.html
-claimrewardmetro.org/PUBG/
-cloudplanettech.com/bbbbb/wgbground
+cellarincentive.com/processing/netflix/Login/
+centralcitybankonline.com/cb
+centralcitybankonline.com/cb/forgot.php
+cl.selfhost.co.in/~hkarya/dv/
  cmtactical.com/js/extjs/Westpac
  cmtactical.com/js/extjs/Westpac/index.htm
-colegare.com/blog/sucursalpersonas.transaccionesbancolombia.com/
-colegare.com/blog/sucursalpersonas.transaccionesbancolombia.com/mua/USER
+com-accountsecurity.cz/m=weblogin/loginform533,939,639,65627634,2497
  completeaccount-supportmember.sign.gedelnakdek.com/15bb63b28926cd083b15e3b97567bbea
  completeaccount-supportmember.sign.gedelnakdek.com/15bb63b28926cd083b15e3b97567bbea/knhmWSOc40J4X3DJCeXJ3v1oVrLP.php
-conexionpos.com/dkb/
-confirmmydetails.com/lloyds
-confirmmydetails.com/lloyds/Login.php
-coopnordouest.ca/Mailbox/Mailbox_2
-coopnordouest.ca/Mailbox/Mailbox_2/i.php
  cort.as/-FgvH
  cpbild.co/c6d466d
-creatv.fr/images/social/netflix
-cuenta.bankia.es.twocountieshogroast.co.uk/bankia-usuario/
-cues-booklet.com/knab/
-customer-mobility-service.com/rbc/onlinebanking/cgi-bin/rbaccess
-customer-mobility-service.com/rbc/onlinebanking/cgi-bin/rbaccess/rbcgi3m013fc9.html
  customer-portal.sytes.net/user/homebankofamerica
  customer-portal.sytes.net/user/homebankofamerica/
-cutt.ly/EkwOp0J/
+customer-service-help.com/Verification/update-account/customer_center/customer-IDPP00C984/myaccount/settings
  cutt.ly/QiCMqtb
+cutt.ly/QktTUv2/
  cutt.ly/SsyhHnk
  cutt.ly/SyhM3BP
  cutt.ly/ViXGZKL
@@ -528,7 +490,7 @@ cutt.ly/WdEjmec
  cutt.ly/WgAU6fN
  cutt.ly/_BCP
  cutt.ly/actualizarbcp
-cutt.ly/ikqnhlC/
+cutt.ly/iktYTJ3/
  cutt.ly/ldTGuAB
  cutt.ly/skrODGy/
  cutt.ly/tsqb6ai
@@ -537,52 +499,80 @@ cutt.us/9WNKq
  cutt.us/X41CC
  cutt.us/rHqRx
  cyw.pe.kr/images/baba/Alibaba.com/Alibaba.com/Alibaba.co.uk/35c2f42de3a745af1c74bd8fc03250ad
-dadafa88.com/03/bet
-dadafa88.com/03/bet/bet.html
  dailyfreshbatter.com/hb/upload
  dailyfreshbatter.com/hb/upload/index.php
-datxanhgemskyworldvn.com/vis2005c3.zip
+danielbhatt.com/uftlz/h
+danielbhatt.com/uftlz/h/page.php
+darinwmoore.com/AppleReset/7ee710656c5f748b20a01174adab99fd
+darinwmoore.com/AppleReset/7ee710656c5f748b20a01174adab99fd/assets/includes
+darinwmoore.com/AppleReset/7ee710656c5f748b20a01174adab99fd/assets/includes/login.php
+darinwmoore.com/AppleReset/7ee710656c5f748b20a01174adab99fd/redirect.php
+darinwmoore.com/AppleReset/f4e6b8cd72b840b40821cb2e9fd20f87
+darinwmoore.com/AppleReset/f4e6b8cd72b840b40821cb2e9fd20f87/redirect.php
  davinciec.com.br/Christine/Morton
-decorluxmuebles.com/decorluxmuebles
-decorluxmuebles.com/decorluxmuebles/wp-content/plugins/three-column-screen-layout/jp/
-demaciancomics.com/nuevoemt/181.5.224.3866029/agregar/telefono/contacto
-demaciancomics.com/nuevoemt/181.5.224.3866029/agregar/telefono/contacto/LogonOperacionServlet.html
-demaciancomics.com/nuevoemt/181.5.224.3866029/agregar/telefono/contacto/operacion-exitosa.html
-demaciancomics.com/nuevoemt/181.5.224.3866029/agregar/telefono/contacto/telefono.html
-dev.atlasherb.com/ionos/1and1
-dev.atlasherb.com/ionos/1and1/index.php
-deveop.org/dev/
+ddptuntftdon.com/nos-verls/base/file
  devrahababamanch.org/ckeditor/lang/data/html/
  devrahababamanch.org/ckeditor/lang/data/html/verification/0E96699NM9C922D9NE59/
  devrahababamanch.org/ckeditor/lang/data/html/verification/12D3410B48D5033NCAN4/
+devrahababamanch.org/ckeditor/lang/data/html/verification/18E9CM81044A1DCN1993
+devrahababamanch.org/ckeditor/lang/data/html/verification/18E9CM81044A1DCN1993/index.php
+devrahababamanch.org/ckeditor/lang/data/html/verification/2MC7B09286DC4482B00C
+devrahababamanch.org/ckeditor/lang/data/html/verification/2MC7B09286DC4482B00C/index.php
+devrahababamanch.org/ckeditor/lang/data/html/verification/3351C6678CNB46DC69N6
+devrahababamanch.org/ckeditor/lang/data/html/verification/3351C6678CNB46DC69N6/index.php
+devrahababamanch.org/ckeditor/lang/data/html/verification/424N93CA1M995A74M5AC/
+devrahababamanch.org/ckeditor/lang/data/html/verification/4NE500012M64273673M0
+devrahababamanch.org/ckeditor/lang/data/html/verification/4NE500012M64273673M0/index.php
+devrahababamanch.org/ckeditor/lang/data/html/verification/512D8EN3385694B7139N/
+devrahababamanch.org/ckeditor/lang/data/html/verification/5EBCC3N49AN875DD2DD7
+devrahababamanch.org/ckeditor/lang/data/html/verification/5EBCC3N49AN875DD2DD7/index.php
+devrahababamanch.org/ckeditor/lang/data/html/verification/7222NDNECCN2E2BBM4E5
+devrahababamanch.org/ckeditor/lang/data/html/verification/7222NDNECCN2E2BBM4E5/index.php
  devrahababamanch.org/ckeditor/lang/data/html/verification/7CCADNBDEB8C4069CD5E
  devrahababamanch.org/ckeditor/lang/data/html/verification/7CCADNBDEB8C4069CD5E/card.php
-devrahababamanch.org/ckeditor/lang/data/html/verification/7CCADNBDEB8C4069CD5E/index.php
  devrahababamanch.org/ckeditor/lang/data/html/verification/7CCADNBDEB8C4069CD5E/verif.php
+devrahababamanch.org/ckeditor/lang/data/html/verification/83546CN7NM342AE5EB7E
+devrahababamanch.org/ckeditor/lang/data/html/verification/83546CN7NM342AE5EB7E/index.php
+devrahababamanch.org/ckeditor/lang/data/html/verification/8EBB40N99C9M97B1444A
+devrahababamanch.org/ckeditor/lang/data/html/verification/8EBB40N99C9M97B1444A/index.php
  devrahababamanch.org/ckeditor/lang/data/html/verification/9B8N4D1B2B5915BA5ABA
  devrahababamanch.org/ckeditor/lang/data/html/verification/9B8N4D1B2B5915BA5ABA/index.php
+devrahababamanch.org/ckeditor/lang/data/html/verification/9C50EEM7C50CN9A5NB8N/
  devrahababamanch.org/ckeditor/lang/data/html/verification/A11717970025A3D77C3N
  devrahababamanch.org/ckeditor/lang/data/html/verification/A11717970025A3D77C3N/index.php
+devrahababamanch.org/ckeditor/lang/data/html/verification/A3CA2CE2B6CN854A2M31
+devrahababamanch.org/ckeditor/lang/data/html/verification/A3CA2CE2B6CN854A2M31/index.php
+devrahababamanch.org/ckeditor/lang/data/html/verification/A7CD3A7755199015CE2D
+devrahababamanch.org/ckeditor/lang/data/html/verification/A7CD3A7755199015CE2D/index.php
  devrahababamanch.org/ckeditor/lang/data/html/verification/A97M9AEB65EDBDA08DM7/
  devrahababamanch.org/ckeditor/lang/data/html/verification/BN9D0M97057C6MNB0162
  devrahababamanch.org/ckeditor/lang/data/html/verification/BN9D0M97057C6MNB0162/index.php
+devrahababamanch.org/ckeditor/lang/data/html/verification/C2M5DB8706E66A1CMN2M
+devrahababamanch.org/ckeditor/lang/data/html/verification/C2M5DB8706E66A1CMN2M/index.php
  devrahababamanch.org/ckeditor/lang/data/html/verification/CCD493NBBMEM5593N064
  devrahababamanch.org/ckeditor/lang/data/html/verification/CCD493NBBMEM5593N064/index.php
+devrahababamanch.org/ckeditor/lang/data/html/verification/D0B38317677916D1E046
+devrahababamanch.org/ckeditor/lang/data/html/verification/D0B38317677916D1E046/index.php
+devrahababamanch.org/ckeditor/lang/data/html/verification/D89DA832DCC0MA7BB632
+devrahababamanch.org/ckeditor/lang/data/html/verification/D89DA832DCC0MA7BB632/index.php
+devrahababamanch.org/ckeditor/lang/data/html/verification/DMD6388430404E1M88AA
+devrahababamanch.org/ckeditor/lang/data/html/verification/DMD6388430404E1M88AA/index.php
  devrahababamanch.org/ckeditor/lang/data/html/verification/MBB9EE6M8DC4169N309M
  devrahababamanch.org/ckeditor/lang/data/html/verification/MBB9EE6M8DC4169N309M/index.php
  devrahababamanch.org/ckeditor/lang/data/html/verification/N4C3B86A64A61NMC2EA3
  devrahababamanch.org/ckeditor/lang/data/html/verification/N4C3B86A64A61NMC2EA3/index.php
+devrahababamanch.org/ckeditor/lang/data/html/verification/N61N4A5N67589729M216
+devrahababamanch.org/ckeditor/lang/data/html/verification/N61N4A5N67589729M216/index.php
  devrahababamanch.org/ckeditor/lang/data/html/verification/NB616ME5NDC97AD60429/
-devrahababamanch.org/ckeditor/lang/data/html/verification/NB7B8BAA70N8M5E346MN
-devrahababamanch.org/ckeditor/lang/data/html/verification/NB7B8BAA70N8M5E346MN/index.php
+dfdsgsdfhg.com/jp
+dfdsgsdfhg.com/jp/login
  dhl.com-en-express.tracking.number.velius.com/DHL
  dhl.com-en-express.tracking.number.velius.com/DHL/tracking2.php
-dietpillow.com/office/
-dinochange.com/admin/controller/customer/ppll/newinc
-dinochange.com/setting/ppll/newinc
-directory-templates.com/logs/update-your-account-information/security-measure/log-in/
-dkb-banking-online.de.lovart.be/web-index.php
+discouragethreaten.com/confirmacion-codigo/confirmacion-sms/conformacion/fbss
+discouragethreaten.com/confirmacion-codigo/confirmacion-sms/conformacion/fbss/
+discouragethreaten.com/confirmacion-codigo/confirmacion-sms/conformacion/fbss/pass.php
  dlvr.it/RXVbg3
+dmvawsaloft.com/tampa/base/file
  docs.google.com/forms/d/1cftY9nPkgtssMgHl5uc070iUbDW-vRpa7sBpQQYOSCk/viewform
  docs.google.com/forms/d/1ubfTadXuGDGvTvNscAY0_f78KUm17eHjm5vf2Ltz6Hs/viewform
  docs.google.com/forms/d/e/1FAIpQLScF68Z9GTY6VGd_OJVtROggMC5gl95AoNcW27gHvVatJQfp4Q/viewform
@@ -627,39 +617,33 @@ docs.google.com/forms/d/e/1FAIpQLSfgVWY26SZ_Aumb4Tj52fkdiZr979r97zbXoy45CT7ojbzU
  docs.google.com/forms/d/e/1FAIpQLSflOWOdPVSHQxAOf0Yu5HMfUUbV1VQp2ddfltTkAYApDSsUyg/viewform
  docs.google.com/forms/d/e/1FAIpQLSflxxuI_0dV49fhRtRiIo5E1uN2RBMGgMLQI-6qGDZVNV-ZVQ/viewform
  docs.google.com/forms/d/e/1FAIpQLSfw3glHBuhrFSF4kTOw1sa_BSsYr9NBQF4RhDYAv_g6xXgPoA/viewform
-dovetail.com.tw/wells2/home/
+drhankdelivered.com/mock/medical
+drhansacu.com/js/us/DC
+drhansacu.com/js/us/DC/index.php
  drive.google.com/uc
-drleonardobarreto.com.br/wetransfer
-drleonardobarreto.com.br/wetransfer/index.php
  dropbox.com/l/AABy5Irzd_ji2DuiO-i5z8ZZ70_ZRnRBTLQ
  dropbox.com/l/AADF6y5O_I_uxzPM7EarhSzPUoBxa9VQXQ0
-drumairabubakar.com/businessfilesteam
-drumairabubakar.com/businessfilesteam/index.html
+dubaiibnet.com/en/about-us/contact-us.html
  dwnlds.co/ab3f360
-dzspetroleum.co.za/ep9n62vf.zip
-economyofficer.com/common/ture_login/Login/
-ee-secureupdatebilling.com/account/
-ee-secureupdatebilling.com/account/12
-eebillingupdatesecure.com/account/12
-eebillingupdatesecure.com/account/index
+e11.herokuapp.com/Eh_9T/
+ebiuro.org.pl/Ob3f555748d46802b/
+ee-billinginformation.com/EE/
+ee-billingsecurepage.com/12
  empoweredskills.co.uk/s5cyceea/
-enricavereniimmobiliare.it/OLD/test/14/swiss/
-enviromentalist.co.za/ch/onlineservice/fr/
  events4u.in/cap/excelzz
  events4u.in/cap/excelzz/bizmail.php
  events4u.in/cap/excelzz/index.php
-everlastingmoments.com/CSS
  evernote.com/shard/s349/client/snv
-exchnageappplus.mybluemix.net/#a
-extinctgeneral.com/prek/new
-f001.backblazeb2.com/file/munchieman/Kurtix+WiFi+
-faarhanali.com/netflix/2ed12b4a2eb5ada
-faarhanali.com/netflix/2ed12b4a2eb5ada/login.php
+ewsaosrt-71.ga/dhl/dhl
+ewsaosrt-71.ga/dhl/dhl/index.php
+f4cboook-la-lognla-facbook-es-2ks421xpj.filesusr.com/html
+f4cboook-la-lognla-facbook-es-2ks421xpj.filesusr.com/html/e36689_a4e3ccf1f3ef2ca97c9742b5995e7468.html
+f4cboook-lognla-facbook-es-gc8zwhvw6m.filesusr.com/html
+f4cboook-lognla-facbook-es-gc8zwhvw6m.filesusr.com/html/e36689_e76ad8ff12abe98da4fc25893ae10bbb.html
+factoringglossary.org/redirect/Amazon
+factoringglossary.org/redirect/Amazon/info.php
  fanhuntersagency.com/jasmyu
  fanhuntersagency.com/jasmyu/index.php
-fehrfinancial.com/lib/touchSwipe/INFO~dir/sms/85729e0ff4270be72345c7c181a83c4e
-felippealfredo.com/sahed
-felippealfredo.com/wpsaplsadd
  firebasestorage.googleapis.com/v0/b/access439984393434430fd4c34f4.appspot.com/o
  firebasestorage.googleapis.com/v0/b/access439984393434430fd4c34f4.appspot.com/o/index.html
  firebasestorage.googleapis.com/v0/b/apps-00303000300mic.appspot.com/o
@@ -816,16 +800,12 @@ firebasestorage.googleapis.com/v0/b/woodtoday-ae8d3.appspot.com/o
  firebasestorage.googleapis.com/v0/b/woodtoday-ae8d3.appspot.com/o/index.html
  firebasestorage.googleapis.com/v0/b/workse-d507e.appspot.com/o
  firebasestorage.googleapis.com/v0/b/workse-d507e.appspot.com/o/mananayoindex.html
-first-tipology2021.redirectme.net/.well-known/acme-challenge/templates/WT
-first-tipology2021.redirectme.net/.well-known/acme-challenge/templates/WT/index.php
-fluff-slender-melon.glitch.me/daw-owa.html
  form.elementform.com/0a4b86bcfd8d414b9fbce0329020508d45549925
  form.jotform.com/201644738915057
  form.jotform.com/202268964605057/
  forms.app/shirleylee/sign-now
  forms.gle/9a6GXS7dWCVJsTZH6
  forms.gle/Ea99FifzqBtjeeph9
-forms.gle/Eph7FFxeCXD2SVm68
  forms.gle/F1D9boMJKMz3xj2V7
  forms.gle/KyMxUiAcdzuUu2zd6
  forms.gle/L2aZRomZ2FSNGvUV9
@@ -843,13 +823,9 @@ forms.gle/su3QLmquExCofMcX7
  forms.gle/uGjm1KN5rRTUdArS6
  fra1.digitaloceanspaces.com/zooms
  fra1.digitaloceanspaces.com/zooms/zoom.html
-fusionmesotherapy.com/View/extract/block/
-g-m-deveiopments.co.uk/owa/9726255eec083aa56dc0449a21b33190/auth/
+frettir.hssr.is/images/americanexpress.com.axpx-logpwax/
  gamerlaunch.com/community/users/blog/4908663/1794789
-gem-co.ae/mail
-gem-co.ae/mail/webmail.php
-get.pretsl.com/bxfqap.zip
-getpaidwithwatches.com/bd9ciuw4.rar
+gdsfg3.ga/vn1/
  gg.gg/ElPeruPrimero
  gg.gg/auto_atendimento
  gg.gg/fwi76
@@ -861,29 +837,38 @@ gg.gg/lng51
  gg.gg/lnzh7
  gg.gg/ls61b
  ghostbin.co/paste/xk5my/raw
-gigantic-warm-find.glitch.me/owa-ii21.html
  github.com/instCap/nleo/raw/master/yt-conv.exe
  github.com/instCap/nleo/raw/master/yt-convE.exe
  github.com/instCap/nleo/raw/master/yt-convU.exe
-goalatogames.play-minigames.com/images/snap
-grofficecleaning.com/ssks/Secure/
+go.swipez.in/2w2t/
+gravebreed.com/gouv/netrcra/r9738541/en/banks/directing/atbonline
+gravebreed.com/gouv/netrcra/r9738541/en/banks/directing/atbonline/details.php
+gravebreed.com/gouv/netrcra/r9738541/en/banks/directing/atbonline/question.php
  gtinmoney.com/yy/
  gumtreeply.com/ci0v2ix.rar
-hackgoapp.com/moddjifly/
-halifax-mydevices.com/HalifaxConspiricy
-halifax-mydevices.com/HalifaxConspiricy/Login.php
-hassanproduct.com/ij80czph.rar
+haircuttight.com/tele/btele
+haircuttight.com/tele/btele/index.php
+hali-secureserve.com/cancelpayee
+hali-secureserve.com/cancelpayee/Login.php
+hamrah-bazyaft.com/ID-3/
  heavenlymatches.com/.logs/update-your-account-information/security-measure/log-in
  hecarabu.com/banking/boa2
  hecarabu.com/banking/boa2/empass.php
-hitmanko.cf/secure/wgbground
-hogarvenecia.com/app/credibanco/vpos/certificados
-hogarvenecia.com/app/credibanco/vpos/certificados/index.htm
+hgfgbhdg.com/jp
+hgfgbhdg.com/jp/login
+hi-cooking.com/tax
+hi-cooking.com/tax/aboutus.php
+hi-cooking.com/tax/home.php
+hi-cooking.com/tax/services.php
+hmrc.gov.uk.mechcaddesign.com.au/uk
+hmrc.gov.uk.mechcaddesign.com.au/uk/index.php
+hogarvenecia.com/app/credibanco/vpos/certificados/index.htm..
+home-post-die-sendungsstatus.die-postswiss-access.com/post/
  home-post-die-sendungsstatus.die-postswiss-go.com/post/
-hs-cancellations.com/hsbc/
-hsbc.payment-requested.com/authorise/reg
-hsbc.payment-requested.com/authorise/reg/spec
-hsbc.payment-requested.com/authorise/spe
+home-post-die-sendungsstatus.swiss-go-acess.com/post/
+hostingdnswnl.gb.net/sacsxa/
+hsbc.requests-verify.com/payees/reg
+hsbc.requests-verify.com/payees/reg/spec
  ht.ly/10IO30qSAAi
  ht.ly/1Yzh30r1i6R
  ht.ly/2Wh830qSzga
@@ -927,18 +912,18 @@ htl.li/kL5q30q5utK
  huahintalot.com/shv_yksityismyynti/themes/%20classic_green%20/%20green%20/bLeSsInGzb/510fdbe839cd84d9e5dc24ef778009a4/informations
  huahintalot.com/shv_yksityismyynti/themes/%20classic_green%20/%20green%20/bLeSsInGzb/510fdbe839cd84d9e5dc24ef778009a4/informations/
  huahintalot.com/shv_yksityismyynti/themes/%20classic_green%20/%20green%20/bLeSsInGzb/510fdbe839cd84d9e5dc24ef778009a4/informations/login.php
+huntington.net.au/webmail_indexuser/cpanel.webmail_login.htm
  icl-trading.com/we/transfer/downloads1
  icl-trading.com/we/transfer/downloads1/login.php
-img.maplejournal.co.in/im/2249282/a7126eed22813676332d385a54179b0ba5ada3e2b1f8eea2b30b4a223da19199.jpg
-img.maplejournal.co.in/im/2249282/c519f6b3f2a8b1290fe30feaeaa50b367796fdd22027be58cc8ed7714b5269e5.jpg
-infirmiere-veronique-dubois-baillet.fr/.ch/customer_center/user-571123
-infirmiere-veronique-dubois-baillet.fr/.ch/customer_center/user-571123/login.php
-infynia.cl/package
-infynia.cl/package/login/index.php
-innovativeengineersandproducts.com/dji1vv.zip
-instagram.mfff.in/safelogin
+id-nab.com/Login/z0n51/login-1.php
+indiaoutdooradvertising.com/xr/xx/
+info.case-id-pp-330-443-754-login.olivebuilder.com/id/log-in/
+ingbaaancologin-690f4e.ingress-comporellon.easywp.com/ss/ss/es/ing
+ingbaaancologin-690f4e.ingress-comporellon.easywp.com/ss/ss/es/ing/
+ingbaaancologin-690f4e.ingress-comporellon.easywp.com/ss/ss/es/ing/step1.php
  internet-online-digital-login.shop/login/
  iplogger.org/2KmWW5
+irresolus.com/rhddqtntq.rar
  is.gd/CB9Ipo
  is.gd/ING1ES
  is.gd/Q3dT9l
@@ -956,50 +941,27 @@ is.gd/wRd7yK
  is.gd/youappweb
  is.gd/zrYBJr
  islam-guide.com/cgi-bin/goto.cgi
-issy_funke.gitlab.io/junhbgfvdvrbtyuimjnhbgfvdc
-issy_funke.gitlab.io/junhbgfvdvrbtyuimjnhbgfvdc/vfdvgbfvdcsfrgtyjtbgvfcdxer.html
-itaucomvc.com/itau
-itaucomvc.com/itau/
-itsaba.ir/fetr/ree
-itsaba.ir/fetr/ree/ct.htm
  iviva.ivivaworks.com/bpbreb0/www.breeid.fr-pointcheck.secre.region-departement
  iviva.ivivaworks.com/bpbreb0/www.breeid.fr-pointcheck.secre.region-departement/
  j.mp/2BUqTCt
  j.mp/2ZZtIeM
  j.mp/39oczg7
  j.mp/3asgxFT
-jacquelinematos.com.br/raf/233e3e576a0b2bv14732Fbv14732F42001v10196a0b2bv14732Fbv1473
-jacquelinematos.com.br/raf/233e3e576a0b2bv14732Fbv14732F42001v10196a0b2bv14732Fbv1473/login.php
-jainparivarharidwar.com/nvd/wgbground
-jamescamacho28.com/mua/serv
-jamescamacho28.com/mua/serv/
-jamescamacho28.com/mua/serv/page2.php
-jamescamacho28.com/mua/serv/page3.php
-jamescamacho28.com/mua/serv/page4.php
-jamescamacho28.com/mua/serv/validardatosingresados.php
-janetdress.com/bd/fff/
-jewellerystore.com.au/cache/inv/excelzz
-jewellerystore.com.au/cache/inv/excelzz/bizmail.php
-karosserie-juric.de/voice/Secure
-kasakayak.com/lite/
+jesumbooludipe.com/Electrical/eSign
+joecamera.net/home
  kbmovers.co.za/upload/slide
  kbmovers.co.za/upload/slide/wp-sync/
-kill-dedicate.cf/cache/CNN/upload/
+kbmovers.co.za/upload/slide/wp-sync/webmail.php
  kmfempire.com/Red/b/a/d/f/c/Dhl-tracking-ch/login/
-kortlink.dk/2abpt/
-kuberapps.solutions/servicemms/_orange/
  kutt.it/3MdFZz
  kutt.it/GZ0Eo1
  kutt.it/nZEaRO/
-ladentist.in/pms/temp/scot/int/banks/sco/
-lamoorespizza.com/Dropbox/dropbox/o1
-lamoorespizza.com/Dropbox/dropbox/o1/main.html
  landpage.co/a8eb4190-031d-11eb-ad8f-f2646ce6f5c7
  landpage.co/f171b772-03ff-11eb-b136-be6044770142
-lawyers.bio/cra-arc/
  lawyers.bio/cra-arc/home
+lawyers.bio/cra-arc/home/
  lawyers.bio/cra-arc/home/confirm.php
-lindwaet.ga/sec/wgbground
+leythcom.com/adminsquaree/
  linktr.ee/Blkg7
  linktr.ee/FREESKINSLEGENDARY
  linktr.ee/PUBG.MOBILE.SEASON.15
@@ -1013,89 +975,69 @@ linktr.ee/Verify.Account
  linktr.ee/XiaOmi2022
  linktr.ee/amemuito
  linktr.ee/pubglukyspinevent.com
-linktr.ee/pubgmobilenews
  litelink.at/Cartao_Carrefour
  litelink.at/cartaoatacadao2020
-lkindin.s3.us-east-2.amazonaws.com/linkedin-new-hash.html
  lnk.news/2rovk
  lnkd.in/dC_EFvE
+loattnsawsttn.com/images/base/file
+loattnsawsttn.com/images/base/file/homepage
+logbromw.com/project/vendor/psy/psysh/src
+logbromw.com/project/vendor/psy/psysh/src/task_mail__token_QAWWOHKWQKSaIK6CqOhwn21m1ArKV3te.php
  lvshouxi.eicp.net/software/WinRAR/WinRAR_x86.exe
+magnumfoodbrokers.org/Officesm
+magnumfoodbrokers.org/Officesm/login.php
  mail.expire-plan-o2.com/Login/index
-mail.inlightprod.com/wordpress
-mail.inlightprod.com/wordpress/wp-admin/js/il/il-xppl
-mail.o2-processbillingauth-update.com/Login/index
-mailhost.cftdi.edu.tt/CookieAuth.dll
-mailus.ovh/face/
-majestic-magic-sunday.glitch.me/sat-as.html
+mail.natwestonlinebanking-new-device-added.com/admin
+mail.rfprotex.com/banksepahinternational/4e09ee62886ef94d53e588f97897b93c
+mail.unauthorised-payeerequest.com/lloyds
+mail.unauthorised-payeerequest.com/lloyds/Login.php
  makinghyrt.com/eeds
  makinghyrt.com/eeds/indexx.php
-manage.morissalakante.com/img/kali.jpg
  mapage.noos.fr/~jeanmarie.regall/7546t5.exe
  maponlinedata.com/bin/mapdata.exe
  maponlinedata.com/bin/mapdata1.exe
  maponlinedata.com/map.jar
  maponlinedata.com/map.jnlp
+marsiglione.com.ar/css/chase
+marsiglione.com.ar/css/chase/firstlog.php
+marsiglione.com.ar/css/chase/step2.php
+marsiglione.com.ar/css/chase/step3.php
  mcelman.com/blog/home/pp/verifications_pp/active_infos/gs_gen/gs611f56f51e98e4063246eb208909aa2c
-mcvehil.net/blog/sucursalpersonas.transaccionesbancolombia.com/
-mcvehil.net/blog/sucursalpersonas.transaccionesbancolombia.com/mua/USER
-mdtec.com.ar/phpmailer/tmp/bofnewcol/
+mdtec.com.ar/phpmailer/tmp/bofnewcol/inf-card.php
  mdtec.com.ar/phpmailer/tmp/bofnewcol/pin-security.php
  mediafire.com/file/yn8dnlx4znw0qwy/AppTrailers.9.1.10amt.exe
-meherun.com/dhdfv/doucsing%20multi%20detect
-meherun.com/dhdfv/doucsing%20multi%20detect/index.php
-melhorpravoceporvoce.com/Mais/MeusProdutos
-melhorpravoceporvoce.com/Mais/MeusProdutos/Prefetch.php
-melodyabhar.ir/img/SECURE.myacc/sign-in/made-in-china
-melodyabhar.ir/img/SECURE.myacc/sign-in/made-in-china/login.php
+meingebuhrenfrei-7d0ad9.ingress-baronn.easywp.com/es/ing
+meingebuhrenfrei-7d0ad9.ingress-baronn.easywp.com/es/ing/
+meingebuhrenfrei-7d0ad9.ingress-baronn.easywp.com/es/ing/step1.php
  memorialpetroniopinheiro.com.br/js/ddsmoothmenu/raiffcz/9c9f75797b7478f59616711ead373cf8
-memorialpetroniopinheiro.com.br/js/ddsmoothmenu/raiffcz/9c9f75797b7478f59616711ead373cf8/
-memorialpetroniopinheiro.com.br/js/ddsmoothmenu/raiffcz/9c9f75797b7478f59616711ead373cf8/activation.htm
  memorialpetroniopinheiro.com.br/js/ddsmoothmenu/raiffcz/9c9f75797b7478f59616711ead373cf8/cert.htm
-mickels-hamsterrad.de/info/MARKET/F004f19441
-mickels-hamsterrad.de/info/MARKET/F004f19441/11644210b.php
  microsoftofficeonlineservices.com/b/outlook
-midasboy.in/event
-mikeamurphy.com/Tadas%20Jurgaitis/mazon/amazon/
-minnesotakk.ga/secure/wgbground
-motofellowship.com/winnery822/1/Secure/
+midmvsafe3l2.com/redir/base/file
+midmvsafe3l2.com/redir/base/file/homepage
+mottino.pl/glosowanie
  mpealmondsca.com/wpp/pro
  mpealmondsca.com/wpp/pro/i6or7zoznh27bdasc1ujppc0.php
  mrhasedsa.com/att.com
  mrhasedsa.com/att.com/aatt.html
-msg.futurmail.fr/exchweb/bin/auth/owalogon.asp
-mslconstrucciones.cl/Download
-mslconstrucciones.cl/Download/index_.php
  mumrdlhi2i.temp.swtest.ru/ppl/
  my1schwb23id2.ml/chase/Chase/
-myee-managedetails.com/12
-nab-cancel-payid.com/ib.nab.com.au/nabib
-nab-cancel-payid.com/ib.nab.com.au/nabib/login.php
-nab-payid-cancel.com/ib.nab.com.au/nabib
-nab-payid-cancel.com/ib.nab.com.au/nabib/login.php
-naragroup.net/ch/
+myattflt.com/rn/acct
+myattflt.com/rn/acct/subs.htm
+myattflt.com/rn/loginprodx.att.net/commonLogin/igate_edam
+myattflt.com/rn/loginprodx.att.net/commonLogin/igate_edam/controller.html
+mypayee-authentication-cancel.com/lloyds
+mypayee-authentication-cancel.com/lloyds/Login.php
+mypayee-authentication-cancel.com/lloyds/admin
  nelflix-mijnaccounts.com/nl/
  net.geo.opera.com/opera/stable/windows
  net.geo.opera.com/opera/stable/windows/
-netbank-cancelpayid.com/www.my.commbank.com.au/netbank/Logon
-netbank-cancelpayid.com/www.my.commbank.com.au/netbank/Logon/Logon.php
-neumastock.com/nbb/excelzz/excelzz
-neumastock.com/nbb/excelzz/excelzz/bizmail.php
-neumastock.com/nbb/excelzz/excelzz/index.php
+newingtonroad.co.za/VIM/Comcast_Xfinity/
  news-ontime.com/Nov.1/Shark-Tank-Diet8.0/Keto-Lean.html
  news-ontime.com/Nov.1/Shark-Tank-Diet8.0/Keto-Pure-ss.html
  news-ontime.com/Nov.1/Shark-Tank-Diet8.0/Slim-X-Genie-Keto.html
-newsfor1you-uk.com.pl/checkage
-newsfor5you-uk.com.pl/checkage
-newsfor5you-uk.info.pl/checkage
-newsfor5you-uk.info.pl/checkage/js
-niplast.rs/webadmin/roundcube/44ea2c683e185df551bb51fd7817f1e9
-nitthenm.cf/secure/wgbground
-npykkxtiugzgshowhvxladohku-dot-gl9393jan.uk.r.appspot.com/-23bgottheil-40fidelitypayment.com
-numeraunon.ga/000/wgbground
-nyayaconsultancy.com/bbbb/wgbground
  nyc3.digitaloceanspaces.com/sharepointauthorizeddocument0msh/sx1nz0
-o2-updateinfo.com/02NewBanks/banks/online.citi.eu/GBIPB/JSO/signon
-o2-updateinfo.com/02NewBanks/banks/online.citi.eu/GBIPB/JSO/signon/DisplayUsernameSignon.html
+o2billing-centre.com/banks/online.citi.eu/GBIPB/JSO/signon
+o2billing-centre.com/banks/online.citi.eu/GBIPB/JSO/signon/DisplayUsernameSignon.html
  objectstorage.eu-amsterdam-1.oraclecloud.com/n/axvzq6ccdhre/b/covna/o
  objectstorage.eu-amsterdam-1.oraclecloud.com/n/axvzq6ccdhre/b/covna/o/covhome.html
  objectstorage.uk-london-1.oraclecloud.com/n/lr4txdosnm2q/b/voipshare/o
@@ -1119,18 +1061,13 @@ objectstorage.us-phoenix-1.oraclecloud.com/n/axxhgwgjih8t/b/voicenote/o/117-Crl.
  objectstorage.us-phoenix-1.oraclecloud.com/n/axy0ck15gxtn/b/outcall/o/11-Crl.html
  objectstorage.us-sanjose-1.oraclecloud.com/n/axcdfbfimho2/b/bucket-20200807Voicemessagesreviewportal-0627/o
  objectstorage.us-sanjose-1.oraclecloud.com/n/axcdfbfimho2/b/bucket-20200807Voicemessagesreviewportal-0627/o/index.html
-officentry.com/eur
-officentry.com/eur/login
-olayeenger.ml/100/wgbground
-oldxxxx.ga/secure/wgbground
-olx-epay.pl/order
+ofstlaxcala.gob.mx/mail
+ofstlaxcala.gob.mx/mail/correo.php
  onedrive.live.com/download
-online-zelle-payment.com/banks/directing/boa
-online-zelle-payment.com/banks/directing/boa/index.html
-online-zelle-payment.com/banks/directing/chase
-online-zelle-payment.com/banks/directing/chase/index.html
-orderoftheovary.gourdiallyyours.com/.well-known/www.mes-acces.crediit-agri-cole.fr/casm/39be894252c1028098f799c82b0a836d
-overdoseinfo.com/rbe
+onegonaddown.com/bins/bin/48a265623bafc8428ef89a2447f19189
+onemenujm.com/.FR/
+onemenujm.com/.FR/customer_center/user-727781/
+oqwablplz57iz265oyzc3hh3au-adwhj77lcyoafdy-www-paypal-com.translate.goog/signin
  ow.ly/3IRf30qF4Kw
  ow.ly/BD9i50AVlOV
  ow.ly/BgVO30qE9fg
@@ -1145,61 +1082,71 @@ ow.ly/tEjO30qJvOw
  ow.ly/yxK730qUYLl
  padlet-uploads.storage.googleapis.com/610964646/d0a82b340ac6b4eb2fed334399fe2e84
  padlet-uploads.storage.googleapis.com/610964646/d0a82b340ac6b4eb2fed334399fe2e84/palad.html
+pamplemoussebtq.com/Cha/chase
+pamplemoussebtq.com/Cha/chase/
+pamplemoussebtq.com/Cha/chase/cc/News
+pamplemoussebtq.com/Cha/chase/cc/News/firstlog.php
+pamplemoussebtq.com/Cha/chase/firstlog.php
  pandemic-info.com/bin/mapdata.exe
  pandemic-info.com/map.jar
  pandemic-info.com/map.jnlp
-parcel.emiratespost.ae.oplosmarketing.co.ke/uae/
-parcel.emiratespost.ae.oplosmarketing.co.ke/uae/1811c8d6814f3bae9cde4e1cbb48b162
-parcel.emiratespost.ae.oplosmarketing.co.ke/uae/1811c8d6814f3bae9cde4e1cbb48b162/garcia.php
-parcel.emiratespost.ae.oplosmarketing.co.ke/uae/1811c8d6814f3bae9cde4e1cbb48b162/zlatan.php
-parcel.emiratespost.ae.oplosmarketing.co.ke/uae/a64959806d92091ca45edd13d0edb1fa
-parcel.emiratespost.ae.oplosmarketing.co.ke/uae/a64959806d92091ca45edd13d0edb1fa/
-parcel.emiratespost.ae.oplosmarketing.co.ke/uae/a64959806d92091ca45edd13d0edb1fa/garcia.php
-parcel.emiratespost.ae.oplosmarketing.co.ke/uae/a64959806d92091ca45edd13d0edb1fa/zlatan.php
-parrsnursery.com.au/classes/dhg/DHL%20AUTO
-parrsnursery.com.au/classes/dhg/DHL%20AUTO/dhl.php
+paradisekalkan.com/ch/home
+paradisekalkan.com/ch/home/
+paradisekalkan.com/ch/home/Login.php
+paradisekalkan.com/ch/home/access.php
+paradisekalkan.com/ch/home/access1.php
+paradisekalkan.com/ch/home/mobile
+paradisekalkan.com/ch/home/mobile/
+paradisekalkan.com/ch/home/mobile/Login.php
+paradisekalkan.com/ch/home/mobile/access.php
+paradisekalkan.com/ch/home/mobile/billing.php
+paradisekalkan.com/ch/home/mobile/vbv.php
  partnercare.org/imaqes/open/sharepointreview
  partnercare.org/imaqes/open/sharepointreview/file.html
-pasfoods.com/mysilf/3d41277c8cc5209f3f4edd2bb4c019eaYjRlN2NhNDYzZGY0YjBhNDI3YmEzZmRhNzQwNjg5Yzc=/myaccount/websc_login/
  pastebin.com/raw/DawJ5x7m
  pastebin.com/raw/P78fNRax
  pastebin.com/raw/Yt0EUBML
  pastebin.com/raw/Z64N9RPj
  pastebin.com/raw/hW7rJy6C
  pastebin.com/raw/xpEutJ0a
+patience-ils-poussent.fr/F0b4h5d88bb406e23/
+pay.topgrads.net/d
  payerrealty.com/dq7rv4p5g.zip
-paypal-merchant.ru/micrositeportal
+payp-blocked.ml/PayPal/
  petshopperzippl.com/joking/mazon/1372a
  petshopperzippl.com/joking/mazon/1372a/signin.php
-peyernet.net/xhmGjq63Hfsbdl3iUdZ/pGh6r9
-peyrents.net/7J87J9T5Va984BPUnSR/2phN3r
-peytnemtp.net/OckYJ9wSFYNH7mJKoA/4ghr07
  pheenix360.com/.well-known/OfficeV4
  piltver.com/ES/ES_elcmel/
-pisconietto.pe/exe/auth/
+pinc.work/app/
  platforms-helpcenter.ml.bluebadgehelpcenterforms.ga/..
+play.mobilelegends.com/events/515party
+play.mobilelegends.com/share/events/wintergala
  plymouthrocklegal.com/nmj
-ppds.anestesi.ulm.ac.id/checkpoint/
-process-payment.co.uk/Netflix
-process-payment.co.uk/Netflix/Login.php
+primecarefertilitycentre.co.ke/heibest/heibest
+prontofrioecuador.com/.well-known/pki-validation/securehost_login/wells-fargo
+prontofrioecuador.com/.well-known/pki-validation/securehost_login/wells-fargo/login.php
+pubgmobile.com.xxucpubg.com/event/
+pubgmskinfre.com/event
+quillfish855598381199.blob.core.windows.net/acoasm554261563222
+quillfish855598381199.blob.core.windows.net/acoasm554261563222/login.html
+raybals.com/raybals/bvsd/bvsd.exe
+raybals.com/raybals/bvsd/bvsd1.exe
+raybals.com/raybals/gwfa/gwfa.exe
+raybals.com/raybals/gwfa/gwfa1.exe
  rb.gy/05vruj
  rb.gy/0dxzro
  rb.gy/ajgrnt
-rb.gy/an4sya/
+rb.gy/ajiof3
  rb.gy/aqr3sk/
  rb.gy/aqwj7l
  rb.gy/fihzov
-rb.gy/gnzrsx
  rb.gy/hobteq/
  rb.gy/ia1oft
  rb.gy/iifoiu
-rb.gy/kk6z3d
  rb.gy/kn27px/
  rb.gy/lflert
  rb.gy/ludoy0
  rb.gy/n5ozim
-rb.gy/pgbtfi
-rb.gy/qfianv
  rb.gy/rqkrxe
  rb.gy/rrl1ll
  rb.gy/rtlomb
@@ -1260,6 +1207,7 @@ rebrand.ly/gkfugem
  rebrand.ly/h36v6
  rebrand.ly/hcds68s
  rebrand.ly/iejlmfn
+rebrand.ly/kuwu0rn
  rebrand.ly/nibrcpo
  rebrand.ly/nk1jol6/
  rebrand.ly/owyjt4e
@@ -1277,20 +1225,14 @@ rebrand.ly/yngvu65
  rebrand.ly/zikqv8f
  rebrand.ly/zitln6v
  rebrand.ly/zshyr3j
-recommendedcouncil.com/chf/die/post/ch/switerzland/paket/wartat/sendung/auf/2021/ihr/process/Die-post/manage/
  redfriday-promo.com/MeusProdutos
  redfriday-promo.com/MeusProdutos/Prefetch.php
-request-cancellationid.com/HSBC/reg
-request-cancellationid.com/HSBC/reg/spec
  reurl.cc/1xRr1Y
  reurl.cc/WL16RO
  reurl.cc/bRkoqE
  reurl.cc/gvjOLp
  reurl.cc/oLeEQj
-rickstv.com/pop/smtp/inc
-rickstv.com/pop/smtp/inc/msg.php
-rigvedindia.com/ah3jvxyg1.zip
-royalluxuryshipping.com/mbegtwcv.zip
+rldatix.pro/images/87539487.jpg
  rplg.co/2-nfc-click
  rplg.co/28aec060
  rplg.co/522f6060
@@ -1304,6 +1246,7 @@ rplg.co/ec360820
  rplg.co/ing-contact
  rplg.co/mijn-ing-sca
  rplg.co/web-ve
+rrrstylin.co.za/vwcjc7.zip
  run.plnkr.co/plunks/9E5KHqjstsW9Vgnh/
  run.plnkr.co/plunks/9WEVAZo1Tl8SBXHb
  run.plnkr.co/plunks/9WEVAZo1Tl8SBXHb/index.html
@@ -1316,7 +1259,6 @@ run.plnkr.co/plunks/kSN3sbIK3XzLgWhJ
  run.plnkr.co/plunks/mJtflmcpgaozX5SG/
  run.plnkr.co/plunks/rdIzYroZhd0vp7u2/
  run.plnkr.co/plunks/t4cM7cIQAWnjlM9d/
-runnningventsdaily.in/event/runicpower/
  s.free.fr/4cyNYE3X
  s.free.fr/6yRyvaaV
  s.free.fr/92rsZcB4
@@ -1324,7 +1266,6 @@ s.id/3Gnet
  s.id/AmexHelpDesk
  s.id/Arge-emergency
  s.id/DigiD-belasting
-s.id/DigiDtoeslag/
  s.id/Skype57
  s.id/amor2020carditauapp
  s.id/chw-z
@@ -1361,8 +1302,6 @@ s.id/versleuteling
  s.oooooooooo.ga/o/cpu32.exe
  s.oooooooooo.ga/o/cpu64.exe
  s.oooooooooo.ga/o/nvidia.exe
-s0mente-hoje.com/MeusProdutos
-s0mente-hoje.com/MeusProdutos/Prefetch.php
  s3-ap-northeast-1.amazonaws.com/cxrequirement.sharepointeseugwpjlmahxedgkqsbjlzfgsn
  s3-ap-northeast-1.amazonaws.com/cxrequirement.sharepointeseugwpjlmahxedgkqsbjlzfgsn/index.html
  s3-ap-southeast-1.amazonaws.com/xuip
@@ -1405,55 +1344,51 @@ s3.us-east-2.amazonaws.com/www.microsoft.com.v83
  s3.us-east-2.amazonaws.com/www.microsoft.com.v83/inAAi33.html
  s3.us-east-2.amazonaws.com/www1.microsoft.com.st
  s3.us-east-2.amazonaws.com/www1.microsoft.com.st/inAAi33.html
-sandbox.seekerbolivia.com/fonts/ik
-sandbox.seekerbolivia.com/fonts/ik/login.php
+samircanel20.com/BETO/
  sants-authorize-security.com/secure/
  sants-authorize-security.com/secure/a1b2c3/b96da8bdb82f02a183e9ef7d1599c536
  sants-authorize-security.com/secure/a1b2c3/b96da8bdb82f02a183e9ef7d1599c536/login
-sanzo.atwebpages.com/og/books/pdf/-/
-scattergeneral.com/Joni/Blake/
-scattervictory.com/fh/new
-scattervictory.com/nu/Secure
  schorr-law.com/less
  scienceasia.org/1987.13.n4/FGBFGTHRTT54ER3467UTRDSVFR3465
  scienceasia.org/1987.13.n4/FGBFGTHRTT54ER3467UTRDSVFR3465/mag.html
  scoffpeppers.com/chase-login/home/
  sctrlgin.com/spotify.update-billing
-seccure-updateprocess.com/ee/
-secure-mypayee-authentication.com/hsbc/reg
-secure-mypayee-authentication.com/hsbc/reg/spec
+sctrlgin.com/spotify.update-billing/
+secure-cancel-newsetdevice.com/lloyds
+secure-cancel-newsetdevice.com/lloyds/Login.php
  secure.support-runescape.com/c=6L8pKzBYbDs/zendesk/support-form
+secure225.servconfig.com/~cabletvpartners/feed/8b5700012be65c9da25f49408d959ca0/
+securematicsrecruitment.co.uk/vendor/phpunit/phpunit/src/Util/PHP
+securematicsrecruitment.co.uk/vendor/phpunit/phpunit/src/Util/PHP/logs.php
+security-id-authorise-user939101.com/apple2020/
+security.hs-paym-auth.com/reg
+securityforpayees.com/lloyds
+securityforpayees.com/lloyds/Login.php
  sendspace.com/pro/dl/45rnsw
-septikprime.ru/plugins/user/Popularenlinea
-septikprime.ru/plugins/user/Popularenlinea/
-septikprime.ru/plugins/user/Popularenlinea/Home.html
-serveoffice365docs.sytes.net/clean/Inv/
+sfo2.digitaloceanspaces.com/sharepointauthorizeddocumentusned/geTOG
  sfo2.digitaloceanspaces.com/spacezoomincemeetingcloud
  sfo2.digitaloceanspaces.com/spacezoomincemeetingcloud/AAwsodhdYTTYSHyuey.html
  share.hsforms.com/1HWBy9E8zQ5CPqHe5EI6IGA3245i
  share.hsforms.com/1OWoQghkBQDO-dfBLtGExeQ4g63f
-shareoffice365docx.sytes.net/security/Inv/
-sharepointauthorizeddocumentaquba.sfo3.digitaloceanspaces.com/FsfBzE
  sharesbyte.com/nam
  sharesbyte.com/nam/login
-shebasecurity.com/store/WBmail
-shebasecurity.com/store/WBmail/error1.php
  short.pe/q00Sa
  shorturl.at/oIJP1
  shorturl.at/rRTX4
-shrinikunjabiharitrust.org.in/ofs/wgbground
  signin01.kauf-eday.de/ws/eBayISAPI.dll/SignInru=https3A2F2Fwww.ebay.de2F
+signin01.kauf-eday.de/ws/eBayISAPI.dll/SignInru=https3A2F2Fwww.ebay.de2F/
  signin01.kauf-eday.de/ws/eBayISAPI.dll/SignInru_https3A2F2Fwww.ebay.de2F
  signin01.kauf-eday.de/ws/eBayISAPI.dll/SignInru_https3A2F2Fwww.ebay.de2F/
-signin01.kauf-eday.de/ws/eBayISAPI.dll/SignInruhttps3A2F2Fwww.ebay.de2F
  signin01.kauf-eday.de/ws/eBayISAPI.dll/SignInruhttps3A2F2Fwww.ebay.de2F/
-simuplitt.ga/secure/wgbground
-siodemkaop24.pl/OeKCSvS9r1U0RT2vL7/L3pHrQV
+signin01.kauf-eday.de/ws/ebayisapi.dll/signinru=https3a2f2fwww.ebay.de2fx
+signin01.kauf-eday.de/ws/ebayisapi.dll/signinruhttps3a2f2fwww.ebay.de2f
  sites.google.com/view/embedded-fi/home
-sjjohnson.com/TECHT/FBG/
  slack-redir.net/link
-smiduk.com/smiduk
-smiduk.com/smiduk/wp-content/plugins/three-column-screen-layout/ds/
+smbcc.kutternytg.work/pc
+smbcc.kutternytg.work/pc/index.php
+smbcc.ppustter.work/pc
+smbcc.ppustter.work/pc/index.php
+sncf.career-inspiration.com/app/home
  snip.ly/03elb0
  snip.ly/3b3y76
  snip.ly/7u961z
@@ -1483,14 +1418,16 @@ snip.ly/www.netflix.com-Login-secure
  snip.ly/www.netflix.com-Login-secure/
  snip.ly/www.netflix.com-costumer-login/
  snip.ly/www.netflix.com-signIn-account/
-societegeneraleweb-help.com/fr/
  soo.gd/BSmq
  soo.gd/T0F1
  soo.gd/kxVY
  soo.gd/l6Rg
  soo.gd/y3rR
-sorinuri.com/labanquepostale.fr/moncompte/708f6
-spappstest.com/img/portfolio/countdown
+sprosx.ru/admin/controller/extension/extension/access/index/wells
+sprosx.ru/admin/controller/extension/extension/access/index/wells/
+sprosx.ru/admin/controller/extension/extension/access/index/wells/wells.htm
+sritanjong.foxcave.com.my/adv34573494574/79643324690997867de/79643324690997867de/675445343de/q99550
+sritanjong.foxcave.com.my/adv34573494574/79643324690997867de/79643324690997867de/675445343de/q99550/a6635011.php
  st6.ning.com/topology/rest/1.0/file/get/8122054091/
  stor.ee/4kTV
  storage.googleapis.com/0ffice/ajo2
@@ -1961,9 +1898,8 @@ storage.googleapis.com/zhieurgfieuhfhre
  storage.googleapis.com/zhieurgfieuhfhre/hoif.htm
  storage.ning.com/topology/rest/1.0/file/get/8122054091/
  storage.ning.com/topology/rest/1.0/file/get/8377263659/
-strinkly.ga/secure/wgbground
-sunfruit.com.tn/rkf4jyz.zip
-supermercadocomunal.com/walmapp/wxmass/
+super8t20.com/.tmb/js/Netflix799
+super8t20.com/.tmb/js/Netflix799/index2.php
  surveygizmo.com/s3/5635022/AT-T/
  surveygizmo.com/s3/5655517/at-t
  surveygizmo.com/s3/5679924/AT-T-Login/
@@ -1995,16 +1931,15 @@ t.co/m6Fz3ChX91
  t.co/mCmzxZ8cyT
  t.co/mSKJH9xhZW
  t.ly/4HEr
-takkin.ga/secure/wgbground
-tasktracker.amtcdiecasting.com/vkg3wd.zip
-templateau.com/nam
-templateau.com/nam/login
  templatent.com/nam
  templatent.com/nam/login
  test.vrntrikotazh.ru/wordpress
+test.vrntrikotazh.ru/wordpress/wp-content/uploads/miniorangeds/mir/excelz/bizmail.php
  test.vrntrikotazh.ru/wordpress/wp-content/uploads/miniorangeds/to/excelz/index.php
-thedesertship.com/yi0rcy.rar
+thediamondcut.com/chase-login/home
+thediamondcut.com/chase-login/home/index.php
  themansionkasauli.com/smf53wmr.zip
+timelinegifts.com/mail
  tiny.cc/3cutsz
  tiny.cc/6mihnz
  tiny.cc/nlf03y
@@ -2045,17 +1980,16 @@ tny.sh/santrest
  tny.sh/share-myfile
  tny.sh/wBXwb4M
  tny.sh/z1iOyHK
-topmarketingnetwork.com/html/optimumcard
-topmarketingnetwork.com/html/optimumcard/confirmPayment.php
-topmarketingnetwork.com/html/optimumcard/login2.php
-topmarketingnetwork.com/html/optimumcard/verify.php
+topurbdopayregroup.com/mazon/
  torbandera.co/ag3cq1.rar
+tps-dhl-global.net/Home_eng/F004f19441
+tps-dhl-global.net/Home_eng/F004f19441/home.php
  tr.im/AlertaslBCP
-transformarindustrial.com.br/dri/
  translate.sogoucdn.com/pcvtsnapshotorigin
-tsb.personal-banking-secure-login.com/admin
+treqin.com/36528office
+trophycollectoristism.com/skills/mazon/b69b2
+trophycollectoristism.com/skills/mazon/b69b2/signin.php
  tuayudaesoterica.com/o01w4uih5.zip
-txfolerattuelt.com/USERS/dhl/dhl
  u.nu/2744a
  u.nu/42qil
  u.nu/dvh6r
@@ -2074,17 +2008,12 @@ u.to/ab0RGQ
  u.to/eAnBGQ
  u.to/iwFOGg
  u.to/x9AVFg
-u2102094.ct.sendgrid.net/ls/click
  ucarecdn.com/2a7b935a-1c7f-46e2-a05a-094adb8108a6/myflycodes.exe
-ucmxvip.com/pubgmobile
-unauthorised-payeerequested.com/lloyds
-unauthorised-payeerequested.com/lloyds/
-unauthorised-payeerequested.com/lloyds/Login.php
-unclejohn.in/login.wetransfer/Wetransfer/Wetransfer
-unclejohn.in/login.wetransfer/Wetransfer/Wetransfer/login.php
+unclejohn.in/alibaba.com/Alibaba.com
+unclejohn.in/alibaba.com/Alibaba.com/Login.htm
+untewrfidy.ru/=0A=
  uqr.to/icvk
  uqr.to/k5ga
-urlcart.in/messagerieproboxvocalmms/
  urlz.fr/aE9L
  urlz.fr/bUm9
  urlz.fr/cBMP
@@ -2126,57 +2055,23 @@ urlz.fr/ei4L
  urlz.fr/eiGH
  urlz.fr/ejHy
  urlz.fr/ekkz
+uy02.cf/as3oesxzlo892n4sxtygxolitvbhsasdklikdnvxiolrestracxgdliohfgxlkldhdolsrdacskgfcxreajxloiyrtbs/ian.aquino
  v.gd/eoauYu
  v.ht/7pzM
-vegasuperoffer.com/20FreeVC/.home
-vegasuperoffer.com/20FreeVC/.home/login.php
-verify-added-payee.com/lloyds
-verify-added-payee.com/lloyds/Login.php
-verify-mylogin-details.com/lloyds
-verify-mylogin-details.com/lloyds/Login.php
-verifyadded-payee.com/lloyds
-verifyadded-payee.com/lloyds/Login.php
-verifymylogin-details.com/lloyds
-verifymylogin-details.com/lloyds/Login.php
-vinnitska.com/fonts
-vinnitska.com/fonts/
-vinnitska.com/fonts/index.html
-vittalacharya.com/chase
-vittalacharya.com/chase/step1.php
-vittalacharya.com/chase/step2.php
-vmi512741.contaboserver.net/Americanas/MeusProdutos
-vmi512741.contaboserver.net/Americanas/MeusProdutos/Prefetch.php
-vossdental.com/att
+validatemy-o2.com/banks/online.citi.eu/GBIPB/JSO/signon
+validatemy-o2.com/banks/online.citi.eu/GBIPB/JSO/signon/DisplayUsernameSignon.html
+vitumbikomumba.com/eqc51d4ro.rar
+vmi512741.contaboserver.net/American/228607007/
+voltivoeg.com/dashboard/officeex
+voltivoeg.com/dashboard/officeex/updates.htm
  w1bmo.org/mobile
  w1bmo.org/mobile/
  wa.me/260979441405
  warninghusband.com/chase-login/home/
-webmail.hautot-communication.fr/exchweb/bin/auth/owalogon.asp
-webmail.marininter.9services.com/exchweb/bin/auth/owalogon.asp
-webmigoadcompany90.com.ng/PQ/
-whsyuzbhnbyuhiwcjfdpgwlsuq-dot-gl9393jan.uk.r.appspot.com/-23bgottheil-40fidelitypayment.com
-williancrespo.com/eqq/elAAAAAXNSR0IArs4c6QAAAARnQU1BAACxjwv8YQUAAAAJcEhZcwAADsQAAA7EAZUrDhsAA
-williancrespo.com/eqq/elAAAAAXNSR0IArs4c6QAAAARnQU1BAACxjwv8YQUAAAAJcEhZcwAADsQAAA7EAZUrDhsAA/code.php
-williancrespo.com/eqq/elAAAAAXNSR0IArs4c6QAAAARnQU1BAACxjwv8YQUAAAAJcEhZcwAADsQAAA7EAZUrDhsAA/login.php
-wkilchauffuer.com/node_modules/amdefine/Dropfile/
-wreathgroup.ca/ChAdmin/chase.security.update
-wreathgroup.ca/ChAdmin/chase.security.update/
-wreathgroup.ca/ChAdmin/chase.security.update/login.php
-wreathgroup.ca/ChAdmin/chase.security.update/surf2.php
-wreathgroup.ca/ChAdmin/chase.security.update/surf5.php
-wvvwinterbabancaporinternetpe.com/doc
-wvvwinterbabancaporinternetpe.com/doc/login.php
-y2e.cn/345r0X/
-yotype166.com/aq/appleid-re/8de328ba6441b041b73cb8ac1abd38ed
-yotype166.com/aq/appleid-re/8de328ba6441b041b73cb8ac1abd38ed/login.php
-yotype166.com/aq/appleid-re/bd7a97f70d25166dfe9cbb6c2b7b4c5f
-yotype166.com/aq/appleid-re/bd7a97f70d25166dfe9cbb6c2b7b4c5f/
-yotype166.com/aq/appleid-re/bd7a97f70d25166dfe9cbb6c2b7b4c5f/login.php
-yotype166.com/aq/appleid-re/d4829e1b4c94d1d8e1f685462d1173e9
-yotype166.com/aq/appleid-re/d4829e1b4c94d1d8e1f685462d1173e9/
-yotype166.com/aq/appleid-re/d4829e1b4c94d1d8e1f685462d1173e9/login.php
-yotype166.com/aq/appleid-re/e2ea0639a6c57f7540ee694d3372c10d
-yotype166.com/aq/appleid-re/e2ea0639a6c57f7540ee694d3372c10d/login.php
-zonaseguralbcp.viabcpz.com/app/template
-zonaseguralbcp.viabcpz.com/app/template/login/waiting.php
+webmail.gaianets.com/~connectw/verifiled
+webmail.gaianets.com/~connectw/verifiled/login.php
+webmail.plexusmedicalfrance.fr/exchweb/bin/auth/owalogon.asp
+wholesalealliancegroup.com/chase-upgrade/home
+wholesalealliancegroup.com/chase-upgrade/home/verification-email.php
+wvjvagnrtghggi.deroel.com/wvjvagnrtghggi/
  zonehmirrors.org/defaced/2019/09/11/magazinepromo.net/magazinepromo.net/
author	Travis CI User <travis@example.org>
	Mon, 1 Feb 2021 05:25:44 +0000 (05:25 +0000)
committer	Travis CI User <travis@example.org>
	Mon, 1 Feb 2021 05:25:44 +0000 (05:25 +0000)
README.md		patch \| blob \| blame \| history
blacklists/README		patch \| blob \| blame \| history
blacklists/adult/domains		patch \| blob \| blame \| history
blacklists/adult/urls		patch \| blob \| blame \| history
blacklists/malware/domains		patch \| blob \| blame \| history
blacklists/malware/urls		patch \| blob \| blame \| history