Automatic blacklist update

author Travis CI User <travis@example.org>

Wed, 7 Oct 2020 03:02:01 +0000 (03:02 +0000)

committer Travis CI User <travis@example.org>

Wed, 7 Oct 2020 03:02:01 +0000 (03:02 +0000)
author Travis CI User <travis@example.org>
Wed, 7 Oct 2020 03:02:01 +0000 (03:02 +0000)
committer Travis CI User <travis@example.org>
Wed, 7 Oct 2020 03:02:01 +0000 (03:02 +0000)
diff --git a/README.md b/README.md

index 32619c05268706b5d734a0594cd93eba29f654f7..a36ca96147310829c2d2ddbdd3ed1188808c9c33 100644 (file)
--- a/README.md
+++ b/README.md
@@ -6,7 +6,7 @@ __Note__: this repository is only intended to mirror lists, to modify/update the
  ## Lists
  | Name | Size | Description |
  |:-----|:-----|:------------|
-| [adult](blacklists/adult) | 2319800 | Some adult site from erotic to hard pornography |
+| [adult](blacklists/adult) | 2319748 | Some adult site from erotic to hard pornography |
  | [agressif](blacklists/agressif) | 380 | Some aggressive sites |
  | [arjel](blacklists/arjel) | 69 | ARJEL which is a french certification authority for gambling sites |
  | [associations_religieuses](blacklists/associations_religieuses) | 1 | religious_association |
@@ -38,7 +38,7 @@ __Note__: this repository is only intended to mirror lists, to modify/update the
  | [jobsearch](blacklists/jobsearch) | 386 | Site to looking for job |
  | [lingerie](blacklists/lingerie) | 83 | Sites for lingerie |
  | [liste_bu](blacklists/liste_bu) | 2881 | A french list for educational sites. VERY locally oriented. may help libraries |
-| [malware](blacklists/malware) | 160696 | Any website which deliver malware |
+| [malware](blacklists/malware) | 160388 | Any website which deliver malware |
  | [manga](blacklists/manga) | 755 | Any website related to manga, and cartoons |
  | [marketingware](blacklists/marketingware) | 28 | Very special marketing sites |
  | [mixed_adult](blacklists/mixed_adult) | 152 | Websites which contains adult sections unstructured |
diff --git a/blacklists/README b/blacklists/README

index 87043838c7d624a58a2dd9c6eb915487a95f8efb..3567505256b0b86a89187f7a8000c761b46a2317 100644 (file)
--- a/blacklists/README
+++ b/blacklists/README
@@ -41,7 +41,7 @@ adult.tar.gz          is a list of adult sites. They are based on
                                          Symon Aked
                                          Todd Sieland-Peterson
  
-Last version Monday 05 October 2020 with 2252046 domains and 67754 urls : 9256 Kb.
+Last version Tuesday 06 October 2020 with 2252034 domains and 67754 urls : 9256 Kb.
                         
  
  OTHER :
diff --git a/blacklists/adult/domains b/blacklists/adult/domains

index 4dadaf6c5498600f8e2de3fb927e36c0cd9a5a13..14b27cc2c978faebd03f10ee9ee9c1e34f7a4f6a 100644 (file)
--- a/blacklists/adult/domains
+++ b/blacklists/adult/domains
@@ -584066,6 +584066,7 @@ conseilsexe.com
  conseilsexologie.canalblog.com
  conseilsexuel.fr
  conseilssexuels.com
+consejosdeunahotwife.blogspot.com
  conselhosdemestre.blogspot.ae
  conselhosdemestre.blogspot.al
  conselhosdemestre.blogspot.am
@@ -927542,6 +927543,7 @@ gay-cock-slave.blogspot.sk
  gay-cock-slave.blogspot.sn
  gay-cock-slave.blogspot.tw
  gay-cock-slave.blogspot.ug
+gay-cock-suckers.blogspot.com
  gay-cockring.com
  gay-cocks-hardcore-sex.com
  gay-cocks.com
@@ -1141797,6 +1141799,7 @@ iporndirectory.blogspot.sn
  iporndirectory.blogspot.tw
  iporndirectory.blogspot.ug
  iporndirectory.com
+ipornerhd.net
  ipornfap.com
  ipornfilms.com
  ipornfree.com
@@ -1379988,6 +1379991,7 @@ mojopics.com
  mojoporn.info
  mojoporno.com
  mojopornos.com
+mojoporntube.com
  mojoporntube.net
  mojosearch.com
  mojosex.com
@@ -2167610,6 +2167614,7 @@ wardrobemalfunction.tumblr.com
  wareador.tumblr.com
  wareferen.tumblr.com
  warehouseraven.tumblr.com
+wareporn.com
  warez-downloads.net
  warez-porn.09dsa.com
  warez-porn.com
@@ -2251988,59 +2251993,3 @@ xxx
  porn
  sex
  adult
-xxx
-porn
-sex
-adult
-xxx
-porn
-sex
-adult
-xxx
-porn
-sex
-adult
-xxx
-porn
-sex
-adult
-xxx
-porn
-sex
-adult
-xxx
-porn
-sex
-adult
-xxx
-porn
-sex
-adult
-ipornerhd.net
-mojoporntube.com
-xnxx.wareporn.com
-wareporn.com
-xxx
-porn
-sex
-adult
-xxx
-porn
-sex
-adult
-xxx
-porn
-sex
-adult
-xxx
-porn
-sex
-adult
-xxx
-porn
-sex
-adult
-xxx
-porn
-sex
-adult
diff --git a/blacklists/adult/urls b/blacklists/adult/urls

index f209ce51eac79cf68c2182deca8faacb948f91a1..393e1e89469ea434a9b173dbf9278f728313e5e3 100644 (file)
--- a/blacklists/adult/urls
+++ b/blacklists/adult/urls
@@ -26960,7 +26960,6 @@ gawker.com/regrettably-farrah-abraham-wrote-an-erotic-romance-n-1557019859
  gawker.com/tag/bondage
  gawker.com/teen-girl-ejected-from-prom-because-horny-dads-cant-sto-1575694507
  gawker.com/theres-a-blowjob-on-youtube-the-nymphomaniac-trailer-1469739897
-gay-cock-suckers.blogspot.com/2019/02
  gay-movie-club.com/gay/02_08/02
  gay-movie-club.com/gay/08_08/02
  gay-nerds.com/site/
diff --git a/blacklists/malware/domains b/blacklists/malware/domains

index 14c3b9c5f226fd65422cc5d31b7c81dc10c54483..163388f2bf4627d3f96a6dbdba94c484fae58253 100644 (file)
--- a/blacklists/malware/domains
+++ b/blacklists/malware/domains
@@ -502,6 +502,7 @@
  101.0.81.153
  101.132.182.76
  101.132.43.162
+101.187.81.254
  101.201.62.45
  101.25.117.141
  101.64.157.103
@@ -653,8 +654,10 @@
  104.168.99.220
  104.175.99.243
  104.192.108.19
+104.193.103.61
  104.194.11.180
  104.194.247.149
+104.194.247.150
  104.194.247.152
  104.194.247.157
  104.194.247.158
@@ -669,6 +672,7 @@
  104.211.28.157
  104.218.48.11
  104.223.143.150
+104.223.143.234
  104.223.170.68
  104.223.170.93
  104.225.251.29
@@ -706,6 +710,7 @@
  104.41.52.218
  1041469-dot-n-e-w-me-ss-age-po-rt-al.wl.r.appspot.com
  104722155613106546.002.sh.cn
+105.185.152.15
  105.186.233.33
  105.209.235.113
  105.27.155.182
@@ -856,6 +861,7 @@
  108studija.lt
  109-365.net
  109.117.53.230
+109.13.179.195
  109.166.89.91
  109.169.12.78
  109.206.139.119
@@ -1445,6 +1451,7 @@
  115.63.19.124
  115.79.195.246
  115.79.59.157
+115.98.0.71
  115.98.71.54
  11515-dot-phonic-obelisk-274214.uk.r.appspot.com
  1152crump.com
@@ -1525,6 +1532,7 @@
  116.75.103.58
  116.75.117.40bin.sh
  116.90.59.223
+116.91.240.96
  116151147136715.002.sh.cn
  1164e4989ededf518a4.yolasite.com
  1169732-dot-phonic-obelisk-274214.uk.r.appspot.com
@@ -1678,6 +1686,7 @@
  119.106.216.84
  119.125.129.86
  119.159.150.176
+119.165.107.65
  119.165.83.110
  119.179.165.18
  119.180.32.217
@@ -1719,6 +1728,7 @@
  12.229.155.122
  12.25.14.44
  12.34.11.112
+120.150.218.241
  120.150.247.164
  120.150.60.189
  120.193.91.197
@@ -1751,6 +1761,7 @@
  120.79.151.95
  120.97.20.106
  120.dodadubose.com
+120264-dot-n-e-w-me-ss-age-po-rt-al.wl.r.appspot.com
  120602-dot-n-e-w-me-ss-age-po-rt-al.wl.r.appspot.com
  120att.weebly.com
  120fsbyy.com
@@ -1828,6 +1839,7 @@
  122.234.77.121
  122.236.192.162
  122.51.92.78
+122177-dot-n-e-w-me-ss-age-po-rt-al.wl.r.appspot.com
  122572447422481-dot-wetransfer-auth-file-341.appspot.com
  122980data.danzer.site
  122uc.com
@@ -1997,10 +2009,12 @@
  125.47.245.184
  125.66.106.2
  125.84.217.97
+125.99.147.56
  125.99.60.171
  125.99.61.162
  125478526j.weebly.com
  125fbe8e-c223-43d2-974f-9e171c4e36c0.htmlcomponentservice.com
+126.126.139.26
  126bus.cn
  126f7b50-bfe6-4649-a622-42cb62c2a8d5.htmlcomponentservice.com
  126mailbox-verification.duckdns.org
@@ -2053,6 +2067,7 @@
  13.59.63.89
  13.65.215.106
  13.65.246.58
+13.66.28.137
  13.73.16.128
  13.73.23.121
  13.77.205.248
@@ -2142,6 +2157,7 @@
  138.68.53.245
  138.68.66.69
  138.97.105.238
+138.97.60.140
  138.97.60.141
  138606-dot-n-e-w-me-ss-age-po-rt-al.wl.r.appspot.com
  13870112233.mer.lstest.siquality.com
@@ -2281,6 +2297,7 @@
  142.93.113.143
  142.93.113.159
  142.93.116.254
+142.93.118.23
  142.93.124.101
  142.93.159.172
  142.93.171.37
@@ -2365,6 +2382,7 @@
  149.62.173.247
  1493-security-dispatch.com
  14978.gucac.com
+149822-dot-n-e-w-me-ss-age-po-rt-al.wl.r.appspot.com
  149908.bibigor.com
  14c24f0231c2422a1bcbdb7ad4d7e754-dot-phonic-obelisk-274214.uk.r.appspot.com
  14h.pw
@@ -2652,6 +2670,7 @@
  162.241.117.179
  162.241.117.37
  162.241.125.106
+162.241.140.129
  162.241.154.215
  162.241.158.222
  162.241.214.166
@@ -2744,6 +2763,7 @@
  165.84.180.66
  16512.url.789msw.com
  1654.3190cfdae.com
+1669183-dot-n-e-w-me-ss-age-po-rt-al.wl.r.appspot.com
  167.114.122.37
  167.114.129.9
  167.114.210.191
@@ -2877,6 +2897,7 @@
  173.249.55.108
  173.254.242.215
  173.254.87.47
+173.82.123.229
  173.82.123.232
  173.82.123.243
  173.82.123.247
@@ -2894,12 +2915,17 @@
  173.82.22.110
  173.82.22.112
  173.82.22.113
+173.82.22.114
  173.82.22.117
  173.82.22.125
+173.82.22.77
+173.82.22.82
+173.82.22.83
  173.82.22.95
  173.82.97.194
  173.82.97.197
  173.82.97.198
+173.82.97.221
  173.82.97.223
  173.82.97.235
  173.91.11.142
@@ -2908,6 +2934,7 @@
  174-365.net
  174.102.48.180
  174.106.122.139
+174.118.202.24
  174.128.226.101
  174.128.235.243
  174.129.10.127
@@ -3072,6 +3099,7 @@
  177.103.240.93
  177.128.35.51
  177.129.17.170
+177.144.130.105
  177.144.135.2
  177.188.121.26
  177.200.94.150
@@ -3108,6 +3136,7 @@
  178.20.74.212
  178.208.75.227
  178.210.66.37
+178.211.45.66
  178.218.222.185
  178.248.200.16
  178.250.54.208
@@ -3606,6 +3635,7 @@
  185.234.217.224
  185.234.218.145
  185.234.72.64
+185.239.242.174
  185.239.242.195
  185.239.242.197
  185.239.242.247
@@ -3694,6 +3724,7 @@
  186.68.141.218
  186.70.127.199
  186.73.188.132
+186.74.215.34
  186.75.130.46
  186.75.241.230
  186.84.173.153
@@ -3797,6 +3828,7 @@
  190.146.131.105
  190.147.215.53
  190.161.67.63
+190.164.135.81
  190.17.44.48
  190.171.153.139
  190.188.245.242
@@ -3841,6 +3873,7 @@
  191.101.166.81
  191.182.6.118
  191.183.21.190
+191.191.23.135
  191.232.169.208
  191.232.172.50
  191.232.176.226
@@ -3890,6 +3923,7 @@
  192.162.102.44
  192.163.199.254
  192.163.221.191
+192.175.111.217
  192.185.129.96
  192.210.140.199
  192.210.217.94
@@ -3901,6 +3935,7 @@
  192.227.215.147
  192.227.233.8
  192.232.205.102
+192.232.229.54
  192.232.245.217
  192.236.146.153
  192.236.146.5
@@ -4120,6 +4155,7 @@
  195.69.187.6
  195.88.208.35
  19536.psdzy.com
+195479-dot-n-e-w-me-ss-age-po-rt-al.wl.r.appspot.com
  196.213.65.166
  196.52.43.52
  196.6.112.70
@@ -4142,6 +4178,7 @@
  198.144.176.147
  198.144.191.135
  198.199.114.69
+198.20.228.9
  198.211.104.28
  198.211.15.61
  198.211.60.243
@@ -4223,7 +4260,6 @@
  19cy3.csb.app
  19vidcra.com
  19x218931x22.xyz
-1a-fitness-coach.com
  1a-teensbilder.de
  1a4761a0-4fc4-4623-b295-d37ac58d58b3.htmlcomponentservice.com
  1a4f258d-3211-4e76-b606-3d4fa3be5563.htmlcomponentservice.com
@@ -4421,6 +4457,7 @@
  2.57.122.167
  2.57.122.186
  2.57.122.196
+2.58.16.86
  2.gabung-grup-whatsapp.getsviip7.com
  2.indexsinas.me
  2.top4top.io
@@ -4496,7 +4533,9 @@
  202.153.220.157
  202.166.170.43
  202.182.112.26
+202.22.141.45
  202.29.215.114
+202.29.237.113
  202.29.239.162
  202.29.57.22
  202.29.95.12
@@ -4700,6 +4739,7 @@
  20200908042003-dot-meta-cistern-288809.appspot.com
  20200908111002-dot-meta-cistern-288809.appspot.com
  20200908125016-dot-meta-cistern-288809.appspot.com
+20200908172903-dot-s2pe7ed9y.rj.r.appspot.com
  20200909112725-dot-t6w5q4p9o7i3.uc.r.appspot.com
  20200909134933-dot-s2pe7ed9y.rj.r.appspot.com
  20200909152032-dot-s2pe7ed9y.rj.r.appspot.com
@@ -4773,6 +4813,7 @@
  20418-dot-n-e-w-me-ss-age-po-rt-al.wl.r.appspot.com
  20449959931.z13.web.core.windows.net
  205.134.182.106
+205.134.255.225
  205.185.113.151
  205.185.114.231
  205.185.115.93
@@ -4850,6 +4891,7 @@
  209.141.59.245
  209.141.61.233
  209.141.62.139
+209.182.202.96
  209.182.219.176
  209.182.219.37
  209.190.46.193
@@ -4886,6 +4928,7 @@
  210.76.64.46
  2109f.com
  210sadivorce.com
+211.104.242.52
  211.105.40.71
  211.110.229.161
  211.117.60.11
@@ -4926,6 +4969,7 @@
  212.129.47.122
  212.162.151.144
  212.186.191.177
+212.22.70.65
  212.227.164.164
  212.227.164.228
  212.237.0.244
@@ -4988,6 +5032,7 @@
  216.251.83.79
  216.47.196.104
  216.75.37.196
+216.83.55.154
  216.97.65.6
  216.98.84.2bin.sh
  21625.xc.iziyo.com
@@ -5027,6 +5072,7 @@
  217.8.117.76
  217.8.117.79
  217.8.117.89
+217538-dot-n-e-w-me-ss-age-po-rt-al.wl.r.appspot.com
  218.156.226.141
  218.156.26.85
  218.2.53.161
@@ -5084,6 +5130,7 @@
  219.92.228.222
  219.94.242.134
  21906.8wix.com
+219236-dot-n-e-w-me-ss-age-po-rt-al.wl.r.appspot.com
  219betasus.com
  219data08219821.info
  21bw3kuv9qjfp0rc3.sted.cc
@@ -5456,6 +5503,7 @@
  24bizhub.com
  24d65ec4693040079.temporary.link
  24december.net
+24dnl.com
  24e8c1f6.ngrok.io
  24ekspres.online
  24gam.ir
@@ -5481,6 +5529,7 @@
  2500edevletaidat.com
  250land.000webhostapp.com
  2511463.top
+251619-dot-n-e-w-me-ss-age-po-rt-al.wl.r.appspot.com
  25170.mydown.xaskm.com
  25173.xc.08an.com
  25220.xc.789msw.com
@@ -5573,6 +5622,7 @@
  277288.com
  277288c.com
  277288d.com
+277765-dot-n-e-w-me-ss-age-po-rt-al.wl.r.appspot.com
  2781mysite.com
  278marsbahis.com
  2794236-dot-n-e-w-me-ss-age-po-rt-al.wl.r.appspot.com
@@ -6811,13 +6861,11 @@
  3xstuff.com
  3zbofaz3.bofa0serivceb.com
  3zonasegurabeta-viabcp-com.ml
-3zonasegurabeta-viabcp-com.tk
  3zonasegurabeta-viabcp.ga
  4-1omkw43qb.vercel.app
  4.4buyuklergazete.com
  4.program-iq.com
  4.top4top.io
-4.virustotalstorage.secure.keen-sight-280309.appspot.com
  40.114.104.42
  40.117.133.229
  40.118.205.218
@@ -7097,6 +7145,7 @@
  45.233.169.14
  45.238.23.82
  45.239.204.100
+45.248.195.94
  45.32.115.39
  45.32.161.249
  45.32.169.147
@@ -7350,6 +7399,7 @@
  46.101.127.55
  46.101.131.239
  46.101.250.174
+46.101.58.37
  46.105.131.68
  46.105.131.69
  46.105.131.79
@@ -7675,7 +7725,6 @@
  4e76363340283f5a51a7a038273b2b34-dot-dbenitonline.ey.r.appspot.com
  4elements.es
  4eomkeale.s3-ap-northeast-1.amazonaws.com
-4esdes4se.dns05.com
  4f2a22237313d456d8821618d67aed6c-dot-dbenitonline.ey.r.appspot.com
  4f3c63a6674418b6e8da97d50eb4e9defe98fca1.info
  4fbpixel.000webhostapp.com
@@ -8033,6 +8082,7 @@
  5242523rl.email
  52539156-dot-sydneyma.appspot.com
  526-deanna.com
+526043-dot-n-e-w-me-ss-age-po-rt-al.wl.r.appspot.com
  526081910.snapchatprime.com
  526547059340471-dot-igd-lkf-ver.appspot.com
  526610eb523122411.temporary.link
@@ -8106,6 +8156,7 @@
  54654sqd465qsd.044bcc2.netsolhost.com
  547.31cf4fdae.com
  54738.dojnh.com
+548280-dot-n-e-w-me-ss-age-po-rt-al.wl.r.appspot.com
  5485j.000webhostapp.com
  54920.gucac.com
  5499299-dot-n-e-w-me-ss-age-po-rt-al.wl.r.appspot.com
@@ -8121,7 +8172,6 @@
  553636.duckdns.org
  553ags9g4ge.sted.cc
  55445dddfsd.000webhostapp.com
-554h-jfjfjf-36647-hfhfh-373ff-3r3r.weebly.com
  5552676-dot-n-e-w-me-ss-age-po-rt-al.wl.r.appspot.com
  555365s.com
  555365t.com
@@ -8234,6 +8284,7 @@
  59.175.116.137
  59.28.44.229
  59.3.94.190
+590466-dot-n-e-w-me-ss-age-po-rt-al.wl.r.appspot.com
  5918062d-fb42-4707-b098-e2c266e14d95.htmlpasta.com
  591860.playcode.io
  5924.3190cfdae.com
@@ -8253,7 +8304,6 @@
  59pillhill.com
  59production.com
  5a89e4aeebac26a66c0d3adca517ad6.cc
-5a900e117d77.ngrok.io
  5a92b3462d9d3bb7799cd751532c044be4c208c5.info
  5aby.com
  5ac76517d87a53aebc273fc2a120ddbb-dot-dbenitonline.ey.r.appspot.com
@@ -8329,6 +8379,7 @@
  5rbuortfa5r.bankofamericaslpemr.com
  5rd43ede4566gt67ytu7h6.kardelenambalaj.com
  5reviews.info
+5rs9iy.com
  5ssolutions.net
  5starprimarycare.org
  5starseuropes.teamplast.co
@@ -8345,7 +8396,6 @@
  5x.to
  5xosecuremy-accountgoogle-servicelogin.gq
  5y8jtebw.com
-5ydfg4dfs.dns05.com
  5yeh.com
  5ytaj8s6-p2tjtsccf.vercel.app
  5zax0yz7ou.vercel.app
@@ -8380,6 +8430,7 @@
  607200279050649-dot-vlr-djt-aeb.appspot.com
  607sportsarchive.com
  608design.com
+609031-dot-n-e-w-me-ss-age-po-rt-al.wl.r.appspot.com
  609155589597169-dot-vui-egd-lhs.appspot.com
  60974429.snapchatprime.com
  60cyr.codesandbox.io
@@ -8537,6 +8588,7 @@
  63hr-y368-f35-hf63-nd3r.weebly.com
  63proflightgamesjs.us
  63qu.uk
+64.13.225.150
  64.130.171.107
  64.156.14.238
  64.183.73.122
@@ -8588,7 +8640,6 @@
  650flwersinsta.000webhostapp.com
  650vm.app.link
  652.3190cfdae.com
-6535345her524h5k4dd8305d3b0d52a2616-dot-hospital-management-sys.uc.r.appspot.com
  653635dda973c896905dc7b87958b1ca0ae257b9.info
  6537712314-itm.ltd
  654.31cf4fdae.com
@@ -8596,6 +8647,7 @@
  6545678765.weebly.com
  6546498-dot-n-e-w-me-ss-age-po-rt-al.wl.r.appspot.com
  654v.com
+656276-dot-n-e-w-me-ss-age-po-rt-al.wl.r.appspot.com
  6564f4ea-83d4-4126-9791-0aacf60437d0.godaddysites.com
  6566587965575699667.000webhostapp.com
  656ttyghhg.hopto.org
@@ -8762,6 +8814,7 @@
  6863536.com
  6863635.com
  6863653.com
+686508-dot-n-e-w-me-ss-age-po-rt-al.wl.r.appspot.com
  68653365.com
  6865353.com
  6865635.com
@@ -8796,6 +8849,7 @@
  69.10.62.78
  69.14.208.221
  69.163.33.84
+69.164.145.131
  69.167.151.209
  69.183.32.121
  69.65.3.168
@@ -8915,6 +8969,7 @@
  7178738ba71e0b5ef7a8208dfajekjfl329a.asd1377.com
  71sise.com
  71zhuan.com
+72.143.73.234
  72.167.223.217
  72.17.22.30
  72.18.130.41
@@ -8954,6 +9009,7 @@
  73.55.128.120
  7302321canadainc.com
  730857112247343118.weebly.com
+732930-dot-n-e-w-me-ss-age-po-rt-al.wl.r.appspot.com
  735203733.servecounterstrike.com
  7357569-dot-n-e-w-me-ss-age-po-rt-al.wl.r.appspot.com
  735846009328314-dot-wetransfer-auth-file-343.appspot.com
@@ -8986,6 +9042,7 @@
  747big.com
  7482c4019d9646fde684daec20b508ab-dot-tomberera.appspot.com
  7482y3740.us-south.cf.appdomain.cloud
+749295-dot-n-e-w-me-ss-age-po-rt-al.wl.r.appspot.com
  749948-dot-n-e-w-me-ss-age-po-rt-al.wl.r.appspot.com
  74d0c9c8.ngrok.io
  74euue.ddns.net
@@ -9172,6 +9229,7 @@
  7c3fd09417.2319edmondson.xyz
  7cbofac7.bofa0serivceb.com
  7cbuofa7c.bankofamericaslpemr.com
+7colours.co.za
  7continents7lawns.com
  7d-textile.com
  7d07afc530.nxcli.net
@@ -9201,6 +9259,7 @@
  7ku50.csb.app
  7l6pcvwrv-km8onf6uk.vercel.app
  7le4bxx1k4wczfd.e8273.pro
+7les.com
  7m1x3b-apple0pay.servecounterstrike.com
  7medsatour.ddns.net
  7melk.com
@@ -9317,6 +9376,8 @@
  81047.psdzy.com
  811-365.net
  811494330656f5087e0d5e14b14a50a0-dot-dbenitonline.ey.r.appspot.com
+81213-dot-n-e-w-me-ss-age-po-rt-al.wl.r.appspot.com
+81231-dot-n-e-w-me-ss-age-po-rt-al.wl.r.appspot.com
  8127646-dot-oaao-274308.uc.r.appspot.com
  8133749b1df9a4aa8ce4bb891da828cab17aa5b9.info
  8133msc.com
@@ -9360,7 +9421,6 @@
  82.81.102.84
  82.81.4.57
  8200msc.com
-8203her928h7e4dd8305d3b0d52a2616-dot-polynomial-sum-287816.df.r.appspot.com
  820820.kansaigroup.net
  820820.salamapetrochemical.com
  820laurelridgedrive-count-mail-163.com-9876111.platinumtransportservices.com
@@ -9402,6 +9462,7 @@
  835932-dot-n-e-w-me-ss-age-po-rt-al.wl.r.appspot.com
  836-365.net
  83709820.tk
+83737-dot-involuted-earth-290716.du.r.appspot.com
  837outl0koff.netlify.app
  83829.tk
  8382canada-ccg.online
@@ -9419,6 +9480,7 @@
  841365365.com
  8425113.com
  842588030.servehalflife.com
+842678-dot-n-e-w-me-ss-age-po-rt-al.wl.r.appspot.com
  843f257a9b35eff7032b03bce281feb1.icu
  8440651-dot-n-e-w-me-ss-age-po-rt-al.wl.r.appspot.com
  8444665-dot-n-e-w-me-ss-age-po-rt-al.wl.r.appspot.com
@@ -9536,6 +9598,7 @@
  87654678.weebly.com
  8765478765432.weebly.com
  87678hhh8767.weebly.com
+876797-dot-n-e-w-me-ss-age-po-rt-al.wl.r.appspot.com
  876962-dot-n-e-w-me-ss-age-po-rt-al.wl.r.appspot.com
  876j.us-south.cf.appdomain.cloud
  8772333.com
@@ -9546,6 +9609,7 @@
  87bb9065-b941-41e6-b7c7-3bfa8ba9ae74.server2.deepsound.live
  87creationsmedia.com
  87d61bf1-78b5-470c-a4bb-fd3e618d85ea.htmlcomponentservice.com
+87du.vip
  87e797ff05f2.ngrok.io
  87ew98hgwrhj1ne3ranj14et5k4r85y66sk7867yrl648tu747p8y7i868we584.buzz
  87ms.com
@@ -9885,6 +9949,7 @@
  92ideas.com
  92jobz.com
  92ld0-fund.online
+93.104.210.230
  93.104.213.162
  93.113.206.62
  93.114.82.154
@@ -9948,6 +10013,7 @@
  94.200.114.162
  94.200.126.42
  94.205.247.10
+94.212.52.40
  94.23.237.171
  94.24.72.63
  94.242.57.190
@@ -10051,6 +10117,7 @@
  970380605.servehalflife.com
  971b0617.ngrok.io
  97290mobilty093.com
+972916-dot-n-e-w-me-ss-age-po-rt-al.wl.r.appspot.com
  972923681372744665.weebly.com
  973259.com
  974427-dot-n-e-w-me-ss-age-po-rt-al.wl.r.appspot.com
@@ -10145,6 +10212,7 @@
  987currentupdate.weebly.com
  988077b0583c14acb17ba4e71dfec8b60f18ba8d.com
  988991-dot-n-e-w-me-ss-age-po-rt-al.wl.r.appspot.com
+989822-dot-n-e-w-me-ss-age-po-rt-al.wl.r.appspot.com
  9899909.ru
  989coworking.com
  98fc40c5287be2095d2f2b2452c7a94b1ea06155.info
@@ -10197,7 +10265,6 @@
  999wordpressdesign.com
  99current-update.weebly.com
  99currentlyupdate.weebly.com
-99deals.top
  99ea0e07-dece-4161-85f1-bb1a4b4a28dc.htmlcomponentservice.com
  99f2a599587cda6df8a344878c4cb5ae37d353e8.info
  99gifty.com
@@ -10278,6 +10345,7 @@ a-americanaspromocoes.com
  a-ccesonligne.yolasite.com
  a-docu-sign.link
  a-e2k.addroits.com
+a-electronics.com.mx
  a-entregasemcasa.com
  a-freelancer.com
  a-js.de
@@ -10639,6 +10707,7 @@ aaronwhitaker.ru
  aarsen.us
  aarsterertaricabl.info
  aartijaya.com
+aartt-71.ga
  aartt-71.ml
  aarvorg.com
  aaryagold.com
@@ -10979,7 +11048,6 @@ absa-sa.com
  absa-validation.com
  absantprovedor.com
  absaonlinebanking.mailview2865.xyz
-absastockbrokers.co.za
  abscete.info
  abschiedvonmatthiascom.chifanassume.top
  absentomar.net
@@ -11019,6 +11087,7 @@ abuelos.com
  abuhamzapetstore1.sizzlingmart.com
  abundancetradingmarketing.com
  abundantphobosaccession.com
+abuse48paypal.com
  abuseamz-support.com
  abushsnakkaan.com
  abusivement.angelaplunkett.com
@@ -11080,7 +11149,6 @@ acampaguaviva.com.br
  acampaguaviva.ycompany.com.br
  acaness.com
  acaonecessaria.net
-acapulco.rs
  acapulkacom.shaxiaassessment.top
  acaradangdut.bj6preegccrnq7yhutemeh2w.com
  acardesign.ro
@@ -11131,7 +11199,6 @@ accecuatfb077.webnode.com
  accedi-subito-app2020.it
  accedissl.naptel.net
  accelerate.zero1creations.com
-accemarbeyal.com
  accent-assurances.com
  accent8bay.com
  accenter.answerivecovid19.com
@@ -11306,6 +11373,7 @@ account-appleid-com-tdknjce2ifm48bp5lg2u9b86g6.fyardq.com
  account-appleid-com-vldovqnpd669ophjtu1avh792m.zokirehai.xyz
  account-billing-ref287.com
  account-blcoked-404-20.azurewebsites.net
+account-bnppariabs.espacepro.saboscario.com
  account-chase.3utilities.com
  account-comfrim.serveirc.com
  account-confirm1.sportspoc.com
@@ -11678,6 +11746,7 @@ accountblocked-netflix.com
  accountchckecker-update-now.drpiza.com
  accountcheckid.000webhostapp.com
  accountcheckinfo.com
+accountendorse.xyz
  accountfb081.webnode.com
  accountg0ogle.000webhostapp.com
  accountgoback.mixh.jp
@@ -11799,6 +11868,7 @@ accountsecure.z13.web.core.windows.net
  accountsecureid.serveirc.com
  accountsecuresupport.com
  accountsecurity-id.serveirc.com
+accountsecurity-payee.com
  accountsecuritypaymentlockedapple.com
  accountsercurityupgrade.web.app
  accountserve-apple.serveirc.com
@@ -11915,6 +11985,7 @@ acdswd.cn
  acdzktuyehjomrawnqpbogm.top
  ace3.legendsbotnet.live
  ace375b9ff0fd69ff0f.net
+acebangladesh.com
  acebo0ok.000webhostapp.com
  acebook.cba.pl
  acecarelectrics.co.uk
@@ -12244,6 +12315,7 @@ actld.org.tw
  actn34acc01.xyz
  actofrage.nl
  actsecs.xyz
+actseize.cyou
  actualisatie-0formulier.com
  actualist-matter.000webhostapp.com
  actualiza-banruralgt.com
@@ -12515,7 +12587,6 @@ adivk.000webhostapp.com
  adiyuvhlagblkvri-dot-millinium.ey.r.appspot.com
  adjapao.com
  adjfzhmcuaclxlsv-dot-millinium.ey.r.appspot.com
-adjoress.top
  adjustintegrate.org
  adkgfqvawtcehztwwx.top
  adkhanabfic.gq
@@ -12620,7 +12691,6 @@ adminverificationattmailservices.weebly.com
  adminwhiz.ca
  admiradoresdaumbanda.com.br
  admiral-markets.com
-admiralkirk.de
  admiralmarketsltd.com
  admirelog.com
  admiring-mcclintock-863f18.netlify.com
@@ -12922,6 +12992,7 @@ advancedmetering.com.au
  advancedphysio.in
  advanceds.000webhostapp.com
  advancedsupportonline.com
+advanceimunssystems.us
  advancesetter0.com
  advancetechnology1471.com
  advanceusaloans.com
@@ -12967,6 +13038,7 @@ adviseradviser.xyz
  adviserbrilliance.xyz
  advisersailor.xyz
  advisio.ro
+advisorybroker.nw.r.appspot.com
  advizewealth.com
  advnaiklpohxbscc-dot-millinium.ey.r.appspot.com
  advocaciadescomplicada.com.br
@@ -13288,6 +13360,7 @@ afucahyeza.topkorder.su
  afukawys.gikorip.net
  afullmovie.org
  afunnything.ddns.net
+afusheng.cn
  afvsgxgdfvvyheruhgujeipkkgbjnfhbcfvagtevdgsvc.000webhostapp.com
  afweb.ru
  afwffuhmxebbrzug-dot-millinium.ey.r.appspot.com
@@ -13815,6 +13888,7 @@ aimarketers.in
  aimeelewis.oucreate.com
  aimeept.com
  aimevolution.com
+aimfire.in
  aimgayolues.com
  aimiberica.com
  aimiljuniorsmiles.com
@@ -14019,6 +14093,7 @@ ajbuilds.uk
  ajchuqbpnnhniogs-dot-millinium.ey.r.appspot.com
  ajczfarnbuggoejl-dot-millinium.ey.r.appspot.com
  ajdevelopmentgroup.com
+ajedrezenmorelos.com
  ajeetbisen.com
  ajexdntaakevcvsc-dot-millinium.ey.r.appspot.com
  ajexin.com
@@ -14433,8 +14508,8 @@ alborzatashza.ir
  albostechnologies.com
  albrechtcccom.chifanavoid.top
  albrightrenovationsinc.com
-albumcut.guru
  albumdepremios.com.br
+albumfoto2.000webhostapp.com
  albzhdmayyuluqzn-dot-millinium.ey.r.appspot.com
  alcaido.com
  alcampocolombia.com
@@ -14497,7 +14572,6 @@ alemdalenda.com.br
  alemelektronik.com
  alemm2edf.000webhostapp.com
  alemrqkulneukclt-dot-millinium.ey.r.appspot.com
-alena1971.es
  alendion-71.ga
  alenjazalshamikh.com
  alerba-nlinea.000webhostapp.com
@@ -14514,6 +14588,7 @@ alert-amazoncenter.serveirc.com
  alert-amzn.serveirc.com
  alert-center-wells.com
  alert-confrim00.gq
+alert-device.cc
  alert-disableupdate.servebeer.com
  alert-fb-security-account.nogueiracontabil.com
  alert-messageunderrequest.xyz
@@ -14593,6 +14668,7 @@ alertaysegurid26.webcindario.com
  alertaysegurid27.webcindario.com
  alertaysegurid28.webcindario.com
  alertaysegurid35.webcindario.com
+alertaysegurid43.webcindario.com
  alertaysegurida1.webcindario.com
  alertaysegurida7.webcindario.com
  alertbofa.ttroger.com
@@ -14708,6 +14784,7 @@ alfomindomitrasukses.com
  alfonsosanchezhormigo.com
  alfonsteruelphotography.com
  alforcargo.com
+alfredcoutureltee.com
  alfredding.xyz
  alfredobajc.com
  alfredocanal.000webhostapp.com
@@ -14764,6 +14841,7 @@ aliabrasil.com.br
  aliad.com.au
  aliaksesuar.com
  alialrajhi.com
+aliancademisericordia.pt
  aliancavisual.com.br
  aliancerubber.com
  alias.com.br
@@ -14955,10 +15033,13 @@ allepaka.miami
  allergoclinic.kz
  allert-mps.com
  alles-wissen.24.eu
+allesr-postch24.com
  alleyesonme.amacificrack.cloud
  alleyesonme.masteradvanced.shop
  alleyesonme.rakutmarketplace.info
  alleyesonme.rekoten.best
+allez-postch24.com
+allfitsuplementos.com.br
  allfordogsbarbet.com
  allfortheloveofyou.com
  allfreedating.ru
@@ -14967,6 +15048,7 @@ allgrupbokepersscrooot.v-25.com
  allhealthylifestyles.com
  allhouseappliances.com
  alliance-credit.com
+alliance-oilfield.com
  alliance-vent.ru
  alliance27.ru
  alliancehomepackers.com
@@ -14999,7 +15081,6 @@ allinevents.in
  allinone.lt
  allinonedrivers.xyz
  allinternetbundles.com
-allisoneddie.ru
  allisonmartinsson.com
  allisto.rusjohn.ru
  allitlab.com
@@ -15031,6 +15112,7 @@ allonzotrier.com
  allooalel.club
  allotasse.kissr.com
  allowanceteft.ga
+allowfaithless.top
  allowmefirstbuildcon.com
  allows48-paypal.com
  alloy-71.ga
@@ -15279,6 +15361,7 @@ altanyucetas.com
  altarfx.com
  altaria.in
  altbiafm.com
+altcbs.com
  altel.org
  alten-mebel63.ru
  alteodolcini.com
@@ -15297,7 +15380,6 @@ alternaturacoslada.es
  altersversorgungmitimmobilieninfo.augerqisafety.top
  altersys.ru
  altervistaf.com
-altgen.org
  altifort-smfi.com
  altilaltravel.com
  altimateclu.work
@@ -15378,7 +15460,6 @@ alzknggmhnsdpgpd-dot-millinium.ey.r.appspot.com
  am-concepts.ca
  am-contractors-office365.com
  am-contractors-online.com
-am-sat.de
  am-smart.ru
  am-stachlhof.de
  am-t.by
@@ -15396,7 +15477,6 @@ ama.gsxinxinyuan.com
  ama.zbbcct.com
  ama.zon.co.jp.mb1va2e9fw9fwnmy.tmbilly.com
  ama.zon.prime-service.exquisitepower.com
-amaaamzzon.xyz
  amaaccupdate.co.jp.xcpykyydjl.org.cn
  amaaccupdate.jackatlas.top
  amaanat.ir
@@ -15418,6 +15498,7 @@ amadonz.ywebu.com.cn
  amaeasank.com
  amaedn.comjyfe.com
  amaeor.xkmfjts.com
+amafhhtech.com
  amaflali.com.br
  amaicred.com.br
  amaijf.fomucr.com
@@ -15523,7 +15604,6 @@ amaz.aws-sec-ureee.loseyourip.com
  amaz.co.jp.japan-admin.ml
  amaz.co.jp.japan-admin.tk
  amaz.on.co.jp.detail.report.jp-qo98iwhdj89qwhiodopi.com
-amaz.photos
  amaz0.shendatrade.com
  amaz0.wanyinggao.com
  amaz0n-centre.serveirc.com
@@ -15633,7 +15713,6 @@ amazon-accountupdate.uc.r.appspot.com
  amazon-activityacc.servebeer.com
  amazon-aktualisieren-covid-19.gleeze.com
  amazon-alliance.xyz
-amazon-amazon.top
  amazon-appservic.serveirc.com
  amazon-autoconfirm.updt.ipq.co
  amazon-berrypopterbaik8945tuh8345-goblok.com
@@ -15775,6 +15854,7 @@ amazon-mail.one
  amazon-mail.photos
  amazon-mail.pictures
  amazon-mail.plus
+amazon-mail.repair
  amazon-mail.today
  amazon-mail.win
  amazon-mail.world
@@ -15807,6 +15887,7 @@ amazon-recoveryacc.servehalflife.com
  amazon-refer.com
  amazon-reportdaily-service.accountsummaryxmcn.com
  amazon-safety-center-id-max-signin-pape-openid-bgp-return.szhkled.com
+amazon-sale.today
  amazon-search-domains.buzz
  amazon-seccure7a.serveirc.com
  amazon-secuirtyrefrence43f7b.org
@@ -16045,7 +16126,6 @@ amazon.co.jp.account-update.s8dacadv5w8x6v486av.xyz
  amazon.co.jp.account-update.usid-7458.mixh.jp
  amazon.co.jp.account-update.zgljmlxlqdqueyuxbaixmngu.top
  amazon.co.jp.accountupdate.top
-amazon.co.jp.activeyouraccount-check.monster
  amazon.co.jp.admin-amazon.co
  amazon.co.jp.af70076f9eacdf1005c8f3f6507bf842.icu
  amazon.co.jp.afge12rew4qf64y1treq.buzz
@@ -16068,7 +16148,6 @@ amazon.co.jp.amazonhkt.xyz
  amazon.co.jp.amazonjp.top
  amazon.co.jp.amazonjpsd.xyz
  amazon.co.jp.amazonsignin.top
-amazon.co.jp.amazoumne-longio.top
  amazon.co.jp.amazznjp.top
  amazon.co.jp.amirkenneddd1.monster
  amazon.co.jp.amx42ca362xcanbvxzsa.net
@@ -16527,6 +16606,7 @@ amazon.verifyinformation.secure.ashjdiwj.com
  amazon.vipmdfz.com
  amazon.viralff.com
  amazon.w1tmikwlimo.buzz
+amazon.wclxsz.asia
  amazon.webstarterz.com
  amazon.yuifewf.com
  amazon.yunhejxzz.com
@@ -16642,7 +16722,6 @@ amazong.xyz
  amazongma.buzz
  amazongsa.monster
  amazongsa.xyz
-amazonhelp.buzz
  amazonhelpaccount.serveirc.com
  amazonhelps.xyz
  amazonhost.shop
@@ -16725,12 +16804,14 @@ amazonq.top
  amazonqiu.monster
  amazonqw.monster
  amazonqw.xyz
+amazonr.buzz
  amazonre.monster
  amazonre.xyz
  amazons-co-jpuserverify-center.top
  amazons-covid-19-secure03-validation.duckdns.org
  amazonsaek.xyz
  amazonsamazonsamazonsamazonsamazonsamazonsssaaaaaa.13463610389.com
+amazonsaso.xyz
  amazonscurity.com
  amazonsec-update.verify-info09.com
  amazonsecure.cf
@@ -16749,6 +16830,7 @@ amazonssales.xyz
  amazonssm.buzz
  amazonstore-loginpage.xyz
  amazonsupportservicellc.tk
+amazont.buzz
  amazonteam-us.ddnsking.com
  amazontedes0.com
  amazonty.ydequkqb.cn
@@ -16774,6 +16856,7 @@ amazonvip.co.jp.dgdhdhdf.live
  amazonvip.dgdhdhdf.live
  amazonvip.icu
  amazonvxa.buzz
+amazonw.buzz
  amazonweb.cc
  amazonworld.world
  amazonwwv.buzz
@@ -16793,7 +16876,6 @@ amazoon.pw
  amazoonl.top
  amazoonn.buzz
  amazoonn.top
-amazoonu.top
  amazoonu.us.mingjiuweiiou.cn
  amazopoer.org
  amazosupport2c65bf5c3ade8a10883ba74265c73e00.iapnashik.com
@@ -16823,6 +16905,7 @@ amber43565423.xyz
  amberadvisors.com.hk
  amberandangela.com
  ambercove27waterfalls.com
+amberexpansion.top
  amberlydentistry.com.au
  amberlyrobinson.com
  ambesten.alludiscounts.com
@@ -17137,7 +17220,6 @@ amexprescd.com
  amexpress-mijnactivatie-nl.zap595455-1.plesk12.zap-webspace.com
  amexpress-service-update.zap591449-1.plesk09.zap-webspace.com
  amexpress-service-update.zap592431-1.plesk13.zap-webspace.com
-amexpress-service.zap597932-1.plesk09.zap-webspace.com
  amexverify.justkeepthegirlshappy.net
  amexxxxpress.americanpie.today
  amezglobal.com
@@ -17309,7 +17391,6 @@ ams3.secureserver.net
  ams4-cerb-gc.com
  amsadmin.com
  amsaiudhasiodhjnasuiohgdqwiofjiogjwepqfgaszdfcqaswdfqaw.asiofhunjqioaaosidhaio.space
-amsande43.de
  amsder.com
  amsdsa12dsbdl.yhrmktf.cn
  amsev.com
@@ -17378,6 +17459,7 @@ amz-europe-sellercentral-eu.uk-business-tld2.pro
  amz-europe-sellercentral.eu-services-dk0.online
  amz-limited.000webhostapp.com
  amz-managedisapointedmajo999985547scampage.gleeze.com
+amz-scure-verify.for-our.info
  amz-scure106.session-reg.com
  amz-scure237.catok-xt9.com
  amz-sellercentral-europe.eu-services-otp.pro
@@ -17403,6 +17485,7 @@ amzn-ref.app
  amzn-ref.net
  amzn-servceaccount.serveirc.com
  amzn-verifys.serveftp.com
+amzn.customers-jp.top
  amzn66854.uc.r.appspot.com
  amznprime-service.serveirc.com
  amznupdates-verificationrequired.zdviint.com
@@ -17520,7 +17603,6 @@ anazom-cardas.com
  anazom.67calderroad.com
  anazom.website
  anazom.weightlosshotel.com
-anazon-card-user.com
  anazoncojpsing156asd156asd156gh1er56h1rt56156as165d3.onozoz.ru
  anb.intcom.kz
  anbenig.com
@@ -17717,6 +17799,8 @@ angkaprediksi.fun
  angkorise.com
  angkorsolution.com
  angle-71.cf
+angleknot.xyz
+angleorbit.xyz
  angliruorg.chifanassociate.top
  anglo-fan.web.app
  angloafricantrading.com
@@ -18053,7 +18137,6 @@ antifrode-bpm.com
  antifrode-mps.com
  antiguaandbarbuda-visa.com
  antiguatabernaqueirolo.com
-antiknowns.icu
  antimisogynoir.com
  antipestltd.co.uk
  antipet.website
@@ -18118,6 +18201,7 @@ anuintegrity.com
  anummod.xyz
  anuonkoooredammn.com
  anuopypanhsrsuqzlhdgztiqqrzvsqruepzf-dot-glegen303939423233.ue.r.appspot.com
+anushreecreations.com
  anussyshbsiopiaj.com
  anvexo.com
  anvietlong.com
@@ -18335,6 +18419,7 @@ apartemenyy.000webhostapp.com
  apartmanmortgage.xyz
  apartment-mall.cn
  apartmentcash.com
+apartmentdodger.com
  apartmenthomes.net
  apartments-real-estate.services
  apartmentsauthority.xyz
@@ -18484,6 +18569,7 @@ aplikasi.bangunrumah-kita.com
  aplikasipulsagratis744.000webhostapp.com
  aplinc-office.servebbs.com
  aplixet32.xyz
+aplleidsasa.servehalflife.com
  apln.club
  aplocazione-start.com
  aplusglass-parebrise-anet.fr
@@ -18498,7 +18584,6 @@ apnacrane.com
  apnalay.com
  apnaoasis.com
  apnapitara.com
-apniakhbar.com
  apnlsxzpwrbmanoz-dot-millinium.ey.r.appspot.com
  apnodhpymfsrgkkv-dot-millinium.ey.r.appspot.com
  apnosz.000webhostapp.com
@@ -18883,8 +18968,6 @@ appeal-form.limited-access.datacentre-pay-pal-trx10.com
  appeal-instagram.com
  appealable-revoluti.000webhostapp.com
  appealform-fb.com
-appear48-paypal.com
-appear72-paypal.com
  appearancerecall.com
  appearanches.com
  appecommerce.acessashop.com.br
@@ -18899,10 +18982,6 @@ appendant-courts.000webhostapp.com
  appeq.000webhostapp.com
  appetitanreger.net
  appf.autoinsmsbb.com
-appfb-35013706.superprimavera.pt
-appfb-41897436.superprimavera.pt
-appfb-53797050.superprimavera.pt
-appfb-97206232.superprimavera.pt
  appfront.club
  appfsms.com
  appfurmyes.com
@@ -19891,6 +19970,7 @@ appleld-apple.accountlocked-feedbackld.ungutng.com
  appleld-apple.accountlocked-page.us.ddfega.com
  appleld-apple.accountlocked-page.us.suitkilo.com
  appleld-apple.accountlocked-pageid.lalapanasw.com
+appleld-apple.accountlocked.id-feedback.baehbae.com
  appleld-apple.accountlocked.page.logins.bnbhrgae.com
  appleld-apple.accountlocked.page.logins.id.bhneheheah.com
  appleld-apple.accountlocked.pageid.verifynows.com
@@ -19916,9 +19996,11 @@ appleld-apple.accountslocked-feedback2020.shahmvcx.com
  appleld-apple.accountslocked-feedbackld.dfoabrescia.com
  appleld-apple.accountslocked-feedbackld.mulai-lamalagi.com
  appleld-apple.accountslocked-page.feedback.awrdsa.com
+appleld-apple.accountslocked-page.feedback.ld.wageaccies.com
  appleld-apple.accountslocked-page.id-feedbackl.pressurecompact.com
  appleld-apple.accountslocked-page.id.complainttournament.com
  appleld-apple.accountslocked-page.kambeng7.com
+appleld-apple.accountslocked-page.quinquefoliainasentence.com
  appleld-apple.accountslocked-policyld.qwaszx-1.com
  appleld-apple.accountslocked-supprt.id.jyrperros.com
  appleld-apple.accountslocked-us.page-feedbackl.preferyard.com
@@ -19937,6 +20019,7 @@ appleld-apple.accountslocked.page.ld.ridgereputas.com
  appleld-apple.accountslocked.page.us.premiumdefendantes.com
  appleld-apple.accountslockeds-feedback.us.swktzs.com
  appleld-apple.accountslockeds-feedbackid.theyaoek.com
+appleld-apple.accountslockeds-page.sub6specializedshoes.com
  appleld-apple.accountslockeds-pageid.us.kintillul.com
  appleld-apple.accountslockeds-us.pageid.awdhahwa.com
  appleld-apple.com-lockedsecures.photocopydifference.com
@@ -20131,6 +20214,7 @@ apply4u.gr
  applycerb.com
  applyedapple.com
  applyopenings.top
+applytax-ref.com
  applyukservice-gov.com
  appmagaalu.com
  appmagaaluu.com
@@ -20222,6 +20306,7 @@ apps-unblocking.my.id
  apps-us.games6.app-verifycationmail.net
  apps-us.games65.identity-verifycationmail87.net
  apps-us.live
+apps.adasasistemas.com
  apps.applestore-payment.customer-service.kusukakntangma.com
  apps.applestore.payment-service.feaenvae.com
  apps.applestore.payment-service.letodelasie.com
@@ -20524,7 +20609,6 @@ aqxlehwplppdarzg-dot-millinium.ey.r.appspot.com
  aqyryufwowvlzpef-dot-millinium.ey.r.appspot.com
  aqzbj.awaykart.com
  aqzhs.xyz
-ar-facebook.xyz
  ar-spa.serveirc.com
  ar.pandora-jewelryoutlet.top
  ar.worldsunnimuslim.net
@@ -20569,7 +20653,6 @@ aramcouk.ru
  aramex1.serveftp.com
  aramunca1980.blogspot.be
  arandahotel.ru
-arandasrestaurant.com
  arandi.co.ke
  aranducachaca.com.br
  aranis.xyz
@@ -20846,6 +20929,7 @@ ariasalersersad.ga
  ariastami.000webhostapp.com
  ariastock.com
  ariateudwwmcevvx-dot-millinium.ey.r.appspot.com
+aricendov.digital
  aridathajoela.ru
  ariefsetiawan.com
  arielpica.ddns.net
@@ -21012,6 +21096,7 @@ arrearirundalumcareer.in
  arredamentogiapponesecom.augerqisafety.top
  arriederal.info
  arrienting.info
+arrnaazan-co-jiopan.xyz
  arrocharboat.xyz
  arrombadodenunciaai.hopto.org
  arrow.kvalitne.cz
@@ -21065,6 +21150,7 @@ artalumin.gr
  artandstyle.com.au
  artarmunion.shutov.am
  artbykristin.com
+artbylelia.ro
  artcontemporarymarin.com
  artdecorstudio.ro
  artdefensive.com
@@ -21082,7 +21168,6 @@ artemissbet.blogspot.com
  artemiwp.katedomia.co
  artemmqw.beget.tech
  arteprata.com.br
-arterial-looks.000webhostapp.com
  arterymblematicv.com
  arterymblematicy.com
  artesacracremona.it
@@ -21135,6 +21220,7 @@ artisticsmilenashville.com
  artistkaranchand.com
  artistmandeep.com
  artistsecret.net
+artistutsav.com
  artistxerocreations.com
  artizaa.com
  artlandinfotech.com
@@ -21303,7 +21389,6 @@ asbasecurity.online
  asbeirasporto.com
  asbestentsorg.de
  asbestosawarenessinuk.co.uk
-asbonline-help-ird-detail-payments.co.nz.nz-c0.gq
  asbonline.duckdns.org
  asbotksthheslbpg-dot-millinium.ey.r.appspot.com
  asbvaliant.com
@@ -21340,6 +21425,7 @@ asd01.andaiaku-raja.com
  asd12.info
  asd59a79af46f84af6a14a6.xyz
  asd71.com
+asda-pranenich.ga
  asdaplus-jp.com
  asdasd.gasdasd.top
  asdasd234.com
@@ -21384,6 +21470,7 @@ asdgxc32.duckdns.org
  asdgxc332.duckdns.org
  asdgxcvb33.duckdns.org
  asdgxsw3.duckdns.org
+asdhnrtter.casacam.net
  asdjgabxzxbczxnmb.hibdosjowbelahaohoshsohsbdbd.pw
  asdjgkfwsas.com
  asdjsdfgvbxc.ru
@@ -21515,6 +21602,7 @@ asiacontracting.com
  asiadiscoversolutions.azureedge.net
  asiafsc.com
  asiaglobalpemasaran.com
+asiagroup.in
  asian1on1.za.net
  asianbusss.ru
  asiancrush.me
@@ -21567,7 +21655,6 @@ askarindo.or.id
  askazz.com
  askcorona.com
  askdcoayntfbzryf-dot-millinium.ey.r.appspot.com
-askew-troop.000webhostapp.com
  askfor.kl.com.ua
  askinbirkan.com
  askinmensucat.com
@@ -21584,6 +21671,7 @@ asksense.cyou
  asktech.io
  asktheneurosurgeon.com
  askthepiercingexpert.com
+askyounow.com
  asl.teudeynskla.com
  aslecorp.pe
  asload01.top
@@ -21627,6 +21715,7 @@ asomzon.webstarterz.com
  asoprocanor.com.co
  asoquefez.com.br
  asosorderlp.co.uk
+asoteca.org.ec
  asou87yur-dot-p7q8y6t5.uc.r.appspot.com
  asparkter.me
  asparkter.net
@@ -21756,6 +21845,7 @@ asskue.weebly.com
  asso-caroule.fr
  asso-pcmd.fr
  assoalhosmadeiras.blogspot.com
+assoc.cinepu.com
  associacaomda.org
  associacioesportivapolitg.cat
  associate-victims.000webhostapp.com
@@ -21797,6 +21887,7 @@ astinn.ru
  astland54-001-site1.gtempurl.com
  astlepa.uk
  astoai-71.ml
+aston-cajamares.com
  astonforex.com
  astonisher1209.000webhostapp.com
  astonmarkets.com
@@ -22257,6 +22348,7 @@ att.climasbazais.com
  att.fbknet-zdwwjwipze.natchyaccessories.com
  att.goruli.com
  att.hsw.cn
+att.jpdmi.com
  att.ticketworkspace.com
  att.veronsec.com.d.wbsprt.com
  att00251.weebly.com
@@ -22757,6 +22849,7 @@ atttnesyt.weebly.com
  atttservice.yolasite.com
  atttservices.weebly.com
  attttinmnwgyyatt.weebly.com
+attttmailyahoomailllliiiing.weebly.com
  attttnetenet.weebly.com
  atttttnet.weebly.com
  attttttmaiiillliiingbox.weebly.com
@@ -23010,6 +23103,7 @@ au.poster.sportingmen.org
  au.prize400.info
  au.support-apple.com-tel.aws-ipd.info
  au.webmailmailchkl.bar
+au02.tokyo
  au233st.urbanizacionlagosazules.com
  au25-bom-demais-e-top.com
  auakyrrypcqbncis-dot-millinium.ey.r.appspot.com
@@ -23141,6 +23235,7 @@ auregami.fr
  aureoleshowtime.com
  aurgule4352.com
  auricchioauto.xyz
+aurickhotels.com
  aurinegro.com.ar
  aurokids.ru
  auropharmaceuticals.in
@@ -23174,6 +23269,7 @@ austinproductsplusllc.com
  austinsidingplus.icu
  austinthorn.com
  austinturnpike.buzz
+austintxlawn.com
  austonstore.cf
  australiabeyondbroadband.com.au
  australiahousinginformation.online
@@ -23378,6 +23474,7 @@ authorisable-closur.000webhostapp.com
  authorisation-payeerequests.com
  authorisationsecured.com
  authorise-cancellation.cc
+authorise-payee-check.com
  authorise-payee.cc
  authorise-payee.uk
  authorisepayments-ppuk.com
@@ -23502,6 +23599,7 @@ autoescuelas.vip
  autofax-gmbh.com
  autofiction.org.in
  autofitness.ru
+autofixalba.ro
  autoflex59.ru
  autofolierung-lu.de
  autofollowers-free-2k20.000webhostapp.com
@@ -24655,18 +24753,17 @@ backlogchidek.com
  backlogphew.top
  backmz.com
  backoffice.scml.hypnotic.pt
+backolifes.us
  backpack-vacuum-cleaners.com
  backpackersandbrew.com
  backpacking.tokeronex.dk
  backpage-inc.com
  backpainbereakthroughgds.us
-backpainbrakthorughs.us
  backpedalsailorh.com
  backplop.com
  backroom.co.nz
  backseam.at
  backstagelightdesigncom.shaxiaoh.top
-backstreetcreative.com
  backstreetpub.com
  backtoformfitness.com
  backtolifefoundation.in
@@ -24825,6 +24922,7 @@ bailbondsmantexas.com
  baileybowbolt.com
  baileyesunnyes.com
  baileylovesbands.icu
+baileyt.000webhostapp.com
  baimpaula2020.000webhostapp.com
  baimpaulauang66.000webhostapp.com
  baimwongofficial.000webhostapp.com
@@ -24849,6 +24947,7 @@ bajasocietytours.com
  bajatel.mx
  bajer.info.pl
  bajramramadan.com
+bajukuindonesia.com
  bak4fltzwrgp.sted.cc
  bakachod.xyz
  bakaerolikese.com
@@ -24933,7 +25032,6 @@ balirichtuban.com
  balispadallas.com
  balistreriwell.buzz
  balitransithotel.com
-baliwholesalemarket.com
  balka.co.in
  balkan-express.info
  balkans-wellbeing.com
@@ -24945,6 +25043,7 @@ ballaholic.net
  ballantd.com
  ballatstone.com
  ballbkk.com
+balletaxiom.top
  balletdancer.ru
  balletestates.com
  balletshop.eu
@@ -24989,7 +25088,6 @@ bamautilitypay.is-a-hard-worker.com
  bamayad.com
  bambamsed.ml
  bambinos.bounceme.net
-bamboog.entrydns.org
  bamboomogleyt.com
  bambudeposu.com
  bamcupsupport.sytes.net
@@ -25243,6 +25341,7 @@ bandmblematicv.com
  bandotoyota.com
  bandrelaugs.bar
  bandrelaugs.best
+bandrelaugs.monster
  bands33.casacam.net
  bandsite.co.uk
  bandwidthmeter.online
@@ -25331,7 +25430,6 @@ bankhsbconline.com
  bankia-es-particularesusarioes.com
  bankia-es.com
  bankia-es.net
-bankia-identificacion.info
  bankiausario-esbankia-esbankiausario.com
  bankieren-mijoverzicht.nl
  bankieren-rabobank-nl.140409.prohoster.biz
@@ -25383,8 +25481,6 @@ bankofamerica-com-system-new-login-info-informtion-new-work.net
  bankofamerica-dc.webcindario.com
  bankofamerica-l07.serveirc.com
  bankofamerica-login.dns04.com
-bankofamerica-login.security.upadte.account.nepalvisa.info
-bankofamerica-login.security.visit2019.gyanhub.website
  bankofamerica-logins.dns05.com
  bankofamerica-ns.webcindario.com
  bankofamerica-secure-34291919not393991ndcs399191900.netlify.com
@@ -25430,7 +25526,6 @@ bankofamericaonlinesignin.net
  bankofamericarefund.onlinebill.zellebillrefund.com
  bankofamericasecurityalerts.giize.com
  bankofamericaverify.sunface.ae
-bankofamerusa.4dq.com
  bankofbinary.com
  bankofdiamond.fr
  bankofinvest.com
@@ -25571,7 +25666,6 @@ barbaroeggplantr.com
  barbaroeggplantz.com
  barbellate-blazes.000webhostapp.com
  barbeque.kz
-barberclubtquito.com
  barberiamartinz.com
  barbershopsite.icu
  barbie32crap.000webhostapp.com
@@ -25621,6 +25715,7 @@ barend-en-inell.co.za
  bareomar.net
  barerahfabrics.com
  baresisneu.tk
+bargainnsbagsfqz6.com
  bargasdesign.com
  barghealborz.com
  bargningavesta.se
@@ -25851,7 +25946,6 @@ baustb.de
  baut24.000webhostapp.com
  bauuer.xyz
  bauxogvlgkvszmjgjrgdjfsoab-dot-gleowayel400503.uc.r.appspot.com
-bauzeichnung.com
  bavadivaclub.club
  bavaxasrvgh5899.webcindario.com
  bavhome.com
@@ -26022,7 +26116,6 @@ bbs.chudance.com
  bbs.idol-project.com
  bbs.tax-helper.info
  bbs.zgfhl.com
-bbs1.marisfrolg.com
  bbsignage.com
  bbsmobler.se
  bbsolucoesdigitais.com
@@ -26484,6 +26577,7 @@ beaaba.com
  beachbitchapparel.com
  beacheventoplocatie.nl
  beachno.cyou
+beachstreetarts.com
  beachview.co.za
  beacon-directory.com
  beaconassociate.info
@@ -26499,7 +26593,6 @@ beafully.net
  beahanradial.buzz
  beamerpresentationcom.nckitickets.gdn
  beamfoundationclt.org
-beaming-source-291013.nw.r.appspot.com
  beamnarrow.cyou
  beancart9.top
  beanera.com
@@ -26704,6 +26797,7 @@ beginntbrowser.com
  begona-martnez-j95vihmwh.vercel.app
  begumazing.com
  begurtyut.info
+behash.com
  behavioralmedicinespecialists.com
  behaviourpersonality.com
  behaylu.000webhostapp.com
@@ -26883,7 +26977,6 @@ benbenradio2.free.fr
  bencemoda.com.tr
  bench-abbey.dvrlists.com
  benchcart.buzz
-benchdie.guru
  benchmarkitservices.com
  benchmarkquality.serveirc.com
  benchover.cn
@@ -27282,6 +27375,7 @@ beta.boiniketan.com
  beta.competitionplus.com
  beta.dhlafricacup.com
  beta.eatgr.com
+beta.gocgarden.com
  beta.habjobs.com
  beta.indiraprojects.com
  beta.kenaidanceta.com
@@ -27460,7 +27554,6 @@ betterbodiesmotorsport.com
  betterbodynet.acemlnc.com
  betterclosers.com
  betterfacebook.qwertz98.de
-betterfithomecare.com
  betterlastbestflashlite.icu
  betterloosenup.com
  betternameszimbradesking.com
@@ -27498,7 +27591,6 @@ beviermoz.buzz
  bevonsituma.net
  bevysocial.com
  bew-gw24w1bee-e52wbe3.party
-bewellstyle.com
  bewilderedcoot.com
  bewitching-workload.000webhostapp.com
  bewuphoneshopd.com
@@ -27846,6 +27938,7 @@ bigbots.cc
  bigboxlive.com
  bigbtceth.com
  bigbtn.com
+bigbusinesscall.geteasycustomers.com
  bigbustyandlusty.com
  bigbustyhousewifes.com
  bigbuttteenslut.za.net
@@ -27939,7 +28032,6 @@ bil.auth-manage-inv.appls.auth-secure-information.com
  bilal.documantal.cc
  bilanacc.com
  bilbaovizcaya.wpdevcloud.com
-bilbosaquet.ug
  bildeboks.no
  bildideen.site
  bildungsunderlebnis.haus
@@ -28480,6 +28572,7 @@ bjifsjfeknsiqpsg-dot-millinium.ey.r.appspot.com
  bjirrr.com
  bjjgears.com
  bjjmywcb.com
+bjk3.m0ky.com
  bjkeevfvdjbszxja-dot-millinium.ey.r.appspot.com
  bjktdknmiehyljdl-dot-millinium.ey.r.appspot.com
  bjkumdo.com
@@ -28564,7 +28657,6 @@ bkp098765.claimholl.me
  bkp18plus.000webhostapp.com
  bkp18plus.log-108.ga
  bkp2020trbruyukgabunggroupwaskrng.000webhostapp.com
-bkp69.dynamic-dns.net
  bkp87435.claimholl.me
  bkp9373.hotzx9.com
  bkpgratis.4free9.com
@@ -28659,6 +28751,7 @@ blacksheepeventi.com
  blacksilk.xyz
  blacksirius.de
  blackskeleton.net
+blackstartupjobs.com
  blackstoneboltworkscom.shaxiacable.top
  blackstoneventures.info
  blackstormdesign.com
@@ -28770,6 +28863,7 @@ blindair.com
  blindedknife.club
  blindfootball.in
  blindshade.com
+blindsplusmore.com
  blingflip.ga
  blink82-wr.xyz
  blinkblink.eu
@@ -28920,7 +29014,6 @@ blog.richardwei.cn
  blog.ruslanski.co
  blog.ruthlopezbeautyconcept.com
  blog.s-se.ru
-blog.saadata.com
  blog.saigon247.vn
  blog.sanaozel.site
  blog.schlichte.xyz
@@ -28938,6 +29031,7 @@ blog.titens.xyz
  blog.todaygig.com
  blog.traun.cn
  blog.triocard.com.br
+blog.tsuginanisuru.com
  blog.tuend.tk
  blog.turnkeytown.com
  blog.tuziip.com
@@ -29016,6 +29110,7 @@ blossomevent.co.uk
  blossomworldinformatix.com
  blotec.in
  bloucoiiglzpdcso-dot-millinium.ey.r.appspot.com
+blowapp.digital
  blowdry.com.co
  blozoo.net
  blpdwvfqqbjiikxuxdagfijgsbxsfbjquxqs-dot-spyexc3093493.ey.r.appspot.com
@@ -29120,6 +29215,7 @@ bluewaterdeliveries.com.au
  bluewave-logistics.com
  bluewin-account-checking.000webhostapp.com
  bluewindservice.com
+blueyasmine.buzz
  blueyellowshop.com
  blufftonchurch.org
  blufibras.com.br
@@ -29407,7 +29503,6 @@ bobbyveert.nl
  bobbyworld.top
  bobcoke.com
  bobehughes.ru
-bobenstetter.net
  bobevents.myap.co.za
  bobliddycoat.com
  bobmaritime.com
@@ -29871,6 +29966,7 @@ bookbeetroots.net
  bookdeluxes.com
  bookdocument.ir
  bookdyne.win
+bookedandboarding.com
  bookf-authenticate.000webhostapp.com
  bookfaceeebook.xyz
  bookgara.com
@@ -29909,6 +30005,7 @@ boomcoins.ml
  boomcup.icu
  boomcup.rest
  boomenergyng.com
+boomers-insurance.com
  boomforex.net
  boomgiveaway.gq
  boomgiveaways.gq
@@ -29922,6 +30019,8 @@ boomskins.gq
  boonde.nckifrance.gdn
  boonfr.nckiregister.gdn
  boookpro.000webhostapp.com
+boopular.best
+boopular.monster
  boosdeveloop.com
  boosted-boys.tk
  boosthybrid.com.au
@@ -30002,7 +30101,6 @@ boslife.com.br
  bosmangouai.xyz
  bosmj.net
  bosniakov.com
-bosonit.com
  bospoint.com
  boss-gear.com
  bossaholidays.co.uk
@@ -30070,6 +30168,7 @@ bottomline.co.in
  bottomlinemotionpictures.com
  bottprivtercess.ga
  bottraxanhtini.com
+boudheib.ae
  bougainsort.com
  boughten-moisture.000webhostapp.com
  bouhuer.com
@@ -30214,6 +30313,7 @@ bozlarenerji.com
  bozprirbonqhzkld-dot-millinium.ey.r.appspot.com
  bozproduction.com
  boztepeiyilikyuvasi.com
+bozur.net
  bozz.com.br
  bozziro.ir
  bp-atualiza-app.com
@@ -30460,6 +30560,7 @@ brandleyowned.com
  brandmarketgroup.com
  brandmarketinggroup.info
  brandmarketinggroups.com
+brandminfestationcomng.us
  brandon-hotel.be
  brandonanything.com
  brandotoday.com
@@ -30475,6 +30576,7 @@ brandsstudio.pk
  brandstrategists.net
  brandstrategy.club
  brandstrumpet-001-site1.ctempurl.com
+brandsum.com
  brandyou-coaching.in
  brandywinedmg.com
  brandzzy.com
@@ -30928,7 +31030,6 @@ bruor.by
  bruserthes.xyz
  bruset.no
  brushnrollinc.com
-brushpan.guru
  brusknet.net
  brussel-airport.be
  brusselstourismjobs.be
@@ -31080,6 +31181,7 @@ bt.43t.shipmao3.xyz
  bt.business.iurycosta.com
  bt.mobilebilling01.com
  bt.mobilebilling20.com
+bt24.yanenergo.online
  bt3v.blob.core.windows.net
  bt832.svcoding.com
  btabfpdydauugimt-dot-millinium.ey.r.appspot.com
@@ -31593,6 +31695,7 @@ businessinflux.com
  businessinnovation.app.link
  businessinsn.com
  businesslabels.com.au
+businesslifecoachingcanada.com
  businesslinks.pk
  businessmatrix12.knitsbygrandmab.com
  businessofferview.app.link
@@ -31689,6 +31792,7 @@ buyhndbjc.com
  buyidou.com
  buyitnow.jp
  buyjchdgfb.com
+buyjunkcars.co
  buyketoultra.site
  buylarginine.net
  buylionkingtickets.com
@@ -32348,7 +32452,6 @@ caintime.ga
  cainwaters.org
  caio11.ddns.net
  caipa.net.cn
-cairnsspeedway.net
  cairnterrier.in.ua
  cairocad.com
  caissefamilylaw.com
@@ -32512,6 +32615,7 @@ calvarykla.com
  calveprimerabanca.zz.com.ve
  calvinist-faces.000webhostapp.com
  calxplus.eu
+calzadobucaramagaa.com
  calzadocaley.com
  calzadosiris.com
  calzeatltd.com
@@ -32587,6 +32691,7 @@ campagne-de-remboursement.com
  campaign.chaserefundalertauth.ararnine.com
  campaignmonitor.aramccogermany.com
  campana20gb.com
+campaniepsd.iset.ro
  campanus.cz
  campbaggageexpress.net
  campbaker.org
@@ -32675,9 +32780,9 @@ canariasterecarga.com
  canberramums.com
  canbertcongco1972.blogspot.be
  canbruixa.com
-cancel-device.link
  cancel-iverify.com
  cancel-myorderappstoresafeactive.marciodelgado.com
+cancel-newdevice.cc
  cancel-orders.serveirc.com
  cancel-payee-hs.com
  cancel-payee-request.com
@@ -32693,6 +32798,7 @@ cancela.netlify.app
  cancela.netlify.com
  cancelation.applieidappsintl.confirmatedinfo.sabyangambus-03.com
  cancelationacc-web.servehttp.com
+canceldevice.link
  canceled-options.servehttp.com
  canceledacc-payment.servehttp.com
  cancellation-immediate.com
@@ -32840,6 +32946,7 @@ capi1taline.liveingwhitewater.icu
  capimain.amazonexpeditions.icu
  capimain.familywishes.top
  capimain.maidsafenetwork.xyz
+capita1one.me
  capital-bovin.com
  capital-cheptel.fr
  capital-coins.com
@@ -32939,7 +33046,6 @@ captureomar.com
  capturestilesatl.com
  capuchechic.com
  capuncho.tk
-capview.guru
  caqd.club
  caqwysbrfwlxplyq-dot-millinium.ey.r.appspot.com
  car-caja-mar-rural.com
@@ -33140,8 +33246,6 @@ carreradelossuenos.com
  carrgostorre.com
  carriagegrowere.com
  carriagehousesalonvt.com
-carried48-paypal.com
-carried72-paypal.com
  carrier-moblitie135return.com
  carrier-myaccount33861.com
  carrier-myaccount33862.com
@@ -33296,7 +33400,6 @@ cascadedtrolley.com
  cascadefitnesscenter.com
  cascavelsexshop.com.br
  cascinaboccaccio.com
-cascope.today
  cascos.fimego.cl
  cascoviejosantander.es
  casdocss.budespo.com
@@ -33409,6 +33512,7 @@ casite-596081.cloudaccess.net
  caso04280420.000webhostapp.com
  caso39926723.webcindario.com
  caso99227213.webcindario.com
+casonahartfordct.com
  casosapple.com-verificacionapple.com
  caspercode.com
  casperlakes.buzz
@@ -33688,7 +33792,6 @@ ccandcbrand.com
  ccaqauvu.topkorder.su
  ccarhcgkjelwuokarbxkobtvkl-dot-gleowayel400503.uc.r.appspot.com
  ccash.xyz
-ccb09ba12e2c.ngrok.io
  ccbb-insaiguaviva.org
  ccbcnes.org
  ccbcomuyjxadneil-dot-millinium.ey.r.appspot.com
@@ -33965,6 +34068,7 @@ cdr5.awaykart.com
  cdrbezawdewzspiv-dot-millinium.ey.r.appspot.com
  cdri.goruli.com
  cdrkhhuhnbjkkemzrtx.top
+cdrrlrmpled8.com
  cds.s6m5m9d7.hwcdn.net
  cds1640.org
  cds84.com
@@ -34337,7 +34441,6 @@ certificates124.in
  certificates125.in
  certificawebank.com
  certifiedmembership.top
-certifiedprolnstabluecheck.000webhostapp.com
  certifymyproperty.com
  certipluseagnece.com
  certrill.top
@@ -34504,6 +34607,7 @@ cgkhzjhdixkaichl-dot-millinium.ey.r.appspot.com
  cglzhi.com
  cgmcfwcydtbdrsyn-dot-millinium.ey.r.appspot.com
  cgn.com.py
+cgoln-bt.xyz
  cgoowes.com
  cgotisvgkjjrdgpb-dot-millinium.ey.r.appspot.com
  cgp60474.com
@@ -34540,6 +34644,7 @@ ch.bakari.dyalcom.pl
  ch.colsan.info
  ch.globalogo.it
  ch.jjconcreteseattle.com
+ch.net2care.com
  ch.ouestexpansion.com
  ch.p2aexpertise.com
  ch.prunauneau.fr
@@ -34627,6 +34732,7 @@ champamusic.000webhostapp.com
  championedunetwork.com
  championfoods.com.pk
  champions-stadium.com
+championscsc.co.zw
  championsgate-vacationhomes.orlandoareavacation.com
  championsholdings.co.zw
  championtreeservicesf.com
@@ -34727,7 +34833,6 @@ charleneleeofcitycouncilofcupertino.com
  charles67325.xyz
  charlesbstrange.com
  charleserick38.com
-charleskontol.github.io
  charlesreger.com
  charlesremcos.duckdns.org
  charlestonscceramictile.com
@@ -34784,6 +34889,7 @@ chase-covid19s.com
  chase-desk.servehttp.com
  chase-financial9w.com
  chase-fraudalert.dnset.com
+chase-id0-online0chase.com
  chase-info2s.com
  chase-j5i.com
  chase-login.ml.cazare-sarmizegetusa.rochase-chase.rcsworld.in
@@ -34975,6 +35081,7 @@ chasebanksecure.com.localcontractorbids.com
  chasebanksuli.ddns.net
  chasebanksys.hopto.org
  chasebankverifications.com
+chasechase.isaquemohamed.xyz
  chasechex.com
  chaseclientverify.venmao.ga
  chasecompany.publicvm.com
@@ -35065,6 +35172,7 @@ chaserverification.sytes.net
  chases-invoice.xyz
  chasese.hopto.org
  chasese.xyz
+chasesec7activities88690.xcqsasw.com
  chasesecure-onlinecheckingaccount1.000webhostapp.com
  chasesecure.xyz
  chasesecure01b.hopto.org
@@ -35209,7 +35317,6 @@ chat-whatsapp-c0m.uptymes.com
  chat-whatsapp-cabopr6sjexhyhzu7lgeoh.4dq.com
  chat-whatsapp-com-group.edu.co.tz
  chat-whatsapp-d4aylpyh9ybdgtycizekc6.3-a.net
-chat-whatsapp-dewasa-18.tosun87.tk
  chat-whatsapp-free-fire.bundle66.cf
  chat-whatsapp-g86cdukr2wefckkmiwixaddsgscwadv.4dq.com
  chat-whatsapp-g86cdukr2wefckkmiwixaddsgscwagf.4dq.com
@@ -35293,6 +35400,7 @@ chat-whatsapp01.ocry2020.tk
  chat-whatsapp04.virall-2020.tk
  chat-whatsapp1.grup26.ga
  chat-whatsapp1.my03.com
+chat-whatsapp1.sexidude.com
  chat-whatsapp11.wikaba.com
  chat-whatsapp16.otzo.com
  chat-whatsapp18.hol11.cf
@@ -35301,7 +35409,6 @@ chat-whatsapp18.hol15.gq
  chat-whatsapp18.vert20.gq
  chat-whatsapp18.xord.ml
  chat-whatsapp20.zztx.ga
-chat-whatsapp2020.dnsrd.com
  chat-whatsapp21.4dq.com
  chat-whatsapp21.qpoe.com
  chat-whatsapp29.2waky.com
@@ -35719,6 +35826,7 @@ cheasoe.com
  cheaszonline.com
  cheat12.ddns.net
  cheats4gaming.com
+cheatsbox.net
  cheatsheetketo.com
  cheatz0ne.com
  chebanca-riepilogo-dati.ripristino-dati2020.net
@@ -35735,7 +35843,6 @@ check-identitylog.bounceme.net
  check-kyc.services
  check-login-acc.com
  check-maill.weebly.com
-check-mypayees.co.uk
  check-security-team.com
  check-team.com
  check-time.ru
@@ -35952,6 +36059,7 @@ chewgpml.000webhostapp.com
  chexdomiki.ru
  cheyannelane.xyz
  cheystars.com
+chezajspagess.cf
  chezalice.co.za
  chezlesdudu.com
  chezmimi.com.br
@@ -35979,7 +36087,6 @@ chibuike.machotextiles.ml
  chicagbooth.club
  chicagoartivism.org
  chicagoaxeroom.com
-chicagosbest.org
  chicagostation.com
  chicagostoneremodeling.com
  chicagowindycityguide.com
@@ -36095,7 +36202,6 @@ chinchillane62.co.uk
  chinchiseng.com
  chinchiu-jp.xyz
  chineke.space
-chinese-photography.net
  chinese2stdy3profesionalandhealthanalyz.duckdns.org
  chinese2stdyonlyywalkaloneinlifea12mtg.duckdns.org
  chinese2thdy9onlyywalkaloneinlifeanre.duckdns.org
@@ -36439,11 +36545,11 @@ cidadecrista.com.br
  cidadeweb.tv.br
  cidat.in
  ciderbox.com
-cidertree.libfoobar.com
  cidigisaystexion.info
  cidrd.com.do
  cidrodidi.com
  cieletamiesnecom.batwoqisep.top
+cielo.nan-ngai.com
  cielopromocao.ml
  cienciassocialesuaz.com.mx
  ciepkij.serviceorder.su
@@ -36525,6 +36631,7 @@ cinemasconfriregis174.ml
  cinemasmash.cyou
  cinemaxnx-vidioid.bokp.net
  cinemay.biz
+cinemods.com
  cinenagari.com
  cinergie-shop.ch
  cinglovy.com
@@ -36918,6 +37025,7 @@ clarkelectric-my.sharepoint.com
  claro-net-emta.aceite.fbiz.com.br
  clarrywillow.top
  clarve.club
+clarwroe785-nifty.xyz
  clashmode0ivuz5.000webhostapp.com
  clasich.com
  clasificadoscochabamba.com
@@ -37071,6 +37179,7 @@ clevermoneyinfo.baerqipresident.top
  cleversnow.com
  clevert.pl
  clevertyp.com
+cleverupplay.com.br
  cleviteenginepartscom.shaxiaact.top
  clevnataphonyman.info
  clfkjoxwwfzvhcgi-dot-millinium.ey.r.appspot.com
@@ -37199,6 +37308,7 @@ clientnasure.com
  clients-boursorama-banques-ssl-nbslvocompte.com
  clients-security-available.network
  clients-wells.work
+clients.devtux.com
  clients.nashikclick.com
  clientsample1.icu
  clientsecure.servehttp.com
@@ -37304,7 +37414,6 @@ cloroxs.xyz
  clos-galant.com
  close-grained-craft.000webhostapp.com
  close48paypal.com
-closeamber.guru
  closeby.coupons
  closefelise.com
  closeio-ticket-attachments.s3.amazonaws.com
@@ -37505,6 +37614,7 @@ cms.vicloud.vn
  cmsbased.net
  cmscards.live
  cmshandelcom.shuiabrown.top
+cmsjm.rj.gov.br
  cmspin4k.club
  cmspin5k.club
  cmstephensconsulting.com
@@ -37587,6 +37697,7 @@ cncrk.down.gsxzq.com
  cncrk.wall.99downer.com
  cncsmyrxdseybkca-dot-millinium.ey.r.appspot.com
  cnctar.hobbycnc.hu
+cnd-tunisie.com
  cnd01.v8s1.com
  cndomainreg100.net
  cndrs.org
@@ -37719,7 +37830,6 @@ co9dance.com
  coabhxzvxxzmxrvj-dot-millinium.ey.r.appspot.com
  coach-fpt.fr
  coachbagsoutletfactory.net
-coachcameron.com
  coachesstrengthandconditioningresource.com
  coachhire-oxford.co.uk
  coaching-force.com
@@ -37792,10 +37902,8 @@ cocukajanslari.com
  cocuva.com
  cod134241723promocional.com
  codashop-topup.3-a.net
-codashop-uygoblok.join-grupnew.my.id
  codashopfreeresmi2020.000webhostapp.com
  codashopofficiall.000webhostapp.com
-codashpppfreeu7.4pu.com
  codbo3-cod.com
  code.caleffi.com
  code19smartkey.com
@@ -37845,6 +37953,7 @@ coditeq.com
  codjoo.ir
  codndraniierijgi-dot-millinium.ey.r.appspot.com
  codnit.com
+codtrade.ro
  codyllamas.com
  coeduo.com
  coelabetoregranteke.info
@@ -37872,6 +37981,7 @@ cogimodule.com
  cogitype166.com
  cogmyboazfvvqaqotcjfoufofshzexhyoaiv-dot-glxcel49934343434.rj.r.appspot.com
  cognerium.com
+cognitec.org
  cognitiveoutlaw.org
  cogqjefxuumkkbaumzzmexdnwlwrmieeylqm-dot-glxcel49934343434.rj.r.appspot.com
  cogstateconstructions.com.au
@@ -38500,7 +38610,6 @@ comparemybuilders.com
  comparesalad.com
  compartamos.identidad.com
  compartetusueno.com
-compartirwifi.com
  compartstudioe.ru
  compass-trading.com
  compassbarsolutions.com
@@ -38546,7 +38655,6 @@ complexaropalace.ro
  complexios.info
  compliable-airfield.000webhostapp.com
  compliance-central.com
-compliance-fda.com
  compliancesolutionsstrategies.com
  complored.xyz
  compmold.com
@@ -38606,6 +38714,7 @@ compte-labanquepostale.fr
  compte-pour-tous.fr
  compte.at
  compteclient.cagrico-servicecms.fr
+compteiikg.000webhostapp.com
  comptesenlignelabanquepostale-fr.surge.sh
  comptoir-carrelage-45.fr
  compub.de
@@ -38750,7 +38859,6 @@ confidesupport.com
  config-clavesmstokenbn1.com
  config-csddre-cliente-re-7.com
  config-traveaux.site44.com
-config.cqhbkjzx.com
  config.kuaisousou.top
  config.wwmhdq.com
  config.younoteba.top
@@ -39097,6 +39205,7 @@ constructionandstone.is-an-engineer.com
  constructionavenue.fr
  constructiondistrict.com
  constructionpedia.com
+constructions.zelenalupa.mk
  constructionsakshay.com
  constructoracft.cl
  constructorameneses.com.mx
@@ -39164,6 +39273,7 @@ contact-customer-online-ebay-uk.customerservice-livechats.live
  contact-ee.com
  contact-orangeboxvocale.web.app
  contact-our-support-payment.com
+contact-portailsms.firebaseapp.com
  contact-portailsms.web.app
  contact-prosmsvocale.web.app
  contact-support-phone-number.com
@@ -39257,6 +39367,7 @@ contracted-perforat.000webhostapp.com
  contractmy3.com
  contradictorylevel.online
  contradistinction.site
+contraloriageneral.usm.cl
  contraloriaibague.gov.co
  contrans.com.pe
  contrarious-intakes.000webhostapp.com
@@ -39281,6 +39392,7 @@ controle-id.online
  controle-onlinedeal.xyz
  controle-pagina.nl
  controle-su-peso.com
+controledeentregas.cash
  controlexaspirer.com
  controliue.tk
  controll2-auth.com
@@ -39775,6 +39887,7 @@ corpserv.co.uk.oregondestinationassociation.com
  corpservshop.com
  corpulent-correlati.000webhostapp.com
  corpworld.com.sg
+corra.live
  corradinoandpapa.com
  corragiovannicom.chifanassociate.top
  corragiovannicom.shaxialike.top
@@ -39842,7 +39955,6 @@ cosjp.mywhvsjv.top
  cosmet-log.com
  cosmetic.webdungsan.com
  cosmeticfigures.com
-cosmic-axe-291221.rj.r.appspot.com
  cosmica-foci.web.app
  cosmicenergy.in
  cosmichorizon.in
@@ -39880,7 +39992,6 @@ costumersservices.com
  cosula-dot.web.app
  coswuufsgmqwclpa-dot-millinium.ey.r.appspot.com
  cosycafe19.com
-cosydat.de
  cosyliving.com.sg
  cot3d.com
  cotacero-salvaescaleras.es
@@ -39918,7 +40029,6 @@ count.mail.163.com.battlecoahs.top
  count.mail.163.com.c2394ac3a958fcf8c76b4d0db71b6ece.feichlmold.com
  count.mail.163.com.emed-depot.com
  count.mail.163.com.fatrecycle.com
-count.mail.163.com.impactmedfoundation.com
  count.mail.163.com.ineedyounow.site
  count.mail.163.com.jutin.tk
  count.mail.163.com.loglolo.xyz
@@ -39972,12 +40082,14 @@ courrielmail201.yolasite.com
  coursedirectory.nationalcareersservice.org.uk
  coursefinder.me
  coursetank.com
+courseworkwritingsite.com
  coursio.com
  courteney-cox.net
  courtesiesdelated.online
  courtney321432.xyz
  courtneybutlerphoto.com
  courtneyhones.ac.ug
+courtneyjjones.ac.ug
  courtsuite.xyz
  couter-nad.firebaseapp.com
  coutoproyectos.com
@@ -40717,6 +40829,7 @@ craigslist.preview-orders.online
  craigslist.preview-posting.us
  craigslist.preview-posts.com
  craigslist.renew-posting.us
+craigslist.review-confirms.us
  craigslist.review-listings.com
  craigslist.yelllowbikerr6.com
  craigslistaccount.email
@@ -40870,6 +40983,7 @@ credibility-check.agku4lor2td7681vwjkd57rl.com
  credibilityinternationals.com
  credicorp-capital.com
  credifacilmz.com
+credifurpu.com
  credigas.com.br
  credimag.ro
  credinnova.pe
@@ -41101,7 +41215,6 @@ crowleprimary-my.sharepoint.com
  crowleyla.buzz
  crown-diamonds.com
  crownedbynature.com
-crownlaw.guru
  crowresul.top
  crpelectric.com
  crrraattyy.de
@@ -41670,6 +41783,7 @@ cuenta-confirm.informacion-cuenta.com
  cuentaalertaa.blogspot.com
  cuentanetflix.disenlaser.co
  cuentarut-online.top
+cuentasegurayt.000webhostapp.com
  cueu0.app.link
  cueva-de-sal.changeland.com
  cueword.tk
@@ -41692,6 +41806,7 @@ cukartuc.com
  cukgpizsp.goruli.com
  cul.x2mp3.com
  culinarist.nl
+culinera.botrise.ro
  culottes.premiumbrandd.com
  culptivehelp.com
  cultish-precision.000webhostapp.com
@@ -41783,7 +41898,6 @@ currecntattmail.weebly.com
  curreentlyattyahoomailservices1.weebly.com
  currenlyatt.weebly.com
  currennttlly24.weebly.com
-current72-paypal.com
  current9.com.ng
  currentaffairsofpakistan.pk
  currentattuser.weebly.com
@@ -41945,6 +42059,7 @@ cust-support-check.coronaviruschina.ml
  cust.capek-aing.com
  cust.chase.gmcparts.net
  cust0merhelp-supp0rt.ju5t-1nf0.org
+custom-bearing-286119.ew.r.appspot.com
  custom-essays-online.co.uk
  custom-kvbo.frb.io
  custom-recovers01.000webhostapp.com
@@ -42041,7 +42156,6 @@ customerrespondhelp4.com
  customers-amazon.serveirc.com
  customers-assistance-spot3.work
  customers-data.services
-customers-jp.top
  customers-safely-wells-fargo.com
  customers.opay.pk
  customers3773923www.site
@@ -42084,7 +42198,6 @@ cut-out-pails.000webhostapp.com
  cutbeetroots.club
  cutebabywardrobe.store
  cutedogy.com
-cutefee.guru
  cutekanxu.com
  cutemeya.000webhostapp.com
  cuteparrots.com
@@ -42656,6 +42769,7 @@ dadas333.julia2.vercel.app
  dadata-71.ml
  dadc.addroits.com
  dadcadvrdvrdwce.com
+daddy.com.vn
  daddyofdeals.com
  daddyplays.com
  daddytaxi.com
@@ -42753,7 +42867,6 @@ dailyshops.co.in
  dailysortlogs.bounceme.net
  dailyweather.info
  daimaruhelp.xyz
-daimonic-commendati.000webhostapp.com
  dain23.com
  dainangsrvcercvery.info
  daincif.com
@@ -42979,6 +43092,7 @@ dar-annadwah.com
  dar-blue.com
  dar-sana.com
  dar1.ml
+daradox.com
  daralqanah.com
  darbarbd.com
  darbartech.com
@@ -42989,7 +43103,6 @@ darcyeqution.com
  dardaseafoodrestaurant.com
  dare-dare.000webhostapp.com
  dareckleyministries.com
-dareeldoince.top
  dareforyoufriend.000webhostapp.com
  darekun.twilightparadox.com
  darellsimonegui.ru
@@ -43129,7 +43242,6 @@ data-startssllink.com
  data-verification--nab.com
  data-wells-notice.com
  data.cloudsave247.com
-data.kaoyany.top
  data.manage.id.information.nesneslarge.com
  data.secure-ionos.es-il3o7h5nk6fopktuehrxwhyuurbz.mjbrittingham.com
  data.simpanpulsa.co.vu
@@ -43322,6 +43434,7 @@ daviviendo.com.co
  davizinmakeraa.000webhostapp.com
  davm.live
  davmobile.me
+davsapp.com
  davtqsmynaeakski-dot-millinium.ey.r.appspot.com
  davvvajuszodlefl-dot-millinium.ey.r.appspot.com
  daw-net.pl
@@ -43461,7 +43574,6 @@ dcaarqhbjutziucj-dot-millinium.ey.r.appspot.com
  dcaesttaipccjnfm-dot-millinium.ey.r.appspot.com
  dcalc.us
  dcanjzcxyspmcnagqiypcxuxae-dot-gleowayel400503.uc.r.appspot.com
-dcard.aglob.fr
  dcard.cleansol.lk
  dcard.ifms-enargeia.gr
  dcard.risecse.com
@@ -43556,6 +43668,7 @@ ddf.thtfkh.cn
  ddfbeqrnizzhozsr-dot-millinium.ey.r.appspot.com
  ddfbvgazrhhmrzjqdpywnsmfqinnvgehexvo-dot-gl494903049.wl.r.appspot.com
  ddfdfbuscando.com
+ddffrrff.ey.r.appspot.com
  ddfgrfs.publicvm.com
  ddfptlbsdnmcnvly-dot-millinium.ey.r.appspot.com
  ddft.ml
@@ -43582,6 +43695,7 @@ ddm0b.jaysbrand.com
  ddmmiduiizjlurqb-dot-millinium.ey.r.appspot.com
  ddncpaabbfculxam-dot-millinium.ey.r.appspot.com
  ddnnews.in
+ddnsmachiavelli.ddns.net
  ddnsweb2-amazoid2648-servnumberid84568.maemh-co-jp.com
  ddofmorhtdeqwkvz-dot-millinium.ey.r.appspot.com
  ddofupqdaqmpzgnw-dot-millinium.ey.r.appspot.com
@@ -43629,6 +43743,7 @@ de-item68452133.com
  de-kleinanzeig-en.ulvmichel22.de
  de-montaj24.ru
  de-onlineservice-supportsk.life
+de-register-app.com
  de-register-device.co.uk
  de-register-newdevice.co.uk
  de-sparkasse1334.000webhostapp.com
@@ -44031,6 +44146,7 @@ deliveryacademy.co
  deliveryas.ru
  deliveryexpressworld.xyz
  deliverysupport.top
+delivoo.ro
  delivrsi-one.tk
  dell1.ug
  dellenbene.de
@@ -44341,7 +44457,6 @@ derols.top
  derols.xyz
  derorjvtnevpemau-dot-millinium.ey.r.appspot.com
  deroropf.com
-derred-ee.info
  dertattguard.com
  dertierfotografde.chifanbudget.top
  deruiterstaalkabel.nl
@@ -44360,6 +44475,7 @@ desainrumahterbaik.co
  desarrollosdeprueba.xyz
  desawdxgni.duckdns.org
  desayunosgreen.com.pe
+desbloqueandoacesso.com
  desbloquear-anuidade-gratis.com
  desbloquearapp.club
  desbloqueaseucartaoaqui.com
@@ -44554,6 +44670,7 @@ destituteputt.com
  destress.co.nz
  destrox60.ddns.net
  destructionachievement.com
+destructionreceipt.com
  destructoring.com
  desvsed.com
  desysetyo.com
@@ -44737,6 +44854,7 @@ device-detection.americansse.org
  device-detection.verifyed-accountid.business
  device-enrolment.services
  device-gived.xyz
+device-halifax.co.uk
  device-icloud.com
  device-manage.hutakataextreme.info
  device-personal-wells.site
@@ -44749,6 +44867,7 @@ device1event.com
  devicechecksecurity.000webhostapp.com
  deviceful-errors.000webhostapp.com
  devicegive.us
+deviceprotection-unknown.link
  devices-srv.mobi
  devicesherpa.com
  devies-ruralviacaja.com
@@ -44951,10 +45070,10 @@ dfrd.creatorlink.net
  dfrhc.xyz
  dfsdewsa.com
  dfsdfuiecenter.com
-dfsfgkg.uhbnempu.best
  dfsg4s.xyz
  dfsg54sdfg.efaktury.icu
  dfsgsj.com
+dfshkqbzt.holopokor.com
  dftmurgoods.com
  dftworld.com
  dfumnbbejkjlrdtudawoayrcxt-dot-gleowayel400503.uc.r.appspot.com
@@ -44990,11 +45109,13 @@ dgehs.qy9l0g.cn
  dgeovtajtcokidgv-dot-millinium.ey.r.appspot.com
  dgeta.top
  dgetasonora.gob.mx
+dgetcest.live
  dgeytopnskgmaimzfubuhxzelp-dot-gleowayel400503.uc.r.appspot.com
  dgfdgdgkjkghhfgdfsdgtyuuuyiuoutredfsdfgfgfhbbnmcvxcxcvf.ac.ug
  dgfeqvielpjwrltg-dot-millinium.ey.r.appspot.com
  dgff.godaddysites.com
  dgfree.site
+dggdfd.creatorlink.net
  dgh-we-yaersdas-se-yazersyrtud.vercel.app
  dgh.fukelamayi.cn
  dghhjfdfcfcx.000webhostapp.com
@@ -45012,12 +45133,14 @@ dgn2.awaykart.com
  dgnoprnwghcvzdijtprjqvigwy-dot-gleowayel400503.uc.r.appspot.com
  dgntaamdedtpge01.my.id
  dgocgzubglysxptf-dot-millinium.ey.r.appspot.com
+dgoln-bt.xyz
  dgonline.ca
  dgorady.000webhostapp.com
  dgpd.mentriqq.com
  dgpxezvibybnlvxaeysfjtwctv-dot-gloff849483.uk.r.appspot.com
  dgqgboudhlymponcbyaltiapji-dot-gleowayel400503.uc.r.appspot.com
  dgqptrjtazcteiqs-dot-millinium.ey.r.appspot.com
+dgreitkelis.lt
  dgret.xyz
  dgroup.ge
  dgrygwer.weebly.com
@@ -45289,7 +45412,6 @@ diamorama.com
  diampatrimoine.com
  diamselection.com
  diamsinvest.fr
-diamstones.be
  dian.199530.com
  diana02920.xyz
  diana8797343.xyz
@@ -45524,6 +45646,7 @@ digitalmarketingcoursetraininginstitute.com
  digitalmillionaires.com
  digitalmind.pl
  digitalmini.pro
+digitalmpg.com
  digitalmusic.icu
  digitalonlinebanking.services
  digitalparkltd.com
@@ -45925,7 +46048,6 @@ divasandladies.com
  divashairsignature.icu
  divasvideo10.xyz
  dive20.tokyo
-divebeard.guru
  divecatalina.com
  divengroup.com
  divercuc.com
@@ -46016,6 +46138,7 @@ djchewalk.net
  djchico.com
  djcttkzyckzqpbjcqjfjwazbrauonmsefzbi-dot-spyexc3093493.ey.r.appspot.com
  djczxejirhrxrycyoakvzxtexw-dot-gleowayel400503.uc.r.appspot.com
+djdandrees.com
  djddjdjfastserviceattromainverificationattdomain.weebly.com
  djddksbnd.000webhostapp.com
  djdhixqcctqcdfir-dot-millinium.ey.r.appspot.com
@@ -46169,7 +46292,6 @@ dl-80076342.md-downloads.com
  dl-97674424.md-downloads.com
  dl-authentication-html.com
  dl-lcc-authentication-jod.com
-dl.1003b.56a.com
  dl.198424.com
  dl.amigodistr.ru
  dl.danslavalleedudl.com
@@ -46419,6 +46541,7 @@ doberman.cc
  dobesell.com
  dobhgacpptjwpxjk-dot-millinium.ey.r.appspot.com
  dobi.nl
+dobien.co.uk
  doblealturacasas.com
  doblementa.com
  dobmanagementnet.shaxiapussy.top
@@ -46442,6 +46565,7 @@ docccutime.xyz
  docciadoccia.it
  doccle-loglnportaal.com
  docecreativo.com
+docentes.uto.edu.bo
  doceoeomafwzzfzz-dot-millinium.ey.r.appspot.com
  docerom.ro
  docesnico.com.br
@@ -46659,7 +46783,6 @@ dokivsem.com
  doklhe9odzkrhzt.e8273.pro
  dokoncit.pro
  doktorlarrehberim.com
-doktorpillenkaufen.xyz
  dokyit.000webhostapp.com
  dol.dance
  dol.gov.1ln.cc
@@ -47023,7 +47146,6 @@ doreen-lehmann.de
  dorehold.com
  dorellejacki.ru
  doreresidential.com
-dorfultariant.top
  dorians-geo.ru
  dorjibari.com.bd
  dormileon.ec
@@ -47281,6 +47403,7 @@ downtownseattlehotel.net
  downwarefree.xyz
  dowseservices.com
  dowsfbtool.com
+dowtwysmlpgcariqdngb.top
  dowwr.com
  doxaonline.net
  doxological.xyz
@@ -47476,6 +47599,7 @@ dreambodygurus.com
  dreamcars4kids.autoshowsonline.com
  dreamcombicom.nckitickets.gdn
  dreamersden.in
+dreamfaces.work
  dreamgaming.zzz.com.ua
  dreamhouse.in.th
  dreamhouses.site
@@ -47582,6 +47706,7 @@ drive.google-eu-cdn.com
  drive.google-us-cdn.com
  drive.google.com.it-barcelona.com
  drive.google.com.pdfdocument.bcuworks.com
+drive.iset.ro
  driveawaysaliencyhun.quickwebchecker.com
  drivechains.org
  drivedocmxrecordssfi1.z13.web.core.windows.net
@@ -47596,13 +47721,11 @@ drivenbymagneticscom.postfix-01.com
  driventodaypodcast.com
  driveonedrive0i.000webhostapp.com
  driveonelodriver.serveirc.com
-drivepity.guru
  driveragentplus.com
  driverandbutler.com
  driveroftheworld.hopto.org
  driverss.tk
  driverupddate.com
-driverzsrrulezzs.com
  drivesfile.serveblog.net
  drivespa.com
  drivespa.ru
@@ -48280,7 +48403,6 @@ dvla.refund-tax.ltd
  dvla.refundform.co.uk
  dvla.refundform.link
  dvla.refundsuk.com
-dvla.refundtax.limited
  dvla.repaymentuk.com
  dvla.resolve-fix.com
  dvla.return-tax.link
@@ -48328,7 +48450,6 @@ dvyppvwyksyntuwk-dot-millinium.ey.r.appspot.com
  dvzxmoidaombemeygpjpowsvkx-dot-gleowayel400503.uc.r.appspot.com
  dw-css.de
  dw-r2.jaysbrand.com
-dw.58wangdun.com
  dw27i.cn
  dw365.cn
  dw928.com
@@ -48573,6 +48694,7 @@ e-0fd.mentriqq.com
  e-1.info
  e-1fd.addroits.com
  e-205ae18ac7bf.netlify.app
+e-20support-centre.info
  e-24gwaltfakt.pl
  e-6zp.svcoding.com
  e-7p.svcoding.com
@@ -48729,6 +48851,8 @@ e.ie-aruba.com
  e.now-connect.net
  e.paczkyups.com
  e.t.interac.ca-acces2.club
+e.t.s.interac.ca-accesc.club
+e.t.s.interac.ca-app.club
  e.top4top.io
  e.uremenber.ru
  e0c0780416d0db77ab0c5f5405ca9e09.buzz
@@ -48937,7 +49061,6 @@ eastindianbajaar.com
  eastkorea.ga
  eastpennlandscape.com
  eastrandpsychologist.co.za
-eastsheen-glaziers.co.uk
  eastt.gq
  eastt.ml
  eastvassalboro.buzz
@@ -48964,7 +49087,6 @@ easybidbuy.xyz
  easybreathe.co.uk
  easycareonline.com.br
  easycarparts.net
-easyclipping.com
  easycup.online
  easycup.space
  easydatatransfercleansystemprofessional.duckdns.org
@@ -49300,6 +49422,7 @@ ebay.co.uk.263387274142.co.uk
  ebay.co.uk.263387284742.co.uk
  ebay.co.uk.3614.pw
  ebay.co.uk.3629720392.uk
+ebay.co.uk.bids.fit
  ebay.co.uk.contact-action-web-seller.gq
  ebay.co.uk.contact-support-about-sales.gq
  ebay.co.uk.ektabhattacharya.com
@@ -49389,6 +49512,8 @@ ebay.de.xcs41zudcnmlxq2.e8273.pro
  ebay.de.yotmixkcpf3rtxz.e8273.pro
  ebay.dji.camera-drones-29o35l22468.llc29o35l2.com
  ebay.dji.drones.camera-drones.itm50283658.llc50283658.com
+ebay.dll.singin.de.pms-mingkee.com
+ebay.dll.singin.pms-mingkee.com
  ebay.es.gdank.com
  ebay.home-garden-generators.itm1l78ol29.com
  ebay.home-garden-generators.itm1o29l60.com
@@ -49437,6 +49562,7 @@ ebic.gulfhirings.com
  ebigcoins.com
  ebik.com
  ebike4all.com
+ebills.thetrissilent.com
  ebillupdateshaw.is-an-accountant.com
  ebinaires.biz
  ebix.ga
@@ -49473,7 +49599,6 @@ ebsxs.xyz
  ebtq916s.cn
  ebtze.addroits.com
  ebu.gucac.com
-ebu.no
  ebureherly.com
  ebuufrdwuhwztdfn-dot-millinium.ey.r.appspot.com
  ebuzzally.com
@@ -49485,6 +49610,7 @@ eby-kleinanzeigen-de-anzeige-10299381103.000webhostapp.com
  eby-kleinanzeigen-de-anzeige-1250942122.000webhostapp.com
  eby-kleinanzeigen-de-anzeige-203919311.000webhostapp.com
  eby-kleinanzeigen-de-anzeige-293010391.000webhostapp.com
+eby-kleinanzeigen-de-anzeige-29301931.000webhostapp.com
  eby-kleinanzeigen-de-anzeige-29830193911.000webhostapp.com
  eby-kleinanzeigen-de-anzeige-29901298.000webhostapp.com
  eby-kleinanzeigen-de-anzeige-30001921.000webhostapp.com
@@ -49628,6 +49754,7 @@ ecomm-pagamentodec4ab2c1sella1it17d002fc.fotoparitani.it
  ecomm-sella-128e02a5.lacommediadellapentola.it
  ecommb4f22103.sella.it0d3e0235.commercialelem.it
  ecommerceweb.info
+ecommercewebdevelopment.co.uk
  ecomms2s.sella.it-onlinessella.it.l3dm-panel.com
  ecomortarcompany.com
  ecompass-project.eu
@@ -49728,6 +49855,7 @@ edankeunatuhwa.freeddns.uk
  edapt.education
  edarah.com.eg
  edarw.xyz
+edatafrica.com
  edatasafecom.nckithailand.gdn
  edayasuo.net
  edbziwarelyipqmh-dot-millinium.ey.r.appspot.com
@@ -49761,7 +49889,6 @@ edenmountaintop.com
  edenrosejewellery.com
  edental-parcels.000webhostapp.com
  edental-population.000webhostapp.com
-edenthedoors.com
  edenvalehotelgh.bulletbean.com
  edenykiraly.hu
  edenzconsultants.com
@@ -49839,7 +49966,6 @@ edok.goruli.com
  edoyvglnvkyxgxaa-dot-millinium.ey.r.appspot.com
  edpdpolska.pl
  edqbcginhmbngbwl-dot-millinium.ey.r.appspot.com
-edqfilqujkzortscevfvfnulns-dot-gloff849483.uk.r.appspot.com
  edqxjpjuthbxmfvleylkvemuxc-dot-gleowayel400503.uc.r.appspot.com
  edrcreditservices.nl
  edresources.sparc37.com
@@ -49969,6 +50095,7 @@ ee-billing-alerts.com
  ee-billing-details.com
  ee-billing-fix.com
  ee-billing-help.com
+ee-billing-infoid.com
  ee-billing-limited.com
  ee-billing-limits.com
  ee-billing-reset.network
@@ -49991,7 +50118,6 @@ ee-billinguk.com
  ee-billingupdates.com
  ee-billpayment.com
  ee-bills-and-payments.000webhostapp.com
-ee-billsuport.com
  ee-billsupport.com
  ee-billsupportuk.com
  ee-checkbilling.com
@@ -50103,7 +50229,6 @@ ee.billingdetails-update.com
  ee.billings-infoverify.com
  ee.billingunsuccessful-update.com
  ee.co.uk-billing.info
-ee.co.uk-ref2t6.com
  ee.co.uk.billing-update-jan11.info
  ee.co.uk.billing-update29june.info
  ee.co.uk.billing-updates-help.info
@@ -50115,7 +50240,6 @@ ee.co.uk.ref895.com
  ee.co.uk.secure-auth.ir
  ee.confirm-billing.com
  ee.failed-billingpayment.com
-ee.failedbill-payment.com
  ee.help-login.net
  ee.help.billing-xz.com
  ee.id1107.icu
@@ -50261,6 +50385,7 @@ eemybilling.com
  eenc3.addroits.com
  eencouragement.ca
  eendswlagnrpopwc-dot-millinium.ey.r.appspot.com
+eenfibercom.com
  eenjoy.live
  eenswrlfppfgwqshretymxrjhy-dot-gleowayel400503.uc.r.appspot.com
  eeodzywkiwpl.ru
@@ -50272,7 +50397,6 @@ eeportal.cc
  eeqibjsmfunlfcht-dot-millinium.ey.r.appspot.com
  eerecovery.000webhostapp.com
  eerna.com.bd
-eesecurebill-accountinfo.com
  eesecuremyaccount.com
  eesgw.xyz
  eesss.online
@@ -50318,7 +50442,6 @@ efbr2r6q84be-r4s-6w.co
  efcavuhmmbukchrw-dot-millinium.ey.r.appspot.com
  efcycwkicsthzxwi-dot-millinium.ey.r.appspot.com
  efdefsfweafsfelive.com
-efdsvse3s.dns05.com
  efe5teh6.gb.net
  efeatasoy.com
  efecketzctcrrmdy-dot-millinium.ey.r.appspot.com
@@ -50343,6 +50466,7 @@ efilisminmendham.ddns.net
  efimb.smtpclick.com
  efis.top
  efkbnnkzfhbfjogy-dot-millinium.ey.r.appspot.com
+efkdmsfosl.com
  eflom.app.link
  efmgecbsotlljvgq-dot-millinium.ey.r.appspot.com
  efmqglqztf.duckdns.org
@@ -50554,7 +50678,6 @@ eifelferienparkcom.chifanassume.top
  eiffelinvest.com
  eig-kristinjangro.com
  eigher.info
-eight-caring-cadet.glitch.me
  eightkimomedicura.info
  eigoeb.com
  eiimquc.goruli.com
@@ -50712,6 +50835,7 @@ ektoralx-gmrnsqrihx.cwp.com.pe
  ekttdkomtaggdjhyfnwehvfftc-dot-gloff849483.uk.r.appspot.com
  ekurgu.anadolu.edu.tr
  ekurhulenigovza2020upt.000webhostapp.com
+ekushwru.ru
  ekute.ml
  ekv26.app.link
  ekvbojlkcamfxdiz-dot-millinium.ey.r.appspot.com
@@ -51067,11 +51191,11 @@ elseelektrikci.com
  elsgroup.mk
  elshimaye.co.uk
  elsiah.com
-elsolivers.com
  elsosobl7arefract.com
  elsvhwccccnxkube-dot-millinium.ey.r.appspot.com
  eltaazh.com
  eltabloidedigital.com
+eltallerartistico.com
  eltaninservicespteltd.com
  eltercerpilar.com
  elternchecker.de
@@ -51259,6 +51383,7 @@ emhfrance.com
  emhjitcithimidia-dot-millinium.ey.r.appspot.com
  emi-china.com
  emi.by
+emi15.com
  emi4q642.vercel.app
  emiemz.com
  emigratingtothesun.com
@@ -51382,7 +51507,6 @@ employment-works.ca
  employmentbasedimmigrationattorney.com
  employmentplacestaffing.com
  empmtg.com
-empoderacomunicacion.pe
  empoderatuvida.org
  emporio71.com.br
  emporio89.com.br
@@ -51589,6 +51713,7 @@ encuestainiciosecion.000webhostapp.com
  encuestaspuno-peru.000webhostapp.com
  encuestauaem.000webhostapp.com
  encuestauaemm.000webhostapp.com
+encuestaygana.000webhostapp.com
  encumbrance.info
  encut.us
  encyclopedie-dofus.com
@@ -51611,7 +51736,6 @@ endsville.wholesale.benadorassociates.com
  endurancere.technemetrologia.pw
  eneconpanama.net
  enegix.com
-enekegyuttes.kig.hu
  enektrssvczdepgx-dot-millinium.ey.r.appspot.com
  enel-energia.org
  enel-ib.com
@@ -51667,6 +51791,7 @@ eng.feedbacks.webapp.okndrwax.com
  eng.login.page.amazon-feedback.com.nqdgqw.com
  eng.page.l0gin.paypal-feedback.com.tdhvjvfr.com
  eng.page.l0gin.paypal-feedback.com.vbnmuas.com
+eng.pampadelcorral.com
  eng.tiuop.com
  eng.ubu.ac.th
  eng.webapp.rukanisada.com
@@ -51677,6 +51802,7 @@ engamellacom.shaxiaabove.top
  engamellacom.shaxiaarea.top
  engamellacom.shaxiabook.top
  engb-facebook.com
+engcamp.org
  engedrill.com.br
  engefer.eng.br
  engefibra.net.br
@@ -51804,6 +51930,7 @@ ensayando.com.ar
  enscreumnoew.com
  ensemblearsmundi.com
  ensenadasportfishing.com
+enserve.co.uk
  enseureachaseses.aonlinebservices.website
  ensgetaways.com
  ensongchina.com
@@ -51856,7 +51983,6 @@ entregasnormal.com
  entrenamiento.grupolpb.com
  entrenate.alcotrans.co
  entrennar.com
-entrenofutbol.com
  entrepinceladas.com
  entrepreneurspider.com
  entreprise-esposito.fr
@@ -51877,6 +52003,7 @@ enuonoe.xyz
  enuyguned.ru
  env-3421506.cloud-fr1.unispace.io
  envelopesprinting.com.au
+enverdadtedigo.com
  envi-us.org
  envi1.com
  enviadoclientesms-com.umbler.net
@@ -51895,6 +52022,7 @@ envirotechcorp.com
  envisioncm.com
  envisioned.duckdns.org
  envisioneyewear.company
+envisonic.today
  envoiice43.com
  envoyemlak.com
  envozalta.com.ar
@@ -52140,6 +52268,7 @@ er6pe.svcoding.com
  era-app.com
  erabbied3rrre61.e8273.pro
  eradicative-ratings.000webhostapp.com
+eradonor.cyou
  eraganhuh.com
  eralparole.uno
  erankingi.pl
@@ -52153,6 +52282,7 @@ erasmus-plius.tomasjs.com
  erastio.mentono.com
  eravecuertaier.net
  erazscs.000webhostapp.com
+erb.org.zm
  erbria.xyz
  ercey.com.tr
  erchasbnlkjptzoy-dot-millinium.ey.r.appspot.com
@@ -52189,7 +52319,6 @@ erfanpich.com
  erfaz.xyz
  erftgbswedcx.fringetheory.net
  erfvmqj.goruli.com
-ergenamazonto.cyou
  ergensu.com
  ergfinance.com
  ergh.232sc.cn
@@ -52399,6 +52528,7 @@ es03.jaysbrand.com
  es1.bedandbreakoz.it
  es2-g.onderhost.com
  esaarc.com
+esabel.us
  esacbd.com
  esadar.com
  esagarautomobiles.com
@@ -53032,6 +53162,7 @@ eucatach.com
  eucharttering.s3-website-eu-west-1.amazonaws.com
  eucharwaterski.com
  euclidean-gravel.000webhostapp.com
+euclidoh.buzz
  eudcationchpal.tk
  eudocumnt18001sec389058yr20mn7.nn.r.appspot.com
  eudoraparks.buzz
@@ -53369,7 +53500,6 @@ evil-oreoo-72.com
  evilcorp.anondns.net
  evilginix.tk
  evilmaster666000666.000webhostapp.com
-evilnerd.org
  evincible-hopes.000webhostapp.com
  evineximlinks.com
  evinysiand.com
@@ -53459,7 +53589,6 @@ ewayrgfhhrguuvga-dot-millinium.ey.r.appspot.com
  ewbhhszmrkukrmyv-dot-millinium.ey.r.appspot.com
  ewbio.cn
  ewcmmckcdoihxpee-dot-millinium.ey.r.appspot.com
-ewegwdlsuqvtcswiuwjgshjeds-dot-gloff849483.uk.r.appspot.com
  ewenhack.ddns.net
  ewenmie.buzz
  eweodinda.ru
@@ -53559,7 +53688,6 @@ excalmore-8888.000webhostapp.com
  excasa3530.com.br
  excavationguay.com
  excel-auth-service.gq
-excel-sheet0.gq
  excelaires.com
  excelcarela.org
  excelcraft.in
@@ -53669,6 +53797,7 @@ exodus.mcdir.ru
  exodus.sh
  exodusadventure.com
  exodustalisman.com
+exogenousketones.net
  exoneracionescr.online
  exorable-hardcopies.000webhostapp.com
  exordiumsolutions.com
@@ -53735,7 +53864,6 @@ explorersx.kz
  exploreupdates.servehttp.com
  exploringplay.com
  explosederire.com
-exploshot.com
  explosible-state.000webhostapp.com
  expoblockchain2020.com
  expocitibanamex.com
@@ -54264,6 +54392,7 @@ fabook12.000webhostapp.com
  fabooklatco-login-com11005678900987654321.filesusr.com
  fabooklatco-loginecologia2310-com.filesusr.com
  fabooklatcol-loginmfaceboock-com.filesusr.com
+fabooklatcol-loginrewaj2jiwrvywkkt-com.filesusr.com
  fabrani.com.br
  fabrejulie.fr
  fabricateproductive.com
@@ -54566,7 +54695,6 @@ facebook-checkpoint-restore.gaadipe.com
  facebook-checkpoint-restore.leadpanther.com
  facebook-checkpoint-restore.membershipsiteprofitsystem.com
  facebook-checkpoint-restore.profit-pulling-reports.com
-facebook-checkpoint-restore.viralebookprofitsystem.com
  facebook-client.cf
  facebook-clone-csc-17.gedev.com.ng
  facebook-com-006962.bluc.mobi
@@ -54868,6 +54996,7 @@ facebook.918592user.online
  facebook.931875account.online
  facebook.ambomega.com
  facebook.anasaounalsoud.eu
+facebook.apptotech.com
  facebook.arabtecsolution.com
  facebook.authentication.pubgmobiler.com
  facebook.babynyouth.com
@@ -54902,21 +55031,6 @@ facebook.com----691842488.wareed.net
  facebook.com----715864486.wareed.net
  facebook.com----806813503.wareed.net
  facebook.com----956571465.wareed.net
-facebook.com-08203199.superprimavera.pt
-facebook.com-11190570.superprimavera.pt
-facebook.com-12470126.superprimavera.pt
-facebook.com-20803893.superprimavera.pt
-facebook.com-25029400.superprimavera.pt
-facebook.com-54211337.superprimavera.pt
-facebook.com-54299801.superprimavera.pt
-facebook.com-57232882.superprimavera.pt
-facebook.com-61094043.superprimavera.pt
-facebook.com-68157336.superprimavera.pt
-facebook.com-71590316.superprimavera.pt
-facebook.com-73792868.superprimavera.pt
-facebook.com-73850318.superprimavera.pt
-facebook.com-86058946.superprimavera.pt
-facebook.com-87377749.superprimavera.pt
  facebook.com-account.security.smahost.ro
  facebook.com-ads-id-588515710.facebooik-ads.com
  facebook.com-check-2579600192.kranti-india.org
@@ -55120,7 +55234,6 @@ facebook.marketplace.somethingradco.com
  facebook.marketplace.svenmix.com
  facebook.marketplace.thechalkcloset.com
  facebook.marketplaces-item.com
-facebook.marketpllace.item.564980043564327.com
  facebook.marketpplace.casa
  facebook.marketpplace.email
  facebook.member-login.online
@@ -55137,7 +55250,6 @@ facebook.page-item.com
  facebook.page490821306456.com
  facebook.page84201139577.com
  facebook.page894382014.com
-facebook.page90129835743.com
  facebook.phwebdev.com
  facebook.playmartit.com
  facebook.portalclf.com.br
@@ -55204,24 +55316,7 @@ facebookbussinezss.com
  facebookcad.0fees.us
  facebookcc.mrface.com
  facebookcf2.duckdns.org
-facebookco-020770738.risecse.com
-facebookco-041856820.risecse.com
-facebookco-049258271.risecse.com
-facebookco-057842791.risecse.com
-facebookco-129060093.risecse.com
-facebookco-172902044.risecse.com
-facebookco-185900022.risecse.com
-facebookco-210754893.risecse.com
-facebookco-415708322.risecse.com
-facebookco-453802619.risecse.com
-facebookco-505543652.risecse.com
-facebookco-541873795.risecse.com
  facebookco-559522221.risecse.com
-facebookco-608319772.risecse.com
-facebookco-641739874.risecse.com
-facebookco-644827177.risecse.com
-facebookco-655210994.risecse.com
-facebookco-815032329.risecse.com
  facebookco-914001473.risecse.com
  facebookcolor1.pubguc.world
  facebookcolor2.pubguc.world
@@ -55300,6 +55395,7 @@ facebooktournament.com
  facebookupdate.com.page-business.online
  facebookupdate.driverhunter.com
  facebookus-01384826.cleansol.lk
+facebookus-07423148.cleansol.lk
  facebookus-25094498.cleansol.lk
  facebookus-85981070.cleansol.lk
  facebookuser.4990315item.online
@@ -55468,7 +55564,6 @@ fadaoqrputra-k0l5ihzrf.vercel.app
  faddier-drink.000webhostapp.com
  fadecup.xyz
  fadefa.ddns.net
-fadelli.com.br
  faderfaderfader.com
  fadnioiduusbsger-dot-millinium.ey.r.appspot.com
  faeboooks.com
@@ -55701,6 +55796,7 @@ fanarticho.com
  fanaticallao.site
  fanaticaviation.com
  fanatictec.com
+fanbasebudi01gaming.wa-mabar20.tk
  fanbmypersondrive.icu
  fanbook.ir
  fanbuilds.com
@@ -55914,7 +56010,6 @@ fashionshoesbykfcom.batwoqisent.top
  fashionspace.in
  fashionstreets.co.uk
  fashiontattoo.xyz
-fashiontoride.com
  fashionupnext.com
  fashionvista.us
  fashporium.shop
@@ -55962,6 +56057,7 @@ fastfivetravel.ph
  fastflow.co.uk
  fastflowgutter.org
  fastflowtrading.com
+fastfoodgozo.rs
  fastfoxshipping.com
  fastfreeredics109.life
  fastingfuighye.com
@@ -56006,7 +56102,6 @@ fatpenis.theworkpc.com
  fatrecipesdoc.com
  fatrockermusic.com
  fatrolfordpd.com
-fatsksgh.work
  fatsnake.duckdns.org
  fattening-reader.000webhostapp.com
  fattest-rams.000webhostapp.com
@@ -56059,7 +56154,6 @@ fawasome8hngku54videonhfunhsgtk7scontest.awasomevideocontest.xyz
  fawltorconsroc1976.blogspot.be
  fawltorconsroc1976.blogspot.com
  fax-payday-loans.com
-faxgroan.guru
  faxitalia.com
  faxmail.live
  faxme.seslightingaustralia.com.au
@@ -56175,6 +56269,7 @@ fb-bb-cc.000webhostapp.com
  fb-bb-ccc.000webhostapp.com
  fb-bc-c.000webhostapp.com
  fb-block.com
+fb-business-marketplace.shop
  fb-business-page.item93084710029476.com
  fb-business-page76233763.com
  fb-buy-sell-trade.online
@@ -56240,6 +56335,7 @@ fb-item2642842.com
  fb-item32d376f6-fashion-page82947346.com
  fb-item3563487.com
  fb-item43526.business-page-id9837ry36trfrsd54367eu38r37.com
+fb-item480.sys482b.xyz
  fb-item4827.com
  fb-item52734323.com
  fb-item546435.online
@@ -56284,6 +56380,7 @@ fb-marketplace-item5453433232.club
  fb-marketplace-item74533242.com
  fb-marketplace-item84773223.com
  fb-marketplace-itemnumber65434342.info
+fb-marketplace-items.shop
  fb-marketplace-offer.us
  fb-marketplace-online.shop
  fb-marketplace-online.store
@@ -56300,6 +56397,10 @@ fb-messenger-heckethorn.xyz
  fb-messenger-profile-id.com
  fb-messenger.5v.pl
  fb-mewhats.myddns.me
+fb-mobi-5003125.creditvalue.ca
+fb-mobi-66749239.creditvalue.ca
+fb-mobi-67395555.creditvalue.ca
+fb-mobi-7710319.creditvalue.ca
  fb-mobile-ikathimerini.000webhostapp.com
  fb-msgconcurso-de-parejas-enamoradas123.000webhostapp.com
  fb-mx.com
@@ -56463,7 +56564,12 @@ fb-trader-marketplace.shop
  fb-traders-populars.online
  fb-trades-swap.club
  fb-trailers-rvs-trade.club
+fb-uber.sys-13k.xyz
  fb-update-policy.365wrf5r.com
+fb-us17719430.heartofwine.ca
+fb-us19461337.heartofwine.ca
+fb-us37170864.heartofwine.ca
+fb-us62131172.heartofwine.ca
  fb-video-vivo.club
  fb-video001.000webhostapp.com
  fb-violation.com
@@ -56793,6 +56899,7 @@ fbcheckpoint.verid645.com
  fbcheckpolicy145532.com
  fbclubvideo.blogspot.com
  fbcom-00860347.chekkos.mx
+fbcom-01067802.chekkos.mx
  fbcom-01443668.chekkos.mx
  fbcom-02715725.chekkos.mx
  fbcom-05846531.chekkos.mx
@@ -56801,6 +56908,9 @@ fbcom-06510013.chekkos.mx
  fbcom-10640072.chekkos.mx
  fbcom-13190631.chekkos.mx
  fbcom-21636095.chekkos.mx
+fbcom-25216221.chekkos.mx
+fbcom-28444807.chekkos.mx
+fbcom-28458057.chekkos.mx
  fbcom-28714532.chekkos.mx
  fbcom-29597384.chekkos.mx
  fbcom-30353136.chekkos.mx
@@ -56808,9 +56918,13 @@ fbcom-32601355.chekkos.mx
  fbcom-32787258.ifms-enargeia.gr
  fbcom-33763123.chekkos.mx
  fbcom-35384681.chekkos.mx
+fbcom-36835899.chekkos.mx
  fbcom-39191075.chekkos.mx
+fbcom-40140343.chekkos.mx
+fbcom-40962258.chekkos.mx
  fbcom-41441042.chekkos.mx
  fbcom-42774185.chekkos.mx
+fbcom-45531986.chekkos.mx
  fbcom-48487915.chekkos.mx
  fbcom-50203673.chekkos.mx
  fbcom-51924358.chekkos.mx
@@ -56820,13 +56934,16 @@ fbcom-61437580.chekkos.mx
  fbcom-62020425.chekkos.mx
  fbcom-64466396.chekkos.mx
  fbcom-67023669.chekkos.mx
+fbcom-71684840.chekkos.mx
  fbcom-72259425.chekkos.mx
  fbcom-73197312.chekkos.mx
  fbcom-73299311.chekkos.mx
  fbcom-76963706.chekkos.mx
  fbcom-80119271.chekkos.mx
+fbcom-80835839.chekkos.mx
  fbcom-85372561.chekkos.mx
  fbcom-87471146.chekkos.mx
+fbcom-91638889.chekkos.mx
  fbcom-95650168.chekkos.mx
  fbcomrc0106.000webhostapp.com
  fbcontactmanager.com
@@ -57136,7 +57253,6 @@ fcecol.info
  fcecoon4.000webhostapp.com
  fcek.8wix.com
  fcelestinerey.com
-fcf.net
  fcfdzikduwvqtupozudhyqhrxraeuoyjmicm-dot-glegen303939423233.ue.r.appspot.com
  fcfe9341ad6332e10f94e94ca940de6924833.net
  fcfportfolio.com
@@ -57328,14 +57444,18 @@ fedexs.net
  fedexs.org
  fedexxpo.wwwnl1-ss14.a2hosted.com
  fediburgame.it
+fedner.net
  fedo.xyz
  fedorus.com
  fedreserves.org
+fedselaarsts.com
  fedsfmr.ru
  feed-back.com.tr
  feed-boosterblogger.com
  feed-life.com
  feed.tetratechsol.com
+feedbaksupport.net
+feedbaksupport.org
  feedexpress.us
  feedfeed.com
  feedingdreamscambodia.org
@@ -57496,6 +57616,7 @@ fermynwoods.co.uk
  fernanda-vieira.com
  fernandadaniel.com.br
  fernandesgestaoservice.yolasite.com
+fernandesprojetoseacabamentos.com
  fernandez.ec
  fernier-anticipatio.000webhostapp.com
  fernmews.buzz
@@ -57901,6 +58022,7 @@ fifgroupcard.fifada.com
  fifidossaltosaltos.com
  fifirayempire.com
  fifohbibou.blogspot.com
+fifteen-circulation.000webhostapp.com
  fifteenmeters.co
  fifth-point-287313.nw.r.appspot.com
  fifth3rdlogin-securityteam.com
@@ -57908,7 +58030,6 @@ fifthelement.be
  fiftolkf.cf
  fiftyy42.beget.tech
  figexorcit.com
-fightcare.guru
  fighttechsports.com
  fightvscorona.com
  fightwithcapitalism.com
@@ -58109,6 +58230,7 @@ financialstockhub.com
  financiamentointeligente.com
  financieracopeande.com
  financingmen.ru.com
+finandopiscologia.000webhostapp.com
  finansbilgiler.com
  finanse-bardzo-osobiste.pl
  finansist.xyz
@@ -58192,7 +58314,6 @@ finedateseekers.com
  finedellacalvizie.it
  finediningweek.pl
  finefeather.info
-fineme.ug
  fineprintingmart.com
  fineproductsinc.com
  finerbook.com
@@ -58265,7 +58386,6 @@ fireglennboyce.info
  firehorny.com
  firehorsenation.com
  fireiniceslangue.com
-fireissue.guru
  firekicksneaker.com
  firelabo.com
  firelala11.com
@@ -58287,6 +58407,7 @@ firma-digitalcr.com
  firma-malarska-poznan.pl
  firmacr-bccr.com
  firmacr-bccrgo.com
+firmaddd.iset.ro
  firmadergisi.com
  firmadigital-cr.com
  firmadigitalcr.online
@@ -58360,7 +58481,6 @@ firsttechfedl.com
  firsttotwelfth.com
  firsttravelguidecom.chifanblow.top
  firstupbusinessuk.com
-firstuualton.org
  firstview.co.kr
  firstvoicedialer.com
  firstyearclevelandorg.chifanbob.top
@@ -58393,7 +58513,6 @@ fishnigtoolsmall.com
  fishpacifica.com
  fisiopet.com.ec
  fisioterapiatempspertu.com
-fisswert.top
  fiswyhjxocpmwjtj-dot-millinium.ey.r.appspot.com
  fit-city.online
  fit-worth.000webhostapp.com
@@ -58711,7 +58830,6 @@ flexistyle.com.pl
  flexitravel.com
  flexmedia.hu
  flexno.com
-flexoarquitectura.com
  flexoempregos.com
  flexpak-th.com
  flexquitacao.com
@@ -58764,6 +58882,7 @@ fllkebghrsfxhlwp-dot-millinium.ey.r.appspot.com
  fllxprint.com
  flmates.com
  flmkmjk44.com
+flndmylphonelocater.com
  flo14.000webhostapp.com
  floatformula.com
  floaty-blindfolds.000webhostapp.com
@@ -58816,7 +58935,6 @@ flowface.bnppre.pinax.org
  flowhealth.icu
  flowjob.top
  flowkvcmi.com
-flowminor.guru
  flowpressurewashing.com
  flowtech-uae.com
  flowtrendspyer.com
@@ -58859,6 +58977,7 @@ flusanie.com
  fluted-house-283121.uc.r.appspot.com
  fluteguard.com
  fluteguards.nn.r.appspot.com
+fluty-bigamy.000webhostapp.com
  fluxcommunity.top
  fluxegtarp.xyz
  fluxpackaging.tk
@@ -58869,7 +58988,6 @@ flvwoxqoxnjgnzya-dot-millinium.ey.r.appspot.com
  flwbvacvcqzcggwz-dot-millinium.ey.r.appspot.com
  flxaekxeoeciwymd-dot-millinium.ey.r.appspot.com
  flxdpyxjpkrwylyw-dot-millinium.ey.r.appspot.com
-fly-car.co
  flyable-radio.000webhostapp.com
  flyarnoldaviation.com
  flybuys.net
@@ -58884,6 +59002,7 @@ flying-bird.top
  flying-medal.000webhostapp.com
  flying-wings-consultants.com
  flying-wolf11.ga
+flyingbuddhadesign.com
  flyinghorsesmusicentertainment.com
  flynnwebapps.xyz
  flyp0rter.com
@@ -58989,6 +59108,7 @@ fnmlko.app.link
  fnmzhptlolxoxqwn-dot-millinium.ey.r.appspot.com
  fnp8.mentriqq.com
  fnpftfhxontbnmtx-dot-millinium.ey.r.appspot.com
+fnphyaba.gov.ng
  fnpqlx9xulakeyanwv0u.us-south.cf.appdomain.cloud
  fnptxzbxtafhzkex-dot-millinium.ey.r.appspot.com
  fnq0v-alternate.app.link
@@ -59062,6 +59182,7 @@ folkish-armory.000webhostapp.com
  folklore-numbers.000webhostapp.com
  follettoshopcom.shuiaedge.top
  follgram00webhostapp.000webhostapp.com
+follipur.com
  follow.steems.top
  followandjoin.zyns.com
  follower-ig-buyol.000webhostapp.com
@@ -59125,6 +59246,7 @@ foodiebazzar.000webhostapp.com
  foodiecafe.info
  foodingencounters.com
  foodline.rw
+foodmap.iset.ro
  foodmarketplace.getdokan.com
  foodpackagingfilms.com
  foods.jkub.com
@@ -59173,6 +59295,7 @@ forbika.com
  forcanoter.com
  forcekravmaga.com
  forceoutsc.temp.swtest.ru
+forcheapflights.net
  forconfirmation.gq
  ford-fusion-item257334848740173.club
  ford-item3245652134768965.world
@@ -59300,9 +59423,11 @@ formostafa.ddns.net
  formotionproduce.com
  formpost2.arthaus.com.mk
  forms-return02.com
+forms-verificationbadgeservices.com
  forms.alocarwash.ir
  formtools.com
  formulaire-chrono.net
+formulaire-fiscale.serveftp.com
  formulaire-web.com
  formularganic.xyz
  formularioparacoronapp.000webhostapp.com
@@ -59334,7 +59459,6 @@ fortaxbank.com
  fortaxbanking.com
  fortbraggfcu.info
  fortbranch.buzz
-fortcollinsathletefactory.com
  forteol.com
  forthamiltonlawyer.com
  fortheloveofthehorse.org
@@ -59652,7 +59776,6 @@ frankeeos112.com
  franken-weingut-braun.de
  frankenmariacatering.nl
  frankfurtadbestcom.nckitickets.gdn
-frankfurtelfarolillo.com
  frankhaney.biz
  franki21121.com
  franki9934.com
@@ -59660,7 +59783,6 @@ frankincensesupply.com
  frankkk12.com
  franklyn.nikhilsangy.com
  frankrebe21342.com
-frankroller.de
  frankroth.com
  franksmith.co
  franktechnik.com
@@ -59673,7 +59795,6 @@ franticsupered.com
  franubait.000webhostapp.com
  franz-spedition.de
  franzenplumbing.com
-franzosenbach.de
  frasi.online
  frattighmygamac.cf
  fraudcheck-365online.com
@@ -59701,6 +59822,7 @@ freckchidek.com
  frecklier-ammonia.000webhostapp.com
  fredca.ucoz.org
  fredderlly.com
+freddo-egypt.com
  freddyboomboomlove.org
  freddylove.com
  fredegnome.com
@@ -59929,6 +60051,7 @@ freeskinpubgmobiletencent.com
  freeskinsoy.tk
  freeskinucpubgx.onedumb.com
  freeslits.net
+freesms.ro
  freesoft.website
  freespending.info
  freespin.bft45.com
@@ -60051,6 +60174,7 @@ freshplace2links.icu
  freshprince.zapto.org
  freshseafood.webhop.me
  freshsoft.site
+freshstorage2020.com
  freshupdate.safesystemupgrade.org
  freshworkxcom.baerseventake.top
  freshworkxcom.chifanblow.top
@@ -60232,7 +60356,6 @@ frugalfu.com
  fruitfreezedry.com
  fruitfulfurnishings.com
  fruitgun.ru
-fruitplot.guru
  fruitproducts1111.webhop.me
  fruits-812.ml
  fruitstip.com
@@ -60329,6 +60452,7 @@ fswgqt.vteexcx.com
  fswisqrtrvszqzpl-dot-millinium.ey.r.appspot.com
  fsxdjrtueslrngov-dot-millinium.ey.r.appspot.com
  fsxfqgnzwhnzxmsq-dot-millinium.ey.r.appspot.com
+fsyesplite.com
  fszdzozkeppvevbe-dot-millinium.ey.r.appspot.com
  ft-gate.com
  ft-invest.net
@@ -60492,6 +60616,7 @@ fullcomputacion.cl
  fullcorp-net.com
  fullelectronica.com.ar
  fullgrown.zapto.org
+fullhdvideoizlemesitesi8007.xyz
  fullinnova.com
  fullmediaco.com
  fullmovie1.co
@@ -60516,6 +60641,7 @@ fuly-lucky.com
  fumblechamomile.com
  fumbshushw.com
  fumigacionesentoluca.com
+fumigacionesrex.com
  fummskojmqqiwwhopineorfrzeysvusoazmo-dot-glegen303939423233.ue.r.appspot.com
  fumxzqys.co.cc
  fun-skin.ga
@@ -60623,7 +60749,6 @@ furnituresales.ir
  furnitureshifting.icu
  furnituru.ru
  furnskin.com
-furolla.xyz
  furomar.com
  furphygratis.com
  furrer.000webhostapp.com
@@ -60631,6 +60756,7 @@ furryfootsteps.com
  furtherissues.ddns.net
  furthobv.000webhostapp.com
  fusaazor6.icu
+fusaed.com
  fuscon.ga
  fuscon.gq
  fusewithme.com
@@ -61025,6 +61151,7 @@ gabung-grup-bokep-viral-indo71.000webhostapp.com
  gabung-grup-indonesia-viral.000webhostapp.com
  gabung-grup-sex-bokep000.000webhostapp.com
  gabung-grup-wa-bokepers.000webhostapp.com
+gabung-grup-whatssapp18.000webhostapp.com
  gabung-grup.collect20.com
  gabung-grupbokep.v-25.com
  gabung-grupbokepindo.jvib20.ga
@@ -61125,7 +61252,6 @@ gaecdelabelangerie.com
  gaefbalwqpopozmz-dot-millinium.ey.r.appspot.com
  gaerac.gdn
  gaesconstrucion.com
-gaffa-music.com
  gaffer.pp.ua
  gaffney-krroese.com
  gafigaf.in
@@ -61133,6 +61259,7 @@ gaga200.com
  gagalicioes.cf
  gagasrollindiner.com
  gagdxbyhhxsxitlt-dot-millinium.ey.r.appspot.com
+gagets.bar
  gaggijatt.zapto.org
  gagmis.webdevcore.com
  gagnerltd.co.tz
@@ -61356,7 +61483,6 @@ gaoyou.06rl.com
  gaozhao-edu.com
  gap.emcl.ng
  gapchance.cyou
-gapesmm.org
  gapfhrwfnyuthsnz-dot-millinium.ey.r.appspot.com
  gapi.org
  gapsystem.com.ar
@@ -61571,6 +61697,7 @@ gazetagminna.cal24.pl
  gazetalubuski.pl
  gazetamazowsze.pl
  gazetapucka.pl
+gazetareforma.com
  gazetkamazowsze.pl
  gazetowo.eu
  gazibosalon.com
@@ -61965,6 +62092,7 @@ genevieveschorr.com
  genf20pluscoupons.com
  gengrasjeepram.com
  geni.us
+genial.com.pl
  geniaturkey.com
  geniavo.com
  genichesk.best
@@ -61998,6 +62126,7 @@ genxphones.com
  genzlvlt.com
  geo-premium.com
  geo.com.my
+geoabscreativo.com
  geoambientechile.cl
  geobelt.ge
  geocachingabortive.com
@@ -62068,7 +62197,6 @@ gerarrivas02.000webhostapp.com
  geratisdata.000webhostapp.com
  gerawest.xyz
  gerbanglampura.co
-gerdahaering.de
  gerdalights.buzz
  gerdasgarden.ru
  gerdosan.com
@@ -62107,7 +62235,6 @@ germany.sechenesore.com
  germanyexploits.com
  germistonmiraclecentre.co.za
  geronaga.com
-gerotax.de
  gerpa.uk
  gerraffhfhcdhi.vercel.app
  gersiolsetacab.tk
@@ -62152,10 +62279,8 @@ gestioneinbizzotutto.com
  gestionprochile.cl
  gestomarket.co
  gestoriadecredito.com.mx
-gestoriasanchez.es
  gesus-skins.me
  geswrptfkuzoxhqfnevmebxoqz-dot-gleowayel400503.uc.r.appspot.com
-geszd.xyz
  get-a-clip.com
  get-authentication.000webhostapp.com
  get-food.in
@@ -62323,6 +62448,7 @@ getwayimmigration.com
  getx8.com
  getyahoo.weebly.com
  getyournameinthegame.com
+getyourrefund.ga
  getyourslot.com
  getz1.shop
  getz4.net
@@ -62332,6 +62458,7 @@ geuka.org
  gevkzojcniieqmlx-dot-millinium.ey.r.appspot.com
  gew63.svcoding.com
  gew9axd89-6xvvf7480.vercel.app
+gewcaaqarelouine.com
  gewe.tech
  gewtt.xyz
  gexgyxglylmpvern-dot-millinium.ey.r.appspot.com
@@ -62504,6 +62631,7 @@ ghadtanter.ga
  ghadtanter.gq
  ghadtanter.ml
  ghadtanter.tk
+ghaenatpakhsh.ir
  ghaeumofpeyntsoxbc.top
  ghafarbooss.ddns.net
  ghancommercialbank.com
@@ -62633,6 +62761,7 @@ gibhennigan.com
  gibizada.com
  gibsonhennigan.com
  gibsonhomesva.com
+gic.smartdms.in
  gicdjnxlppvozamg-dot-millinium.ey.r.appspot.com
  gidazkepxhvkfbvifulccacihz-dot-gleowayel400503.uc.r.appspot.com
  giddyupmedia.com.au
@@ -62719,6 +62848,7 @@ giidehvmmwuwwusj-dot-millinium.ey.r.appspot.com
  giisrduuqsgtjkzdsspucbhdtc-dot-gleowayel400503.uc.r.appspot.com
  gijaalzryuvstnzq-dot-millinium.ey.r.appspot.com
  gikbik123.ga
+gikei.jp
  giksmol.by
  gil93.ru
  gilandnsijandhn.com
@@ -62744,6 +62874,7 @@ gimevlqdsxfaorvgriwxokxmeu-dot-gloff849483.uk.r.appspot.com
  gimewtliiatcefrmeldebjlecg-dot-gleowayel400503.uc.r.appspot.com
  gimhon.ml
  gimibimxurcbpdchjgptymrfqp-dot-gleowayel400503.uc.r.appspot.com
+gimscompany.com
  gimsuri.xyz
  gimta-door.web.app
  gimumurwyqozmxsq-dot-millinium.ey.r.appspot.com
@@ -62795,6 +62926,7 @@ girlillamarketing.com
  girlscanlead.co
  girlschat.delhijob.xyz
  girlschat.hotelkaunic.com
+girlscouts.org.ph
  girlsexy02.ddnsking.com
  girlsexyvietnam.com
  girlsgettinggoals.com
@@ -63182,6 +63314,7 @@ globalvasca.it
  globalweb.asia
  globalwebpay.co
  globalworks.main.jp
+globalyahoo.weebly.com
  globalyouthrecruitment.com
  globdesign.com
  globe.swiatkowski.cz
@@ -63329,7 +63462,6 @@ gmvmexico.com
  gmw2.ailacabs.com
  gmwlegal.co.ke
  gmwmag.com
-gmx.soft-secure.de
  gmxjzzpfacdqnrrs-dot-millinium.ey.r.appspot.com
  gmxportalmail236.yolasite.com
  gmxtbillingsemailedppl.managementmyorders.com
@@ -63339,7 +63471,6 @@ gn2t.psdzy.com
  gn52.cn
  gn8q2.onderhost.com
  gnaaaabry12june1.godaddysites.com
-gnadl.net
  gnalkqctdapjplzzmmldmfhsqb-dot-gleowayel400503.uc.r.appspot.com
  gnarlyearth.com
  gnb4.blob.core.windows.net
@@ -63430,6 +63561,7 @@ goallineembroidery.com
  goanbazzar.com
  goandshine.org
  goapplesupport.com
+goasjves.org
  goatskinflakily.co.kr
  goattlogin.com
  goaudio.info
@@ -63463,6 +63595,7 @@ godbayern.shaxiaassessment.top
  godbloodcc.000webhostapp.com
  godbuntu.net
  godeageaux.com
+godeaug.org
  godgokaogkakga.ml
  godintullahoma.com
  godinyour.life
@@ -63477,6 +63610,7 @@ godrejproperties-thane.co.in
  godrejs-southestate-okhla.com
  godrivedrop.com
  godryall.com
+godsadhana.com
  godsave.tk
  godsglotyonme.com
  godwebmaster.com
@@ -63630,7 +63764,6 @@ goldenyoungwaywork.hopto.org
  golder.hk
  golderse.xyz
  goldfish.servebeer.com
-goldfom.tokyo
  goldfor10.com
  goldframe.ir
  goldgallerymultimedia.co.zw
@@ -63665,6 +63798,7 @@ goldwinmarket.com
  goldyoung.com
  goletracas.com
  golf-fine.com
+golfballsonline.com
  golfbygeorge.com
  golfcartech.com
  golfcartsnebraskacity.com
@@ -63864,7 +63998,6 @@ googlething-part-2.toast12.repl.co
  googletime.ac.ug
  googletime.ug
  googletutor.com.au.craftfacts.com
-googlewebsiralamahizmetleri.com
  googllee.000webhostapp.com
  googoltwitchpatriarch20.com
  googplay.gq
@@ -64346,6 +64479,7 @@ grafishop.com.ar
  grafoaksara.com
  grahabailindonesia.com
  grahampentelow.com
+graingateway.top
  grainpost.com
  grambusiness.es
  gramilms.xyz
@@ -64355,6 +64489,7 @@ grampashouse.com
  grampicz.com
  gramsteles.ml
  gramview.yellow-bat-79.telebit.io
+gran10.tokyo
  gran4.blob.core.windows.net
  grananphota.tk
  granbyumber.com
@@ -64755,6 +64890,9 @@ groub-chat-whatapp11.wikaba.com
  groub-chat-whatapps20.gets5.com
  groub-kumpulan-bokep-dan-vcs.000webhostapp.com
  groub-vkp2020.whatsaap7.tk
+groubmabarfreefire-1.my.id
+groubmabarfreefire.asia
+groubrealbudi.asia
  groubtantedanoom.skinfree9.com
  groubwa18sex.000webhostapp.com
  groubwamabarff.skinfree9.com
@@ -64910,6 +65048,7 @@ groupswhatsapp.faqserv.com
  groupupdatessoftwares.com
  groupvacations.icu
  groupvideo18plusaachat.000webhostapp.com
+groupviral2020.get-claimfree.ga
  groupvirall.zyns.com
  groupvirallku.faqserv.com
  groupwa.guied7.my.id
@@ -64974,6 +65113,7 @@ groupy.pro
  groveparaplanning.com.au
  grovesquarejc.com
  grovezsuiter.buzz
+grow.ucidity.com
  growagency.ru
  growena.in
  growfurtherfinancials.com
@@ -64986,6 +65126,7 @@ growsp-official.com
  growthat.life
  growthfunnels.com.au
  growtopiagame.xyz
+growvein.cyou
  growwebrank.com
  growyourtaxoffice.com
  groysman.club
@@ -65164,7 +65305,6 @@ grub-whatsapp89.ocryw.com
  grub-whatsappbokep.join-bkeps10.gq
  grub-whatshaap.4pu.com
  grub-xnxx.wikaba.com
-grub.whatsapp.new.duppor3.my.id
  grub18-keatasbr.000webhostapp.com
  grub18.wa-sex.com
  grub18.whatsapp-bokep.tk
@@ -65393,7 +65533,6 @@ grup-happy-18keatas.000webhostapp.com
  grup-indonesia-2020.000webhostapp.com
  grup-join-whatsapp.vizvaz.com
  grup-juniiv2.ga
-grup-kembang-desa.xyz
  grup-mabar-bulanramadhan.000webhostapp.com
  grup-mabar-ff77.2waky.com
  grup-mabar-free-fire-0009.000webhostapp.com
@@ -65831,6 +65970,7 @@ grupofiducia.com
  grupofrservicosecomercios.com
  grupoincap.com.br
  grupoinelpro.com
+grupoinmare.com
  grupoinnove.com.br
  grupoitalopoblano.com
  grupojps.com.br
@@ -66330,6 +66470,7 @@ gtdopvrtudwzcyig-dot-millinium.ey.r.appspot.com
  gtdxrqcmtdvykvsvzp.top
  gtecham.com
  gtechglobal.com
+gtface.tokyo
  gtfifuqkosapuiha-dot-millinium.ey.r.appspot.com
  gtfratjoca.duckdns.org
  gtg22312.ddns.net
@@ -66422,7 +66563,6 @@ gueriniarmi.it
  guerir-nature.fr
  guerircestpossible.fr
  guerison-energetique-vibratoire.fr
-guerison-integrale.fr
  guessgsl.co.cc
  guest-room.net
  guestcreditunion.000webhostapp.com
@@ -66459,6 +66599,7 @@ guildfordprinting.co.uk
  guilhermebasilio.com
  guilhermetalma.com.br
  guilin1.9avip.cn
+guillermo.co.uk
  guillo.serveftp.com
  guimant.com
  guinathon.ysu.edu
@@ -66895,6 +67036,7 @@ h2ap.jaysbrand.com
  h2d9.onderhost.com
  h2ijfv8y.cene.cc
  h2jd8.mentriqq.com
+h2o-unlimited.com
  h2omarketsltd.com
  h2tfashion.com
  h35h2hn3tehoqrzc.gmz.cc
@@ -67193,10 +67335,14 @@ halfpricelosangeles.com
  halfruffs.com
  halfs-71.tk
  halfwayor.com
+hali-secureinfo.com
+hali-secureinfos.com
  haliaxpgsss.000webhostapp.com
  halifax-account.com
  halifax-confirm.com
  halifax-groupsonline.com
+halifax-onlinepayment.com
+halifax-onlinesecurity.com
  halifax-securebanking.com
  halifax-securedevice.cc
  halifax-secureonline.com
@@ -67209,6 +67355,7 @@ halifax.co.uk-mobileappupdate-system-update.kamukartsigorta.com
  halifax.co.uk-mobileappupdate-system-update.mecheformacion.com
  halifax.co.uk-mobileappupdate-system-update.thurnhamteece.com.au
  halifax.co.uk-mobileappupdate-system-update.wemova.com
+halifax.co.uk.login-review-1679.info
  halifax.co.uk.login-review-1967.info
  halifax.co.uk.login-review-2457.info
  halifax.co.uk.login-review-2478.info
@@ -67226,7 +67373,6 @@ halifax.co.uk.login-review-5274.info
  halifax.co.uk.login-review-5786.info
  halifax.co.uk.login-review-6782.info
  halifax.co.uk.login-review-7295.info
-halifax.co.uk.login-review-765.info
  halifax.co.uk.login-review-9483.info
  halifax.co.uk.payee-review-2849.info
  halifax.co.uk.review-login-2763.info
@@ -67240,6 +67386,7 @@ halifax.co.uk.review-payee-5783.info
  halifax.co.uk.review-payee-9382.info
  halifax.co.uk.verify-login-3847.info
  halifax.deregister-a-device.com
+halifax.deregister-app.com
  halifax.deregister-device.com
  halifax.deregister-newdevice.com
  halifax.deregister-newdevices.com
@@ -67253,17 +67400,18 @@ halifax.device-deregistration.com
  halifax.fix-mypayee.com
  halifax.instruction-security.co.uk
  halifax.login-help-uk.com
+halifax.manage-mypayee.uk
  halifax.manage-payee.org
-halifax.manage-payee.uk
-halifax.managepayee.com
  halifax.managepayee.org
-halifax.manageyourpayee.org
+halifax.mobile-banking-auth.com
  halifax.mobile-banking-ref101.com
  halifax.mobile-banking.co.uk
  halifax.my-payees.co.uk
+halifax.my-secure-check.co.uk
  halifax.mypayee.co.uk
  halifax.new-device-deregister.com
  halifax.newdevice-deregistration.com
+halifax.newdevices-deregistration.com
  halifax.newpayee-alerts.com
  halifax.newpayments-alert.com
  halifax.newpayments-verifyalert.com
@@ -67299,9 +67447,9 @@ halifax.secure-online-sign-in.com
  halifax.secure-unregister.com
  halifax.secure-verified-access.com
  halifax.securelogin-paymentsverify.com
+halifax.securelogins-paymentschecksalert.com
  halifax.securemy-payees.com
  halifax.securepayee.co.uk
-halifax.securepayments-alertschecks.com
  halifax.security-unregister.co.uk
  halifax.uk-security-check.com
  halifax.uk-unregister.co.uk
@@ -67312,12 +67460,13 @@ halifax.verified-unregister.com
  halifax.verify-deregister.com
  halifax.verify-payee-ref101.com
  halifax.verify-payee-ref13.com
-halifax.verify-payees.co.uk
  halifax.verify-unregister.com
  halifax.withhold-payee.co.uk
  halifaxbank-online.com
+halifaxdevicemanagement.com
  halifaxid.it
  halifaxonline-secure.com
+halifaxonline-security.com
  halifaxreviewmyacc.live
  halifaxsecure-onlinelogin.com
  hall-motor-47.myjino.ru
@@ -67396,6 +67545,7 @@ hand-controleselferinnovo.com
  hand-gloves.xyz
  handan.yfqzdfd.com
  handanlipin.com
+handantc.com
  handanzhize.info
  handcraftadvisor.com
  handeejoe.com
@@ -67427,7 +67577,6 @@ handyphoto4.com
  handystarlet.com
  handystepcom.shuiabox.top
  hang3clip.ddns.net
-hang3xvi.ddns.net
  hangang.com.ua
  hangcha-rf.ru
  hangduc24h.com
@@ -67444,7 +67593,6 @@ hangsengecard.com
  hangthang.com
  hangtheuducthanh.com
  hangtieudung.cf
-hangtotnhapkhau.com
  hangtrentroi.com
  hangxingdun.cn
  hanhen-shippings.com
@@ -67553,6 +67701,7 @@ hardcore-bell-fee8b7.netlify.app
  hardcore-goldberg-324ede.netlify.app
  harddecisions.info
  harddecisions.org
+harddrivedonors.com
  hardegginfo.shaxiaapplication.top
  hardengratiz.com
  hardenvol.com
@@ -67587,6 +67736,7 @@ harmenolgs.info
  harmoneylife.co.uk
  harmonious-fuschia-cardigan.glitch.me
  harmonyrealestate.ae
+haroldhazard1-wixsite-com.filesusr.com
  haroldkjones.com
  harolds.ooguy.com
  haroldsports.com
@@ -67653,6 +67803,7 @@ hashtagvietnam.com
  hasiba.co.jp
  hasifria.net
  haslkdokdm.com
+hasmob.com
  hasnaindadani.000webhostapp.com
  hasnet.xyz
  hassanandhassan.com
@@ -67873,7 +68024,6 @@ hcriusnispzrbmnu-dot-millinium.ey.r.appspot.com
  hcrmic.com
  hcrmrc.com
  hcro222.000webhostapp.com
-hcrrun-tg.org
  hcsbatee.com
  hcsbbcnbridge.com
  hcsiooqfgbhcmhvu-dot-millinium.ey.r.appspot.com
@@ -68101,6 +68251,7 @@ hebreoenlinea-chms.mx
  hebros.id
  heck-electric.com
  hecka.myddns.me
+heckproductions.com
  heclebunia.com
  hecs.com
  hecubalaspoesjdiekd.dynamic-dns.net
@@ -68145,7 +68296,6 @@ heightssuitek.buzz
  heihai.wang
  heiio.co.uk
  heike7.com
-heimaless.top
  heimkinobeamerinfo.shaxiaarchive.top
  heinesapichinfo.batwoqishopping.top
  heinrichgrp.com
@@ -68426,6 +68576,7 @@ helpgamewow.cn
  helphomewelcomeshowdown.com
  helpinfo-amazon.servebeer.com
  helpingblogger.com
+helpingcopyrightappeal.com
  helpingcoronahands.club
  helpinghands4needy.org
  helpinghandsx.xyz
@@ -68473,6 +68624,7 @@ helprecover.cf
  helprecover.log-recover.xyz
  helprenew.cloudaccess.host
  helps-accounts2020.000webhostapp.com
+helps-copyrights-business.com
  helps-ig.com
  helps-instagram-central.com
  helps-instagramteams.com
@@ -68504,7 +68656,6 @@ helpticket-tmobile.com
  helpvan.su
  helpy007.com
  helthdoctor.000webhostapp.com
-hemagen.com.br
  hemak-ing.com.hr
  hemalrathod.com
  hemballoondecorator.com
@@ -68950,6 +69101,7 @@ hiepthinhphat.com
  hiepvan.com
  hierarchic-fish.000webhostapp.com
  hierrfjtkxncqrys-dot-millinium.ey.r.appspot.com
+hierrodiseno.com
  hiervbsbgtownnygjsrdlrojks-dot-gleowayel400503.uc.r.appspot.com
  hiexdoncaster-vc.com
  hiexdoncaster-vmlisten.com
@@ -69128,6 +69280,7 @@ hiperkids.com.br
  hiperpontosmultiplus.com
  hiphopbrasil.com.br
  hiphoppods.com
+hipiaet.com
  hipolink.me
  hippbeta.000webhostapp.com
  hippiatric-nomencla.000webhostapp.com
@@ -69181,6 +69334,7 @@ hitek-pk.com
  hitekscaffolding.co.uk
  hitello.com
  hiteronak.icu
+hitman71hd-wixsite-com.filesusr.com
  hitmanisbackfuckyou.hopto.org
  hitme.ga
  hitmusic21.com
@@ -69232,7 +69386,6 @@ hjhjjkhghg.weebly.com
  hjhkgdtf.cf
  hjhuas.efk086.cn
  hjihnd.yirbag.cn
-hjkds.hq2.best
  hjkg456hfg.ru
  hjksadf3894-fjwe9rt834t423y.ahwduih-yhdw98d33.dynv6.net
  hjldmjqmjblvlsxl-dot-millinium.ey.r.appspot.com
@@ -69410,6 +69563,7 @@ hm.ref-forms09.com
  hm.refund.esc38.com
  hm.return-claims11.com
  hm.returns-claim01.com
+hm.revenue.apply.refu48.com
  hm.revenue.esc38.com
  hm.revenue.p60.regs38.com
  hm.revenue.regs42.com
@@ -69496,7 +69650,6 @@ hmrc-uk.net
  hmrc.accounts-confirm.org
  hmrc.apply-tax-rebate.uk
  hmrc.calculate-tax.uk
-hmrc.claim-myrebate.help
  hmrc.claimrebates.tax
  hmrc.club
  hmrc.com.onlinesecuremyaccount.italianamericanrelief.org
@@ -69525,7 +69678,6 @@ hmrc.gov-uktaxrebate-secure.org
  hmrc.gov-uktaxrefund.org
  hmrc.gov-uktaxreturn-secure.org
  hmrc.gov.alert-file.com
-hmrc.gov.alert-form.net
  hmrc.gov.apply-return.com
  hmrc.gov.check-details.com
  hmrc.gov.claim-updates-gb.com
@@ -69548,7 +69700,6 @@ hmrc.gov.ref-form.com
  hmrc.gov.refund-form.co.uk
  hmrc.gov.renew-info-gb.com
  hmrc.gov.require-form.net
-hmrc.gov.return-detail.net
  hmrc.gov.return-forms.com
  hmrc.gov.return-gb-claim.com
  hmrc.gov.returns-gb.com
@@ -69804,6 +69955,7 @@ hofshgfxcgdrjqwh-dot-millinium.ey.r.appspot.com
  hofti-71.gq
  hoga-consulting.de
  hogarymas.es
+hoge01.tokyo
  hoghooghonline.legal
  hogoscarstudio.com
  hogvet.com
@@ -69875,7 +70027,6 @@ holiganguncelgir.blogspot.com
  holinamet.us
  holinessinchrist.com
  holipath.com
-holistic-guerison.fr
  holistic.therapies.coachingbykarin.eu
  holisticdreams.org.np
  holisticpurpose-group.com
@@ -69935,6 +70086,7 @@ holzrueckewagen.de
  homa-co.ir
  homaaviation.ir
  homanjalitimes.com
+homano.us
  hombresvalientesposadas.com
  home-activate.com
  home-appiesecure01-auth.kozow.com
@@ -70209,6 +70361,7 @@ hormonerebalance.com
  hornbachapeldoorncom.licufashion.gdn
  hornbytheplc.com
  hornelink.cn
+hornevalhawse.com
  hornyhookup.co.in
  horobkjfio.info
  horoscope.serveirc.com
@@ -70374,7 +70527,6 @@ hotart.co.nz
  hotblowup.com
  hotbooks.tech
  hotbooks.xyz
-hotclub4u.icu
  hotcopyware.pro
  hotcup.xyz
  hotdealsaz.com
@@ -70568,12 +70720,10 @@ houses-gulf.com
  houses-realtor.xyz
  houseshieldcoating.com
  housesittingreference.com
-houseurge.guru
  housewifes.co
  houshds.com
-housing.cetinje4you.com
  housing.facebook.ccl.in
-housing.paktins.com
+housing.zelenalupa.mk
  housinstil.info
  houssjrad.ddns.net
  houston.cypshluchim.com
@@ -70832,7 +70982,8 @@ hs-ressurfprct.com
  hs-secnotify.com
  hs-secprotifes.com
  hs-secure-login.com
-hs-securehelp.com
+hs-securedinfos.com
+hs-securednotice.com
  hs-securepayrefund139.com
  hs-securinfo.com
  hs-securityhelp.com
@@ -70935,7 +71086,6 @@ hsbc.hspayee-customer.com
  hsbc.hspayee-safeguard.com
  hsbc.instruction-authenticate.co.uk
  hsbc.instruction-validate.co.uk
-hsbc.login-support.co
  hsbc.ma.gp
  hsbc.my-payee.co.uk
  hsbc.mysecurity-instruction.co.uk
@@ -70968,6 +71118,7 @@ hsbc.paymentalert-verify.com
  hsbc.paymentalertsecurity.com
  hsbc.payments-team.net
  hsbc.payments-verify.com
+hsbc.personal-customer.com
  hsbc.process-check.co.uk
  hsbc.process-payee.co.uk
  hsbc.protectverification.com
@@ -70990,6 +71141,7 @@ hsbc.secure-ref153.com
  hsbc.secure-valid.com
  hsbc.secure-validations.com
  hsbc.secureaccountalert.com
+hsbc.securelogin-paymentscheckalert.com
  hsbc.securemy-payee.co.uk
  hsbc.securepayee-restriction.uk
  hsbc.securepaymentalert.com
@@ -71009,7 +71161,6 @@ hsbc.uk.activity-checks.com
  hsbc.uk.secure-panel.com
  hsbc.uksecurekey-id2.com
  hsbc.uksecurepanel.co.uk
-hsbc.unverified-payee.com
  hsbc.verifymy-payee.com
  hsbc.verifymypayee.com
  hsbc.verifymypayee.uk
@@ -71077,7 +71228,6 @@ hsorcrihngucbxpt-dot-millinium.ey.r.appspot.com
  hsp-shuto.jp
  hspackaging.in
  hspayee.cc
-hspayment.co.uk
  hspaymentshelp.com
  hspwjsehshuqygrz-dot-millinium.ey.r.appspot.com
  hsrfjgkytvzeiddtsonwscnwqs-dot-gleowayel400503.uc.r.appspot.com
@@ -71473,6 +71623,7 @@ hutangbosku.com
  hutchinson3g.com
  hutchisonfinefurniture.com
  hutedredea.com
+hutersingt.com
  hutezhgxndhcltai-dot-millinium.ey.r.appspot.com
  hutime.kr
  hutoknepper.de
@@ -71639,7 +71790,6 @@ hybrid-brains.com
  hybrid-heel.000webhostapp.com
  hybrid-system.network
  hybrid-system.xyz
-hybrid-topping.000webhostapp.com
  hybridsbed.com
  hybridseed.co.nz
  hybwyfdimphelnpc-dot-millinium.ey.r.appspot.com
@@ -71680,6 +71830,7 @@ hyey.cn
  hyfix.ai
  hygieneeuropeorg.shaxiabuy.top
  hygienicwallcladding.com
+hyhththytyr.dt.r.appspot.com
  hyi.4b7w.cn
  hyiqkuzvei.bestservicep.su
  hyirjjufj.com
@@ -71723,6 +71874,7 @@ hypnosepourguerir.fr
  hypnosis-to-control.com
  hypnotismbamboo.com
  hypnotismcenozoic.com
+hypnotismprofile.com
  hypocellularity.xyz
  hypotactic-habits.000webhostapp.com
  hypotensive-ropes.000webhostapp.com
@@ -71734,7 +71886,6 @@ hyracoidgroup.htmlpasta.com
  hyrfs.xyz
  hyscopatrimoine.com
  hysic.co
-hysleria.top
  hyslliguloglhekg-dot-millinium.ey.r.appspot.com
  hysthrolot.com
  hysuspkohgabybje-dot-millinium.ey.r.appspot.com
@@ -71924,6 +72075,7 @@ iamcyteese.com
  iamdpfzntdtzbcbq-dot-millinium.ey.r.appspot.com
  iamhereai.me
  iamin.events
+iamkevinfay.com
  iamlipoblue.com
  iamlosingweighttoday.com
  iammyeconomy.com
@@ -72615,11 +72767,13 @@ id.wobalawaigyeolgug.com
  id023933955.xyz
  id0645050531052.000webhostapp.com
  id0720.icu
+id098234.fb-msg.com
  id1-applckdszservc.serveirc.com
  id128-sync.com
  id14.good-gid.ru
  id20091816224-listing.com
  id2minhaconta4.com
+id34908.fb-msg.com
  id4546666-listing.com
  id47aca543ac53bacs53.notification.info-dvla.com
  id52.dojnh.com
@@ -72628,15 +72782,18 @@ id55667.mixh.jp
  id6632-amazon.ludisgestion.com
  id6921.host
  id7-facebook.com
+id7834.fb-msg.com
  id7oomz.ddns.net
  id8053.com
  id837842.mixh.jp
+id89342.fb-msg.com
  id912312313.login.authorities.xtra.co.nz.coster.id
  id9283.mixh.jp
  id9384.jp
  id94761.kim
  id94761.online
  id95972.net
+id9857.fb-msg.com
  id98943txtconfirm.mobi
  ida-ug.org
  idaapmswqe.onthewifi.com
@@ -72734,7 +72891,6 @@ identify-ee.com
  identify-myee.com
  identify-payees.com
  identify-security.000webhostapp.com
-identiity--okmarks.ml
  identiity-sociiety-sec.ga
  identisea.com
  identisoft.pt
@@ -73128,6 +73284,7 @@ igfejjbnqktepxro-dot-millinium.ey.r.appspot.com
  igfmarket.com
  igfnqtspitlpoxlh-dot-millinium.ey.r.appspot.com
  igfollowerslike.hopto.org
+igforhelpsforcopyrightmedia.com
  igforyoupage.000webhostapp.com
  igfromfb.000webhostapp.com
  igg4syndrominfo.shuiadrink.top
@@ -73165,7 +73322,6 @@ ignin.weebly.com
  ignited-dev.com
  igniteinternationalschool.com
  ignitemarketingpros.com
-igniter.fobbly.net
  ignive.com
  ignoreanychanges.greetingsamazon.best
  ignovikovo.temp.swtest.ru
@@ -73258,7 +73414,6 @@ ihsan-kw.info
  ihsq4ndb7pcryep-khwzc5fno.vercel.app
  ihstjllaajrxoulw-dot-millinium.ey.r.appspot.com
  ihtaneyrcehsdsyr-dot-millinium.ey.r.appspot.com
-ihtejnorqf.web.app
  ihtgaiycketxyzsd-dot-millinium.ey.r.appspot.com
  ihtiifiruhmepcbgghlusjsctp-dot-gleowayel400503.uc.r.appspot.com
  ihvmnc.com
@@ -73486,6 +73641,7 @@ ilmnutrition.com
  ilnzqunddsfzzdpmmymiztwcrt-dot-gleowayel400503.uc.r.appspot.com
  ilo-aruba.blogspot.com
  ilobabascity.webredirect.org
+iloejuiiw.cam
  ilog-requestchecking.com
  ilog-tosecure.com
  ilogins-apple.com
@@ -73504,6 +73660,7 @@ ilovepanqueca.com.br
  ilovepony.site
  iloverohtak.com
  ilovetocomehome.com
+iloveyoubabu.ac.ug
  iloveyoubaby1.pro
  iloveyoupizdec2.info
  ilriypuv.dermals.org
@@ -73633,6 +73790,7 @@ immanuel.com.vn
  immarisaa.com
  immatriculation-cnss-services.000webhostapp.com
  immbanjarbaru.com
+immediate-cancellation.com
  immediax.com
  immediencient.com
  immenseholiday.com
@@ -73656,9 +73814,9 @@ immobilienamneckarorg.shaxiaadd.top
  immobilienamneckarorg.shuiacast.top
  immobilienfuldaorg.shuiacensus.top
  immobiliengutachtenbiz.shaxiaaccommodation.top
-immobilvallo.com
  immobrasilinfo.shaxiarecord.top
  immoenselffr.chifanbob.top
+immokwp.be
  immoplexsaguenay.com
  immowelt.at.wohnungen-mieten-1tf5j3n.xyz
  immowelt.de.wohnung-1udgs5.xyz
@@ -73727,6 +73885,7 @@ imposingchoking.ch
  impots-covid19.com
  impots-govfraccount.ddns.net
  impotsgouv20.blogspot.com
+impotsgouvfinances.sytes.net
  impotsgouvfr.info
  impotsgouvfr.tn
  impotspublicservice.com
@@ -73793,6 +73952,7 @@ imtu18.webcindario.com
  imunizadoraimbituba.com.br
  imunna.000webhostapp.com
  imurprint.com
+imusica.in
  imvalles.com
  imvegas.ddns.net
  imvndlbcegjcigqg-dot-millinium.ey.r.appspot.com
@@ -73971,6 +74131,7 @@ indhrigroup.com
  india-manufacturer.com
  indiabuletin.com
  indiainsta01.000webhostapp.com
+indialossiu.com
  indian-escorts-qatar.com
  indian-escorts-rak.com
  indian-first.pl
@@ -74015,6 +74176,7 @@ indirimpazarim.com
  indiscussible.info
  indivisibleheart.com
  indkoko.xyz
+indmarkformtech.com
  indo-heavy.com
  indo-iranian-hierar.000webhostapp.com
  indobkp-18.xxuz.com
@@ -74094,6 +74256,7 @@ inexpensivepets.com
  inf-recoversecsigninid.bentelucilata.com
  inf-reinformation.net
  inf0-sc0t1a83i.com
+infalobiko.xyz
  infamousstrike.com
  infantbaptism.net
  infantjesushighschool.com
@@ -74321,7 +74484,6 @@ infomessaging11.org
  infompp-mobile-id048507.cf
  infomy-3.com
  infomy-3billingsupport.com
-infomy01.my.id
  infomy3.com
  infoneedstobeupdate.theamazonnewer.xyz
  infonetworjismung.club
@@ -74606,6 +74768,7 @@ ininedmarp.com
  ininox.com
  inisiarsesion.000webhostapp.com
  inism.net
+inismor.com
  inistagram.tk
  initial-lash.000webhostapp.com
  initiallogin.southernstrustonline.com
@@ -74654,6 +74817,7 @@ inloggen.internetomgeving.mijn.lng.nl.veiligheidsomgeving.info
  inlogsoftware.com
  inmarsat.com.kz
  inmarsat.servehalflife.com
+inmastersq.com
  inmayjose.es
  inmeayjnmcevchjqkdupackwrr-dot-gleowayel400503.uc.r.appspot.com
  inmed.vn
@@ -74731,7 +74895,6 @@ inodeyplsafe.higlobal-safe.com
  inodpudayewauzhg-dot-millinium.ey.r.appspot.com
  inomoto.vn
  inopportuneness.xyz
-inostrannie-diplomy77.ru
  inoutapps.com
  inovamaxx.com.br
  inovatplus.com
@@ -75052,7 +75215,6 @@ instagram-user.0fees.us
  instagram-verif-2020.cf
  instagram-verificado-insignia.tk
  instagram-verification-badge.com
-instagram-verification-badge.gearhostpreview.com
  instagram-verification-com.ga
  instagram-verified-badge-form.naip.net
  instagram-verified-badges.com
@@ -75123,7 +75285,6 @@ instagram.holl5.com
  instagram.hop.ru
  instagram.incorporation.cf
  instagram.likes.com
-instagram.livemediateam.com
  instagram.lizo.ir
  instagram.luvpm.in
  instagram.mediahelpcenter.com
@@ -75284,7 +75445,6 @@ instagramnhaber.0fees.us
  instagramnotice-security.com
  instagramoffice-help.com
  instagramoffice-support.com
-instagramofficial.netlify.app
  instagramofficialverfy.com
  instagramofhelps.com
  instagramofsupport.com
@@ -75480,6 +75640,7 @@ instasam.000webhostapp.com
  instasaugat.000webhostapp.com
  instascram.000webhostapp.com
  instasecuritylgn.000webhostapp.com
+instasecuritysystemserver.000webhostapp.com
  instasex.space
  instasikayet.com
  instaspecials.com
@@ -75774,6 +75935,7 @@ internetodds.co.cc
  internetorange-messageriefixe.web.app
  internetservicetech.com
  internetsoko.com
+internetwolf.de
  internetyellowpages.buzz
  internode.on.net.webmailmailchkl.bar
  interoceanica.com.bo
@@ -75995,7 +76157,6 @@ invite-group-bokep-viral.000webhostapp.com
  invite-group-whatsapp-free-porn-vidio-2020.2waky.com
  invite-group-whatsapp-porn-2020.wikaba.com
  invite-group-whatsapp-porn-indo-2020.2waky.com
-invite-groupsesx-whatsapp-groupsesx71.2waky.com
  invite-grub-whatsappsex-chat.2waky.com
  invite-grubwa18.wikaba.com
  invite-grupvidhot2020.000webhostapp.com
@@ -76014,7 +76175,6 @@ invitegrup2020hit.000webhostapp.com
  invitegruphijab2020.000webhostapp.com
  invitestore.co
  invitewhatsapp-grupdewasa.xxicv.gq
-invitewhatsapp-mabarbudi01.my.id
  invodi12.com
  invoic3-order872946.serveirc.com
  invoice.ae
@@ -76441,6 +76601,7 @@ ironmpcom.nckiconsulting.gdn
  ironn.000webhostapp.com
  ironrods.world
  irontwistings.ml
+iroom.com.ua
  iroquoislawnbowlingclub.ca
  iround-cube.web.app
  irox.biz
@@ -76680,6 +76841,7 @@ isthisadvertising.com
  istif.org
  istitutobpascalweb.it
  istlrtevcnbsxrtx-dot-millinium.ey.r.appspot.com
+istno.link
  istockcapital.com
  istop-requests.com
  istore.cheap
@@ -76740,6 +76902,7 @@ ita-covid19.com
  ita-pontos-combr.ezpz.work
  ita.acessoatualizadobr.com
  ita30horas.net
+ita30horasdigital.myvnc.com
  itaauaumentodelimite-com-br.umbler.net
  itaaucartoes24horasatuali-com-br.preview-domain.com
  itabrics.com
@@ -76981,6 +77144,7 @@ iteeman.com
  itekcom.pe
  itekscompany.com
  itelagen.com
+itelbpo.in
  itelefon.org
  itelemed.ca
  itelligent.nl
@@ -77224,6 +77388,7 @@ ivafpuearkkckgfi-dot-millinium.ey.r.appspot.com
  ivaighxtqybkiefrshueiriplj-dot-gleowayel400503.uc.r.appspot.com
  ivangencheff.com.au
  ivanlef0u.fr
+ivanlins.com.br
  ivanmartinez.es
  ivanmocko.sk
  ivannestrada.top
@@ -77661,7 +77826,6 @@ jaman.shop
  jamaylibertad.com
  jambanswers.org
  jambeymnqjbeyykhvu.top
-jambhui.work
  jambongrup.com
  jamboster.ug
  jamconsulting.com.au
@@ -77834,6 +77998,7 @@ jasaweb.biz
  jasawebsite.online
  jasbilofritid.se
  jascondienterprisesltd.com
+jasd332.dyndns.dk
  jaserie-cajamares.com
  jaservicioscontables.casteviajes.com
  jasilte.com
@@ -77870,6 +78035,7 @@ jatakavedhan.com
  jatkit.gq
  jatland.000webhostapp.com
  jatoapp.com
+jats3.cf
  jattoba.com
  jaucpeozodvmpbmw-dot-millinium.ey.r.appspot.com
  jaudhus.work
@@ -77930,6 +78096,7 @@ jayogroup.com.cn
  jayp.eu
  jaypapi.000webhostapp.com
  jaypapiworksndphoes.site
+jaypeeinfratechar.in
  jayracing.com
  jayrolzcashout.000webhostapp.com
  jaysawant.xyz
@@ -77948,6 +78115,7 @@ jazzcommunications.info
  jazzitup.pl
  jazzpackages.pk
  jazztechnical.asia
+jazzymaid.com
  jb-62.svcoding.com
  jb-qroups.com
  jb0k.hamhonar.com
@@ -78092,7 +78260,6 @@ jdkolledj.kz
  jdkr.shoesmogul.com
  jdkzxgmapjbxtdfa-dot-millinium.ey.r.appspot.com
  jdnwnsdhejuuxcdj-dot-millinium.ey.r.appspot.com
-jdordsk.weebly.com
  jdoucettermt.ca
  jdpmuyxe.goruli.com
  jdpwwyifikkgwlmzqxgtjukxztyjnbekusdm-dot-glenxpecial3009493.ey.r.appspot.com
@@ -78139,6 +78306,7 @@ jeep4ever.free.fr
  jeepgirlz.com
  jeetmehtabalshala.org
  jeetojackpot2020.000webhostapp.com
+jeeyash.casa
  jeff1121.com
  jeff3.my03.com
  jeffandmiquell.com
@@ -78449,7 +78617,6 @@ jhomiorganiccotton.com
  jhoxx.com.br
  jhpipaa.com
  jhrzcvgpljgxszdu-dot-millinium.ey.r.appspot.com
-jhsahjwk.weebly.com
  jhsenterprisesonline.com
  jhsstudio.com.br
  jhtilhgtnocebbpd-dot-millinium.ey.r.appspot.com
@@ -78534,6 +78701,7 @@ jijidncxfpivxvch-dot-millinium.ey.r.appspot.com
  jijimn.com
  jijineptunium.com
  jikiloltwqygsnll-dot-millinium.ey.r.appspot.com
+jikko.jp
  jikonmusic.com
  jiktwmeiknjpipvkavrzaycrch-dot-gleowayel400503.uc.r.appspot.com
  jillboor.com
@@ -78605,7 +78773,6 @@ jiradiagnostics.com
  jirafeu.meerai.eu
  jiraiya.info
  jirehaccesorios1.com
-jirehaccesorioskids.com
  jiremenad.blogspot.com
  jirginsama.000webhostapp.com
  jirihavelka.eu
@@ -78961,7 +79128,6 @@ jobcapper.com
  jobcareer.me
  jobcenterkenya.com
  jobconnect.ddns.net
-jobdare.guru
  jobdiesel.com.br
  jobduties.org
  jobecofood.com
@@ -79092,6 +79258,7 @@ johnsulston-edu.uk
  johntillerygolf.com
  johr.page.link
  joicemiller.com
+joielashes.com
  joigrupbokep2020asiansex.000webhostapp.com
  joiiin-whatssap.asli20.com
  joiiinwhattaapp-dewasaa18.sexy80.com
@@ -79111,6 +79278,7 @@ join--grupwa18--2020.000webhostapp.com
  join-18-grup-whatsap.sexy5.gq
  join-2020.000webhostapp.com
  join-400-wabokep.get15.ru
+join-appiwhatsapp.gr-frontal.ga
  join-b0kpindo2020.tk
  join-bokep-terbaru000.000webhostapp.com
  join-chat-gropwhatsapp-sex12-invite.2waky.com
@@ -79615,7 +79783,6 @@ joingrubdewasanobocilandbicah.000webhostapp.com
  joingrubenaena.000webhostapp.com
  joingrubkokeb-hot.000webhostapp.com
  joingrubngentoteoe.vip5x.com
-joingrubokep.dumb4.my.id
  joingrubshot.hol21.design
  joingrubterbarudewasa.000webhostapp.com
  joingrubwa00.zyns.com
@@ -79676,6 +79843,7 @@ joingrupbkp.bokep-ind.com
  joingrupbkp.wa-chats69.tk
  joingrupbkp18.2waky.com
  joingrupbkpindohotnewz.claimz6.com
+joingrupbkpremajahits.claimfree-mobile12.tk
  joingrupbkpviralind.000webhostapp.com
  joingrupbok3pwa.viyyy.my.id
  joingrupbokeepwhatsapp.whatsap77.tk
@@ -79736,6 +79904,7 @@ joingrupdewasa999.000webhostapp.com
  joingrupdewasadijamincrot18.000webhostapp.com
  joingrupdewasaviralterbaru.000webhostapp.com
  joingrupenak20.000webhostapp.com
+joingrupgrupwwfrontal.freefire-mobile.ml
  joingruphotyangbikinseger.000webhostapp.com
  joingrupinvitebokepwa.000webhostapp.com
  joingrupkami.cordz2.tk
@@ -79851,7 +80020,6 @@ joingrupwhatsappbokep.xvipz8.com
  joingrupwhatsappbokep2020.vvipz3.tk
  joingrupwhatsappbokep2020.wagroupx.com
  joingrupwhatsappbokepterbaru.vvipzz3.com
-joingrupwhatsappdewasahot.dumb1.my.id
  joingrupwhatsappdisini.onedumb.com
  joingrupwhatsappnew.porn-group.com
  joingrupwhatsappp18.hot6.gq
@@ -79909,7 +80077,6 @@ joinsekarang.getsviip7.com
  joinsekarangdigrubwa2020.000webhostapp.com
  joinsex.wa19.net
  joinsexxx.wa-hotnew.ga
-joinsgroups.000webhostapp.com
  joinsgrup.ml
  joinsgrupbokepnewgroupwhatsapp.newsx4.com
  joinss-whatsappp.wikaba.com
@@ -79924,7 +80091,6 @@ jointhegoodcampaign.com
  jointmentron.xyz
  jointogroupswa.000webhostapp.com
  jointsquarelimited.com
-jointured-escape.000webhostapp.com
  jointwork19555.000webhostapp.com
  joinusforfreefire.000webhostapp.com
  joinviralbokepcrot.wa-21.com
@@ -80338,7 +80504,6 @@ jpamazon.top
  jpamazoncompany.icu
  jpamazoncompany.xyz
  jpamazonn.com
-jpamzne.com
  jpasportsmedia.com
  jpauresbptqiaqty-dot-millinium.ey.r.appspot.com
  jpawamazon.com
@@ -80358,6 +80523,7 @@ jpjimmychooshops.com
  jpkohler.com
  jplvwbperdusenomdmvgdotrewhcbxugzyor.xyz
  jplymell.com
+jpm0rgan-chasewebsup01.ml
  jpmaepesboxirwhc-dot-millinium.ey.r.appspot.com
  jpmdvlzxkgvcbujw-dot-millinium.ey.r.appspot.com
  jpmkkvmnqtyacgunlkjezwiugr-dot-gleowayel400503.uc.r.appspot.com
@@ -80639,6 +80805,7 @@ jrizbieffqeoscac-dot-millinium.ey.r.appspot.com
  jrkcepzxqprwmqjn-dot-millinium.ey.r.appspot.com
  jrmfeemokpkb.in
  jrmimtstkqigwvkwvittrrpwkn-dot-gloff849483.uk.r.appspot.com
+jrmlocks.ir
  jroiauycgdihnuvhakabrvmzvzbqyayqfbbz-dot-glegen303939423233.ue.r.appspot.com
  jrpb.awaykart.com
  jrpizvpnkkosjkqh-dot-millinium.ey.r.appspot.com
@@ -80804,6 +80971,7 @@ juanamaria15.000webhostapp.com
  juanitacarrasco.com
  juanjorcom.shaxiabeauty.top
  juanmanuelnavia.com
+juanthradio.com
  juantrejoo.com
  jubilant-beach.cloudvent.net
  jubilantenterprise.com
@@ -80911,6 +81079,7 @@ jumpo2.com
  junakart.com
  junctionsapt.buzz
  junctionsgt.buzz
+jundiaimoveisplanejados.com.br
  june2020.xyz
  june34-nill.xyz
  juneauopioidworkgroup.org
@@ -81631,6 +81800,7 @@ kanvex.pl
  kanwaldesigners.com
  kanyebtc.org
  kanyewest-shoes.com
+kanzlei-hermes.com
  kao.at
  kao3131.info
  kaoliao.ac.th
@@ -81879,6 +82049,7 @@ katypiaphotography.com
  katyremodelingpros.com
  katzenaugecom.shuiabid.top
  kauf4.de
+kaufenperueberweisung.xyz
  kaufenpervorkasse.xyz
  kauffischcom.nckiaccounting.gdn
  kauffischcom.nckiphoto.gdn
@@ -82127,6 +82298,7 @@ kedgicksword.com
  kedi-russian.ru
  kedkekk.co.cc
  keeblerplain.buzz
+keen-sight-280309.appspot.com
  keen-sight-280309.nw.r.appspot.com
  keenan53124698.xyz
  keenenh.xyz
@@ -82387,6 +82559,7 @@ kevinley.com
  kevinseeger.org
  kevonspeuase.com
  kevsun.org
+kevwilmusic.com
  kewagamangdentalclinic.co.bw
  kewcorp.ca
  kex4.svcoding.com
@@ -82672,6 +82845,7 @@ kialovuigene.com
  kianafrooz.com
  kiancar.lh.pl
  kiandoors.com
+kiaopfg.org
  kiapfg.com
  kiaqms.shoesmogul.com
  kiaraindia.in
@@ -82704,6 +82878,7 @@ kidkvenbo.com
  kidms.com
  kidnapfun.cyou
  kidnapomar.net
+kidnesydsiess.us
  kidneycentre.com
  kidneycurves.com
  kido-kr.pw
@@ -82909,6 +83084,7 @@ kinpiraxyz.wvftqkfe.xyz
  kinpo.info
  kinseymt.buzz
  kinseymte.buzz
+kinstationery.com
  kintenta-shop.top
  kintore-daietto.com
  kintyrend.buzz
@@ -83172,7 +83348,6 @@ klein-stephan.de
  kleinanzeigen-kostenlos-einfach-lokal.de
  kleinanzeigen-kostenlos-einfach.de
  kleinanzeigen-top.xf.cz
-kleinanzeigen890-001-site1.etempurl.com
  kleinanzeigens-001-site15.ctempurl.com
  kleincorners.buzz
  kleinendeli.co.za
@@ -83269,6 +83444,7 @@ km2cd.addroits.com
  km374nsj283cvteqw22.onb38372hsbje122xss.dynv6.net
  km4o0.codesandbox.io
  kmaberlin.net
+kmakeit.com
  kmananeng.com
  kmaritusc.com
  kmbbnfhrrrupijtu-dot-millinium.ey.r.appspot.com
@@ -83364,6 +83540,7 @@ knifew.ml
  knifez-win.xyz
  knigamart38.ru
  knightfinances.info
+knightjd.work
  knightlycomputing.com
  knightsbridgeenergy.com.ng
  knightshadows.com
@@ -83677,7 +83854,6 @@ koohsportsfoundation.com
  koolahivqruibesk-dot-millinium.ey.r.appspot.com
  koolergazishop.ir
  koolpiquillov.com
-kooperatiba.ph
  kooperativa-studio.rs
  koopjesvanbea.be
  koopon.ae
@@ -83791,6 +83967,7 @@ koulaesse.com
  kourousakki.com
  kourssuyld.topkorder.su
  kourtoglou.com
+kouzina.ca
  kovimall.com
  kovkaplitka.ru
  kovolem.cz
@@ -84030,6 +84207,7 @@ krunchies.xyz
  krungsri.online.com.songkrong.info
  krupalenterprise.com
  krusebilcenter.se
+krushisardar.com
  krutiznaspb.ru
  krvqmsspumelbqgc-dot-millinium.ey.r.appspot.com
  krwotoki.org
@@ -84126,7 +84304,6 @@ kto-kruche.fun
  ktoler.000webhostapp.com
  ktoooo.com
  ktovdmgbjyvvkxugyxffxswpnoxyoewwlzqo-dot-gl494903049.wl.r.appspot.com
-ktpdx.net
  ktpn.kalisz.pl
  ktqz.evokefootwears.co
  ktreiztixjbclyoesidzaxuusa-dot-gleowayel400503.uc.r.appspot.com
@@ -84185,6 +84362,7 @@ kuhncoppersolutions.com
  kuhnya.novo.uz
  kuhoqrmhgpepkhpk-dot-millinium.ey.r.appspot.com
  kuiagame.com
+kuisionerlmj.000webhostapp.com
  kuizhai.com
  kukafreska.com.br
  kukgjgaisvnifmit-dot-millinium.ey.r.appspot.com
@@ -84753,6 +84931,7 @@ lagucover.xyz
  lagunational.com
  lahoremutablet.com
  lahorepropertygroup.com
+lahoreviphotels.com
  lahta-centr.ru
  lahwhniajwfvlhsr-dot-millinium.ey.r.appspot.com
  laiagency.co.tz
@@ -84803,7 +84982,6 @@ lakstech.com.br
  laktevit.ru
  lakunat.ru
  lakutenla.xyz
-laladiwanchandmodernwrestlingandyogacentre.com
  lalalt-71.gq
  lalalukc-71.cf
  laleal.com
@@ -84842,7 +85020,6 @@ lamdepbeauty.com
  lamdepuytinsaigon.com
  lamedipedia.es
  lamefrp.xyz
-lameguard.ru
  lamellose-perfect.000webhostapp.com
  lament.ee
  lamentation-ink.ga
@@ -84964,6 +85141,7 @@ laovoanew.com
  laoyebh.com
  lap-mang-vnpt.com
  lapacodec.com
+lapage-d-authentification.webador.com
  lapakmanis.com
  lapapeteria.at
  laparoenterotomy.xyz
@@ -85085,6 +85263,7 @@ lasermodel.shop
  laserscanner3dde.shaxiaadd.top
  lasertec-mi.com
  laserworksatl.com
+laserworldwideltd.com
  laserworx.nl
  lashdbutnotleast.com
  lashelleboutique.com
@@ -85098,8 +85277,10 @@ laskins.xyz
  laskonsult.se
  lasmdirs.online
  lasnetwork.net
+lasofoaf.ml
  lasolutionfinance.fr.gd
  lasorgentecentroestetico.it
+laspanofashion.com
  lassahnnet.batwoqisellers.top
  lassiinfo.chifanbob.top
  lassiinfo.shaxiabuy.top
@@ -85186,6 +85367,7 @@ laura434gleich.000webhostapp.com
  laura43grappini.000webhostapp.com
  laura92.xyz
  lauraburkowsky.ca
+lauradebiasio.com
  lauraehall.com
  laurajayedesigns.com
  laurasmusic.ro
@@ -85230,8 +85412,8 @@ laveyfleet.club
  laviago.com
  lavicorpgroup.com
  lavidagroups.com
+lavidasegundanny.com
  lavienailscorp.com
-lavienouvelle.org
  laviosaviaggi.com
  lavirjoias.com
  lavishboys.com
@@ -85425,6 +85607,7 @@ lddoklnpflfpdjpg-dot-millinium.ey.r.appspot.com
  lderinmejusna.tk
  ldfl.goruli.com
  ldfsgc.com
+ldgcorp.com
  ldibxfvwtrybedrfaqisqjbbae-dot-gleowayel400503.uc.r.appspot.com
  ldireproprintingllc.for-more.biz
  ldjbsgcqmaqnfoyg-dot-millinium.ey.r.appspot.com
@@ -85671,7 +85854,6 @@ lefeter.evalubuyz.com
  lefim.eu
  lefktthdnhhx.info
  leftbavel.com
-leftline.guru
  leftofcentre.net.au
  lefumetdesdombes.com
  leg.fuacheng.cn
@@ -85759,7 +85941,6 @@ lekangwuye.com
  lekangwuye.com.cn
  lekhankunja.com
  lekkeropdemet.be
-lektorat-rauthe.de
  lelangg.online
  lelecars.it
  leleshwa.com
@@ -86160,6 +86341,7 @@ li.destina1.net
  li.destina1sms.com
  li.farm2salad.com
  li.giggsfreak.com
+li.globalfds.org
  li.humanbiomics-project.org
  li.jimlarsh.com
  li.pawsupsocal.com
@@ -86268,8 +86450,6 @@ lieferungexpressch.com
  liekidfqioktsdzv-dot-millinium.ey.r.appspot.com
  liencs.fr
  lienit.000webhostapp.com
-lienket-facebook-garena.3utilities.com
-lienket-facebook.3utilities.com
  lienteerport.live
  lieoo.ml
  liermadoni.temp.swtest.ru
@@ -86413,12 +86593,14 @@ likebetting.com
  likecoin.site
  likedinset.zzux.com
  likedinxet.onedumb.com
+likeland.net
  likeme.pt
  likemypost000.000webhostapp.com
  likemypostinsta.000webhostapp.com
  likendln.com
  likenow.tv
  likepage.site
+likepoint.000webhostapp.com
  likepost007instagra0m.000webhostapp.com
  liker-pro.000webhostapp.com
  liker.website
@@ -86463,6 +86645,7 @@ lillys.nl
  lillywyatt.host.brouser.net
  lilmocc.com
  lilpilito.cf
+lilplay.com
  lilycharme.com
  lilychidet.com
  lilyholidaytour.com
@@ -86538,7 +86721,6 @@ limited-account-services.com
  limited-accounts-verification.com.exlcart.in
  limited-authflow.com
  limited-binary.com
-limited-confirm.demandocracteskuy.com
  limited-device.stylestonesdfg.org
  limited-ee.com
  limited-help.com
@@ -86634,10 +86816,12 @@ line.monalisapizzeriasi.com
  line.starlightgroupllc.com
  line.stopcollectionharassment.com
  line.supportubr.online
+line.tdrcoastalhomes.com
  line.tecsupportubr.site
  line02bankofamerika.myvnc.com
  linea1s.com
  lineaenvirtual.com
+lineahandy.it
  lineapon.xyz
  lineaserramenti.it
  lineconty.cool
@@ -86686,6 +86870,7 @@ link-whatsaap-terbaru-2020.000webhostapp.com
  link.do
  link.gmreg5.net
  link.goverifyme.net
+link.hybridcorehomescc.com
  link.icloudcowboy.com
  link.kunstsignal.com
  link.panibaba.com
@@ -87043,6 +87228,7 @@ livepind.com
  livepowerfully.io
  liveriedgreyseal.htmlpasta.com
  liverings.xyz
+livermdlikenewws.us
  liverpool-mx.site
  liversaleven.xyz
  liveskim.xyz
@@ -87076,6 +87262,7 @@ livingstonbank.com
  livingstonphotographer.com
  livingstontn.buzz
  livingswimming.com
+livingwagenyc.org
  livingwateraromatherapy.com
  livingwellfm.com
  livingwest.eu
@@ -87248,6 +87435,7 @@ lloyds-help.com
  lloyds-online.com
  lloyds-verification.com
  lloyds.account.update.secure.newaccount.saynotorobotgb.xyz
+lloyds.bank-confirm.com
  lloyds.bank.confirm-accounts.com
  lloyds.bank.new-request.com
  lloyds.bank.update-application.com
@@ -87256,14 +87444,15 @@ lloyds.bank.verify-request.com
  lloyds.business.online.gb.verifyff.newtownremembers.co.uk
  lloyds.de-registerdevices.com
  lloyds.deregister-new-device.com
+lloyds.deregister-newchanges.com
  lloyds.device-deregistration.com
  lloyds.fix-mypayee.com
  lloyds.management-payee.com
  lloyds.newdevice-deregister.com
+lloyds.newdevice-deregistrations.com
  lloyds.online-deregister.com
  lloyds.payeemanagement.com
  lloyds.payeemanagement.uk
-lloyds.payments-review.com
  lloyds.safemy-payee.uk
  lloyds.securelogin-paymentsalerts.com
  lloyds.settle-mypayee.uk
@@ -87651,7 +87840,6 @@ lnterac7-refund3.com
  lnterbank.pe-ib.com
  lnternetbanklng-mobilecaixadigital.com
  lnterservice-si.com
-lntesa-psd2-aggiorna.lntesa-aggiorna-psd2.xyz
  lntesasanpaolo-aggiornare.com
  lntesasp-web.eu.org
  lntrac0001.com
@@ -87721,7 +87909,6 @@ lobose-education.000webhostapp.com
  lobstitraima.tk
  lobvdr.tk
  loc5-lacaixa.es
-loc8me.owlight.co.uk
  locadex.kz
  locafacile.fr
  locagroup.club
@@ -87767,6 +87954,9 @@ localizacao-buscar.com
  localizershub.com
  locallbitcoins.com3-login-wefevj9gf43irk43fw.xyz
  locallyeshop.com
+localmobile-------17667199.esthepharm.ba
+localmobile-------33471084.esthepharm.ba
+localmobile-------46696722.esthepharm.ba
  localnet.srv.br
  localobitcoin.com
  localpublicidad.com
@@ -87877,6 +88067,7 @@ log-way2301416-redirect-the-step.duckdns.org
  log.angelicabrown.com
  log.dogepay.info
  log.kl.com.ua
+log.newhybridhome.com
  log.rstempler.com
  log.widgetstat.net
  log1992.com
@@ -87989,6 +88180,7 @@ login-icloud.com
  login-icloud.find-ios.live
  login-icloud.tools
  login-icloudsvappld.serveirc.com
+login-id-ee.com
  login-id-verification.lkindi39.xyz
  login-impots-gouv-fr.info
  login-information-servt3.com
@@ -88158,7 +88350,6 @@ login.appleld-apple.page.kambeng1.com
  login.asb.customr-center.co.nz.nz-0lll0data.ml
  login.asb0nline-profile.co.nz.srt-01.tk
  login.asbonline.customr-center.co.nz.nzll0-0nl1ne.ml
-login.aytx.uk
  login.bancodobrasil.icu
  login.blcokchain.biz
  login.blcokchaln.biz
@@ -88216,6 +88407,7 @@ login.live.com.medbp.com
  login.live.com.moseswong.com
  login.live.com.mvc.rev365.shn2.myshn.eu
  login.live.com.office.cgict.comguard.myshn.net
+login.live.com.office.flagstarbancorp.myshn.net
  login.live.com.office.honeywell.myshn.net
  login.live.com.office.o365revproxy.nuvancepocformvc.myshn.net
  login.live.com.office.prod.abbvie.myshn.net
@@ -88423,7 +88615,6 @@ loginblxxslingfbvfgh600ohjm.cf
  loginblxxslingfbvfgh600ohjm.ga
  loginboa.net
  loginbolasbobet.io
-logincliente.tk
  loginclientebb.com
  logincurenthlypass.weebly.com
  logincurentlyattmail.weebly.com
@@ -88432,6 +88623,7 @@ logincurrentlyattdomainnetwork.weebly.com
  logincurrentlyattdomainwebsite.weebly.com
  logincurrentlyattmails.weebly.com
  logincustomerpageamazonauthenticationbilling.kozow.com
+logindevice-unknown.cc
  logindisek.tk
  logindomainserver.xyz
  logineasyverification.info
@@ -88547,6 +88739,7 @@ lognserpplap.molinasmusichouse.com
  lognweb.laxmiexport.cf
  logobossdenver.netlify.app
  logobossdragon.netlify.app
+logomine.co
  logomunch.com
  logon-appid.comaccvobillverification.com
  logon-wellsfargo.com
@@ -88768,8 +88961,6 @@ lookup.in.net
  loolmarathon207.com
  loooijtrcmxrccbt-dot-millinium.ey.r.appspot.com
  loopagcom.nckifrance.gdn
-looppair.guru
-looppie.guru
  loopsol.com
  loopsuite.buzz
  looptraffic.com.au
@@ -88796,6 +88987,7 @@ lopdent.club
  lopdjbn.com
  lopeidkd.com
  lopez-painters.com
+lopisia.com
  lopkyt.brucebil.repl.co
  loplopuseres.blogspot.com
  lopperment.com
@@ -88873,7 +89065,6 @@ lottoland-indiaa.com
  lottoland-indian.com
  lottothai99.com
  lotulife.com
-lotus.wb5.com.br
  lotushairandbeauty.com
  lotusinglighters.com
  lotusorganics.store
@@ -89145,6 +89336,7 @@ lt-pet.com
  lt-whatsapp.crotsz.com
  lt.bitcoinsystem-appl.t500track8.com
  lt.kayamalimusavirlik.com
+lt02.datacomspecialists.net
  lt0crtnr93syer.dt.r.appspot.com
  lt4u24horas.ddns.net
  ltabjttytgmuqigf-dot-millinium.ey.r.appspot.com
@@ -89214,6 +89406,7 @@ ltoygealgdwgilpg-dot-millinium.ey.r.appspot.com
  ltoyqrdgbkfioikb-dot-millinium.ey.r.appspot.com
  ltpyivjgvkwbkfgqgvgejunbkp-dot-gleowayel400503.uc.r.appspot.com
  ltrgrf.cn
+ltrybus.com
  ltrzgogrzsit.com
  lts9m4hyer.firebaseapp.com
  ltseo.se
@@ -89237,6 +89430,7 @@ luatminhthuan.com
  luatsusaigon.info
  lubancx.ug
  lubangx.25u.com
+lubermo.com
  lubetkinmediacompanies.com
  lubmail04com.shaxiarequest.top
  lubmail07de.nckifitness.gdn
@@ -89771,6 +89965,8 @@ m-giffgaff.link
  m-giffgaff.network
  m-groupusa.com
  m-gs.at
+m-i-jn-l-gservices.xyz
+m-ijn-l-gservices.xyz
  m-in.cn
  m-instagramfromcopyright.com
  m-instagramsupport.com
@@ -89778,6 +89974,7 @@ m-kleinanzeigen.de.s-anzeige.com
  m-kleinanzeigen.de.s-anzeige1.com
  m-ltaubancmobile.com
  m-ltaulinedigital.com
+m-ltauresgateseuspontos.com
  m-magaluemcasa.com
  m-magaluofertas.com
  m-manutencaoonline.com
@@ -89785,7 +89982,6 @@ m-n0x.jaysbrand.com
  m-o-f-365.oa.r.appspot.com
  m-oguzov.ru
  m-paypal-login.com
-m-pcp2020.apps-ph.com
  m-pe.com
  m-personaliite30hrs.com
  m-prezadoclienteltau.com
@@ -89887,7 +90083,6 @@ m.facebok-market-place-item-6476251.pararaiovfx.com
  m.facebok-market-place-item-744211.orionphillips.com
  m.facebok-marketplace-item-512422.remindway.com
  m.facebook-acc.verify-sistem.app
-m.facebook-market-item-7523412.rosesjewelrybox.com
  m.facebook-market-place-item-15122.myflexapp.com
  m.facebook-market-place-item-63123.ob-gyn.com
  m.facebook-market-place-item-63179.codendo.com
@@ -90126,6 +90321,7 @@ m.hf618.com
  m.hf652.com
  m.hf692.com
  m.hf695.com
+m.hf705.com
  m.hf706.com
  m.hf735.com
  m.hf739.com
@@ -90341,6 +90537,7 @@ m93701t2.beget.tech
  m95x.jaysbrand.com
  m9b5.mentriqq.com
  m9bk.com
+m9c.net
  m9e4.com
  m9np.svcoding.com
  m9q0.svcoding.com
@@ -90481,6 +90678,7 @@ madaratnews.com
  madaresbartar.com
  madarhd.co
  madbk.com
+maddogtowing.icu
  maddoridas.com
  maddykart.com
  made-in-china1.000webhostapp.com
@@ -90668,6 +90866,7 @@ magazine-loja12.com
  magazine-loja34.com
  magazine-loja4.com
  magazine-luizaloja988.com
+magazine-magalu.ibx.lat
  magazine-mega-saldo.000webhostapp.com
  magazine-novidades2020.com
  magazine-ofertas-2020.com
@@ -90950,6 +91149,7 @@ mail-nepalgovnp.zapto.org
  mail-pay-pal-communication.com
  mail-santafe-gov-ar.000webhostapp.com
  mail-secure-office.nw.r.appspot.com
+mail-secure.me
  mail-serverautoconfirmation.klm2693.alertsapple.com
  mail-services-appid-2374562.symphonykauharus.com
  mail-services-appid-server82384.kappeiurnero.com
@@ -90961,7 +91161,6 @@ mail-updatedamazon.serveirc.com
  mail-upgrade-services.000webhostapp.com
  mail-us.stago.com
  mail.0verchargereturn20.info
-mail.168vitheyrealestate.com
  mail.2020-coronavirus.ru
  mail.263gmail.net.cn
  mail.4privacy.nl
@@ -91105,9 +91304,11 @@ mail.faccbbook.com
  mail.facebookssecurity.com
  mail.faceboook-security.com
  mail.facebu0k.cf
+mail.facematt.ml
  mail.faciliusincinstagram-business-services.com
  mail.faixavermelha.com.br
  mail.faroc.cl
+mail.fastland.tk
  mail.fb-copyright-delete-pages.xyz
  mail.fb23674-page76219-real-estate-item52659.house
  mail.fb29674-page47659-real-estate-item75642.house
@@ -91299,6 +91500,7 @@ mail.paypal-updateverif.giize.com
  mail.paypal.jav22.org
  mail.paypal007.serveirc.com
  mail.paypalid.co
+mail.paypallogin.net
  mail.paypalsecures.gleeze.com
  mail.paypaprocessed.info
  mail.pending-paypal.com
@@ -91488,7 +91690,6 @@ mail.yoncalla.net
  mail.yotaglobal.com
  mail.youtubevideo.club
  mail.zanderkutcher.com
-mail.zanello.adv.br
  mail001.hiuasyolaperakende.com
  mail00182.xyz
  mail002.hiuasyolaperakende.net
@@ -91565,6 +91766,7 @@ mailattme.weebly.com
  mailattservice.weebly.com
  mailbandhan.com
  mailbibi.verifyaccount.againalertsverfying.com
+mailbox-update-portal23615.uc.r.appspot.com
  mailbox-web.servebeer.com
  mailbox.gmail.google.mikov.bg
  mailbox31update.xxuz.com
@@ -91584,6 +91786,7 @@ mailered.hopto.org
  mailerpremium.com
  mailerserve.xyz
  mailfast.co.uk
+mailgate.performers.lu
  mailgoi001.applestore-id-apple.com
  mailgrupobancolombia.online
  mailguard.ie
@@ -91624,6 +91827,7 @@ mailowl.jkub.com
  mailpageupgrade.weebly.com
  mailpgradelog.ddns.net
  mailprivacy.duckdns.org
+mailrange.cyou
  mailred.site
  mailru.aiq.ru
  mailru.vipshop.ru
@@ -91899,6 +92103,7 @@ malesherbiaceous.xyz
  malevolent-ornament.000webhostapp.com
  malexandersports.com
  mali7.eu
+maliaep.servepics.com
  malibmgddteblbleofnhxncolvhjsyefbhhb-dot-glxcel49934343434.rj.r.appspot.com
  malihope.com
  malimoncton.ml
@@ -91953,7 +92158,6 @@ mamailaatt.weebly.com
  mamailatt.weebly.com
  mamainamovi.com
  mamaisonnova.com
-mamakumpir.de
  mamalusinde1.000webhostapp.com
  mamamhmuda.com
  mamangothounga.com
@@ -92465,7 +92669,6 @@ maolxtype.com
  maolxvenue.com
  maolxway.com
  maomao588.cn
-maoqe3.com
  maoqiansui.com
  maori-jar.000webhostapp.com
  maotltibrtnvxaes-dot-millinium.ey.r.appspot.com
@@ -92578,7 +92781,6 @@ marchencfo.ru.com
  marcheseinvestments.com
  marchfleet.com
  marchrufend2.com
-marchseem.guru
  marcin-wojtynek.pl
  marckapiksa.ug
  marcodenova.com.mx
@@ -92591,6 +92793,7 @@ marconi-galletti.it
  marconiliqhting.com
  marconistore.com
  marcopolo.la
+marcos-cajamarurales.com
  marcoscarbone.com
  marcosmgimoveis.com.br
  marcoterzulli.com
@@ -92917,6 +93120,7 @@ marketplace-item-576233.com
  marketplace-item-576427.com
  marketplace-item-577632.com
  marketplace-item-732536425.com
+marketplace-item-7328247123.000webhostapp.com
  marketplace-item-7362352.com
  marketplace-item-754874.com
  marketplace-item-7625332.com
@@ -93409,6 +93613,7 @@ marriottzsj.com
  marroiq.com
  marryplustravel.com
  marryscristmasssanta.website
+marsadd.cyou
  marsbahis234.com
  marsbahis259.com
  marsbahis272.com
@@ -93597,6 +93802,7 @@ master-ms.com
  master-nourad.parisnanterre.fr
  master-of-bitcoin.net
  master.appleimmortal.com
+master.d1ms5ihqjbtlox.amplifyapp.com
  masterbateshop.ru
  masterbrand.co.ke
  mastercarsecurity-chek.000webhostapp.com
@@ -93670,6 +93876,7 @@ matambinrajab.org
  matanewssite.com
  matangioffice.com
  matasov-art.ru
+matb5.com
  matbe.online
  matbet387.com
  matbet388.com
@@ -93780,6 +93987,7 @@ maureaunetservice.com
  maureenbreezedancetheater.org
  mauricio-sarria.club
  mauricioynicole.com
+maururutravel.com
  mautic.manunameredill.com
  mauy.org
  mavali.de
@@ -93920,6 +94128,7 @@ mazcclanswfloelf-dot-millinium.ey.r.appspot.com
  mazdank9.beget.tech
  mazedecrypt.top
  mazeedkyabar.com
+mazeinfouma.ru
  mazharul-hossain.info
  mazhenkai.top
  mazif.us
@@ -94159,6 +94368,7 @@ mdp.mg
  mdp11.000webhostapp.com
  mdprobuilders.com
  mdqassessing.co.za
+mdr0ae9jdg9izxiymdiw.filesusr.com
  mdrcqa.shoesmogul.com
  mdrealtor.in
  mdsb.shoesmogul.com
@@ -94172,6 +94382,7 @@ mdvzidmpuibjpdof-dot-millinium.ey.r.appspot.com
  mdx2893.3utilities.com
  me-faccebook-tr.com
  me-faccebook-trr.com
+me-helpdesk-submit1824587.live
  me-instagram.net
  me.kayamalimusavirlik.com
  me.mellatholding.com
@@ -94259,6 +94470,7 @@ mediaclan.info
  mediaconvert.pro
  mediacopyright-support.com
  mediacopyrights.com
+mediafile.in
  mediaforceadz.com
  mediagift.vn
  mediahubml.com
@@ -94299,6 +94511,7 @@ medicalbillingclerks.ca
  medicalcosmeticsicily.com
  medicalfa.com
  medicalghaliadam.net
+medicalinfonews.com
  medicaljournalshouse.com
  medicalspaskincare.com
  medicalsupplies2u.com
@@ -94366,7 +94579,6 @@ medomshakel.ddns.net
  medopfresde.com
  medoslon.top
  medovica.com
-medparamarsh.com
  medpatchrx.com
  medramaccl.com
  medrealiscom.shaxiaapplication.top
@@ -94390,6 +94602,7 @@ meedfiinde.com
  meee-designbuild.com
  meeghwmubersrxkvja.top
  meekybaron.typeform.com
+meelloddii.com
  meemanshu.in
  meemwebhub.com
  meenou.com
@@ -94400,6 +94613,7 @@ meet-realtor.ca
  meetabansal.in
  meetabella.com
  meetbg.com
+meetcord.cyou
  meeting-23900123090123.bitbucket.io
  meeting.azurefd.net
  meetme.run
@@ -94414,6 +94628,7 @@ meeweb.com
  meeyid.vn
  mefashion.in
  mefbuikoe.com
+mefesebook.000webhostapp.com
  meflixfreewatch.tk
  mega-brand.ru
  mega-clean.ro
@@ -94975,7 +95190,6 @@ messsengerr.com
  messtours.com
  messuaempresa.com
  messundpruefgeraetecom.chifanassume.top
-messurine.guru
  mestand.com
  mestisko.sk
  mestkafe.com
@@ -95093,7 +95307,6 @@ meunasahmee.id
  meunasahmesjid.desa.id
  meunasahteungeh.id
  meunetespaco.net
-meupedidoamericana-com.preview-domain.com
  meupuglzjnslgtsd-dot-millinium.ey.r.appspot.com
  meurls.xyz
  meuservidor.applet-bb-com-br.live
@@ -95316,7 +95529,6 @@ mi88karine.company
  mia-netpeople.com
  miaabshaar.com
  miaamusement.com
-miadfr.fdgted.top
  miaedj.goruli.com
  miahtzsxghojzrnn-dot-millinium.ey.r.appspot.com
  miakhalifa.giize.com
@@ -95524,6 +95736,7 @@ microsoftmirror.ac.ug
  microsoftoffice-messagesreview158.yolasite.com
  microsoftofficerenewal.com
  microsoftoms.com
+microsoftonedrive342.typeform.com
  microsoftonedriven133263642adkbhf.glitch.me
  microsoftonline-365.webhop.me
  microsoftonline.bugsec.co
@@ -95649,6 +95862,7 @@ mihinsa.com
  miinstagram.com
  miitsolutions.com.au
  mij-in-g-servlets.xyz
+mij-l-n-g-servlet.xyz
  mijin.xyz
  mijn-app1.com
  mijn-digid.net
@@ -95824,7 +96038,6 @@ millerscornermt.com
  millertau.com
  millesime-invest.com
  milliemeitnerium.com
-millilanae.ru
  millingvicsafeds.com
  millinium.ey.r.appspot.com
  millionsacademy.com
@@ -95871,6 +96084,7 @@ mimkco.com
  mimnatie.work
  mimosdapaty.com.br
  mimreklam.site
+mimtilmima.xyz
  min.bz
  min762appleidpermanetarsiacccountyou.ablukinama.com
  minagi.org
@@ -96072,6 +96286,7 @@ mirceasoft.net
  mirchads.com
  mircocrop.space
  mireddetrabajo.com
+mireoeo.work
  mirfileonlines.club
  miriamgrimm.de
  mirjamholleman.nl
@@ -96087,6 +96302,7 @@ mirovayatech.pk
  mirpnzhjxyvecmut-dot-millinium.ey.r.appspot.com
  mirpol-bud.pl
  mirrapl.com
+mirror.mypage.sk
  mirrorheart.de
  mirrorwhite.com
  mirshapok.com.ua
@@ -96141,7 +96357,6 @@ mission2019.shop
  mission2019.site
  mission2019.website
  missionalcanadian.com
-missiondesjeunes.org
  missionhoperwanda.org
  missionnnairereture.000webhostapp.com
  missionovercooked01.com
@@ -96298,7 +96513,6 @@ mjm.dimaflix.com
  mjmhighendcom.shaxiacommittee.top
  mjnalha.ml
  mjnbkok.com
-mjplantbased.com
  mjqlhebwxceuxcff-dot-millinium.ey.r.appspot.com
  mjqx.goruli.com
  mjryfbzumetmoxbk-dot-millinium.ey.r.appspot.com
@@ -96515,7 +96729,6 @@ mmnskehnbbbs.in
  mmobillbahis233.com
  mmobilleitaucardonline.com
  mmocrjihowepqvlc-dot-millinium.ey.r.appspot.com
-mmoehring.de
  mmorpgx.space
  mmosite.com
  mmp.lt
@@ -96556,7 +96769,6 @@ mmuucqvqxvoorjcz-dot-millinium.ey.r.appspot.com
  mmwebmail-87703.web.app
  mmxdwnatwrsnmstn-dot-millinium.ey.r.appspot.com
  mmxhswouedaak.com
-mmxiv.org
  mmyijtapqztalhse-dot-millinium.ey.r.appspot.com
  mmyjdqofqwgwelpa-dot-millinium.ey.r.appspot.com
  mmz-servis.by
@@ -96878,6 +97090,20 @@ mobilee-pubg.com
  mobileearth.net
  mobileenterprises.org
  mobilefacebuuking.000webhostapp.com
+mobilefb-03794556.performers.lu
+mobilefb-09681956.performers.lu
+mobilefb-13456269.performers.lu
+mobilefb-24876933.performers.lu
+mobilefb-25584746.performers.lu
+mobilefb-35883896.performers.lu
+mobilefb-37014390.performers.lu
+mobilefb-40898430.performers.lu
+mobilefb-59444862.performers.lu
+mobilefb-64011929.performers.lu
+mobilefb-64205222.performers.lu
+mobilefb-65215149.performers.lu
+mobilefb-96888641.performers.lu
+mobilefb-99617844.performers.lu
  mobilefb.devicenewcheck.one
  mobilefbook-login-com.filesusr.com
  mobilefinanceiro.com
@@ -97020,7 +97246,9 @@ modexcommunications.eu
  modexcourier.eu
  modexintl.xyz
  modhbrahmansthapakconviner.com
+modhbrahmasamaj.org
  modhi.no
+modification-de-mot-de-passe.paypal.fr.caisse-depargne.me
  modified-argon-286212.ey.r.appspot.com
  modifypiquillov.com
  modignite.com
@@ -97074,6 +97302,7 @@ moguti.site
  moguto.site
  mogutse.site
  mogyang.net
+moha-group.com
  mohamed090.000webhostapp.com
  mohamedalhabbo.hopto.org
  mohamedferria2020a71243eghfbkhfbnt.000webhostapp.com
@@ -97502,7 +97731,6 @@ morhenshtern.com
  moriggind.com
  morilloart.com
  morina.ml
-morinchoiniere.com
  moringacos.com
  moripoly.kr
  morish-stopper.000webhostapp.com
@@ -97678,6 +97906,7 @@ moveitbrothers.com
  movelogistics.net
  movemax.co.in
  movementts.com
+movemycouch.com
  movenorte.com.br
  moveonnews.com
  movepueblo.com
@@ -97976,6 +98205,7 @@ msfbook.000webhostapp.com
  msfgwte.duckdns.org
  msfnmperjhvhhzumiqskqtpczq-dot-gleowayel400503.uc.r.appspot.com
  msfsystem.com
+msftoutlook.com
  msftoutlook.site
  msg-banco.es
  msgamers.ddns.net
@@ -98132,7 +98362,6 @@ mtuclwvvzmuvdold-dot-millinium.ey.r.appspot.com
  mtunctejbtjrkmlz-dot-millinium.ey.r.appspot.com
  mtuwe.xyz
  mtuwjrilvkdymszx-dot-millinium.ey.r.appspot.com
-mtvradio.dk
  mtvstayingalive.org
  mtw4g-ht1-ge2rbh86rhthy.loan
  mtwiedf.godaddysites.com
@@ -98559,6 +98788,7 @@ mxdqyqsvipslgwxu-dot-millinium.ey.r.appspot.com
  mxe80-alternate.app.link
  mxflintidicfxyufscskrbuacy-dot-gleowayel400503.uc.r.appspot.com
  mxgcathyon.info
+mxhlbrt.de
  mxjjijgukslmwnwj-dot-millinium.ey.r.appspot.com
  mxjzoqgezlpeqrhb-dot-millinium.ey.r.appspot.com
  mxkotobnynhuqiul-dot-millinium.ey.r.appspot.com
@@ -98792,7 +99022,6 @@ my3-support-uk.com
  my3-support.net
  my3-team.com
  my3-three-restrictions.com
-my3-uk-bill.info
  my3-update-bill.com
  my3-update-information.com
  my3-updatepay.com
@@ -99102,7 +99331,6 @@ myee-account-support-view-my-ee.000webhostapp.com
  myee-accountbilling.com
  myee-alert.com
  myee-billingconfirm.com
-myee-billingrestriction.com
  myee-confirmbilling.com
  myee-contract.com
  myee-customerhub.com
@@ -99355,7 +99583,6 @@ mylovelydmitriy.tk
  mylovelydressing.com
  mylovelyrose.info
  myltiki.ru
-mym-buch.de
  mymac4565.000webhostapp.com
  mymail-prepayment.redirectme.net
  mymailexp.com
@@ -99365,6 +99592,7 @@ mymauimaid.com
  mymdxcuzjruvnsbi-dot-millinium.ey.r.appspot.com
  mymediationcom.shaxiaput.top
  mymembership-payment.com
+mymembership-planrenew.com
  mymembership-renew.com
  mymembership-renewal.com
  mymembership-signin.com
@@ -99406,7 +99634,6 @@ mynulifellc.com
  mynurserybazaar.com
  mynydd-ednyfed-countryhouse.co.uk
  myo.net.au
-myo2.account.details-billing-secure.com
  myo2.bill231.com
  myo2.ref783.com
  myo2.signin.billing-secure-account.com
@@ -99589,7 +99816,6 @@ mytestwp.cf
  mytextblast242.com
  mythical-rule.000webhostapp.com
  mythikall.com
-mythlion.guru
  mythpolitics.com
  mythree-alerts-billing.com
  mythree-alerts-billling.com
@@ -100226,6 +100452,7 @@ narcologics.ru
  narcosblue.net
  narcoticschloss.org
  nardeducation.com
+nardoweb.it
  nareatisoan.com
  naredetest.000webhostapp.com
  narendar.online
@@ -100327,6 +100554,7 @@ nationalsecuritydirect.com
  nationalsin.com
  nationalsupermarket.in
  nationaltenders.com
+nationalwireless-us.com
  nationaustralianbank.herokuapp.com
  nationotsation.xyz
  nationpayee-help.com
@@ -100357,6 +100585,7 @@ nationwide.uk.payeealert.cc
  nationwidesonline.com
  nationwidesupplyinc.com
  natiq.se
+nativeaol.com
  nativefinancial.co.uk
  nativeformulas.com
  nativestylings.ml
@@ -100376,7 +100605,6 @@ natthehiv.com
  natucave.com
  naturabellasartes.com
  natural-apricot-278809.wm.r.appspot.com
-naturalalopeciawellness.com
  naturalenterprises.in
  naturalfriend.net
  naturalhealthsystems.us
@@ -100763,6 +100991,7 @@ nebula-business.com
  nebuytrfns.000webhostapp.com
  nececadzllaacmhq-dot-millinium.ey.r.appspot.com
  necessary-circular-rib.glitch.me
+nechas.co.tz
  neciwear.com
  neck2massg.icu
  neckedexpress.com
@@ -100778,6 +101007,7 @@ nectaribate.com.br
  nectarworks.co
  nedaelwatan.com
  nedbank.com-web.xyz
+nederland.verhuur.facebook.marketplace.com.29-52.site
  nederland.verhuur.facebook.marketplace.com.50481.space
  nedisnive.ml
  nedorim.top
@@ -100837,6 +101067,7 @@ negyremete.hu
  negztsgfgnftcvpp-dot-millinium.ey.r.appspot.com
  nehashetty.xyz
  nehsu.com
+neighbourhoodwatchcasey.com
  neighbourmiss.tk
  neilmacqueen.com
  neilslifestyle123.com
@@ -100915,7 +101146,6 @@ neoscenrer.com
  neosmartbolivia.com
  neosoma.com.br
  neotecconstrucao.com.br
-neotechnology.info
  neotericsalve.club
  neovivah.com
  nepagold.com
@@ -101048,6 +101278,7 @@ netcabo.co
  netcast.servebeer.com
  netcfd.com
  netcinema.cinepu.com
+netciti.id
  netcity1.net
  netclixlinkfb.000webhostapp.com
  netcoinplace.com
@@ -101143,6 +101374,8 @@ netflix-id-12837.com
  netflix-idmsa.com
  netflix-info-update.webredirect.org
  netflix-jfs.com
+netflix-membership-plan.com
+netflix-membership-renew.com
  netflix-myplan-renew.com
  netflix-myplan.com
  netflix-myplanrenew.com
@@ -101231,7 +101464,6 @@ netflix.deutschland.yt
  netflix.error-with-billing.com
  netflix.errors-with-billing.com
  netflix.failed-billingpayment.com
-netflix.failedbill-payment.com
  netflix.failedbilling-details.com
  netflix.failedbilling-info.com
  netflix.failedpayment-info.com
@@ -101298,7 +101530,6 @@ netflixautopay.cf
  netflixbilling-info.com
  netflixbilling-issue.com
  netflixbilling-renew.com
-netflixbilling-update.com
  netflixbilling01-001-site1.1tempurl.com
  netflixbrazilcovid.com
  netflixbro.000webhostapp.com
@@ -101381,6 +101612,7 @@ netfupdate.info
  netgetdream.com
  netgraphicsenterprises.com
  nethmddwrhqzmqejen.top
+neti-logistics.com
  netiflix-unable.com
  netiflixits.com
  netihinontonbarengtvnz.com
@@ -101399,6 +101631,7 @@ netkromsolution.com
  netlaxerif-online.preview-domain.com
  netlfhdfix.ddns.net
  netlflix.com-billing.com
+netlinzscureaccunsignzseries.nontonskytvnzdirumah.com
  netlix-acc0untsupp.zapto.org
  netlix.myddns.me
  netlixauexntend.com
@@ -101552,7 +101785,6 @@ new-adminseveritycenters.azurewebsites.net
  new-center-fargo.work
  new-coronavirusmask.com
  new-credit.space
-new-devicealert.com
  new-evenst-pubg-royalepas13.000webhostapp.com
  new-facebook.de
  new-faceeboook.000webhostapp.com
@@ -101567,7 +101799,6 @@ new-my3.uk
  new-mythree.com
  new-onlinepayee.com
  new-opt.com
-new-payeeverify.xyz
  new-paymentsupport.com
  new-shape.co
  new-signin3.uk
@@ -101597,6 +101828,7 @@ new-three.link
  new-three.network
  new-threealert.com
  new-threecancelswap.com
+new-threehelpdesk.ga
  new-threelogin.info
  new-threesupportuk.co
  new-threeupdate.info
@@ -101685,7 +101917,7 @@ newcup.xyz
  newcurrentlylogin.weebly.com
  newdawn.pw
  newdecorationideas.xyz
-newdevice-authorise.link
+newdevice-cancellation.link
  newdiamond.hot1.shop
  newdiamondff.com
  newdiscoverclutch.discoverclutch.com
@@ -101798,6 +102030,7 @@ newportky.buzz
  newportranch.ml
  newporttower.marketingthrugraphics.com
  newpredatorrabotatsuka.site
+newprojectdocument.uc.r.appspot.com
  newpropertiesinside-houses-townhomes-mercury8500.com
  newpropertiespage3898530638.com
  newproplaunch.com
@@ -101913,6 +102146,7 @@ newsmilegrants.com
  newsmuseorg.nckiaccounting.gdn
  newsnachamerre.tk
  newsnaija.ng
+newsnextone.com
  newsonghannover.org
  newsonic.com
  newsped.eu
@@ -102178,6 +102412,7 @@ ngvthhyz.biogenicherb.com
  ngweh.xyz
  ngwipioenplbucpo-dot-millinium.ey.r.appspot.com
  ngx234.inmotionhosting.com
+ngx249.inmotionhosting.com
  ngx257.inmotionhosting.com
  ngyfqgdjumyftnzb-dot-millinium.ey.r.appspot.com
  ngzhw.mentriqq.com
@@ -102352,6 +102587,7 @@ nicolas.ug
  nicolasbaldoma.com
  nicoleaeschbachorg.wordpress.com
  nicoledeas.com
+nicolemerry.ru
  nicolerdixon.com
  nicolesprenger.com
  nicolettasaraceni.servebeer.com
@@ -102482,9 +102718,9 @@ nimbleoffice.org
  nimbleurbia53.com
  nimbopio.com
  nimeoi.cam
-nimeu.asia
  nimitta.life
  nimmecqagxfkqloo-dot-millinium.ey.r.appspot.com
+nimneupeo.work
  nimotv-tournamentonline-pubgmobile.000webhostapp.com
  nimsnowshera.edu.pk
  nimsome.pnjsheodnomb.top
@@ -102523,7 +102759,6 @@ ninoeggplante.com
  ninovaeczadeposu.com.tr
  ninratzesqewsggn-dot-millinium.ey.r.appspot.com
  niobic-roars.000webhostapp.com
-niokolo.com
  nionmatoms.net
  niophologtimale.tk
  niosdeledguide.com
@@ -102544,6 +102779,7 @@ niralsolutions.com
  nireuhzuz.net
  nirhas.org
  nirjhara.com
+nirmalind.com
  nirmalnetworks.com
  nirr.xyz
  nirvaana.biz
@@ -102570,7 +102806,6 @@ nite0l32.ga
  nitechsolution.com
  niteqite.com.ng
  nitesh94792.000webhostapp.com
-niteshenterprise.com
  nithfflix.ddns.net
  nithishpaperbags.com
  nithyahomes.com
@@ -102850,7 +103085,6 @@ nnpcaids.com.ng
  nnpcgroupjvops.com
  nnpgeiwezwjxeevviutvnopxhnfdserfygnu-dot-gl494903049.wl.r.appspot.com
  nnplantlab.com
-nnpstv.com
  nnsrhazwdobbivwu-dot-millinium.ey.r.appspot.com
  nnswj.svcoding.com
  nntjopepqzojktrl-dot-millinium.ey.r.appspot.com
@@ -103116,6 +103350,7 @@ noonbir.com
  noonle.xyz
  nooo11.ddns.net
  noor.me.ke
+nooragifts.com
  noorrik.com
  noorweb.us
  noosaasics.com
@@ -103230,7 +103465,6 @@ northstarinnovations.in
  northstratford.xyz
  northwestfootballreport.com
  nortiainteriors.com.au
-nortonbillpay.com
  nortondustrial.com
  nortonlilly.info
  nortonremotesupport.com
@@ -103279,6 +103513,8 @@ note-netflix.com
  note.donhuvy.com
  note.tubnd.tk
  notearzz.com
+notebook-133794123.ml
+notebook-32184238.ga
  notefy.space
  notehashtom.ir
  notendur.hi.is
@@ -103383,7 +103619,6 @@ notla.ddns.net
  notlficatlonbofa.sytes.net
  notmissingout.com
  notonmane.tk
-notorietcrimeproduct.com
  notpaidsz.com
  notre-courtier.fr
  notriicka.ir
@@ -103474,6 +103709,7 @@ now-fill.co.uk
  now-release.ga
  now-release.ml
  now-release.tk
+now-thats-salerooms.co.uk
  nowallowvideos.videoscats18.xyz
  nowapolskaa.cyou
  nowapolskaa.online
@@ -103808,7 +104044,6 @@ nuazar.tk
  nubank.modulodeseguranca.com
  nubertak.top
  nubianlabel.com
-nubul.org
  nucare.com.au
  nucgbqfypygqkoedojlezlldsk-dot-gleowayel400503.uc.r.appspot.com
  nucheloe.com
@@ -103894,6 +104129,7 @@ nureth13.org
  nurfaizi.my.id
  nurkankaplan.com
  nurmerg43lebada.000webhostapp.com
+nuropain.monster
  nurseryomar.com
  nursing-assessment.net
  nurturingwisdom.com
@@ -104207,6 +104443,7 @@ nzx1.awaykart.com
  nzyspozixrzmucbi-dot-millinium.ey.r.appspot.com
  nzyxeqtjmfgmgdcb-dot-millinium.ey.r.appspot.com
  nzzyteulgepmazia-dot-millinium.ey.r.appspot.com
+o-amazon.top
  o-f-f-c.s3.amazonaws.com
  o-f-ice.du.r.appspot.com
  o-faceit.fun
@@ -104375,7 +104612,6 @@ obeidmachinery.com
  obeikanprojects.tech
  oberiba.pl
  obes.shoesmogul.com
-obesecamp.guru
  obgeogjxabsteawcvnllrroema-dot-gleowayel400503.uc.r.appspot.com
  obgynonthepark.com
  obgynresults.com
@@ -104401,6 +104637,7 @@ objectstorage.eu-amsterdam-1.oraclecloud.com
  objectstorage.uk-london-1.oraclecloud.com
  objectstorage.us-ashburn-1.oraclecloud.com
  objectstorage.us-phoenix-1.oraclecloud.com
+objectstorage.us-sanjose-1.oraclecloud.com
  objectstream.ga
  objectway.ca
  objenet.batwoqisent.top
@@ -104483,6 +104720,7 @@ oceanrdstore.com
  oceans-news.com
  oceanstourscartagena.com
  oceanstourscartera.com
+oceantires.com
  oceanvibes.com.au
  oceetee-my.sharepoint.com
  ocelliptigo.com
@@ -104573,7 +104811,6 @@ odeftg.com
  odentidj.ml
  odessa-travel-guide.com
  odessade.buzz
-odeville.de
  odeycapital.com
  odfknhdujd.github.io
  odfmrof.serviceorder.su
@@ -104670,6 +104907,7 @@ oewtwgnktdoyxmp.vercel.app
  oezbsazuzcrowldcjmttuqwfdh-dot-gleowayel400503.uc.r.appspot.com
  oezpiauooqeuozbr-dot-millinium.ey.r.appspot.com
  of-icc-es-123.du.r.appspot.com
+of0yzforall.com
  of357-alternate.app.link
  ofacepraelasok.xyz
  ofam.com.ru
@@ -104878,7 +105116,6 @@ office365-visitor-284108.ue.r.appspot.com
  office365.cha.us.org
  office365.cloverpeople.com
  office365.firewall-gateway.com
-office365.lankaeducation.com
  office365.legalverify.co
  office365.login.acc.itsalloverin.tk
  office365.loginviewmessages.servpartner.tk
@@ -104906,7 +105143,6 @@ office365voicemailcovid19.com
  office3gc080ba3xyb1izo8hsh2q6njurdw5.s3.us-east-2.amazonaws.com
  office48-paypal.com
  office55zj9w2piajege0t2v5i0ld6.df.r.appspot.com
-office72-paypal.com
  office8m9mehxaeruzzw91kjlk0d6o.df.r.appspot.com
  office9nibg9fhinfwfu17pyf8snrd.wm.r.appspot.com
  officeadmin.netlify.app
@@ -105520,6 +105756,7 @@ olrpthononttanoq-dot-millinium.ey.r.appspot.com
  olrsezyhapclljdc-dot-millinium.ey.r.appspot.com
  olssondesignfirm.com
  olt.aletitself.ru
+oltransdostal.cz
  oltratoke.ru
  oltrefroneraprogetti.com
  olubankee.com
@@ -105951,7 +106188,6 @@ online-billingsupport.com
  online-bofa.net
  online-bpiupdate.servepics.com
  online-business.bankofscotlandbuson.com
-online-cancel-payee.com
  online-career-projects.ew.r.appspot.com
  online-center-uk-help.com
  online-cep-btk-duyuru.ml
@@ -105967,6 +106203,7 @@ online-compte-securitaire.webnode.com.co
  online-crescent.000webhostapp.com
  online-customer-support.beribucaratelahkucoba.com
  online-dating-safe.com
+online-device-deregister.com
  online-easy-web-td.com
  online-error-reporting.com
  online-error.cc
@@ -106079,6 +106316,7 @@ online.asb.co.nz.auth-login.xyz
  online.asb.co.nz.auth.fm.nz-classic.cf
  online.asb.co.nz.auths.info
  online.asb.co.nz.autth.xyz
+online.asb.co.nz.classic.nz-ibn.ml
  online.asb.co.nz.com.nz-c0.ml
  online.asb.co.nz.hahn5aif.com
  online.asb.co.nz.iml-es.com
@@ -106196,6 +106434,7 @@ onlinedetect.com
  onlineeregistration.com
  onlineetaindia.com
  onlineexcelviewer.ddns.net
+onlineexpressepaiement.weebly.com
  onlinefantacysports.com
  onlinefbcontest.000webhostapp.com
  onlinefidosolutions.com
@@ -106529,6 +106768,7 @@ operacaoninjadeoz.com
  operaciones1bnweb.com
  operagx.ru
  operahouse2.com
+operaricos.com
  operaslovakia.sk
  operateable.org
  operatingsystemassignmenthelp.com
@@ -106812,7 +107052,6 @@ orbhftvemqtyzoqt-dot-millinium.ey.r.appspot.com
  orbitonion.cyou
  orbity3.com
  orbitztour.com
-orbymart.co.in
  orcapm.com
  orcess.info
  orchaskiddiesworld.com
@@ -106990,6 +107229,7 @@ orthodoxfacts.org
  orthodoxhospital.co.ke
  orthodoxproduction.com
  orthodoxquotation.com
+orthodoxresearcher.com
  orthogenie.net
  orthomaxdental.com
  orthopaedix.com.au
@@ -107012,7 +107252,6 @@ orytcqeh.goruli.com
  oryxplastics.com
  orzmpkssvyngwory-dot-millinium.ey.r.appspot.com
  os-dias-das-maes-ainda-nao-acabou.000webhostapp.com
-os8pcf13.web.app
  osa-co.com
  osaborijyoshi.com
  osads.ddns.net
@@ -107115,6 +107354,7 @@ ostwaltsonsite.com
  ostyhglnddvbsvje-dot-millinium.ey.r.appspot.com
  osuiriygfoizbraj-dot-millinium.ey.r.appspot.com
  osullivansremovals.co.uk
+osun.cz
  osvaldo.buzz
  osvaldoalberti.com
  osvoyzeimbznjqww-dot-millinium.ey.r.appspot.com
@@ -107127,6 +107367,7 @@ otacilio.online
  otakejc.com
  otakunity.net
  otanityre.in
+otaviomoura.com.br
  otb24com.nckiengland.gdn
  otc-manila.com
  otcmrgxgjrzpfgai-dot-millinium.ey.r.appspot.com
@@ -107212,7 +107453,6 @@ ottocoating.com
  ottokurier.com
  ottservs.site
  otumbaonline.webredirect.org
-otupage1.web.app
  otuwytfkfzlqrbbr-dot-millinium.ey.r.appspot.com
  otxhydyc.gikorip.net
  otyhlddxzvbyomik-dot-millinium.ey.r.appspot.com
@@ -107260,7 +107500,6 @@ oult.ml
  oulthelpservce.creatorlink.net
  oumngh.tk
  oumzqbieofmcrsjj-dot-millinium.ey.r.appspot.com
-ounasari.ga
  ounceandpound.com
  ounddd.com
  ounterempresa.com
@@ -107284,6 +107523,7 @@ ourcityradio.com
  ourfathersworld.org
  ourfreshmarket.com
  ourfuturedream.com
+ourgoodlifefarm.com
  ourhajn.me
  ourhansenfamily.com
  ourhouse.id.au
@@ -107372,6 +107612,8 @@ outlook-office-mail.virginiabeachcarpetcleaning.us
  outlook-office365-signin.el.r.appspot.com
  outlook-office365.dns.army
  outlook-officedrive2.web.app
+outlook-officedrive4.web.app
+outlook-officedrive5.web.app
  outlook-owa-86c70.web.app
  outlook-protection.pr916.com
  outlook-protection.yallahmaana.com
@@ -107459,7 +107701,6 @@ outmost-disks.000webhostapp.com
  outofahat.co.uk
  outofanger.net
  outofhandcreations.ca
-outofphase.de
  outofthebaseline.info
  outonoemlisboa.com
  outookeidot.000webhostapp.com
@@ -107615,7 +107856,6 @@ owamicrosft79fpf8t5mgcr1z1z7.el.r.appspot.com
  owaoutlook-webmailadmin.moonfruit.com
  owaoutlookwebapp.moonfruit.com
  owas4ps55aaauser.an.r.appspot.com
-owasupport.web.app
  owasupportunit8986.000webhostapp.com
  owaupdataaccotemmy.web.app
  owavoice.christexousia.org
@@ -107764,6 +108004,7 @@ ozarkhardwoodpellets.com
  ozarkmorealtor.com
  ozbizzgroup.com
  ozcanelektronik.com.tr
+oze.vn
  ozeki.hopto.org
  ozelhospital.com
  ozemag.com
@@ -107772,6 +108013,7 @@ ozenne.com
  ozenpromosyon.ru
  ozettcqesfcjfmxj-dot-millinium.ey.r.appspot.com
  ozfdkqhvnceiaomb-dot-millinium.ey.r.appspot.com
+ozgbi.ru
  ozgurdusleranaokulu.com
  ozgursimsek.xyz
  oziaamnxbiulie.icu
@@ -107891,6 +108133,7 @@ p8h1w.com
  p8jk3eiahaginktovmhrs5sgje.ykhw09.com
  p8p6k.codesandbox.io
  p8w.618mcp.com
+p8z96shu.web.app
  p92b.awaykart.com
  p943r.jaysbrand.com
  p95-j.mentriqq.com
@@ -107965,7 +108208,6 @@ pacelfmetracettech.info
  pacemakerltd.com
  paceoli.com
  pacepowerglobal.com
-paceready.guru
  pachlina.at
  pacific-formula-278007.du.r.appspot.com
  pacific-traders.com
@@ -108006,6 +108248,7 @@ pacqjijjtmxsstdkesbsxsrvbo-dot-gleowayel400503.uc.r.appspot.com
  pacradelectronics.com
  pacshorecorp.com
  pactional-docks.000webhostapp.com
+pactmachines.net
  pacuniversity.ac.ke
  pacusdy.almostmy.com
  pacuskurier.org
@@ -108275,7 +108518,6 @@ paidtrees.com
  paiement-bitcoin.com
  paiement-numerique-secu.000webhostapp.com
  paiementcyon-net-5772dea2.lagrandegraine.fr
-paiementpaypal.laurentcourco.com
  paietunisiecom.shaxiareal.top
  paigecleary.com
  paigecleary.net
@@ -108454,6 +108696,7 @@ panchalii.com
  panchamimedient.com
  pancretermatic.info
  pancyprianusa.com
+pandaimath.com
  pandainfantil.cl
  pandaparken.at
  pandaproject.ru
@@ -108807,7 +109050,6 @@ partpursuits.com
  parts.kuru2jam.com
  parttimecollegejobs.com
  party-bucket.000webhostapp.com
-party-pix.org
  party-slot.com
  partycity.ml
  partycloud.nl
@@ -108871,6 +109113,7 @@ passornaluminium.com
  passpiortailibabacom.000webhostapp.com
  passport-alibaba.com
  passportabaitbacom.000webhostapp.com
+passportalibaba.gearhostpreview.com
  passportened.xyz
  passportialbacom.000webhostapp.com
  passprotabilababacom.000webhostapp.com
@@ -109016,7 +109259,6 @@ pauledfr344sms.000webhostapp.com
  paulharrisphotojournalist.com
  paulisdogshop.de
  paulkerslake.com
-paulkirk.net
  paulklosterimages.com
  paullemmerick.com
  paulmartinseo.com
@@ -109027,6 +109269,7 @@ paulniklewicz.com
  paulnorwood.com
  pauloasilva.com.br
  paulospainting.com
+pauloune-lambert.com
  paulpartington-dot-cellular-line-243507.appspot.com
  paulscomputing.com
  paulsonvan.cloudaccess.host
@@ -109036,7 +109279,6 @@ pausastre.com
  pause-derive.xyz
  pauseforamoment.com
  pauseful-locations.000webhostapp.com
-pautz.org
  pauzmrqbmqpbllup-dot-millinium.ey.r.appspot.com
  pavaril.com
  pavaroto.net
@@ -109176,7 +109418,6 @@ pay3.eoeg.cn
  pay4001.xyqv.cn
  pay4essays.net
  payacountredu.000webhostapp.com
-payadollarandsee.com
  payaer.info
  payagenebiotech.com
  payailfire.000webhostapp.com
@@ -109236,8 +109477,11 @@ payeecancel82.com
  payeehelp-online.com
  payeeprotection-hs.cc
  payeercrypto.site
+payeeref-help.com
+payeereview-help.com
  payeeriskalert.cc
  payees-removal.com
+payeesecure-help.com
  payeesecure-new.com
  payeeupdate-boi.com
  payeeverify.co.uk
@@ -109318,6 +109562,7 @@ payments-ebay.com
  payments-instant.club
  payments-my3.com
  payments-myee.com
+payments-review.com
  payments-update-netflix.giize.com
  payments.g.cdcde.com
  payments.netfixredirection.info
@@ -109331,6 +109576,7 @@ paymenttest.buycannabliss.com
  paymenttreats.com
  paymentupdateaccount-netflix.com
  paymentverification-online-hs-secure.com
+paymentveritcationthrouhsecureandsafe.000webhostapp.com
  paymodf0al.com
  paymounter.xyz
  paymybill.guru
@@ -109847,6 +110093,7 @@ paypal.active.account.lyleturkson.com
  paypal.admin-authorisation.com
  paypal.ariaprint.ma
  paypal.atozconceptinc.com
+paypal.attends.icu
  paypal.auth-login.verif-021620.com
  paypal.auth-login.verif-111320.com
  paypal.authentic-registration.com
@@ -110151,7 +110398,6 @@ paypal.com.webauth-login.verif-092120.com
  paypal.com.webauth-login.verif-201706.com
  paypal.com.zoomtec.info
  paypal.confirm-my-account.com
-paypal.confirmation-identiteenligne.com
  paypal.cs.support.webservices.secure-loggin.com
  paypal.customer-techsupport.com
  paypal.customersupport.link
@@ -110167,7 +110413,6 @@ paypal.deutschland-kundenkonto-sicherheit.info
  paypal.deutschland-kundenservice-sicherheit.info
  paypal.e-checkouts.online
  paypal.elitebankgroup.com
-paypal.error-with-payment.com
  paypal.eurotourist.online
  paypal.failed-attempt.com
  paypal.fr.signin.iecinc.net
@@ -110222,13 +110467,13 @@ paypal.login.us.wahanadigital.co.id
  paypal.login.validate-secure-details.com
  paypal.mattiasvaucher.com
  paypal.me.berarderic.com
-paypal.me.laurentcourco.com
  paypal.me.moinebaptiste.com
  paypal.me.philmooreowens.com
  paypal.me.service-support.digital
  paypal.members-check.com
  paypal.miccosylvain.com
  paypal.moesystems.info
+paypal.mutilated.icu
  paypal.my-bill.co.uk
  paypal.my-secured-account.com
  paypal.myaccount-support.com
@@ -110239,6 +110484,7 @@ paypal.mypaypalverification.com
  paypal.mypaypverification.com
  paypal.net-drive.xyz
  paypal.newamazonworld.com
+paypal.newdevicealert.org
  paypal.nextliferepair.com
  paypal.nl-4.pw
  paypal.notificetion.tk
@@ -110348,6 +110594,7 @@ paypal.support.update-account.cswebservices.com
  paypal.support.verifica.account.securecuoktytyxuyhugfglogin.com
  paypal.support.verification.center.securitycompany.biz
  paypal.supporthelpcentre.com
+paypal.thatjohns.eu
  paypal.uk-accountsecurity.com
  paypal.uk-login.com
  paypal.uk-online-help-centre.com
@@ -110546,7 +110793,6 @@ paypalsetup.info
  paypalsigninfo.deisemelo.com
  paypalsir.com
  paypalssdfmwemfmsdfz.buzz
-paypalsservice.com
  paypalstatus2407.info
  paypalstroe.com
  paypalsupportcenter.digital
@@ -110694,11 +110940,7 @@ payplticket20964790.info
  payplticket2937591.info
  payplticket2937592.info
  payplticket3161496.info
-payplticket318660.info
-payplticket318661.info
  payplticket4161287194.info
-payplticket4161287195.info
-payplticket4161287197.info
  payplticket4733090.info
  payplticket4733092.info
  payplticket4733093.info
@@ -110760,6 +111002,7 @@ paywtqgvagkpqybmak.top
  payyosafoolayzu.com
  payypal.club
  payypal.live
+payypalsecurecustomer.xyz
  payyypalk.000webhostapp.com
  payzonecapital.com
  pb128o6c2favwk.com
@@ -110873,6 +111116,7 @@ pcservicetechnikercom.shaxiabuy.top
  pcsoft.down2.99downer.com
  pcsoft.wall.99downer.com
  pcsolutioncenter.com.ar
+pcsoori.com
  pcstdhfguazhotlmvxroyjovli-dot-gleowayel400503.uc.r.appspot.com
  pcsucdn.com
  pcsvet.si
@@ -110969,7 +111213,6 @@ peacefulbirth.id
  peacefulplushes.com
  peacejetcargo.ne-n.com
  peacethroughsports.asia
-peaceto.guru
  peach-care.org
  peaches-place.com
  peachessuccess.com
@@ -111041,7 +111284,6 @@ pedological-briefin.000webhostapp.com
  pedragal.com
  pedram82.ir
  pedrobraun.com
-pedroguinle.com
  pedrootavio.top
  pedroserrano.cl
  pedrozaasesores.com
@@ -111163,7 +111405,6 @@ penicenterprises.com
  penielspiritual.com
  peninsulals.com
  peninsulasbeijing.com
-penknife.guru
  penlichorvoy1949.blogspot.com
  penlichorvoy1949.blogspot.lu
  pennapoinx.com
@@ -111186,6 +111427,7 @@ pensiuneafenyo.ro
  pensiunealaluna.com
  pensive-lamarr-a7c3ce.netlify.app
  pensoutlet.cn
+penta.com.au
  pentacledrummers.co.uk
  pentaworkspace.com
  pentest-host.000webhostapp.com
@@ -111255,6 +111497,7 @@ perez-tome.net
  perfect-bank.ru
  perfect-change.ru
  perfect-creed.com
+perfect-ly.de
  perfect-maconnerie.fr
  perfect-netflix.com
  perfect-pay.ru
@@ -111320,6 +111563,7 @@ periohealthidahoreviews.com
  periotexas.com
  peripheroneural.info
  perisplenic.xyz
+peristomial-routine.000webhostapp.com
  perithecium.xyz
  perkasa.warzonedns.com
  perkasacrane.com
@@ -111511,7 +111755,6 @@ petshappyhome.com
  petsittingexcellence.com
  petsmenu.us
  petsmypassion.com
-pettyclock.guru
  pettyrosso.it
  peturreja1971.blogspot.be
  peturreja1971.blogspot.com
@@ -111622,7 +111865,6 @@ pglxtjufqhfadyhq-dot-millinium.ey.r.appspot.com
  pglxtxbrjgqgfpdy-dot-millinium.ey.r.appspot.com
  pgm-patrimoine.com
  pgmessindia.com
-pgmm.club
  pgnig-24.pl
  pgnigonline.pl
  pgoasfxvdmehbtfg-dot-millinium.ey.r.appspot.com
@@ -111850,6 +112092,7 @@ photosbyart.net
  photosetunrecognizably.org
  photoshop.ac
  photosmarts.gq
+photosphereclackamas.com
  phototeen20202021.000webhostapp.com
  photoyatra.in
  php19.necto.cc
@@ -112014,6 +112257,7 @@ pilgrimageadvisor.com
  pilgrimsbeacon.com
  pili.la
  pill-bank.com
+pillenperueberweisung.xyz
  piller-sg.com
  pillheat.cyou
  pillmarket.ph
@@ -112276,7 +112520,6 @@ pkk.depok.go.id
  pkkpkrqyzgsocawrwtkzgpolsl-dot-gleowayel400503.uc.r.appspot.com
  pklooster.nl
  pklwu.vipsnapchatsexting.com
-pkmedia.us
  pkmsolutions.com.my
  pkoiefqcqrunwqxk-dot-millinium.ey.r.appspot.com
  pkp.cyto.ru
@@ -112371,7 +112614,6 @@ planno.ir
  planodesaude.yuplan.com.br
  planorama-com-dot-gl494903049.wl.r.appspot.com
  planosdesaudepreventsenior.com.br
-planosdesaudesemcarencia.com
  planosecuritycameras.icu
  planosperfeitomagalluuh.com
  planospreventsenior.net.br
@@ -112512,7 +112754,6 @@ plbfqcraoxjldsjy-dot-millinium.ey.r.appspot.com
  pldgsbexzhufkmov-dot-millinium.ey.r.appspot.com
  pldtdsll.net
  pldxs.rogagot.com
-pleaddump.guru
  pleadingelsosobl7a.com
  pleasanttravelchicago.com
  pleasantvalleydreamrides.com
@@ -112702,6 +112943,7 @@ pn.netflixtv-cunduhdqhn.htunmyitta.com
  pn24news.com
  pn8w.mentriqq.com
  pna46.onderhost.com
+pnaia.com
  pnaypal.ddns.net
  pnb.dyamm.com
  pnbtasarim.com
@@ -112750,6 +112992,7 @@ pobedastaff.ru
  pobfziepnr.duckdns.org
  poblgthgynacizhb-dot-millinium.ey.r.appspot.com
  pocahontasilz.top
+pochegroup.com
  pochi.eek.jp
  pochta-rus.ru
  pocked-capital.000webhostapp.com
@@ -112823,7 +113066,6 @@ pohe.co.nz
  poi.zebilke.com
  poicanabfe.gq
  poin.com.br
-poinsiduited.top
  point-empire.pro
  point-jp.tokyo
  point-rewards.com
@@ -113179,6 +113421,7 @@ port-9331b.firebaseapp.com
  portaal-online.website
  portabledocuments.github.io
  portail-client.weebly.com
+portail-infovocaleprosms.web.app
  portail-members.appsid-support.connect.cloudsvp.biz
  portail-messagerie-mmsvocale.web.app
  portail-messagerie-orangesms.firebaseapp.com
@@ -113221,6 +113464,7 @@ portal-regularizacao-estilo.com
  portal-stone.ga
  portal-web-itauweb1-brasil-com-voce2.000webhostapp.com
  portal-web-net-sempre-com-voce-itauweb3.000webhostapp.com
+portal-zz.com
  portal.auone.jp-app.ezweb-dns0291.com
  portal.auone.jp-verifykey.acahegfs.com
  portal.auone.jp-verifykey.afoajisjcas.com
@@ -113306,6 +113550,7 @@ portermedicals.com
  portfolio.modelsculture.com
  portfolioanalytics.net
  portgeographe.com.au
+porthealthpharmasave.com
  portiaplayground.ca
  portinfo.servecounterstrike.com
  portioncouncil.com
@@ -113408,11 +113653,6 @@ post-x.top
  post-y.top
  post-z.top
  post.360degreehosting.com
-post.facebookcom-14775456.aglob.fr
-post.facebookcom-16923728.aglob.fr
-post.facebookcom-78976395.aglob.fr
-post.facebookcom-80461357.aglob.fr
-post.facebookcom-92080922.aglob.fr
  post1621638617.us
  post1inform.info
  post2024.com
@@ -113509,6 +113749,7 @@ pot-f.top
  pot-g.top
  pot-h.top
  pot-i.top
+pot-n.top
  potatocat.net
  potens.ru
  potentagents.com
@@ -113622,7 +113863,6 @@ pp-e-virement-secure.000webhostapp.com
  pp-ee-support.com
  pp-eesupport.com
  pp-evirement-securepay.000webhostapp.com
-pp-giftcard.com
  pp-helpcenter.com
  pp-info-manage.com
  pp-info.xyz
@@ -113670,6 +113910,7 @@ ppal-personal-recovery-team-gb.ir
  ppal-unusualactivity.com
  ppalertpal.com
  ppalertsonline.com
+ppallimitationssecure.xyz
  ppalogin.com
  ppalorders.xyz
  ppalpartnerships.000webhostapp.com
@@ -113743,6 +113984,7 @@ ppl-centre-required-actions19519.000webhostapp.com
  ppl-centre-required-actions52382.000webhostapp.com
  ppl-contoclin.com
  ppl-notification-secure.com
+ppl-online-support.com
  ppl-redirectionsecure.com
  ppl-resolution-centre-id822.com
  ppl-safe.serveftp.com
@@ -113759,7 +114001,6 @@ pplavanderia.com.br
  pplimited-info.com
  pplimited-secured.com
  pplimited-verify.com
-pplinfzerviice.blogspot.com
  pplinkpo.000webhostapp.com
  pplkzoksymmpwdcg-dot-millinium.ey.r.appspot.com
  ppllnc-mpp.blogspot.com
@@ -113928,6 +114169,7 @@ praxair-peru.com
  praximusfon.000webhostapp.com
  praxis-foerderdiagnostik.de
  praxis-management-plus.de
+praxis.arq.ufmg.br
  praxisbeiercom.shaxiaas.top
  praxismall.com
  praxiswegenerinfo.shaxiabuy.top
@@ -113935,6 +114177,7 @@ prayanholidays.com
  praydraft.cyou
  prayercenter.uk
  prayerever.buzz
+prayerforce.org
  prayerfulness.xyz
  prayersapp.com
  praynis.com
@@ -114018,6 +114261,7 @@ premetalarredourbanocom.chifanbudget.top
  premetalarredourbanocom.shaxiaput.top
  premexpert.kz
  premierambulette.com
+premierbarcode.com
  premierbarsamui.com
  premierevents.co.zw
  premierhonda.in
@@ -114178,6 +114422,7 @@ prevenciondelavadodedinero.com
  prevenciondelcoronavirus.com
  preventcoronavirus19.com
  prevention-notknown.listencoerce.net
+prevention-payee.com
  preventionsystem2021.com.ve
  preventivo-desbloqueio.000webhostapp.com
  preventppal.xyz
@@ -114409,6 +114654,7 @@ privatechat2.com
  privatedomainupdate.web.app
  privatefb.club
  privatefbartist.com
+privateinvestigatormilan.com
  privatel0gintelegrafh-com.preview-domain.com
  privatelabelpower.com
  privatemortgagecanada.com
@@ -114458,6 +114704,7 @@ prmcsdgs.ug
  prmeordes.com
  prmry-pagecinfirmationaccount.njfajltd.com
  prmsd.msdbangkok.go.th
+prmtsttkstarholudgg.my.id
  prn51.mentriqq.com
  prnt.jaysbrand.com
  pro-activemetrics.com
@@ -114582,6 +114829,7 @@ productfb586787656454564373.com
  productiondelphi.minehosting.xyz
  productiondocument.com
  productivevision.com.my
+productivv.asia
  productmusics.com
  productosavvillas.com
  productosverdevalledelnorte.com.mx
@@ -114594,6 +114842,7 @@ productsbusnesphonesystemsvoip.web.app
  productsofindiareviews.com
  productvideohut.com
  produkcija-sidor.globalnet.mk
+produkte-kommunizieren.de
  produsesalon.ro
  produto-semanal.com
  produtoexclusivoeimperdiveleaqui.com
@@ -114856,6 +115105,7 @@ prolanyards.com
  proldste.xyz
  prolegis.pl
  prolinebracing.com
+prologcovere.com
  prom.com.hr
  promalaga.es
  promang.net
@@ -115164,6 +115414,7 @@ provlisurpwils.tk
  provocativeplanet.com
  provoke.be
  prowaysitsolutions.com
+prowergrounsystemsl.us
  prowin.co.th
  proxima-net.com
  proximatesolutions.com
@@ -115186,6 +115437,7 @@ proyectomayhem.000webhostapp.com
  proyectonoviembre.com
  proyectoprueba112233.000webhostapp.com
  proyectoseinnovaciones.com
+proyectospalma.com
  proyectosunicor-men.com
  proyectosurbam.es
  proyectotj-videos-167272437475.000webhostapp.com
@@ -115215,6 +115467,7 @@ pruebaderebuild.000webhostapp.com
  pruebaingenieria1234567.000webhostapp.com
  pruebaingenieria7.000webhostapp.com
  pruebapraboa.000webhostapp.com
+pruebaredsocial1.000webhostapp.com
  pruebas.dentaldelangel.com
  pruebas.mktmid.com
  pruebas1.mcblack1.com
@@ -115223,7 +115476,6 @@ pruebashack2020.zapto.org
  prukia.000webhostapp.com
  prunescape.com.au
  pruprioritas.net
-prusa3d.link
  prusinfo.shaxianovember.top
  pruvit.com.co
  prvcy01hlpbsnspgesrvce01.my.id
@@ -115279,6 +115531,7 @@ psc.fyi
  pscfsljghtbwylgrmzkefyrwzz-dot-gleowayel400503.uc.r.appspot.com
  pscincrop.com
  pscomputerservices.in
+psd.botrise.ro
  psd2-bnl-anagrafica.com
  psd2-intesaweb.com
  psd2-nexdati.000webhostapp.com
@@ -115401,6 +115654,7 @@ pt.timothygerwing.com
  pt.ultimatelifestyling.com
  pt.usbiorefiners.com
  pt.usell4more.com
+pt.wildsdesigns.com
  pt.worldorthodontics.org
  pt69kyu5jxcnddh-24zrcg1gw.vercel.app
  ptaksenergy.com
@@ -115752,6 +116006,7 @@ publinid.com
  publiplast.tn
  publiquesgouv.justns.ru
  publish-advanced-recovery-2020.my.id
+publishers.chloedigital.com
  publjanuary.xyz
  pubmskins13.ezua.com
  pubonlineservices.com
@@ -115780,7 +116035,6 @@ puertasyaccesorios.com
  puertosalsa.cl
  puevnghvnqvxnoifvznfapxcld-dot-gleowayel400503.uc.r.appspot.com
  pufferfiz.net
-puffgoatdashboard.com
  pugifts.diaryngifts.com
  pugmyyflcdouqfay-dot-millinium.ey.r.appspot.com
  pugsberacas.com
@@ -115810,7 +116064,6 @@ pullabest.com
  pullknife.work
  pullleft.com
  pullo.eu
-pullrank.guru
  pulpbiteeizee.com
  pulptzid.com
  pulsa--gratis-alpoerator.000webhostapp.com
@@ -115843,7 +116096,6 @@ puminsceft.com
  pump-one.com
  pumped-silicon-singularity.glitch.me
  pumpitem.buzz
-pumppazh.com
  pumpumonfleek.xyz
  punani1.webnode.com
  punchbaby.com
@@ -115916,6 +116168,7 @@ puremxn.com
  purepijat.online
  pureplatinumlabeled.com
  purepropertiesobx.com
+pureroom.com
  pureshredder.com
  puretrustghana.org
  purevirtues.com
@@ -115975,7 +116228,6 @@ pusatonline88.com
  pusatunggulan.poltekkesbandung.com
  puseesee.com
  pusemime.com
-push1.tokyo
  push65.duckdns.org
  pushfifth.com
  pushflighdasbeu.com
@@ -116607,6 +116859,7 @@ qi8ymuiiito-otimo-e-top.com
  qian-lai.com
  qianbishouchang.com
  qianghankeji.com
+qianjiangchao.com
  qianlizx.com
  qiannan.06rl.com
  qicfmqntfzljjkuj-dot-millinium.ey.r.appspot.com
@@ -117060,6 +117313,7 @@ quara31fnn.xyz
  quarantainezone-homebanking.online
  quarantine-digipass.website
  quarantine.cc
+quarantined-mails.df.r.appspot.com
  quarantnewebmail.an.r.appspot.com
  quarantnwebmail.an.r.appspot.com
  quarenta.eu
@@ -117082,6 +117336,7 @@ quartosalacozinhaparavoce.com
  quartosalacozinhavoce.com
  quartz-eg.com
  quasi-monkey.com
+quasi.ro
  quasimercantileinsecticidally.site
  quassia.es
  quatanggmt.com
@@ -117125,7 +117380,6 @@ queensrocketry.ca
  queenswati.000webhostapp.com
  queenwash.net
  queenyconnection.com
-queezes.cyou
  quefinanciamiento.com
  quehagoencartagena.com
  queima-de-estoque-imperdivel.ddnsfree.com
@@ -117546,6 +117800,7 @@ r3dm4.awaykart.com
  r3fewdsarg3few.rf.gd
  r3fund.com
  r3ig2001hk21da45z4xpd.000webhostapp.com
+r3l3az3.s3.ca-central-1.amazonaws.com
  r3s7.awaykart.com
  r3tur4ntob1lls.info
  r3vvh0r6.firebaseapp.com
@@ -117669,6 +117924,7 @@ rabotavlitve.com
  rabotkerk.be
  rabowereldpas.com
  rabrittanitschecom.chifanbackground.top
+rabsemangahai.com
  rac-lb.com
  rac3dspbd.com
  raccanelli.com.br
@@ -117681,7 +117937,6 @@ racesparecom.augerqisafety.top
  racesparescom.chifanbank.top
  racesparescom.shaxiaapplication.top
  racetov.com
-rachaeljena.ru
  rachatbitcoin.com
  rachel4237345.xyz
  rachel453634.xyz
@@ -117948,6 +118203,7 @@ rakutem.shop
  rakuten-2.club
  rakuten-ac.com
  rakuten-acardsyhd.com
+rakuten-account.pw
  rakuten-account.xyz
  rakuten-card-admin.com
  rakuten-card-co-jp.vip
@@ -118528,6 +118784,7 @@ rakuten.co.jp.rakvten.top
  rakuten.co.jp.rakvten.xyz
  rakuten.co.jp.rakvtenr.xyz
  rakuten.co.jp.rakvteo.xyz
+rakuten.co.jp.rasdzxcc.xyz
  rakuten.co.jp.ratuenlkrtbrtbxt.xyz
  rakuten.co.jp.ratuenlktjlkznlkrlkl.xyz
  rakuten.co.jp.rbhtkf.ph
@@ -118536,6 +118793,7 @@ rakuten.co.jp.rehaikou.cn
  rakuten.co.jp.rektencomanyj.xyz
  rakuten.co.jp.rekutan.top
  rakuten.co.jp.rekuten.icu
+rakuten.co.jp.rekutenjprekuten.xyz
  rakuten.co.jp.remfer.xyz
  rakuten.co.jp.remfs.xyz
  rakuten.co.jp.remfsd6ftech.xyz
@@ -118548,6 +118806,7 @@ rakuten.co.jp.rontnafovad.top
  rakuten.co.jp.rrakuten.tk
  rakuten.co.jp.rravkutan.xyz
  rakuten.co.jp.s55c4z.cn
+rakuten.co.jp.safemaill.top
  rakuten.co.jp.safesaccountbjknojioklmlkmiuhyuguvftxweaez.xyz
  rakuten.co.jp.safetyinstructions.xyz
  rakuten.co.jp.sasasas.xyz
@@ -118737,6 +118996,7 @@ rakutenco.xyz
  rakutencocojp.xyz
  rakutencojp-accountcenter.xyz
  rakutencojp-loginaccount.xyz
+rakutencojp-mail.xyz
  rakutencojp.top
  rakutencojpdonotcomplainmaliciously.xyz
  rakutencojplogin.top
@@ -118867,7 +119127,6 @@ ramarglobe.com
  ramaya23.000webhostapp.com
  ramazanda20gb.xyz
  rameau-olivier.dz
-ramec.com.au
  rameshbhatt.in
  rameshmendolabjp.com
  ramesv.site
@@ -118891,7 +119150,6 @@ ramsxy.com
  ramtechcouk.ddns.net
  ramtsoftt.com
  ramun.ch
-ramutable.cyou
  ramzansale.com
  ramzi01.ddns.net
  ran-patch.com
@@ -119143,7 +119401,6 @@ ray00.kozow.com
  ray54.mentriqq.com
  rayani.in
  rayaxiaomi.com
-raybadenergy.com
  raybak.top
  raybh.com
  raycityga.buzz
@@ -119182,6 +119439,7 @@ razorcrypter.com
  razorsharkdesign.com
  razultraafa.cloudaccess.host
  razumere12.000webhostapp.com
+razvivaisya-vsegda.ru
  razvivashka.kz
  rb-day.net
  rb-form2.com
@@ -119408,6 +119666,7 @@ rddyissqwhvsrfsc-dot-millinium.ey.r.appspot.com
  rde-netflix.com
  rde.center
  rdelab.com
+rdelafuente.com
  rderx.com
  rdezz.com
  rdfaj.svcoding.com
@@ -119467,6 +119726,7 @@ re.onlinespace.site
  re04-mx.lifebite.club
  re11.info
  re2.habitatsudconsulting.biz
+re20.tokyo
  re365.com
  re4z.svcoding.com
  re5mett.cars-boullet.com
@@ -119500,6 +119760,7 @@ readforjobs.com
  readhornofafrica.org
  readinglytr.weebly.com
  readingstatrthealk.us
+readnow.fb-msg.com
  ready-witted-leave.000webhostapp.com
  ready.co.id
  readyforwearables.com
@@ -119671,7 +119932,6 @@ reanychanges.greetingsrakuten.pw
  reaolpicveraosik.servehttp.com
  reaperskins.xyz
  reapple-receipt.servebeer.com
-reargrace.guru
  rearpusnor.com
  reastapo.com
  reaszsa.000webhostapp.com
@@ -119980,6 +120240,7 @@ redhands.studio
  redhillaccountants.com.au
  redhornsign.com
  redimsa.net
+redionesrvcont.com
  redir.qwerfceaw.com
  redirctxcwosx.hopto.org
  redirec-ts.com
@@ -119988,6 +120249,7 @@ redirecn.com
  redirect-account-unlock-verification.anggursetan.com
  redirect-account.apple-manage.brainwall.fr
  redirect-autoupdate.blogspot.com
+redirect-f6fe0.web.app
  redirect-fr2035.com
  redirect-mailupdate.mdelimakuntas.com
  redirect-mobile-wells.com
@@ -120092,6 +120354,7 @@ rees52.com
  reestablishes.xyz
  reetatu.cam
  reetiy.work
+ref-101foneid.info
  ref-393.com
  ref-51self-form.com
  ref-628274.co.uk
@@ -120155,6 +120418,7 @@ reform-mitsumori.net
  reformasartetxe.com
  reformation2017.ca
  reforme-account.fr
+reformsports.com
  refosvyafnmxfhie-dot-millinium.ey.r.appspot.com
  refreclusive.com
  refrein.com
@@ -120195,6 +120459,7 @@ regain-accountaccess.com
  regain-paypal.com
  regainpaypal.com
  regalmed.ae
+regalrent.com
  regalskins.com
  regardle.xyz
  regardsapplinc.com
@@ -120349,7 +120614,6 @@ reithracsellidi.tk
  reiugy.healthygenez.club
  reiytoys.com
  reizprivateresidence.com
-rejasan.com
  rejectionpending.ddns.net
  rejinilla.com
  rejox.in
@@ -120450,93 +120714,23 @@ relprosurgical.com
  relucture.xyz
  relyfxst0.live
  rem-b.hr
-rem-facebookcom-00306402.lhcaa.ca
-rem-facebookcom-02877779.lhcaa.ca
  rem-facebookcom-04217838.lhcaa.ca
-rem-facebookcom-04556574.lhcaa.ca
  rem-facebookcom-05589891.lhcaa.ca
-rem-facebookcom-06427598.lhcaa.ca
-rem-facebookcom-08058857.lhcaa.ca
-rem-facebookcom-08134725.lhcaa.ca
-rem-facebookcom-09874209.lhcaa.ca
-rem-facebookcom-09910514.lhcaa.ca
-rem-facebookcom-10623725.lhcaa.ca
-rem-facebookcom-11400246.lhcaa.ca
-rem-facebookcom-11911920.lhcaa.ca
-rem-facebookcom-12766444.lhcaa.ca
-rem-facebookcom-13335207.lhcaa.ca
-rem-facebookcom-13390533.lhcaa.ca
  rem-facebookcom-13794882.lhcaa.ca
-rem-facebookcom-14147010.lhcaa.ca
  rem-facebookcom-15822328.lhcaa.ca
-rem-facebookcom-17156276.lhcaa.ca
-rem-facebookcom-18824562.lhcaa.ca
-rem-facebookcom-19979661.lhcaa.ca
-rem-facebookcom-20553374.lhcaa.ca
-rem-facebookcom-21144179.lhcaa.ca
  rem-facebookcom-22342655.lhcaa.ca
-rem-facebookcom-27123363.lhcaa.ca
-rem-facebookcom-27497172.lhcaa.ca
  rem-facebookcom-28676746.lhcaa.ca
-rem-facebookcom-32227336.lhcaa.ca
-rem-facebookcom-33864343.lhcaa.ca
-rem-facebookcom-34439213.lhcaa.ca
-rem-facebookcom-35997771.lhcaa.ca
  rem-facebookcom-36246700.lhcaa.ca
-rem-facebookcom-39754273.lhcaa.ca
-rem-facebookcom-43754432.lhcaa.ca
-rem-facebookcom-44928502.lhcaa.ca
-rem-facebookcom-45535295.lhcaa.ca
-rem-facebookcom-46325008.lhcaa.ca
-rem-facebookcom-46603403.lhcaa.ca
-rem-facebookcom-46827964.lhcaa.ca
-rem-facebookcom-48056147.lhcaa.ca
-rem-facebookcom-48587932.lhcaa.ca
-rem-facebookcom-49386287.lhcaa.ca
  rem-facebookcom-50938886.lhcaa.ca
-rem-facebookcom-51729343.lhcaa.ca
-rem-facebookcom-51743351.lhcaa.ca
-rem-facebookcom-55319526.lhcaa.ca
-rem-facebookcom-56438881.lhcaa.ca
-rem-facebookcom-56458853.lhcaa.ca
-rem-facebookcom-56746631.lhcaa.ca
  rem-facebookcom-61815685.lhcaa.ca
  rem-facebookcom-62104236.lhcaa.ca
-rem-facebookcom-62134614.lhcaa.ca
  rem-facebookcom-66454332.lhcaa.ca
-rem-facebookcom-66569106.lhcaa.ca
-rem-facebookcom-70182007.lhcaa.ca
-rem-facebookcom-71010769.lhcaa.ca
-rem-facebookcom-71985542.lhcaa.ca
-rem-facebookcom-72226758.lhcaa.ca
-rem-facebookcom-72594846.lhcaa.ca
  rem-facebookcom-76141014.lhcaa.ca
-rem-facebookcom-79017675.lhcaa.ca
-rem-facebookcom-80196596.lhcaa.ca
-rem-facebookcom-80228065.lhcaa.ca
-rem-facebookcom-81148105.lhcaa.ca
-rem-facebookcom-81199583.lhcaa.ca
-rem-facebookcom-81327049.lhcaa.ca
-rem-facebookcom-82461280.lhcaa.ca
-rem-facebookcom-83161983.lhcaa.ca
  rem-facebookcom-83898592.lhcaa.ca
-rem-facebookcom-85429594.lhcaa.ca
-rem-facebookcom-88029811.lhcaa.ca
-rem-facebookcom-88878504.lhcaa.ca
-rem-facebookcom-88940680.lhcaa.ca
-rem-facebookcom-89202088.lhcaa.ca
-rem-facebookcom-92891864.lhcaa.ca
-rem-facebookcom-93344587.lhcaa.ca
-rem-facebookcom-93598776.lhcaa.ca
-rem-facebookcom-93819327.lhcaa.ca
  rem-facebookcom-96674121.lhcaa.ca
-rem-facebookcom-98255376.lhcaa.ca
-rem-facebookcom-98820201.lhcaa.ca
-rem-facebookcom-99692749.lhcaa.ca
-rem-facebookcom-99728341.lhcaa.ca
-rem.fbcom-01067802.chekkos.mx
  rem.fbcom-02348534.chekkos.mx
  rem.fbcom-60424287.chekkos.mx
+rem.fbcom-75373033.chekkos.mx
  rem.fbcom-82180525.chekkos.mx
  remabad.com
  remaboardhouse.com.br
@@ -120598,6 +120792,7 @@ remjaxyzcjjmxpnz-dot-millinium.ey.r.appspot.com
  remlse.com
  remmabrownr.com
  remmarrkkaablleee.com
+remnegocios.com.br
  remoangeloni.es
  remodelacionesgq.cl
  remofliegner.com.net2care.com
@@ -120618,6 +120813,7 @@ remote1.ga
  remote1.gq
  remote1.tk
  remoteaccessservices.net
+remotefacilities.com
  remotemisorac.com
  remous.fr
  removal-authorising.com
@@ -120632,10 +120828,8 @@ remove-facebookcom-01132944.tizianacristofari.it
  remove-facebookcom-04429941.tizianacristofari.it
  remove-facebookcom-17191484.tizianacristofari.it
  remove-facebookcom-17405262.tizianacristofari.it
-remove-facebookcom-25381983.tizianacristofari.it
  remove-facebookcom-27320955.tizianacristofari.it
  remove-facebookcom-32043740.tizianacristofari.it
-remove-facebookcom-48740436.tizianacristofari.it
  remove-facebookcom-55097686.tizianacristofari.it
  remove-facebookcom-68230796.tizianacristofari.it
  remove-facebookcom-80222487.tizianacristofari.it
@@ -120702,7 +120896,6 @@ rendevooapp.com
  rendz-log.herokuapp.com
  renebelliveau.myjino.ru
  reneemerriman.com
-reneeways.xyz
  renegade69.zapto.org
  renegociarboletopan.com
  renegocieaymore.net
@@ -120765,6 +120958,7 @@ renovation-hosting.com
  renovbankinter.com
  renoveneers.in
  renoveseusdados.com.br
+renovianutraceuticals.com
  renowden.id.au
  rent-a-dress.xyz
  rent-a-house.xyz
@@ -120817,6 +121011,7 @@ rentry-keamanan-info-login-facebookapp5.webnode.com
  rentstraw.cyou
  rentusbil.com
  rentyouracc.ru
+renvices-cajamardes.com
  renwe-hjawdyuawd.webhop.org
  reoat-71.tk
  reoatk-71.cf
@@ -121365,6 +121560,7 @@ revisionesovalle.cl
  revistaiga.unsj.edu.ar
  revistametro.com.ar
  revistatitan.com.ar
+revistaufobrasil1.com
  revistaunipaz.000webhostapp.com
  revivafotografiaescolar.com
  reviveapi.club
@@ -121668,7 +121864,6 @@ ribatturk.com
  ribeiro-wellness.de
  riberzinco.com.br
  ribg.ooguy.com
-ribgaffe.guru
  ribi-dzophat.000webhostapp.com
  riblanda.com
  ricado.9e.cz
@@ -121889,6 +122084,7 @@ risingcare.org
  risingeast.net
  risingmarketingllc.com
  risingstarawards.co.za
+risingsunministorage.com
  risk-management-account-data-setup-support-amazon.com
  risk-management-account-data-setup-support-appleid-apple.com
  riskxai.com
@@ -121940,6 +122136,7 @@ riverswomencooperative.org
  riverviewtaxcpa.com
  riverwalkmb.com
  riverwayretail.info
+riverwayretail.net
  riveting-lash.000webhostapp.com
  rivlnvtzhjqckwmj-dot-millinium.ey.r.appspot.com
  riwpeyvmtvgvnkhc-dot-millinium.ey.r.appspot.com
@@ -122069,7 +122266,6 @@ rlwhvtqu.top
  rlwxfcjqzhcqgjet-dot-millinium.ey.r.appspot.com
  rlwyfokqtszipgngcgeohcwlrlbixaqvckqe-dot-glegen303939423233.ue.r.appspot.com
  rlxdcourixzlipbvwnxpmgrkut-dot-gleowayel400503.uc.r.appspot.com
-rm.facebookus-07423148.cleansol.lk
  rm.facebookus-16478272.cleansol.lk
  rm.facebookus-21214697.cleansol.lk
  rm.facebookus-26575660.cleansol.lk
@@ -122221,6 +122417,7 @@ robertbtc.net
  robertdays.com
  robertgfkensell-saer.com
  roberthvac.com
+robertmcardle.com
  roberto-restivo.it
  roberto-victoria.com
  robertodondi.com
@@ -122368,7 +122565,6 @@ rogers-mobility.info
  rogers-ref.info
  rogers-wireless.info
  rogers.app
-rogers.ca-sign.com
  rogers.help-bc.com
  rogerscarrier.info
  rogersmembercenter9687546.weebly.com
@@ -122584,6 +122780,7 @@ rootsroundup.com
  rootvewr.com
  rootvhcfjrxnjbqp-dot-millinium.ey.r.appspot.com
  rootwqra.com
+rooyan.in
  rop.technomatica.ovh
  ropaemporio.com
  ropergulf.net.au
@@ -122620,7 +122817,6 @@ roseburgmma.com
  roseedessalinscom.nckiaccounting.gdn
  rosemariehakim.com
  rosemarykattan.com
-rosemontnj.xyz
  rosemurphy.co.uk
  rosenbauerallianzcom.nckidirectory.gdn
  rosenbaumt.buzz
@@ -122688,6 +122884,7 @@ roundcube-uk.3876148.ciclopower.com.br
  roundcube-webmailapp-login.ew.r.appspot.com
  roundcube.gl0baltronics.com
  roundcube2020-updates.web.app
+roundcubemailagent.web.app
  roundcubemoh.web.app
  roundcubenewupdatesnet.web.app
  roundcubesernet.web.app
@@ -122780,6 +122977,7 @@ royalparkhotel.com.br
  royalplusmobile.ir
  royalpostcards.be
  royalqueennyc.com
+royalsclubinternational.com
  royalsecurityinc.com
  royalshoppee.com
  royalsr.in
@@ -123030,6 +123228,7 @@ rtdus.xyz
  rtdwkvizgmwvrndn-dot-millinium.ey.r.appspot.com
  rtedmia.shoesmogul.com
  rtefdafrweasd.epizy.com
+rtehbrblt.000webhostapp.com
  rteriodialysis.info
  rtfeddsede.gamaterial.com
  rtfg.mudisp.cn
@@ -123255,6 +123454,7 @@ runescapeapk.com
  runescapebonds-jagexawards.com
  runescaperedirect.bar
  runescapes-security.com
+runescapesbond-award.com
  runescapeservices.com
  runescapewow.zapto.org
  runescupe.com
@@ -123270,6 +123470,7 @@ runningpacking.com
  runningpolenta.com
  runningskin.xyz
  runpayrolladmin.com
+runsomes.weebly.com
  runtah.com
  runtic.com.hr
  runtimebroker.pw
@@ -123314,6 +123515,7 @@ russellville.buzz
  russia-cdek.ru
  russia-coronavirus.ru
  russiamagazine.net
+russianamericanballet.com
  russianfooddirectory.com
  russianwrestling.xyz
  russiaoutlookdd.moonfruit.com
@@ -123336,6 +123538,7 @@ rutgers.id
  ruthannadaley.com
  ruththomaz.gq
  rutiinternational.com
+rutorl.cf
  rutty-cares.000webhostapp.com
  ruugus.buahx.cn
  ruvstkipwsqoabqq-dot-millinium.ey.r.appspot.com
@@ -123490,7 +123693,6 @@ ryg.rogagot.com
  ryghthelp.com
  rygvptpulolqgjce-dot-millinium.ey.r.appspot.com
  rygwcdsliblwzdsy-dot-millinium.ey.r.appspot.com
-ryhdfre4fdf.my03.com
  ryhea.com
  ryhfdidkipjfywca-dot-millinium.ey.r.appspot.com
  ryhgu.08s4k.cn
@@ -123505,6 +123707,7 @@ rylwbdrnqrboianc-dot-millinium.ey.r.appspot.com
  rymvc.com
  rymxzyp1c.gmz.cc
  rynehazzard.com
+ryner.net.au
  rynsrw.godaddysites.com
  ryparorab.tk
  rypdegqoweysiake-dot-millinium.ey.r.appspot.com
@@ -123574,6 +123777,7 @@ s-61j.jaysbrand.com
  s-84.svcoding.com
  s-and-j.hu
  s-ashirov-mektep.kz
+s-e-e-c-u-r-i-t-e-t-y.wl.r.appspot.com
  s-emura.com
  s-epos.co.uk
  s-faceit.fun
@@ -123618,6 +123822,7 @@ s0g2.awaykart.com
  s0htr.codesandbox.io
  s0n1c.ru
  s0pg.onderhost.com
+s0s9p0pspuser.df.r.appspot.com
  s0yyweans02ytdkltawai0wmaoaeach1ohyc5wo.icu
  s1-netflix.com
  s10002.000webhostapp.com
@@ -123987,7 +124192,6 @@ safemlog.000webhostapp.com
  safensatext.me
  safenxcvbmvwwyefiwbfmbvkaowifyiuqewgf.xyz
  safenxcvbmvwwyefiwbfmbvkaowinmcxbuyqewtuirweqf.xyz
-safer.com.gt
  saferakuten.top
  safeservicesfze.com
  safestsolutions.amazinghour.com
@@ -124115,7 +124319,6 @@ saidzfqfrlapytfn-dot-millinium.ey.r.appspot.com
  saielectronicsservices.com
  saigeforestsuite.icu
  saiglobal.biz
-saiglobaltourism.com
  saigon24h.net
  saigon3t.com
  saigonbestbuy.com
@@ -124247,7 +124450,6 @@ salemzeid.com
  saleparty.su
  salermio.pw
  sales-mail.duckdns.org
-sales.balancedearnings.com
  sales.it
  sales7.net
  salesbrandsa.com
@@ -124394,6 +124596,7 @@ samerkhodeir.com
  samgong-online.co
  samhitaconsultancy.com
  samidmodemanagess.bounceme.net
+samimtech.com
  saminig.com
  saminnewgen.com
  saminprinter.com
@@ -124448,6 +124651,7 @@ samuel32.com
  samuel82-ameobi-nfqgnm.aneobi.com
  samuelchoi.com
  samuelvieira.net
+samuelyvanessa.com
  samundarmarine.com
  samuraibangalore.com
  samuray-wf.ru
@@ -124551,6 +124755,7 @@ sanjeewafb.000webhostapp.com
  sanjiemajiang.com
  sanjilkumar.com
  sanjivsteel.com
+sanjoaquinvalleybrewfest.com
  sanjosegruaencarnacion.com
  sanjosewebdeveloper.com
  sanjustoylaweb.com.ar
@@ -125082,13 +125287,11 @@ scd0.ykt.io
  scdbgloa.weebly.com
  scenepublique.net
  scenerycap.com
-sceniabay.vn
  scentematography.com
  scfh.awaykart.com
  scglobal.co.th
  scglobal.com.ph
  schachkraft.de
-schade-wangen.de
  schadenlock.xyz
  schaefer-frank.de
  schaefer-konzepte.de
@@ -125109,7 +125312,6 @@ schimsky.com
  schinnerroad.xyz
  schlafsack-test.net
  schlauchboot.ga
-schlink.net
  schluesseldienst-aufsperrdienst.at
  schlumido.de
  schmalhorst.de
@@ -125244,6 +125446,7 @@ scopesports.net
  scopoeidid.com
  scor-bankofamerica.com
  scorchplus.co.uk
+scoretitle.cyou
  scoria-int.com
  scorned-rowboat.000webhostapp.com
  scorp.ro
@@ -125277,6 +125480,7 @@ scotibank.online08scotia.com
  scotibank.online69scotia.com
  scotncolpn.com
  scottbhale.com
+scotthweg.net
  scottishwildlifecommunity.co.uk
  scottknight.com
  scottm1.000webhostapp.com
@@ -125611,7 +125815,6 @@ seasonsfcu.payrolldeposit.org
  seasontreeservice.com
  seasportstravel.com
  seatdekho.com
-seatquiet.guru
  seatrade.com.eg
  seattleareasports.org
  seattlebugsafari.com
@@ -125880,6 +126083,7 @@ secure-crdrfw.cf
  secure-cspaypal3d.osterlingotu.com
  secure-de-paiement-plp.000webhostapp.com
  secure-deletepayee.com
+secure-deviceonline.cc
  secure-dll-in.000webhostapp.com
  secure-dns-resolve.com
  secure-document-viewer-login.du.r.appspot.com
@@ -125942,6 +126146,7 @@ secure-login-update-2020.com
  secure-login.bofa-auth.alert-00001.davidmoment.com
  secure-login.cc
  secure-login.servicecondictiais.nbb.huncajsx.com
+secure-mail.serveftp.com
  secure-mailonlineaccount.duckdns.org
  secure-manage-customers-facebook.item0324238473234.com
  secure-manage.thejunglebookss.com
@@ -126014,6 +126219,7 @@ secure-pays.co
  secure-portal-user.com
  secure-ppaccount.com
  secure-processes-online.com
+secure-proton.xyz
  secure-pypalaccont2.servebeer.com
  secure-realestatecenter.stage.rsiteweb.com
  secure-recovery.xyz
@@ -126418,6 +126624,7 @@ secure.verify.paypal.com.service-access.live
  secure.veritasmoviestudio.com
  secure.voiceaccess.gq
  secure.wazbmart.com
+secure.web894.com
  secure.webmail.2020.pending-emailverification.ks.salonadut.rs
  secure.wellsfargo.policy3546.com
  secure.wellsonline.xyz
@@ -126543,6 +126750,7 @@ secure05c-ccnasee.com
  secure05c-chase.serveirc.com
  secure05c-chase3.com
  secure05c-online-chase.000webhostapp.com
+secure05c-verify.lflink.com
  secure05c.chase.com.appsecurecontentxp.site
  secure05c.chase.com.junkgasijdiwd.business
  secure05c.helisad.net
@@ -126612,6 +126820,7 @@ secure09-chase.com.nasilolunurki.com
  secure09-verify-user.gleeze.com
  secure09.ddns.net
  secure09b-chaseinfo.duckdns.org
+secure09b-cibc-account-help08.dynamic-dns.net
  secure09b-paypal.serveirc.com
  secure09b-support.org
  secure09b.chase.secureslvr.com
@@ -126667,6 +126876,7 @@ secure2.paypal.com.one-safety-help.com
  secure2.store.apple-icloud.com.superformsys.com
  secure234.inmotionhosting.com
  secure243.servconfig.com
+secure249.inmotionhosting.com
  secure267.inmotionhosting.com
  secure268.servconfig.com
  secure270.inmotionhosting.com
@@ -126794,6 +127004,7 @@ secured-0nline.xyz
  secured-2020-fastnet-classic.nz-ib.tk
  secured-amazonseo.serveirc.com
  secured-appleid.domckxa.com
+secured-banking-mydevices.com
  secured-banking.services
  secured-biller7738.info
  secured-box.icu
@@ -126864,7 +127075,6 @@ securedcurrently.weebly.com
  secureddownload.monster
  securedeliveryexpress.com
  securedeposit.redirectme.net
-securedevice-lloydsuk.link
  securedevice-online.link
  securedfastnetclassic.co.nz.nz-inbk.ga
  securedfilestransfer.com
@@ -127006,6 +127216,7 @@ securepasswel.ru
  securepavpal.xyz
  securepay.services
  securepayapal.world-heberg.com
+securepayee-hs.com
  securepayeealert.com
  securepayees-personal.com
  securepaymentapp.myftp.org
@@ -127274,7 +127485,6 @@ security.hsbc.add-checker.com
  security.hsbc.authorise-payee-now.com
  security.hsbc.caution-verification.com
  security.hsbc.confirm-added-payee.com
-security.hsbc.edit-payee.com
  security.hsbc.manage-securelink.com
  security.hsbc.payee-confirmation.com
  security.hsbc.referral-team.com
@@ -127389,7 +127599,6 @@ secvre05c.com
  secvre7c-chas3c.com
  seczxkfgaboirdanuusxkvkjjk-dot-gleowayel400503.uc.r.appspot.com
  sed-userauth-verification-verify-yur-information.kozow.com
-sedalaser.com
  sedanepal.org.np
  sedco-ss.com
  seddgtgobes.online
@@ -127460,6 +127669,7 @@ segrrsegserff.000webhostapp.com
  segrt.top
  segsx.duckdns.org
  segsx.top
+segu.cl
  seguidores.com.ar
  seguidoresdeinstagram.com
  seguimientobancanetcitibanamx.com
@@ -127706,6 +127916,7 @@ senadorarosedefreitas.com.br
  senandungmerana.org
  senary-furnace.000webhostapp.com
  senat.polnep.ac.id
+senat.poltekba.ac.id
  senatopografia.com
  senatorsweeney.com
  send-funds.boubit.com
@@ -127797,7 +128008,6 @@ seoluisuctio.tk
  seometriks.de
  seonic.top
  seonostra.com
-seoper.beget.tech
  seopoint.com
  seosprint.vipcentr.ru
  seothreesixty.com
@@ -128657,7 +128867,6 @@ setralnet.shaxiareport.top
  setriosmanli.com
  sets.edu.in
  setsd.xyz
-setshed.guru
  setsi.ph
  setskins.ml
  setsuzoku-suru.com
@@ -128785,7 +128994,6 @@ sexeducation.atspace.com
  sexgrup.info15.net
  sexgrup.x21s.net
  sexgruphotvideosindojapan.000webhostapp.com
-sexhayvienam1.ddns.net
  sexhihi.000webhostapp.com
  sexhools18.2waky.com
  sexhotgirl.000webhostapp.com
@@ -128821,7 +129029,6 @@ sexxgroupswa.joins5.com
  sexxjoin.jkub.com
  sexxjoingrup.itsaol.com
  sexxjoingrup20.dns04.com
-sexxvideossgrp.25u.com
  sexxxwhatsapp.4dq.com
  sexy-girls-ljk.blogspot.li
  sexy-ike.theworkpc.com
@@ -129050,6 +129257,7 @@ sgywap.servegame.org
  sh-sunq.com
  sh-sunvvard.com
  sh-womensstore.com
+sh.m.sxhpyy.com
  sh.wireless-cable.co
  sh.xhoao.com
  sh001.bigrock.tempwebhost.net
@@ -129065,6 +129273,7 @@ sh1128952.a.had.su
  sh1153351.a.had.su
  sh1213285.a.had.su
  sh1358402.a.had.su
+sh1453274.a.had.su
  sh2017.chancemkt.com
  sh8smmd.senandungmerana.info
  sha-30756-paperless-billing-c.consumer.fe-spectrum.net
@@ -129187,7 +129396,6 @@ shangxuzhou.net
  shangyigs.com
  shangyingfang.com
  shanifilms.com
-shanilivvyy.ru
  shannon-be.com
  shannon32432452.xyz
  shannonbanks.com
@@ -129211,7 +129419,6 @@ shapedbyorie.com
  shapeliest-task.000webhostapp.com
  shapely-morning.000webhostapp.com
  shapoorji-pallonji-gurgaon-102.in
-shappiraight.top
  shaquinta64328.xyz
  shar2345ewater.site
  shar2345ewater.space
@@ -129263,7 +129470,6 @@ sharefiletooutlook.cloudns.asia
  sharefoundation.in
  sharegdie.firewall-gateway.net
  sharegroup.info
-sharehour.guru
  shareinpectonfile.com
  sharemydiskcom.nckiconsulting.gdn
  sharepntonline.oa.r.appspot.com
@@ -129340,6 +129546,7 @@ shatorupa.com
  shattercombine.com
  shauriegrosir.com
  shaut.ru
+shavegift.cyou
  shavik197616.000webhostapp.com
  shawbillcenterload.is-a-financialadvisor.com
  shawers.ml
@@ -129407,7 +129614,6 @@ sheepeggplante.com
  sheepzinn.com
  sheerfoldy.com
  sheeriuruba.com
-sheet1.us-south.cf.appdomain.cloud
  sheewanttestayy.com
  shefdj.cf
  shefdj.gq
@@ -129450,7 +129656,6 @@ shentiya.com
  shenzhen.06rl.com
  sheoen.com
  sheraleetour.com
-sheration.top
  sherazsaleem.softvion.com
  shere-point-document-365.oa.r.appspot.com
  sherman.org.za
@@ -129520,6 +129725,7 @@ shifturethra.com
  shifty-poison.000webhostapp.com
  shigrigroup.com
  shijihuandao.com
+shikh-ali-magribi.co
  shikhafd.org
  shikinka.000webhostapp.com
  shikshadarshan.in
@@ -130119,6 +130325,7 @@ sidehustlemarketer.co.uk
  sidereal-plots.000webhostapp.com
  sidet.com.mx
  sideward-depots.000webhostapp.com
+sidmouthcs.com
  sidneyradial.xyz
  sidonycrealestate.com
  sidore.com.ua
@@ -130164,7 +130371,6 @@ sigeifgator.com
  sigepromo.com
  siggnninattemail.weebly.com
  sigh-812.cf
-sighlaured.top
  sigi.com.au
  sigin-pagemail33.servebeer.com
  sigin-pemblokiran-fb20.gq
@@ -131050,7 +131256,6 @@ sindhgames.com
  sindhrealestate.com
  sindhusupercleen.com
  sindicato1ucm.cl
-sindicatodeseguridad.com
  sindicombustiveis.com.br
  sindobatam.com
  sinefocvchcocsorjpmmmiyrer-dot-gleowayel400503.uc.r.appspot.com
@@ -131059,6 +131264,7 @@ sinergia-planificacion.com.mx
  sinergica.es
  sinergikz.000webhostapp.com
  sinergitelematika.com
+sinful-bombs.000webhostapp.com
  sing.einloggen-ebay.de.jupesa.com.ec
  singchan.studio
  singed.otzo.com
@@ -131118,7 +131324,6 @@ siolnet.yolasite.com
  siomaykomplit.com
  sipahielektrik.com
  sipai888.com
-sipainmd.com
  sipamal.com
  sipesv.org
  sipgmbhcom.shaxiaact.top
@@ -131127,7 +131332,6 @@ siphonsailorv.com
  siping.yfqzdfd.com
  sipkvntbczuvpjiwhdfdxsemhyfrljrylyve-dot-spyexc3093493.ey.r.appspot.com
  sippetsinvoicing.com
-siprisk.guru
  sipstroysochi.ru
  sipunculid-dictiona.000webhostapp.com
  sira7md.ddns.net
@@ -131541,6 +131745,7 @@ sklirisrealestate.gr
  skllog.ru
  skmaircoon.com
  skmc.in
+skmoha.xyz
  sknaquatech.com
  sknrtel.com
  skokie-inv-auth.net
@@ -131676,7 +131881,6 @@ slashingdelegator.win
  slasoalepmao.mybigcommerce.com
  slasquareup.com
  slatenctionnit.xyz
-slation.cyou
  slausonswapmeet.net
  slavik.meltser.info
  slavov.studio
@@ -131776,7 +131980,6 @@ sloaneandhyde.com
  sloar.xyz
  slofrightfest.com
  sloganoxbow.com
-sloka.constantcontactsites.com
  slomiter45u.us
  slon3kjmd.duckdns.org
  slonncarelin.com
@@ -132039,6 +132242,7 @@ smbc-card.com.jp-webpcusa0201uip02scrdodnsfromwebhosting.xyz
  smbc-card.com.jrejgfxjarehbdshsa.xyz
  smbc-card.com.lbdsa.com
  smbc-card.com.lyutlytulytulyutltyugf.shop
+smbc-card.com.nuyzeqnc.com
  smbc-card.com.presoul.com
  smbc-card.com.qwgsdagwgsapro.xyz
  smbc-card.com.rltxsm.com
@@ -132051,6 +132255,7 @@ smbc-card.dbyzq87bhs.xyz
  smbc-card.mobi
  smbc-card.net.cn
  smbc-card.pmlsqp.com
+smbc-card.pqsdeet.cn
  smbc-card.top
  smbc-card.unicomassist.com
  smbc-card.vip
@@ -132088,10 +132293,12 @@ smbc-cn.com
  smbc-co-jp.shop
  smbc-co-jp.vip
  smbc-co-jp.xyz
+smbc-co.kytgeszc.best
  smbc-jdauw.com
  smbc-jdauw.me
  smbc-jp.club
  smbc-pa.com
+smbc-qwerqwer.zzqhb.com
  smbc-vpass-reset.com
  smbc-vpass.fi
  smbc-vpass.live
@@ -132213,13 +132420,11 @@ smikgfd.godaddysites.com
  smilebaby.in
  smilegate-cfs.epizy.com
  smilehousecafesf.buzz
-smileplz.com
  smilerryan.com
  smiles-bbpontosresgate.com
  smiles.al-wed.com
  smilesanitations.com
  smilexone.com
-smiltisfiest.cyou
  smineolo39wings.in
  smiothmadara.ug
  smiplus.com.mx
@@ -132312,6 +132517,7 @@ sms.agencia-digitals.com
  sms.clienteaprovado.com
  sms.clientebb.me
  sms.empresitapp.com
+sms.iset.ro
  sms.prganvani.com
  sms110.net
  smsalerta-viabcp.com
@@ -132476,7 +132682,6 @@ snnbcwebs-help.xyz
  snnbcwebs-helps.xyz
  snnbcwebs.xyz
  snnmnkxdhflwgthqismb.com
-snoeker.com
  snoginei.com
  snome.tk
  snomoln.se
@@ -132488,6 +132693,7 @@ snoringsleepstopsapnesa.us
  snortcnc.duckdns.org
  snowagainfearfreezesagainagainitfeelslikeiceisinmyhands.space
  snowap.xyz
+snowboardyardt.com
  snowcamp.org
  snowiegame.com
  snowlike-analyst.000webhostapp.com
@@ -132495,7 +132701,6 @@ snowman720.com
  snowpower.xyz
  snows-filmes.000webhostapp.com
  snowtecccom.nckiemployment.gdn
-snowtraveller.com.au
  snp2m.poliupg.ac.id
  snpbilling.net
  snpdk.addroits.com
@@ -132539,7 +132744,6 @@ soapcafemalta.com
  soaponline.org
  soapstampingmachines.com
  soaquitempromocao.site
-soardie.guru
  soaresjf.com
  soaring13.free.fr
  sobafin.com
@@ -132658,7 +132862,6 @@ socialinkedsweden.000webhostapp.com
  socialistic-meridia.000webhostapp.com
  socialldownload.000webhostapp.com
  socialleys.info
-sociallistsystem.com
  sociallysavvyseo.com
  socialmediabluebadge.com
  socialmediafactory.se
@@ -132727,7 +132930,6 @@ sofrehgard.com
  soft-portal.ml
  soft-shell-destinat.000webhostapp.com
  soft-spoken-satelli.000webhostapp.com
-soft.110route.com
  soft.114lk.com
  soft.serveftp.com
  soft.xp666.com
@@ -132779,6 +132981,7 @@ softwarestorage.club
  softwareupdate.ga
  softwayvn.com
  sogarecordings.com
+sogemadgestion.com
  soggerfpt.com
  sogiitx.org
  sogive.net
@@ -132901,6 +133104,7 @@ sollutions-network.com
  solnaciente.com.ec
  solo-credit-rapide.over-blog.com
  solo-international.com
+solobuenasideas.com
  solod.bounceme.net
  sololearnquiz.000webhostapp.com
  sololike2341.000webhostapp.com
@@ -132982,7 +133186,6 @@ somlalitschool.org
  somnatros.com
  somnolent-diagnosti.000webhostapp.com
  somnukschool.com
-somosdrucken.com
  somosfabula.cl
  somoshentes.com
  somosleyendas.cl
@@ -133278,6 +133481,7 @@ sovogin.com
  sow101.com
  soweqs.xyz
  sowr-paypalservis5g.servebeer.com
+sowseglass.com
  soxlablengdiumenet.xyz
  soxmi.vipsnapchatsexting.com
  soxzc.000webhostapp.com
@@ -133287,6 +133491,7 @@ soybarrabrava.com
  soydigitalbns1d.com
  soyperito.com
  soysass.buzz
+soytablaroquero.com
  sozkbhxw.goruli.com
  sozlerderyasi.com
  sozocoffee.org
@@ -133334,6 +133539,7 @@ spacermedia.com
  spacesarchitects-ka.com
  spacesolutions.com.cy
  spaceteampo.net
+spaceweba.com
  spaceweba.net
  spaceworkstudios.com
  spacex-fund.com
@@ -133362,7 +133568,6 @@ spamjrty.org
  spammingvic.com
  spancs.com
  spandytool.com
-spanferkelgrill-verleih.com
  spanflattop.co.za
  spanishwithmireia.com
  sparanta.net
@@ -133465,6 +133670,7 @@ spdentalclinic.com
  spdodoma.com
  spdshs.com
  speakandlead.info
+speakerpedia.in
  speakerrepairs.co.za
  speakerscovers.club
  speaklishworld.com
@@ -134103,6 +134309,7 @@ srodkidlagastronomii.pl
  sromano.it
  sroomf70nasiru.duckdns.org
  srr.servequake.com
+srrom.ro
  srsdatuksimonfung.edu.my
  srskgroup.com
  srsshodhsansthan.org
@@ -134111,6 +134318,7 @@ srsvalid.cudraz.com
  srtipe-acc.com
  sruedlqzbdeglfvgmebwhsgfqz-dot-gleowayel400503.uc.r.appspot.com
  srushtiinstitutemncl.com
+srutbmi.ml
  srv-amazonservic9k.servebeer.com
  srv-applelckdservpa.serveirc.com
  srv-externaluserlogin-amazon.gleeze.com
@@ -134202,11 +134410,14 @@ srv89621.ht-test.ru
  srv89732.ht-test.ru
  srv89744.ht-test.ru
  srv89749.ht-test.ru
+srv89759.ht-test.ru
  srv89760.ht-test.ru
  srv89820.ht-test.ru
  srv89832.ht-test.ru
  srv89860.ht-test.ru
  srv89867.ht-test.ru
+srv89887.ht-test.ru
+srv89889.ht-test.ru
  srvceabsepstshelprcvy22.site
  srvcehelppstsabse343.site
  srvcpgehlp01cnfrm.my.id
@@ -134505,7 +134716,6 @@ stall-rosenbusch.com
  stallbyggen.se
  stalliongraphics.com
  stalliorsport.com
-stally.top
  stalussnip.com
  stametcurug.com
  stamfordvt.buzz
@@ -134525,7 +134735,6 @@ standated.xyz
  standbyyoucoaching.com
  standessential.top
  standingovationsentertainment.com
-standontheedge.com
  standortnoeat.nckieducation.gdn
  standproud.com.au
  standrew.co.kr
@@ -134550,6 +134759,7 @@ starbritekuwait.com
  starcadecapital.com
  starcalculate.xyz
  starconsultation.com
+starcountry.net
  stardealerportal.com
  stardewvals.org
  starf1.000webhostapp.com
@@ -134610,9 +134820,9 @@ startmarkets.com
  startnewage.space
  starto-de.integratedpattern.com
  startoptions.com
-startorline.info
  startpa.ru
  startpricetab.ru
+startrade.iset.ro
  startrm.ru
  startseite-verden.de
  startseunegocio.com
@@ -134665,6 +134875,7 @@ stateunico.com
  statewooddog.com
  static-ak-fbcdn.atspace.com
  static-lkord.3utilities.com
+static.124.97.119.168.clients.your-server.de
  static.133.209.217.95.clients.your-server.de
  static.147.129.47.78.clients.your-server.de
  static.210.109.130.94.clients.your-server.de
@@ -134688,9 +134899,11 @@ statos.xyz
  stats.charleswbrownonline.com
  stats.paypal.com-informationaccounts.com
  stats.sitelemon.com
+stats.softoptions.com
  stats.stopthecase.com
  statsrc.cool
  statsrichwork.com
+statsseotraff.xyz
  status-2879.paypal.at-kundeninfo.tk
  status-fargo-contact.com
  status-login-wells.mobi
@@ -134915,7 +135128,6 @@ steamdfol.ga
  steamdiff.tk
  steamdota2case.pp.ru
  steamdrq.xyz
-steamenemy.guru
  steamev.gq
  steamfck.xyz
  steamfest.net
@@ -135124,6 +135336,7 @@ step1-reset-password.now.digitalfm107.com
  step9999yulecheng.tavmo.com
  stepbystep.saves-the-whales.com
  stepbystep.watch
+stepcute.cyou
  stepcute.xyz
  stephanehamard.com
  stephanidaee.com
@@ -135168,7 +135381,6 @@ sterridges.info
  stethosglobenet.nckitickets.gdn
  steubershore.xyz
  steuer-kel.de
-steuerbuero-nack.de
  steuerfreistellungcom.batwoqiseries.top
  steumcommuity.org.ru
  steustachius.org
@@ -135523,6 +135735,7 @@ strdashport.com
  strdashport.me
  strdashport.net
  strdashport.org
+streamcommuinty.com
  streamcommuniti.xyz
  streamcommunlty.com
  streamerzradio1.site
@@ -135540,7 +135753,6 @@ streamsfilms.com
  streamshroud.ru.com
  strearncommunity.xyz
  streck.com.br
-strects.top
  streefkerk.be
  streetfile.org
  streetkan.com
@@ -135876,7 +136088,6 @@ subsessilecrash.htmlpasta.com
  subsiliodev1.com
  subsolar-harmonies.000webhostapp.com
  substime.xyz
-subtlesolutions.co
  subtlestbireme.online
  subtriangular-maneu.000webhostapp.com
  subul.com.sa
@@ -136123,6 +136334,7 @@ sugarpuffstore.com
  sugart.dynamic-dns.net
  sugarygrowerz.com
  suggenesse.com
+suggesteggplantr.com
  suggestration.xyz
  sugilicali.zbel50.now.sh
  sugiono123.000webhostapp.com
@@ -136146,7 +136358,6 @@ suisjkf.ga
  suit-able.com
  suitablefoodsja.com
  suitcaserockers.com
-suite.kpechios.gr
  suited-permits.000webhostapp.com
  suitelimit.cyou
  suitsforseniors.com
@@ -136195,7 +136406,6 @@ sultangame-etkinlik.com
  sultangunner.com
  sultonousero.com
  sultrax.com.br
-suma-kemper.de
  sumadinanhe.com
  sumadosa.ml
  sumaktsac.com
@@ -136209,7 +136419,6 @@ sumbar88rancak01.xyz
  sumdany.com
  sumenterprise.com
  sumeyemozlen.blogcu.com
-sumikhan.com
  suministrohosteleria.com
  suministrosdelimpieza.elesplendor.com
  suministrosralovi.com
@@ -136219,6 +136428,7 @@ sumitomo-mitsui-banking-corporation.b8fzk.cn
  sumitomo-mitsui-banking-corporation.dezddftson.xyz
  sumitomo-mitsui-banking-corporation.hoopdc.com
  sumitomo-mitsui-banking-corporation.pmlsqp.com
+sumitomo-mitsui-banking-corporation.pqsdeet.cn
  sumitup.co
  sumki-vip.com.ua
  summary-paymeny-appleid.apple.jangakeun.com
@@ -136297,7 +136507,6 @@ sundancer29.com
  sundarbonit.com
  sunday.com.ua
  sundaymonday107.live
-sunde-computer.de
  sundeckdestinations.com
  sunderfoods.com
  sundersls.weebly.com
@@ -136710,6 +136919,7 @@ support-user-id-1386az8h4d5.com
  support-venmo.com
  support-verif.myvnc.com
  support-verification.dynamic-dns.net
+support-verified-badge.com
  support-verify-wells.com
  support-vpass-smbc-card.com
  support-wells-apps.com
@@ -136909,6 +137119,7 @@ supportonlinesecurity.com
  supportpages2020.my.id
  supportpages2211.cf
  supportpages22211.cf
+supportpay-online.com
  supportpaypal8.serveirc.com
  supportpgepp-manage.forumz.info
  supportprotect.pw
@@ -136962,6 +137173,7 @@ supptchoice.000webhostapp.com
  supptyahoo.weebly.com
  suprabasidorsal.info
  supracapitals.com
+supradesk.ro
  supraprcorremamae-segurapreccs.com
  suprcoolsupplies.com
  supremebands.com
@@ -137092,6 +137304,7 @@ susp-italliness.gotdns.ch
  suspect-ppal.xyz
  suspended-auth.com
  suspended-crops.000webhostapp.com
+suspended-recover.serveusers.com
  suspension-aws.com
  suspgercvrysrvce01.my.id
  suspicious-activity-paypal.vrfd-arz-sppt4.com
@@ -137303,6 +137516,7 @@ sweet-bud.com
  sweetbabytunes.com
  sweetbasilalabama.com
  sweetclementinespops.buzz
+sweetclothing.co.uk
  sweetdaysbar.com
  sweetgrassplasticsurqery.is-a-doctor.com
  sweethomecochusa.org
@@ -137330,6 +137544,7 @@ swer8y.xyz
  swerlinggol.com
  swervepoinytq.ga
  sweyleyre.com
+swflp.com
  swfse.xyz
  swfw.tilianyungang.cn
  swguro.com
@@ -137352,6 +137567,7 @@ swindongardeners.com
  swingcommerce.com
  swingersdance.com
  swingmastersgolf.com
+swingproof.com
  swipefools.com
  swipenearn.com
  swipenippy.com
@@ -137380,6 +137596,7 @@ switchclub.it
  switchgain.com
  switchnets.net
  switech.it
+switelandeer.xyz
  switzerladencom.shuiacarry.top
  switzerland-capital.com
  switzerlandrental.top
@@ -137724,7 +137941,6 @@ t-mobile-technical.org
  t-mobilehelp.org
  t-mrz.svcoding.com
  t-online.de.rongouniversitychaplaincy.com
-t-privat.de
  t-uber-sa.com
  t-uber.app
  t-uber.cam
@@ -137792,6 +138008,7 @@ t597.regardisperfectshild.ru
  t5a-712com-e-bons.com
  t5xcbseh.xyz
  t60w.mentriqq.com
+t61.emails.nationaltrust.org.uk
  t666v.com
  t6logs.sytes.net
  t6ue-e-tudo-de-bom.com
@@ -137891,10 +138108,10 @@ tafertergr.com
  tafrdghujvngh.weebly.com
  tafsong.net
  tafultaineasare.tk
-tagamoga.de
  taganu.com
  tagbdfgxtpjmrrqlkdobsecwrictgpzimfog-dot-spyexc3093493.ey.r.appspot.com
  taghrib.com
+tagrich.com
  tagrijn-emma.nl
  tags-bootstrap.icu
  tahanikhawaji.com
@@ -138079,6 +138296,7 @@ tamirkhan.ir
  tamkean.com
  tamlen.com
  tampaallen.com
+tampafl.xyz
  tampatutorsforkids.com
  tampertastefulr.com
  tampilbeda.id
@@ -138088,7 +138306,6 @@ tamsuamy.com
  tamsucongai.net
  tamultihousing.com
  tamviagensabc.tur.br
-tamymakeup.com
  tan-shuai.com
  tanaduke.com
  tanakagrpcom.baerseventhere.top
@@ -138103,9 +138320,11 @@ tandaeldecks.com
  tandartspraktijkhartjegroningen.nl
  tandartspraktijkheesch.nl
  tandempropertiesnj.com
+tandenblekenhoofddorp.nl
  tandf.xyz
  tandinbhutantravel.com
  tandlonline.com
+tandrs.co.uk
  tandyjayjay.mikestrailer.live
  tanerm.ug
  tangbingyue.com
@@ -138146,6 +138365,7 @@ tantiengiang.vn
  tanubooks.shop
  tanujatatkephotography.com
  tanumanu.ga
+tanushthakor.com
  tanyadelavega.com
  tanzprojekt.com
  tanzschule-kieber.de
@@ -138229,7 +138449,6 @@ tarynminterlaw.com
  tarztarzpumperon.info
  tarzthlserngguard.com
  tasarrufvakti.com
-tasawurfire.com
  tasawwufinstitute.com
  tasbeka.com
  tascadatiaju.com
@@ -138326,6 +138545,7 @@ tax-submit.bad.me.uk
  tax-wewill.jp
  tax.hm-1ref.com
  tax.hm-ref1.com
+tax.rebate-gov.com
  tax.rebates-uk1.com
  tax.refund-form339.com
  tax.refund-form689.com
@@ -138577,6 +138797,7 @@ teaminboxmail.000webhostapp.com
  teamincbenefits.com
  teamincubation.org
  teaminstagram.0fees.us
+teammotivation.in
  teamnetaccnt-setup.com
  teamnetflxacctsetu.com
  teamoffice.homelinux.com
@@ -138924,7 +139145,6 @@ telecomege.shop
  telecomholdingsllc.com
  telecomjobfinder.com
  telecomsolutionsllc.com
-teleconx.com
  telecredito-empresas-peru.webinrebak.com
  telecreditobcp.webcindario.com
  telecreditobcp.website
@@ -139103,6 +139323,7 @@ tenwhinilci.ml
  teocaltiche.com.mx
  teolp45.dyndns.dk
  teoresp.com
+teoriafloral.com
  teorija.rs
  tepcian.utcc.ac.th
  tepcoti.com
@@ -139349,7 +139570,9 @@ test11.ddns.net
  test12.com-find2.us
  test121212bitebite.000webhostapp.com
  test123.starcarrent.ge
+test2.botrise.ro
  test2.easyplanet.fr
+test3.botrise.ro
  test32038.futurehost.net.pl
  test3653.club
  test45634446.hopto.org
@@ -139495,7 +139718,6 @@ textrefwinfo.ru
  texusit.com
  texveka.ru
  teyawzd.goruli.com
-teyeue.tokyo
  teyse.xyz
  teyue.xyz
  tez-tour.site
@@ -139674,6 +139896,7 @@ the-gamer-zone.000webhostapp.com
  the-gordons.net
  the-instagramhlp.0fees.us
  the-kyliejenner-collection.000webhostapp.com
+the-lobby.org
  the-poms.com
  the-shoemakers.com
  the-vegan-shop.com
@@ -139741,6 +139964,7 @@ thebaptistfoundationofca.com
  thebaptistfoundationofcalifornia.com
  thebaptistfoundationofcalifornia.net
  thebarbeeston.co.uk
+thebarbersden.uk
  thebaseballs.ru
  thebasementcompanylondon.co.uk
  thebdhost.com
@@ -139767,6 +139991,7 @@ thebizcircle.com
  theblackcadstudio.com
  theblackfun.000webhostapp.com
  theblackgirlguides.com
+theblackroom.ca
  theblacksheep.org
  theblazingshutters.com
  theblogchamp.com
@@ -139821,7 +140046,6 @@ theclubms.com
  thecoachwebsite.com
  thecoastaltimes.media
  thecolortheory.com
-thecomedycrowd.com
  thecomicshop.net
  thecommitmentproject.net
  theconcept.am
@@ -139836,7 +140060,6 @@ thecove.org.au
  thecoverstudio.com
  thecrazychique.com
  thecreativecafe.co.uk
-thecreativeronin.com
  thecreatort.com
  thecreditcompass.org
  thecreekpv.com
@@ -139891,7 +140114,6 @@ theentrepreneursprimer.com
  theersda.com
  theesuites.com
  theexcellenceaddiction.com
-theexchangemascot.com
  thefabricstudio.in
  thefaceboook.com.identity.signinv2.ru
  thefantasticviolinaires.org
@@ -139901,6 +140123,7 @@ thefashionoffice.com
  thefgawaewrw.com
  thefieldagent.net
  thefifththirdbank.com
+thefinalinterview.org
  thefinalroundnews.com
  thefirts-com.preview-domain.com
  thefirtss-com.preview-domain.com
@@ -140043,6 +140266,7 @@ thelakesnv.xyz
  thelanespa.com
  thelasallian.com
  thelashroomatsalonroxy.com
+thelatinkitchen.com
  thelaughnet.com
  thelavanyabanquet.com
  thelawaxion.xyz
@@ -140072,6 +140296,7 @@ theloftrehab-pdf.me
  theloftrehab-pdf.org
  theloghouse.co.in
  thelogodept.com
+thelongevityrevolution.com
  thelonpogo.com
  theloopexclusive.com
  theloopfoundation.org
@@ -140171,6 +140396,7 @@ theonlineboaup.com
  theonlinechase.com
  theonlygoodman.com
  theoqri.com
+theoriginalstoryclub.com
  theorized533az.pw
  theorymusiconline.com
  theoryterm.cyou
@@ -140191,6 +140417,7 @@ thepassionpundit.com
  thepatternoflife.com
  thepawnshoponline.xyz
  thepcsystem4.xyz
+thepenilizer.com
  thepennypocket.com
  theperfectiondetox.com
  theperfectkitandcompany.com
@@ -140245,6 +140472,7 @@ therationalafrican.co.ke
  therattgang.com
  therealabd.ca
  therealmormon.com
+therealproductsonline.com
  therealstephaniemurphy.com
  therealtycircle.com
  therearemoments.tk
@@ -140494,7 +140722,6 @@ thkiqbudhxdwgipgmuwinkbpje-dot-gleowayel400503.uc.r.appspot.com
  thoatran.000webhostapp.com
  thobartwealth.com
  thodoronment.info
-thogicid.cyou
  thoitrangsile.org
  thoitrangstaup.com
  thoitrangzayoko.com
@@ -140654,7 +140881,6 @@ three.co.uk.session-id-jnwij293i8977dsn55688hga8669nd194jaj0ap889.dashbuy.rw
  three.co.uk.unpaid.july-2020.icu
  three.confirm-bill.net
  three.confirmbilling.com
-three.failedbill-payment.com
  three.gb-uk.co.uk
  three.id-update.com
  three.mobile-ecare.com
@@ -140698,6 +140924,7 @@ threebillinguk.com
  threebills.co
  threebrothersmoving.net
  threeconfirm.co.uk
+threecustomers.co.uk
  threecustomerservicefix.com
  threehelp.org
  threehelpteam.com
@@ -140746,6 +140973,7 @@ threeverifybilling-2020.com
  threeverifydetails.com
  threlasel.com
  threololic.com
+thriftswapapp.tk
  thriftyformals.com
  thrillgeek.com
  thrivaltactic.com
@@ -140780,7 +141008,6 @@ thuerptdmlpglatmgzxtmjnjwrfptclatymv-dot-gl494903049.wl.r.appspot.com
  thugesh.ml
  thuglife.host
  thuillier.marc.free.fr
-thulilekhanyile.co.za
  thumbnaill.buzz
  thumbtrister.com
  thumpmagical.top
@@ -140867,6 +141094,7 @@ tien5s.com
  tienaris.com
  tienda-bombillo.000webhostapp.com
  tienda.inelecsis.com
+tiendademodainfantildetalles.es
  tiendajuanvaldez.com
  tiendamiracolo.com
  tiendapablus.net
@@ -140959,10 +141187,10 @@ tilt-ed.com
  tiltanman.duckdns.org
  tiltroom.com
  tiltteexx.co
+tim-pagamenti.com
  tim-riccarca.com
  tim99.net
  timacker3423dsdf54dgf.ru
-timamollo.co.za
  timaoxz0sa17anxious0sable7730.wn.r.appspot.com
  timaxotiau.net
  timber-framed-sound.000webhostapp.com
@@ -141047,10 +141275,8 @@ tinbaomoi24h.net
  tincafrica.com
  tinckorm.beget.tech
  tinderaccountpictures.000webhostapp.com
-tinderlocals.com
  tinderphotocom.shaxiabeauty.top
  tindubaii.000webhostapp.com
-tinerservis.com
  tinfosrierla.yolasite.com
  tingchaojianxin.com
  tingdrinkscaddy.com
@@ -141097,7 +141323,7 @@ tioflaninat1974.blogspot.be
  tioflaninat1974.blogspot.com
  tioguadenolite.tk
  tioguards.ml
-tionds.top
+tiole.com.tr
  tionhrzisllsztion.com
  tioq.ga
  tioreboubo1987.blogspot.be
@@ -141148,7 +141374,6 @@ titantech.co
  titantrade.com
  titelinedrillingintl.yolasite.com
  titlesettlements.com.au
-titleyard.guru
  titmewn.com
  tito30.ddns.net
  titoantonio.com
@@ -141165,6 +141390,7 @@ tivoli.nu
  tixon.mooo.com
  tixon.website
  tiyait.com
+tiyart.cam
  tiyasarkhoj.com
  tizane.com
  tj-ce.svcoding.com
@@ -141178,7 +141404,6 @@ tj25.svcoding.com
  tj2u1smd13.firebaseapp.com
  tj7si.weblium.site
  tjdagngdsshyiglvldcjemeyiumtmdezeccb-dot-glegen303939423233.ue.r.appspot.com
-tjdengler.info
  tjenterprises.com.pk
  tjfr.tk
  tjfyskj.com
@@ -141201,6 +141426,7 @@ tk-cruise-mee.info
  tk-vostok.ru
  tk-w.ailacabs.com
  tk.worldtreeyoga.org
+tk10.tokyo
  tk3m7.alnawwar.com
  tk4y.jaysbrand.com
  tkaystore.com
@@ -141218,7 +141444,6 @@ tknoll.free.fr
  tknowledgy.com
  tkozlowski.ct8.pl
  tkpbearings.com
-tkpl.in
  tkqb.goruli.com
  tkqilfzuxfyctpenmpcjxqiqnu-dot-gleowayel400503.uc.r.appspot.com
  tkr.co.id
@@ -141369,7 +141594,6 @@ toblatcous.com
  tobmojiol2adf.com
  tobrdavid.com
  tobulb.buzz
-toby-warren.com
  tobylowczoraj.cyou
  toc-goldratt.com
  tocadoacai.com.br
@@ -141392,6 +141616,7 @@ todayais.com
  todayalbanianews.info
  todaybirthdayfamous.com
  todaycricketprediction.com
+todayif.com
  todayissoftware.com
  todaylink.tk
  todaynews9.in
@@ -141415,7 +141640,6 @@ todiplywood.com
  todlfdjw.godaddysites.com
  todo-dia-temofertasluiza.com
  todocaracoles.com
-tododiabetes.mx
  tododiaeseudiaonlinequarentena.ml
  tododiaumanovaofertapravc.com
  tododiiaumaofertaexclusivaparavoce.com
@@ -141439,6 +141663,7 @@ toetats.com
  tofekeh.co.cc
  toffeeapplesinc.com
  tofighigasht.ir
+tofita.us
  tofynfpxpghjkcakyobyabxuxq-dot-gloff849483.uk.r.appspot.com
  togaauctions.com
  togatta.com.br
@@ -141685,6 +141910,7 @@ topfastweb.com
  topfault.cyou
  topfivela.com
  topfivex.com
+topfoodseafood.com
  topgadgetblue.com
  topgolfreviews.com
  topgomdinfb.com
@@ -142099,6 +142325,7 @@ tracocivil.com
  tracstar.co.za
  tractocerv.com
  tracy.smartfirstoutlet.ru
+tracylalla.com
  tradabank.com
  tradarea.com
  tradaxa.com
@@ -142118,7 +142345,7 @@ tradefactsltd.co.uk
  tradefair.duckdns.org
  tradefb86756453453647875.com
  tradegit.top
-tradegood.tokyo
+tradehuge.cyou
  tradehuge.xyz
  tradehuntmgmt.in
  tradeinreviewfile.xyz
@@ -142217,6 +142444,7 @@ trainingcswni.company
  trainingenterprise.com.mx
  traininginstituteahmedabad.com
  trainings.smartscape.eu
+trainings.tvetjobs.com
  trainsagain.sytes.net
  trainyourdogs.myvnc.com
  traitementtransactioneurope.000webhostapp.com
@@ -142348,7 +142576,6 @@ tranzact.groceryshop.ae
  tranzpander.xyz
  trapesweb.com
  trapezblechverkauf24.de
-trapfeel.guru
  trapiantofue.it
  trapone.xyz
  trappie.nl
@@ -142567,6 +142794,7 @@ triathlonontario-my.sharepoint.com
  triathlontraining5.com
  tribal-logic-286210.uc.r.appspot.com
  tribalsignatures.com
+tribeinfinity.com
  tribelessappalachiahun.quickwebchecker.com
  tribratanewsbondowoso.com
  tribu-ltd.com
@@ -142633,7 +142861,6 @@ trinnux.com
  trinomulkantho.com
  trint390293.com
  trintahorasaoseulad-com.umbler.net
-trioecious-nerve.000webhostapp.com
  triofenix-pt.com
  triofleetw.com
  trioholzbaucom.chifanbudget.top
@@ -142671,6 +142898,7 @@ tripsit.info
  tripticksorg.chifanblock.top
  triptixgmbhcom.shaxiaadd.top
  triptixgmbhcom.shaxiaca.top
+triptoca.com
  triptovacations.com
  triptravel.co
  tripuramatrimonial.com
@@ -142730,6 +142958,7 @@ trotdeiman.ga
  troubleshootservice.com
  troubletobyr.com
  trouserlanditd.com
+troutanimations.com
  troutystech.com
  trouvetonhandisport.be
  trouwcheques.nl
@@ -142784,6 +143013,7 @@ trueholisticlifestyle.com
  truehrana.space
  truein-264db.web.app
  truelifemedicare.com
+truelyticit.com
  truemansmoke.com
  truemkt.net
  truenextsrf.com
@@ -142998,6 +143228,7 @@ ttlcxqubtyokenzqsvpjhbugyp-dot-gleowayel400503.uc.r.appspot.com
  ttlrecycling.com
  ttlworldbaseballclassic.com
  ttm-yahoomail.weebly.com
+ttmfqvgashxcwsgvbc.top
  ttmvaosz.vipsnapchatsexting.com
  ttn6.svcoding.com
  tto.com.sg
@@ -143011,6 +143242,7 @@ ttreg45.com
  ttrtw.com
  ttrufusionscottsdale.com
  ttsalonspa.ca
+ttson.name.vn
  ttt.hm00h8.cn
  ttte.website
  ttw-yahoomail-com.weebly.com
@@ -143211,6 +143443,7 @@ turns.flecreyeow.nl
  turnstile.net.au
  turpialexpress.com
  turpwo.co.uk
+turquoise-ritzy-gasosaurus.glitch.me
  turretglobal.com
  tursaf.org.tr
  turtalya.com.tr
@@ -143358,6 +143591,7 @@ twdseras.com
  tweaksoft.xyz
  tweeting.tk
  twelimur.com
+twendesafaris.com
  twenty5uk.com
  twentysevenlooks.com
  twenzsh.club
@@ -143925,6 +144159,7 @@ uenjt.rogagot.com
  uentenu.com
  ueoevhuhhkbdcvkvggbxqwmyps-dot-gleowayel400503.uc.r.appspot.com
  uepl.com.pk
+ueprnynmjzuychqzyf.top
  ueqtmovbtumwipiylbphgamyjm-dot-gloff849483.uk.r.appspot.com
  uer.reiykiq.ir
  uetac.goruli.com
@@ -143938,6 +144173,7 @@ uf0jh.cene.cc
  ufa888.com
  ufcscyszdpsjkqhbxw.top
  ufctaekwondo.com
+ufero.co.za
  uffsfydddf.com
  uffydddftv.com
  uffydddfusa.com
@@ -143976,6 +144212,7 @@ ugmalhquhbuswkgqqscghaconfnemrsxfdtu-dot-glegen303939423233.ue.r.appspot.com
  ugnkekrkacoafkgdn.top
  ugnodon1.com
  ugo.ad-cup.com.au
+ugoiusosf.cf
  ugottahavea.com
  ugovendut.com
  ugovlahovic.hr
@@ -143996,7 +144233,6 @@ uhfgkztmeaszoupkzoidkpadpc-dot-gleowayel400503.uc.r.appspot.com
  uhfzjfablnxcdbmohpmgraxuhnvgqfedfiqv-dot-glxcel49934343434.rj.r.appspot.com
  uhhg.45ii5w.cn
  uhjcejbfnhkisvwbwzezyvsqsp-dot-gleowayel400503.uc.r.appspot.com
-uhlenbusch.info
  uhnbr.xyz
  uhoibougyohouhpyh87yy-chase.duckdns.org
  uhomes.in
@@ -144188,6 +144424,7 @@ ukrembtr.com
  ukresolvethree.com
  ukrestrictionpaypal.com
  ukrhockey.info
+ukronet.ru
  uksa.in
  uksecureverify.com
  ukservice.org
@@ -144288,7 +144525,6 @@ umapreowned.com
  umasoalma.com
  umattr.info
  umbilicum.com
-umbrarace.com
  umbrellacorp.id
  umbrellas-cars.com
  umbrellasmanufacturers.com
@@ -144386,7 +144622,6 @@ uncomely-requiremen.000webhostapp.com
  uncomfermed.com
  uncommoncbd.com
  uncompelled-shears.000webhostapp.com
-uncompersick.cyou
  unconciliatory-grip.000webhostapp.com
  unconfessed-seam.000webhostapp.com
  unconfused-dam.000webhostapp.com
@@ -144599,6 +144834,7 @@ unisarasedialitybi.xyz
  unisonsouthayr.org.uk
  unisurprise.com
  unisvvap.live
+uniswap.biliangwang.com
  uniswap.eu
  uniswaper.link
  uniswapp.xyz
@@ -144676,9 +144912,11 @@ unknowhost.ddns.net
  unknowhost.zapto.org
  unknown-bot.000webhostapp.com
  unknown-soft.com
+unknownalert-safety.cc
  unknownentertainment.ca
  unknownlogin-attempt.link
  unknownmoney.duckdns.org
+unknownthreat-online.cc
  unl0csecure-amazon.serveirc.com
  unlamd-nl.nl
  unlawfulmoglen.com
@@ -144690,6 +144928,7 @@ unlimitedfb20.000webhostapp.com
  unlimitedimportandexport.com
  unlimitedpayroll.myvnc.com
  unlimitedrackspace.com
+unlink-device.co.uk
  unlinkpro.com
  unliquidated-rear.000webhostapp.com
  unlock-account-system-info.cf
@@ -144826,7 +145065,6 @@ untwistruby.com
  unundww.xyz
  unusable-consequenc.000webhostapp.com
  unusual-sigonpaypal.com
-unverify-payee.com
  unwantedlochsa02.com
  unwatever.xyz
  unwelcomemouserv.com
@@ -145009,6 +145247,7 @@ update.flach.cn
  update.iliao8.com
  update.iwang8.com
  update.kuai-go.com
+update.llhoa.us
  update.manage.data.qbocehzkdu.com
  update.messenger-check.to
  update.my-idog.com
@@ -145069,6 +145308,7 @@ updateattemail.weebly.com
  updateattlogin.weebly.com
  updateattlogin2020.weebly.com
  updateattmail123.weebly.com
+updateattnow.weebly.com
  updateattonline.weebly.com
  updateattsignup.weebly.com
  updatebiteedz.com
@@ -145377,6 +145617,7 @@ urbnlink.com
  urbnwarrior.com
  urchinstarlit.com
  urclan.net
+urdhvagamanelevators.com
  urecas-cajamaresrvia.com
  urep03.top
  ureripeg.com
@@ -145424,6 +145665,7 @@ urlisverified.uk
  urlm.ir
  urls.gorean.biz
  urlsverified.com
+urlsverified.uk
  urlvoice41.moonfruit.com
  urlzs.com
  urmasiimariiuniri.ro
@@ -145598,6 +145840,7 @@ user-id4839854.com
  user-id519.com
  user-id520.com
  user-id8289.com
+user-id837930.xyz
  user-id975.com
  user-info-fargo.services
  user-login-account.com
@@ -146141,13 +146384,13 @@ vaastuconsultant.org
  vabcanada.org
  vacanora-unorestaurante.grupojenrab.mx
  vacanora.grupojenrab.mx
+vacantspaces.co.uk
  vacanzeinnet.shaxiaaccommodation.top
  vacasacalifornia.com
  vacation-home.biz
  vacationgiveawaysclub.com
  vacationintucson.com
  vacationsincity.top
-vacavilleappliance.com
  vacaytrip.com
  vaccincorona.com
  vaccinial-sailor.000webhostapp.com
@@ -146327,9 +146570,7 @@ vampolerimmer.com
  van-wettennl.nl
  van.info.vn
  van.photo-web.cc
-vanbaalen.info
  vanbaolu.com
-vanbrast.com
  vanbrunwarecap.com
  vanbrusselservices.nl
  vancelogistics-au.com
@@ -146427,6 +146668,7 @@ varang.ru
  varazadegelouret.flywheelsites.com
  vardancards.com
  vardhaman.org
+vardhmanproducts.com
  vardtorg.ru
  varenmethandice.ru
  vareztattp.com
@@ -146459,6 +146701,7 @@ varzeshpress.com
  varzil.com
  vasantvihar.co
  vasavivivahavedhika.com
+vasco-ruralcajamares.com
  vascucare.co.za
  vasdgfsdrt.gq
  vasf.ml
@@ -146724,12 +146967,12 @@ velissimilio.site
  vellstables.xyz
  vellz0n.com
  velo2.mon-application.com
+veloactif.be
  veloelectriqueassurancecom.nckifitness.gdn
  velozlubrificantes.com.br
  veltz3d.com
  velvet-rain.homeip.net
  velvociamicxshy.tk
-velvociarutopl.tk
  vem-aproveita-e-compra-agora.com
  vem-comprar.com
  vem-magalu.com
@@ -146934,6 +147177,7 @@ verif-ppl.serveftp.com
  verif-probox11.yolasite.com
  verif-probox3.yolasite.com
  verif-your-account.applevalide.com
+verif.pp-recouvrement-paiement.com
  verif.services
  verif1-ac0nt.com
  verif1-b9cf4.firebaseapp.com
@@ -146994,6 +147238,7 @@ verificar-b-c-p-per.mar-cop.com
  verificar-b-c-p.chu-cs.com
  verificar-bcpmovil-peru.cobra-ks.com
  verificar-bcpmovil.cobra-ks.com
+verificar-identidad-bc-xyz.preview-domain.com
  verificar-usuarios-bc-xyz.preview-domain.com
  verificarbc.webcindario.com
  verificarbcp-online.bb-pos.com
@@ -147054,6 +147299,7 @@ verification-data.gq
  verification-data.ml
  verification-desjardins.online
  verification-fb.servehttp.com
+verification-framework.org
  verification-member-paypal.giize.com
  verification-my3.com
  verification-netflix.com
@@ -147183,6 +147429,7 @@ verifiedsafelinks-mailingdeliveries-authentications.us-south.cf.appdomain.cloud
  verifiedsecured07.serveirc.com
  verifiedspace.com
  verifiedurl.uk
+verifiedweb.co.uk
  verifieren.controlle-iban.xyz
  verifieren.deal-veilig.xyz
  verifieren.veilighier.xyz
@@ -147206,7 +147453,6 @@ verifikasi45231fb.wixsite.com
  verifikasi508.webnode.com
  verifikasi682.webnode.com
  verifikasi695.webnode.com
-verifikasiaccount02.weebly.com
  verifikasiakun-fb7.webnode.com
  verifikasiakun72.webnode.com
  verifikasifb20.webnode.com
@@ -147299,7 +147545,6 @@ verify-orderanlu.ddnsking.com
  verify-orderapple-storeoffcial.theworkpc.com
  verify-payee-manage.com
  verify-payee.cc
-verify-payee.net
  verify-paypal.kozow.com
  verify-paypal.serveftp.com
  verify-paypal.sytes.net
@@ -147421,7 +147666,6 @@ verifycentercare.weebly.com
  verifychase-support.ddns.net
  verifyclaim19.com
  verifycrash.mcdir.ru
-verifydevice-security.cc
  verifydfbk.com
  verifydreocredsdacc.servehalflife.com
  verifyed-accountinf.com
@@ -147526,13 +147770,13 @@ verizoncovid-18.com
  verizoncovid-19.com
  verizoncovid23.com
  verizone53.com
+verizonqsf.temp.swtest.ru
  verizonwirelessltd.com
  verlfication-apple.ddnsking.com
  verlfiymatch.com
  verlflcations-accesd.com
  vermacon.at
  vermarelocation.in
-vermasiyaahi.com
  vermicidal-manager.000webhostapp.com
  vermicular-here.000webhostapp.com
  vermicuva.gq
@@ -147545,6 +147789,7 @@ vermoegenmanagencom.shaxiarecord.top
  vermoegensaufbaumitimmobilieninfo.augerqisafety.top
  vermoote.de
  vern-particul-santanderesinfo.com
+vernadaizeinc.com
  vernashopping.tk
  vernieuwing-betaalpas.com
  veromcashopping.cf
@@ -147630,6 +147875,7 @@ vestaxmusic.com
  vestcheasy.com
  vestea.jp
  vestibulecovers.club
+vestibulecovers.com
  vestibulecovert.com
  vestjyskbnk-dk-159.000webhostapp.com
  vet-equin.fr
@@ -147643,12 +147889,10 @@ veterinaryassistantschools.net
  vetmir58.ru
  vettentilari.xyz
  vetter-pharmainc.com
-vetwestir.com
  veu.dojnh.com
  veulalmffyy.company
  veumisland.buzz
  veve.fun
-vevereooansure.ga
  vevete22.pw
  vevobahis0544.com
  vevobahis211.blogspot.com
@@ -147688,6 +147932,7 @@ vfhsnzwmuqclhfswwxgtsdnwqp-dot-gleowayel400503.uc.r.appspot.com
  vfixarqwxdwtbgrmppthervrab-dot-gleowayel400503.uc.r.appspot.com
  vfk.000webhostapp.com
  vflhvavyllbswjeugroyqutjjh-dot-gleowayel400503.uc.r.appspot.com
+vfocus.net
  vfootcare.com
  vfsds.com
  vftgrf.kozow.com
@@ -147882,7 +148127,6 @@ victorioenterprises.com
  victoriousfestival.co.uk
  victorybijja.com
  victorydashbordr.com
-victoryrespect.com
  victoryroasteringc.com
  victoryseminary.com
  victoryvisionfoundation.org
@@ -148047,7 +148291,6 @@ vidogar.com.ar
  vidoogle.co
  vidorencontrer.tk
  vidramaq.com.br
-vidriodecoracion.com
  vidrioyaluminiosayj.com
  vidx.4pu.com
  vidxnxxpro.cf
@@ -148161,6 +148404,7 @@ vihvex.goruli.com
  viibes.com
  viirttubcoosupurrtt.atwebpages.com
  viirttubcoosupurrttt.atwebpages.com
+vijayamathapublicschool.com
  vijayanagaravani.com
  vijaybarathe.com
  vijayvargiyasweets.in
@@ -148213,6 +148457,7 @@ villasroofingcontractors.com
  villatera.com
  villedefrancecovid19.online
  villyfeefilm1909.blogspot.li
+vilvammatrimony.com
  vim.xwa.mybluehost.me
  vimal.omenterprisesgroup.in
  viman.digital
@@ -148233,6 +148478,7 @@ vinaykhatri.in
  vinaytraders.in
  vince-breaio.ml
  vincecamutogiftcard.com
+vinceduchene.cnbcreative.co.uk
  vincegillen.org
  vincentboy.com
  vincentclothingncraft.com
@@ -148381,13 +148627,11 @@ vircardererjenn.xyz
  virdgedigital.com
  vire1000.000webhostapp.com
  virement-payp-secure-versement.000webhostapp.com
-virementpaypal.laurentcourco.com
  virementpypl.000webhostapp.com
  virgilio.it-ses.giize.com
  virgilio.it-ver.giize.com
  virgin-alerte.com
  virgin-billing-update.com
-virgin-billsupport.com
  virgin-dell.com
  virgin-final-notice.com
  virgin-mediainfo.com
@@ -148507,7 +148751,6 @@ visionexims.com
  visionherbal.com
  visioninternational.info
  visionmoneymantra.com
-visionpharmapk.com
  visionplus.co.ke
  visionrealestatesvs.com
  visions.ddns.net
@@ -148987,11 +149230,11 @@ voanio.com
  vobmeczusyccyolppxsrrckaub-dot-gleowayel400503.uc.r.appspot.com
  vobzllganqiluvjjvnfmugjvam-dot-gleowayel400503.uc.r.appspot.com
  vocaciondefuturo.cl
-vocal-actu2020.webnode.com.co
  vocal-france.webador.com
  vocal-mmsfrance.webador.com
  vocal-orange3.yolasite.com
  vocalbozo.com
+vocale-prosmsinfo.web.app
  vocale-smsprocontact.web.app
  vocale-telpromessagerie.web.app
  vocaleappel-smscontact.web.app
@@ -149096,7 +149339,6 @@ voiceofmelange.com
  voiceoncall.blob.core.windows.net
  voicepath.us
  voicerui.com
-voicescale.guru
  voicesmailnotes.z13.web.core.windows.net
  voicesofprevention.com
  voicetoplusms.com
@@ -149124,6 +149366,7 @@ volam2.club
  volamtayson.top
  volamthailan.com
  volamxmen.com
+volantini.cloud
  volare.co.ls
  volarevic.com
  volatilizes543xz.pw
@@ -149172,7 +149415,6 @@ voorzorgmaatregel.info
  vootseries.gq
  vootseries.tk
  vophuccode.000webhostapp.com
-voquev.top
  vorldsnet.shaxiaadd.top
  vorldsnet.shaxiaapril.top
  vorminfunctie.nl
@@ -149290,6 +149532,7 @@ vpntop.com
  vpq.dermals.org
  vps-11f6a5dc.vps.ovh.net
  vps-14d6349d.vps.ovh.net
+vps-1c473bcd.vps.ovh.net
  vps-1c9a5476.vps.ovh.net
  vps-2282d033.vps.ovh.net
  vps-22bb18bc.vps.ovh.net
@@ -149317,6 +149560,7 @@ vps1.voxtera.com.my
  vps333.com
  vps5640.inmotionhosting.com
  vps60124.inmotionhosting.com
+vps62909.inmotionhosting.com
  vps63689.inmotionhosting.com
  vpscouriers.com
  vpsecityurcwm.pw
@@ -149468,7 +149712,6 @@ vuleapen.com
  vulim.buzz
  vulkanland-bio-safran.at
  vulned-helmets.000webhostapp.com
-vulnessione.top
  vulpss.net
  vulpzelindro.tk
  vulsdjmidvyikhnjdlqndsryhx-dot-gleowayel400503.uc.r.appspot.com
@@ -149551,6 +149794,7 @@ vww.scotiabak.online12scotia.com
  vww.scotiabank.online.scotiabank.online147.com
  vww.scotiabank.online12scotia.com
  vwzkqxufdiyymmaerntttwfner-dot-gleowayel400503.uc.r.appspot.com
+vxailine.com
  vxaitzal.com
  vxcznbvbzcxn.servecounterstrike.com
  vxgdft.shoesmogul.com
@@ -149810,6 +150054,7 @@ wagnergroupnet.nckiregister.gdn
  wagnersystemen.nl
  wagoatilby.com
  wagroup-bokepindonew.tk
+wagroup-invited111.2waky.com
  wagroup18.h3d.shop
  wagroup18.site-hadiah.com
  wagroupindo.000webhostapp.com
@@ -149863,7 +150108,6 @@ wajoingrub-wagrub61618.000webhostapp.com
  wajoinxzxc72618.000webhostapp.com
  wak.co.ke
  wakaa.net
-wakan-tanka.org
  wakandatravel.com
  wakecar.cn
  wakeomar.net
@@ -149909,6 +150153,7 @@ walletlinhpro.pro
  walletmoney.net
  wallets-trezor.io
  wallhack.servecounterstrike.com
+wallieget.com
  wallisshopping.tk
  wallistreet.com
  walloskins.xyz
@@ -150026,6 +150271,7 @@ wara.bryh.fun
  waraboo.com
  warahprime.com
  waraly.com
+warayana.com.pe
  warbysports.com
  warcorona.com
  warcraftoutlet.com
@@ -150153,6 +150399,7 @@ waterfalls.co.ke
  waterfrontmachinery.xyz
  waterfrontunion.info
  watergold.icu
+waterheaterrepairpanamacity.com
  waterhousecleaning.co.uk
  waterlifebd.com
  watermanwebs.com
@@ -150244,6 +150491,7 @@ wazaa.mywire.org
  wazex.xyz
  wazifonline.com
  wazxs.xyz
+wazzpromo.com
  wb-shirt.tk
  wb-wx.mentriqq.com
  wb0rur.com
@@ -150682,6 +150930,7 @@ webbankieren-rabo.xyz
  webbankofamerica.com
  webbbb.yolasite.com
  webbfilms.co.uk
+webbisrvcostumm.com
  webbsupp.com
  webbuze.online
  webcanal.000webhostapp.com
@@ -150775,7 +151024,6 @@ webhelpdensrae.cloudaccess.host
  webhiste18.000webhostapp.com
  webhome-show.com
  webhost-centre-action-required-pp.000webhostapp.com
-webhost4christ.org
  webhosting04984.com
  webhostingbingo.com
  webhostingsrbija.rs
@@ -150963,7 +151211,6 @@ webmailxuzhxch.moonfruit.com
  webmailzimbrasuport232.weebly.com
  webmaintenancenhsmail.weebly.com
  webmaster-peloton.com
-webmasterofficialewem.wasemoren.net
  webmercado.net
  webmonero.club
  webmotion-design.com
@@ -150990,6 +151237,7 @@ webparkinged.ru
  webpaymentid.applepays.japanzone.gabsbkanb.com
  webpictool.com
  webpingo.ca
+webpostmedia.com
  webpower.pdc-ind.com
  webpresario.com
  webprotectionpro.com
@@ -151072,6 +151320,7 @@ websystemsupporthelpdesk9874.000webhostapp.com
  webtalavera.com
  webtaskertest.net
  webtechservices.club
+webtechxperts.com
  webtosalesforce.fenceline.biz
  webtvpk.online
  webuilditfirst.com
@@ -151127,6 +151376,7 @@ weddpreop.com
  wedeh-sultan.000webhostapp.com
  wedelivercoachella.com
  wedeofficial.com
+wedescollection.com
  wedid.online
  wedif.com
  wedjoyet.com
@@ -151153,11 +151403,11 @@ weekdanys.com
  weekskypp.hopto.org
  weenal.info
  weeniecat.com
-weepeggle.cyou
  weesh.xyz
  weetmoglen.com
  weets.xyz
  weetw.xyz
+weevoxsound.com
  weewerilikesites.cf
  weexperts.fr
  wefastermore1.c1.biz
@@ -151234,7 +151484,6 @@ wellbeingresort-ci.com
  welldiytoolswebopoutlet.club
  wellfitladyinfo.nckiengland.gdn
  wellgate.co
-wellhook.guru
  wellls-fargo.com-activi.rpdwfsf.xyz
  wellness3390.site
  wellnessbeautyhub.com
@@ -151446,7 +151695,6 @@ wepzc.jaysbrand.com
  weq8b9qr2zn.sted.cc
  wer.8t36b5.cn
  wereldpas-aanvraag-procedure.nl100.ir
-wereldpas-aanvraag-procedure.nl105.ir
  wereldpas-aanvraag-procedure.nl1748.ir
  wereldpas-aanvraag-procedure.nl8278.ir
  wereldpas-aanvraag-procedure.nl9979.ir
@@ -151482,7 +151730,6 @@ werkplaatover.com
  werneckgomes.com.br
  werner-boehm.com
  werner-loesch.de
-wernergansbergen.de
  wernerluftartist.com
  werqe.xyz
  wersiamone.xyz
@@ -151584,7 +151831,6 @@ westsuburbanchamber.com
  westtexasoffroadcenter.com
  westtexaswinetours.com
  westuatrans.com
-westvac.com
  westworldfansite.com
  westyellowstonesnowmobile.com
  wesuntrustonline.webcindario.com
@@ -151677,6 +151923,7 @@ wetzs.xyz
  weverifyit.duckdns.org
  wevetrieditd.ru
  wevgqsrpmasrcuqwcwwd.top
+wew.goldgreet.com
  wewege.com
  wewewewewesesesesasbacwederffggffddsss.duckdns.org
  wewiozjum.info
@@ -151864,6 +152111,7 @@ whatsap-gupsbokep.grubxx.xyz
  whatsap-indonew.xxnnvv.tk
  whatsap-invite-groupberbagi8.2waky.com
  whatsap-invitex12-videos2.2waky.com
+whatsap.burik-event1.my.id
  whatsap.hol21.design
  whatsap1.ff-indo.com
  whatsap18plus.alwysg.tk
@@ -152063,13 +152311,13 @@ whatsapp-xgrup.wikaba.com
  whatsapp.bkp-grup.bkp-wa18.ml
  whatsapp.bkp.croot-18.tk
  whatsapp.bokep0016.ga
-whatsapp.febryiva996.asia
  whatsapp.freegrub.cf
  whatsapp.group.onviy.com
  whatsapp.group2020.ml
  whatsapp.grublink014.vip2x.net
  whatsapp.grubsjoin.ga
  whatsapp.grup-18plusss.gq
+whatsapp.grup18-invit.my.id
  whatsapp.grup18.vvipx77.ga
  whatsapp.hols20.cf
  whatsapp.hot1.shop
@@ -152169,7 +152417,6 @@ whatsappgroups.xxuz.com
  whatsappgroups20.hopto.org
  whatsappgroups62.otozo99.ml
  whatsappgroupsex.javd5.tk
-whatsappgroupsexsmexs18.otzo.com
  whatsappgroupsexyjoinfast.otzo.com
  whatsappgroupx-18.cf
  whatsappgroupx.ddns.net
@@ -152243,6 +152490,7 @@ whatsappmessenger-free.diamondff15.tk
  whatsappmessengger.bokep-new.my.id
  whatsappnetbokepdewasaindo.tk
  whatsappnew.ooguy.com
+whatsappnewbokep02.lexax4.my.id
  whatsappnewchat.giize.com
  whatsappori.ooguy.com
  whatsapporn.fartit.com
@@ -152447,7 +152695,6 @@ whistmenrimul.ml
  whistondin.com
  whistorican.info
  whitdoit.tk
-white-on-rice.com
  whitebellstravels.com
  whitecasse.com
  whitecertifiedangusbeef.com
@@ -152516,6 +152763,7 @@ whoppingdee.com
  whoreson-delays.000webhostapp.com
  whorichacen.top
  whosemobilenumberisthis.com
+whotakescoin.com
  whsaatsppsxx.ezua.com
  whsx.svcoding.com
  whsyearbook.com
@@ -152641,13 +152889,16 @@ wildcard.azph.monster
  wildcard.c3ul.ru
  wildcard.cchos.network
  wildcard.cleansol.lk
+wildcard.creditvalue.ca
  wildcard.dragglobal.com
  wildcard.drwax.as
  wildcard.e39-dee3s-ssl.com
  wildcard.earnmoneypoint.com
+wildcard.esthepharm.ba
  wildcard.fbsev.best
  wildcard.formref109.com
  wildcard.formreturn110.com
+wildcard.heartofwine.ca
  wildcard.ifms-enargeia.gr
  wildcard.igr2.ru
  wildcard.jaynerenault.co
@@ -152656,7 +152907,7 @@ wildcard.oidjwoidj84.com
  wildcard.qizx.ru
  wildcard.qxc9.su
  wildcard.rc-cr4d-2ds.com
-wildcard.risecse.com
+wildcard.rencetek.com
  wildcard.rr4-d34s-1e.com
  wildcard.rrc-f43-sc-3e.com
  wildcard.rrd-dse-1q2.com
@@ -152678,6 +152929,7 @@ wildcard.sslc-4d-as.com
  wildcard.ssld-4d4-s31.com
  wildcard.sslf-4d3s-23e3.com
  wildcard.synergyglobal.one
+wildcard.tizianacristofari.it
  wildcard.w3s-fd4-1q32.com
  wildcard.wpmudev.host
  wildcard.wwdf-4d-3w.com
@@ -152729,6 +152981,7 @@ willingwater.com
  willingwoods.com
  willinkzx.com
  willisngutierrez.xyz
+willmartowing.com
  willow-nettica.com
  willowallsun.ru
  willowvideoproductions.com
@@ -152858,7 +153111,6 @@ winetcoha.com
  winevalleypayroll.com
  wineycakes.com
  winfieldks.xyz
-wingable.guru
  wingame.us
  wingamekey.xyz
  wingames.live
@@ -153513,10 +153765,8 @@ wormbasin.cyou
  wornbfydtecxoyaso.bounceme.net
  worotest.weebly.com
  worpjjsgkycb-ispi9o2p7.vercel.app
-worryart.guru
  worshiper255kq.pw
  worshiphubug.com
-worshipiro.today
  worshipping-yard.000webhostapp.com
  worth-it.app
  worthgravel.cyou
@@ -153679,7 +153929,6 @@ wrigglyspend.com
  wrightindustrial.co.nz
  wrightsboutique.co.uk
  wristbanddeal.com
-wristpan.guru
  writabeats.com
  writec.ca
  writefb.000webhostapp.com
@@ -153720,6 +153969,7 @@ ws3lfkm.com
  ws4polisi.pdc-ind.com
  ws6q.gazengel.com
  ws76dr.com
+ws852.com
  wsadministrateurxvocalebe.yolasite.com
  wsads.weebly.com
  wsdfghjkjhgfcv.duckdns.org
@@ -153837,7 +154087,6 @@ wulggyrplodnhcirrxejkwxawg-dot-gleowayel400503.uc.r.appspot.com
  wulierji.com
  wulumuqi.06rl.com
  wundergrau.com
-wunderlande.de
  wunnuinnwuilm.com
  wunschlodge.buzz
  wupay.trade
@@ -154005,6 +154254,8 @@ wwqpo.000webhostapp.com
  wwrgnxzvf.hotdiscountnow.ru
  wwrsy.com
  wwsecityuremm.pw
+wwsecureoffice365gua7fqdtsgrbq0b4edzol9qhm1.azurewebsites.net
+wwsecureoffice365gua7fqdtsgrbq0b4edzol9qhm9.azurewebsites.net
  wwsecurerclwanzn7aat2l3qcfirnxck3.azurewebsites.net
  wwsss.xyz
  wwsvvayixy.bestserviceo.su
@@ -154024,6 +154275,7 @@ www-abndiensten.com
  www-accounts-wells-fargo.mobi
  www-accweb-desj.com
  www-acesso-seguro.cloud-fr1.unispace.io
+www-amazno.co-service-infoupdate-sighin-to-page.monster
  www-amazon-co-jp.de1e8a08-0cf8-4b8a-95e3-be415a966db2.co
  www-amazon-home-prime-it-srl2020.ooguy.com
  www-amazon-info-secure-com.giize.com
@@ -154221,6 +154473,7 @@ www3-phi.vercel.app
  www3-uc2-1ca4d-c0-jpn.bloomfieldcarpetcleaning.com
  www3eletroni-casaboraaprove1ta.com
  www4-irs-gov.uc.r.appspot.com
+www_amazn_co_jp.api.amaz.photos
  www_amazon.co.jp.api_sitegides_sxhvkzvmmcjp.uihf.top
  www_amazon.co.jp_qaz.yew.monster
  www_smbc.co.jp_qwer.jpamazoncom.xyz
@@ -154421,6 +154674,7 @@ x13ze.jaysbrand.com
  x15xqfyoagk2arw.e8273.pro
  x16.life
  x1a-f.mentriqq.com
+x1a4x6xa1x7xa1x8x1.art
  x1dr7.svcoding.com
  x1f2.mentriqq.com
  x1jk2rz.ambi.cc
@@ -154494,6 +154748,7 @@ xaayvi.icu
  xaccount-securefacebook.gq
  xaccount-securefacebook1.gq
  xacminhfb-garena.ddns.net
+xacnhan-facebook-veri.bounceme.net
  xacnsnva.bounceme.net
  xacq.jaysbrand.com
  xacveq.com
@@ -155056,6 +155311,7 @@ xn--80aafuec2bqq9b9f.049.xn--p1acf
  xn--80aajiaapeyhqdbo9bk.xn--p1acf
  xn--80aanufcfzcs6l.xn--p1ai
  xn--80abnk0a8a0ga.xn--p1ai
+xn--80acb5a5avn7a8a.xn--p1ai
  xn--80aceg5a5a4c9b0a.xn--p1ai
  xn--80adafaiy2bcy.xn--p1acf
  xn--80adeexj3i.xn--p1ai
@@ -155070,6 +155326,7 @@ xn--80ajcz5a1dp.xn--p1ai
  xn--80akackgdchp7bcf0au.xn--p1ai
  xn--80al0adb1gd.xn--p1ai
  xn--80apaabfhzk7a5ck.xn--p1ai
+xn--80arm9betcs.xn--p1ai
  xn--80atlp0a2b.xn--p1ai
  xn--90acfttjig6gc.xn--p1ai
  xn--90achbqoo0ahef9czcb.xn--p1ai
@@ -155080,7 +155337,6 @@ xn--90afdnal1aqq.xn--p1ai
  xn--90ao1cqfddgc.xn--p1ai
  xn--90aoc2avsb.xn--p1ai
  xn--90aqehc.xn--p1ai
-xn--90ar9a3as.xn--p1ai
  xn--90avpa.xn--p1ai
  xn--accweb-muv-desjardns-s9c36d.com
  xn--acsso-pagseguro-cnb.com
@@ -155103,6 +155359,7 @@ xn--besthe-tta61awinm.net
  xn--betha-8ra8ski0ki7e.net
  xn--bethae-k2a2p2l5g.net
  xn--bethae-k2a2p2l7i.net
+xn--bhdlen-fxa.com
  xn--bimain-j17b.com
  xn--blcokchan-nk7d.com
  xn--bnkofamerca-87a302a.ws
@@ -155132,6 +155389,7 @@ xn--clinicatraa-beb.com
  xn--cloud-9nc.com
  xn--covid19-gncelsalgnvakalar-nwc35l.com
  xn--d1aak1d4ami.xn--p1ai
+xn--d1acfr2ai8ah.xn--p1ai
  xn--d1ahebikdfcgr7jsa.xn--p1ai
  xn--d1ajejfcbjhse2c.xn--p1acf
  xn--d1albnc.xn--p1ai
@@ -155545,7 +155803,6 @@ xspins.tencenters.com
  xsqd.awaykart.com
  xsr.hamhonar.com
  xsryx.xyz
-xssecmil.com
  xsso.anbtr.com
  xstmqwhcfgqixdpvtjhapxshme-dot-gleowayel400503.uc.r.appspot.com
  xstradepro.com
@@ -155943,6 +156200,7 @@ yahoo.com.serviceloadbk.bar
  yahoo.customer-servicephonenumber.com
  yahoo.digitalmktg.com.hk
  yahoo.xapoinvest.com
+yahoo038.webnode.com
  yahoo674.weebly.com
  yahooaccount.authenticationonlinever.com.d.wbsprt.com
  yahooactiveaccountverify.weebly.com
@@ -156141,6 +156399,7 @@ yas-s.glitch.me
  yasarkemalplatformu.org
  yasarlarinsaat.com.tr
  yasarsu.com.tr
+yaseturismo.com.br
  yasgold.com
  yashdemo.yashinfosystems.com
  yasiionasdnberece.net
@@ -156155,7 +156414,6 @@ yatay.org
  yatesassociates.co.za
  yaticaterm.com
  yatinlan.com
-yatkiralama.online
  yatnl.goruli.com
  yatogastro.cz
  yatoshafoundation.or.tz
@@ -156706,7 +156964,6 @@ yoreepencia.info
  yoreselelazig.com
  york.huagol.com
  yorki-style.ru
-yorkislonjes.icu
  yorkshire.es
  yorkstrike.on.nimp.org
  yorskchneptubkpewqwklpmoraxoailsugaq-dot-glegen303939423233.ue.r.appspot.com
@@ -157353,7 +157610,6 @@ z9nogft1.com
  z9w1d.jaysbrand.com
  z9wc.mentriqq.com
  za549.onderhost.com
-zaaher.com
  zaba2heldar.com
  zabava163.ru
  zabenkot.top
@@ -157406,7 +157662,6 @@ zahlung.swisscom2.ch.studiouniko.com
  zahlung.swisscom3.ch.genss.it
  zahlung.swisscom4.ch.studiouniko.com
  zahnariumnet.shaxiaoh.top
-zahnarzt-flensburg.com
  zahnarztingolstadtorg.baersevensupply.top
  zahnarztwebdesigncom.shuiabring.top
  zahneckeinfo.chifanbudget.top
@@ -157536,7 +157791,6 @@ zaragoza.co.ug
  zaragoza.ug
  zaragozsa.ug
  zarahmat.000webhostapp.com
-zarahmoden.com
  zaranefax.com
  zaratour.net
  zardini.com.br
@@ -157749,7 +158003,6 @@ zenith.vipmbwx.com
  zenithautomotive.com
  zenithdelivery.org
  zenithegypt.com
-zenithenergy.com
  zenjijewels.com
  zenmatec.com
  zennhero.com
@@ -157891,7 +158144,6 @@ zhangwei.000webhostapp.com
  zhangye.yfqzdfd.com
  zhangyiyi.xyz
  zhangzhou.yfqzdfd.com
-zhaniyasoft.ir
  zhaochangli.cn
  zhaofanju.com
  zhaojijm.com
@@ -158041,6 +158293,7 @@ zimbraphpnuke.000webhostapp.com
  zimbrapstmaster.ml
  zimbrar.000webhostapp.com
  zimbrastellcofilersd.com
+zimbrawebmaster.000webhostapp.com
  zimbrchim.com
  zimbrstemupgrdenie405.jdevcloud.com
  zimcon.de
@@ -158218,6 +158471,7 @@ znbh6.jaysbrand.com
  znbsyj.com
  zncssyxroyfxejzfwefpmiceni-dot-gloff849483.uk.r.appspot.com
  zncx4ha.com
+zndjieu.cam
  zndxa.com
  znekohpig.xyz
  znetmarketing.com
@@ -158264,7 +158518,6 @@ zokhferr.com
  zokkoefewqaovkuhzumitjxggfgsrnjdaozm-dot-glegen303939423233.ue.r.appspot.com
  zolampaqes-secur0.ga
  zolampaqes-summary.ga
-zolistons.icu
  zolodemo.com
  zolofollowegain.000webhostapp.com
  zoloto2020avatar2d1.000webhostapp.com
@@ -158285,6 +158538,7 @@ zona.registrandotusdatos.com
  zona188.000webhostapp.com
  zona1bn.com
  zona1segurabetaviabcpe.com
+zonabancofalalbella.com
  zonabeta-viabcp.alertasms-aviso.com
  zonabeta-viabcp.com
  zonabetabcponline.com
@@ -158358,6 +158612,7 @@ zonasegura1.bn.com.pe.segvurabetaonlinebn1.xyz
  zonasegura1.pe-bnn.com
  zonasegura1betaviabcp.com
  zonasegura1bn-com-pe.ga
+zonasegura1bn.webenvirtual.multiportalempresa.com
  zonasegura1bnenlineape.com
  zonasegura1bnmultired.com
  zonasegura1bnperu.seguridad-virtual.com
@@ -158736,6 +158991,8 @@ zwz597p4z3ll8jx.gmz.cc
  zx-7.com
  zx-f.mentriqq.com
  zxaaqweb.com
+zxaswead.com
+zxaswead.net
  zxbqrhkjfiwiflgjufjlkdmcji-dot-gleowayel400503.uc.r.appspot.com
  zxc03.codesandbox.io
  zxc123.cc
diff --git a/blacklists/malware/urls b/blacklists/malware/urls

index e348d2d6175291cb9da8d3ba60f0b91deb806c72..9a20102e59e56834c385db1d2b6cb2ab08c44010 100644 (file)
--- a/blacklists/malware/urls
+++ b/blacklists/malware/urls
@@ -1,103 +1,17 @@
  0i.is/7Tr9
  0i.is/CpAq
  0i.is/IqWc
-104.194.247.150/ap/signin
-104.223.143.234/coconut
-104.223.143.234/coconut/Panel/Panel/five/fre.php
  123formbuilder.com/form-5559915/microsoft-team
-13.66.28.137/US
-13.66.28.137/US/
-13.66.28.137/US/webapps
-13.66.28.137/US/webapps/mpp
-13.66.28.137/authflow/email-recovery
-13.66.28.137/authflow/email-recovery/
-13.66.28.137/authflow/email-recovery/'
-13.66.28.137/authflow/email-recovery/'/signin'
-13.66.28.137/authflow/email-recovery/signin
-13.66.28.137/authflow/password-recovery
-13.66.28.137/authflow/password-recovery/
-13.66.28.137/authflow/unsupported-browser/
-13.66.28.137/home
-13.66.28.137/signin
-13.66.28.137/us
-13.66.28.137/us/home
-13.66.28.137/us/signin
-13.66.28.137/us/webapps
-13.66.28.137/us/webapps/mpp/
-13.66.28.137/us/webapps/mpp/home
-142.93.118.23/systemerror-win-chx
-173.82.123.229/ap/signin
-173.82.22.114/ap/signin
-173.82.22.77/ap/signin
-173.82.97.221/ap/signin
-185.239.242.174/oue
  1drv.ms/xs/s
-20200908172903-dot-s2pe7ed9y.rj.r.appspot.com/office
-20200908172903-dot-s2pe7ed9y.rj.r.appspot.com/office/index.html
-205.134.255.225/~netsch5
-205.134.255.225/~netsch5/wp-content/themes/boomber/signin.php
-209.182.202.96/~marti177
-209.182.202.96/~marti177/wp-content/themes/twentytwo/signin.php
-209.182.202.96/~netsch5
-209.182.202.96/~netsch5/wp-content/themes/boomber/signin.php
-211.104.242.52/zehir/z3hir.x86
-216.83.55.154/mim
-216.83.55.154/mim/2hi91w79p8030281310y14058cl9u959e215u46f2315c4lq36.html
-24dnl.com/nridistribution.com
-24dnl.com/nridistribution.com/index.html
-64.13.225.150/enabled/loadan/sess
-69.164.145.131/www/html/bank_websites/www.chase.com
-69.164.145.131/www/html/bank_websites/www.chase.com/index.html
-7colours.co.za/go/suncoast/vov/credit/union
-7colours.co.za/go/suncoast/vov/credit/union/login.html
-7les.com/zoom/appsuite
-7les.com/zoom/appsuite/index.html
-87du.vip/svchast.exe
-93.104.210.230/cc/machint/auth-login/verification-page
-a-electronics.com.mx/dga/hbhc
-a-electronics.com.mx/dga/hbhc/
-a-electronics.com.mx/dga/hbhc/validate.php
-aartt-71.ga/0nfile/0nfile/oneddrive
-aartt-71.ga/0nfile/0nfile/oneddrive/index.php
+2dehandsbancontact.net/kbc
  abre.ai/as0p
  abre.ai/caixacx
  abre.ai/seguranca-app
-ajedrezenmorelos.com/imagenes/bcPAkRelh
-ajedrezenmorelos.com/imagenes/bcPAkRelh/
-ajedrezenmorelos.com/imagenes/docs/0624/8j59tjnicf-3025/
-ajedrezenmorelos.com/imagenes/izgq9byyt3qm/dm640645634686706tyhlnlgym6opde0fqdg/
-allfitsuplementos.com.br/am/net/hom
-allfitsuplementos.com.br/am/net/hom/
-allfitsuplementos.com.br/am/net/hom/cp.php
-allfitsuplementos.com.br/am/net/hom/email.html
-allfitsuplementos.com.br/am/net/hom/sms-error.html
-allfitsuplementos.com.br/am/net/hom/sms.html
  allowcopy.com/open
  allowcopy.com/open/
  angelfire.com/games/gamez3
  angelfire.com/games/gamez3/facebook.htm
-aplleidsasa.servehalflife.com/account
-apps.adasasistemas.com/SugarCRM/ModuleInstall/PackageManager
-apps.adasasistemas.com/SugarCRM/ModuleInstall/PackageManager/ListViewPackages.html
-apps.adasasistemas.com/SugarCRM/custom
-apps.adasasistemas.com/SugarCRM/custom/66526566595623.html
-apps.adasasistemas.com/SugarCRM/custom/CER
-apps.adasasistemas.com/SugarCRM/custom/CER/5.html
-apps.adasasistemas.com/SugarCRM/custom/themes
-apps.adasasistemas.com/SugarCRM/custom/themes/00.html
-asdhnrtter.casacam.net/r/PVzTQOk/
-asiagroup.in/cars.gif
-askyounow.com/html
-askyounow.com/html/frame.php
-att.jpdmi.com/2019/500255-LP
-att.jpdmi.com/2019/500255-LP/index.php
-att.jpdmi.com/2019/500255-LP/spanish.php
-aurickhotels.com/image/dena/dena
-aurickhotels.com/image/dena/dena/
-aurickhotels.com/slide/dena/dena
-aurickhotels.com/slide/dena/dena/
-austintxlawn.com/excel-viewer/
-autofixalba.ro/piese/newdoc/pdf
+basmahane.com/491c439a07fa4deb480951c51a6b138b/XMlV
  bit.do/EN9NET
  bit.do/Help-Recovery-Page
  bit.do/Hiosene
@@ -147,13 +61,7 @@ bit.do/fHdqn
  bit.do/fHgEL
  bit.do/fHhng
  bit.do/fHyaq
-bit.do/fJYKC
  bit.do/fJYKM
-bit.do/fJYKQ
-bit.do/fJYKS
-bit.do/fJYKW
-bit.do/fJYKm
-bit.do/fJYKz
  bit.do/fJaHP
  bit.do/fJjFX
  bit.do/fJwzX
@@ -181,7 +89,6 @@ bit.ly/2ENdtta
  bit.ly/2ERc18Z
  bit.ly/2ETX99T
  bit.ly/2F0CgtP
-bit.ly/2GcOfWi/
  bit.ly/2IHS17F
  bit.ly/2Jkx7vI
  bit.ly/2MPKgOT
@@ -243,6 +150,7 @@ bit.ly/35v5E4B
  bit.ly/36P3dux
  bit.ly/36VRD0I
  bit.ly/36g7SoG
+bit.ly/36vcVUw
  bit.ly/36wCTos
  bit.ly/38Xmo4D
  bit.ly/38p7HqJ
@@ -287,6 +195,7 @@ bit.ly/3h9K3Tz
  bit.ly/3hS6PzH
  bit.ly/3hk0Wvc
  bit.ly/3hxtaCj
+bit.ly/3itOHfD
  bit.ly/3iz0PgJ
  bit.ly/3jEnEQK
  bit.ly/3jKPWZ8
@@ -324,76 +233,9 @@ bitbucket.org/jessypinkman/bsplayer/downloads/BSPlayer.exe
  bitbucket.org/listary/listary/downloads/Listary.exe
  bitly.com/2PuohhR
  bitly.com/PAYPAL-LOGIN-IL
-bjk3.m0ky.com/-/uni/
-blackstartupjobs.com/voicemail
-blackstartupjobs.com/voicemail/
-blog.tsuginanisuru.com/turbine.ie/toda/
-blowapp.digital/nomideses/customer_center/customer-IDPP00C332/myaccount/identity
-bookedandboarding.com/.tin/At&amp;t
-bookedandboarding.com/.tin/At&amp;t/index2.html
-bookedandboarding.com/.tin/At&t
-bookedandboarding.com/.tin/At&t/
-bookedandboarding.com/.tin/At&t/index2.html
-bookedandboarding.com/.tin/at&t
-boomers-insurance.com/secure/verify
-boomers-insurance.com/secure/verify/816b078bdecc72ac24734a9b54314324.php
-bozur.net/ws/
-brandsum.com/images/fifa/newpp.login.html
-businesslifecoachingcanada.com/uploads
-businesslifecoachingcanada.com/uploads/busy1.html
-businesslifecoachingcanada.com/uploads/busy2.html
-businesslifecoachingcanada.com/uploads/busy3.html
-businesslifecoachingcanada.com/uploads/logon1.php
-buyjunkcars.co/lnterac.money-transfer/
-buyjunkcars.co/lnterac.money-transfer/directing/desjardins/identifiantunique
-buyjunkcars.co/lnterac.money-transfer/directing/desjardins/identifiantunique/index.php
-buyjunkcars.co/lnterac.money-transfer/directing/desjardins/identifiantunique/index2.php
-buyjunkcars.co/lnterac.money-transfer/directing/fcu/
-buyjunkcars.co/lnterac.money-transfer/directing/online.simplii.com
-buyjunkcars.co/lnterac.money-transfer/directing/online.simplii.com/index.php
-buyjunkcars.co/lnterac.money-transfer/directing/secure.tangerine.ca/web
-buyjunkcars.co/lnterac.money-transfer/directing/secure.tangerine.ca/web/complete.php
-buyjunkcars.co/lnterac.money-transfer/directing/secure.tangerine.ca/web/login.php
-buyjunkcars.co/lnterac.money-transfer/directing/secure.tangerine.ca/web/questions.php
-buyjunkcars.co/lnterac.money-transfer/directing/www.atbonline.com/ATB
-buyjunkcars.co/lnterac.money-transfer/directing/www.atbonline.com/ATB/complete.html
-buyjunkcars.co/lnterac.money-transfer/directing/www.atbonline.com/ATB/login.html
-buyjunkcars.co/lnterac.money-transfer/directing/www.atbonline.com/ATB/question.php
-buyjunkcars.co/lnterac.money-transfer/directing/www.bmo.com/cgi-bin/netbnx
-buyjunkcars.co/lnterac.money-transfer/directing/www.bmo.com/cgi-bin/netbnx/BMOMobileBanking.html
-buyjunkcars.co/lnterac.money-transfer/directing/www.bmo.com/cgi-bin/netbnx/secquestions.php
-buyjunkcars.co/lnterac.money-transfer/directing/www.cibc.mobi/ebm-mobile-anp
-buyjunkcars.co/lnterac.money-transfer/directing/www.cibc.mobi/ebm-mobile-anp/account.php
-buyjunkcars.co/lnterac.money-transfer/directing/www2.scotiaonline.scotiabank.com/online/authentication
-buyjunkcars.co/lnterac.money-transfer/directing/www2.scotiaonline.scotiabank.com/online/authentication/confirm.php
  cakeurl.com/sw3zY
  capesandbox.com/file/sample/2582/8729e52104ec08ca7002b217c42c3ec12262badbb3f11faaab1829eba505c3cb
-capita1one.me/login/
-casonahartfordct.com/hrnmecrcr/bin/Indexxatt
-casonahartfordct.com/hrnmecrcr/bin/Indexxatt/Indexxatt.htm
  cdn.discordapp.com/attachments/680977014139650072/681241009618681896/n.exe
-ch.net2care.com/ar2/
-ch.net2care.com/https/admin.hostpoint.ch
-ch.net2care.com/https/admin.hostpoint.ch/
-championscsc.co.zw/b2020123/1
-championscsc.co.zw/b2020123/1/
-championscsc.co.zw/b2020123/1/index2.php
-chase-id0-online0chase.com/newm/nuiz/maine/ch_01.24.19_1.0/702184902
-chasesec7activities88690.xcqsasw.com/s
-chasesec7activities88690.xcqsasw.com/s/dashboard
-cheatsbox.net/cty/city/verification/253B09CE99CE4ACM3ED8
-cheatsbox.net/cty/city/verification/253B09CE99CE4ACM3ED8/index.php
-clients.devtux.com/updates/payment
-clients.devtux.com/updates/payment/mweb.html
-cmsjm.rj.gov.br/includes/Express/
-codeblue.ch.net2care.com/https/admin.hostpoint.ch
-codeblue.ch.net2care.com/https/admin.hostpoint.ch/
-courseworkwritingsite.com/admin
-courseworkwritingsite.com/admin/
-courtneyjjones.ac.ug/ds2.exe
-courtneyjjones.ac.ug/rc.exe
-craigslist.review-confirms.us/account
-credifurpu.com/index_htm_files/eryjmw6yjw5.pdf
  cutt.ly/QiCMqtb
  cutt.ly/SsyhHnk
  cutt.ly/SyhM3BP
@@ -404,31 +246,7 @@ cutt.ly/ldTGuAB
  cutt.ly/tsqb6ai
  cutt.ly/vsqbVMI
  cyw.pe.kr/images/baba/Alibaba.com/Alibaba.com/Alibaba.co.uk/35c2f42de3a745af1c74bd8fc03250ad
-daddy.com.vn/.docusign/shoppng
-daddy.com.vn/.docusign/shoppng/u.php
-ddffrrff.ey.r.appspot.com/login.microsoftonline.com/common/oauth2/authorize=vnews2
-dfshkqbzt.holopokor.com/admine/voscomptes/banqueposataleservice/postale.activation
-dfshkqbzt.holopokor.com/admine/voscomptes/banqueposataleservice/postale.activation/
-dgreitkelis.lt/ww12/gmei_ksa_vb
  dlvr.it/RXVbg3
-dobien.co.uk/dunhill/eTrac
-docentes.uto.edu.bo/aalavet
-docentes.uto.edu.bo/aalavet/wp-includes/bid
-docentes.uto.edu.bo/aalavet/wp-includes/bid/information.php
-docentes.uto.edu.bo/aalavet/wp-includes/bid/login.php
-docentes.uto.edu.bo/abaltazarc
-docentes.uto.edu.bo/abaltazarc/bid
-docentes.uto.edu.bo/abaltazarc/bid/information.php
-docentes.uto.edu.bo/abaltazarc/bid/login.php
-docentes.uto.edu.bo/abaltazarc/wp-includes/bid/information.php
-docentes.uto.edu.bo/acolquea
-docentes.uto.edu.bo/acolquea/wp-includes/bid/information.php
-docentes.uto.edu.bo/acolquea/wp-includes/bid/login.php
-docentes.uto.edu.bo/dmoyaa
-docentes.uto.edu.bo/dmoyaa/wp-includes/bid/information.php
-docentes.uto.edu.bo/dmoyaa/wp-includes/bid/login.php
-docentes.uto.edu.bo/oarcec
-docentes.uto.edu.bo/oarcec/wp-includes/images/smilies/Login.htm
  docs.google.com/forms/d/1cftY9nPkgtssMgHl5uc070iUbDW-vRpa7sBpQQYOSCk/viewform
  docs.google.com/forms/d/1ubfTadXuGDGvTvNscAY0_f78KUm17eHjm5vf2Ltz6Hs/viewform
  docs.google.com/forms/d/e/1FAIpQLScF68Z9GTY6VGd_OJVtROggMC5gl95AoNcW27gHvVatJQfp4Q/viewform
@@ -464,20 +282,8 @@ docs.google.com/forms/d/e/1FAIpQLSfw3glHBuhrFSF4kTOw1sa_BSsYr9NBQF4RhDYAv_g6xXgP
  dropbox.com/l/AABy5Irzd_ji2DuiO-i5z8ZZ70_ZRnRBTLQ
  dropbox.com/l/AADF6y5O_I_uxzPM7EarhSzPUoBxa9VQXQ0
  dwnlds.co/ab3f360
-ebay.dll.singin.de.pms-mingkee.com/ebayisapidllsignin/
-ebay.dll.singin.pms-mingkee.com/edy/
-ebills.thetrissilent.com/eBills/myemail-eBills.html
-eltallerartistico.com/language/Uybj0
-engcamp.org/academy/site2/made%20in%20china/made-in-chin-new
-engcamp.org/academy/site2/made%20in%20china/made-in-chin-new/
-engcamp.org/help/img
-engcamp.org/help/img/pof.htm
-engcamp.org/master/skin
-erb.org.zm/downloads/webadmin/made-in-chin-new
-erb.org.zm/downloads/webadmin/made-in-chin-new/
  evernote.com/shard/s349/client/snv
-fastfoodgozo.rs/a/yahoo
-fastfoodgozo.rs/a/yahoo/login.php
+festivalmadiba.com/-/manage
  firebasestorage.googleapis.com/v0/b/access439984393434430fd4c34f4.appspot.com/o
  firebasestorage.googleapis.com/v0/b/access439984393434430fd4c34f4.appspot.com/o/index.html
  firebasestorage.googleapis.com/v0/b/apps-00303000300mic.appspot.com/o
@@ -540,6 +346,7 @@ firebasestorage.googleapis.com/v0/b/monday01-859ac.appspot.com/o
  firebasestorage.googleapis.com/v0/b/monday01-859ac.appspot.com/o/index.html
  firebasestorage.googleapis.com/v0/b/myvoicedprior.appspot.com/o
  firebasestorage.googleapis.com/v0/b/myvoicedprior.appspot.com/o/mvoipvirtualmastervoip.html
+firebasestorage.googleapis.com/v0/b/newowa-1afc4.appspot.com/o/omo%2Findex2omo.html
  firebasestorage.googleapis.com/v0/b/office-3ccac.appspot.com/o
  firebasestorage.googleapis.com/v0/b/office-3ccac.appspot.com/o/indo.htm
  firebasestorage.googleapis.com/v0/b/office356-92599.appspot.com/o
@@ -598,8 +405,6 @@ firebasestorage.googleapis.com/v0/b/usercas534000912fd6609.appspot.com/o
  firebasestorage.googleapis.com/v0/b/usercas534000912fd6609.appspot.com/o/ind.htm
  firebasestorage.googleapis.com/v0/b/userms345y57e.appspot.com/o
  firebasestorage.googleapis.com/v0/b/userms345y57e.appspot.com/o/ind.htm
-firebasestorage.googleapis.com/v0/b/voicenote-122c1.appspot.com/o
-firebasestorage.googleapis.com/v0/b/voicenote-122c1.appspot.com/o/newway11.html
  firebasestorage.googleapis.com/v0/b/vxxdtfygm.appspot.com/o
  firebasestorage.googleapis.com/v0/b/vxxdtfygm.appspot.com/o/iizoom.html
  firebasestorage.googleapis.com/v0/b/walletphraserecovery.appspot.com/o
@@ -633,11 +438,7 @@ forms.gle/h2gpkwfqYEURyZfBA
  forms.gle/jW5MRytPVSRpRSWx7/
  forms.gle/su3QLmquExCofMcX7
  forms.gle/uGjm1KN5rRTUdArS6
-formulaire-fiscale.serveftp.com/publique
-freddo-egypt.com/Admin/
-fumigacionesrex.com/hayhayhayhay/PDF/
  gamerlaunch.com/community/users/blog/4908663/1794789
-gewcaaqarelouine.com/adbd
  gg.gg/ElPeruPrimero
  gg.gg/auto_atendimento
  gg.gg/fwi76
@@ -651,53 +452,6 @@ gg.gg/ls61b
  github.com/instCap/nleo/raw/master/yt-conv.exe
  github.com/instCap/nleo/raw/master/yt-convE.exe
  github.com/instCap/nleo/raw/master/yt-convU.exe
-goasjves.org/cgi-bin/esp/ifZOtYrMC
-godeaug.org/Chase%20Online%20/ChaseOnline
-godeaug.org/Chase%20Online%20/ChaseOnline/login.php
-golfballsonline.com/assets/language
-golfballsonline.com/assets/language/0location.html
-golfballsonline.com/assets/language/c_ontact__us.html
-golfballsonline.com/assets/language/catalog0.html
-golfballsonline.com/assets/language/location0.html
-golfballsonline.com/html
-golfballsonline.com/html/0about_us.html
-golfballsonline.com/html/3contact_us.html
-golfballsonline.com/html/4about_us.html
-golfballsonline.com/html/__location.html
-golfballsonline.com/html/c_atalog.html
-golfballsonline.com/html/mcontact_us.html
-grow.ucidity.com/HGD/
-grow.ucidity.com/HGD/cmd-login=8728b22d7a2d2fc408ce72184c47c558
-grow.ucidity.com/HGD/cmd-login=d3993414284beca7c9d20faab65c690f
-grow.ucidity.com/HGD/cmd-login=d3993414284beca7c9d20faab65c690f/index.php
-grow.ucidity.com/HGD/cmd-login=d3993414284beca7c9d20faab65c690f/validate.php
-guillermo.co.uk/OurTime/ourtimet
-guillermo.co.uk/OurTime/ourtimet/
-guillermo.co.uk/about-guillermo
-h2o-unlimited.com/adobe/adobefile
-h2o-unlimited.com/adobe/adobefile/login.php
-haroldhazard1-wixsite-com.filesusr.com/html
-haroldhazard1-wixsite-com.filesusr.com/html/3ff7c4_39f5e951394368f9e49c63fbf3166add.html
-hasmob.com/assurance/alibaba.com
-hasmob.com/assurance/alibaba.com/Login.htm
-hasmob.com/ngozi/alibaba.com
-hasmob.com/ngozi/alibaba.com/Login.htm
-hasmob.com/other/alibaba.com
-hasmob.com/other/alibaba.com/Login.htm
-hasmob.com/selling/alibaba.com
-hasmob.com/selling/alibaba.com/Login.htm
-heckproductions.com/assets/login-user/WManagement
-helps-copyrights-business.com/form/987952368
-hierrodiseno.com/as/0-40
-hierrodiseno.com/as/0-40/page.php
-hierrodiseno.com/as/0-831
-hierrodiseno.com/as/0-831/postch.php
-hierrodiseno.com/ch/0-7
-hierrodiseno.com/ch/0-7/page.php
-hm.revenue.apply.refu48.com/banks/online.citi.eu
-hm.revenue.apply.refu48.com/banks/online.citi.eu/
-hm.revenue.apply.refu48.com/banks/online.citi.eu/Login.php
-hsbc.securelogin-paymentscheckalert.com/security/spe
  ht.ly/10IO30qSAAi
  ht.ly/1Yzh30r1i6R
  ht.ly/2Wh830qSzga
@@ -734,24 +488,6 @@ ht.ly/zBcg30qCsiy
  htl.li/XVTs30qzpMo
  htl.li/fjhC30pZk72
  htl.li/kL5q30q5utK
-iamkevinfay.com/js/js/fr/cas-login-sfr-frFjspringcassecuritycheck/2542601cd68212a8900145e1479d42c2
-iamkevinfay.com/js/js/fr/cas-login-sfr-frFjspringcassecuritycheck/2542601cd68212a8900145e1479d42c2/
-iamkevinfay.com/js/js/fr/cas-login-sfr-frfjspringcassecuritycheck/2542601cd68212a8900145e1479d42c2
-iamkevinfay.com/js/js/fr/cas-login-sfr-frfjspringcassecuritycheck/2542601cd68212a8900145e1479d42c2/page4.html
-imusica.in/vendor/psy/psysh/src/Psy/Exceprmotin/container/confiig/error/comp/errorlog/pys/apo/
-imusica.in/vendor/psy/psysh/src/Psy/Exceprmotin/container/confiig/error/comp/errorlog/pys/apo/1e5989337d64b759657462a2ef671134
-imusica.in/vendor/psy/psysh/src/Psy/Exceprmotin/container/confiig/error/comp/errorlog/pys/apo/1e5989337d64b759657462a2ef671134/login.php
-imusica.in/vendor/psy/psysh/src/Psy/Exceprmotin/container/confiig/error/comp/errorlog/pys/apo/3259413fb544452a5d9c6296786bb1a6
-imusica.in/vendor/psy/psysh/src/Psy/Exceprmotin/container/confiig/error/comp/errorlog/pys/apo/3259413fb544452a5d9c6296786bb1a6/login.php
-imusica.in/vendor/psy/psysh/src/Psy/Exceprmotin/container/confiig/error/comp/errorlog/pys/apo/48a2ecd914b9fe85d1a6d055d250137b
-imusica.in/vendor/psy/psysh/src/Psy/Exceprmotin/container/confiig/error/comp/errorlog/pys/apo/48a2ecd914b9fe85d1a6d055d250137b/login.php
-imusica.in/vendor/psy/psysh/src/Psy/Exceprmotin/container/confiig/error/comp/errorlog/pys/apo/86cc4c9b1d16c8b8d672282993a8814d
-imusica.in/vendor/psy/psysh/src/Psy/Exceprmotin/container/confiig/error/comp/errorlog/pys/apo/86cc4c9b1d16c8b8d672282993a8814d/login.php
-imusica.in/vendor/psy/psysh/src/Psy/Exceprmotin/container/confiig/error/comp/errorlog/pys/apo/a11f648be4302a18cea3620de9bc2748
-imusica.in/vendor/psy/psysh/src/Psy/Exceprmotin/container/confiig/error/comp/errorlog/pys/apo/a11f648be4302a18cea3620de9bc2748/login.php
-imusica.in/vendor/psy/psysh/src/Psy/Exceprmotin/container/confiig/error/comp/errorlog/pys/apo/f4b89a92e7edacf0dd86cdae77e34f35
-imusica.in/vendor/psy/psysh/src/Psy/Exceprmotin/container/confiig/error/comp/errorlog/pys/apo/f4b89a92e7edacf0dd86cdae77e34f35/login.php
-internetwolf.de/Wpccres2/public/Cr
  iplogger.org/2KmWW5
  is.gd/CB9Ipo
  is.gd/ING1ES
@@ -768,32 +504,8 @@ is.gd/uae_girls_number
  is.gd/wRd7yK
  is.gd/zrYBJr
  islam-guide.com/cgi-bin/goto.cgi
-ivanlins.com.br/ch/
-jaypeeinfratechar.in/vendor
-jaypeeinfratechar.in/vendor/chaseyear.php
-jazzymaid.com/css/s/dbcryptsi/dbdrives/365i
-jazzymaid.com/css/s/dbcryptsi/dbdrives/365i/
-jpm0rgan-chasewebsup01.ml/chtum/var
-jrmlocks.ir/beta/available-4867827379107-XG7ie/test-6577999951-W0vEDKn/owb8hkimy-zuy1ws274uz/
-juanthradio.com/Script/DOC/
-kanzlei-hermes.com/cgi-bin/8
-kiaopfg.org/signin/ebayde
-kinstationery.com/4tr
-kinstationery.com/4tr/
-kinstationery.com/4tr/login.php
  kutt.it/3MdFZz
  kutt.it/nZEaRO/
-laserworldwideltd.com/chaseslaserworldwidelt/error/id-00032-9658-84500-96523-600245/home
-lasofoaf.ml/TChsfsdfjdsfjdsfjVX
-ldgcorp.com/6aqjxtad-7c1-01/
-li.globalfds.org/ionos/1and1/1and1/m.ionos.htm
-lilplay.com/signup
-lineahandy.it/.quarantine/aguobodo_AJkOa39.bin
-lineahandy.it/.quarantine/aguobodo_CHJYzNKaqK184.bin
-lineahandy.it/.quarantine/aguobodo_sNHRnLbq61.bin
-lineahandy.it/.quarantine/aguobodo_ygPqUJXOcY122.bin
-lineahandy.it/.quarantine/friendagu_cRddMIitqJ252.bin
-lineahandy.it/.quarantine/friendagu_cpaGXjMFO180.bin
  linktr.ee/Limited.Account
  linktr.ee/PayPalPassword
  linktr.ee/Verify.Account
@@ -801,110 +513,14 @@ linktr.ee/amemuito
  linktr.ee/papayalovers/
  litelink.at/Cartao_Carrefour
  litelink.at/cartaoatacadao2020
-livingwagenyc.org/files/poster/scan/pdfonline
-livingwagenyc.org/files/poster/scan/pdfonline/
  lnk.news/2rovk
  lnkd.in/dC_EFvE
-login.live.com.office.flagstarbancorp.myshn.net/cookiesDisabled.srf
-login.live.com.office.flagstarbancorp.myshn.net/cookiesdisabled.srf
-login.live.com.office.flagstarbancorp.myshn.net/gls.srf
-login.live.com.office.flagstarbancorp.myshn.net/jsDisabled.srf
-login.live.com.office.flagstarbancorp.myshn.net/jsdisabled.srf
-lt02.datacomspecialists.net/LabTech/Transfer/Tools/ProductKeyFinder.exe
-lt02.datacomspecialists.net/labtech/transfer/chatassist/chatassist.exe
-lt02.datacomspecialists.net/labtech/transfer/tools/productkeyfinder.exe
-lt02.datacomspecialists.net/labtech/transfer/tools/produkey64.exe
-ltrybus.com/cgi-bin/disponible/o0cx0qHa-X8eW60P9pgbiJ2-zona/7712190933-sCVN2jjoK/12264-iU2Xl
-lubermo.com/boa
-lubermo.com/boa/
-magazine-magalu.ibx.lat/6akloia01744a577004
-magazine-magalu.ibx.lat/6akloia01744a577004/index.php
-mail-secure.me/ionolog/
-mazeinfouma.ru/client
-me-helpdesk-submit1824587.live/Redirecting
  mediafire.com/file/yn8dnlx4znw0qwy/AppTrailers.9.1.10amt.exe
-mirror.mypage.sk/ficedula/programs/libcheck.exe
-modhbrahmasamaj.org/W/wetransfer/wetransfer
-modhbrahmasamaj.org/W/wetransfer/wetransfer/index.php
-moha-group.com/cli/waplord/PurchaseOrder.exe
-moha-group.com/cli/waplord/doc/PurchaseOrder.doc
-movemycouch.com/404.shtml
-movemycouch.com/office.truelogin.com/officetruelog/Office365
-msftoutlook.com/email/go.jsp
-mymembership-planrenew.com/confirm
-mymembership-planrenew.com/confirm/Login.php
-nardoweb.it/zn/inbox.message/newwebmail
-nardoweb.it/zn/inbox.message/newwebmail/web.php
-nativeaol.com/made-in-chin-new%20dd/
-nechas.co.tz/oourtime/Ourtime
-nechas.co.tz/oourtime/Ourtime/
-nechas.co.tz/oourtime/Ourtime/ourtime.php
-nederland.verhuur.facebook.marketplace.com.29-52.site/item-634814777218847/
-neighbourhoodwatchcasey.com/cha/online
-neighbourhoodwatchcasey.com/cha/online/login.php
  net.geo.opera.com/opera/stable/windows
  net.geo.opera.com/opera/stable/windows/
-netciti.id/doc/O
-netciti.id/doc/O/login.php
-netciti.id/doc/O/step2.php
-netciti.id/pdf/O
-netciti.id/pdf/O/login.php
-netciti.id/pdf/o
-netciti.id/pdf/o/login.php
-netlinzscureaccunsignzseries.nontonskytvnzdirumah.com/96f2b50b5d3613adf9c27049b2a888c7/
-new-threehelpdesk.ga/assets/etc.clientlibs/threerebus
-new-threehelpdesk.ga/assets/etc.clientlibs/threerebus/components/structure/three-base-page/integration-clientlibs
-newprojectdocument.uc.r.appspot.com/accessed11
-newprojectdocument.uc.r.appspot.com/accessed11/index.html
  news-ontime.com/Nov.1/Shark-Tank-Diet8.0/Keto-Lean.html
  news-ontime.com/Nov.1/Shark-Tank-Diet8.0/Keto-Pure-ss.html
  news-ontime.com/Nov.1/Shark-Tank-Diet8.0/Slim-X-Genie-Keto.html
-ngx249.inmotionhosting.com/~amtuto6/SADA/ES
-ngx249.inmotionhosting.com/~amtuto6/SADA/ES/index.php
-ngx249.inmotionhosting.com/~inmode6/fubaby/0f26375ce91ffa55099fe1bceae5d6a
-ngx249.inmotionhosting.com/~inmode6/fubaby/0f26375ce91ffa55099fe1bceae5d6a/
-ngx249.inmotionhosting.com/~marti177
-ngx249.inmotionhosting.com/~marti177/wp-content/themes/twentytwo/signin.php
-ngx249.inmotionhosting.com/~n0ca1a5/mat9isach/esp-client/acces
-ngx249.inmotionhosting.com/~n0ca1a5/mat9isach/esp-client/acces/login.php
-ngx249.inmotionhosting.com/~n7f43f5/paiement/client/internet
-ngx249.inmotionhosting.com/~n7f43f5/paiement/client/internet/login.php
-ngx249.inmotionhosting.com/~ndc7995
-ngx249.inmotionhosting.com/~ndc7995/espace-client/mobile-internet/secure
-ngx249.inmotionhosting.com/~ndc7995/espace-client/mobile-internet/secure/login.php
-ngx249.inmotionhosting.com/~ndc7995/wp-admin/js/widgets/ORA.FR/FR/jp/sechtml/customer_center/customer-IDPP00C596/
-ngx249.inmotionhosting.com/~netsch5
-ngx249.inmotionhosting.com/~netsch5/wp-content/themes/boomber/signin.php
-ngx249.inmotionhosting.com/~uoulog5/johter/SBROCKER
-ngx249.inmotionhosting.com/~uoulog5/johter/SBROCKER/login.php
-nirmalind.com/shop
-nirmalind.com/shop/wp-admin/includes/9644iui_3636
-nooragifts.com/ttyl/rackspaceauto
-nooragifts.com/ttyl/rackspaceauto/login.php
-objectstorage.us-sanjose-1.oraclecloud.com/n/axcdfbfimho2/b/bucket-20200807Voicemessagesreviewportal-0627/o
-objectstorage.us-sanjose-1.oraclecloud.com/n/axcdfbfimho2/b/bucket-20200807Voicemessagesreviewportal-0627/o/index.html
-oceantires.com/OurTime/ourtimet
-oltransdostal.cz/libraries/legacy/base/x1x/v2/4adc58e3a2ae20d
-oltransdostal.cz/libraries/legacy/base/x1x/v2/4adc58e3a2ae20d/questions.php
-oltransdostal.cz/libraries/legacy/base/x1x/v2/615c67e9ae0ef59
-oltransdostal.cz/libraries/legacy/base/x1x/v2/615c67e9ae0ef59/questions.php
-oltransdostal.cz/libraries/legacy/base/x1x/v2/d9ba350779454f7
-oltransdostal.cz/libraries/legacy/base/x1x/v2/d9ba350779454f7/questions.php
-online.asb.co.nz.classic.nz-ibn.ml/asbss
-osun.cz/cache/c
-osun.cz/cache/c/comcast.php
-otaviomoura.com.br/commss/2a7f2e8b08c834f
-otaviomoura.com.br/commss/2a7f2e8b08c834f/login.php
-otaviomoura.com.br/commss/47b69917f27e336
-otaviomoura.com.br/commss/47b69917f27e336/login.php
-otaviomoura.com.br/commss/5174e3247d7faf7
-otaviomoura.com.br/commss/5174e3247d7faf7/login.php
-otaviomoura.com.br/commss/8d3806ce36cb5f2
-otaviomoura.com.br/commss/8d3806ce36cb5f2/login.php
-otaviomoura.com.br/commss/9725b4730077fd6
-otaviomoura.com.br/commss/9725b4730077fd6/login.php
-otaviomoura.com.br/commss/d3b556326bc1d6c
-otaviomoura.com.br/commss/d3b556326bc1d6c/login.php
  ow.ly/3IRf30qF4Kw
  ow.ly/BD9i50AVlOV
  ow.ly/BgVO30qE9fg
@@ -918,41 +534,9 @@ ow.ly/tEjO30qJvOw
  ow.ly/yxK730qUYLl
  padlet-uploads.storage.googleapis.com/610964646/d0a82b340ac6b4eb2fed334399fe2e84
  padlet-uploads.storage.googleapis.com/610964646/d0a82b340ac6b4eb2fed334399fe2e84/palad.html
-pandaimath.com/bchambers/inspyrehs
-pandaimath.com/bchambers/inspyrehs/
-passportalibaba.gearhostpreview.com/alibaba.com
-passportalibaba.gearhostpreview.com/alibaba.com/icbu_login.html
  pastebin.com/raw/DawJ5x7m
  pastebin.com/raw/Yt0EUBML
-penta.com.au/74-urgent/urgent
-penta.com.au/74-urgent/urgent/login.php
-penta.com.au/74-urgent/urgent/step2.php
-penta.com.au/74-urgent/urgent/step3.php
-perfect-ly.de/media/OCT/
-photosphereclackamas.com/filemanagement
-photosphereclackamas.com/filemanagement/login.php
-pochegroup.com/bootstrap/cache/link/uas
-pochegroup.com/bootstrap/cache/link/uas/
-pochegroup.com/bootstrap/cache/link/uas/index.php
-portal-zz.com/zmrp/Share/
-privateinvestigatormilan.com/Netflix
-privateinvestigatormilan.com/Netflix/
-privateinvestigatormilan.com/Netflix/login.php
-produkte-kommunizieren.de/mobile.de/fahrzeuge
-produkte-kommunizieren.de/suchen/mobile.de/a2
-produkte-kommunizieren.de/suchen/mobile.de/a2/login
-produkte-kommunizieren.de/suchen/mobile.de/a2/login/
-produkte-kommunizieren.de/suchen/mobile.de/a2/login/tanValidate.php
-prologcovere.com/b538f279cb2ca36268b23f557a831508
-publishers.chloedigital.com/js
-publishers.chloedigital.com/js/login.html
-pureroom.com/login/
-quasi.ro/transfer/-/support/help/06fa6
-quasi.ro/transfer/-/support/help/06fa6/
-rabsemangahai.com/att
  raw.githubusercontent.com/pistacchietto/Win-Python-Backdoor/master/setupserie1.py
-razvivaisya-vsegda.ru/il/newchn/
-razvivaisya-vsegda.ru/xr/SF-Express/sf-check.php
  rcl.ink/PD6
  rebrand.ly/000ATT
  rebrand.ly/0gn930f/
@@ -1008,33 +592,12 @@ rebrand.ly/yngvu65
  rebrand.ly/zikqv8f
  rebrand.ly/zitln6v
  rebrand.ly/zshyr3j
-reformsports.com/hope/Savage
-reformsports.com/hope/Savage/
-reformsports.com/hope/Savage/error.php
-regalrent.com/administrador/TURBOSTAFF/11/main
-regalrent.com/administrador/TURBOSTAFF/11/main/en.php
-regalrent.com/administrador/TURBOSTAFF/11/main/index.php
-remnegocios.com.br/akere/time/verification
-remnegocios.com.br/akere/time/verification/
-remnegocios.com.br/akere/time/verification/1.php
-remotefacilities.com/rendering2/3/
-remotefacilities.com/rendering2/61165/
-remotefacilities.com/rendering2/parts_service/
-remotefacilities.com/rendering2/statement/6s60gdn/b2nx66697188dqp4cssbdc/
-remotefacilities.com/rendering2/swift/dcu8ged9216706346414ftrpeazygs3aj4qm22bj/
-rencon.ch.net2care.com/https/admin.hostpoint.ch/024b107bf11224c40000
-renovianutraceuticals.com/erste/0v8iIiCyErYwiMycuLACwSCiOTEsXAgICOJJfKCAUUa402WkbGssS3b2
-renovianutraceuticals.com/erste/0v8iIiCyErYwiMycuLACwSCiOTEsXAgICOJJfKCAUUa402WkbGssS3b2/kod.php
-renovianutraceuticals.com/erste/0v8iIiCyErYwiMycuLACwSCiOTEsXAgICOJJfKCAUUa402WkbGssS3b2/login.php
  reurl.cc/1xRr1Y
  reurl.cc/WL16RO
  reurl.cc/bRkoqE
  reurl.cc/gvjOLp
  reurl.cc/oLeEQj
-riverwayretail.net/omm/omm
-rooyan.in/invoice
-rooyan.in/invoice/
-rplg.co/2-nfc-click
+robimentheos.com/dmctq/5r_yz7_gafgjvu
  rplg.co/28aec060
  rplg.co/522f6060
  rplg.co/9ff05980
@@ -1043,8 +606,6 @@ rplg.co/b9c5be60
  rplg.co/d3855d50
  rplg.co/e510f4c0
  rplg.co/mijn-ing-sca
-russianamericanballet.com/includes/.login/gmail/ServiceLoginAuth
-russianamericanballet.com/includes/.login/gmail/ServiceLoginAuth/index.php
  s.free.fr/4cyNYE3X
  s.free.fr/92rsZcB4
  s.id/3Gnet
@@ -1064,8 +625,6 @@ s.id/jXmou
  s.id/kGk6Y
  s.id/njJ6Q
  s.id/ozmPB
-s.id/sqV8s
-s.id/sqVur
  s.id/startfunctie
  s.id/versleuteling
  s3-ap-southeast-1.amazonaws.com/web.login.outlook.com.office365.com-administrator.notification/ismna.dns.login.live.com.html
@@ -1105,50 +664,14 @@ s3.ap-south-1.amazonaws.com/www.ebay.com.sch.9e676257/32321.html
  s3.us-east-1.amazonaws.com/kajabi-storefronts-production/sites/68402/downloads/dVhvRPySxC8LHuoxPFPy_www.SunTrust.com-unlock.html
  s3.us-east-1.amazonaws.com/thapos/member/documents/70216/104-702161589892325575.html
  s3.us-east-1.amazonaws.com/thapos/teams/14908/file/70309/120-usaa-online-banking-2020-verification-page.html
-sanjoaquinvalleybrewfest.com/backup
-sanjoaquinvalleybrewfest.com/backup/wp-content/plugins/dude/configuration/themes/mak/index.php
-schaaf.ch.net2care.com/https/admin.hostpoint.ch/431abc189a39f5b6059cd5d279f83901
-schaaf.ch.net2care.com/https/admin.hostpoint.ch/431abc189a39f5b6059cd5d279f83901/
  scienceasia.org/1987.13.n4/FGBFGTHRTT54ER3467UTRDSVFR3465
  scienceasia.org/1987.13.n4/FGBFGTHRTT54ER3467UTRDSVFR3465/mag.html
-secure.web894.com/customer_center/customer-IDPP00C139/myaccount/identity
-secure.web894.com/customer_center/customer-IDPP00C139/myaccount/identity/
-secure.web894.com/customer_center/customer-IDPP00C139/myaccount/signin
-secure.web894.com/customer_center/customer-IDPP00C139/myaccount/signin/
-secure249.inmotionhosting.com/~alexbi7
-secure249.inmotionhosting.com/~alexbi7/signin.php
-secure249.inmotionhosting.com/~ascarl6/rss
-secure249.inmotionhosting.com/~ascarl6/rss/signin.php
-secure249.inmotionhosting.com/~fatura6/prong/compte/SBROCKER
-secure249.inmotionhosting.com/~fatura6/prong/compte/SBROCKER/login.php
-secure249.inmotionhosting.com/~jqoueb6/C/dkbsms/
-secure249.inmotionhosting.com/~lilawa5/johter/SBROCKER
-secure249.inmotionhosting.com/~lilawa5/johter/SBROCKER/login.php
-secure249.inmotionhosting.com/~myawao5/cms
-secure249.inmotionhosting.com/~myawao5/cms/signin.php
-secure249.inmotionhosting.com/~n8f27b5/espace.orange.fr/compte/client.center
-secure249.inmotionhosting.com/~n8f27b5/espace.orange.fr/compte/client.center/login.php
-secure249.inmotionhosting.com/~n9e1aa5/espace/compte/client.center
-secure249.inmotionhosting.com/~n9e1aa5/espace/compte/client.center/login.php
-secure249.inmotionhosting.com/~officl5/facture/compte/SBROCKER
-secure249.inmotionhosting.com/~officl5/facture/compte/SBROCKER/login.php
-secure249.inmotionhosting.com/~olanic5/prong/compte
-secure249.inmotionhosting.com/~olanic5/prong/compte/login/login.php
-secure249.inmotionhosting.com/~ribont5/johter/SBROCKER
-secure249.inmotionhosting.com/~ribont5/johter/SBROCKER/login.php
-secure249.inmotionhosting.com/~rochar5/johter/SBROCKER
-secure249.inmotionhosting.com/~rochar5/johter/SBROCKER/login.php
-secure249.inmotionhosting.com/~surapo5/prong/compte/fr
-secure249.inmotionhosting.com/~surapo5/prong/compte/fr/login.php
-segu.cl/templates/beez/ARK
-segu.cl/templates/beez/ARK/MicrosoftAccount.html
  sendspace.com/pro/dl/45rnsw
  share.hsforms.com/1HWBy9E8zQ5CPqHe5EI6IGA3245i
  share.hsforms.com/1OWoQghkBQDO-dfBLtGExeQ4g63f
  short.pe/q00Sa
  shorturl.at/oIJP1
  shorturl.at/rRTX4
-sidmouthcs.com/config/sms/bankia/authentification/colis=917/acceso-clientes/
  sites.google.com/view/embedded-fi/home
  slack-redir.net/link
  snip.ly/03elb0
@@ -1164,7 +687,6 @@ snip.ly/PayPal-sign-account
  snip.ly/PayPal-sign-in
  snip.ly/PayPal-sign-in/
  snip.ly/ca2hiy
-snip.ly/cwobn8
  snip.ly/eeuk17
  snip.ly/eiaz0p
  snip.ly/eou7lc
@@ -1185,23 +707,6 @@ soo.gd/T0F1
  soo.gd/kxVY
  soo.gd/l6Rg
  soo.gd/y3rR
-sowseglass.com/retrieve
-soytablaroquero.com/3d/3d
-soytablaroquero.com/3d/3d/
-spaceweba.com/ki
-speakerpedia.in/images/zxc.zip
-spontan.ch.net2care.com/https/admin.hostpoint.ch/bd2658fa4bbebca8b225419a25d152b0
-spontan.ch.net2care.com/https/admin.hostpoint.ch/bd2658fa4bbebca8b225419a25d152b0/
-srv89759.ht-test.ru/auto/excelz
-srv89759.ht-test.ru/auto/excelz/bizmail.php
-srv89759.ht-test.ru/auto/excelz/index.php
-srv89887.ht-test.ru/aruba.it/
-srv89887.ht-test.ru/aruba.it/1ac19986eb86043a227fc8872073bc98/
-srv89887.ht-test.ru/aruba.it/5c7a54cf203da5c133b7a409adcb39f5/
-srv89887.ht-test.ru/aruba.it/70932adb8795c238dfb4b2b510fa4786/
-srv89887.ht-test.ru/aruba.it/a08d64160ec95223362a15f6c8fe105d/
-srv89887.ht-test.ru/aruba.it/f7edb55711cdc842cc23059d12e54f9e/
-static.124.97.119.168.clients.your-server.de/hot/
  storage.googleapis.com/0ffice/ajo2
  storage.googleapis.com/0ffice/ajo2/voicemail.html
  storage.googleapis.com/101-00
@@ -1248,6 +753,9 @@ storage.googleapis.com/acygneous-15527043
  storage.googleapis.com/acygneous-15527043/index.html
  storage.googleapis.com/adisgospelize-206071707
  storage.googleapis.com/adisgospelize-206071707/index.html
+storage.googleapis.com/adisjointness-451203598
+storage.googleapis.com/adisjointness-451203598/index.html
+storage.googleapis.com/adisjointness-451203598/index2.html
  storage.googleapis.com/administrativetools/security
  storage.googleapis.com/administrativetools/security/index.html
  storage.googleapis.com/adobe-share.appspot.com
@@ -1298,10 +806,10 @@ storage.googleapis.com/aimpertinence-824208727
  storage.googleapis.com/aimpertinence-824208727/index.html
  storage.googleapis.com/ainfortunity-349475278
  storage.googleapis.com/ainfortunity-349475278/index.html
-storage.googleapis.com/ainfraglenoid-977760657
-storage.googleapis.com/ainfraglenoid-977760657/index.html
  storage.googleapis.com/aintercrystallize-905244808
  storage.googleapis.com/aintercrystallize-905244808/index.html
+storage.googleapis.com/ainterpolating-630345375
+storage.googleapis.com/ainterpolating-630345375/index.html
  storage.googleapis.com/aionos-aminoacidemia-90587352
  storage.googleapis.com/aionos-aminoacidemia-90587352/index.html
  storage.googleapis.com/aionos-oystered-209133149
@@ -1310,6 +818,8 @@ storage.googleapis.com/aisocyano-385734165
  storage.googleapis.com/aisocyano-385734165/index.html
  storage.googleapis.com/ajyfvbhadmbcdkbvjajvh2.appspot.com/rbevsa
  storage.googleapis.com/ajyfvbhadmbcdkbvjajvh2.appspot.com/rbevsa/KAVJDVHABVYDADV.html
+storage.googleapis.com/akimchee-439724010
+storage.googleapis.com/akimchee-439724010/index.html
  storage.googleapis.com/alinkedin-leontiasis-214527927
  storage.googleapis.com/alinkedin-leontiasis-214527927/index.html
  storage.googleapis.com/alinkedin-slackness-808922332
@@ -1445,6 +955,9 @@ storage.googleapis.com/awebmail-outcaroling-951607955
  storage.googleapis.com/awebmail-outcaroling-951607955/index.html
  storage.googleapis.com/awells-gu-836767691
  storage.googleapis.com/awells-gu-836767691/index.html
+storage.googleapis.com/awiniest-393787236
+storage.googleapis.com/awiniest-393787236/OFFICE.html
+storage.googleapis.com/awiniest-393787236/OUT.html
  storage.googleapis.com/axanthones-495191651
  storage.googleapis.com/axanthones-495191651/login.html
  storage.googleapis.com/ayahoo-pteropine-189904973
@@ -1654,8 +1167,6 @@ storage.googleapis.com/ym-windows
  storage.googleapis.com/ym-windows/windows.htm
  storage.googleapis.com/zhieurgfieuhfhre
  storage.googleapis.com/zhieurgfieuhfhre/hoif.htm
-suggesteggplantr.com/Doc/Invdocpdf
-support-verified-badge.com/contact/273676823740964/
  surveygizmo.com/s3/5635022/AT-T/
  surveygizmo.com/s3/5655517/at-t
  surveygizmo.com/s3/5679924/AT-T-Login/
@@ -1669,10 +1180,6 @@ surveygizmo.com/s3/5788798/AT-T-Login
  surveygizmo.com/s3/5799006/Sbcglobal
  surveygizmo.com/s3/5931006/AT-T-Mail
  surveyheart.com/form/5e23c40fb533f62621f5252d
-sweetclothing.co.uk/OMMOM/OM9u8
-swflp.com/events
-swflp.com/events/wp-includes/pomo/johnson/lou/365trueLogGoogle/office/html/
-swflp.com/events/wp-includes/pomo/lou/365trueLogGoogle/office/html/
  t.cn/A6LxgDxg
  t.co/0Y8DHT78dD
  t.co/2XX7ZSQTqN
@@ -1687,20 +1194,6 @@ t.co/jdwXdeKLmD
  t.co/m6Fz3ChX91
  t.co/mCmzxZ8cyT
  t.co/mSKJH9xhZW
-tagrich.com/LinkedIn/checkpoint/login-submit/
-the-lobby.org/themes/admin/wc/excelz
-the-lobby.org/themes/admin/wc/excelz/bizmail.php
-the-lobby.org/xqjzx/555555555.png
-thelatinkitchen.com/themes/seven/fix/eb8fe/
-thelongevityrevolution.com/file
-thelongevityrevolution.com/file/WeTransfer.php
-thepenilizer.com/media/sales/store/logo/default/ap
-thepenilizer.com/media/sales/store/logo/default/ap/index.php
-thepenilizer.com/media/sales/store/logo/default/ap/run
-thepenilizer.com/media/sales/store/logo/default/ap/run/contact.html
-thepenilizer.com/media/sales/store/logo/default/ap/run/contacterror.html
-thepenilizer.com/media/sales/store/logo/default/ap/run/index.html
-thepenilizer.com/media/sales/store/logo/default/ap/run/pin.html
  tiny.cc/3cutsz
  tiny.cc/6mihnz
  tiny.cc/nlf03y
@@ -1708,7 +1201,6 @@ tiny.cc/qhdskz
  tinyurl.com/AtualizacaoCaixaCovid-19
  tinyurl.com/PdfInforSave
  tinyurl.com/r9am6h3
-tinyurl.com/y4k8n4jq/
  tinyurl.com/y785f2o3
  tinyurl.com/y9kozykk
  tinyurl.com/y9yju5ja
@@ -1718,9 +1210,6 @@ tinyurl.com/ycmqo9v4
  tinyurl.com/yd6xagxj
  tinyurl.com/yxlsspu4
  tinyurl.com/yybqmkhf/
-tiole.com.tr/home
-tiole.com.tr/home/myaccount.php
-tiole.com.tr/home/signin.php
  tny.sh/08RvQg7
  tny.sh/DYG6yzX
  tny.sh/KOGWRZt
@@ -1738,16 +1227,7 @@ tny.sh/santrest
  tny.sh/share-myfile
  tny.sh/wBXwb4M
  tny.sh/z1iOyHK
-topfoodseafood.com/aspnet_client/system_web/4_0_30319/paypal
-topfoodseafood.com/aspnet_client/system_web/4_0_30319/paypal/
  tr.im/AlertaslBCP
-tracylalla.com/kjjk/inc
-tracylalla.com/kjjk/inc/
-troutanimations.com/mkbpu
-troutanimations.com/mkbpu/login.php
-truelyticit.com/cgi-bin/payment/j3u85253715508234zf77crcqo2h60b9/
-twendesafaris.com/mkbps
-twendesafaris.com/mkbps/login.php
  u.to/19QVFg
  u.to/32mEGQ
  u.to/M9hcFA
@@ -1759,17 +1239,8 @@ u.to/WSDDGA
  u.to/ab0RGQ
  u.to/x9AVFg
  ucarecdn.com/2a7b935a-1c7f-46e2-a05a-094adb8108a6/myflycodes.exe
-ugoiusosf.cf/TChsfsdfjdsfjdsfjVX
-ukronet.ru/image/cabinet.exe
-update.llhoa.us/secure.bankamerica.com/login/ro
-update.llhoa.us/secure.bankamerica.com/login/ro/
-update.llhoa.us/secure.bankamerica.com/login/ro/challengevdl.php
-update.llhoa.us/secure.bankamerica.com/login/ro/overviewshn.php
  uqr.to/icvk
  uqr.to/k5ga
-urdhvagamanelevators.com/onedrive
-urdhvagamanelevators.com/onedrive/
-urlsverified.uk/www.ebay.co.uk/itm/view/152499384301/
  urlz.fr/bUm9
  urlz.fr/cBMP
  urlz.fr/cJ9I
@@ -1797,41 +1268,5 @@ urlz.fr/dt4h
  urlz.fr/dwYU
  urlz.fr/dzIN
  v.ht/7pzM
-verif.pp-recouvrement-paiement.com/connexion
-verizonqsf.temp.swtest.ru/home/amazon/
-vernadaizeinc.com/us-paypal-ft/
-vestibulecovers.com/ntfx/Netfilx/21f96b0f11de638e097b0ceb7a6718ca
-vfocus.net/download/down/cmdbind2.zip
-vilvammatrimony.com/templates/ZS/IK
-vilvammatrimony.com/templates/ZS/IK/5sau8vfd1bkjpxxqnznb4wqq.php
-vilvammatrimony.com/templates/ZS/IK/retry.php
-vinceduchene.cnbcreative.co.uk/Dc1/Dc1/docu/a
-vinceduchene.cnbcreative.co.uk/Dc1/Dc1/docu/a/
-vinceduchene.cnbcreative.co.uk/dc1/dc1/docu/a
-volantini.cloud/TW/po/
-vps62909.inmotionhosting.com/~nff7555/ld/compte/SBROCKER
-vps62909.inmotionhosting.com/~nff7555/ld/compte/SBROCKER/login.php
-vps62909.inmotionhosting.com/~nff7555/ld/compte/rdc
-vps62909.inmotionhosting.com/~nff7555/ld/compte/rdc/login.php
  wa.me/260979441405
-wallieget.com/8jdu/sb6
-wallieget.com/8jdu/sb6/index.php
-warayana.com.pe/blog/
-waterheaterrepairpanamacity.com/c/OD
-waterheaterrepairpanamacity.com/c/OD/
-waterheaterrepairpanamacity.com/c/PP
-waterheaterrepairpanamacity.com/c/PP/
-wazzpromo.com/ws/playstore/
-wazzpromo.com/ws/ps
-webpostmedia.com/Autokeep/Confirm/websc_signin
-webpostmedia.com/Autokeep/Confirm/websc_signin/
-weevoxsound.com/jfjhfhfhfhfjk/office_micro/login/office
-weevoxsound.com/jfjhfhfhfhfjk/office_micro/login/office/
-weevoxsound.com/wihfghbf
-weevoxsound.com/wihfghbf/re.php
-wew.goldgreet.com/kF51VBVD/
-whotakescoin.com/jobs/login/
-willmartowing.com/wm/public_html/webmail/webmail
-willmartowing.com/wm/public_html/webmail/webmail/index.php
-zonabancofalalbella.com/Techbank/sso
  zonehmirrors.org/defaced/2019/09/11/magazinepromo.net/magazinepromo.net/
author	Travis CI User <travis@example.org>
	Wed, 7 Oct 2020 03:02:01 +0000 (03:02 +0000)
committer	Travis CI User <travis@example.org>
	Wed, 7 Oct 2020 03:02:01 +0000 (03:02 +0000)
README.md		patch \| blob \| blame \| history
blacklists/README		patch \| blob \| blame \| history
blacklists/adult/domains		patch \| blob \| blame \| history
blacklists/adult/urls		patch \| blob \| blame \| history
blacklists/malware/domains		patch \| blob \| blame \| history
blacklists/malware/urls		patch \| blob \| blame \| history