Automatic blacklist update

author Travis CI User <travis@example.org>

Mon, 23 Nov 2020 03:37:30 +0000 (03:37 +0000)

committer Travis CI User <travis@example.org>

Mon, 23 Nov 2020 03:37:30 +0000 (03:37 +0000)
author Travis CI User <travis@example.org>
Mon, 23 Nov 2020 03:37:30 +0000 (03:37 +0000)
committer Travis CI User <travis@example.org>
Mon, 23 Nov 2020 03:37:30 +0000 (03:37 +0000)
diff --git a/README.md b/README.md

index fbac44e39ce7d4fa955ac414064174f826ab1ba4..50b3645248bc7a7b4e65272ccf3d01dd0db3bbd9 100644 (file)
--- a/README.md
+++ b/README.md
@@ -6,7 +6,7 @@ __Note__: this repository is only intended to mirror lists, to modify/update the
  ## Lists
  | Name | Size | Description |
  |:-----|:-----|:------------|
-| [adult](blacklists/adult) | 2532101 | Some adult site from erotic to hard pornography |
+| [adult](blacklists/adult) | 2532105 | Some adult site from erotic to hard pornography |
  | [agressif](blacklists/agressif) | 380 | Some aggressive sites |
  | [arjel](blacklists/arjel) | 69 | ARJEL which is a french certification authority for gambling sites |
  | [associations_religieuses](blacklists/associations_religieuses) | 1 | religious_association |
@@ -38,7 +38,7 @@ __Note__: this repository is only intended to mirror lists, to modify/update the
  | [jobsearch](blacklists/jobsearch) | 386 | Site to looking for job |
  | [lingerie](blacklists/lingerie) | 83 | Sites for lingerie |
  | [liste_bu](blacklists/liste_bu) | 2881 | A french list for educational sites. VERY locally oriented. may help libraries |
-| [malware](blacklists/malware) | 326877 | Any website which deliver malware |
+| [malware](blacklists/malware) | 327617 | Any website which deliver malware |
  | [manga](blacklists/manga) | 755 | Any website related to manga, and cartoons |
  | [marketingware](blacklists/marketingware) | 28 | Very special marketing sites |
  | [mixed_adult](blacklists/mixed_adult) | 152 | Websites which contains adult sections unstructured |
diff --git a/blacklists/README b/blacklists/README

index 8cca7bfabb617d8975eab6f4eed22b43c0db9844..f1b88c07f655f37d7299c293264e2cc3658b695a 100644 (file)
--- a/blacklists/README
+++ b/blacklists/README
@@ -41,7 +41,7 @@ adult.tar.gz          is a list of adult sites. They are based on
                                          Symon Aked
                                          Todd Sieland-Peterson
  
-Last version Saturday 21 November 2020 with 2464390 domains and 67764 urls : 11020 Kb.
+Last version Sunday 22 November 2020 with 2464364 domains and 67767 urls : 11020 Kb.
                         
  
  OTHER :
diff --git a/blacklists/adult/domains b/blacklists/adult/domains

index 556042dd4fbb152c6ea89e1485e374cb2cf193c0..2ca61e0628c52015abb2e9fe0b9303739c0ac92e 100644 (file)
--- a/blacklists/adult/domains
+++ b/blacklists/adult/domains
@@ -1511924,6 +1511924,7 @@ molesquirrelsexblog.tumblr.com
  molette.centerblog.net
  molettreka.fw.hu
  molewartrelief.com
+molexuyuk.blogspot.com
  molgeras.tumblr.com
  molhadissima.blogspot.ae
  molhadissima.blogspot.al
diff --git a/blacklists/adult/urls b/blacklists/adult/urls

index 4c8ee3614733adb625ec57a2ab2d9a4859e0bded..04a68fc4754476508817b34df41ccda0a28b44e1 100644 (file)
--- a/blacklists/adult/urls
+++ b/blacklists/adult/urls
@@ -3744,6 +3744,7 @@ amara.org/videos/tdFcBd1irTzM/info/hot-sexy-girl-horny-babe-striptease-stripping
  amasxstuff.tumblr.com/post/76730248711/hqhomeclips-hot-amateur-babe-fucked-hard-in-the
  amateur-pornostar.com/so-schaffst-du-es-garantiert-sex-zu-haben
  amateurangelsfan.tumblr.com/post/127905075020/more-hot-amateur-girls-httpsextlocalscom
+amateurbestiality.fun/fr/sex/best
  amateurfun.net/payc
  amateurgrupal.biz/2015
  amateurilike.tumblr.com/post/50728091449
@@ -38418,6 +38419,7 @@ mario.to/geri/geri.htm
  mariozinho63.blogspot.com/2013/03
  mariozinho63.blogspot.com/2016/12
  mariozinho63.blogspot.com/2018
+mariposasdechocolate.blogspot.com/2020/11
  maripossa12.blogspot.com/2010/01
  marisalobo.com.br/projeto-de-lei-autoriza-cirurgia-de-mudanca-de-sexo-para-criancas-no-sus
  mark.kalumtuggle.com/resebou21
@@ -55979,6 +55981,7 @@ supremecarlos.co.uk/post/138796888182/lucillesballs-when-u-post-a-selfie-and-non
  supremecougars.tumblr.com/post/137769181533/babesandmatures-horny-teens-on-live-cam-join
  supremecougars.tumblr.com/post/137772842373/over18xxx-sexy-college-girls-on-cams-so-join
  sur.ly/o/smutfemdom.com
+surete-international.fr/psy-Erquy-candaulisme-plan-gratuit-cul/luxe-La-de-trixhentain-plan-Pommeraye-q-escort
  surewin.holowww.com/lala
  surf-site.com/i.x/Adult/Image_Galleries
  surf.to/exxtaselist
diff --git a/blacklists/malware/domains b/blacklists/malware/domains

index 2576df9ccacd3d532259462b8d9fe9483f9a40ba..47d794b8d057cadcb8fd3008e4b714c49624467e 100644 (file)
--- a/blacklists/malware/domains
+++ b/blacklists/malware/domains
@@ -458,6 +458,8 @@
  1.0.132.165
  1.0.132.249
  1.0.133.100
+1.0.133.13
+1.0.133.209
  1.0.133.84
  1.0.133.89
  1.0.134.105
@@ -466,21 +468,22 @@
  1.0.134.168
  1.0.134.200
  1.0.134.206
+1.0.134.208
  1.0.134.230
  1.0.134.233
+1.0.134.234
  1.0.134.3
-1.0.134.6
  1.0.134.62
  1.0.134.67
  1.0.136.138
  1.0.136.171
  1.0.136.51
-1.0.142.105
+1.0.142.104
  1.0.142.180
  1.0.142.20
  1.0.142.69
-1.0.144.28
  1.0.147.245
+1.0.154.107
  1.0.154.211
  1.0.156.121
  1.0.157.238
@@ -488,32 +491,44 @@
  1.0.157.67
  1.0.160.218
  1.0.161.107
-1.0.162.245
  1.0.162.44
  1.0.163.107
+1.0.163.131
+1.0.163.81
+1.0.167.28
  1.0.170.158
  1.0.170.50
+1.0.176.69
+1.0.177.161
+1.0.182.76
+1.0.185.138
  1.0.185.255
  1.0.185.35
  1.0.186.33
  1.0.188.242
  1.0.190.20
+1.0.194.228
  1.0.208.79
  1.0.212.131
+1.0.212.34
  1.0.213.3
  1.0.213.40
  1.0.213.83
  1.0.214.230
+1.0.226.130
+1.0.231.188
  1.0.237.53
  1.0.238.18
+1.0.238.236
  1.0.239.223
  1.0.251.164
+1.0.251.22
  1.1.139.28
-1.1.156.48
  1.1.158.239
  1.1.166.196
  1.1.169.233
  1.1.169.249
+1.1.170.42
  1.1.214.185
  1.1.223.128
  1.1.230.164
@@ -528,14 +543,12 @@
  1.1.247.34
  1.1.251.221
  1.10.140.43
-1.10.146.30
  1.10.146.31
+1.10.147.106
  1.10.154.52
  1.10.167.121
  1.10.169.110
  1.10.170.84
-1.10.172.200
-1.10.172.236
  1.10.184.119
  1.10.184.139
  1.10.186.114
@@ -546,7 +559,6 @@
  1.10.187.92
  1.10.188.140
  1.10.188.202
-1.10.188.203
  1.10.188.93
  1.10.189.107
  1.10.189.133
@@ -554,7 +566,6 @@
  1.10.241.191
  1.10.246.179
  1.11.201.18
-1.119.129.17
  1.119.131.102
  1.119.132.249
  1.119.153.110
@@ -566,11 +577,11 @@
  1.122.234.70
  1.122.64.110
  1.129.107.148
+1.129.110.42
  1.143.56.98
  1.143.57.202
  1.143.89.43
  1.143.89.60
-1.143.89.75
  1.156.232.27
  1.156.249.201
  1.158.107.159
@@ -581,18 +592,19 @@
  1.160.19.49
  1.160.195.62
  1.160.20.55
+1.160.22.15
  1.160.65.130
  1.160.69.162
-1.160.71.246
  1.160.73.97
+1.160.94.214
  1.161.120.198
  1.161.213.71
  1.161.240.105
+1.161.240.188
  1.161.241.226
  1.161.246.234
  1.161.246.75
  1.161.26.111
-1.161.89.211
  1.162.120.126
  1.162.199.251
  1.162.227.109
@@ -600,7 +612,6 @@
  1.162.229.104
  1.162.229.215
  1.163.100.17
-1.163.100.223
  1.163.111.150
  1.163.115.107
  1.163.201.81
@@ -623,7 +634,6 @@
  1.165.53.25
  1.165.65.198
  1.165.66.223
-1.165.70.92
  1.168.110.172
  1.168.186.102
  1.168.198.206
@@ -642,11 +652,12 @@
  1.169.231.12
  1.169.233.70
  1.170.106.22
-1.170.157.106
  1.170.183.146
  1.170.226.128
  1.170.230.226
  1.171.104.231
+1.171.124.189
+1.171.154.153
  1.171.155.78
  1.171.173.20
  1.171.175.50
@@ -654,6 +665,7 @@
  1.171.178.249
  1.171.195.111
  1.171.228.182
+1.171.29.99
  1.171.60.106
  1.171.79.63
  1.17110.com
@@ -662,6 +674,7 @@
  1.172.123.230
  1.172.172.206
  1.172.83.30
+1.172.93.80
  1.173.102.155
  1.173.104.79
  1.173.111.65
@@ -671,12 +684,14 @@
  1.173.186.241
  1.173.37.104
  1.173.68.80
+1.173.84.175
  1.173.99.78
  1.174.10.220
  1.174.10.57
  1.174.10.62
  1.174.13.200
  1.174.140.58
+1.174.172.164
  1.174.198.18
  1.174.204.63
  1.174.249.100
@@ -685,6 +700,7 @@
  1.175.126.107
  1.175.139.9
  1.175.149.24
+1.175.157.226
  1.175.165.27
  1.175.166.18
  1.175.166.85
@@ -736,12 +752,13 @@
  1.180.3.69
  1.180.51.36
  1.180.89.186
+1.180.93.25
  1.180.97.162
  1.181.46.238
  1.186.107.135
+1.186.151.219
  1.186.242.12
  1.186.250.78
-1.186.253.230
  1.186.40.157
  1.186.40.2
  1.186.40.9
@@ -756,10 +773,10 @@
  1.188.87.94
  1.189.12.220
  1.189.206.64
+1.189.88.67
  1.189.88.68
  1.189.88.69
  1.189.88.70
-1.189.94.148
  1.190.117.41
  1.190.141.82
  1.190.17.18
@@ -779,49 +796,53 @@
  1.192.181.57
  1.192.218.156
  1.192.218.179
+1.192.90.228
  1.192.94.61
  1.193.113.7
  1.193.160.164
-1.193.236.80
  1.193.39.196
-1.193.97.192
-1.193.98.120
  1.194.123.127
  1.194.238.187
  1.194.238.226
-1.195.121.57
+1.194.53.155
+1.194.53.181
  1.195.127.60
  1.196.152.217
+1.196.238.130
  1.197.121.137
+1.197.32.10
  1.197.79.3
  1.198.72.233
  1.199.132.62
  1.199.135.110
  1.199.138.253
  1.199.30.20
-1.199.69.152
  1.2.132.146
  1.2.139.118
-1.2.142.84
  1.2.161.11
  1.2.161.246
  1.2.169.101
  1.2.169.49
  1.2.169.8
  1.2.169.81
-1.2.176.232
  1.2.187.63
  1.2.196.21
+1.2.197.253
+1.2.200.177
+1.2.203.131
  1.2.203.213
  1.2.205.7
  1.2.207.45
  1.2.207.65
  1.2.209.194
  1.2.214.78
+1.2.215.248
+1.2.215.45
  1.2.219.33
  1.2.223.192
  1.2.226.75
  1.2.227.18
+1.2.228.185
  1.2.242.108
  1.2.242.199
  1.2.244.181
@@ -842,34 +863,37 @@
  1.20.103.248
  1.20.137.191
  1.20.137.82
+1.20.143.186
  1.20.152.193
-1.20.154.166
  1.20.156.230
  1.20.160.82
  1.20.161.108
  1.20.161.206
  1.20.168.115
  1.20.168.160
+1.20.169.153
  1.20.171.94
-1.20.178.141
+1.20.173.133
  1.20.179.190
  1.20.180.31
-1.20.180.58
  1.20.181.241
+1.20.181.242
  1.20.181.42
  1.20.184.238
  1.20.202.13
  1.20.203.175
  1.20.203.246
-1.20.207.159
-1.20.207.191
-1.20.207.224
+1.20.207.102
  1.20.207.46
+1.20.212.107
+1.20.212.223
  1.20.217.52
  1.20.217.78
  1.20.220.79
+1.20.221.133
  1.20.221.136
  1.20.221.221
+1.20.224.12
  1.20.224.207
  1.20.227.220
  1.20.227.66
@@ -889,18 +913,24 @@
  1.20.99.122
  1.20.99.44
  1.201.151.54
-1.202.114.194
+1.202.115.76
  1.202.116.212
+1.202.117.35
  1.202.128.68
  1.202.183.178
  1.202.187.82
+1.202.237.165
  1.202.240.163
  1.202.76.226
  1.202.77.210
  1.203.102.100
+1.203.115.141
  1.203.80.2
  1.203.93.254
+1.204.202.185
+1.204.207.42
  1.204.64.20
+1.204.69.38
  1.205.104.98
  1.205.224.54
  1.206.207.185
@@ -928,6 +958,7 @@
  1.220.185.149
  1.220.89.178
  1.220.9.68
+1.220.90.53
  1.221.173.148
  1.221.227.165
  1.221.254.82
@@ -936,7 +967,7 @@
  1.222.139.15
  1.222.141.38
  1.222.142.219
-1.222.145.52
+1.222.145.45
  1.222.166.69
  1.222.170.43
  1.222.176.232
@@ -946,8 +977,10 @@
  1.222.180.107
  1.222.180.9
  1.222.184.86
+1.222.191.137
  1.222.35.39
  1.222.38.196
+1.223.121.10
  1.223.240.212
  1.223.248.99
  1.224.249.138
@@ -967,8 +1000,10 @@
  1.229.165.34
  1.229.221.76
  1.229.83.194
+1.23.110.245
  1.230.191.123
  1.231.158.170
+1.231.226.67
  1.231.64.217
  1.232.247.3
  1.233.163.193
@@ -976,22 +1011,23 @@
  1.233.193.181
  1.233.207.9
  1.234.13.176
-1.234.178.127
-1.234.182.12
  1.234.4.69
  1.234.49.107
  1.234.58.157
  1.234.58.236
+1.234.85.79
  1.235.102.223
  1.235.102.226
  1.235.102.234
  1.235.192.218
  1.235.72.111
  1.235.72.112
+1.236.151.223
  1.239.254.79
  1.24.177.240
  1.24.194.142
  1.24.210.102
+1.24.210.4
  1.24.210.74
  1.24.229.225
  1.24.229.246
@@ -1087,7 +1123,6 @@
  1.248.75.9
  1.249.182.178
  1.249.61.5
-1.25.0.78
  1.25.21.196
  1.25.216.237
  1.25.78.134
@@ -1100,24 +1135,26 @@
  1.255.226.37
  1.255.6.104
  1.26.191.104
+1.26.250.197
  1.26.250.214
  1.26.251.253
  1.27.162.72
  1.27.166.48
+1.28.204.122
  1.28.224.202
  1.28.225.8
  1.28.80.121
  1.29.137.61
-1.29.138.142
  1.29.138.233
+1.29.176.189
  1.29.177.238
  1.29.178.161
  1.29.192.42
-1.29.58.17
  1.29.75.98
  1.29.8.116
  1.30.200.126
  1.30.215.144
+1.30.218.89
  1.31.68.78
  1.31.7.211
  1.31.70.189
@@ -1129,7 +1166,6 @@
  1.32.59.217
  1.34.10.75
  1.34.10.87
-1.34.103.6
  1.34.105.33
  1.34.107.199
  1.34.107.238
@@ -1258,9 +1294,9 @@
  1.35.177.150
  1.36.118.254
  1.36.123.199
+1.36.127.17
  1.36.13.136
  1.36.16.32
-1.36.180.32
  1.36.182.126
  1.36.189.20
  1.36.204.130
@@ -1272,31 +1308,30 @@
  1.36.82.103
  1.36.88.200
  1.36.99.80
-1.39.181.123
  1.4.131.57
  1.4.141.229
  1.4.141.241
-1.4.154.15
+1.4.152.121
  1.4.155.114
  1.4.157.35
  1.4.159.17
  1.4.159.170
+1.4.160.158
  1.4.161.12
-1.4.162.80
-1.4.164.18
  1.4.167.153
  1.4.187.207
  1.4.198.117
  1.4.225.192
  1.4.231.43
  1.4.247.138
-1.4.250.133
+1.4.249.206
+1.4.250.109
  1.4.250.160
  1.4.250.181
  1.40.161.240
  1.42.201.180
  1.42.86.46
-1.47.10.139
+1.47.7.29
  1.48.224.120
  1.48.225.199
  1.48.248.11
@@ -1305,9 +1340,11 @@
  1.4buyuklergazete.com
  1.52.102.98
  1.52.141.29
+1.52.141.44
  1.52.155.92
  1.52.161.104
  1.52.164.109
+1.52.167.62
  1.52.182.115
  1.52.184.188
  1.52.185.106
@@ -1316,9 +1353,7 @@
  1.52.194.59
  1.52.196.33
  1.52.197.245
-1.52.198.91
  1.52.200.133
-1.52.201.110
  1.52.203.245
  1.52.204.202
  1.52.204.69
@@ -1326,19 +1361,16 @@
  1.52.206.218
  1.52.208.70
  1.52.210.17
-1.52.23.88
+1.52.212.255
  1.52.242.46
  1.52.245.56
  1.52.255.128
  1.52.255.32
  1.52.36.130
  1.52.36.9
-1.52.45.242
  1.52.50.179
-1.52.51.54
  1.52.55.144
  1.52.84.241
-1.52.97.148
  1.53.10.61
  1.53.110.56
  1.53.12.112
@@ -1350,28 +1382,22 @@
  1.53.137.84
  1.53.137.92
  1.53.144.186
-1.53.157.195
  1.53.176.194
  1.53.183.161
  1.53.185.111
  1.53.208.133
-1.53.217.129
  1.53.235.243
-1.53.235.250
  1.53.238.138
-1.53.3.219
  1.53.32.73
  1.53.34.190
  1.53.36.10
  1.53.37.199
  1.53.37.223
-1.53.38.110
  1.53.38.214
  1.53.38.40
  1.53.38.85
  1.53.39.44
  1.53.44.225
-1.53.51.97
  1.53.52.135
  1.53.6.242
  1.53.67.245
@@ -1395,35 +1421,29 @@
  1.54.139.168
  1.54.139.206
  1.54.139.251
-1.54.146.200
  1.54.146.44
  1.54.164.112
+1.54.166.219
  1.54.191.54
  1.54.212.112
-1.54.215.136
  1.54.22.166
  1.54.22.224
  1.54.243.61
  1.54.26.12
  1.54.46.43
  1.54.5.10
-1.54.7.247
  1.54.7.42
-1.54.8.2
  1.54.8.212
  1.54.8.81
  1.54.85.210
  1.55.0.87
  1.55.106.98
-1.55.108.165
  1.55.108.83
  1.55.14.55
-1.55.14.89
  1.55.142.230
  1.55.150.89
  1.55.151.223
  1.55.167.202
-1.55.170.80
  1.55.174.251
  1.55.206.214
  1.55.207.155
@@ -1431,9 +1451,10 @@
  1.55.217.0
  1.55.223.88
  1.55.223.95
+1.55.239.195
  1.55.241.4
+1.55.251.196
  1.55.28.214
-1.55.47.146
  1.55.51.100
  1.55.51.17
  1.55.51.218
@@ -1442,11 +1463,11 @@
  1.55.53.142
  1.55.55.145
  1.55.79.43
-1.55.80.207
  1.55.81.209
  1.55.86.223
  1.55.86.78
  1.56.155.227
+1.56.155.232
  1.56.207.130
  1.56.84.130
  1.56.84.228
@@ -1456,6 +1477,7 @@
  1.58.193.19
  1.58.206.243
  1.58.47.13
+1.58.50.67
  1.59.120.74
  1.59.121.102
  1.59.123.31
@@ -1474,8 +1496,7 @@
  1.62.139.227
  1.62.148.209
  1.62.154.165
-1.62.208.44
-1.62.66.140
+1.62.220.95
  1.62.82.72
  1.63.226.82
  1.63.251.30
@@ -1487,10 +1508,10 @@
  1.64.219.222
  1.64.233.202
  1.64.241.31
-1.64.49.16
+1.64.59.208
  1.64.60.168
+1.64.98.50
  1.65.188.221
-1.65.218.132
  1.65.218.14
  1.65.218.174
  1.69.243.225
@@ -1498,12 +1519,10 @@
  1.69.78.71
  1.7.142.58
  1.70.182.159
-1.70.65.146
  1.71.134.18
  1.71.140.222
  1.71.188.37
  1.71.191.178
-1.80.138.223
  1.80.138.32
  1.80.153.149
  1.80.166.54
@@ -1527,6 +1546,7 @@
  1.83.158.81
  1.83.221.200
  1.83.222.40
+1.83.29.241
  1.85.0.98
  1.85.10.156
  1.85.12.230
@@ -1535,6 +1555,7 @@
  1.85.36.252
  1.85.53.210
  1.85.7.164
+1.86.240.221
  1.86.241.140
  1.86.241.96
  1.9.111.145
@@ -1544,6 +1565,7 @@
  1.9.167.36
  1.9.196.82
  1.9.213.114
+1.9.46.177
  1.9.7.197
  1.9.71.2
  1.9.78.242
@@ -1565,17 +1587,18 @@
  100-365.net
  100-diamond.000webhostapp.com
  100.0.41.228
+100.1.149.223
  100.1.160.202
  100.1.218.108
  100.1.221.131
  100.11.101.157
  100.11.11.221
-100.11.185.15
  100.111.231.2.static.cdnserver.in
  100.12.51.86
  100.14.9.2
  100.15.108.163
  100.15.81.199
+100.16.188.120
  100.16.255.31
  100.2.0.58
  100.2.154.68
@@ -1586,20 +1609,25 @@
  100.2.243.233
  100.2.48.232
  100.2.62.15
-100.24.240.12
+100.25.110.164
+100.25.117.140
+100.25.143.232
  100.25.185.145
  100.25.217.29
  100.25.218.155
+100.25.36.197
  100.25.60.57
  100.26.143.89
  100.26.180.70
  100.26.218.97
  100.26.221.143
+100.26.236.211
  100.3.129.148
  100.3.129.59
  100.32.29.134
  100.33.112.5
  100.33.153.106
+100.33.229.143
  100.33.246.209
  100.33.3.222
  100.33.71.189
@@ -1658,7 +1686,6 @@
  100gelgeorgia.xyz
  100golosv.byethost8.com
  100hotdvds.com
-100jutabossque.myz.info
  100kemail.com
  100milesmanhattan.com
  100stuff.site
@@ -1682,8 +1709,6 @@
  101.0.32.160
  101.0.32.163
  101.0.32.164
-101.0.32.169
-101.0.32.176
  101.0.32.178
  101.0.32.179
  101.0.32.18
@@ -1706,7 +1731,6 @@
  101.0.32.235
  101.0.32.238
  101.0.32.246
-101.0.32.247
  101.0.32.249
  101.0.32.250
  101.0.32.251
@@ -1714,7 +1738,6 @@
  101.0.32.253
  101.0.32.254
  101.0.32.255
-101.0.32.50
  101.0.32.59
  101.0.32.62
  101.0.32.64
@@ -1722,13 +1745,11 @@
  101.0.32.77
  101.0.32.79
  101.0.32.81
-101.0.32.87
  101.0.32.99
  101.0.38.155
  101.0.42.114
  101.0.42.171
  101.0.42.237
-101.0.42.4
  101.0.42.70
  101.0.42.78
  101.0.42.99
@@ -1739,7 +1760,6 @@
  101.100.182.12
  101.100.185.235
  101.100.201.67
-101.100.209.199
  101.101.128.11
  101.101.132.244
  101.101.133.229
@@ -1751,27 +1771,30 @@
  101.108.114.165
  101.108.115.69
  101.108.115.83
+101.108.116.194
+101.108.117.190
  101.108.118.181
  101.108.118.83
  101.108.119.39
  101.108.120.226
-101.108.121.128
+101.108.120.77
  101.108.121.59
+101.108.122.161
  101.108.122.24
-101.108.122.3
+101.108.123.171
  101.108.123.214
  101.108.124.199
  101.108.125.255
  101.108.126.149
  101.108.127.194
  101.108.127.222
-101.108.132.164
+101.108.130.0
  101.108.132.254
  101.108.145.106
  101.108.154.100
  101.108.155.24
-101.108.155.4
  101.108.155.53
+101.108.155.8
  101.108.16.248
  101.108.172.102
  101.108.176.146
@@ -1785,12 +1808,13 @@
  101.108.192.13
  101.108.192.150
  101.108.192.70
-101.108.194.121
  101.108.194.246
-101.108.195.49
+101.108.195.126
+101.108.197.143
  101.108.197.28
+101.108.199.117
+101.108.199.75
  101.108.210.52
-101.108.212.162
  101.108.215.187
  101.108.215.47
  101.108.215.70
@@ -1799,10 +1823,10 @@
  101.108.32.208
  101.108.40.116
  101.108.5.200
-101.108.56.153
  101.108.62.4
  101.108.78.223
  101.108.79.90
+101.108.90.163
  101.108.93.178
  101.108.93.57
  101.108.99.14
@@ -1811,18 +1835,13 @@
  101.109.119.106
  101.109.128.195
  101.109.143.71
+101.109.154.212
  101.109.165.53
  101.109.175.219
  101.109.177.105
-101.109.179.43
-101.109.181.29
  101.109.184.193
-101.109.199.6
-101.109.211.252
  101.109.212.171
-101.109.219.224
  101.109.242.42
-101.109.242.70
  101.109.245.200
  101.109.246.126
  101.109.248.86
@@ -1839,14 +1858,14 @@
  101.109.44.129
  101.109.46.111
  101.109.53.23
-101.109.60.255
  101.109.64.203
  101.109.7.123
  101.109.71.111
-101.109.80.150
  101.109.95.37
+101.112.169.46
  101.113.224.180
  101.113.231.154
+101.115.42.20
  101.116.156.63
  101.116.232.44
  101.116.30.178
@@ -1856,6 +1875,7 @@
  101.127.168.234
  101.127.185.104
  101.127.2.115
+101.127.242.163
  101.127.242.9
  101.127.243.254
  101.127.246.73
@@ -1874,6 +1894,7 @@
  101.132.121.66
  101.132.131.251
  101.132.149.193
+101.132.175.186
  101.132.182.76
  101.132.193.141
  101.132.33.79
@@ -1896,7 +1917,7 @@
  101.173.24.210
  101.176.10.98
  101.177.12.219
-101.178.60.17
+101.178.175.30
  101.178.90.141
  101.179.14.213
  101.18.254.225
@@ -1911,13 +1932,13 @@
  101.20.161.112
  101.20.200.213
  101.20.35.78
-101.20.49.136
  101.200.124.141
  101.200.127.75
  101.200.160.24
  101.200.199.44
  101.200.56.138
  101.200.56.77
+101.200.57.240
  101.200.61.23
  101.200.84.159
  101.201.237.252
@@ -1927,10 +1948,11 @@
  101.203.172.89
  101.203.173.119
  101.204.125.132
+101.204.53.36
  101.205.48.238
  101.206.162.139
  101.206.162.156
-101.206.162.166
+101.206.162.157
  101.206.162.168
  101.206.162.170
  101.206.162.176
@@ -1941,26 +1963,26 @@
  101.206.162.222
  101.206.162.224
  101.206.162.245
+101.206.162.247
  101.206.162.249
  101.206.162.250
+101.206.35.153
  101.206.80.107
  101.207.227.41
  101.21.119.125
  101.21.143.98
  101.22.120.94
+101.22.229.73
  101.224.166.13
  101.226.241.22
  101.226.241.74
  101.226.253.162
  101.227.214.80
-101.227.247.85
  101.227.251.235
  101.227.34.23
-101.227.67.35
  101.227.82.60
  101.227.99.86
  101.227.99.99
-101.228.162.140
  101.228.208.82
  101.228.48.108
  101.229.106.34
@@ -1979,6 +2001,7 @@
  101.231.137.70
  101.231.146.34
  101.231.146.36
+101.231.166.39
  101.231.213.242
  101.231.241.170
  101.231.91.196
@@ -1989,7 +2012,6 @@
  101.24.124.242
  101.249.251.50
  101.249.251.60
-101.25.109.188
  101.25.112.240
  101.25.117.141
  101.25.47.250
@@ -2003,17 +2025,21 @@
  101.254.115.180
  101.254.136.130
  101.254.192.54
-101.254.208.2
+101.255.103.201
+101.255.115.122
  101.255.115.123
  101.255.116.61
  101.255.116.98
  101.255.117.2
  101.255.120.161
  101.255.120.65
+101.255.121.148
+101.255.121.49
  101.255.122.185
  101.255.122.73
  101.255.122.9
  101.255.124.35
+101.255.124.93
  101.255.125.57
  101.255.125.59
  101.255.40.18
@@ -2027,6 +2053,7 @@
  101.255.65.138
  101.255.65.225
  101.255.65.66
+101.255.72.171
  101.255.75.46
  101.255.79.18
  101.255.79.249
@@ -2052,9 +2079,7 @@
  101.28.72.208
  101.29.168.251
  101.29.170.223
-101.29.179.27
  101.29.181.35
-101.29.27.208
  101.29.4.84
  101.29.5.85
  101.29.67.32
@@ -2069,6 +2094,7 @@
  101.32.11.31
  101.32.11.54
  101.32.12.91
+101.32.14.145
  101.32.161.189
  101.32.164.227
  101.32.166.191
@@ -2078,10 +2104,12 @@
  101.32.169.27
  101.32.169.61
  101.32.176.97
+101.32.18.188
  101.32.181.249
  101.32.183.162
  101.32.183.172
  101.32.183.189
+101.32.183.196
  101.32.186.30
  101.32.188.89
  101.32.189.123
@@ -2089,7 +2117,6 @@
  101.32.19.184
  101.32.194.166
  101.32.201.221
-101.32.201.223
  101.32.204.171
  101.32.204.213
  101.32.205.105
@@ -2098,21 +2125,27 @@
  101.32.213.171
  101.32.213.203
  101.32.26.159
-101.32.3.166
+101.32.31.136
  101.32.31.176
  101.32.32.9
  101.32.34.76
  101.32.36.242
+101.32.40.216
+101.32.42.126
  101.32.42.252
  101.32.45.10
  101.32.45.219
+101.32.48.90
  101.32.68.55
  101.32.72.24
  101.32.76.108
+101.36.106.68
  101.36.107.178
  101.36.109.214
+101.36.110.20
  101.36.111.233
  101.36.112.191
+101.36.118.168
  101.36.118.82
  101.36.118.86
  101.36.121.111
@@ -2129,10 +2162,10 @@
  101.36.178.48
  101.36.179.145
  101.36.179.159
-101.36.181.186
  101.36.73.148
  101.37.118.54
  101.37.161.61
+101.37.171.24
  101.37.33.19
  101.37.75.150
  101.39.226.100
@@ -2141,8 +2174,8 @@
  101.39.228.55
  101.4.136.34
  101.50.1.2
-101.50.54.49
  101.50.57.47
+101.50.68.68
  101.50.71.139
  101.50.80.26
  101.50.81.171
@@ -2151,13 +2184,12 @@
  101.50.81.53
  101.50.81.96
  101.50.81.99
-101.50.82.24
  101.50.82.60
  101.50.83.78
  101.51.0.128
  101.51.102.118
  101.51.104.11
-101.51.104.151
+101.51.104.127
  101.51.104.156
  101.51.104.163
  101.51.104.225
@@ -2165,7 +2197,8 @@
  101.51.104.245
  101.51.104.39
  101.51.104.78
-101.51.105.108
+101.51.105.135
+101.51.105.154
  101.51.105.157
  101.51.105.178
  101.51.105.200
@@ -2176,7 +2209,6 @@
  101.51.115.159
  101.51.12.67
  101.51.121.203
-101.51.127.238
  101.51.132.77
  101.51.136.232
  101.51.138.111
@@ -2190,47 +2222,45 @@
  101.51.141.20
  101.51.141.81
  101.51.144.22
-101.51.155.25
  101.51.160.72
-101.51.175.130
  101.51.176.155
  101.51.184.97
  101.51.185.138
  101.51.185.84
-101.51.197.215
+101.51.195.37
+101.51.199.76
  101.51.201.1
  101.51.204.198
  101.51.206.37
  101.51.208.163
-101.51.218.200
-101.51.224.148
  101.51.225.250
  101.51.228.222
  101.51.23.160
  101.51.230.1
  101.51.232.28
-101.51.234.5
+101.51.240.160
  101.51.246.247
  101.51.28.201
-101.51.29.112
  101.51.30.85
  101.51.32.227
  101.51.39.4
  101.51.4.79
  101.51.40.127
+101.51.40.210
  101.51.59.107
  101.51.59.125
  101.51.59.149
  101.51.59.151
-101.51.59.165
-101.51.59.177
  101.51.59.18
  101.51.59.196
+101.51.59.197
  101.51.59.198
  101.51.59.20
  101.51.59.200
  101.51.59.211
  101.51.59.22
+101.51.59.221
+101.51.59.234
  101.51.59.236
  101.51.59.237
  101.51.59.238
@@ -2241,13 +2271,13 @@
  101.51.6.103
  101.51.65.39
  101.51.67.11
-101.51.70.41
  101.51.74.211
  101.51.8.216
+101.51.83.236
  101.51.84.248
-101.51.85.221
  101.51.86.103
  101.51.86.39
+101.51.86.61
  101.51.87.123
  101.51.88.115
  101.51.89.77
@@ -2255,11 +2285,14 @@
  101.53.100.115
  101.53.100.155
  101.53.101.16
+101.53.242.73
  101.53.248.70
  101.55.55.143
  101.55.76.66
+101.6.133.27
  101.6.28.160
  101.6.64.76
+101.64.117.29
  101.64.117.49
  101.64.140.28
  101.64.156.58
@@ -2269,6 +2302,7 @@
  101.64.235.70
  101.64.33.227
  101.64.34.198
+101.64.64.245
  101.64.67.203
  101.64.72.229
  101.65.128.150
@@ -2276,7 +2310,6 @@
  101.65.161.62
  101.65.162.181
  101.65.64.177
-101.65.65.178
  101.67.215.7
  101.67.225.133
  101.67.226.50
@@ -2285,14 +2318,15 @@
  101.67.241.95
  101.67.243.158
  101.68.72.78
+101.68.78.194
  101.68.86.83
  101.69.110.197
  101.69.200.162
  101.69.206.211
  101.69.240.94
  101.69.242.242
-101.69.63.163
  101.70.15.84
+101.71.124.202
  101.71.158.209
  101.71.249.170
  101.71.251.202
@@ -2300,12 +2334,13 @@
  101.71.3.53
  101.71.38.82
  101.71.51.192
+101.72.132.187
  101.72.16.245
  101.72.33.145
  101.72.62.68
-101.73.11.90
  101.73.145.214
  101.73.151.145
+101.73.171.195
  101.73.187.231
  101.73.193.189
  101.73.224.244
@@ -2314,6 +2349,8 @@
  101.73.239.249
  101.73.253.168
  101.74.59.140
+101.75.15.2
+101.75.161.81
  101.75.177.107
  101.75.208.10
  101.78.105.3
@@ -2325,10 +2362,13 @@
  101.78.3.29
  101.78.9.235
  101.78.9.237
+101.79.167.142
  101.79.5.58
  101.80.137.164
+101.80.183.200
  101.81.136.34
  101.83.123.106
+101.83.144.207
  101.83.253.146
  101.83.253.57
  101.84.64.157
@@ -2342,16 +2382,20 @@
  101.89.110.204
  101.89.116.39
  101.89.143.15
+101.89.145.133
  101.89.148.159
+101.89.150.171
+101.89.151.127
  101.89.188.88
+101.89.192.64
+101.89.201.250
  101.89.219.59
+101.89.63.136
  101.89.68.114
  101.91.119.172
  101.91.178.122
  101.91.207.208
-101.92.46.126
  101.93.151.32
-101.93.182.81
  101.93.185.199
  101.93.223.168
  101.93.32.28
@@ -2397,11 +2441,14 @@
  102.101.13.240
  102.101.156.87
  102.101.226.111
-102.114.12.156
+102.112.65.138
+102.114.112.209
+102.114.19.195
  102.114.52.126
  102.114.63.66
+102.114.88.180
  102.115.231.233
-102.115.246.94
+102.115.238.43
  102.129.199.106
  102.129.199.108
  102.129.199.119
@@ -2413,33 +2460,33 @@
  102.130.24.92
  102.130.64.30
  102.131.244.113
-102.131.244.78
  102.131.57.29
  102.131.59.243
  102.131.60.21
+102.132.219.6
  102.132.231.89
-102.132.233.132
  102.132.245.16
  102.133.163.144
+102.133.165.93
  102.133.167.0
+102.133.174.40
  102.134.147.63
  102.135.182.72
  102.137.241.7
  102.141.197.17
-102.152.129.57
-102.152.17.54
  102.152.19.2
-102.152.49.212
-102.156.241.116
+102.152.34.75
  102.164.108.43
  102.164.200.46
+102.164.214.7
+102.164.248.235
+102.164.5.177
+102.165.126.30
  102.165.27.147
-102.165.27.156
  102.165.27.223
  102.165.27.252
  102.165.27.33
  102.165.27.58
-102.165.27.83
  102.165.27.88
  102.165.30.1
  102.165.30.13
@@ -2458,18 +2505,14 @@
  102.165.30.61
  102.165.30.9
  102.165.52.117
-102.165.52.126
  102.165.52.146
  102.165.52.174
-102.165.52.20
  102.165.52.21
  102.165.52.230
  102.165.52.28
  102.165.52.63
-102.165.52.77
  102.165.52.95
  102.165.55.113
-102.165.55.138
  102.165.55.18
  102.165.55.182
  102.165.55.188
@@ -2509,15 +2552,11 @@
  102.185.203.142
  102.186.148.193
  102.186.202.202
-102.189.163.162
-102.189.170.154
  102.189.212.165
-102.189.224.98
-102.22.223.223
+102.22.219.251
  102.223.209.38
  102.223.72.211
  102.23.221.1
-102.23.238.121
  102.23.242.15
  102.23.247.85
  102.23.247.91
@@ -2525,6 +2564,7 @@
  102.252.64.148
  102.32.133.196
  102.32.9.65
+102.33.59.74
  102.35.85.39
  102.36.164.141
  102.37.10.155
@@ -2539,49 +2579,44 @@
  102.38.50.78
  102.39.108.176
  102.39.111.112
+102.39.236.15
  102.39.67.51
  102.40.59.217
  102.45.138.94
+102.45.143.211
  102.46.28.124
+102.47.237.46
  102.53.4.195
  102.53.4.231
  102.53.7.199
  102.64.120.134
  102.64.120.166
-102.64.120.187
-102.64.120.22
  102.64.120.227
-102.64.120.235
  102.64.120.67
  102.64.122.133
  102.64.122.141
-102.64.122.142
  102.64.122.163
  102.64.122.191
  102.64.122.194
-102.64.122.202
  102.64.122.233
  102.64.122.246
  102.64.122.35
  102.64.122.37
-102.64.122.79
  102.64.123.187
-102.64.123.228
  102.64.123.23
  102.64.123.31
  102.64.123.44
  102.64.123.65
+102.64.163.153
  102.64.32.34
  102.64.33.143
-102.65.152.240
  102.65.17.60
  102.65.190.42
+102.65.48.22
  102.65.89.16
  102.66.99.54
-102.67.153.24
  102.67.160.130
  102.67.19.132
-102.67.23.131
  102.67.68.1
  102.67.73.1
  102.67.74.1
@@ -2606,9 +2641,6 @@
  10293482595861768368.us-south.cf.appdomain.cloud
  102region.online
  103.1.12.194
-103.1.209.107
-103.1.209.206
-103.1.93.184
  103.1.93.59
  103.1.94.78
  103.10.121.155
@@ -2621,7 +2653,6 @@
  103.10.228.221
  103.10.23.161
  103.10.55.163
-103.10.59.180
  103.10.59.73
  103.10.81.172
  103.10.84.60
@@ -2631,9 +2662,12 @@
  103.100.159.21
  103.100.175.15
  103.100.188.51
+103.100.208.254
+103.100.209.118
  103.100.209.152
  103.100.209.190
  103.100.209.24
+103.100.210.136
  103.100.211.107
  103.100.66.230
  103.100.83.253
@@ -2643,10 +2677,12 @@
  103.101.228.175
  103.101.233.13
  103.101.253.250
+103.101.58.243
  103.101.81.138
  103.101.82.238
  103.102.102.41
  103.102.115.170
+103.102.117.34
  103.102.141.56
  103.102.141.61
  103.102.142.184
@@ -2655,9 +2691,6 @@
  103.102.195.178
  103.102.205.38
  103.102.248.98
-103.102.250.214
-103.102.43.6
-103.102.87.8
  103.103.124.145
  103.103.124.169
  103.103.124.177
@@ -2668,30 +2701,17 @@
  103.103.175.253
  103.103.213.122
  103.103.213.231
-103.103.40.162
-103.103.40.67
-103.103.40.68
-103.103.40.69
-103.103.40.73
-103.103.41.145
-103.103.41.67
-103.103.41.71
-103.103.41.83
-103.103.41.84
-103.103.41.87
-103.103.41.88
  103.103.52.40
  103.103.58.43
  103.103.69.58
  103.103.71.8
  103.103.8.206
-103.103.88.213
  103.104.121.231
  103.104.124.33
  103.104.132.2
  103.104.133.178
  103.104.213.255
-103.104.213.70
+103.104.44.116
  103.104.61.102
  103.104.61.167
  103.104.85.2
@@ -2723,7 +2743,6 @@
  103.105.237.245
  103.105.237.249
  103.105.237.254
-103.105.253.38
  103.105.40.1
  103.105.40.145
  103.105.40.161
@@ -2737,10 +2756,8 @@
  103.105.64.253
  103.105.70.148
  103.105.70.9
-103.105.77.11
  103.105.77.19
  103.106.112.11
-103.106.114.134
  103.106.115.22
  103.106.154.132
  103.106.155.194
@@ -2749,8 +2766,10 @@
  103.106.180.66
  103.106.192.245
  103.106.237.182
+103.106.239.197
  103.106.242.146
  103.106.250.248
+103.106.250.53
  103.106.28.206
  103.106.28.78
  103.106.32.1
@@ -2778,7 +2797,6 @@
  103.106.35.17
  103.106.35.25
  103.106.35.9
-103.106.57.9
  103.106.65.243
  103.106.72.76
  103.107.157.58
@@ -2850,6 +2868,7 @@
  103.108.120.5
  103.108.128.178
  103.108.146.96
+103.108.187.100
  103.108.187.194
  103.108.187.195
  103.108.187.252
@@ -2858,6 +2877,7 @@
  103.108.59.212
  103.108.75.153
  103.108.75.83
+103.108.87.133
  103.108.87.161
  103.108.98.1
  103.109.0.20
@@ -2939,14 +2959,12 @@
  103.110.88.218
  103.110.89.148
  103.111.103.254
-103.111.110.154
  103.111.113.35
  103.111.128.8
  103.111.197.194
  103.111.199.18
  103.111.219.132
  103.111.219.149
-103.111.219.2
  103.111.219.245
  103.111.22.26
  103.111.22.65
@@ -2968,7 +2986,6 @@
  103.112.212.102
  103.112.212.133
  103.112.212.30
-103.112.226.198
  103.112.244.249
  103.112.29.124
  103.112.60.2
@@ -2992,7 +3009,6 @@
  103.113.157.206
  103.113.159.250
  103.113.197.11
-103.113.225.51
  103.113.229.202
  103.113.26.62
  103.113.3.126
@@ -3007,11 +3023,11 @@
  103.113.3.242
  103.113.3.74
  103.113.35.93
-103.114.104.130
  103.114.104.35
  103.114.104.68
  103.114.105.149
  103.114.105.180
+103.114.105.213
  103.114.105.83
  103.114.106.11
  103.114.106.121
@@ -3021,6 +3037,7 @@
  103.114.107.249
  103.114.161.117
  103.114.161.131
+103.114.208.198
  103.114.226.99
  103.114.61.150
  103.114.64.22
@@ -3034,7 +3051,6 @@
  103.114.98.205
  103.114.98.221
  103.114.98.233
-103.114.98.249
  103.115.116.17
  103.115.119.17
  103.115.119.226
@@ -3051,8 +3067,13 @@
  103.115.181.233
  103.115.181.32
  103.115.252.129
+103.115.252.13
  103.115.252.26
  103.115.252.30
+103.115.253.129
+103.115.254.13
+103.115.254.25
+103.115.254.9
  103.115.255.1
  103.115.255.102
  103.115.255.129
@@ -3064,10 +3085,11 @@
  103.115.255.225
  103.115.255.65
  103.115.255.73
+103.115.255.85
  103.115.255.86
  103.115.255.90
  103.115.255.93
-103.115.44.192
+103.115.26.51
  103.116.104.139
  103.116.116.178
  103.116.118.10
@@ -3075,6 +3097,7 @@
  103.116.205.233
  103.116.224.113
  103.116.226.118
+103.116.232.42
  103.116.29.115
  103.116.29.83
  103.116.76.106
@@ -3086,8 +3109,11 @@
  103.117.125.105
  103.117.146.210
  103.117.146.98
+103.117.152.204
+103.117.153.252
  103.117.175.74
  103.117.186.142
+103.117.20.11
  103.117.202.215
  103.117.213.82
  103.117.220.2
@@ -3110,6 +3136,7 @@
  103.118.44.39
  103.118.44.4
  103.118.47.210
+103.118.76.3
  103.118.76.54
  103.119.144.206
  103.119.188.34
@@ -3127,7 +3154,6 @@
  103.12.150.14
  103.12.150.254
  103.12.151.6
-103.12.160.90
  103.12.161.194
  103.12.161.196
  103.12.161.21
@@ -3135,7 +3161,6 @@
  103.12.177.34
  103.12.197.246
  103.12.198.115
-103.12.198.82
  103.12.242.130
  103.12.246.10
  103.12.246.105
@@ -3155,19 +3180,20 @@
  103.12.246.77
  103.12.246.81
  103.12.246.97
+103.120.124.142
  103.120.168.3
  103.120.176.240
  103.120.188.1
  103.120.188.9
  103.120.200.34
+103.120.220.121
+103.120.220.127
  103.120.220.128
  103.120.220.129
  103.120.220.130
-103.120.220.131
-103.120.220.132
  103.120.220.133
+103.120.220.134
  103.120.220.135
-103.120.220.2
  103.120.224.222
  103.120.238.85
  103.121.185.2
@@ -3177,7 +3203,7 @@
  103.121.42.229
  103.122.104.114
  103.122.105.242
-103.122.253.36
+103.122.200.3
  103.122.35.163
  103.122.66.184
  103.122.66.200
@@ -3201,9 +3227,10 @@
  103.123.246.54
  103.123.246.66
  103.123.27.23
-103.123.38.165
+103.123.38.102
  103.123.48.249
  103.123.54.48
+103.123.64.19
  103.123.65.186
  103.123.65.22
  103.123.8.75
@@ -3213,6 +3240,7 @@
  103.124.105.145
  103.124.105.253
  103.124.106.150
+103.124.12.11
  103.124.136.77
  103.124.141.248
  103.124.147.22
@@ -3221,12 +3249,12 @@
  103.124.175.139
  103.124.197.106
  103.124.205.17
-103.124.206.228
  103.124.87.178
  103.124.87.216
  103.124.92.84
  103.125.106.2
  103.125.117.202
+103.125.128.245
  103.125.154.103
  103.125.154.203
  103.125.171.20
@@ -3242,6 +3270,7 @@
  103.125.191.14
  103.125.191.158
  103.125.191.180
+103.125.191.182
  103.125.191.205
  103.125.191.225
  103.125.191.229
@@ -3250,6 +3279,7 @@
  103.125.191.28
  103.125.191.5
  103.125.191.54
+103.125.191.55
  103.125.191.72
  103.125.191.78
  103.125.218.107
@@ -3260,6 +3290,7 @@
  103.126.100.18
  103.126.100.225
  103.126.100.31
+103.126.100.5
  103.126.100.7
  103.126.172.6
  103.126.218.68
@@ -3267,17 +3298,20 @@
  103.126.252.181
  103.126.253.21
  103.126.254.10
+103.126.28.181
  103.126.92.82
  103.127.104.242
  103.127.108.96
+103.127.124.117
  103.127.187.184
  103.127.207.30
+103.127.33.67
  103.127.41.103
-103.129.115.186
  103.129.13.45
  103.129.194.1
  103.129.195.48
  103.129.216.79
+103.129.221.18
  103.129.221.55
  103.129.223.101
  103.129.223.126
@@ -3290,13 +3324,17 @@
  103.13.229.170
  103.13.231.22
  103.13.240.38
-103.13.66.42
+103.130.109.20
+103.130.109.8
+103.130.109.9
  103.130.173.110
  103.130.191.1
  103.130.191.2
  103.130.191.3
  103.130.196.154
  103.130.201.19
+103.130.209.248
+103.130.212.61
  103.130.213.191
  103.130.213.21
  103.130.214.215
@@ -3314,7 +3352,6 @@
  103.131.11.105
  103.131.11.106
  103.131.11.98
-103.131.147.11
  103.131.16.76
  103.131.17.83
  103.131.202.34
@@ -3345,6 +3382,7 @@
  103.133.111.7
  103.133.223.122
  103.133.248.20
+103.133.56.85
  103.134.1.134
  103.134.133.197
  103.134.133.29
@@ -3370,7 +3408,6 @@
  103.135.38.137
  103.135.38.142
  103.135.38.232
-103.135.39.140
  103.135.95.134
  103.136.251.36
  103.136.40.50
@@ -3401,9 +3438,10 @@
  103.138.22.212
  103.138.4.107
  103.138.4.33
-103.138.54.115
+103.138.8.133
  103.138.8.165
  103.138.8.176
+103.138.96.110
  103.139.10.182
  103.139.102.110
  103.139.102.113
@@ -3413,8 +3451,6 @@
  103.139.163.219
  103.139.170.164
  103.139.180.34
-103.139.19.53
-103.139.196.71
  103.139.212.18
  103.139.212.205
  103.139.212.206
@@ -3423,9 +3459,9 @@
  103.139.212.211
  103.139.212.212
  103.139.212.213
-103.139.45.87
+103.139.219.20
+103.139.58.117
  103.139.67.10
-103.14.128.40
  103.14.198.18
  103.14.229.253
  103.14.235.26
@@ -3460,6 +3496,7 @@
  103.140.186.101
  103.140.186.124
  103.140.2.231
+103.140.224.59
  103.140.234.102
  103.140.234.9
  103.140.238.246
@@ -3473,13 +3510,13 @@
  103.140.251.156
  103.140.251.77
  103.140.35.94
-103.140.64.26
  103.140.66.5
  103.140.82.1
  103.140.83.0
  103.140.83.12
  103.140.83.129
  103.140.83.17
+103.140.83.20
  103.140.83.81
  103.140.83.85
  103.140.83.90
@@ -3505,11 +3542,9 @@
  103.141.142.47
  103.141.158.160
  103.141.177.194
-103.141.182.108
  103.141.234.41
  103.141.246.186
  103.141.46.154
-103.142.102.219
  103.142.111.146
  103.142.115.30
  103.142.164.37
@@ -3542,7 +3577,6 @@
  103.143.234.245
  103.143.234.249
  103.143.234.253
-103.143.234.29
  103.143.234.4
  103.143.234.8
  103.143.235.17
@@ -3557,12 +3591,11 @@
  103.144.166.234
  103.144.167.4
  103.144.180.22
+103.144.181.106
  103.144.200.251
  103.144.200.5
  103.144.201.138
  103.144.213.13
-103.144.48.122
-103.144.49.222
  103.145.12.11
  103.145.12.221
  103.145.12.23
@@ -3575,6 +3608,7 @@
  103.145.13.110
  103.145.13.113
  103.145.13.117
+103.145.13.118
  103.145.13.12
  103.145.13.129
  103.145.13.143
@@ -3599,11 +3633,15 @@
  103.145.13.59
  103.145.13.60
  103.145.168.104
+103.145.172.34
+103.145.184.19
  103.145.252.23
  103.145.252.39
  103.145.253.210
  103.145.253.87
  103.145.255.217
+103.145.48.58
+103.145.51.208
  103.145.62.255
  103.145.67.246
  103.145.67.58
@@ -3616,18 +3654,22 @@
  103.146.110.37
  103.146.110.41
  103.146.111.1
+103.146.174.208
  103.146.177.39
  103.146.202.150
  103.146.202.160
  103.146.202.4
  103.146.204.60
  103.146.204.80
+103.146.63.44
  103.147.10.222
  103.147.119.3
  103.147.132.104
  103.147.184.14
  103.147.185.166
  103.147.192.28
+103.147.3.94
+103.147.4.9
  103.148.195.11
  103.148.195.18
  103.148.195.23
@@ -3637,14 +3679,15 @@
  103.148.195.37
  103.148.195.45
  103.148.195.46
-103.148.209.1
+103.148.244.153
  103.148.57.129
+103.148.72.151
+103.148.79.106
+103.148.79.114
  103.149.142.3
-103.149.147.143
  103.149.238.94
  103.149.240.226
  103.149.240.228
-103.149.48.56
  103.149.91.163
  103.15.140.140
  103.15.140.185
@@ -3654,10 +3697,8 @@
  103.15.167.125
  103.15.167.126
  103.15.167.34
-103.15.167.35
  103.15.167.36
  103.15.167.38
-103.15.185.235
  103.15.226.14
  103.15.242.204
  103.15.242.210
@@ -3673,7 +3714,6 @@
  103.15.40.202
  103.15.60.6
  103.15.62.119
-103.15.67.210
  103.15.83.83
  103.150.112.234
  103.150.114.25
@@ -3681,17 +3721,14 @@
  103.150.215.115
  103.150.242.249
  103.150.30.19
-103.151.10.148
-103.151.118.38
-103.151.122.3
  103.151.176.21
  103.151.182.6
  103.151.226.57
-103.151.47.138
  103.151.47.209
  103.152.118.244
  103.152.119.198
  103.152.119.219
+103.152.198.209
  103.152.21.163
  103.152.21.164
  103.152.21.173
@@ -3700,7 +3737,6 @@
  103.152.21.177
  103.152.21.178
  103.152.21.180
-103.152.21.185
  103.152.21.186
  103.152.242.19
  103.152.242.87
@@ -3709,24 +3745,23 @@
  103.153.73.113
  103.153.76.182
  103.153.78.194
-103.153.78.56
+103.153.79.236
  103.154.9.66
  103.154.9.67
  103.154.9.68
  103.154.9.69
-103.155.75.41
+103.155.129.12
  103.155.92.72
-103.156.108.8
  103.156.168.189
  103.156.221.0
  103.156.221.1
+103.156.221.10
  103.156.221.8
  103.156.93.244
  103.156.93.57
  103.156.93.70
  103.157.161.232
  103.16.115.18
-103.16.12.214
  103.16.128.63
  103.16.128.72
  103.16.130.215
@@ -3734,9 +3769,11 @@
  103.16.132.195
  103.16.132.210
  103.16.14.216
+103.16.144.85
  103.16.157.79
  103.16.199.133
  103.16.199.165
+103.16.202.224
  103.16.228.20
  103.16.24.202
  103.16.24.205
@@ -3749,7 +3786,6 @@
  103.17.104.35
  103.17.106.239
  103.17.108.126
-103.17.110.74
  103.17.117.40
  103.17.117.43
  103.17.196.29
@@ -3758,13 +3794,10 @@
  103.17.39.26
  103.17.49.2
  103.17.51.234
-103.17.72.30
  103.17.96.25
  103.17.96.27
-103.18.160.88
  103.18.179.196
  103.18.179.212
-103.18.242.21
  103.18.245.174
  103.18.247.130
  103.18.71.130
@@ -3808,15 +3841,13 @@
  103.193.4.182
  103.194.104.98
  103.194.117.13
-103.194.171.120
  103.194.171.205
  103.194.192.29
  103.194.193.13
+103.194.193.155
  103.194.234.47
  103.194.242.254
  103.194.242.78
-103.194.243.188
-103.194.243.212
  103.194.248.166
  103.194.251.201
  103.194.251.42
@@ -3825,7 +3856,6 @@
  103.195.141.61
  103.195.205.43
  103.195.7.97
-103.195.76.237
  103.195.90.115
  103.195.90.7
  103.196.127.210
@@ -3852,11 +3882,11 @@
  103.198.10.47
  103.198.10.52
  103.198.10.71
+103.198.124.45
  103.198.139.3
  103.198.19.7
  103.198.192.14
  103.198.80.87
-103.198.81.12
  103.199.100.194
  103.199.100.74
  103.199.103.67
@@ -3905,7 +3935,7 @@
  103.199.162.153
  103.199.163.186
  103.199.17.107
-103.199.84.122
+103.199.176.222
  103.199.84.41
  103.199.84.42
  103.199.84.54
@@ -3916,11 +3946,11 @@
  103.199.98.220
  103.2.132.166
  103.20.166.167
+103.20.188.18
  103.20.188.94
  103.20.189.126
  103.20.191.242
  103.20.215.187
-103.20.3.124
  103.20.3.159
  103.20.3.60
  103.20.33.185
@@ -3935,16 +3965,15 @@
  103.200.135.228
  103.200.135.229
  103.200.135.230
+103.200.20.222
  103.200.209.210
  103.200.39.102
  103.200.40.194
  103.200.95.82
  103.200.97.70
-103.201.132.205
  103.201.140.246
  103.201.140.6
  103.201.141.10
-103.202.223.227
  103.203.208.48
  103.203.65.2
  103.204.109.143
@@ -3961,7 +3990,6 @@
  103.205.128.129
  103.205.128.7
  103.205.128.81
-103.205.128.83
  103.205.130.17
  103.205.130.18
  103.205.130.195
@@ -3973,7 +4001,6 @@
  103.205.130.206
  103.205.130.208
  103.205.130.212
-103.205.130.215
  103.205.130.216
  103.205.130.22
  103.205.130.220
@@ -3983,29 +4010,28 @@
  103.205.130.230
  103.205.130.232
  103.205.130.234
-103.205.130.236
+103.205.130.237
  103.205.130.238
  103.205.130.240
  103.205.130.244
  103.205.130.246
  103.205.130.25
+103.205.130.250
  103.205.130.252
-103.205.130.254
  103.205.130.27
  103.205.130.28
  103.205.130.3
+103.205.130.30
  103.205.130.34
-103.205.130.37
  103.205.130.4
  103.205.130.40
-103.205.130.42
  103.205.130.45
  103.205.130.46
  103.205.130.48
  103.205.130.51
  103.205.130.53
-103.205.130.55
  103.205.130.57
+103.205.130.59
  103.205.130.6
  103.205.130.60
  103.205.130.62
@@ -4014,7 +4040,6 @@
  103.205.130.71
  103.205.130.72
  103.205.130.74
-103.205.130.76
  103.205.130.78
  103.205.130.8
  103.205.130.82
@@ -4046,7 +4071,6 @@
  103.205.68.2
  103.205.7.115
  103.205.7.26
-103.205.7.36
  103.205.7.84
  103.206.100.56
  103.206.105.193
@@ -4058,7 +4082,6 @@
  103.206.118.47
  103.206.119.12
  103.206.119.16
-103.206.119.22
  103.206.119.25
  103.206.123.126
  103.206.123.31
@@ -4074,7 +4097,6 @@
  103.206.227.22
  103.206.246.110
  103.206.253.58
-103.206.254.170
  103.206.254.242
  103.207.0.134
  103.207.0.193
@@ -4085,6 +4107,7 @@
  103.207.156.207
  103.207.165.9
  103.207.168.207
+103.207.168.226
  103.207.168.229
  103.207.169.26
  103.207.3.82
@@ -4106,12 +4129,13 @@
  103.207.38.202
  103.207.38.215
  103.207.38.31
+103.207.38.57
  103.207.39.214
  103.207.39.8
  103.207.39.9
  103.207.58.103
-103.207.7.134
  103.207.7.182
+103.207.7.69
  103.207.96.21
  103.207.96.225
  103.207.96.226
@@ -4130,6 +4154,8 @@
  103.208.220.226
  103.208.53.236
  103.209.100.238
+103.209.141.5
+103.209.16.2
  103.209.178.208
  103.209.178.65
  103.209.18.163
@@ -4143,6 +4169,7 @@
  103.209.89.66
  103.209.9.2
  103.21.116.249
+103.21.117.92
  103.21.142.12
  103.21.149.102
  103.21.149.92
@@ -4163,12 +4190,15 @@
  103.210.133.21
  103.210.134.5
  103.210.142.54
+103.210.22.252
  103.210.236.229
  103.210.237.13
  103.210.29.193
  103.210.31.49
  103.210.57.90
+103.210.72.47
  103.210.72.72
+103.210.86.176
  103.211.10.14
  103.211.11.233
  103.211.11.37
@@ -4181,6 +4211,7 @@
  103.211.218.202
  103.211.219.205
  103.211.233.26
+103.211.54.241
  103.211.71.90
  103.211.8.101
  103.211.8.105
@@ -4218,6 +4249,7 @@
  103.212.128.228
  103.212.128.253
  103.212.138.54
+103.212.144.215
  103.212.144.224
  103.212.146.5
  103.212.209.139
@@ -4254,7 +4286,6 @@
  103.212.93.254
  103.212.94.253
  103.213.0.46
-103.213.116.178
  103.213.116.84
  103.213.209.162
  103.213.213.185
@@ -4264,16 +4295,19 @@
  103.213.30.223
  103.213.96.15
  103.214.112.178
+103.214.112.239
  103.214.137.155
  103.214.137.55
  103.214.138.189
  103.214.146.12
+103.214.171.14
  103.214.191.170
  103.214.191.253
  103.214.201.17
  103.214.202.145
  103.214.219.49
  103.214.229.236
+103.214.235.10
  103.214.235.243
  103.214.35.116
  103.214.41.98
@@ -4290,11 +4324,9 @@
  103.215.148.25
  103.215.148.4
  103.215.165.144
-103.215.177.153
  103.215.177.231
  103.215.201.194
  103.215.203.25
-103.215.243.27
  103.215.245.131
  103.215.245.240
  103.215.247.12
@@ -4303,14 +4335,14 @@
  103.215.247.68
  103.215.247.8
  103.215.53.104
+103.215.72.230
  103.215.80.182
-103.215.80.70
  103.215.81.107
  103.215.81.74
  103.215.82.17
+103.216.115.38
  103.216.147.49
  103.216.155.238
-103.216.160.93
  103.216.167.72
  103.216.169.253
  103.216.216.10
@@ -4341,7 +4373,6 @@
  103.216.82.200
  103.216.82.203
  103.216.82.206
-103.216.82.209
  103.216.82.211
  103.216.82.213
  103.216.82.214
@@ -4358,7 +4389,7 @@
  103.217.133.211
  103.217.152.30
  103.217.153.213
-103.217.166.244
+103.217.158.125
  103.217.173.210
  103.217.213.129
  103.217.213.145
@@ -4373,17 +4404,16 @@
  103.218.2.188
  103.218.228.147
  103.218.24.8
+103.218.241.161
  103.218.27.76
  103.219.112.31
  103.219.112.48
  103.219.112.63
-103.219.143.135
-103.219.163.130
+103.219.112.88
  103.219.165.194
  103.219.186.130
  103.219.187.55
  103.219.187.56
-103.219.205.197
  103.219.207.118
  103.219.212.87
  103.219.231.235
@@ -4394,7 +4424,8 @@
  103.219.31.207
  103.219.37.20
  103.22.144.67
-103.22.183.188
+103.22.172.42
+103.22.172.49
  103.22.191.100
  103.22.191.144
  103.22.248.59
@@ -4407,7 +4438,6 @@
  103.220.207.17
  103.220.207.242
  103.220.214.106
-103.220.215.102
  103.220.28.105
  103.220.28.137
  103.220.31.93
@@ -4417,7 +4447,6 @@
  103.220.6.254
  103.220.7.13
  103.221.211.210
-103.221.220.114
  103.221.222.136
  103.221.222.30
  103.221.232.111
@@ -4425,12 +4454,10 @@
  103.221.232.137
  103.221.232.231
  103.221.232.41
-103.221.232.51
  103.221.234.183
  103.221.234.238
  103.221.234.24
  103.221.234.29
-103.221.235.84
  103.221.252.38
  103.221.252.46
  103.221.253.145
@@ -4454,34 +4481,24 @@
  103.223.12.183
  103.223.12.33
  103.223.13.84
-103.223.8.124
  103.223.8.127
  103.223.8.13
  103.223.8.136
-103.223.8.138
-103.223.8.141
  103.223.8.149
-103.223.8.174
-103.223.8.177
  103.223.8.198
  103.223.8.2
  103.223.8.22
-103.223.8.23
  103.223.8.233
  103.223.8.250
-103.223.8.252
  103.223.8.57
  103.223.8.62
  103.223.8.63
-103.223.8.66
-103.223.9.0
  103.223.9.10
  103.223.9.103
  103.223.9.11
  103.223.9.142
  103.223.9.157
  103.223.9.169
-103.223.9.174
  103.223.9.195
  103.223.9.214
  103.223.9.43
@@ -4492,7 +4509,6 @@
  103.224.101.195
  103.224.101.197
  103.224.118.79
-103.224.167.227
  103.224.185.16
  103.224.185.208
  103.224.185.4
@@ -4514,9 +4530,9 @@
  103.224.83.91
  103.225.136.151
  103.225.150.94
+103.225.20.198
  103.225.206.22
  103.225.207.51
-103.225.22.118
  103.225.222.14
  103.225.228.1
  103.225.228.101
@@ -4547,7 +4563,6 @@
  103.225.229.10
  103.225.244.7
  103.225.41.198
-103.225.48.39
  103.225.9.47
  103.225.92.8
  103.225.93.2
@@ -4560,6 +4575,7 @@
  103.226.250.28
  103.226.250.79
  103.226.51.80
+103.226.89.93
  103.227.145.6
  103.227.147.142
  103.227.176.23
@@ -4579,7 +4595,7 @@
  103.228.143.65
  103.228.152.25
  103.228.181.206
-103.228.220.83
+103.228.183.10
  103.228.244.242
  103.228.53.155
  103.228.53.59
@@ -4611,21 +4627,16 @@
  103.23.101.30
  103.23.101.97
  103.23.102.1
-103.23.102.129
  103.23.102.245
  103.23.144.53
  103.23.144.74
  103.23.21.127
  103.23.224.89
-103.23.36.254
-103.230.104.55
  103.230.107.229
-103.230.107.54
  103.230.152.101
  103.230.155.154
  103.230.49.143
  103.231.101.57
-103.231.11.212
  103.231.162.68
  103.231.188.130
  103.231.191.7
@@ -4640,14 +4651,16 @@
  103.231.46.66
  103.231.65.3
  103.231.93.5
+103.231.94.2
  103.232.104.227
  103.232.120.109
  103.232.121.152
+103.232.123.116
  103.232.123.175
+103.232.125.96
  103.232.244.253
  103.232.33.147
  103.232.64.226
-103.232.65.66
  103.232.66.107
  103.232.66.137
  103.232.66.154
@@ -4677,15 +4690,17 @@
  103.233.153.126
  103.233.154.18
  103.233.154.19
+103.233.198.156
  103.233.2.162
  103.233.5.24
+103.233.65.158
  103.233.68.9
  103.233.76.246
+103.233.8.5
  103.233.80.154
  103.233.80.25
  103.233.80.26
  103.234.137.130
-103.234.139.147
  103.234.139.86
  103.234.21.26
  103.234.21.3
@@ -4695,11 +4710,9 @@
  103.234.254.10
  103.234.254.164
  103.234.40.145
-103.235.1.69
  103.235.164.110
  103.235.170.162
  103.235.170.195
-103.235.179.82
  103.235.197.42
  103.235.198.60
  103.235.199.46
@@ -4710,7 +4723,6 @@
  103.235.232.218
  103.235.254.210
  103.236.114.38
-103.236.153.82
  103.236.155.169
  103.236.160.129
  103.236.161.11
@@ -4721,7 +4733,6 @@
  103.236.161.26
  103.236.161.29
  103.236.161.33
-103.236.161.34
  103.236.161.36
  103.236.161.43
  103.236.161.44
@@ -4731,6 +4742,7 @@
  103.236.162.206
  103.236.162.221
  103.236.179.162
+103.236.193.124
  103.236.201.110
  103.236.201.88
  103.236.252.80
@@ -4741,7 +4753,8 @@
  103.237.144.150
  103.237.144.182
  103.237.145.182
-103.237.56.130
+103.237.56.236
+103.237.58.130
  103.237.78.6
  103.238.14.242
  103.238.224.138
@@ -4755,6 +4768,7 @@
  103.238.69.169
  103.239.147.129
  103.239.165.42
+103.239.165.45
  103.239.19.142
  103.239.204.57
  103.239.252.178
@@ -4816,8 +4830,8 @@
  103.240.33.241
  103.240.34.218
  103.240.64.130
+103.240.79.44
  103.240.79.67
-103.241.141.188
  103.241.141.234
  103.241.178.10
  103.241.204.225
@@ -4846,9 +4860,9 @@
  103.242.132.33
  103.242.14.68
  103.242.14.8
-103.242.15.37
  103.242.168.14
  103.242.173.118
+103.242.180.65
  103.242.186.60
  103.242.224.105
  103.242.224.107
@@ -4860,6 +4874,8 @@
  103.242.45.68
  103.242.60.33
  103.242.60.39
+103.242.61.214
+103.242.62.23
  103.242.66.56
  103.242.72.7
  103.243.112.173
@@ -4872,6 +4888,7 @@
  103.243.25.131
  103.243.25.214
  103.243.25.92
+103.243.252.244
  103.243.27.175
  103.243.27.23
  103.243.4.162
@@ -4882,13 +4899,14 @@
  103.243.82.198
  103.243.82.234
  103.244.108.160
-103.244.177.250
  103.244.193.25
  103.244.205.146
+103.244.241.93
  103.244.5.230
  103.244.6.102
  103.244.6.139
  103.244.80.148
+103.244.90.174
  103.244.96.26
  103.245.118.50
  103.245.181.2
@@ -4904,11 +4922,13 @@
  103.245.208.190
  103.245.208.197
  103.245.208.63
+103.245.209.17
  103.245.48.197
  103.246.1.218
  103.246.1.220
  103.246.1.222
  103.246.106.118
+103.246.110.216
  103.246.112.41
  103.246.113.9
  103.246.161.146
@@ -4918,7 +4938,6 @@
  103.247.13.129
  103.247.13.45
  103.247.142.178
-103.247.151.107
  103.247.151.117
  103.247.151.122
  103.247.151.133
@@ -4944,8 +4963,6 @@
  103.247.22.161
  103.247.22.17
  103.247.22.177
-103.248.119.110
-103.248.123.141
  103.248.14.26
  103.248.172.17
  103.248.173.94
@@ -4965,6 +4982,7 @@
  103.249.155.145
  103.249.155.149
  103.249.155.169
+103.249.155.185
  103.249.155.197
  103.249.155.245
  103.249.155.97
@@ -4979,9 +4997,6 @@
  103.249.28.87
  103.249.31.189
  103.249.34.149
-103.249.70.31
-103.249.77.2
-103.249.87.12
  103.249.87.154
  103.25.0.202
  103.25.120.138
@@ -4990,14 +5005,14 @@
  103.25.123.193
  103.25.123.197
  103.25.130.114
-103.25.134.235
+103.25.132.104
  103.25.152.51
-103.25.153.5
  103.25.155.202
  103.25.167.200
  103.25.21.34
  103.25.3.82
  103.25.36.194
+103.25.44.34
  103.25.45.38
  103.25.6.111
  103.25.81.4
@@ -5007,6 +5022,7 @@
  103.25.84.185
  103.25.84.207
  103.250.148.82
+103.250.152.22
  103.250.152.30
  103.250.153.203
  103.250.156.22
@@ -5030,6 +5046,7 @@
  103.250.69.86
  103.250.69.94
  103.250.71.33
+103.251.176.22
  103.251.189.129
  103.251.190.6
  103.251.214.167
@@ -5061,13 +5078,17 @@
  103.251.222.9
  103.251.223.13
  103.251.225.10
+103.251.225.13
  103.251.225.16
+103.251.225.18
+103.251.45.235
  103.251.48.38
  103.251.57.23
  103.251.59.116
  103.251.60.4
  103.251.64.44
  103.251.83.14
+103.252.116.138
  103.252.116.184
  103.252.117.100
  103.252.128.166
@@ -5076,14 +5097,16 @@
  103.252.144.123
  103.252.16.224
  103.252.171.85
+103.252.19.30
+103.252.196.150
  103.252.219.163
  103.252.52.68
  103.253.112.17
  103.253.113.54
  103.253.14.43
-103.253.140.24
  103.253.140.28
  103.253.140.48
+103.253.140.66
  103.253.145.125
  103.253.145.133
  103.253.145.153
@@ -5092,6 +5115,7 @@
  103.253.146.142
  103.253.146.235
  103.253.146.56
+103.253.146.88
  103.253.147.15
  103.253.147.234
  103.253.153.21
@@ -5120,8 +5144,8 @@
  103.254.207.197
  103.254.210.244
  103.254.56.114
-103.254.58.250
  103.254.59.235
+103.254.73.71
  103.254.73.98
  103.254.94.19
  103.254.94.190
@@ -5140,6 +5164,7 @@
  103.255.36.84
  103.255.53.98
  103.26.136.173
+103.26.208.254
  103.26.213.117
  103.26.213.151
  103.26.213.228
@@ -5156,6 +5181,7 @@
  103.27.237.5
  103.27.239.185
  103.27.239.216
+103.27.32.26
  103.27.4.161
  103.27.61.222
  103.27.7.85
@@ -5167,12 +5193,14 @@
  103.28.112.5
  103.28.113.22
  103.28.121.58
+103.28.148.28
  103.28.149.180
  103.28.149.201
  103.28.149.72
  103.28.161.26
  103.28.22.27
  103.28.225.223
+103.28.32.18
  103.28.37.131
  103.28.38.166
  103.28.39.35
@@ -5250,6 +5278,7 @@
  103.31.186.20
  103.31.186.97
  103.31.20.109
+103.31.225.200
  103.31.227.146
  103.31.227.183
  103.31.227.29
@@ -5257,9 +5286,11 @@
  103.31.250.122
  103.31.250.197
  103.31.250.204
+103.31.251.17
  103.31.251.25
  103.31.251.58
  103.31.45.174
+103.31.47.58
  103.31.84.122
  103.35.108.145
  103.35.108.198
@@ -5269,6 +5300,7 @@
  103.35.111.101
  103.35.111.102
  103.35.132.50
+103.35.142.61
  103.35.171.178
  103.35.173.132
  103.35.65.54
@@ -5286,10 +5318,8 @@
  103.36.11.243
  103.36.11.248
  103.36.124.158
-103.36.124.80
  103.36.125.162
  103.36.126.14
-103.36.33.4
  103.36.35.131
  103.36.35.135
  103.36.44.130
@@ -5336,6 +5366,8 @@
  103.39.212.96
  103.39.213.170
  103.39.213.236
+103.39.214.9
+103.39.214.93
  103.39.219.179
  103.39.231.121
  103.39.235.166
@@ -5348,7 +5380,6 @@
  103.4.164.205
  103.4.217.138
  103.4.217.139
-103.4.234.39
  103.4.29.27
  103.4.94.178
  103.4.94.49
@@ -5367,9 +5398,11 @@
  103.40.203.21
  103.40.21.41
  103.40.22.97
+103.40.240.244
  103.40.241.146
  103.40.242.32
  103.40.243.100
+103.40.243.216
  103.40.244.166
  103.40.248.195
  103.40.248.203
@@ -5385,6 +5418,7 @@
  103.40.8.70
  103.40.8.87
  103.40.8.93
+103.41.106.89
  103.41.147.130
  103.41.147.137
  103.41.164.70
@@ -5409,7 +5443,6 @@
  103.41.26.136
  103.41.26.137
  103.41.26.14
-103.41.26.142
  103.41.26.143
  103.41.26.144
  103.41.26.145
@@ -5422,23 +5455,19 @@
  103.41.26.157
  103.41.26.159
  103.41.26.16
-103.41.26.161
  103.41.26.163
  103.41.26.165
-103.41.26.167
  103.41.26.171
  103.41.26.172
  103.41.26.173
  103.41.26.176
  103.41.26.177
-103.41.26.179
  103.41.26.181
  103.41.26.182
  103.41.26.183
  103.41.26.187
  103.41.26.189
  103.41.26.192
-103.41.26.194
  103.41.26.195
  103.41.26.196
  103.41.26.198
@@ -5452,7 +5481,6 @@
  103.41.26.212
  103.41.26.213
  103.41.26.217
-103.41.26.22
  103.41.26.220
  103.41.26.221
  103.41.26.225
@@ -5485,14 +5513,12 @@
  103.41.26.54
  103.41.26.55
  103.41.26.56
-103.41.26.57
  103.41.26.58
  103.41.26.6
  103.41.26.60
  103.41.26.63
  103.41.26.64
  103.41.26.65
-103.41.26.7
  103.41.26.70
  103.41.26.71
  103.41.26.72
@@ -5522,12 +5548,9 @@
  103.41.27.121
  103.41.27.127
  103.41.27.132
-103.41.27.133
  103.41.27.135
  103.41.27.136
-103.41.27.14
  103.41.27.140
-103.41.27.146
  103.41.27.151
  103.41.27.152
  103.41.27.153
@@ -5545,8 +5568,6 @@
  103.41.27.193
  103.41.27.194
  103.41.27.197
-103.41.27.198
-103.41.27.20
  103.41.27.201
  103.41.27.202
  103.41.27.206
@@ -5554,12 +5575,10 @@
  103.41.27.210
  103.41.27.211
  103.41.27.213
-103.41.27.219
  103.41.27.227
  103.41.27.228
  103.41.27.23
  103.41.27.230
-103.41.27.238
  103.41.27.239
  103.41.27.241
  103.41.27.244
@@ -5567,7 +5586,6 @@
  103.41.27.254
  103.41.27.26
  103.41.27.28
-103.41.27.3
  103.41.27.31
  103.41.27.32
  103.41.27.35
@@ -5585,14 +5603,12 @@
  103.41.27.66
  103.41.27.74
  103.41.27.78
-103.41.27.8
  103.41.27.80
  103.41.27.81
  103.41.27.84
  103.41.27.87
  103.41.27.88
  103.41.27.9
-103.41.27.90
  103.41.27.94
  103.41.27.96
  103.41.28.70
@@ -5601,13 +5617,12 @@
  103.41.31.25
  103.41.36.106
  103.41.36.217
-103.41.36.254
  103.41.37.134
-103.41.37.173
  103.41.37.185
  103.41.37.213
  103.41.37.27
  103.41.37.34
+103.41.47.234
  103.41.66.179
  103.41.66.250
  103.41.67.202
@@ -5623,9 +5638,9 @@
  103.42.156.105
  103.42.157.99
  103.42.158.137
-103.42.158.242
  103.42.162.198
  103.42.162.30
+103.42.195.70
  103.42.218.94
  103.42.253.139
  103.42.253.210
@@ -5640,7 +5655,6 @@
  103.43.151.46
  103.43.16.146
  103.43.18.173
-103.43.184.174
  103.43.185.142
  103.43.185.166
  103.43.202.18
@@ -5668,10 +5682,12 @@
  103.44.240.67
  103.44.241.133
  103.44.243.45
+103.44.243.5
  103.44.248.252
  103.44.253.18
  103.44.254.142
  103.44.254.237
+103.44.27.16
  103.44.27.65
  103.44.28.78
  103.44.50.114
@@ -5689,17 +5705,23 @@
  103.45.115.211
  103.45.115.96
  103.45.116.121
-103.45.116.183
+103.45.128.176
+103.45.128.37
+103.45.130.32
  103.45.131.11
+103.45.131.47
+103.45.150.170
  103.45.152.21
+103.45.172.11
  103.45.173.167
  103.45.173.18
  103.45.174.218
  103.45.175.130
+103.45.175.158
  103.45.175.247
+103.45.176.115
  103.45.176.61
  103.45.180.157
-103.45.182.116
  103.45.182.118
  103.45.182.120
  103.45.182.123
@@ -5712,6 +5734,7 @@
  103.45.182.62
  103.45.183.104
  103.45.183.110
+103.45.183.119
  103.45.183.12
  103.45.183.226
  103.45.183.27
@@ -5726,7 +5749,9 @@
  103.45.188.38
  103.45.189.20
  103.45.189.232
+103.45.190.152
  103.45.248.169
+103.45.70.58
  103.45.98.92
  103.46.128.41
  103.46.128.43
@@ -5747,6 +5772,7 @@
  103.47.219.133
  103.47.219.79
  103.47.241.244
+103.47.66.154
  103.47.70.252
  103.47.80.164
  103.47.92.17
@@ -5772,9 +5798,9 @@
  103.48.119.116
  103.48.119.13
  103.48.180.104
+103.48.180.131
  103.48.181.189
  103.48.183.113
-103.48.186.120
  103.48.186.143
  103.48.186.167
  103.48.192.48
@@ -5793,7 +5819,9 @@
  103.49.62.182
  103.49.94.14
  103.5.126.7
-103.5.72.15
+103.5.144.122
+103.5.144.98
+103.5.6.37
  103.50.148.129
  103.50.150.225
  103.50.152.226
@@ -5806,6 +5834,7 @@
  103.50.170.177
  103.50.170.181
  103.50.170.197
+103.50.170.201
  103.50.170.33
  103.50.170.37
  103.50.170.41
@@ -5899,11 +5928,11 @@
  103.53.44.83
  103.53.44.85
  103.53.45.130
-103.53.53.14
  103.53.76.82
  103.53.82.242
  103.53.83.24
  103.54.101.28
+103.54.102.100
  103.54.144.254
  103.54.145.65
  103.54.146.117
@@ -5915,20 +5944,18 @@
  103.54.148.54
  103.54.148.58
  103.54.19.137
-103.54.217.135
  103.54.217.187
  103.54.217.198
  103.54.217.80
-103.54.217.98
  103.54.221.122
  103.54.251.152
  103.54.28.234
  103.54.30.57
-103.54.38.74
  103.54.95.70
  103.55.104.210
  103.55.144.54
  103.55.144.70
+103.55.169.186
  103.55.191.113
  103.55.191.141
  103.55.24.37
@@ -5950,9 +5977,11 @@
  103.56.207.230
  103.56.207.233
  103.56.207.81
+103.56.235.186
  103.56.239.123
-103.56.239.48
+103.56.61.21
  103.56.77.104
+103.57.11.54
  103.57.120.249
  103.57.123.1
  103.57.143.246
@@ -5988,22 +6017,20 @@
  103.57.81.128
  103.57.81.224
  103.57.81.64
-103.57.82.98
  103.57.83.192
  103.57.83.224
  103.57.85.244
+103.58.115.38
  103.58.144.60
  103.58.16.106
  103.58.16.254
  103.58.17.246
-103.58.248.112
  103.58.65.178
  103.58.66.204
  103.58.66.21
  103.58.73.78
  103.58.74.2
  103.58.92.14
-103.59.103.74
  103.59.105.241
  103.59.107.186
  103.59.113.128
@@ -6019,15 +6046,13 @@
  103.59.200.26
  103.59.200.58
  103.59.38.130
+103.59.88.20
  103.6.104.104
  103.6.133.42
  103.6.133.45
  103.6.133.87
  103.6.140.230
  103.6.184.222
-103.6.185.84
-103.6.196.175
-103.6.198.100
  103.6.6.90
  103.60.114.13
  103.60.125.66
@@ -6037,6 +6062,7 @@
  103.60.165.116
  103.60.165.117
  103.60.173.250
+103.60.175.137
  103.60.175.80
  103.60.180.130
  103.60.181.210
@@ -6047,6 +6073,7 @@
  103.60.187.129
  103.60.212.113
  103.60.214.18
+103.61.100.49
  103.61.198.114
  103.61.198.122
  103.61.198.234
@@ -6102,6 +6129,7 @@
  103.67.235.10
  103.67.235.76
  103.67.235.8
+103.67.236.191
  103.68.0.114
  103.68.0.188
  103.68.0.67
@@ -6112,6 +6140,7 @@
  103.68.176.73
  103.68.181.35
  103.68.193.154
+103.68.250.46
  103.68.250.60
  103.68.3.187
  103.68.34.185
@@ -6120,7 +6149,6 @@
  103.68.53.76
  103.68.54.66
  103.68.9.150
-103.69.112.185
  103.69.118.77
  103.69.124.247
  103.69.193.127
@@ -6143,16 +6171,13 @@
  103.69.220.11
  103.69.224.57
  103.69.240.97
-103.69.243.125
  103.69.245.55
-103.69.9.63
  103.69.91.211
  103.7.18.208
  103.7.244.10
  103.7.248.122
  103.7.248.222
  103.7.43.187
-103.7.59.231
  103.7.8.105
  103.7.8.134
  103.70.130.24
@@ -6177,7 +6202,6 @@
  103.70.38.218
  103.70.38.46
  103.70.77.18
-103.71.169.130
  103.71.192.38
  103.71.192.40
  103.71.20.220
@@ -6187,20 +6211,20 @@
  103.71.254.17
  103.71.254.40
  103.71.255.100
+103.71.40.110
  103.72.11.188
  103.72.144.228
-103.72.147.12
  103.72.166.31
+103.72.166.55
  103.72.169.121
+103.72.169.25
  103.72.172.20
-103.72.218.247
  103.72.218.81
  103.72.4.148
  103.72.9.238
  103.73.101.126
  103.73.101.29
  103.73.102.130
-103.73.102.162
  103.73.152.24bin.sh
  103.73.161.149
  103.73.162.156
@@ -6224,17 +6248,15 @@
  103.74.227.130
  103.74.244.157
  103.74.244.244
-103.74.245.115
  103.74.245.230
  103.74.245.53
-103.74.246.254
  103.74.70.142
  103.74.70.97
  103.75.1.198
  103.75.1.252
  103.75.101.59
  103.75.117.215
-103.75.125.21
+103.75.125.226
  103.75.148.103
  103.75.148.17
  103.75.148.203
@@ -6249,7 +6271,7 @@
  103.75.182.8
  103.75.189.154
  103.75.190.11
-103.75.197.124
+103.75.197.57
  103.75.2.26
  103.75.208.53
  103.75.217.122
@@ -6257,9 +6279,11 @@
  103.75.225.37
  103.75.225.45
  103.75.226.25
+103.75.247.74
  103.75.27.250
  103.75.27.86
  103.75.33.195
+103.75.34.121
  103.75.35.14
  103.75.96.34
  103.76.14.244
@@ -6277,6 +6301,7 @@
  103.76.188.97
  103.76.189.1
  103.76.190.1
+103.76.190.129
  103.76.190.193
  103.76.190.209
  103.76.190.210
@@ -6284,11 +6309,12 @@
  103.76.190.37
  103.76.190.81
  103.76.200.62
-103.76.201.118
  103.76.201.181
  103.76.201.246
  103.76.204.26
+103.76.208.219
  103.76.21.58
+103.76.211.187
  103.76.23.99
  103.76.252.6
  103.76.253.150
@@ -6303,6 +6329,7 @@
  103.77.189.122
  103.77.189.126
  103.77.20.1
+103.77.228.43
  103.77.23.129
  103.77.23.137
  103.77.23.141
@@ -6313,9 +6340,8 @@
  103.77.23.233
  103.77.23.241
  103.77.23.9
+103.77.37.140
  103.77.37.145
-103.77.37.152
-103.77.45.116
  103.77.49.194
  103.77.8.149
  103.78.13.4
@@ -6332,7 +6358,6 @@
  103.78.164.201
  103.78.168.105
  103.78.181.143
-103.78.183.24
  103.78.210.158
  103.78.210.205
  103.78.213.226
@@ -6360,10 +6385,9 @@
  103.78.37.98
  103.78.38.158
  103.78.38.34
-103.78.53.101
-103.78.53.2
  103.78.53.32
  103.78.72.202
+103.78.73.91
  103.78.73.92
  103.78.80.170
  103.78.81.186
@@ -6375,13 +6399,13 @@
  103.79.141.158
  103.79.142.91
  103.79.154.230
+103.79.155.42
  103.79.169.129
  103.79.169.145
  103.79.169.153
  103.79.176.31
  103.79.74.26
  103.79.74.3
-103.79.90.72
  103.8.113.242
  103.8.115.27
  103.8.119.166
@@ -6412,6 +6436,7 @@
  103.81.15.38
  103.81.153.133
  103.81.215.26
+103.81.94.136
  103.82.11.209
  103.82.11.237
  103.82.11.97
@@ -6427,7 +6452,7 @@
  103.82.15.140
  103.82.15.210
  103.82.157.163
-103.82.222.165
+103.82.223.77
  103.82.24.110
  103.82.24.120
  103.82.24.125
@@ -6435,6 +6460,7 @@
  103.82.24.141
  103.82.24.158
  103.82.24.178
+103.82.24.179
  103.82.24.189
  103.82.24.193
  103.82.24.201
@@ -6471,7 +6497,6 @@
  103.82.8.197
  103.82.8.201
  103.82.8.209
-103.82.80.90
  103.82.81.91
  103.82.82.55
  103.82.98.151
@@ -6479,7 +6504,6 @@
  103.83.107.234
  103.83.109.228
  103.83.110.21
-103.83.116.202
  103.83.144.99
  103.83.156.112
  103.83.156.113
@@ -6499,7 +6523,6 @@
  103.83.179.153
  103.83.179.154
  103.83.179.156
-103.83.179.195
  103.83.184.242
  103.83.184.52
  103.83.185.1
@@ -6507,13 +6530,11 @@
  103.83.187.202
  103.83.187.245
  103.83.205.57
-103.83.244.153
  103.83.249.252
  103.83.70.250
  103.83.79.69
  103.83.8.176
  103.83.95.82
-103.84.108.109
  103.84.109.18
  103.84.110.133
  103.84.129.20
@@ -6526,10 +6547,7 @@
  103.84.240.237
  103.84.240.251
  103.84.241.102
-103.84.241.11
  103.84.241.117
-103.84.241.122
-103.84.241.126
  103.84.241.145
  103.84.241.79
  103.84.241.88
@@ -6539,10 +6557,9 @@
  103.84.84.250
  103.85.150.201
  103.85.150.253
-103.85.157.28
  103.85.162.62
+103.85.172.150
  103.85.188.50
-103.85.205.85
  103.85.23.161
  103.85.23.60
  103.85.63.66
@@ -6562,7 +6579,6 @@
  103.86.1.41
  103.86.1.9
  103.86.103.85
-103.86.106.96
  103.86.130.43
  103.86.134.194
  103.86.135.42
@@ -6576,6 +6592,7 @@
  103.86.161.244
  103.86.172.129
  103.86.180.10
+103.86.19.69
  103.86.195.186
  103.86.195.190
  103.86.197.219
@@ -6583,7 +6600,6 @@
  103.86.20.13
  103.86.20.49
  103.86.20.5
-103.86.200.144
  103.86.44.122
  103.86.45.77
  103.86.49.11
@@ -6593,21 +6609,25 @@
  103.86.70.222
  103.86.86.71
  103.87.160.177
+103.87.168.118
+103.87.168.191
  103.87.168.30
  103.87.169.135
  103.87.169.234
+103.87.169.238
+103.87.169.242
  103.87.170.100
  103.87.170.119
-103.87.170.123
-103.87.170.167
  103.87.170.62
+103.87.170.66
+103.87.170.77
  103.87.170.87
  103.87.170.94
  103.87.171.163
  103.87.171.165
+103.87.171.236
  103.87.171.251
  103.87.173.139
-103.87.173.237
  103.87.174.54
  103.87.206.101
  103.87.206.249
@@ -6616,13 +6636,13 @@
  103.87.230.249
  103.87.236.46
  103.87.25.106
-103.87.25.138
  103.87.25.193
  103.87.25.42
  103.87.251.146
  103.87.26.125
+103.87.26.229
  103.87.27.122
-103.87.46.156
+103.87.46.122
  103.87.48.1
  103.87.48.45
  103.87.48.57
@@ -6630,14 +6650,13 @@
  103.87.49.60
  103.88.169.6
  103.88.179.2
-103.88.216.150
-103.88.216.195
  103.88.221.105
  103.88.221.123
  103.88.221.194
  103.88.233.5
  103.88.234.58
  103.88.247.212
+103.88.76.206
  103.88.77.147
  103.88.77.32
  103.89.152.190
@@ -6647,6 +6666,9 @@
  103.89.252.123
  103.89.252.222
  103.89.254.138
+103.89.254.142
+103.89.5.116
+103.89.5.26
  103.89.57.131
  103.89.88.169
  103.89.88.222
@@ -6658,7 +6680,7 @@
  103.89.90.115
  103.89.90.24
  103.89.90.44
-103.89.90.5
+103.89.91.202
  103.89.91.205
  103.89.91.251
  103.9.113.90
@@ -6676,6 +6698,8 @@
  103.9.174.120
  103.9.188.229
  103.9.227.210
+103.9.77.108
+103.9.77.159
  103.9.79.132
  103.90.158.77
  103.90.159.34
@@ -6687,18 +6711,19 @@
  103.90.226.41
  103.90.228.121
  103.90.228.151
+103.90.228.165
  103.90.233.35
  103.90.237.212
  103.90.237.217
  103.90.68.180
  103.90.72.211
  103.91.123.148
-103.91.123.91
  103.91.128.182
  103.91.130.1
  103.91.17.136
  103.91.176.170
  103.91.176.98
+103.91.181.25
  103.91.204.30
  103.91.210.187
  103.91.210.9
@@ -6723,11 +6748,13 @@
  103.91.245.47
  103.91.245.5
  103.91.245.54
+103.91.245.55
  103.91.245.60
+103.91.52.118
  103.91.65.216
  103.91.65.55
  103.91.69.30
-103.91.80.224
+103.91.85.146
  103.91.90.101
  103.91.90.103
  103.91.90.186
@@ -6737,12 +6764,10 @@
  103.91.92.168
  103.91.92.169
  103.91.92.172
-103.91.92.173
  103.92.101.178
  103.92.104.127
  103.92.121.218
  103.92.132.66
-103.92.160.138
  103.92.212.1
  103.92.212.17
  103.92.212.242
@@ -6759,7 +6784,10 @@
  103.92.25.95
  103.92.26.252
  103.92.29.247
+103.92.29.50
+103.92.31.32
  103.93.106.135
+103.93.17.149
  103.93.17.208
  103.93.17.55
  103.93.181.10
@@ -6768,6 +6796,7 @@
  103.93.202.36
  103.93.202.38
  103.93.220.182
+103.93.51.30
  103.93.9.198
  103.93.97.214
  103.94.0.178
@@ -6784,7 +6813,6 @@
  103.94.7.254
  103.94.76.157
  103.94.86.44
-103.95.209.4
  103.95.40.121
  103.95.40.20
  103.95.40.9
@@ -6801,17 +6829,15 @@
  103.95.98.179
  103.95.98.90
  103.95.99.229
+103.96.116.34
  103.96.129.21
  103.96.220.115
  103.96.221.93
  103.96.43.115
  103.96.73.160
  103.96.73.208
-103.97.100.15
  103.97.124.53
-103.97.138.126
-103.97.138.17
-103.97.138.44
+103.97.136.159
  103.97.164.98
  103.97.179.141
  103.97.213.136
@@ -6835,6 +6861,7 @@
  103.97.6.230
  103.97.63.5
  103.98.109.30
+103.98.109.62
  103.98.112.218
  103.98.120.89
  103.98.128.51
@@ -6848,10 +6875,10 @@
  103.98.78.34
  103.99.0.124
  103.99.0.36
+103.99.1.31
  103.99.1.82
  103.99.109.123
  103.99.109.146
-103.99.149.250
  103.99.15.136
  103.99.164.253
  103.99.167.253
@@ -6863,14 +6890,17 @@
  103.99.170.220
  103.99.176.32
  103.99.177.247
+103.99.189.253
  103.99.189.254
  103.99.2.245
  103.99.2.67
  103.99.201.97
+103.99.202.209
  103.99.205.250
  103.99.207.129
  103.99.207.139
  103.99.207.151
+103.99.207.158
  103.99.207.183
  103.99.207.49
  103.99.251.189
@@ -6887,30 +6917,42 @@
  104.11.88.224
  104.12.66.70
  104.128.161.233
+104.128.228.113
  104.128.35.50
  104.128.48.202
  104.128.63.215
  104.128.92.120
  104.128.95.31
  104.129.118.13
-104.129.13.66
+104.129.13.72
  104.129.131.148
+104.129.15.134
+104.129.171.121
  104.129.18.138
  104.129.18.157
  104.129.180.37
  104.129.184.232
+104.129.186.182
  104.129.187.23
  104.129.192.170
  104.129.192.171
  104.129.194.50
+104.129.194.86
  104.129.196.126
+104.129.196.187
+104.129.198.109
+104.129.198.79
  104.129.202.48
  104.129.202.51
  104.129.202.55
+104.129.205.131
  104.129.206.103
  104.129.206.199
-104.129.253.247
+104.129.253.179
  104.129.253.72
+104.129.255.115
+104.129.255.167
+104.129.255.64
  104.129.3.224
  104.129.3.234
  104.129.3.243
@@ -6919,24 +6961,24 @@
  104.129.40.145
  104.129.40.155
  104.129.40.156
-104.129.46.24
-104.129.46.5
+104.129.41.187
+104.129.46.48
  104.129.48.36
  104.129.48.52
+104.129.48.59
  104.129.48.6
  104.129.58.198
-104.129.58.207
  104.129.58.211
-104.129.58.214
+104.129.58.223
  104.129.58.229
  104.129.58.231
-104.129.58.240
  104.129.61.39
  104.129.9.166
-104.129.9.25
+104.129.9.27
  104.129.9.33
-104.129.9.8
+104.129.9.52
  104.13.168.146
+104.130.11.162
  104.130.11.17
  104.130.12.221
  104.130.12.226
@@ -6952,7 +6994,6 @@
  104.130.170.128
  104.130.173.243
  104.130.175.159
-104.130.239.164
  104.130.26.20
  104.130.28.77
  104.130.30.194
@@ -6974,11 +7015,14 @@
  104.131.105.231
  104.131.107.111
  104.131.108.5
+104.131.11.149
  104.131.11.150
  104.131.11.153
  104.131.11.255
+104.131.110.155
  104.131.111.61
  104.131.112.141
+104.131.112.197
  104.131.112.44
  104.131.112.45
  104.131.113.118
@@ -6995,6 +7039,7 @@
  104.131.12.184
  104.131.12.67
  104.131.123.190
+104.131.126.201
  104.131.127.244
  104.131.128.33
  104.131.13.185
@@ -7060,7 +7105,6 @@
  104.131.186.46
  104.131.187.106
  104.131.187.116
-104.131.187.140
  104.131.187.218
  104.131.188.89
  104.131.189.105
@@ -7080,6 +7124,7 @@
  104.131.2.98
  104.131.20.57
  104.131.206.55
+104.131.21.222
  104.131.214.94
  104.131.217.153
  104.131.217.156
@@ -7109,6 +7154,7 @@
  104.131.44.179
  104.131.44.29
  104.131.45.150
+104.131.45.190
  104.131.45.239
  104.131.46.166
  104.131.46.187
@@ -7121,6 +7167,7 @@
  104.131.54.244
  104.131.55.155
  104.131.55.236
+104.131.57.95
  104.131.58.110
  104.131.58.132
  104.131.58.179
@@ -7128,9 +7175,11 @@
  104.131.58.242
  104.131.59.42
  104.131.59.76
+104.131.60.112
  104.131.60.220
  104.131.60.87
  104.131.61.161
+104.131.62.248
  104.131.63.163
  104.131.64.121
  104.131.64.156
@@ -7167,6 +7216,7 @@
  104.131.84.0
  104.131.84.253
  104.131.84.29
+104.131.85.190
  104.131.86.2
  104.131.86.255
  104.131.88.1
@@ -7221,26 +7271,19 @@
  104.143.38.34
  104.143.43.37
  104.143.83.242
-104.144.103.122
-104.144.103.124
+104.144.103.56
  104.144.110.144
  104.144.112.124
-104.144.112.167
-104.144.112.182
+104.144.112.184
  104.144.112.186
-104.144.112.190
  104.144.112.208
-104.144.112.220
  104.144.112.221
  104.144.116.218
  104.144.155.228
-104.144.161.159
-104.144.163.198
  104.144.164.40
+104.144.171.158
  104.144.171.77
  104.144.18.168
-104.144.180.221
-104.144.184.201
  104.144.185.94
  104.144.191.103
  104.144.196.102
@@ -7250,27 +7293,32 @@
  104.144.203.26
  104.144.207.207
  104.144.207.229
+104.144.210.120
  104.144.210.151
  104.144.210.244
  104.144.210.253
-104.144.210.56
+104.144.210.62
  104.144.210.8
  104.144.213.102
  104.144.213.103
  104.144.213.104
  104.144.213.105
  104.144.213.106
+104.144.213.107
  104.144.215.95
  104.144.22.135
  104.144.22.148
-104.144.22.178
+104.144.22.180
  104.144.22.184
-104.144.22.244
+104.144.22.197
  104.144.22.251
+104.144.220.14
  104.144.226.92
+104.144.236.15
  104.144.236.48
  104.144.248.217
  104.144.249.72
+104.144.250.147
  104.144.28.148
  104.144.28.185
  104.144.45.160
@@ -7282,13 +7330,17 @@
  104.144.6.29
  104.144.6.30
  104.144.83.106
+104.144.83.111
  104.144.83.115
-104.144.83.124
  104.144.83.146
  104.144.83.16
+104.144.83.20
  104.144.83.45
+104.144.83.47
  104.144.89.139
+104.144.91.125
  104.144.91.54
+104.145.222.228
  104.145.225.68
  104.145.225.69
  104.145.225.70
@@ -7338,14 +7390,18 @@
  104.145.236.51
  104.145.236.52
  104.145.236.57
+104.148.100.24
+104.148.100.25
+104.148.100.29
+104.148.100.30
  104.148.114.139
  104.148.124.120
  104.148.18.187
-104.148.204.133
  104.148.5.120
  104.148.5.125
  104.148.57.2
  104.148.64.26
+104.148.89.181
  104.148.90.102
  104.149.128.2
  104.149.134.218
@@ -7358,6 +7414,7 @@
  104.152.168.29
  104.152.187.114
  104.152.191.110
+104.152.52.15
  104.152.52.18
  104.152.52.21
  104.152.52.22
@@ -7377,12 +7434,17 @@
  104.152.52.37
  104.152.52.38
  104.152.52.39
+104.152.52.66
+104.152.52.71
+104.152.52.8
  104.152.52.9
  104.152.58.238
-104.152.59.40
  104.153.101.197
  104.153.102.152
  104.153.105.98
+104.153.109.243
+104.153.96.154
+104.154.147.52
  104.154.156.5
  104.154.160.251
  104.154.203.62
@@ -7407,6 +7469,7 @@
  104.155.137.238
  104.155.140.217
  104.155.155.206
+104.155.163.244
  104.155.169.7
  104.155.198.147
  104.155.199.169
@@ -7439,6 +7502,7 @@
  104.158.35.42
  104.159.28.244
  104.160.1.101
+104.160.1.113
  104.160.1.136
  104.160.1.17
  104.160.1.179
@@ -7463,7 +7527,6 @@
  104.160.8.96
  104.161.42.227
  104.161.79.135
-104.162.132.58
  104.162.213.245
  104.163.160.252
  104.163.204.204
@@ -7475,12 +7538,14 @@
  104.167.85.18
  104.168.102.149
  104.168.102.178
+104.168.107.54
  104.168.115.187
  104.168.125.136
  104.168.135.4
  104.168.136.8
  104.168.152.158
  104.168.153.200
+104.168.155.2
  104.168.160.6
  104.168.162.144
  104.168.165.199
@@ -7495,7 +7560,6 @@
  104.168.173.244
  104.168.173.248
  104.168.176.160
-104.168.176.243
  104.168.177.9
  104.168.195.213
  104.168.198.194
@@ -7515,14 +7579,12 @@
  104.168.25.183
  104.168.253.120
  104.168.28.149
+104.168.28.195
  104.168.29.252
  104.168.30.147
  104.168.30.156
-104.168.4.203
  104.168.44.166
-104.168.51.129
  104.168.51.132
-104.168.51.157
  104.168.52.171
  104.168.53.157
  104.168.53.170
@@ -7548,8 +7610,8 @@
  104.171.240.216
  104.171.242.155
  104.171.58.244
-104.172.138.77
  104.172.59.225
+104.173.30.50
  104.174.61.206
  104.175.168.148
  104.175.67.100
@@ -7579,8 +7641,6 @@
  104.192.74.41
  104.192.74.44
  104.192.81.238
-104.193.173.216
-104.193.232.46
  104.193.252.207
  104.193.252.208
  104.193.252.209
@@ -7623,7 +7683,6 @@
  104.196.231.10
  104.196.231.248
  104.196.249.140
-104.196.34.208
  104.196.43.128
  104.196.44.241
  104.196.46.232
@@ -7658,6 +7717,7 @@
  104.198.114.145
  104.198.124.113
  104.198.146.118
+104.198.149.181
  104.198.151.160
  104.198.157.73
  104.198.16.231
@@ -7671,6 +7731,7 @@
  104.198.216.178
  104.198.220.180
  104.198.227.140
+104.198.228.2
  104.198.232.15
  104.198.232.252
  104.198.248.51
@@ -7696,6 +7757,7 @@
  104.199.148.161
  104.199.173.216
  104.199.177.7
+104.199.178.247
  104.199.181.232
  104.199.192.122
  104.199.203.204
@@ -7733,22 +7795,20 @@
  104.205.176.87
  104.205.227.69
  104.206.106.10
-104.206.106.11
  104.206.106.12
-104.206.106.13
  104.206.106.14
-104.206.106.17
-104.206.106.28
+104.206.106.16
+104.206.106.19
  104.206.106.30
-104.206.106.32
+104.206.106.31
+104.206.106.38
+104.206.106.40
  104.206.106.43
  104.206.106.44
-104.206.106.53
+104.206.106.49
  104.206.106.56
-104.206.106.62
  104.206.119.176
  104.206.119.186
-104.206.119.206
  104.206.119.220
  104.206.128.10
  104.206.128.14
@@ -7771,8 +7831,6 @@
  104.206.128.74
  104.206.128.78
  104.206.182.94
-104.206.206.107
-104.206.206.131
  104.206.252.71
  104.206.81.132
  104.206.81.133
@@ -7782,10 +7840,12 @@
  104.206.81.192
  104.206.81.195
  104.206.81.23
+104.206.81.58
  104.206.81.67
  104.206.96.58
  104.207.129.179
  104.207.130.24
+104.207.138.15
  104.207.140.218
  104.207.141.40
  104.207.143.121
@@ -7810,27 +7870,41 @@
  104.210.213.35
  104.210.40.19
  104.210.50.142
-104.210.55.0
  104.210.58.78
+104.211.117.106
+104.211.119.52
  104.211.158.124
  104.211.16.26
+104.211.164.137
+104.211.179.167
  104.211.18.235
  104.211.183.247
+104.211.203.197
  104.211.227.138
  104.211.230.17
+104.211.245.131
  104.211.27.49
  104.211.28.157
  104.211.29.53
  104.211.38.90
  104.211.49.188
+104.211.72.132
+104.211.78.121
  104.211.8.210
+104.211.9.236
+104.211.95.50
+104.214.113.80
  104.214.116.45
  104.214.234.237
+104.214.25.194
  104.214.34.1
  104.214.51.167
  104.214.51.93
  104.214.51.98
+104.214.52.220
  104.214.54.66
+104.214.57.138
+104.214.58.53
  104.214.59.120
  104.214.59.255
  104.215.124.156
@@ -7845,15 +7919,16 @@
  104.215.73.23
  104.215.80.224
  104.215.84.159
+104.215.96.168
  104.217.252.25
  104.217.253.76
  104.218.136.190
  104.218.242.18
  104.218.48.11
+104.218.51.242
  104.218.63.119
  104.219.158.68
  104.219.248.110
-104.219.248.2
  104.219.250.36
  104.219.52.253
  104.220.15.160
@@ -7861,9 +7936,7 @@
  104.220.195.245
  104.220.211.171
  104.220.36.195
-104.221.119.9
  104.222.96.61
-104.223.103.33
  104.223.105.140
  104.223.114.36
  104.223.123.98
@@ -7871,6 +7944,7 @@
  104.223.143.150
  104.223.143.234
  104.223.153.121
+104.223.153.235
  104.223.17.18
  104.223.170.68
  104.223.170.93
@@ -7879,22 +7953,29 @@
  104.223.225.56
  104.223.229.194
  104.223.24.70
+104.223.25.145
  104.223.25.146
  104.223.25.168
  104.223.28.164
  104.223.28.241
-104.223.29.219
+104.223.29.171
+104.223.31.115
  104.223.31.118
  104.223.31.121
+104.223.31.24
  104.223.31.48
+104.223.31.55
+104.223.31.59
  104.223.31.83
-104.223.31.91
+104.223.32.179
+104.223.33.118
  104.223.33.30
+104.223.38.139
  104.223.38.83
  104.223.42.101
-104.223.42.74
  104.223.42.88
  104.223.57.250
+104.223.76.187
  104.223.79.124
  104.223.79.77
  104.223.79.80
@@ -7904,6 +7985,7 @@
  104.224.141.75
  104.224.142.70
  104.224.146.218
+104.224.148.231
  104.224.149.157
  104.224.150.168
  104.224.151.213
@@ -7913,6 +7995,8 @@
  104.224.173.181
  104.224.178.44
  104.224.183.154
+104.224.185.114
+104.224.186.29
  104.224.187.120
  104.224.191.210
  104.225.141.208
@@ -7920,13 +8004,13 @@
  104.225.153.190
  104.225.153.191
  104.225.154.136
+104.225.154.247
  104.225.158.162
  104.225.218.192
  104.225.233.10
  104.225.251.29
  104.226.31.66
  104.226.31.67
-104.227.103.121
  104.227.106.129
  104.227.112.240
  104.227.112.249
@@ -7934,11 +8018,9 @@
  104.227.116.231
  104.227.121.107
  104.227.121.41
-104.227.124.218
  104.227.124.221
  104.227.162.105
  104.227.168.130
-104.227.17.170
  104.227.173.123
  104.227.173.9
  104.227.175.34
@@ -7950,22 +8032,18 @@
  104.227.204.77
  104.227.204.85
  104.227.205.12
-104.227.254.131
-104.227.255.109
+104.227.254.218
  104.227.4.203
  104.227.4.206
  104.227.49.250
  104.227.49.253
  104.227.54.139
  104.227.57.94
-104.227.77.177
  104.227.77.181
-104.227.77.182
  104.227.77.220
  104.227.77.235
-104.227.83.153
+104.227.90.248
  104.227.90.76
-104.227.99.10
  104.228.72.171
  104.231.138.13
  104.232.103.226
@@ -7995,7 +8073,6 @@
  104.236.118.20
  104.236.120.31
  104.236.121.248
-104.236.122.193
  104.236.122.229
  104.236.124.45
  104.236.127.247
@@ -8025,6 +8102,7 @@
  104.236.188.163
  104.236.191.177
  104.236.191.63
+104.236.192.33
  104.236.193.185
  104.236.194.6
  104.236.197.15
@@ -8041,6 +8119,7 @@
  104.236.207.1
  104.236.207.117
  104.236.207.254
+104.236.207.70
  104.236.208.60
  104.236.21.114
  104.236.210.185
@@ -8086,6 +8165,7 @@
  104.236.254.8
  104.236.26.177
  104.236.31.115
+104.236.33.155
  104.236.38.57
  104.236.39.38
  104.236.4.161
@@ -8133,12 +8213,14 @@
  104.237.130.171
  104.237.137.181
  104.237.138.78
+104.237.139.235
  104.237.139.99
  104.237.140.220
  104.237.142.182
  104.237.143.106
  104.237.144.63
  104.237.144.74
+104.237.146.140
  104.237.146.208
  104.237.149.194
  104.237.152.195
@@ -8154,6 +8236,7 @@
  104.237.232.152
  104.237.233.103
  104.237.233.111
+104.237.233.113
  104.237.234.74
  104.237.240.112
  104.237.240.6
@@ -8161,17 +8244,19 @@
  104.237.252.12
  104.237.252.181
  104.237.253.104
+104.237.253.91
  104.237.255.248
  104.237.255.254
  104.238.111.150
  104.238.111.218
-104.238.120.51
+104.238.116.19
  104.238.128.197
  104.238.129.228
  104.238.131.42
  104.238.133.128
  104.238.144.225
  104.238.144.62
+104.238.144.96
  104.238.145.74
  104.238.148.175
  104.238.149.217
@@ -8190,7 +8275,6 @@
  104.238.188.207
  104.238.190.16
  104.238.196.4
-104.238.202.194
  104.238.214.160
  104.238.220.17
  104.238.220.199
@@ -8200,9 +8284,11 @@
  104.238.39.159
  104.238.39.199
  104.238.59.125
+104.238.59.236
  104.238.80.237
  104.238.83.242
  104.238.97.215
+104.239.138.208
  104.239.149.183
  104.239.163.85
  104.239.164.100
@@ -8223,10 +8309,12 @@
  104.243.21.205
  104.243.24.211
  104.243.31.81
+104.243.41.192
  104.243.41.97
  104.243.44.219
  104.243.44.36
  104.244.168.11
+104.244.225.200
  104.244.72.104
  104.244.72.115
  104.244.72.152
@@ -8238,6 +8326,7 @@
  104.244.72.99
  104.244.73.126
  104.244.73.13
+104.244.73.183
  104.244.73.193
  104.244.73.205
  104.244.73.220
@@ -8246,6 +8335,7 @@
  104.244.73.93
  104.244.74.121
  104.244.74.169
+104.244.74.223
  104.244.74.248
  104.244.74.28
  104.244.74.47
@@ -8262,11 +8352,13 @@
  104.244.76.181
  104.244.76.245
  104.244.76.39
+104.244.76.58
  104.244.76.69
  104.244.77.158
  104.244.77.199
  104.244.77.254
  104.244.77.95
+104.244.78.136
  104.244.78.139
  104.244.78.163
  104.244.78.231
@@ -8277,6 +8369,7 @@
  104.244.79.43
  104.244.91.229
  104.245.228.65
+104.245.41.113
  104.245.41.139
  104.245.42.120
  104.245.42.220
@@ -8284,7 +8377,6 @@
  104.245.95.243
  104.245.99.48
  104.247.159.123
-104.247.234.42
  104.248.0.135
  104.248.1.197
  104.248.1.92
@@ -8300,6 +8392,7 @@
  104.248.121.227
  104.248.121.36
  104.248.122.140
+104.248.122.143
  104.248.123.197
  104.248.124.109
  104.248.126.166
@@ -8321,7 +8414,7 @@
  104.248.14.71
  104.248.140.108
  104.248.142.140
-104.248.142.142
+104.248.142.203
  104.248.142.79
  104.248.143.177
  104.248.143.41
@@ -8344,6 +8437,7 @@
  104.248.148.134
  104.248.149.130
  104.248.149.132
+104.248.151.112
  104.248.151.229
  104.248.152.132
  104.248.152.152
@@ -8359,7 +8453,6 @@
  104.248.158.95
  104.248.158.98
  104.248.159.109
-104.248.159.205
  104.248.159.69
  104.248.16.234
  104.248.16.27
@@ -8371,6 +8464,7 @@
  104.248.164.20
  104.248.165.25
  104.248.167.176
+104.248.169.127
  104.248.169.128
  104.248.17.207
  104.248.17.7
@@ -8397,7 +8491,6 @@
  104.248.206.51
  104.248.208.227
  104.248.208.33
-104.248.209.105
  104.248.21.17
  104.248.21.247
  104.248.21.71
@@ -8406,6 +8499,7 @@
  104.248.22.82
  104.248.225.14
  104.248.226.148
+104.248.226.186
  104.248.226.215
  104.248.228.193
  104.248.229.42
@@ -8414,10 +8508,13 @@
  104.248.23.55
  104.248.230.153
  104.248.231.110
+104.248.231.200
  104.248.231.44
  104.248.231.46
+104.248.232.187
  104.248.232.39
  104.248.233.34
+104.248.235.138
  104.248.236.112
  104.248.236.250
  104.248.237.69
@@ -8430,16 +8527,21 @@
  104.248.245.250
  104.248.246.25
  104.248.247.114
+104.248.247.218
+104.248.247.250
  104.248.247.55
  104.248.25.159
-104.248.25.175
  104.248.25.64
  104.248.250.229
  104.248.251.117
  104.248.251.126
  104.248.251.5
+104.248.252.49
  104.248.253.2
+104.248.254.177
+104.248.254.237
  104.248.255.132
+104.248.255.211
  104.248.26.106
  104.248.27.18
  104.248.27.36
@@ -8506,6 +8608,7 @@
  104.248.51.186
  104.248.52.119
  104.248.53.72
+104.248.55.129
  104.248.56.103
  104.248.56.243
  104.248.57.27
@@ -8524,6 +8627,7 @@
  104.248.63.49
  104.248.65.129
  104.248.65.141
+104.248.66.115
  104.248.70.191
  104.248.71.34
  104.248.71.7
@@ -8539,6 +8643,7 @@
  104.248.83.183
  104.248.84.36
  104.248.84.82
+104.248.85.6
  104.248.88.112
  104.248.88.127
  104.248.89.7
@@ -8546,7 +8651,6 @@
  104.248.90.45
  104.248.90.77
  104.248.93.133
-104.248.93.66
  104.248.94.133
  104.248.94.217
  104.248.94.238
@@ -8603,7 +8707,6 @@
  104.250.98.58
  104.250.98.59
  104.251.236.153
-104.252.222.149
  104.252.222.150
  104.254.244.100
  104.254.247.111
@@ -8611,7 +8714,6 @@
  104.255.65.207
  104.255.78.89
  104.32.136.154
-104.32.160.103
  104.32.43.13
  104.33.226.187
  104.34.111.22
@@ -8629,7 +8731,9 @@
  104.37.216.117
  104.37.31.241
  104.37.84.4
+104.40.159.206
  104.40.197.65
+104.40.221.195
  104.40.222.165
  104.40.31.157
  104.40.57.109
@@ -8639,50 +8743,58 @@
  104.41.130.190
  104.41.133.111
  104.41.136.172
+104.41.137.152
  104.41.139.78
  104.41.165.106
+104.41.201.197
  104.41.202.71
  104.41.203.153
+104.41.204.120
  104.41.205.252
  104.41.229.205
  104.41.24.129
-104.41.40.191
  104.41.42.167
  104.41.44.242
  104.41.52.218
-104.41.57.96
  104.41.60.236
+104.42.169.125
+104.42.213.169
  104.42.48.216
  104.42.48.29
-104.43.128.168
  104.43.133.226
  104.43.142.211
  104.43.163.249
  104.43.170.237
  104.43.195.130
  104.43.201.142
+104.43.217.180
+104.43.217.70
  104.43.222.126
  104.43.222.200
+104.43.245.228
  104.43.249.112
  104.45.130.1
  104.45.134.2
+104.45.142.15
  104.45.142.247
  104.45.156.76
  104.45.159.151
+104.45.193.247
  104.45.212.9
  104.45.41.45
  104.45.6.203
+104.45.86.101
  104.46.15.169
  104.46.227.151
  104.46.32.152
  104.47.145.50
  104.47.147.196
+104.47.149.108
  104.47.152.29
  104.47.167.206
  104.50.144.110
  104.50.180.85
  104.50.201.209
-104.54.219.175
  104.57.18.233
  104.57.20.130
  104.6.134.23
@@ -8704,8 +8816,8 @@
  105.105.162.145
  105.107.36.211
  105.108.115.4
+105.111.111.252
  105.112.10.244
-105.112.104.182
  105.112.91.234
  105.139.82.89
  105.140.31.136
@@ -8715,34 +8827,32 @@
  105.155.161.10
  105.155.254.142
  105.156.246.21
-105.157.159.89
  105.157.22.95
  105.158.103.128
  105.158.163.158
-105.158.164.85
+105.158.178.78
  105.158.91.157
  105.159.149.193
  105.159.205.19
-105.168.72.38
+105.163.241.213
+105.174.18.14
  105.174.38.250
  105.174.4.110
  105.184.224.75
-105.185.136.183
  105.189.37.21
-105.189.40.193
  105.191.33.149
  105.208.44.183
  105.209.235.113
+105.209.40.101
  105.21.40.54
  105.212.115.3
  105.212.56.107
-105.213.113.37
+105.213.107.163
  105.213.120.142
  105.225.107.181
  105.225.162.142
-105.225.212.108
  105.225.53.180
-105.225.84.12
+105.225.60.130
  105.226.188.16
  105.226.97.18
  105.229.20.225
@@ -8767,20 +8877,18 @@
  105.247.244.235
  105.247.67.115
  105.255.222.42
-105.27.116.46
  105.27.143.190
  105.27.152.206
  105.27.155.182
  105.27.177.130
+105.27.205.26
  105.27.245.249
  105.29.64.133
  105.29.64.195
  105.29.67.20
-105.66.2.84
  105.66.3.163
  105.66.4.96
  105.67.1.230
-105.67.11.9
  105.96.106.11
  105.96.109.13
  105.96.11.148
@@ -8794,12 +8902,9 @@
  106.0.5.140
  106.0.5.69
  106.0.58.112
-106.0.58.219
-106.0.59.116
  106.0.6.236
  106.0.6.240
  106.0.6.33
-106.0.61.10
  106.1.113.10
  106.1.113.97
  106.1.144.36
@@ -8811,7 +8916,7 @@
  106.1.164.65
  106.1.164.90
  106.1.174.59
-106.1.175.53
+106.1.175.130
  106.1.18.45
  106.1.184.157
  106.1.185.81
@@ -8827,16 +8932,18 @@
  106.1.77.180
  106.1.77.204
  106.1.89.22
+106.1.91.90
  106.1.92.202
  106.1.92.31
  106.1.93.87
  106.1.94.110
-106.101.3.43
+106.101.3.220
  106.104.113.145
  106.104.125.61
  106.104.126.231
  106.104.134.174
  106.104.140.226
+106.104.148.2
  106.104.151.142
  106.104.162.72
  106.104.163.13
@@ -8873,7 +8980,6 @@
  106.107.209.4
  106.107.222.46
  106.107.222.91
-106.107.237.151
  106.109.112.zoom-lab.com
  106.110.104.29
  106.110.105.60
@@ -8899,10 +9005,6 @@
  106.110.219.88
  106.110.22.223
  106.110.224.236
-106.110.35.12
-106.110.35.127
-106.110.35.199
-106.110.35.55
  106.110.69.24
  106.110.71.236
  106.110.79.167
@@ -8913,7 +9015,6 @@
  106.110.93.16
  106.110.94.54
  106.111.155.239
-106.111.168.142
  106.111.224.174
  106.111.38.110
  106.111.38.143
@@ -8937,21 +9038,24 @@
  106.115.125.37
  106.115.190.214
  106.116.118.89
-106.116.118.90
  106.116.166.64
  106.116.19.245
  106.116.209.80
  106.116.99.111
  106.117.207.186
+106.117.235.78
  106.117.236.81
  106.117.236.82
  106.117.239.135
  106.117.239.19
+106.117.240.11
  106.118.121.213
  106.118.214.220
  106.12.10.21
  106.12.10.72
  106.12.10.8
+106.12.100.206
+106.12.100.73
  106.12.102.210
  106.12.102.54
  106.12.105.130
@@ -8978,23 +9082,29 @@
  106.12.115.169
  106.12.116.75
  106.12.119.1
+106.12.119.218
+106.12.12.127
  106.12.12.242
  106.12.121.148
  106.12.122.138
  106.12.123.239
  106.12.123.48
+106.12.125.241
  106.12.126.114
  106.12.127.136
  106.12.127.39
+106.12.127.47
  106.12.129.67
  106.12.13.185
  106.12.13.20
  106.12.130.189
+106.12.130.44
  106.12.131.102
  106.12.132.224
  106.12.133.103
  106.12.133.225
  106.12.133.38
+106.12.134.118
  106.12.134.187
  106.12.136.154
  106.12.14.130
@@ -9012,6 +9122,7 @@
  106.12.149.176
  106.12.149.253
  106.12.149.27
+106.12.15.225
  106.12.15.27
  106.12.15.56
  106.12.150.36
@@ -9020,18 +9131,22 @@
  106.12.153.211
  106.12.154.24
  106.12.155.254
+106.12.156.164
  106.12.159.112
  106.12.159.138
  106.12.16.149
  106.12.16.2
+106.12.160.6
  106.12.161.86
  106.12.162.234
+106.12.163.58
  106.12.163.87
  106.12.165.253
  106.12.165.53
  106.12.166.167
  106.12.166.201
  106.12.166.209
+106.12.167.216
  106.12.17.214
  106.12.171.253
  106.12.171.31
@@ -9054,8 +9169,8 @@
  106.12.18.219
  106.12.180.136
  106.12.181.144
+106.12.182.38
  106.12.183.209
-106.12.183.239
  106.12.185.102
  106.12.185.18
  106.12.186.130
@@ -9071,10 +9186,12 @@
  106.12.194.26
  106.12.195.70
  106.12.196.118
+106.12.196.38
  106.12.197.52
  106.12.198.236
  106.12.199.117
  106.12.199.30
+106.12.2.221
  106.12.2.81
  106.12.20.113
  106.12.20.15
@@ -9097,6 +9214,7 @@
  106.12.207.92
  106.12.208.141
  106.12.208.211
+106.12.209.117
  106.12.209.57
  106.12.209.81
  106.12.210.115
@@ -9122,6 +9240,7 @@
  106.12.222.209
  106.12.23.44
  106.12.24.182
+106.12.24.193
  106.12.24.225
  106.12.242.19
  106.12.242.58
@@ -9129,14 +9248,15 @@
  106.12.25.152
  106.12.25.96
  106.12.252.122
-106.12.252.34
  106.12.253.136
  106.12.26.131
  106.12.26.160
  106.12.26.167
+106.12.26.237
  106.12.28.152
  106.12.28.157
  106.12.29.204
+106.12.3.28
  106.12.30.133
  106.12.30.41
  106.12.30.87
@@ -9154,7 +9274,9 @@
  106.12.37.20
  106.12.37.38
  106.12.38.109
+106.12.38.143
  106.12.38.231
+106.12.38.70
  106.12.4.158
  106.12.40.74
  106.12.42.123
@@ -9165,18 +9287,23 @@
  106.12.46.179
  106.12.46.229
  106.12.47.108
+106.12.47.229
  106.12.5.13
  106.12.5.137
  106.12.5.168
  106.12.5.190
  106.12.5.48
+106.12.51.10
  106.12.51.110
  106.12.52.154
+106.12.52.34
  106.12.52.98
  106.12.55.170
+106.12.55.39
  106.12.55.57
  106.12.56.126
  106.12.56.41
+106.12.56.74
  106.12.56.84
  106.12.57.149
  106.12.57.165
@@ -9225,7 +9352,6 @@
  106.12.83.53
  106.12.84.29
  106.12.84.33
-106.12.84.63
  106.12.84.83
  106.12.85.128
  106.12.85.225
@@ -9242,34 +9368,35 @@
  106.12.89.173
  106.12.89.206
  106.12.90.29
-106.12.90.63
+106.12.90.45
  106.12.91.102
  106.12.91.209
+106.12.91.225
  106.12.91.36
  106.12.92.246
  106.12.93.25
  106.12.93.251
  106.12.93.253
  106.12.94.119
+106.12.94.186
  106.12.94.65
  106.12.94.74
  106.12.94.83
  106.12.95.45
  106.12.96.23
  106.12.96.91
-106.12.97.104
+106.12.97.132
  106.12.97.46
  106.120.198.90
  106.120.221.78
  106.120.75.98
  106.122.205.43
  106.123.32.86
-106.123.41.120
+106.123.47.40
  106.123.52.175
  106.123.60.134
  106.124.120.205
  106.124.129.115
-106.124.130.114
  106.124.131.194
  106.124.131.214
  106.124.131.70
@@ -9302,6 +9429,7 @@
  106.13.104.41
  106.13.104.8
  106.13.107.196
+106.13.110.36
  106.13.112.143
  106.13.112.221
  106.13.112.252
@@ -9311,6 +9439,7 @@
  106.13.115.17
  106.13.118.175
  106.13.119.163
+106.13.119.176
  106.13.119.89
  106.13.123.29
  106.13.123.73
@@ -9320,6 +9449,7 @@
  106.13.128.71
  106.13.130.166
  106.13.131.132
+106.13.133.78
  106.13.138.162
  106.13.138.253
  106.13.139.79
@@ -9330,7 +9460,9 @@
  106.13.142.93
  106.13.144.207
  106.13.144.233
-106.13.145.1
+106.13.144.8
+106.13.146.233
+106.13.146.93
  106.13.147.89
  106.13.148.240
  106.13.149.57
@@ -9352,25 +9484,31 @@
  106.13.169.193
  106.13.171.239
  106.13.172.167
+106.13.172.226
  106.13.173.228
  106.13.173.73
+106.13.174.144
  106.13.174.171
-106.13.175.126
  106.13.175.233
  106.13.176.163
-106.13.176.220
+106.13.176.235
+106.13.177.231
  106.13.177.53
  106.13.178.211
  106.13.179.45
+106.13.18.86
  106.13.180.245
  106.13.181.235
  106.13.181.242
  106.13.182.100
  106.13.182.41
  106.13.182.60
+106.13.183.216
+106.13.183.36
  106.13.183.89
  106.13.184.128
  106.13.184.136
+106.13.184.139
  106.13.184.174
  106.13.184.234
  106.13.184.243
@@ -9386,15 +9524,16 @@
  106.13.19.75
  106.13.190.84
  106.13.191.25
+106.13.191.26
  106.13.194.25
  106.13.194.64
+106.13.195.132
  106.13.195.32
  106.13.196.177
  106.13.196.51
  106.13.197.35
  106.13.198.167
  106.13.199.185
-106.13.199.34
  106.13.20.229
  106.13.20.31
  106.13.200.150
@@ -9410,42 +9549,64 @@
  106.13.207.45
  106.13.209.80
  106.13.210.188
+106.13.210.81
  106.13.212.162
  106.13.213.76
+106.13.215.17
  106.13.215.207
  106.13.215.94
  106.13.216.115
  106.13.217.10
  106.13.217.124
+106.13.218.169
+106.13.219.219
  106.13.221.213
  106.13.222.42
  106.13.223.100
  106.13.223.163
-106.13.225.60
+106.13.226.112
+106.13.226.34
+106.13.227.104
  106.13.227.19
+106.13.228.13
  106.13.228.133
  106.13.228.153
+106.13.228.21
+106.13.228.33
+106.13.228.62
  106.13.229.254
  106.13.229.99
  106.13.23.86
  106.13.230.219
+106.13.230.36
  106.13.231.103
-106.13.231.239
+106.13.231.150
+106.13.231.20
+106.13.232.193
+106.13.232.197
  106.13.232.67
  106.13.232.79
  106.13.233.102
+106.13.233.32
+106.13.233.4
+106.13.233.5
+106.13.233.83
+106.13.234.36
  106.13.234.81
  106.13.235.57
  106.13.236.70
  106.13.236.94
  106.13.237.170
+106.13.238.1
  106.13.238.73
+106.13.239.120
  106.13.25.242
  106.13.26.62
  106.13.27.134
  106.13.27.156
  106.13.27.206
  106.13.27.75
+106.13.28.132
  106.13.29.92
  106.13.3.175
  106.13.3.238
@@ -9454,6 +9615,7 @@
  106.13.34.131
  106.13.34.173
  106.13.35.121
+106.13.35.167
  106.13.35.176
  106.13.35.232
  106.13.35.87
@@ -9464,6 +9626,7 @@
  106.13.37.213
  106.13.37.33
  106.13.38.121
+106.13.39.56
  106.13.4.132
  106.13.4.86
  106.13.40.219
@@ -9548,10 +9711,10 @@
  106.13.97.228
  106.13.99.107
  106.13.99.224
+106.13.99.39
  106.14.1.209
  106.14.188.79
  106.14.199.121
-106.14.21.174
  106.14.211.77
  106.14.224.228
  106.14.241.0
@@ -9588,18 +9751,22 @@
  106.187.99.130
  106.2.13.189
  106.2.207.106
-106.2.233.226
  106.2.45.15
  106.201.233.16
  106.201.238.227
-106.206.59.85
  106.210.136.13
+106.211.197.254
+106.213.247.97
+106.215.123.61
  106.215.125.109
-106.220.109.38
-106.225.199.38
+106.225.192.140
+106.225.204.216
+106.225.211.193
  106.225.211.248
  106.225.219.144
  106.225.228.68
+106.226.50.168
+106.226.7.195
  106.240.131.5
  106.240.24.38
  106.240.61.28
@@ -9612,7 +9779,7 @@
  106.242.35.34
  106.243.144.238
  106.244.127.11
-106.244.227.136
+106.244.227.141
  106.244.233.87
  106.244.77.149
  106.245.146.26
@@ -9640,7 +9807,6 @@
  106.250.11.246
  106.250.156.76
  106.250.34.36
-106.251.173.72
  106.251.240.146
  106.251.66.171
  106.251.98.241
@@ -9665,9 +9831,11 @@
  106.3.45.140
  106.3.45.254
  106.3.45.45
+106.32.27.203
  106.35.148.152
  106.35.151.66
  106.35.215.115
+106.35.40.220
  106.37.178.165
  106.37.178.172
  106.37.205.136
@@ -9694,7 +9862,7 @@
  106.38.20.182
  106.38.205.205
  106.38.3.251
-106.38.65.28
+106.38.53.234
  106.38.70.178
  106.38.84.164
  106.38.99.138
@@ -9710,9 +9878,9 @@
  106.40.149.74
  106.40.150.212
  106.40.188.16
+106.46.127.124
  106.47.251.170
  106.5.168.58
-106.5.74.112
  106.51.139.44
  106.51.16.120
  106.51.164.41
@@ -9720,8 +9888,11 @@
  106.51.2.56
  106.51.227.10
  106.51.234.102
+106.51.242.164
  106.51.255.21
+106.51.3.214
  106.51.36.64
+106.51.38.60
  106.51.48.117
  106.51.63.3
  106.51.73.204
@@ -9730,7 +9901,6 @@
  106.51.80.198
  106.51.81.136
  106.51.85.16
-106.51.96.190
  106.51.98.159
  106.51.98.180
  106.52.105.158
@@ -9742,7 +9912,6 @@
  106.52.115.36
  106.52.12.21
  106.52.122.203
-106.52.127.250
  106.52.128.100
  106.52.130.163
  106.52.130.172
@@ -9763,6 +9932,8 @@
  106.52.152.16
  106.52.152.168
  106.52.152.237
+106.52.153.210
+106.52.156.195
  106.52.162.134
  106.52.162.140
  106.52.163.30
@@ -9770,7 +9941,6 @@
  106.52.174.149
  106.52.177.16
  106.52.177.213
-106.52.177.51
  106.52.178.166
  106.52.179.227
  106.52.181.236
@@ -9782,10 +9952,12 @@
  106.52.2.174
  106.52.20.112
  106.52.203.17
+106.52.205.211
  106.52.209.36
  106.52.210.175
  106.52.210.90
  106.52.217.57
+106.52.22.64
  106.52.222.11
  106.52.222.133
  106.52.23.108
@@ -9793,23 +9965,32 @@
  106.52.231.46
  106.52.235.246
  106.52.236.23
+106.52.242.21
  106.52.243.17
  106.52.244.128
  106.52.244.46
+106.52.246.152
  106.52.249.134
  106.52.250.153
+106.52.250.46
  106.52.251.114
+106.52.251.24
  106.52.251.30
+106.52.26.50
  106.52.28.75
+106.52.30.184
  106.52.33.183
  106.52.33.247
  106.52.33.78
+106.52.4.195
  106.52.42.23
-106.52.43.123
+106.52.44.179
+106.52.50.225
  106.52.51.73
  106.52.55.146
  106.52.56.193
  106.52.56.26
+106.52.58.81
  106.52.6.77
  106.52.63.37
  106.52.64.125
@@ -9825,6 +10006,7 @@
  106.52.86.172
  106.52.89.135
  106.52.9.154
+106.52.90.84
  106.52.92.220
  106.52.96.247
  106.52.98.89
@@ -9843,7 +10025,7 @@
  106.53.125.98
  106.53.127.49
  106.53.17.135
-106.53.18.22
+106.53.178.199
  106.53.19.38
  106.53.192.15
  106.53.192.246
@@ -9856,6 +10038,7 @@
  106.53.202.86
  106.53.207.227
  106.53.210.12
+106.53.220.103
  106.53.220.198
  106.53.223.127
  106.53.226.224
@@ -9872,6 +10055,7 @@
  106.53.237.190
  106.53.238.111
  106.53.238.15
+106.53.238.97
  106.53.239.130
  106.53.239.195
  106.53.239.28
@@ -9890,26 +10074,29 @@
  106.53.55.86
  106.53.61.167
  106.53.62.73
+106.53.68.158
  106.53.70.152
  106.53.74.231
  106.53.81.17
  106.53.83.97
  106.53.84.238
  106.53.88.144
+106.53.9.137
  106.53.9.163
  106.53.92.254
  106.53.92.85
  106.53.93.44
  106.53.96.123
  106.53.97.54
+106.54.1.58
  106.54.101.141
  106.54.101.25
  106.54.105.9
  106.54.108.8
  106.54.111.75
  106.54.112.173
+106.54.114.248
  106.54.117.51
-106.54.125.127
  106.54.126.152
  106.54.129.202
  106.54.129.69
@@ -9918,16 +10105,20 @@
  106.54.140.165
  106.54.141.196
  106.54.144.22
+106.54.155.35
  106.54.163.106
  106.54.166.168
  106.54.166.187
  106.54.167.195
  106.54.167.68
+106.54.17.221
  106.54.171.167
  106.54.173.254
  106.54.174.38
  106.54.182.137
  106.54.182.161
+106.54.182.239
+106.54.182.32
  106.54.183.246
  106.54.184.153
  106.54.184.192
@@ -9946,8 +10137,11 @@
  106.54.217.12
  106.54.219.237
  106.54.220.54
+106.54.221.104
+106.54.222.51
  106.54.224.217
  106.54.227.32
+106.54.233.175
  106.54.236.220
  106.54.236.226
  106.54.238.208
@@ -9958,13 +10152,18 @@
  106.54.253.152
  106.54.253.41
  106.54.253.9
+106.54.255.11
+106.54.255.57
+106.54.3.90
  106.54.40.151
  106.54.44.202
  106.54.47.12
+106.54.47.171
  106.54.48.130
  106.54.48.208
  106.54.48.241
  106.54.50.55
+106.54.51.77
  106.54.52.141
  106.54.52.35
  106.54.53.84
@@ -9973,6 +10172,7 @@
  106.54.57.203
  106.54.61.195
  106.54.62.168
+106.54.64.147
  106.54.64.77
  106.54.65.139
  106.54.65.144
@@ -9983,13 +10183,16 @@
  106.54.74.83
  106.54.77.171
  106.54.79.212
+106.54.80.210
  106.54.82.69
  106.54.83.253
  106.54.83.80
+106.54.84.191
  106.54.86.190
  106.54.87.169
  106.54.89.231
  106.54.90.60
+106.54.91.157
  106.54.92.106
  106.54.92.214
  106.54.93.182
@@ -10033,17 +10236,21 @@
  106.55.17.63
  106.55.170.47
  106.55.170.49
+106.55.18.226
+106.55.195.243
  106.55.21.141
+106.55.23.112
  106.55.233.29
  106.55.236.107
  106.55.236.71
  106.55.238.164
-106.55.239.113
  106.55.240.104
  106.55.240.252
  106.55.241.126
+106.55.242.220
  106.55.242.70
  106.55.249.164
+106.55.251.81
  106.55.26.195
  106.55.30.229
  106.55.31.71
@@ -10059,9 +10266,12 @@
  106.55.47.184
  106.55.48.134
  106.55.49.141
+106.55.5.192
  106.55.53.121
  106.55.58.118
+106.55.59.64
  106.55.6.108
+106.55.61.15
  106.55.9.175
  106.55.9.52
  106.56.48.43
@@ -10072,6 +10282,7 @@
  106.58.214.242
  106.58.215.95
  106.58.30.113
+106.59.1.250
  106.59.100.16
  106.59.122.95
  106.59.134.58
@@ -10092,24 +10303,29 @@
  106.75.103.4
  106.75.103.67
  106.75.104.44
+106.75.105.110
  106.75.114.98
  106.75.116.12
  106.75.119.202
  106.75.12.245
+106.75.12.247
  106.75.123.210
  106.75.123.95
+106.75.129.66
  106.75.129.76
  106.75.13.173
  106.75.13.192
  106.75.132.3
  106.75.133.250
  106.75.133.57
-106.75.137.168
  106.75.138.38
  106.75.141.155
  106.75.141.160
+106.75.141.219
  106.75.141.223
  106.75.143.233
+106.75.146.67
+106.75.148.111
  106.75.148.228
  106.75.148.48
  106.75.152.124
@@ -10134,6 +10350,8 @@
  106.75.174.6
  106.75.174.87
  106.75.176.189
+106.75.179.208
+106.75.179.87
  106.75.181.119
  106.75.190.98
  106.75.209.179
@@ -10150,9 +10368,13 @@
  106.75.22.216
  106.75.224.132
  106.75.225.193
+106.75.226.163
  106.75.230.208
  106.75.231.107
+106.75.233.158
+106.75.233.206
  106.75.234.61
+106.75.234.83
  106.75.239.204
  106.75.239.79
  106.75.240.86
@@ -10160,17 +10382,23 @@
  106.75.241.94
  106.75.246.131
  106.75.246.176
+106.75.247.137
  106.75.247.206
  106.75.247.218
  106.75.247.8
  106.75.249.21
  106.75.249.26
+106.75.249.8
+106.75.25.114
  106.75.25.148
  106.75.25.86
  106.75.251.140
  106.75.254.109
+106.75.254.207
  106.75.254.53
  106.75.26.61
+106.75.29.132
+106.75.29.239
  106.75.3.15
  106.75.3.35
  106.75.30.102
@@ -10179,27 +10407,32 @@
  106.75.4.117
  106.75.4.19
  106.75.48.8
+106.75.5.94
  106.75.52.43
  106.75.55.46
+106.75.6.230
  106.75.61.147
  106.75.61.203
  106.75.62.25
  106.75.63.218
+106.75.66.108
  106.75.66.70
  106.75.67.6
  106.75.7.109
  106.75.74.225
  106.75.77.230
  106.75.78.135
+106.75.8.139
  106.75.8.155
  106.75.84.197
  106.75.85.37
  106.75.86.180
  106.75.9.141
  106.75.92.239
+106.75.92.5
  106.75.92.78
  106.75.93.26
-106.75.96.24
+106.75.95.6
  106.75.97.129
  106.75.97.141
  106.75.98.184
@@ -10224,9 +10457,11 @@
  106.86.54.3
  106.86.55.66
  106.87.72.122
+106.87.88.49
  106.87.89.76
  106.91.5.182
  106.92.3.49
+106.96.113.220
  106373423597656-dot-hi0-492-net.appspot.com
  106b.com
  107.0.135.4
@@ -10260,9 +10495,11 @@
  107.15.154.173
  107.15.159.1
  107.15.40.62
+107.150.100.197
+107.150.101.12
  107.150.107.142
+107.150.107.143
  107.150.112.187
-107.150.125.147
  107.150.125.83
  107.150.167.114
  107.150.2.29
@@ -10276,14 +10513,15 @@
  107.150.50.234
  107.150.58.196
  107.150.60.26
-107.150.64.128
  107.150.65.11
  107.150.65.115
  107.150.65.119
  107.150.65.127
  107.150.65.129
  107.150.65.59
+107.150.70.87
  107.150.70.90
+107.150.84.138
  107.150.89.191
  107.150.89.199
  107.151.152.210
@@ -10291,10 +10529,11 @@
  107.151.194.175
  107.151.195.6
  107.151.218.131
+107.152.106.145
  107.152.129.250
  107.152.139.201
  107.152.139.218
-107.152.139.249
+107.152.139.219
  107.152.145.126
  107.152.151.57
  107.152.157.134
@@ -10314,21 +10553,19 @@
  107.152.229.13
  107.152.239.122
  107.152.239.16
+107.152.239.18
+107.152.239.188
  107.152.239.230
-107.152.242.204
  107.152.242.71
  107.152.243.81
  107.152.246.144
-107.152.246.148
  107.152.247.0
  107.152.247.150
  107.152.247.224
+107.152.247.226
  107.152.247.233
-107.152.247.242
  107.152.251.96
-107.152.255.218
  107.152.255.221
-107.152.255.98
  107.152.35.198
  107.152.47.41
  107.155.132.187
@@ -10338,6 +10575,7 @@
  107.155.153.98
  107.155.160.204
  107.155.162.15
+107.155.25.41
  107.155.45.241
  107.155.48.36
  107.155.65.34
@@ -10353,8 +10591,10 @@
  107.158.154.94
  107.158.154.99
  107.158.202.118
+107.158.202.129
+107.158.202.36
  107.158.25.139
-107.158.25.172
+107.158.25.183
  107.158.25.83
  107.158.32.118
  107.158.32.128
@@ -10364,10 +10604,10 @@
  107.158.32.48
  107.158.32.62
  107.158.8.88
-107.158.84.94
  107.158.85.18
  107.158.85.208
  107.158.85.243
+107.158.86.95
  107.158.9.170
  107.158.9.223
  107.158.9.250
@@ -10422,11 +10662,11 @@
  107.170.131.23
  107.170.135.29
  107.170.14.209
-107.170.144.113
  107.170.160.61
  107.170.162.155
  107.170.164.211
  107.170.172.23
+107.170.178.103
  107.170.18.163
  107.170.184.26
  107.170.192.181
@@ -10447,7 +10687,6 @@
  107.170.210.211
  107.170.210.45
  107.170.217.106
-107.170.218.87
  107.170.219.152
  107.170.221.122
  107.170.221.204
@@ -10489,6 +10728,7 @@
  107.170.77.69
  107.170.8.24
  107.170.9.195
+107.170.91.121
  107.170.96.6
  107.170.99.119
  107.171.179.10
@@ -10498,6 +10738,7 @@
  107.172.100.204
  107.172.101.71
  107.172.103.144
+107.172.104.125
  107.172.13.87
  107.172.131.179
  107.172.131.186
@@ -10510,29 +10751,27 @@
  107.172.141.105
  107.172.142.113
  107.172.142.122
-107.172.143.214
  107.172.146.81
  107.172.148.135
  107.172.148.136
-107.172.148.139
-107.172.148.145
+107.172.148.137
+107.172.148.160
  107.172.148.174
-107.172.150.53
  107.172.150.56
  107.172.151.208
  107.172.156.153
  107.172.157.108
  107.172.157.125
  107.172.157.131
-107.172.157.169
  107.172.157.191
  107.172.168.105
  107.172.168.139
  107.172.185.17
-107.172.185.205
  107.172.188.107
  107.172.191.103
+107.172.191.113
  107.172.193.13
+107.172.195.147
  107.172.196.110
  107.172.197.101
  107.172.197.186
@@ -10540,6 +10779,7 @@
  107.172.198.118
  107.172.198.146
  107.172.201.10
+107.172.206.82
  107.172.22.132
  107.172.22.136
  107.172.22.197
@@ -10561,13 +10801,12 @@
  107.172.241.181
  107.172.246.235
  107.172.248.138
-107.172.25.151
  107.172.3.146
-107.172.37.105
  107.172.39.131
  107.172.39.27
  107.172.42.80
  107.172.43.152
+107.172.44.250
  107.172.49.106
  107.172.5.116
  107.172.56.198
@@ -10577,26 +10816,25 @@
  107.172.66.135
  107.172.66.167
  107.172.67.242
-107.172.67.245
  107.172.68.247
  107.172.80.110
  107.172.80.113
+107.172.80.126
  107.172.80.130
  107.172.80.132
-107.172.82.134
-107.172.88.164
  107.172.89.15
  107.172.89.165
  107.172.94.133
  107.172.95.115
-107.172.99.8
+107.172.99.15
+107.172.99.16
  107.173.114.51
  107.173.122.10
+107.173.129.119
  107.173.137.253
  107.173.140.114
  107.173.141.112
  107.173.141.161
-107.173.141.163
  107.173.141.208
  107.173.141.209
  107.173.141.3
@@ -10612,14 +10850,12 @@
  107.173.182.173
  107.173.192.61
  107.173.194.241
-107.173.195.5
-107.173.196.13
-107.173.196.133
  107.173.2.6
  107.173.2.98
  107.173.201.161
  107.173.201.244
  107.173.201.87
+107.173.202.178
  107.173.202.197
  107.173.202.204
  107.173.204.16
@@ -10632,25 +10868,22 @@
  107.173.222.153
  107.173.229.72
  107.173.230.227
-107.173.230.246
+107.173.230.252
  107.173.233.12
  107.173.233.120
  107.173.24.170
  107.173.246.131
  107.173.248.114
-107.173.248.119
  107.173.248.151
  107.173.248.211
  107.173.248.73
  107.173.251.100
  107.173.27.180
-107.173.28.34
+107.173.3.69
  107.173.33.126
-107.173.4.197
  107.173.42.101
  107.173.48.253
  107.173.49.10
-107.173.49.118
  107.173.50.220
  107.173.51.246
  107.173.67.131
@@ -10660,10 +10893,10 @@
  107.174.13.220
  107.174.133.119
  107.174.140.184
+107.174.143.245
  107.174.144.157
  107.174.148.112
  107.174.149.41
-107.174.149.60
  107.174.149.7
  107.174.150.66
  107.174.150.98
@@ -10673,6 +10906,7 @@
  107.174.205.28
  107.174.206.110
  107.174.224.153
+107.174.224.176
  107.174.224.184
  107.174.224.185
  107.174.226.222
@@ -10698,7 +10932,6 @@
  107.174.33.134
  107.174.33.153
  107.174.33.159
-107.174.38.215
  107.174.39.102
  107.174.39.107
  107.174.39.118
@@ -10706,29 +10939,28 @@
  107.174.5.238
  107.174.5.242
  107.174.54.37
+107.174.61.115
  107.174.64.206
+107.174.64.217
  107.174.76.237
  107.174.76.247
  107.175.0.13
-107.175.101.113
-107.175.101.114
  107.175.108.254
  107.175.110.116
  107.175.114.127
  107.175.128.141
+107.175.129.141
  107.175.129.252
  107.175.129.51
  107.175.13.100
  107.175.13.17
  107.175.13.21
-107.175.133.35
-107.175.136.157
  107.175.146.203
+107.175.150.68
  107.175.150.73
  107.175.150.83
  107.175.151.78
  107.175.153.195
-107.175.153.222
  107.175.153.245
  107.175.153.253
  107.175.154.129
@@ -10746,11 +10978,13 @@
  107.175.197.164
  107.175.197.177
  107.175.216.127
+107.175.224.134
  107.175.231.186
-107.175.236.254
+107.175.240.120
  107.175.240.21
  107.175.247.36
  107.175.247.76
+107.175.31.12
  107.175.31.146
  107.175.32.237
  107.175.32.92
@@ -10777,6 +11011,7 @@
  107.175.58.82
  107.175.60.131
  107.175.61.58
+107.175.62.16
  107.175.64.101
  107.175.64.108
  107.175.64.137
@@ -10784,7 +11019,6 @@
  107.175.65.251
  107.175.69.122
  107.175.71.42
-107.175.75.154
  107.175.78.60
  107.175.78.7
  107.175.8.68
@@ -10813,16 +11047,15 @@
  107.179.96.11
  107.180.100.223
  107.180.100.224
-107.180.108.24
+107.180.106.60
  107.180.108.32
  107.180.108.7
  107.180.120.45
+107.180.120.51
  107.180.120.55
  107.180.120.61
  107.180.121.26
-107.180.121.3
  107.180.122.10
-107.180.122.15
  107.180.227.163
  107.180.229.15
  107.180.44.78
@@ -10837,18 +11070,19 @@
  107.181.136.15
  107.181.174.175
  107.181.175.112
-107.181.178.109
  107.181.180.166
  107.181.180.173
  107.181.180.175
  107.181.187.132
  107.181.187.141
+107.181.189.145
  107.181.246.211
  107.181.58.56
  107.182.131.117
  107.182.17.72
  107.182.173.131
  107.182.177.38
+107.182.178.177
  107.182.180.36
  107.182.182.216
  107.182.19.193
@@ -10859,11 +11093,14 @@
  107.182.23.162
  107.182.234.190
  107.182.25.146
+107.182.73.214
  107.184.103.112
  107.184.39.22
+107.185.206.112
  107.186.120.130
  107.189.10.101
  107.189.10.119
+107.189.10.140
  107.189.10.174
  107.189.10.185
  107.189.10.243
@@ -10920,6 +11157,7 @@
  107.21.192.118
  107.21.196.112
  107.21.225.222
+107.21.61.32
  107.21.77.7
  107.219.185.75
  107.22.127.222
@@ -10931,6 +11169,7 @@
  107.22.91.113
  107.220.199.71
  107.222.10.97
+107.223.161.13
  107.23.116.84
  107.23.14.203
  107.23.189.203
@@ -10954,6 +11193,10 @@
  107.6.162.37
  107.6.162.38
  107.6.163.34
+107.6.163.35
+107.6.163.36
+107.6.163.37
+107.6.163.38
  107.6.168.210
  107.6.168.211
  107.6.168.212
@@ -11091,7 +11334,6 @@
  108-365.net
  108.11.29.107
  108.12.147.7
-108.13.189.76
  108.14.79.202
  108.16.0.72
  108.160.138.55
@@ -11108,14 +11350,14 @@
  108.161.134.78
  108.161.134.8
  108.162.139.230
-108.162.215.234
-108.162.215.42
-108.162.219.174
-108.162.219.43
+108.162.215.70
+108.162.219.38
  108.162.229.35
+108.162.229.90
  108.162.245.119
-108.162.245.120
+108.162.245.50
  108.162.245.83
+108.162.246.227
  108.162.246.36
  108.162.246.54
  108.162.28.6
@@ -11138,13 +11380,9 @@
  108.165.192.227
  108.165.192.250
  108.165.192.60
-108.165.247.18
-108.165.247.204
  108.165.247.216
  108.165.247.31
-108.165.247.50
  108.165.247.72
-108.165.247.89
  108.166.168.158
  108.166.194.71
  108.166.202.103
@@ -11153,6 +11391,7 @@
  108.167.163.100
  108.167.180.12
  108.167.189.16
+108.168.111.44
  108.168.131.106
  108.168.131.248
  108.168.131.251
@@ -11186,13 +11425,17 @@
  108.174.196.234
  108.174.198.231
  108.174.199.180
+108.174.81.136
  108.175.154.212
  108.175.2.186
+108.175.225.220
  108.175.233.202
+108.175.3.235
  108.175.86.73
  108.176.59.82
  108.176.71.170
  108.177.235.218
+108.177.235.223
  108.178.10.50
  108.178.15.210
  108.178.59.178
@@ -11206,8 +11449,8 @@
  108.179.219.12
  108.179.54.171
  108.183.77.12
-108.184.162.8
  108.185.130.115
+108.185.250.191
  108.185.49.129
  108.185.77.62
  108.186.6.161
@@ -11227,11 +11470,9 @@
  108.197.138.180
  108.2.119.69
  108.20.186.210
-108.20.203.32
  108.20.207.31
  108.20.222.209
  108.20.238.154
-108.200.255.200
  108.201.79.41
  108.204.134.57
  108.207.11.152
@@ -11269,7 +11510,6 @@
  108.29.77.74
  108.30.135.146
  108.30.14.21
-108.30.160.14
  108.30.177.92
  108.30.209.194
  108.31.147.13
@@ -11279,6 +11519,7 @@
  108.35.101.26
  108.36.253.227
  108.39.181.17
+108.4.207.148
  108.41.142.8
  108.41.153.231
  108.41.2.202
@@ -11288,7 +11529,6 @@
  108.46.155.174
  108.46.29.236
  108.48.176.222
-108.5.154.248
  108.5.191.157
  108.5.49.62
  108.50.231.111
@@ -11296,6 +11536,7 @@
  108.51.195.163
  108.51.195.30
  108.51.85.97
+108.51.89.141
  108.52.18.169
  108.53.1.212
  108.53.145.212
@@ -11312,10 +11553,8 @@
  108.6.205.196
  108.60.183.101
  108.60.206.189
-108.60.219.24
  108.60.48.72
  108.60.50.229
-108.60.53.52
  108.61.119.36
  108.61.123.69
  108.61.123.70
@@ -11357,6 +11596,7 @@
  108.61.75.251
  108.61.86.34
  108.61.87.179
+108.62.118.2
  108.62.121.176
  108.62.121.177
  108.62.121.210
@@ -13433,7 +13673,6 @@
  108bpo.com.br
  108studija.lt
  109-365.net
-109.10.194.233
  109.100.43.230
  109.101.137.162
  109.101.137.186
@@ -13447,6 +13686,7 @@
  109.102.254.170
  109.102.31.54
  109.102.39.254
+109.102.83.31
  109.102.92.90
  109.103.126.100
  109.103.167.204
@@ -13462,7 +13702,6 @@
  109.103.74.3
  109.104.162.96
  109.104.164.105
-109.104.197.153
  109.104.206.40
  109.104.243.204
  109.104.74.88
@@ -13471,26 +13710,26 @@
  109.105.195.250
  109.105.205.229
  109.105.205.230
-109.105.205.232
-109.105.242.31
  109.106.139.225
+109.107.85.110
  109.107.95.226
-109.108.166.51
-109.108.48.74
+109.108.136.103
  109.108.87.136
  109.108.88.156
  109.108.93.227
  109.110.128.241
  109.110.51.31
+109.110.52.77
  109.110.73.106
  109.110.81.90
  109.111.104.230
-109.111.144.220
+109.111.149.47
  109.111.162.10
  109.111.164.63
  109.111.190.65
  109.111.231.158
  109.111.237.38
+109.115.11.98
  109.115.117.189
  109.115.203.19
  109.115.243.142
@@ -13500,6 +13739,7 @@
  109.116.245.220
  109.116.245.80
  109.116.41.157
+109.116.41.170
  109.116.41.238
  109.116.7.179
  109.117.125.132
@@ -13513,6 +13753,7 @@
  109.117.52.47
  109.117.53.230
  109.118.112.147
+109.118.123.17
  109.120.141.160
  109.120.141.220
  109.120.144.247
@@ -13529,8 +13770,8 @@
  109.122.80.234
  109.122.81.1
  109.122.81.11
+109.122.81.9
  109.123.101.28
-109.123.102.209
  109.123.117.146
  109.123.118.162
  109.123.120.107
@@ -13538,6 +13779,7 @@
  109.123.66.206
  109.124.162.238
  109.124.65.86
+109.125.128.53
  109.125.131.162
  109.125.132.143
  109.125.133.156
@@ -13546,23 +13788,27 @@
  109.125.136.233
  109.125.137.170
  109.125.140.9
-109.125.160.13
  109.125.209.0
  109.125.218.134
  109.128.122.124
  109.129.18.13
  109.129.185.113
+109.13.179.195
  109.130.101.37
+109.130.41.110
  109.130.42.23
  109.130.46.33
  109.133.195.236
+109.133.31.73
+109.134.113.102
  109.134.232.81
+109.136.104.217
  109.136.135.101
+109.136.193.1
  109.136.220.23
  109.136.35.45
  109.147.219.51
  109.148.140.120
-109.148.94.176
  109.149.177.137
  109.151.179.17
  109.151.179.33
@@ -13570,8 +13816,12 @@
  109.154.168.97
  109.154.217.159
  109.154.217.177
+109.154.217.242
  109.156.113.47
+109.156.18.103
  109.157.133.203
+109.158.175.230
+109.160.22.211
  109.160.55.202
  109.160.72.219
  109.160.72.231
@@ -13587,50 +13837,43 @@
  109.162.240.106
  109.162.240.116
  109.162.240.119
-109.162.240.121
  109.162.240.130
  109.162.240.156
  109.162.240.171
  109.162.240.193
  109.162.240.214
  109.162.240.29
-109.162.240.47
  109.162.240.51
  109.162.240.65
  109.162.240.72
  109.162.240.86
  109.162.240.96
-109.162.241.122
+109.162.241.125
  109.162.241.177
  109.162.241.187
-109.162.241.232
  109.162.241.38
  109.162.241.60
  109.162.241.7
-109.162.241.8
+109.162.242.111
  109.162.242.129
  109.162.242.130
  109.162.242.153
  109.162.242.156
  109.162.242.161
+109.162.242.175
  109.162.242.214
  109.162.242.223
  109.162.242.225
-109.162.242.63
  109.162.242.8
  109.162.242.93
-109.162.242.96
  109.162.243.119
  109.162.243.131
-109.162.243.14
  109.162.243.17
+109.162.243.181
  109.162.243.183
  109.162.243.198
-109.162.243.206
-109.162.243.212
  109.162.243.6
  109.162.244.134
-109.162.244.141
  109.162.244.145
  109.162.244.149
  109.162.244.157
@@ -13638,60 +13881,44 @@
  109.162.244.190
  109.162.244.193
  109.162.244.211
-109.162.244.215
  109.162.244.243
  109.162.244.244
  109.162.244.47
-109.162.244.50
  109.162.244.71
  109.162.244.9
  109.162.244.97
+109.162.245.119
  109.162.245.13
  109.162.245.161
  109.162.245.163
  109.162.245.19
  109.162.245.198
-109.162.245.225
-109.162.245.240
  109.162.245.4
  109.162.245.42
-109.162.245.46
  109.162.245.56
  109.162.246.118
-109.162.246.130
  109.162.246.140
  109.162.246.144
  109.162.246.177
+109.162.246.21
  109.162.247.126
  109.162.247.185
  109.162.247.195
  109.162.247.224
-109.162.247.242
-109.162.247.48
-109.162.247.57
-109.162.247.60
-109.162.247.64
-109.162.248.116
+109.162.247.51
  109.162.248.127
  109.162.248.132
  109.162.248.148
  109.162.248.173
  109.162.248.191
-109.162.248.212
  109.162.248.215
-109.162.248.227
-109.162.248.32
-109.162.248.43
  109.162.248.44
-109.162.248.75
  109.162.249.11
  109.162.249.112
-109.162.249.116
+109.162.249.115
  109.162.249.118
  109.162.249.148
  109.162.249.183
-109.162.249.194
-109.162.249.243
  109.162.249.72
  109.162.249.78
  109.162.250.117
@@ -13701,7 +13928,6 @@
  109.162.251.105
  109.162.251.113
  109.162.251.127
-109.162.251.207
  109.162.251.215
  109.162.251.224
  109.162.251.24
@@ -13709,7 +13935,6 @@
  109.162.254.38
  109.162.35.86
  109.162.71.220
-109.163.177.47
  109.163.178.200
  109.163.218.22
  109.163.233.44
@@ -13720,14 +13945,9 @@
  109.164.5.222
  109.165.232.4
  109.165.235.186
-109.165.74.102
-109.166.140.243
-109.166.144.192
  109.166.167.101
  109.166.213.12
-109.166.70.166
  109.166.70.172
-109.166.83.250
  109.166.89.91
  109.167.132.201
  109.167.134.253
@@ -13740,11 +13960,10 @@
  109.167.249.41
  109.167.38.1
  109.168.109.50
-109.168.145.81
  109.168.27.35
+109.169.134.121
  109.169.20.168
  109.169.25.101
-109.169.29.232
  109.169.29.30
  109.169.33.163
  109.169.6.152
@@ -13769,12 +13988,12 @@
  109.173.17.154
  109.173.41.43
  109.173.41.95
-109.173.87.173
  109.174.10.11
  109.174.126.155
  109.174.19.134
  109.174.24.121
  109.175.10.239
+109.175.100.218
  109.175.155.94
  109.175.17.198
  109.177.45.207
@@ -13828,10 +14047,12 @@
  109.190.35.249
  109.191.194.31
  109.191.9.168
+109.192.64.231
  109.193.50.253
  109.193.77.109
  109.194.107.121
  109.194.162.252
+109.194.166.11
  109.194.17.181
  109.194.174.78
  109.194.175.108
@@ -13840,13 +14061,14 @@
  109.194.3.165
  109.195.115.13
  109.195.139.50
+109.195.179.129
  109.195.179.88
  109.195.194.79
  109.195.215.52
-109.195.23.113
  109.195.38.201
  109.195.83.165
  109.195.84.213
+109.196.172.252
  109.196.68.236
  109.196.82.214
  109.197.189.42
@@ -13870,6 +14092,7 @@
  109.200.132.161
  109.200.156.102
  109.200.165.213
+109.200.174.170
  109.200.24.116
  109.200.24.97
  109.200.24.98
@@ -13881,15 +14104,13 @@
  109.201.140.50
  109.201.140.9
  109.201.142.116
-109.201.178.8
  109.201.212.64
-109.201.34.49
-109.201.34.62
-109.201.39.6
+109.201.96.16
  109.201.96.222
  109.202.10.22
  109.202.107.147
  109.202.107.39
+109.202.111.231
  109.202.17.4
  109.202.28.247
  109.202.44.98
@@ -13897,19 +14118,17 @@
  109.205.113.134
  109.205.115.234
  109.205.45.246
-109.206.12.25
-109.206.13.74
  109.206.139.119
-109.206.15.94
  109.206.168.240
  109.206.245.10
  109.206.245.123
  109.206.246.149
-109.206.255.6
  109.207.102.183
  109.207.183.52
+109.207.186.155
  109.207.191.188
  109.207.191.44
+109.207.193.33
  109.207.193.46
  109.207.38.87
  109.207.46.111
@@ -13931,7 +14150,6 @@
  109.224.11.238
  109.224.12.170
  109.224.12.174
-109.224.12.58
  109.224.16.110
  109.224.22.34
  109.224.22.36
@@ -13959,20 +14177,24 @@
  109.227.63.3
  109.228.12.92
  109.228.157.237
+109.228.168.80
  109.228.21.246
  109.228.21.30
  109.228.46.119
  109.228.50.121
  109.228.53.116
+109.228.55.151
  109.228.56.55
  109.228.57.41
-109.229.167.172
  109.229.171.58
+109.229.20.239
  109.229.210.6
  109.229.29.99
  109.229.4.87
  109.229.69.158
+109.229.8.179
  109.230.162.45
+109.230.198.18
  109.230.199.69
  109.230.199.84
  109.230.218.110
@@ -13988,8 +14210,10 @@
  109.230.251.8
  109.230.67.162
  109.231.194.188
+109.231.63.227
  109.232.106.236
  109.232.109.58
+109.232.4.126
  109.233.212.105
  109.233.95.192
  109.234.112.206
@@ -14002,9 +14226,7 @@
  109.235.50.135
  109.235.69.120
  109.236.105.40
-109.236.180.67
  109.236.219.80
-109.236.52.115
  109.236.52.120
  109.236.52.198
  109.236.52.252
@@ -14046,10 +14268,14 @@
  109.238.223.67
  109.238.229.233
  109.238.230.42
+109.238.49.70
+109.239.211.17
+109.239.49.225
  109.239.58.52
  109.24.144.155
  109.24.243.250
  109.241.164.89
+109.241.98.147
  109.242.120.86
  109.242.127.121
  109.242.153.9
@@ -14058,6 +14284,7 @@
  109.242.205.251
  109.242.223.104
  109.244.102.25
+109.244.102.27
  109.244.103.150
  109.244.35.47
  109.244.35.48
@@ -14073,14 +14300,13 @@
  109.245.239.125
  109.245.241.89
  109.245.242.105
-109.246.112.28
  109.246.201.93
  109.247.106.144
  109.247.21.55
+109.247.48.107
  109.247.98.202
  109.248.11.115
  109.248.128.9
-109.248.129.241
  109.248.139.244
  109.248.142.99
  109.248.144.77
@@ -14095,18 +14321,19 @@
  109.248.203.27
  109.248.203.4
  109.248.203.69
+109.248.205.94
  109.248.206.13
  109.248.245.121
  109.248.55.51
  109.248.62.207
  109.248.9.32
  109.25.250.77
+109.250.139.108
  109.250.140.26
-109.250.142.168
  109.250.152.227
  109.250.154.210
  109.250.159.53
-109.250.244.221
+109.250.255.26
  109.251.247.240
  109.251.252.123
  109.251.68.112
@@ -14127,12 +14354,13 @@
  109.254.93.166
  109.255.152.153
  109.28.24.17
+109.31.131.82
  109.40.66.245
+109.41.129.108
  109.48.7.90
  109.49.172.172
  109.49.176.182
  109.50.204.198
-109.60.98.48
  109.61.10.121
  109.61.112.10
  109.61.112.33
@@ -14140,6 +14368,7 @@
  109.61.112.53
  109.61.14.0
  109.61.2.166
+109.61.200.92
  109.61.207.181
  109.62.161.3
  109.62.162.44
@@ -14150,19 +14379,16 @@
  109.64.231.189
  109.64.95.196
  109.64.95.221
-109.65.39.46
  109.65.4.202
  109.65.57.85
-109.66.192.152
  109.66.65.126
  109.66.73.46
-109.67.106.1
  109.67.73.190
  109.67.93.216
  109.68.189.22
  109.68.212.154
  109.68.212.165
-109.68.92.99
+109.68.43.23
  109.69.0.69
  109.69.1.178
  109.69.1.234
@@ -14217,7 +14443,6 @@
  109.70.100.60
  109.70.132.150
  109.70.189.51
-109.70.189.56
  109.70.189.70
  109.70.3.229
  109.70.36.102
@@ -14263,13 +14488,8 @@
  109.75.41.71
  109.75.42.231
  109.75.43.17
-109.75.51.212
-109.75.54.32
-109.75.62.2
  109.76.123.107
  109.76.76.211
-109.79.129.57
-109.79.13.121
  109.79.14.227
  109.80.128.210
  109.86.121.118
@@ -14289,11 +14509,12 @@
  109.87.131.244
  109.87.141.136
  109.87.143.67
+109.87.144.27
  109.87.172.204
  109.87.183.226
  109.87.20.125
  109.87.224.76
-109.87.40.23
+109.87.72.142
  109.87.78.144
  109.88.32.151
  109.89.132.126
@@ -14302,12 +14523,10 @@
  109.89.78.164
  109.9.175.65
  109.90.2.70
-109.91.245.71
  109.92.141.118
  109.92.142.106
  109.92.17.115
  109.92.176.217
-109.92.201.251
  109.92.202.222
  109.92.205.35
  109.92.222.102
@@ -14319,14 +14538,16 @@
  109.94.172.151
  109.94.172.195
  109.94.172.232
+109.94.172.50
  109.94.172.52
  109.94.172.70
  109.94.172.83
  109.94.172.95
+109.94.173.175
  109.94.182.128
  109.94.182.9
+109.94.209.93
  109.94.220.110
-109.94.220.153
  109.94.220.18
  109.94.220.212
  109.94.220.48
@@ -14335,15 +14556,18 @@
  109.94.220.58
  109.94.79.94
  109.95.145.172
+109.95.182.199
  109.95.219.239
  109.95.255.82
  109.95.38.206
+109.96.132.158
  109.96.177.2
  109.96.233.9
  109.96.57.246
  109.96.66.75
  109.97.116.131
  109.97.54.206
+109.98.161.88
  109.98.76.22
  109.99.109.236
  109.99.146.210
@@ -14395,27 +14619,36 @@
  110.10.179.65
  110.10.183.98
  110.12.143.150
+110.12.221.72
  110.12.64.96
+110.13.128.178
  110.132.199.200
  110.136.129.228
  110.136.207.150
+110.136.218.139
  110.136.241.180
-110.136.30.190
  110.136.50.250
+110.136.7.74
  110.137.194.135
  110.137.223.62
  110.137.77.19
+110.138.149.140
+110.138.149.179
+110.138.151.200
  110.138.194.10
  110.138.195.86
  110.138.199.109
+110.138.34.193
  110.139.121.16
  110.139.128.232
  110.139.183.12
  110.139.206.102
  110.139.24.72
+110.139.94.59
  110.14.163.111
  110.14.163.112
  110.14.184.43
+110.14.58.190
  110.140.161.226
  110.141.221.58
  110.141.249.250
@@ -14427,11 +14660,14 @@
  110.142.236.207
  110.143.221.124
  110.143.84.202
+110.144.5.59
+110.144.73.241
  110.145.101.66
  110.145.77.103
  110.15.30.241
  110.15.30.242
  110.15.56.173
+110.152.109.190
  110.153.13.20
  110.154.150.247
  110.154.175.68
@@ -14453,6 +14689,7 @@
  110.157.232.46
  110.157.28.43
  110.159.136.82
+110.159.19.154
  110.159.32.5
  110.159.75.142
  110.159.88.153
@@ -14474,9 +14711,12 @@
  110.165.19.77
  110.165.35.52
  110.165.37.61
+110.165.40.168
+110.165.40.40
  110.166.254.107
  110.166.254.112
  110.166.254.74
+110.166.254.76
  110.166.254.84
  110.166.87.119
  110.167.133.45
@@ -14496,13 +14736,14 @@
  110.17.41.183
  110.17.41.93
  110.17.42.234
-110.17.76.54
  110.170.254.50
  110.170.37.194
  110.170.65.146
-110.171.216.120
+110.171.101.128
+110.171.117.93
  110.171.226.67
  110.171.24.197
+110.171.29.226
  110.171.33.104
  110.172.147.35
  110.172.160.42
@@ -14519,6 +14760,7 @@
  110.174.3.2
  110.175.118.246
  110.175.128.62
+110.175.96.192
  110.177.12.230
  110.177.3.152
  110.177.4.131
@@ -14568,16 +14810,15 @@
  110.188.66.141
  110.189.104.54
  110.189.152.59
-110.189.201.118
  110.189.214.99
  110.189.215.148
  110.19.111.202
  110.19.243.1
  110.19.99.107
  110.19.99.9
-110.224.190.53
+110.224.210.131
+110.225.6.2
  110.227.118.199
-110.227.224.3
  110.227.238.26
  110.227.250.72
  110.228.160.191
@@ -14591,15 +14832,14 @@
  110.230.58.147
  110.230.97.122
  110.232.115.241
-110.232.248.62
  110.232.249.164
  110.232.249.177
  110.232.252.145
  110.232.252.206
+110.232.66.162
  110.232.74.55
  110.232.76.39
  110.232.76.94
-110.232.77.147
  110.232.78.221
  110.232.83.117
  110.232.86.168
@@ -14608,12 +14848,11 @@
  110.235.246.252
  110.235.247.1
  110.235.250.71
-110.235.253.184
  110.235.33.173
+110.235.65.178
  110.235.67.46
  110.235.85.110
  110.239.26.129
-110.240.169.55
  110.240.180.78
  110.240.205.93
  110.240.229.237
@@ -14629,6 +14868,7 @@
  110.244.158.234
  110.244.230.28
  110.244.234.152
+110.244.251.54
  110.244.254.123
  110.244.46.196
  110.246.104.29
@@ -14637,6 +14877,7 @@
  110.247.16.64
  110.247.161.122
  110.248.180.228
+110.248.216.91
  110.248.38.151
  110.249.137.131
  110.249.143.202
@@ -14672,7 +14913,6 @@
  110.32.165.79
  110.32.201.239
  110.33.254.100
-110.34.0.151
  110.34.110.129
  110.34.121.15
  110.34.122.196
@@ -14689,8 +14929,6 @@
  110.34.70.96
  110.35.11.212
  110.35.136.73
-110.35.145.127
-110.35.17.123
  110.35.200.29
  110.35.200.51
  110.35.204.152
@@ -14699,14 +14937,16 @@
  110.35.221.111
  110.35.221.134
  110.35.221.15
+110.35.225.22
  110.35.225.69
+110.35.227.100
  110.35.227.26
  110.35.232.81
  110.35.233.147
  110.35.234.192
-110.35.234.28
  110.35.235.57
  110.35.238.147
+110.35.238.9
  110.35.242.44
  110.35.245.16
  110.35.245.162
@@ -14722,7 +14962,6 @@
  110.36.216.218
  110.36.216.62
  110.36.218.194
-110.36.219.178
  110.36.220.101
  110.36.228.154
  110.36.228.178
@@ -14732,12 +14971,14 @@
  110.36.234.146
  110.36.239.218
  110.36.239.220
+110.37.207.186
  110.37.216.118
  110.37.223.142
  110.37.224.243
  110.37.225.74
  110.37.226.83
  110.37.227.139
+110.38.2.210
  110.38.28.91
  110.38.28.92
  110.39.128.134
@@ -14747,8 +14988,10 @@
  110.39.174.58
  110.39.187.254
  110.39.191.29
+110.39.199.89
  110.39.21.86
  110.39.23.154
+110.39.52.86
  110.4.27.27
  110.4.45.150
  110.40.13.121
@@ -14758,6 +15001,7 @@
  110.42.1.213
  110.42.10.141
  110.42.6.121
+110.42.66.111
  110.43.241.63
  110.43.40.146
  110.43.42.91
@@ -14765,12 +15009,14 @@
  110.43.49.148
  110.43.50.203
  110.43.52.158
+110.43.64.132
  110.43.64.162
  110.44.116.2
  110.44.117.232
  110.44.117.26
  110.44.122.76
  110.44.123.116
+110.44.124.224
  110.44.126.235
  110.44.236.131
  110.44.240.194
@@ -14780,12 +15026,12 @@
  110.44.240.202
  110.45.139.12
  110.45.145.165
+110.45.146.232
  110.45.146.84
  110.45.147.246
  110.45.147.248
  110.45.147.77
  110.45.155.101
-110.45.178.214
  110.45.4.221
  110.46.12.14
  110.46.12.15
@@ -14806,9 +15052,9 @@
  110.49.167.189
  110.49.47.242
  110.49.60.66
+110.49.71.143
  110.5.102.238
  110.5.21.58
-110.5.74.234
  110.50.50.181
  110.50.52.65
  110.50.53.11
@@ -14818,10 +15064,10 @@
  110.50.84.5
  110.50.85.103
  110.50.85.162
+110.51.148.228
  110.52.132.227
  110.52.145.234
  110.52.215.119
-110.52.223.243
  110.52.230.57
  110.52.27.102
  110.52.28.111
@@ -14836,7 +15082,6 @@
  110.52.29.116
  110.52.29.126
  110.52.29.128
-110.52.29.134
  110.52.29.139
  110.52.29.171
  110.52.29.176
@@ -14849,9 +15094,7 @@
  110.53.205.126
  110.54.126.94
  110.54.134.15
-110.54.159.246
  110.54.160.7
-110.54.245.130
  110.54.33.157
  110.55.117.248
  110.6.28.206
@@ -14894,7 +15137,6 @@
  110.77.145.5
  110.77.148.50
  110.77.148.62
-110.77.149.221
  110.77.149.227
  110.77.154.170
  110.77.154.185
@@ -14902,48 +15144,46 @@
  110.77.159.198
  110.77.161.153
  110.77.162.67
-110.77.167.85
+110.77.163.13
  110.77.168.71
-110.77.170.28
  110.77.171.22
-110.77.171.24
  110.77.173.178
  110.77.180.194
  110.77.180.69
+110.77.181.76
  110.77.184.122
  110.77.184.167
+110.77.184.214
  110.77.184.54
  110.77.184.92
  110.77.189.93
-110.77.196.16
  110.77.204.47
+110.77.207.163
  110.77.215.130
  110.77.217.238
+110.77.217.240
  110.77.217.30
  110.77.226.169
-110.77.226.205
  110.77.226.221
  110.77.226.85
-110.77.228.70
  110.77.232.226
-110.77.232.250
  110.77.232.49
  110.77.235.120
+110.77.235.85
  110.77.236.106
  110.77.236.121
-110.77.236.75
  110.77.240.101
  110.77.240.174
  110.77.241.89
-110.77.242.163
  110.77.242.59
  110.77.242.85
+110.77.244.167
  110.77.244.176
  110.77.246.175
+110.77.246.3
  110.77.246.83
+110.77.246.84
  110.77.248.156
-110.77.248.27
-110.77.248.92
  110.77.250.185
  110.78.114.236
  110.78.136.153
@@ -14955,30 +15195,31 @@
  110.78.143.184
  110.78.143.222
  110.78.145.23
+110.78.145.31
  110.78.145.69
  110.78.145.9
  110.78.146.202
  110.78.148.144
  110.78.148.249
+110.78.148.68
  110.78.149.11
  110.78.149.120
-110.78.149.184
  110.78.149.202
-110.78.149.221
+110.78.149.248
  110.78.149.43
  110.78.149.85
  110.78.152.173
  110.78.152.237
-110.78.153.12
+110.78.152.85
+110.78.153.119
  110.78.153.120
  110.78.153.228
  110.78.153.23
  110.78.153.81
+110.78.154.18
  110.78.154.199
-110.78.154.37
  110.78.154.46
  110.78.154.89
-110.78.155.16
  110.78.158.221
  110.78.159.175
  110.78.159.19
@@ -14994,10 +15235,9 @@
  110.78.172.90
  110.78.173.103
  110.78.173.198
-110.78.173.215
  110.78.177.124
-110.78.178.87
  110.78.179.121
+110.78.179.140
  110.78.179.191
  110.78.186.122
  110.78.186.130
@@ -15007,48 +15247,48 @@
  110.78.186.207
  110.78.186.238
  110.78.186.53
+110.78.186.66
  110.78.20.62
  110.78.23.220
  110.78.4.26
  110.8.67.146
  110.8.71.166
  110.8.84.231
+110.80.142.84
  110.80.142.88
+110.81.182.33
  110.82.18.16
  110.83.152.133
  110.83.152.224
-110.83.154.46
  110.83.154.99
+110.83.165.155
+110.83.17.167
  110.83.32.243
  110.83.32.25
  110.83.32.4
+110.83.40.24
  110.83.51.25
-110.84.220.174
  110.84.221.162
  110.84.221.182
-110.85.172.223
-110.85.180.53
  110.85.216.186
  110.85.5.210
  110.85.99.220
  110.86.173.135
+110.86.181.86
  110.86.7.82
-110.87.1.170
  110.87.106.44
  110.87.12.192
-110.87.13.32
  110.87.26.135
  110.87.32.241
  110.87.34.53
  110.87.56.139
  110.87.56.192
-110.88.127.191
  110.88.160.179
  110.88.160.233
  110.89.158.158
  110.90.105.75
-110.90.179.111
  110.90.99.57
+110.92.64.241
  110.93.13.182
  110.93.13.190
  110.93.13.233
@@ -15059,13 +15299,13 @@
  110.93.214.37
  110.93.219.122
  110.93.219.91
-110.93.226.48
  110.93.230.109
+110.93.236.169
  110.93.240.71
  110.93.246.222
  110.93.247.91
  110.93.87.254
-111.0.123.228
+111.0.120.89
  111.0.123.230
  111.0.123.73
  111.0.124.124
@@ -15073,7 +15313,6 @@
  111.1.184.250
  111.1.62.189
  111.10.19.16
-111.108.18.89
  111.11.107.130
  111.11.117.90
  111.11.30.189
@@ -15081,7 +15320,6 @@
  111.113.2.158
  111.115.196.26
  111.115.196.79
-111.118.103.146
  111.118.105.57
  111.118.108.122
  111.118.111.207
@@ -15098,7 +15336,7 @@
  111.118.144.230
  111.118.150.193
  111.118.152.155
-111.118.153.208
+111.118.155.61
  111.118.171.103
  111.118.28.52
  111.118.32.162
@@ -15121,8 +15359,7 @@
  111.118.88.61
  111.118.9.16
  111.118.96.2
-111.119.177.0
-111.119.187.0
+111.118.96.76
  111.119.210.10
  111.119.218.179
  111.119.233.65
@@ -15132,6 +15369,7 @@
  111.12.121.37
  111.12.191.180
  111.120.16.2
+111.121.110.139
  111.121.192.228
  111.122.15.139
  111.122.175.73
@@ -15145,7 +15383,8 @@
  111.124.98.157
  111.124.99.244
  111.124.99.72
-111.125.108.43
+111.125.108.227
+111.125.108.65
  111.125.110.154
  111.125.143.143
  111.125.230.46
@@ -15156,12 +15395,12 @@
  111.125.88.188
  111.127.253.95
  111.127.255.25
-111.127.43.25
  111.13.102.195
  111.132.5.0
  111.132.5.132
  111.14.221.8
  111.14.222.130
+111.15.92.164
  111.160.112.142
  111.160.124.194
  111.160.231.251
@@ -15176,10 +15415,10 @@
  111.161.74.117
  111.161.74.118
  111.161.74.125
-111.162.103.110
+111.162.224.162
+111.164.173.131
  111.164.177.13
  111.164.184.156
-111.164.186.47
  111.164.236.36
  111.165.223.102
  111.165.242.26
@@ -15201,10 +15440,9 @@
  111.17.223.104
  111.170.81.217
  111.170.84.18
-111.170.85.194
  111.170.85.31
+111.170.87.17
  111.172.180.125
-111.172.37.128
  111.172.98.121
  111.172.99.239
  111.175.145.8
@@ -15213,8 +15451,6 @@
  111.175.35.199
  111.175.85.55
  111.175.92.140
-111.176.239.230
-111.176.250.4
  111.176.46.94
  111.177.114.5
  111.177.175.77
@@ -15227,9 +15463,7 @@
  111.177.32.73
  111.177.9.174
  111.178.149.162
-111.179.38.202
-111.179.77.186
-111.18.81.219
+111.179.115.13
  111.180.106.160
  111.180.108.79
  111.180.24.216
@@ -15244,6 +15478,7 @@
  111.185.125.139
  111.185.126.245
  111.185.171.248
+111.185.174.175
  111.185.174.4
  111.185.177.109
  111.185.19.107
@@ -15251,10 +15486,9 @@
  111.185.227.40
  111.185.231.6
  111.185.234.27
+111.185.242.48
  111.185.27.9
-111.185.4.94
  111.185.40.23
-111.185.6.233
  111.185.62.40
  111.186.57.17
  111.187.45.87
@@ -15274,7 +15508,6 @@
  111.19.255.9
  111.19.83.225
  111.192.188.97
-111.192.209.209
  111.192.212.10
  111.192.82.28
  111.194.218.71
@@ -15284,7 +15517,9 @@
  111.194.233.46
  111.194.56.153
  111.196.189.163
-111.197.60.30
+111.197.61.124
+111.197.61.58
+111.197.62.185
  111.198.190.132
  111.198.3.45
  111.198.3.54
@@ -15294,14 +15529,14 @@
  111.2.188.193
  111.20.111.194
  111.20.159.74
-111.20.190.44
+111.20.190.40
  111.20.195.30
-111.20.200.22
  111.20.52.198
  111.200.197.227
  111.200.216.72
  111.200.244.226
  111.200.54.113
+111.201.129.190
  111.201.49.57
  111.202.12.190
  111.202.133.66
@@ -15335,7 +15570,14 @@
  111.206.170.115
  111.206.170.119
  111.206.170.99
+111.206.198.105
+111.206.198.50
+111.206.198.78
+111.206.221.17
+111.206.221.4
+111.206.221.94
  111.206.86.147
+111.206.86.149
  111.206.87.226
  111.207.1.151
  111.207.1.209
@@ -15346,6 +15588,7 @@
  111.207.167.147
  111.207.167.151
  111.207.182.2
+111.207.197.195
  111.207.231.250
  111.207.36.124
  111.207.49.186
@@ -15361,32 +15604,41 @@
  111.22.215.116
  111.22.216.175
  111.22.3.148
+111.223.1.156
+111.223.103.210
  111.223.140.116
  111.223.3.83
  111.223.34.205
  111.223.40.158
  111.223.49.131
  111.223.49.147
+111.223.52.228
  111.223.67.201
  111.223.68.56
  111.223.90.7
  111.224.127.188
-111.224.166.156
-111.224.167.243
-111.224.167.40
+111.224.166.154
+111.224.166.189
+111.224.166.248
+111.224.166.41
+111.224.166.48
+111.224.167.249
  111.224.205.194
  111.224.52.35
+111.224.53.233
  111.224.53.24
  111.225.144.216
  111.225.205.11
  111.225.206.142
  111.225.216.67
+111.225.216.70
+111.225.222.236
  111.225.239.156
+111.225.255.172
  111.225.36.6
  111.225.90.244
  111.225.95.4
  111.226.191.185
-111.226.232.123
  111.227.197.155
  111.227.197.33
  111.227.231.122
@@ -15400,6 +15652,7 @@
  111.229.103.45
  111.229.104.94
  111.229.105.245
+111.229.108.132
  111.229.108.188
  111.229.109.26
  111.229.110.107
@@ -15414,19 +15667,21 @@
  111.229.124.151
  111.229.124.215
  111.229.128.136
+111.229.128.34
  111.229.128.9
  111.229.129.100
  111.229.129.176
  111.229.129.64
  111.229.13.242
  111.229.130.46
+111.229.131.83
  111.229.132.128
  111.229.132.48
  111.229.134.68
  111.229.135.152
+111.229.136.177
  111.229.137.10
  111.229.137.13
-111.229.139.252
  111.229.139.95
  111.229.141.64
  111.229.142.192
@@ -15436,6 +15691,7 @@
  111.229.148.198
  111.229.148.96
  111.229.155.183
+111.229.155.209
  111.229.156.243
  111.229.156.53
  111.229.157.73
@@ -15455,6 +15711,7 @@
  111.229.168.229
  111.229.170.89
  111.229.171.178
+111.229.174.65
  111.229.176.206
  111.229.176.60
  111.229.177.38
@@ -15484,6 +15741,7 @@
  111.229.206.250
  111.229.208.88
  111.229.21.39
+111.229.211.16
  111.229.211.5
  111.229.211.66
  111.229.212.104
@@ -15495,6 +15753,7 @@
  111.229.218.60
  111.229.219.39
  111.229.220.11
+111.229.222.112
  111.229.222.118
  111.229.222.7
  111.229.224.121
@@ -15518,6 +15777,8 @@
  111.229.244.205
  111.229.245.135
  111.229.246.59
+111.229.248.168
+111.229.248.87
  111.229.249.75
  111.229.250.170
  111.229.251.35
@@ -15528,6 +15789,7 @@
  111.229.253.8
  111.229.254.17
  111.229.26.25
+111.229.27.134
  111.229.27.180
  111.229.27.225
  111.229.28.34
@@ -15546,11 +15808,14 @@
  111.229.4.66
  111.229.41.2
  111.229.41.20
+111.229.43.185
+111.229.43.27
  111.229.44.68
  111.229.48.141
  111.229.49.165
  111.229.49.48
  111.229.50.131
+111.229.50.25
  111.229.53.186
  111.229.57.21
  111.229.57.3
@@ -15560,6 +15825,7 @@
  111.229.61.82
  111.229.63.21
  111.229.63.223
+111.229.64.212
  111.229.65.34
  111.229.67.3
  111.229.68.113
@@ -15568,6 +15834,7 @@
  111.229.73.244
  111.229.74.209
  111.229.74.27
+111.229.75.27
  111.229.76.117
  111.229.76.239
  111.229.78.120
@@ -15575,19 +15842,17 @@
  111.229.78.199
  111.229.78.212
  111.229.79.17
-111.229.81.5
  111.229.84.77
  111.229.85.164
  111.229.85.222
  111.229.89.86
-111.229.90.123
  111.229.92.17
  111.229.92.95
  111.229.93.104
  111.229.95.77
+111.229.96.67
  111.229.99.165
-111.23.173.218
-111.23.173.234
+111.23.117.219
  111.23.180.150
  111.23.253.213
  111.23.58.253
@@ -15596,9 +15861,11 @@
  111.230.141.155
  111.230.146.246
  111.230.148.82
+111.230.151.123
  111.230.151.13
  111.230.157.123
  111.230.157.219
+111.230.167.137
  111.230.170.95
  111.230.174.114
  111.230.179.116
@@ -15607,6 +15874,7 @@
  111.230.19.79
  111.230.197.61
  111.230.204.113
+111.230.206.15
  111.230.206.161
  111.230.209.21
  111.230.210.140
@@ -15616,14 +15884,16 @@
  111.230.221.203
  111.230.226.124
  111.230.231.145
-111.230.231.196
+111.230.233.91
  111.230.241.110
  111.230.244.13
  111.230.247.243
+111.230.248.93
  111.230.25.75
  111.230.29.17
  111.230.56.118
  111.230.67.250
+111.230.73.133
  111.230.90.144
  111.230.92.241
  111.231.103.64
@@ -15640,12 +15910,15 @@
  111.231.137.83
  111.231.140.184
  111.231.141.141
+111.231.143.71
+111.231.145.104
  111.231.145.199
  111.231.164.168
  111.231.18.208
  111.231.19.44
  111.231.190.106
-111.231.192.88
+111.231.192.209
+111.231.193.72
  111.231.195.159
  111.231.198.139
  111.231.199.243
@@ -15658,12 +15931,13 @@
  111.231.223.88
  111.231.225.87
  111.231.226.216
-111.231.226.65
  111.231.226.87
  111.231.228.239
  111.231.231.22
  111.231.237.27
  111.231.238.159
+111.231.253.134
+111.231.32.127
  111.231.33.135
  111.231.33.19
  111.231.34.252
@@ -15674,6 +15948,7 @@
  111.231.54.33
  111.231.55.75
  111.231.57.126
+111.231.61.15
  111.231.62.191
  111.231.62.217
  111.231.63.14
@@ -15687,6 +15962,7 @@
  111.231.79.227
  111.231.82.143
  111.231.87.204
+111.231.87.209
  111.231.88.39
  111.231.88.87
  111.231.89.140
@@ -15698,6 +15974,8 @@
  111.235.65.211
  111.241.164.110
  111.241.167.13
+111.241.185.134
+111.241.193.175
  111.241.198.251
  111.241.20.165
  111.241.22.206
@@ -15707,7 +15985,6 @@
  111.242.50.224
  111.242.60.115
  111.243.110.100
-111.243.206.9
  111.243.90.102
  111.246.151.202
  111.246.29.10
@@ -15717,10 +15994,12 @@
  111.246.93.28
  111.248.161.104
  111.248.164.171
+111.248.201.122
  111.248.56.99
  111.249.11.149
  111.249.15.37
  111.249.44.103
+111.25.126.227
  111.250.128.211
  111.250.16.172
  111.250.179.93
@@ -15737,15 +16016,16 @@
  111.251.31.2
  111.251.40.221
  111.251.58.251
+111.251.76.68
  111.251.84.50
  111.252.122.155
  111.252.148.110
  111.252.155.184
-111.252.197.77
  111.252.248.106
  111.252.41.33
  111.252.46.220
  111.252.48.44
+111.252.55.68
  111.253.129.149
  111.253.37.45
  111.253.84.46
@@ -15761,7 +16041,6 @@
  111.255.19.159
  111.255.26.98
  111.255.27.231
-111.255.3.228
  111.255.37.224
  111.255.4.122
  111.255.71.226
@@ -15777,7 +16056,6 @@
  111.26.116.167
  111.26.162.147
  111.26.163.175
-111.26.163.176
  111.26.169.130
  111.26.181.223
  111.26.192.91
@@ -15793,6 +16071,7 @@
  111.30.114.22
  111.30.34.48
  111.30.35.162
+111.30.78.12
  111.30.98.26
  111.31cf4fdae.com
  111.32.157.131
@@ -15817,7 +16096,6 @@
  111.38.104.165
  111.38.106.128
  111.38.106.19
-111.38.106.48
  111.38.107.15
  111.38.117.97
  111.38.120.224
@@ -15828,8 +16106,8 @@
  111.38.121.228
  111.38.123.136
  111.38.123.15
+111.38.123.158
  111.38.123.171
-111.38.123.18
  111.38.123.197
  111.38.123.23
  111.38.13.156
@@ -15856,9 +16134,11 @@
  111.38.8.81
  111.38.9.114
  111.38.9.115
+111.39.109.29
  111.39.13.152
  111.39.13.153
  111.39.188.124
+111.39.219.222
  111.39.38.6
  111.39.40.170
  111.39.88.92
@@ -15870,6 +16150,8 @@
  111.40.161.105
  111.40.161.166
  111.40.161.212
+111.40.161.236
+111.40.161.242
  111.40.161.79
  111.40.165.46
  111.40.174.135
@@ -15877,6 +16159,7 @@
  111.40.217.92
  111.40.28.177
  111.40.3.34
+111.40.50.116
  111.40.7.67
  111.40.7.84
  111.40.7.85
@@ -15942,10 +16225,12 @@
  111.43.223.59
  111.43.223.80
  111.43.3.36
+111.43.41.40
  111.43.41.78
  111.43.96.51
  111.44.164.66
  111.47.171.44
+111.47.18.22
  111.47.22.111
  111.47.28.239
  111.47.84.248
@@ -15953,6 +16238,7 @@
  111.48.129.253
  111.48.132.225
  111.50.1.149
+111.50.30.110
  111.53.119.184
  111.53.120.12
  111.53.13.253
@@ -15965,19 +16251,20 @@
  111.56.143.94
  111.56.37.46
  111.56.41.37
+111.56.41.84
  111.56.44.126
  111.56.57.180
  111.56.57.75
  111.56.79.217
  111.56.79.25
  111.56.79.52
-111.56.79.73
  111.57.0.90
  111.59.149.75
  111.59.156.196
  111.59.174.46
  111.59.184.172
  111.59.189.75
+111.59.40.20
  111.59.62.21
  111.59.65.15
  111.59.67.40
@@ -15989,8 +16276,8 @@
  111.6.78.17
  111.6.79.58
  111.6.96.72
+111.61.100.89
  111.61.101.86
-111.61.177.158
  111.61.196.113
  111.61.223.67
  111.61.234.47
@@ -16000,6 +16287,7 @@
  111.61.77.228
  111.61.77.89
  111.61.81.13
+111.62.40.36
  111.62.81.15
  111.63.21.98
  111.63.22.72
@@ -16020,7 +16308,7 @@
  111.67.196.227
  111.67.198.184
  111.67.199.130
-111.67.199.142
+111.67.199.99
  111.67.20.202
  111.67.200.148
  111.67.201.13
@@ -16030,10 +16318,12 @@
  111.67.202.240
  111.67.202.37
  111.67.203.82
+111.67.204.109
  111.67.204.137
  111.67.204.202
  111.67.204.220
  111.67.205.129
+111.67.206.248
  111.67.207.154
  111.67.207.160
  111.67.207.218
@@ -16050,6 +16340,8 @@
  111.68.105.76
  111.68.108.116
  111.68.117.164
+111.68.118.132
+111.68.15.174
  111.68.15.226
  111.68.2.58
  111.68.27.38
@@ -16073,14 +16365,10 @@
  111.70.4.193
  111.70.8.33
  111.72.193.121
-111.72.193.58
-111.72.193.9
-111.72.194.245
-111.72.194.247
  111.72.194.35
-111.72.194.61
+111.72.195.44
  111.72.195.91
-111.72.196.192
+111.72.196.90
  111.73.0.157
  111.73.0.254
  111.73.45.204
@@ -16092,20 +16380,17 @@
  111.75.137.163
  111.75.149.176
  111.75.149.221
-111.75.164.130
  111.75.164.132
  111.75.164.133
  111.75.164.134
  111.75.164.136
-111.75.164.137
  111.75.164.138
  111.75.164.139
  111.75.164.141
  111.75.164.142
  111.75.164.145
-111.75.164.146
+111.75.164.147
  111.75.164.149
-111.75.164.150
  111.75.164.156
  111.75.164.157
  111.75.164.158
@@ -16122,7 +16407,6 @@
  111.77.250.205
  111.77.250.65
  111.77.251.94
-111.77.76.123
  111.78.210.191
  111.79.197.173
  111.79.45.186
@@ -16195,6 +16479,7 @@
  111.93.10.213
  111.93.109.98
  111.93.121.26
+111.93.126.214
  111.93.145.20
  111.93.169.90
  111.93.17.6
@@ -16204,6 +16489,7 @@
  111.93.203.206
  111.93.205.186
  111.93.206.26
+111.93.214.67
  111.93.235.74
  111.93.24.98
  111.93.244.230
@@ -16216,6 +16502,7 @@
  111.95.152.49
  111.95.17.87
  111.95.174.139
+111.95.19.231
  111.95.203.73
  111.95.27.103
  111.95.27.177
@@ -16232,6 +16519,7 @@
  112-111-vip888.com
  112-365.net
  112.1.148.88
+112.1.17.70
  112.101.100.104
  112.101.75.86
  112.102.207.101
@@ -16253,7 +16541,6 @@
  112.105.57.190
  112.105.63.232
  112.105.8.18
-112.106.145.190
  112.109.130.92
  112.109.198.105
  112.109.198.106
@@ -16282,7 +16569,6 @@
  112.115.247.130
  112.115.34.112
  112.115.51.115
-112.115.88.238
  112.116.119.218
  112.116.125.77
  112.116.155.205
@@ -16300,7 +16586,6 @@
  112.118.222.100
  112.118.227.201
  112.118.236.220
-112.118.237.153
  112.118.4.167
  112.118.40.29
  112.118.41.200
@@ -16311,8 +16596,8 @@
  112.119.201.17
  112.119.212.25
  112.119.219.173
+112.119.240.159
  112.119.241.152
-112.119.28.92
  112.119.32.213
  112.119.36.199
  112.119.84.20
@@ -16320,6 +16605,7 @@
  112.12.35.85
  112.12.63.62
  112.120.122.100
+112.120.122.228
  112.120.122.53
  112.120.128.28
  112.120.134.121
@@ -16330,7 +16616,7 @@
  112.120.179.56
  112.120.18.227
  112.120.212.195
-112.120.244.108
+112.120.218.161
  112.120.70.203
  112.120.75.125
  112.120.77.3
@@ -16339,13 +16625,11 @@
  112.121.184.244
  112.121.184.245
  112.121.247.212
-112.122.1.34
  112.122.102.136
  112.122.166.213
  112.122.189.40
  112.122.189.52
  112.122.189.8
-112.122.5.13
  112.122.5.6
  112.122.58.155
  112.122.58.205
@@ -16376,6 +16660,7 @@
  112.13.101.81
  112.13.203.76
  112.13.88.4
+112.13.91.29
  112.132.0.20
  112.132.0.7
  112.132.144.159
@@ -16389,22 +16674,19 @@
  112.133.187.188
  112.133.192.211
  112.133.192.83
+112.133.192.86
  112.133.194.62
  112.133.197.113
  112.133.206.138
  112.133.206.59
  112.133.209.52
-112.133.215.202
  112.133.219.167
-112.133.222.151
  112.133.222.158
  112.133.232.135
  112.133.232.137
-112.133.236.67
-112.133.239.121
  112.133.243.242
  112.133.244.169
-112.133.244.186
+112.133.244.17
  112.133.254.146
  112.134.70.134
  112.135.192.139
@@ -16416,7 +16698,6 @@
  112.137.129.111
  112.137.164.101
  112.137.95.27
-112.138.81.2
  112.14.158.86
  112.14.184.94
  112.14.3.200
@@ -16433,11 +16714,13 @@
  112.145.210.253
  112.146.109.19
  112.146.109.225
+112.149.179.68
  112.15.38.248
  112.15.9.120
  112.15.9.53
  112.15.95.244
  112.153.124.112
+112.154.208.134
  112.154.4.155
  112.155.200.108
  112.155.3.177
@@ -16459,6 +16742,7 @@
  112.160.232.174
  112.160.234.183
  112.160.238.138
+112.160.246.149
  112.160.3.153
  112.160.86.34
  112.160.98.119
@@ -16467,6 +16751,7 @@
  112.161.171.243
  112.161.211.65
  112.161.220.223
+112.161.223.69
  112.161.236.76
  112.161.4.45
  112.161.97.145
@@ -16530,6 +16815,7 @@
  112.167.229.237
  112.167.37.73
  112.167.40.36
+112.167.76.55
  112.167.96.77
  112.168.0.84
  112.168.0.84bin.sh
@@ -16540,7 +16826,7 @@
  112.168.22.115
  112.168.228.254
  112.168.251.132
-112.169.121.50
+112.168.53.22
  112.169.231.236
  112.169.86.110
  112.17.104.45
@@ -16591,11 +16877,14 @@
  112.171.241.251
  112.171.245.26
  112.171.247.182
+112.171.26.46
  112.171.90.93
  112.172.13.40
  112.172.135.239
  112.172.139.163
+112.172.147.34
  112.172.173.99
+112.172.27.129
  112.172.54.157
  112.172.58.137
  112.172.6.167
@@ -16606,12 +16895,14 @@
  112.173.217.111
  112.173.232.73
  112.173.67.170
+112.173.84.3
  112.173.86.170
  112.173.87.94
  112.175.137.20
  112.175.184.36
  112.175.232.169
  112.18.27.169
+112.18.69.127
  112.184.104.55
  112.184.121.250
  112.184.16.186
@@ -16619,8 +16910,10 @@
  112.184.17.241
  112.184.179.48
  112.184.206.118
+112.184.214.127
  112.184.222.89
  112.184.232.127
+112.184.50.14
  112.185.115.55
  112.185.128.94
  112.185.168.194
@@ -16638,7 +16931,6 @@
  112.186.124.197
  112.186.175.233
  112.186.199.93
-112.186.223.186
  112.186.228.208
  112.186.228.30
  112.186.3.67
@@ -16659,17 +16951,16 @@
  112.187.240.211
  112.187.40.175
  112.187.6.59
+112.187.63.245
  112.187.84.75
  112.187.85.244
  112.187.90.195
  112.19.174.226
  112.192.159.136
  112.192.159.4
-112.192.160.11
-112.192.160.125
-112.192.160.30
+112.192.160.117
  112.192.160.46
-112.192.161.58
+112.192.161.70
  112.192.195.203
  112.192.199.111
  112.194.135.241
@@ -16711,6 +17002,7 @@
  112.198.246.75
  112.198.64.19
  112.198.77.219
+112.199.112.42
  112.199.118.195
  112.199.131.158
  112.199.131.244
@@ -16723,26 +17015,35 @@
  112.199.65.118
  112.199.76.44
  112.199.98.42
+112.2.219.4
+112.2.31.228
  112.2.45.2
+112.200.98.112
  112.201.176.54
+112.201.66.149
  112.201.91.20
  112.202.160.210
-112.202.17.190
+112.202.201.136
  112.202.208.124
  112.202.39.210
+112.202.58.181
  112.203.97.204
  112.204.183.90
+112.204.83.191
  112.205.132.16
+112.205.209.168
  112.206.16.237
  112.206.176.10
  112.206.85.168
  112.207.220.102
  112.207.248.247
  112.207.254.54
+112.207.97.148
  112.208.72.136
  112.21.162.146
  112.21.162.150
  112.21.188.235
+112.21.191.10
  112.21.191.244
  112.210.59.106
  112.211.40.49
@@ -16765,6 +17066,7 @@
  112.213.97.105
  112.213.97.106
  112.213.99.227
+112.213.99.83
  112.214.127.42bin.sh
  112.214.132.53
  112.214.41.221
@@ -16772,8 +17074,8 @@
  112.215.113.10
  112.215.113.11
  112.215.205.236
+112.215.243.212
  112.216.153.186
-112.216.226.146
  112.216.3.211
  112.216.39.234
  112.216.64.163
@@ -16784,6 +17086,7 @@
  112.217.188.122
  112.217.207.130
  112.217.225.146
+112.217.226.146
  112.217.41.237
  112.218.127.140
  112.218.129.11
@@ -16815,13 +17118,13 @@
  112.225.103.205
  112.225.110.223
  112.225.15.207
-112.225.151.95
  112.225.172.13
  112.225.186.20
  112.225.19.143
  112.225.197.116
  112.225.201.221
  112.225.204.1
+112.225.208.14
  112.225.217.4
  112.225.232.96
  112.225.28.70
@@ -16871,7 +17174,7 @@
  112.228.178.129
  112.228.203.223
  112.228.65.134
-112.228.69.110
+112.228.96.135
  112.228.96.209
  112.229.109.162
  112.229.14.49
@@ -16900,6 +17203,7 @@
  112.232.194.101
  112.233.118.239
  112.233.248.5
+112.233.252.103
  112.233.61.230bin.sh
  112.233.88.214
  112.233.93.88
@@ -16912,10 +17216,12 @@
  112.235.234.75
  112.235.248.255
  112.235.42.117
+112.235.69.186
  112.235.94.79
  112.236.188.131
  112.236.60.218
  112.236.63.166
+112.236.99.252
  112.237.105.199
  112.237.125.95
  112.237.127.98
@@ -16925,15 +17231,15 @@
  112.237.137.10
  112.237.14.15
  112.237.140.181
-112.237.151.39
+112.237.141.149
  112.237.156.48
-112.237.159.207
  112.237.168.233
  112.237.168.32
  112.237.169.112
  112.237.17.226bin.sh
+112.237.18.247
  112.237.182.149
-112.237.20.189
+112.237.192.164
  112.237.202.108
  112.237.21.147
  112.237.210.126
@@ -16944,7 +17250,6 @@
  112.237.225.100
  112.237.25.84
  112.237.4.196
-112.237.42.117
  112.237.53.242
  112.237.62.183
  112.237.64.67
@@ -16973,6 +17278,7 @@
  112.238.188.180
  112.238.194.102
  112.238.196.43
+112.238.198.123
  112.238.199.143
  112.238.207.23
  112.238.21.170
@@ -16998,7 +17304,6 @@
  112.240.173.23
  112.240.248.45
  112.240.249.198
-112.240.253.139
  112.240.253.174
  112.240.253.5
  112.241.120.225
@@ -17029,32 +17334,30 @@
  112.242.58.230
  112.242.6.180
  112.242.62.171
+112.242.66.248
  112.242.76.197
  112.242.76.95
  112.242.81.11
  112.242.86.48
  112.242.93.89
  112.242.99.130
+112.243.153.234
  112.243.167.181
  112.243.171.121
  112.243.218.135
  112.243.236.14
-112.243.95.153
  112.244.215.200
  112.245.108.219
  112.245.115.241
  112.245.148.223
-112.245.177.136
  112.245.215.249
  112.245.4.132
-112.245.45.7
  112.245.51.48
  112.245.94.205
  112.246.124.14
  112.246.16.56
  112.246.160.53
  112.246.184.97
-112.246.185.186
  112.246.23.73
  112.246.248.227
  112.246.42.101
@@ -17065,6 +17368,7 @@
  112.247.191.75
  112.247.191.75bin.sh
  112.247.203.10
+112.247.208.124
  112.247.211.180
  112.247.248.114
  112.247.80.248
@@ -17091,6 +17395,7 @@
  112.248.75.18
  112.248.85.54
  112.249.114.118
+112.249.116.109
  112.249.184.199
  112.249.194.167
  112.249.204.12
@@ -17100,10 +17405,8 @@
  112.249.239.146
  112.249.239.249
  112.249.243.254
-112.249.254.40
  112.249.27.67
  112.249.34.188
-112.249.40.91
  112.249.44.140
  112.249.6.100
  112.249.6.180
@@ -17117,7 +17420,6 @@
  112.25.11.42
  112.25.138.6
  112.25.170.221
-112.25.178.214
  112.25.184.142
  112.25.208.10
  112.25.72.56
@@ -17127,13 +17429,12 @@
  112.250.159.120
  112.250.201.156
  112.250.51.167
-112.250.69.74
  112.250.80.39
  112.250.84.109
-112.251.174.77
+112.251.220.114
  112.251.52.42
+112.252.166.193
  112.252.213.72
-112.252.220.249
  112.252.239.125
  112.252.239.36
  112.252.33.173
@@ -17181,7 +17482,6 @@
  112.255.84.55
  112.255.86.179
  112.255.87.124
-112.255.87.203
  112.255.92.233
  112.26.113.106
  112.26.160.67
@@ -17332,6 +17632,7 @@
  112.29.174.240
  112.29.174.55
  112.29.174.80
+112.29.238.18
  112.29.66.53
  112.3.20.155
  112.30.1.119
@@ -17366,6 +17667,7 @@
  112.30.1.238
  112.30.1.238bin.sh
  112.30.1.245bin.sh
+112.30.1.247
  112.30.1.54
  112.30.1.55
  112.30.1.55bin.sh
@@ -17422,10 +17724,8 @@
  112.30.185.126
  112.30.195.171
  112.30.210.4
-112.30.210.50
  112.30.213.192
  112.30.35.237
-112.30.37.79
  112.30.38.100
  112.30.38.100bin.sh
  112.30.38.101
@@ -17450,6 +17750,8 @@
  112.30.4.53
  112.30.4.53bin.sh
  112.30.4.57
+112.30.4.60
+112.30.4.61
  112.30.4.62
  112.30.4.68
  112.30.4.68bin.sh
@@ -17460,10 +17762,12 @@
  112.30.4.78
  112.30.4.90
  112.30.4.90bin.sh
+112.30.61.183
  112.30.97.184
  112.31.12.214
  112.31.176.16
  112.31.191.217
+112.31.205.135
  112.31.208.137
  112.31.211.135
  112.31.218.39
@@ -17472,13 +17776,12 @@
  112.31.8.213
  112.31.82.160
  112.31.87.98
-112.33.112.0
  112.33.112.170
  112.33.13.124
  112.33.16.34
  112.33.254.28
-112.33.34.76
  112.33.40.113
+112.33.45.247
  112.33.46.163
  112.33.47.249
  112.33.47.27
@@ -17487,6 +17790,7 @@
  112.35.146.115
  112.35.184.193
  112.35.191.231
+112.35.27.97
  112.35.62.225
  112.4.116.70
  112.4.119.50
@@ -17495,6 +17799,7 @@
  112.4.235.230
  112.4.79.70
  112.4.97.41
+112.41.52.35
  112.44.108.251
  112.44.118.2
  112.47.3.53
@@ -17513,7 +17818,9 @@
  112.5.37.146
  112.5.76.235
  112.5.86.45
+112.51.247.77
  112.51.248.206
+112.51.249.235
  112.51.97.38
  112.53.176.84
  112.53.224.79
@@ -17543,30 +17850,35 @@
  112.60.95.1
  112.64.133.222
  112.64.136.62
+112.64.167.26
  112.64.176.54
  112.64.32.118
  112.64.33.38
-112.64.68.218
+112.64.68.128
  112.65.125.190
  112.65.131.190
  112.65.157.165
  112.65.214.63
  112.65.233.110
  112.65.48.157
-112.65.48.49
+112.65.53.82
+112.65.61.140
  112.65.61.75
-112.65.61.76
  112.65.61.85
  112.65.63.62
  112.66.101.215
  112.66.107.5
+112.66.178.96
+112.66.240.238
  112.66.241.108
+112.66.242.15
  112.66.246.136
  112.66.250.176
  112.66.48.95
  112.66.70.101
  112.66.96.99
  112.67.160.84
+112.67.176.17
  112.67.176.63
  112.67.252.237
  112.67.253.202
@@ -17577,19 +17889,20 @@
  112.72.133.118
  112.72.134.162
  112.72.137.118
+112.72.137.176
  112.72.137.246
  112.72.137.94
  112.72.139.102
  112.72.14.40
  112.72.143.181
-112.72.143.39
+112.72.144.33
  112.72.144.90
  112.72.146.150
-112.72.147.27
  112.72.153.37
  112.72.157.2
  112.72.157.63
  112.72.162.159
+112.72.162.53
  112.72.162.80
  112.72.173.79
  112.72.175.124
@@ -17597,10 +17910,12 @@
  112.72.176.112
  112.72.176.84
  112.72.181.141
+112.72.181.92
  112.72.182.143
  112.72.195.47
  112.72.200.38
  112.72.231.55
+112.72.241.179
  112.72.241.88
  112.72.244.10
  112.72.244.135
@@ -17610,7 +17925,6 @@
  112.72.249.189
  112.72.250.20
  112.72.253.88
-112.72.80.10
  112.72.95.152
  112.72.98.151
  112.73.67.137
@@ -17618,15 +17932,17 @@
  112.74.44.120
  112.74.94.219
  112.78.0.37
-112.78.1.134
+112.78.11.31
  112.78.11.92
  112.78.134.154
  112.78.134.229
  112.78.134.230
  112.78.136.108
+112.78.136.76
  112.78.136.78
  112.78.141.211
  112.78.142.170
+112.78.144.146
  112.78.144.58
  112.78.15.3
  112.78.15.5
@@ -17634,14 +17950,15 @@
  112.78.161.18
  112.78.161.188
  112.78.161.92
-112.78.162.74
  112.78.163.244
+112.78.164.109
  112.78.164.149
  112.78.164.177
  112.78.164.58
  112.78.166.58
  112.78.167.31
  112.78.170.26
+112.78.183.21
  112.78.184.30
  112.78.185.146
  112.78.186.110
@@ -17650,7 +17967,6 @@
  112.78.3.119
  112.78.3.130
  112.78.3.39
-112.78.3.40
  112.78.38.226
  112.78.38.235
  112.78.38.238
@@ -17670,6 +17986,7 @@
  112.80.171.204
  112.80.200.18
  112.80.238.37
+112.80.35.2
  112.80.38.210
  112.81.102.157
  112.81.139.63
@@ -17695,6 +18012,7 @@
  112.84.115.205
  112.84.21.184
  112.84.225.35
+112.84.63.156
  112.84.74.254
  112.84.95.230
  112.85.125.89
@@ -17705,6 +18023,7 @@
  112.85.42.102
  112.85.42.110
  112.85.42.112
+112.85.42.117
  112.85.42.119
  112.85.42.120
  112.85.42.121
@@ -17724,24 +18043,34 @@
  112.85.42.187
  112.85.42.188
  112.85.42.189
+112.85.42.190
  112.85.42.196
  112.85.42.200
  112.85.42.227
  112.85.42.229
  112.85.42.230
+112.85.42.231
+112.85.42.232
  112.85.42.233
  112.85.42.237
  112.85.42.30
  112.85.42.47
  112.85.42.53
  112.85.42.67
+112.85.42.69
+112.85.42.73
  112.85.42.74
  112.85.42.81
  112.85.42.85
  112.85.42.87
+112.85.42.88
+112.85.42.89
+112.85.42.91
  112.85.42.96
  112.85.42.98
  112.85.54.88
+112.85.64.170
+112.85.65.121
  112.86.100.60
  112.86.132.95
  112.86.163.153
@@ -17758,7 +18087,6 @@
  112.87.206.195
  112.87.252.15
  112.87.72.83
-112.9.128.16
  112.90.131.43
  112.90.217.199
  112.91.120.20
@@ -17770,7 +18098,6 @@
  112.91.154.114
  112.91.81.100
  112.92.133.33
-112.92.164.174
  112.93.2.231
  112.93.28.227
  112.94.161.92
@@ -17791,10 +18118,10 @@
  112sarj.com
  113-365.net
  113.0.100.176
-113.0.109.152
  113.0.113.136
  113.0.191.182
  113.0.56.10
+113.1.147.11
  113.1.165.147
  113.1.206.85
  113.1.40.128
@@ -17811,34 +18138,41 @@
  113.102.161.126
  113.102.161.93
  113.102.163.168
+113.102.163.42
  113.102.18.154
-113.102.18.238
+113.102.18.207
  113.102.19.143
  113.102.19.146
  113.102.19.186
  113.102.19.47
  113.102.19.73
  113.102.19.92
+113.102.35.213
  113.102.36.185
+113.102.81.240
  113.103.57.113
-113.104.180.196
-113.104.198.116
+113.104.191.190
+113.104.199.13
  113.104.204.38
-113.104.227.178
+113.104.236.220
+113.104.242.159
  113.104.242.97
  113.105.137.241
  113.105.192.82
  113.105.8.58
  113.106.0.114
+113.106.106.98
  113.106.11.107
  113.106.11.6
  113.106.111.50
  113.106.12.9
+113.106.162.114
  113.106.58.99
  113.106.66.58
  113.106.8.55
  113.107.139.68
  113.107.162.179
+113.107.166.9
  113.107.215.28
  113.107.244.124
  113.107.53.119
@@ -17853,12 +18187,10 @@
  113.108.126.5
  113.108.127.1
  113.108.127.10
-113.108.127.13
  113.108.127.17
  113.108.127.18
  113.108.127.2
  113.108.127.20
-113.108.127.23
  113.108.127.24
  113.108.127.25
  113.108.127.6
@@ -17879,11 +18211,12 @@
  113.11.3.30
  113.11.34.129
  113.11.64.62
-113.110.164.46
  113.110.164.66
  113.110.165.218
+113.110.166.68
  113.110.200.252
  113.110.201.139
+113.110.214.135
  113.110.214.146
  113.110.215.110
  113.110.215.16
@@ -17895,74 +18228,74 @@
  113.110.227.66
  113.110.228.205
  113.110.230.28
-113.110.236.97
-113.110.246.197
  113.110.252.177
  113.110.40.95
  113.110.42.19
+113.111.10.185
  113.111.109.135
  113.111.128.102
-113.111.32.254
+113.111.184.113
+113.111.244.229
  113.111.35.144
-113.111.43.21
  113.111.44.129
  113.113.81.174
+113.116.106.89
  113.116.128.144
+113.116.130.233
+113.116.131.234
  113.116.14.129
-113.116.148.109
-113.116.148.113
-113.116.150.223
-113.116.151.157
+113.116.142.115
  113.116.170.175
  113.116.177.211
-113.116.177.212
-113.116.206.151
-113.116.206.250
-113.116.217.122
+113.116.205.141
+113.116.206.214
+113.116.218.112
  113.116.218.186
+113.116.226.41
+113.116.227.120
+113.116.236.250
  113.116.245.8
+113.116.246.168
  113.116.247.126
-113.116.247.136
+113.116.32.75
  113.116.35.193
-113.116.40.15
  113.116.41.128
  113.116.41.191
  113.116.42.139
-113.116.5.10
-113.116.5.162
+113.116.45.134
  113.116.5.164
-113.116.50.162
  113.116.54.105
+113.116.73.14
  113.116.88.93
+113.116.91.39
  113.117.12.190
-113.117.13.112
  113.117.13.15
-113.117.14.241
-113.117.180.217
+113.117.13.79
  113.117.180.229
  113.117.193.189
  113.118.105.163
  113.118.112.53
  113.118.120.140
  113.118.123.24
-113.118.13.152
-113.118.13.83
-113.118.133.247
+113.118.13.208
+113.118.133.155
  113.118.14.231
+113.118.14.63
  113.118.16.128
-113.118.16.69
-113.118.216.193
+113.118.199.148
  113.118.24.185
  113.118.249.183
-113.118.46.167
-113.118.84.214
-113.118.84.53
+113.118.45.115
+113.118.46.162
+113.118.7.163
  113.118.86.7
-113.118.87.61
+113.119.132.95
  113.119.167.146
+113.119.36.91
  113.119.58.245
  113.119.59.218
  113.119.68.16
+113.119.8.16
  113.119.9.136
  113.12.64.58
  113.12.66.62
@@ -17972,37 +18305,42 @@
  113.12.81.116
  113.120.32.150
  113.120.32.16
-113.120.33.129
-113.120.33.135
-113.120.34.246
-113.120.36.183
-113.120.36.215
-113.120.37.208
-113.120.37.213
+113.120.32.225
+113.120.36.166
+113.120.37.16
  113.120.38.145
+113.120.38.24
+113.120.39.39
+113.120.39.41
  113.120.39.63
  113.120.46.121
-113.120.60.134
+113.120.60.155
+113.120.60.83
+113.120.61.153
  113.120.61.2
+113.120.61.4
  113.120.62.147
  113.120.63.109
  113.120.63.225
+113.120.68.122
  113.120.74.61
  113.120.8.178
  113.121.38.152
  113.121.64.5
  113.122.40.174
  113.123.140.95
-113.124.20.157
-113.124.23.167
+113.124.95.108
  113.125.146.138
  113.125.21.66
  113.125.44.66
  113.125.67.184
-113.128.10.225
-113.128.10.4
-113.128.120.69
+113.128.10.34
+113.128.116.229
+113.128.120.161
  113.128.121.9
+113.128.122.215
+113.128.122.224
+113.128.122.39
  113.128.123.89
  113.128.128.128
  113.128.129.31
@@ -18016,21 +18354,28 @@
  113.128.236.121
  113.128.246.50
  113.128.25.205
-113.128.26.65
+113.128.25.213
+113.128.25.68
+113.128.26.81
  113.128.27.160
  113.128.27.79
-113.128.28.186
-113.128.28.83
+113.128.29.137
+113.128.29.60
+113.128.30.167
+113.128.30.18
  113.128.30.200
-113.128.31.27
  113.128.31.88
-113.128.31.89
-113.128.34.214
-113.128.38.107
+113.128.33.154
+113.128.33.18
+113.128.34.158
+113.128.34.28
+113.128.35.192
+113.128.61.190
  113.128.64.30
  113.128.65.100
-113.128.8.136
+113.128.8.143
  113.128.8.3
+113.128.9.55
  113.13.176.117
  113.13.188.131
  113.130.126.2
@@ -18081,7 +18426,6 @@
  113.131.177.224
  113.131.177.225
  113.131.177.231
-113.131.182.66
  113.131.182.67
  113.131.182.68
  113.131.182.69
@@ -18093,7 +18437,6 @@
  113.131.182.76
  113.131.182.77
  113.131.183.10
-113.131.183.11
  113.131.183.12
  113.131.183.13
  113.131.183.15
@@ -18127,12 +18470,14 @@
  113.131.224.197
  113.133.176.204
  113.133.224.68
+113.133.226.183
  113.134.203.6
  113.134.203.8
  113.134.211.242
  113.134.211.28
  113.134.211.42
  113.134.240.218
+113.135.61.130
  113.137.39.88
  113.138.208.127
  113.14.110.79
@@ -18186,8 +18531,6 @@
  113.142.72.111
  113.142.72.123
  113.142.72.2
-113.142.72.85
-113.142.72.97
  113.142.73.214
  113.143.36.226
  113.148.3.57
@@ -18203,6 +18546,7 @@
  113.160.113.45
  113.160.117.172
  113.160.117.244
+113.160.117.48
  113.160.117.88
  113.160.130.116
  113.160.130.13
@@ -18211,11 +18555,12 @@
  113.160.150.43
  113.160.158.39
  113.160.166.129
+113.160.172.105
  113.160.172.75
  113.160.183.25
  113.160.188.21
-113.160.198.13
  113.160.201.166
+113.160.202.211
  113.160.206.37
  113.160.209.205
  113.160.219.210
@@ -18234,13 +18579,15 @@
  113.160.37.32
  113.160.54.78
  113.160.58.230
+113.160.98.121
  113.161.0.206
  113.161.1.106
  113.161.1.54
  113.161.128.192
+113.161.128.238
  113.161.128.28
  113.161.129.13
-113.161.145.50
+113.161.143.29
  113.161.146.24
  113.161.148.81
  113.161.151.17
@@ -18250,10 +18597,13 @@
  113.161.163.247
  113.161.176.113
  113.161.177.52
+113.161.180.131
  113.161.186.101
  113.161.207.105
  113.161.207.99
  113.161.234.101
+113.161.24.238
+113.161.39.205
  113.161.44.87
  113.161.45.89
  113.161.52.89
@@ -18262,6 +18612,7 @@
  113.161.62.31
  113.161.68.146
  113.161.70.172
+113.161.70.224
  113.161.70.97
  113.161.76.129
  113.161.76.211
@@ -18273,8 +18624,9 @@
  113.161.92.91
  113.161.94.109
  113.162.167.166
+113.162.176.202
+113.162.185.90
  113.162.37.191
-113.162.39.23
  113.162.55.133
  113.163.131.121
  113.163.157.250
@@ -18290,9 +18642,8 @@
  113.166.92.12
  113.166.92.5
  113.167.107.167
-113.169.133.54
+113.168.196.217
  113.169.251.233
-113.17.105.57
  113.17.35.73
  113.17.37.209
  113.170.132.75
@@ -18301,22 +18652,20 @@
  113.170.36.88
  113.172.112.176
  113.172.123.85
-113.172.130.126
  113.172.132.45
  113.172.158.59
  113.172.16.139
  113.172.164.3
+113.172.171.75
  113.172.184.235
+113.172.186.11
  113.172.187.133
-113.172.210.67
  113.172.226.30
  113.172.244.130
  113.172.76.168
-113.173.118.139
-113.173.152.148
  113.173.167.146
  113.173.169.103
-113.173.218.80
+113.173.2.93
  113.173.59.91
  113.174.61.127
  113.176.130.156
@@ -18326,19 +18675,19 @@
  113.176.88.10
  113.176.88.18
  113.176.89.116
-113.177.27.165
+113.176.99.246
  113.177.27.217
  113.178.168.173
  113.178.176.149
  113.178.211.118
  113.178.233.171
  113.178.237.130
+113.178.36.151
  113.178.51.228
  113.178.52.135
  113.179.142.176
  113.179.156.155
  113.179.169.250
-113.179.93.178
  113.180.141.39
  113.180.148.152
  113.180.28.130
@@ -18350,23 +18699,23 @@
  113.182.182.39
  113.182.72.112
  113.183.134.63
+113.183.172.148
  113.183.238.33
+113.183.92.26
  113.185.19.134
-113.185.43.26
-113.185.78.128
  113.186.180.10
+113.186.42.25
  113.186.80.181
  113.188.234.184
  113.188.51.219
  113.189.16.177
-113.189.7.213
+113.189.241.247
  113.19.72.124
  113.19.72.151
-113.190.106.3
  113.190.107.84
-113.190.156.199
  113.190.19.230
  113.190.222.146
+113.190.223.163
  113.190.235.148
  113.190.235.196
  113.190.235.28
@@ -18374,7 +18723,6 @@
  113.190.254.11
  113.190.254.147
  113.190.254.165
-113.190.254.180
  113.190.254.245
  113.190.255.114
  113.190.36.2
@@ -18382,9 +18730,9 @@
  113.190.38.202
  113.190.40.199
  113.190.6.226
-113.190.74.218
-113.193.191.132
+113.193.183.204
  113.193.26.210
+113.193.30.171
  113.193.30.172
  113.193.30.174
  113.193.6.34
@@ -18393,33 +18741,27 @@
  113.194.141.129
  113.194.142.138
  113.194.142.237
+113.194.143.30
  113.194.50.197
  113.195.133.247
  113.195.156.20
  113.195.164.178
  113.195.164.222
-113.195.168.29
+113.195.165.192
  113.195.207.146
  113.195.243.178
+113.195.246.74
  113.197.138.84
  113.197.214.174
  113.197.244.231
-113.197.69.21
  113.199.108.13
  113.2.243.45
  113.20.106.129
-113.20.106.176
-113.20.106.177
  113.20.106.66
-113.20.106.96
-113.20.107.180
-113.20.107.51
-113.20.122.112
  113.20.122.171
  113.20.122.186
  113.20.122.86
-113.20.123.109
-113.20.123.142
+113.20.123.110
  113.20.123.31
  113.20.86.138
  113.200.105.23
@@ -18427,6 +18769,7 @@
  113.200.156.180
  113.200.161.155
  113.200.201.29
+113.200.212.170
  113.200.219.2
  113.200.236.133
  113.200.51.222
@@ -18435,7 +18778,6 @@
  113.200.60.74
  113.200.65.138
  113.201.61.178
-113.203.214.154
  113.203.233.226
  113.203.236.211
  113.203.236.216
@@ -18455,14 +18797,12 @@
  113.209.128.30
  113.209.197.236
  113.21.112.236
-113.21.115.245
  113.21.231.98
  113.21.64.23
  113.21.70.127
  113.21.73.168
  113.21.73.9
  113.21.74.199
-113.212.123.204
  113.212.127.35
  113.212.162.155
  113.212.164.140
@@ -18980,6 +19320,7 @@
  113.212.70.98
  113.212.70.99
  113.214.20.179
+113.214.25.170
  113.214.26.106
  113.214.26.134
  113.214.26.202
@@ -18989,10 +19330,8 @@
  113.214.34.90
  113.214.6.60
  113.214.6.61
-113.215.220.58
-113.215.222.71
+113.215.180.234
  113.215.223.39
-113.219.200.7
  113.22.107.20
  113.22.110.70
  113.22.116.221
@@ -19001,13 +19340,13 @@
  113.22.177.91
  113.22.185.137
  113.22.198.126
+113.22.199.253
  113.22.207.98
  113.22.21.35
  113.22.222.97
  113.22.223.75
  113.22.23.122
  113.22.23.25
-113.22.236.170
  113.22.245.130
  113.22.252.129
  113.22.252.209
@@ -19016,14 +19355,11 @@
  113.22.70.146
  113.22.72.216
  113.22.72.223
-113.22.82.136
  113.22.87.81
-113.22.90.197
  113.22.93.174
  113.22.95.180
  113.221.13.204
  113.221.50.64
-113.221.51.243
  113.221.56.180
  113.222.144.10
  113.222.146.209
@@ -19031,6 +19367,7 @@
  113.224.138.102
  113.224.180.80
  113.224.21.1
+113.224.215.100
  113.224.225.105
  113.224.235.166
  113.224.235.32
@@ -19038,7 +19375,9 @@
  113.224.246.167
  113.224.251.246
  113.224.94.147
+113.225.112.182
  113.225.113.234
+113.225.22.173
  113.225.23.67
  113.225.93.57
  113.225.93.76
@@ -19048,7 +19387,6 @@
  113.226.215.73
  113.226.5.182
  113.226.56.119
-113.227.112.87
  113.227.14.78
  113.227.171.70
  113.227.42.149
@@ -19059,13 +19397,15 @@
  113.228.105.50
  113.228.107.91
  113.228.114.163
+113.228.121.2
+113.228.147.100
  113.228.208.78
  113.228.217.86
  113.228.40.112
  113.228.58.22
  113.228.59.180
+113.228.60.102
  113.228.66.10
-113.228.80.5
  113.228.80.6
  113.229.185.186
  113.229.24.180
@@ -19077,10 +19417,8 @@
  113.23.107.48
  113.23.107.88
  113.23.108.15
-113.23.108.166
  113.23.108.184
  113.23.109.185
-113.23.109.212
  113.23.11.28
  113.23.110.249
  113.23.111.169
@@ -19092,34 +19430,38 @@
  113.23.83.119
  113.23.83.18
  113.230.114.228
+113.230.203.38
  113.230.203.52
+113.230.237.243
  113.231.110.183
  113.231.131.211
  113.231.20.201
  113.231.237.140
  113.231.252.60
  113.231.93.168
-113.232.227.122
+113.232.225.131
  113.232.24.155
  113.232.241.144
  113.232.26.204
  113.232.29.158
  113.233.114.175
-113.233.115.87
  113.233.120.119
  113.233.121.116
  113.233.129.55
  113.233.130.111
  113.233.25.62
  113.234.7.198
+113.234.82.95
  113.235.104.232
-113.235.121.246
  113.235.122.97
  113.235.124.173
  113.235.161.246
  113.235.163.233
+113.235.165.216
  113.235.194.46
+113.235.198.48
  113.235.199.68
+113.235.2.35
  113.235.203.34
  113.235.204.10
  113.235.28.132
@@ -19127,7 +19469,6 @@
  113.236.125.80
  113.236.166.68
  113.236.176.223
-113.236.2.251
  113.236.241.203
  113.236.64.106
  113.236.64.8
@@ -19140,9 +19481,9 @@
  113.237.159.75
  113.237.17.163
  113.237.232.79
+113.237.238.99
  113.238.109.236
  113.238.127.138
-113.238.130.218
  113.238.142.208
  113.238.15.216
  113.238.90.187
@@ -19155,17 +19496,20 @@
  113.239.87.105
  113.240.184.183
  113.240.186.132
-113.240.197.195
  113.240.227.123
  113.242.223.181
  113.243.130.13
  113.243.221.145
  113.243.25.4
+113.243.42.62
+113.243.46.56
  113.245.191.254
  113.245.224.185
  113.246.243.65
+113.247.129.180
  113.247.233.22
  113.247.240.11
+113.248.192.140
  113.248.192.30
  113.249.170.126
  113.249.175.254
@@ -19178,6 +19522,7 @@
  113.252.226.235
  113.252.23.104
  113.252.249.104
+113.252.254.133
  113.252.33.4
  113.252.8.114
  113.252.87.214
@@ -19185,12 +19530,12 @@
  113.253.155.192
  113.253.162.225
  113.253.170.73
+113.253.179.90
  113.253.203.34
  113.253.229.211
  113.253.26.98
  113.253.5.120
  113.253.5.247
-113.253.89.246
  113.254.114.93
  113.254.14.72
  113.254.178.224
@@ -19206,13 +19551,13 @@
  113.255.105.46
  113.255.149.66
  113.255.149.92
-113.255.175.196
  113.255.191.225
  113.255.218.32
  113.255.218.71
  113.255.229.132
  113.255.245.104
  113.255.245.11
+113.255.245.129
  113.255.246.244
  113.255.247.221
  113.255.78.197
@@ -19234,11 +19579,12 @@
  113.31.109.63
  113.31.114.207
  113.31.115.137
+113.31.115.53
+113.31.117.68
  113.31.118.80
  113.31.119.246
  113.31.125.11
  113.31.125.177
-113.31.125.218
  113.31.147.54
  113.4.131.194
  113.4.176.138
@@ -19261,6 +19607,7 @@
  113.53.165.49
  113.53.166.205
  113.53.170.33
+113.53.181.104
  113.53.185.252
  113.53.188.195
  113.53.211.230
@@ -19271,6 +19618,7 @@
  113.53.238.195
  113.53.247.221
  113.53.255.222
+113.53.29.172
  113.53.29.185
  113.53.29.218
  113.53.29.228
@@ -19278,12 +19626,12 @@
  113.53.4.25
  113.53.47.236
  113.53.52.128
+113.53.53.15
  113.53.60.216
  113.53.61.128
  113.53.61.235
  113.53.61.27
  113.53.61.43
-113.53.62.101
  113.53.82.157
  113.53.83.210
  113.53.83.212
@@ -19291,7 +19639,6 @@
  113.53.91.12
  113.53.91.214
  113.53.94.122
-113.53.94.213
  113.53.94.235
  113.56.107.67
  113.56.119.118
@@ -19306,11 +19653,14 @@
  113.57.170.50
  113.57.222.83
  113.57.222.88
+113.57.222.97
  113.57.252.72
+113.57.95.20
  113.58.177.147
  113.58.215.66
  113.58.228.48
  113.58.229.252
+113.58.239.92
  113.59.128.133
  113.59.135.144
  113.59.136.39
@@ -19321,10 +19671,10 @@
  113.59.154.15
  113.59.155.11
  113.59.156.167
+113.59.156.171
  113.59.156.244
  113.59.156.28
  113.59.156.77
-113.59.160.42
  113.59.164.135
  113.59.164.137
  113.59.165.19
@@ -19333,12 +19683,11 @@
  113.59.166.202
  113.59.168.103
  113.59.168.113
-113.59.174.108
  113.59.176.34
  113.59.180.54
+113.59.181.6
  113.59.181.79
  113.59.187.154
-113.59.189.90
  113.59.191.39
  113.59.191.57
  113.59.224.149
@@ -19346,13 +19695,12 @@
  113.59.224.77
  113.6.149.97
  113.6.164.181
+113.6.170.119
  113.6.18.75
  113.6.210.168
  113.6.252.202
  113.60.190.204
  113.60.202.175
-113.60.202.179
-113.60.245.18
  113.61.136.240
  113.61.197.23
  113.61.204.190
@@ -19366,9 +19714,11 @@
  113.65.160.34
  113.65.206.80
  113.65.21.108
+113.65.210.160
+113.65.211.167
  113.65.211.173
-113.65.211.18
  113.65.231.46
+113.66.112.129
  113.66.228.13
  113.66.251.237
  113.66.254.100
@@ -19381,7 +19731,6 @@
  113.68.193.55
  113.69.131.223
  113.69.25.253
-113.7.40.165
  113.7.57.172
  113.7.63.23
  113.70.133.250
@@ -19392,7 +19741,6 @@
  113.70.59.199
  113.70.59.29
  113.70.59.98
-113.71.156.149
  113.71.208.192
  113.71.208.217
  113.71.208.59
@@ -19416,11 +19764,8 @@
  113.72.23.92
  113.74.26.114
  113.76.148.122
-113.77.100.21
  113.77.24.187
-113.77.24.189
  113.77.25.15
-113.77.25.36
  113.77.26.141
  113.78.64.231
  113.78.65.13
@@ -19435,66 +19780,61 @@
  113.8.239.30
  113.81.14.252
  113.81.159.106
+113.81.159.136
  113.81.206.83
-113.81.233.62
-113.81.234.16
  113.81.60.123
  113.81.60.188
  113.81.60.219
  113.81.60.250
-113.81.60.62
  113.81.60.78
  113.83.150.106
  113.83.248.182
  113.85.177.56
  113.86.205.108
-113.87.145.184
  113.87.163.135
-113.87.195.48
-113.87.200.74
  113.87.203.51
+113.87.224.57
+113.87.227.47
  113.87.32.101
-113.87.32.160
  113.87.32.192
  113.87.32.54
-113.88.118.114
+113.87.88.158
+113.88.101.140
+113.88.117.18
+113.88.118.189
+113.88.124.186
  113.88.124.229
-113.88.124.63
-113.88.132.34
-113.88.133.213
-113.88.133.251
-113.88.152.103
+113.88.134.118
+113.88.134.178
+113.88.164.130
  113.88.164.180
+113.88.164.96
  113.88.166.25
-113.88.167.191
  113.88.167.200
+113.88.167.62
+113.88.167.92
  113.88.209.192
-113.88.209.220
  113.88.209.235
  113.88.209.9
  113.88.210.82
-113.88.229.44
-113.88.242.224
+113.88.211.249
+113.88.243.253
+113.88.248.45
  113.88.249.4
  113.88.36.107
+113.88.39.35
  113.88.80.19
  113.88.81.189
-113.88.84.169
-113.88.87.228
-113.89.124.145
-113.89.245.229
  113.89.245.43
-113.89.247.101
  113.89.34.91
  113.89.35.84
-113.89.4.137
+113.89.40.80
  113.89.52.182
  113.89.53.39
-113.89.53.86
+113.89.55.138
  113.89.55.229
-113.89.6.133
  113.89.70.214
-113.89.70.218
+113.89.71.16
  113.9.104.32
  113.9.129.164
  113.9.134.131
@@ -19502,42 +19842,45 @@
  113.9.19.147
  113.9.223.186
  113.9.233.14
-113.9.88.223
  113.90.135.225
  113.90.176.26
+113.90.176.35
  113.90.178.161
-113.90.178.249
-113.90.179.108
+113.90.237.101
+113.90.237.21
+113.90.238.221
  113.90.245.165
-113.90.245.93
  113.90.246.92
  113.90.247.249
  113.90.92.2
-113.91.162.34
+113.91.142.130
+113.91.171.41
  113.91.209.136
  113.91.209.138
  113.91.209.8
  113.91.210.104
  113.91.210.50
-113.91.211.255
  113.91.211.43
+113.91.249.61
  113.91.32.224
-113.91.33.66
-113.91.38.189
-113.92.196.102
+113.91.36.40
+113.91.39.90
+113.92.158.254
+113.92.159.40
+113.92.198.5
  113.92.222.33
-113.92.223.119
+113.92.223.127
  113.92.223.182
+113.92.223.239
  113.92.223.6
  113.93.224.56
  113.93.240.12
-113.93.241.168
  113.94.129.67
  113.94.137.170
  113.94.137.246
  113.94.137.37
+113.94.156.249
  113.94.156.84
-113.94.193.201
  113.94.193.206
  113.95.154.213
  113.95.192.232
@@ -19561,23 +19904,25 @@
  114.104.164.233
  114.104.189.119
  114.106.137.174
+114.106.222.200
  114.108.130.135
  114.108.140.37
  114.108.150.156
  114.108.177.104
  114.108.177.125
  114.108.177.176
+114.108.218.2
  114.108.47.171
  114.108.67.230
  114.109.172.105
  114.109.179.60
-114.109.193.95
  114.110.21.121
  114.110.21.50
  114.110.21.54
  114.111.245.225
  114.112.104.185
  114.112.104.187
+114.112.104.188
  114.112.161.155
  114.112.167.122
  114.112.236.228
@@ -19586,6 +19931,7 @@
  114.112.79.17
  114.112.96.30
  114.112.96.61
+114.113.126.181
  114.113.127.182
  114.113.237.67
  114.113.238.22
@@ -19594,6 +19940,7 @@
  114.115.186.58
  114.115.186.74
  114.115.190.21
+114.116.110.86
  114.116.13.215
  114.116.198.143
  114.116.199.175
@@ -19607,7 +19954,6 @@
  114.118.16.78
  114.118.5.130
  114.118.5.243
-114.119.157.189
  114.124.130.41
  114.129.17.51
  114.129.219.63
@@ -19621,12 +19967,9 @@
  114.134.187.236
  114.134.188.29
  114.134.191.194
-114.134.93.202
-114.134.95.234
  114.139.194.251
  114.139.201.15
  114.139.201.170
-114.139.241.242
  114.139.242.156
  114.139.245.163
  114.139.246.115
@@ -19639,7 +19982,9 @@
  114.141.55.178
  114.142.153.86
  114.142.232.28
+114.142.237.21
  114.143.100.102
+114.143.191.84
  114.143.240.150
  114.143.25.156
  114.144.208.176
@@ -19649,6 +19994,7 @@
  114.151.83.202
  114.156.234.88
  114.157.141.91
+114.160.154.162
  114.160.83.4
  114.162.118.129
  114.166.15.188
@@ -19665,6 +20011,7 @@
  114.198.173.40
  114.199.111.162
  114.199.112.138
+114.199.112.234
  114.199.113.38
  114.199.113.78
  114.199.116.9
@@ -19676,11 +20023,11 @@
  114.199.158.15
  114.199.159.159
  114.199.176.230
-114.199.192.103
  114.199.194.36
  114.199.195.51
  114.199.204.37
  114.199.215.31
+114.199.228.245
  114.199.232.166
  114.199.241.41
  114.199.247.45
@@ -19692,10 +20039,12 @@
  114.202.236.158
  114.202.240.111
  114.202.240.112
+114.202.34.8
  114.203.1.152
  114.204.214.32
  114.204.218.154
  114.205.154.67
+114.205.244.251
  114.205.36.141
  114.206.60.98
  114.207.139.203
@@ -19707,27 +20056,32 @@
  114.216.181.201
  114.216.202.114
  114.216.230.25
+114.216.244.125
  114.216.46.217
+114.218.16.147
  114.218.17.116
  114.218.31.241
  114.218.57.215
-114.218.64.175
  114.218.88.202
  114.219.127.116
+114.219.133.7
  114.219.157.174
+114.219.157.34
  114.219.157.97
  114.219.18.147
  114.219.18.204
  114.220.126.80
+114.220.238.72
  114.220.4.214
  114.220.59.60
  114.220.63.219
  114.220.74.62
  114.220.76.22
  114.220.76.79
-114.222.25.112
+114.221.198.63
  114.223.48.158
  114.223.85.115
+114.223.94.137
  114.224.212.99
  114.225.168.128
  114.225.69.129
@@ -19757,7 +20111,6 @@
  114.226.35.160
  114.226.35.234
  114.226.54.21
-114.226.55.242
  114.226.80.165
  114.226.81.133
  114.226.82.119
@@ -19779,8 +20132,7 @@
  114.227.111.45
  114.227.159.191
  114.227.159.88
-114.227.168.24
-114.227.186.184
+114.227.170.45
  114.227.26.138
  114.227.28.178
  114.227.30.70
@@ -19807,7 +20159,6 @@
  114.228.57.156
  114.228.63.106
  114.229.1.126
-114.229.118.77
  114.229.165.72
  114.229.18.229
  114.229.201.54
@@ -19823,39 +20174,38 @@
  114.23.246.137
  114.23.254.130
  114.23.97.230
-114.230.127.45
  114.230.177.137
  114.230.177.227
  114.230.27.39
-114.230.57.225
-114.231.104.162
-114.231.105.65
+114.231.104.209
  114.231.108.14
  114.231.108.149
  114.231.108.179
+114.231.109.220
+114.231.109.31
  114.231.243.176
-114.231.41.203
+114.231.41.192
  114.231.41.211
  114.231.42.17
  114.231.42.176
+114.231.42.204
+114.231.42.52
  114.231.44.155
-114.231.45.124
  114.231.45.62
-114.231.46.161
-114.231.46.183
-114.231.8.16
-114.231.8.190
+114.231.46.17
  114.231.82.120
-114.231.82.51
-114.232.109.78
-114.232.110.104
-114.232.110.111
+114.231.82.203
+114.232.109.194
  114.232.110.125
-114.232.110.225
+114.232.110.173
+114.232.110.188
+114.232.110.193
+114.232.110.219
  114.232.110.41
-114.232.110.43
  114.232.176.199
  114.232.5.174
+114.232.97.54
+114.233.112.74
  114.233.123.152
  114.233.153.177
  114.233.153.202
@@ -19895,11 +20245,11 @@
  114.234.182.32
  114.234.182.56
  114.234.19.216
-114.234.192.44
  114.234.192.49
  114.234.193.2
  114.234.195.112
  114.234.195.62
+114.234.195.67
  114.234.195.71
  114.234.32.233
  114.234.32.62
@@ -19933,7 +20283,6 @@
  114.235.149.134
  114.235.15.240
  114.235.153.32
-114.235.160.113
  114.235.161.67
  114.235.174.24
  114.235.197.18
@@ -19944,13 +20293,11 @@
  114.235.22.32
  114.235.222.44
  114.235.231.214
+114.235.238.240
  114.235.24.79
-114.235.248.147
  114.235.248.241
-114.235.250.68
  114.235.252.140
  114.235.3.33
-114.235.32.38
  114.235.34.235
  114.235.38.105
  114.235.4.183
@@ -19968,35 +20315,15 @@
  114.236.135.129
  114.236.152.230
  114.236.155.118
-114.236.159.117
-114.236.16.20
-114.236.17.227
  114.236.17.66
-114.236.18.122
-114.236.18.96
-114.236.19.195
-114.236.20.91
-114.236.21.180
-114.236.22.125
  114.236.23.186
-114.236.23.59
  114.236.24.152
-114.236.24.173
-114.236.25.63
-114.236.28.91
-114.236.29.9
-114.236.30.175
-114.236.30.217
-114.236.31.74
-114.236.63.101
+114.236.32.142
  114.236.72.230
  114.236.73.226
  114.236.73.95
-114.236.77.10
-114.236.77.94
  114.236.93.187
  114.237.109.232
-114.237.134.138
  114.237.140.72
  114.237.17.160
  114.237.63.85
@@ -20013,6 +20340,7 @@
  114.239.118.175
  114.239.124.14
  114.239.128.231
+114.239.149.70
  114.239.151.41
  114.239.160.225
  114.239.161.249
@@ -20049,7 +20377,6 @@
  114.24.58.69
  114.240.34.130
  114.240.96.162
-114.241.228.171
  114.241.248.11
  114.241.252.247
  114.242.113.242
@@ -20057,37 +20384,35 @@
  114.242.125.163
  114.242.125.190
  114.242.185.164
+114.242.225.6
  114.242.236.140
  114.242.25.132
  114.242.34.166
-114.243.193.189
  114.244.211.190
-114.244.52.64
  114.244.65.32
  114.244.71.13
  114.244.77.151
  114.244.79.17
+114.245.23.173
  114.246.34.150
  114.246.34.152
  114.246.35.161
  114.246.67.225
  114.246.9.18
  114.247.226.19
-114.247.39.51
  114.247.79.179
+114.248.163.89
  114.248.58.93
  114.249.116.128
-114.249.214.111
-114.249.221.152
+114.249.157.13
+114.249.209.70
+114.249.222.123
  114.249.224.86
-114.249.230.87
-114.249.233.197
  114.25.133.159
  114.25.156.250
  114.25.158.69
  114.25.161.61
  114.25.228.12
-114.25.30.185
  114.25.31.20
  114.25.36.43
  114.250.162.108
@@ -20130,6 +20455,7 @@
  114.30.55.54
  114.30.77.94
  114.31.15.22
+114.31.15.86
  114.31.4.122
  114.31.5.154
  114.32.10.121
@@ -20153,6 +20479,7 @@
  114.32.149.253
  114.32.150.79
  114.32.151.45
+114.32.152.47
  114.32.153.44
  114.32.156.26
  114.32.156.97
@@ -20180,6 +20507,7 @@
  114.32.198.213
  114.32.198.99
  114.32.2.209
+114.32.20.141
  114.32.200.188
  114.32.200.226
  114.32.204.140
@@ -20212,6 +20540,7 @@
  114.32.234.96
  114.32.235.28
  114.32.236.239
+114.32.236.99
  114.32.237.73
  114.32.240.222
  114.32.240.93
@@ -20222,6 +20551,7 @@
  114.32.246.188
  114.32.246.252
  114.32.249.95
+114.32.250.58
  114.32.26.40
  114.32.27.62
  114.32.30.16
@@ -20268,6 +20598,7 @@
  114.32.81.143
  114.32.81.186
  114.32.82.109
+114.32.86.176
  114.32.86.247
  114.32.87.181
  114.32.87.234
@@ -20323,6 +20654,7 @@
  114.33.129.211
  114.33.13.207
  114.33.133.204
+114.33.134.226
  114.33.135.185
  114.33.137.28
  114.33.138.107
@@ -20334,7 +20666,6 @@
  114.33.147.241
  114.33.147.251
  114.33.148.20
-114.33.148.205
  114.33.149.107
  114.33.149.159
  114.33.150.61
@@ -20399,6 +20730,7 @@
  114.33.198.171
  114.33.198.186
  114.33.198.220
+114.33.2.184
  114.33.200.33
  114.33.201.140
  114.33.202.106
@@ -20465,6 +20797,7 @@
  114.33.34.142
  114.33.34.217
  114.33.34.82
+114.33.38.193
  114.33.41.115
  114.33.41.203
  114.33.42.189
@@ -20532,7 +20865,6 @@
  114.34.107.162
  114.34.107.45
  114.34.107.72
-114.34.111.15
  114.34.111.25
  114.34.113.47
  114.34.118.164
@@ -20552,7 +20884,6 @@
  114.34.160.41
  114.34.163.241
  114.34.166.118
-114.34.166.65
  114.34.170.230
  114.34.173.201
  114.34.176.197
@@ -20572,14 +20903,13 @@
  114.34.193.108
  114.34.193.29
  114.34.195.181
-114.34.197.10
  114.34.2.185
  114.34.203.140
  114.34.203.250
  114.34.205.98
  114.34.211.77
  114.34.212.127
-114.34.213.166
+114.34.213.7
  114.34.214.145
  114.34.215.185
  114.34.222.49
@@ -20593,12 +20923,10 @@
  114.34.231.79
  114.34.232.189
  114.34.232.43
-114.34.234.201
  114.34.234.211
  114.34.236.166
  114.34.236.212
  114.34.241.95
-114.34.25.245
  114.34.254.156
  114.34.254.182
  114.34.26.33
@@ -20704,7 +21032,6 @@
  114.35.140.201
  114.35.140.245
  114.35.146.151
-114.35.146.87
  114.35.147.111
  114.35.148.168
  114.35.148.77
@@ -20743,7 +21070,6 @@
  114.35.170.11
  114.35.170.147
  114.35.176.124
-114.35.176.15
  114.35.176.69
  114.35.177.126
  114.35.178.132
@@ -20751,7 +21077,6 @@
  114.35.178.201
  114.35.178.26
  114.35.178.73
-114.35.179.124
  114.35.179.146
  114.35.179.165
  114.35.179.182
@@ -20764,6 +21089,7 @@
  114.35.181.80
  114.35.182.22
  114.35.182.221
+114.35.182.223
  114.35.182.83
  114.35.186.108
  114.35.188.117
@@ -20777,7 +21103,9 @@
  114.35.194.125
  114.35.194.4
  114.35.194.46
+114.35.195.112
  114.35.197.138
+114.35.2.112
  114.35.20.110
  114.35.200.107
  114.35.200.190
@@ -20857,7 +21185,6 @@
  114.35.28.41
  114.35.28.55
  114.35.29.203
-114.35.29.94
  114.35.3.228
  114.35.3.32
  114.35.30.25
@@ -20951,6 +21278,7 @@
  114.35.96.172
  114.35.96.195
  114.36.106.4
+114.36.17.76
  114.36.22.143
  114.37.220.186
  114.37.66.225
@@ -20958,9 +21286,13 @@
  114.39.104.242
  114.39.20.56
  114.39.29.65
+114.39.47.216
  114.39.62.50
+114.4.110.189
  114.4.192.17
  114.4.8.14
+114.4.83.56
+114.40.104.40
  114.40.108.64
  114.40.12.158
  114.40.146.151
@@ -20977,6 +21309,7 @@
  114.41.211.35
  114.41.34.57
  114.41.98.181
+114.42.153.115
  114.42.167.125
  114.42.18.174
  114.42.18.251
@@ -20991,19 +21324,24 @@
  114.43.133.147
  114.43.190.186
  114.43.25.43
+114.43.26.203
  114.43.48.250
+114.43.55.148
  114.43.58.41
  114.43.97.117
+114.43.98.10
  114.43.99.112
  114.44.1.165
  114.44.244.69
  114.45.101.18
  114.45.151.44
+114.45.156.29
  114.45.157.168
  114.45.18.25
  114.45.57.147
  114.46.7.250
  114.47.101.154
+114.47.102.121
  114.47.104.137
  114.47.108.152
  114.47.153.147
@@ -21016,18 +21354,19 @@
  114.47.98.235
  114.47.98.87
  114.47.99.26
-114.5.109.199
  114.5.12.34
  114.5.192.3
  114.5.195.226
  114.5.198.101
  114.5.21.206
+114.5.216.242
  114.5.24.14
  114.5.35.98
  114.5.36.243
  114.5.64.49
  114.5.98.30
  114.5.99.106
+114.55.92.167
  114.57.185.12
  114.57.189.130
  114.57.33.222
@@ -21042,6 +21381,8 @@
  114.6.94.94
  114.64.253.153
  114.64.253.154
+114.67.102.123
+114.67.102.54
  114.67.103.151
  114.67.103.250
  114.67.104.176
@@ -21051,8 +21392,11 @@
  114.67.108.60
  114.67.110.126
  114.67.110.227
+114.67.110.240
  114.67.110.58
+114.67.112.67
  114.67.113.90
+114.67.117.120
  114.67.117.219
  114.67.123.3
  114.67.125.253
@@ -21066,23 +21410,31 @@
  114.67.180.177
  114.67.198.134
  114.67.200.2
+114.67.202.170
+114.67.206.36
  114.67.212.197
  114.67.219.159
  114.67.224.239
+114.67.225.91
  114.67.229.212
+114.67.230.101
  114.67.231.39
+114.67.239.47
  114.67.250.30
  114.67.253.227
  114.67.254.244
  114.67.66.26
  114.67.67.11
+114.67.67.148
  114.67.68.255
  114.67.69.0
  114.67.72.164
  114.67.77.148
+114.67.77.159
  114.67.77.183
  114.67.80.134
  114.67.82.217
+114.67.83.42
  114.67.85.74
  114.67.87.218
  114.67.87.255
@@ -21091,6 +21443,7 @@
  114.67.94.177
  114.67.95.121
  114.67.95.61
+114.67.96.178
  114.69.232.101
  114.69.232.121
  114.69.232.125
@@ -21123,6 +21476,7 @@
  114.69.243.89
  114.69.243.93
  114.69.244.210
+114.69.244.238
  114.69.244.66
  114.69.247.168
  114.69.249.145
@@ -21130,6 +21484,7 @@
  114.69.249.194
  114.7.112.118
  114.7.120.194
+114.7.124.134
  114.7.15.146
  114.7.162.198
  114.7.162.6
@@ -21142,10 +21497,10 @@
  114.7.96.178
  114.7.97.193
  114.70.235.64
-114.74.101.107
  114.74.88.199
  114.79.136.69
  114.79.151.157
+114.79.161.44
  114.79.173.41
  114.80.108.158
  114.80.118.153
@@ -21162,9 +21517,13 @@
  114.84.212.242
  114.84.242.116
  114.84.27.192
+114.84.31.165
  114.84.67.84
+114.84.81.121
  114.86.128.145
  114.86.191.214
+114.86.90.115
+114.88.100.86
  114.88.154.55
  114.88.176.7
  114.88.92.236
@@ -21174,6 +21533,7 @@
  114.93.36.232
  114.93.75.129
  114.95.107.39
+114.95.149.112
  114.95.172.20
  114.95.173.150
  114.95.186.75
@@ -21190,11 +21550,12 @@
  114.97.141.249
  114.97.184.184
  114.97.184.192
+114.97.185.86
  114.97.238.19
-114.97.240.15
  114.97.243.25
  114.98.236.124
-114.99.27.133
+114.99.29.103
+114.99.63.219
  1147.org
  114oldest.com
  115.100.249.238
@@ -21239,11 +21600,12 @@
  115.132.49.216
  115.132.58.78
  115.132.91.0
+115.132.94.107
  115.133.255.83
  115.133.33.136
  115.133.51.34
-115.134.12.226
  115.134.124.23
+115.134.128.90
  115.134.130.53
  115.134.194.216
  115.134.194.220
@@ -21258,10 +21620,10 @@
  115.144.26.3
  115.144.69.105
  115.146.121.108
+115.146.121.79
  115.146.122.237
  115.146.123.112
  115.146.126.209
-115.148.72.144
  115.148.80.189
  115.148.82.102
  115.148.83.137
@@ -21285,12 +21647,13 @@
  115.159.115.17
  115.159.115.69
  115.159.117.250
-115.159.117.88
+115.159.119.142
  115.159.123.146
  115.159.124.199
  115.159.126.215
  115.159.145.80
  115.159.148.174
+115.159.148.72
  115.159.151.171
  115.159.152.108
  115.159.152.188
@@ -21312,7 +21675,6 @@
  115.159.221.187
  115.159.222.221
  115.159.226.53
-115.159.23.54
  115.159.25.145
  115.159.25.60
  115.159.3.147
@@ -21326,10 +21688,12 @@
  115.159.42.232
  115.159.53.215
  115.159.54.212
+115.159.56.151
  115.159.64.121
  115.159.66.109
  115.159.71.202
  115.159.71.95
+115.159.74.68
  115.159.83.182
  115.159.88.167
  115.159.90.137
@@ -21342,9 +21706,7 @@
  115.159.98.28
  115.160.104.73
  115.160.142.169
-115.160.170.62
  115.161.243.249
-115.165.103.120
  115.165.166.169
  115.165.199.81
  115.165.200.200
@@ -21371,7 +21733,6 @@
  115.171.238.92bin.sh
  115.176.148.20
  115.177.188.104
-115.178.103.231
  115.178.119.110
  115.178.49.238
  115.178.98.62
@@ -21385,15 +21746,17 @@
  115.186.187.249
  115.186.30.38
  115.186.58.41
+115.187.39.166
+115.187.62.195
  115.192.102.199
  115.192.2.141
  115.192.238.67
  115.192.34.237
+115.192.61.226
  115.193.163.81
  115.193.166.211
  115.193.169.13
  115.193.19.150
-115.193.7.242
  115.194.188.60
  115.194.40.221
  115.195.143.180
@@ -21408,23 +21771,28 @@
  115.196.247.87
  115.196.52.62
  115.197.173.196
+115.197.188.170
  115.197.19.77
  115.197.245.171
  115.197.83.141
+115.198.227.193
  115.198.229.1
  115.198.234.222
-115.198.38.25
+115.198.84.245
  115.199.106.191
  115.199.111.204
  115.199.126.246
  115.199.181.225
+115.199.65.153
  115.199.66.154
  115.20.157.220
  115.20.174.59
  115.20.180.18
  115.20.189.226
  115.200.121.27
+115.200.123.209
  115.200.202.109
+115.200.65.130
  115.201.105.118
  115.201.169.141
  115.201.190.230
@@ -21433,10 +21801,10 @@
  115.201.42.185
  115.201.47.10
  115.201.6.120
+115.201.6.134
  115.201.6.206
  115.201.7.214
  115.202.237.182
-115.203.129.234
  115.204.123.213
  115.204.165.171
  115.204.201.240
@@ -21456,42 +21824,38 @@
  115.207.206.236
  115.207.252.184
  115.207.255.30
-115.207.4.168
+115.207.81.103
  115.207.9.109
-115.207.99.78
  115.208.100.88
  115.208.115.120
  115.208.117.143
  115.208.123.133
  115.208.126.111
  115.208.134.3
+115.208.167.197
  115.208.192.204
  115.208.204.5
  115.208.208.231
+115.208.227.164
  115.208.32.55
  115.208.50.106
  115.208.61.7
+115.208.92.97
  115.208.98.118
+115.208.99.182
  115.209.28.244
+115.209.29.239
  115.209.52.156
  115.209.66.166
-115.209.8.248
  115.21.13.61
  115.21.29.160
  115.21.89.222
-115.210.180.108
-115.210.181.46
-115.210.182.191
-115.210.182.3
-115.210.183.181
-115.210.76.70
-115.210.77.14
  115.211.149.190
  115.211.190.175
-115.212.15.199
+115.212.14.72
  115.212.183.84
  115.212.2.56
-115.212.81.208
+115.212.56.161
  115.213.128.170
  115.214.184.5
  115.214.187.239
@@ -21519,20 +21883,17 @@
  115.217.252.59
  115.217.254.78
  115.217.33.95
-115.217.78.30
  115.218.114.89
  115.218.122.19
  115.218.123.158
-115.218.128.135
+115.218.131.30
  115.218.2.79
  115.218.96.13
  115.218.96.149
  115.218.96.17
-115.219.148.33
  115.219.86.76
  115.219.90.185
  115.219.93.234
-115.219.94.126
  115.22.117.80
  115.22.121.34
  115.22.139.177
@@ -21565,12 +21926,12 @@
  115.224.21.22
  115.224.88.245
  115.226.119.144
-115.226.130.110
-115.226.156.35
  115.226.219.216
  115.227.101.41
-115.227.195.123
+115.227.185.211
  115.229.11.214
+115.229.203.63
+115.229.224.182
  115.229.249.129
  115.23.112.218
  115.23.161.204
@@ -21578,13 +21939,13 @@
  115.23.196.182
  115.23.199.220
  115.23.223.53
-115.23.223.56
  115.23.223.63
  115.23.223.68
  115.23.223.71
  115.23.223.9
  115.23.224.52
  115.23.31.133
+115.23.48.47
  115.23.49.133
  115.23.58.207
  115.23.68.166
@@ -21620,11 +21981,13 @@
  115.231.231.3
  115.231.242.206
  115.231.27.81
+115.231.67.2
  115.233.210.218
  115.233.218.204
  115.233.218.205
  115.233.224.130
  115.233.227.58
+115.236.100.36
  115.236.119.139
  115.236.13.186
  115.236.182.133
@@ -21635,6 +21998,7 @@
  115.236.32.130
  115.236.38.120
  115.236.50.98
+115.236.52.122
  115.236.52.28
  115.236.61.2
  115.236.62.43
@@ -21645,6 +22009,7 @@
  115.236.8.253
  115.236.83.114
  115.236.87.26
+115.238.161.234
  115.238.164.123
  115.238.175.90
  115.238.191.219
@@ -21653,6 +22018,7 @@
  115.238.49.107
  115.238.61.222
  115.238.62.154
+115.238.65.36
  115.238.67.22
  115.238.97.2
  115.239.2.86
@@ -21670,21 +22036,20 @@
  115.239.66.248
  115.239.66.25
  115.239.67.17
-115.239.80.29
  115.240.115.210
  115.241.164.10
  115.242.8.153
  115.243.35.98
  115.248.28.145
+115.249.31.3
  115.254.63.50
  115.28.156.119
  115.28.172.65
-115.28.186.180
  115.28.208.35
+115.28.211.230
  115.28.241.52
  115.28.36.14
  115.29.102.204
-115.29.141.60
  115.29.151.56
  115.29.198.37
  115.29.5.153
@@ -21692,257 +22057,264 @@
  115.31.111.202
  115.31.167.28
  115.31.65.161
+115.36.165.53
  115.36.91.46
  115.37.147.201
  115.37.196.148
  115.38.173.209
  115.38.178.51
  115.38.188.214
-115.4.56.5
  115.40.112.138
-115.40.80.163
+115.40.214.42
  115.40.81.106
  115.41.165.38
  115.41.28.249
+115.42.122.194
  115.42.127.133
  115.42.151.75
  115.42.19.249
-115.42.44.94
+115.42.66.248
+115.42.76.40
  115.43.9.20
+115.43.97.27
+115.44.108.114
  115.44.109.32
-115.44.137.111
  115.44.80.25
  115.45.102.227
  115.45.104.103
  115.45.178.25
  115.46.131.122
  115.47.53.34
-115.48.129.236
-115.48.130.252
+115.48.130.219
  115.48.131.146
+115.48.132.7
  115.48.134.181
-115.48.141.248
-115.48.144.122
-115.48.145.174
+115.48.144.169
+115.48.147.25
  115.48.148.116
-115.48.148.22
-115.48.153.177
-115.48.157.12
+115.48.148.245
+115.48.148.82
+115.48.149.210
+115.48.153.253
+115.48.157.121
  115.48.17.86
  115.48.180.127
  115.48.183.26
  115.48.190.19
  115.48.197.63
-115.48.200.54
-115.48.201.173
+115.48.200.3
+115.48.202.135
+115.48.202.146
+115.48.202.155
+115.48.202.83
  115.48.205.78
-115.48.208.17
-115.48.211.216
  115.48.212.139
  115.48.228.241
  115.48.231.177
  115.48.46.61
-115.48.52.95
  115.48.54.224
-115.48.55.45
-115.48.87.146
-115.49.120.218
+115.48.82.209
+115.48.84.106
  115.49.154.168
-115.49.21.89
+115.49.209.57
  115.49.210.221
  115.49.211.89
  115.49.215.114
  115.49.227.139
  115.49.232.204
-115.49.243.163
-115.49.244.216
-115.49.25.252
-115.49.31.191
-115.49.36.146
+115.49.253.171
+115.49.3.188
  115.49.36.30
  115.49.37.204bin.sh
+115.49.41.142
  115.49.43.107
-115.49.43.119
  115.49.43.177
  115.49.45.132
-115.49.45.22
  115.49.46.223
-115.49.61.53
-115.49.72.38
-115.49.72.61
+115.49.60.215
+115.49.72.227
  115.49.72.68
+115.49.73.13
  115.49.73.34
-115.49.73.7
  115.49.75.165
-115.49.76.102
+115.49.76.129
  115.49.76.183
  115.49.78.108
  115.49.78.142
  115.49.78.51
  115.49.96.91
+115.49.96.97
  115.49.97.55
  115.50.0.131
-115.50.101.67
-115.50.102.119
+115.50.100.18
  115.50.103.177
-115.50.105.29
-115.50.107.234
-115.50.108.129
-115.50.110.190
-115.50.156.1
-115.50.157.163
+115.50.105.75
+115.50.109.139
+115.50.110.108
+115.50.124.52
+115.50.135.212
+115.50.144.53
+115.50.149.59
+115.50.150.22
+115.50.154.132
  115.50.158.179
  115.50.160.53
-115.50.162.126
  115.50.164.216
  115.50.166.184
-115.50.168.6
-115.50.173.179
+115.50.171.42
  115.50.173.80
  115.50.174.185
  115.50.187.9
-115.50.20.161
  115.50.20.66
  115.50.205.237
  115.50.207.184
-115.50.208.154
-115.50.208.188
-115.50.211.23
-115.50.211.8
+115.50.209.183
+115.50.210.204
+115.50.210.236
+115.50.215.124
  115.50.215.95
+115.50.218.125
  115.50.219.28
-115.50.221.241
-115.50.225.212
-115.50.226.29
  115.50.226.83
-115.50.230.55
-115.50.232.137
-115.50.233.65
-115.50.234.197
-115.50.238.177
-115.50.240.27
+115.50.227.93
+115.50.229.104
+115.50.229.31
+115.50.233.176
  115.50.240.33
  115.50.240.49
+115.50.241.198
  115.50.247.130
-115.50.251.79
-115.50.3.137
-115.50.3.22
-115.50.3.67
+115.50.250.46
+115.50.254.169
+115.50.32.10
  115.50.33.128
+115.50.33.206
  115.50.33.224
-115.50.33.42
+115.50.33.69
  115.50.35.69
-115.50.44.109
+115.50.38.235
+115.50.4.204
  115.50.5.130
+115.50.5.216
  115.50.56.92
-115.50.60.207
+115.50.57.245
+115.50.6.54
  115.50.63.60
-115.50.65.215
-115.50.67.129
-115.50.67.164
-115.50.68.147
+115.50.64.25
+115.50.65.254
+115.50.66.202
+115.50.67.168
  115.50.68.184
-115.50.69.186
-115.50.69.201
+115.50.7.223
  115.50.70.91
-115.50.71.46
+115.50.78.89
  115.50.80.154
  115.50.82.93
-115.50.93.62
-115.51.105.97
+115.50.82.99
+115.50.89.182
+115.50.96.237
  115.51.110.122
  115.51.110.250
-115.51.111.124
-115.51.122.255
+115.51.125.104
+115.51.125.242
+115.51.125.62
  115.51.29.199
  115.51.47.80
-115.52.106.68
+115.51.95.166
  115.52.107.178
-115.52.111.190
-115.52.118.195
+115.52.108.117
  115.52.12.28
-115.52.122.237
  115.52.122.8
+115.52.163.150
  115.52.163.204
  115.52.18.152
  115.52.18.222
-115.52.20.68
+115.52.18.42
+115.52.190.92
+115.52.234.25
  115.52.236.171
+115.52.238.96
+115.52.43.119
  115.52.58.160
+115.52.60.57
  115.53.129.151
  115.53.134.16
-115.53.201.48
-115.53.202.43
+115.53.202.32
+115.53.203.164
  115.53.229.152
-115.53.237.123
+115.53.234.183
+115.53.235.44
+115.53.24.67
  115.53.248.17
-115.53.253.172
-115.53.254.218
  115.53.254.48
  115.53.61.40
  115.53.77.89
  115.53.78.87
  115.53.79.106
-115.54.100.146
+115.53.95.186
  115.54.129.10
  115.54.152.176
  115.54.153.182
  115.54.157.150
+115.54.170.227
  115.54.183.113
+115.54.187.69
  115.54.200.181
  115.54.205.92
-115.54.207.36
-115.54.208.121
-115.54.208.195
+115.54.209.163
+115.54.213.129
+115.54.213.238
+115.54.213.28
  115.54.214.163
-115.54.215.130
+115.54.214.65
  115.54.235.170
-115.54.236.132
  115.54.236.192
-115.54.239.210
-115.54.239.226
  115.54.239.57
+115.54.242.182
  115.54.243.83
  115.54.249.91
-115.54.70.49
  115.55.104.20
-115.55.109.46
  115.55.109.67
  115.55.116.137
  115.55.119.196
-115.55.128.161
-115.55.128.215
+115.55.128.97
  115.55.129.241
  115.55.130.195
  115.55.130.55
  115.55.131.30
+115.55.132.64
  115.55.132.65
-115.55.135.85
+115.55.136.179
  115.55.137.51
-115.55.138.6
+115.55.138.4
  115.55.139.146
+115.55.139.49
+115.55.141.178
  115.55.141.193
-115.55.143.62
+115.55.141.60
  115.55.144.195
  115.55.144.27
  115.55.145.105
  115.55.145.253
+115.55.146.140
  115.55.146.3
  115.55.149.192
  115.55.149.197
  115.55.149.253
  115.55.149.83
  115.55.150.245
+115.55.150.47
  115.55.151.165
+115.55.151.89
  115.55.151.94
-115.55.153.177
-115.55.153.60
+115.55.152.62
+115.55.153.61
  115.55.153.83
  115.55.154.143
  115.55.154.201
  115.55.155.58
-115.55.155.99
  115.55.156.206
+115.55.157.129
  115.55.157.2
  115.55.157.45
  115.55.157.5
@@ -21951,125 +22323,137 @@
  115.55.159.46
  115.55.159.76
  115.55.161.184
+115.55.176.11
  115.55.177.44
  115.55.178.66
+115.55.179.183
  115.55.180.53
-115.55.181.113
-115.55.181.51
-115.55.184.0
-115.55.187.168
-115.55.190.173
-115.55.191.68
-115.55.193.65
+115.55.187.144
+115.55.187.212
  115.55.202.175
-115.55.207.171
+115.55.208.136
  115.55.208.186
-115.55.210.59
+115.55.214.209
  115.55.221.182
  115.55.224.29
+115.55.227.144
  115.55.27.190
+115.55.29.210
  115.55.29.22
  115.55.32.190
-115.55.39.154
+115.55.41.233
  115.55.41.246
+115.55.43.252
+115.55.60.5
  115.55.78.238
  115.55.89.18
  115.55.90.41
+115.55.93.188
  115.56.111.53
+115.56.113.252
  115.56.114.233
  115.56.115.248
-115.56.124.83
  115.56.128.11
  115.56.128.237
+115.56.128.57
  115.56.129.141
+115.56.129.29
  115.56.130.26
  115.56.130.85
  115.56.131.72
-115.56.132.102
+115.56.132.147
  115.56.132.235
+115.56.133.57
  115.56.134.90
  115.56.135.103bin.sh
-115.56.135.214
  115.56.135.247
+115.56.136.214
  115.56.136.78
+115.56.137.151
  115.56.137.196
  115.56.137.47
  115.56.140.64
-115.56.141.189
+115.56.141.39
  115.56.143.125
  115.56.143.13
+115.56.143.56
+115.56.145.180
  115.56.145.249
  115.56.146.213
-115.56.147.219
  115.56.147.73
  115.56.149.155
  115.56.149.92
  115.56.152.221
  115.56.152.235
-115.56.152.3
  115.56.153.210bin.sh
  115.56.153.93
-115.56.155.120
  115.56.155.255
  115.56.156.200
  115.56.157.33
  115.56.159.190
+115.56.159.48
  115.56.161.84
-115.56.162.178
  115.56.162.240
-115.56.169.55
  115.56.175.203
-115.56.180.168
  115.56.181.117
  115.56.181.237
  115.56.182.15
  115.56.182.87
+115.56.183.0
  115.56.183.203
-115.56.186.121
+115.56.185.37
  115.56.189.100
  115.56.189.174
  115.56.197.113
+115.56.197.147
  115.56.200.109
-115.56.202.41
-115.56.216.168
-115.56.217.221
+115.56.202.227
  115.56.219.110
  115.56.24.68
-115.56.99.175
+115.56.27.109
+115.56.42.112
+115.56.96.124
+115.58.1.67
  115.58.10.64
+115.58.103.93
+115.58.104.93
  115.58.11.236
  115.58.12.69
  115.58.132.212
  115.58.132.230
-115.58.132.250
  115.58.132.6
  115.58.133.121
  115.58.133.14
+115.58.133.193
+115.58.133.199
  115.58.133.49
  115.58.134.105
-115.58.134.165
+115.58.134.159
+115.58.134.194
  115.58.135.179
  115.58.135.221
  115.58.14.205
-115.58.140.33
  115.58.141.145
  115.58.153.154
  115.58.155.63
  115.58.162.230
+115.58.162.50
  115.58.168.104
+115.58.18.119
  115.58.18.59
-115.58.192.150
+115.58.194.6
+115.58.199.151
  115.58.2.34
+115.58.20.136
  115.58.201.75
  115.58.209.70
  115.58.37.44
-115.58.41.84
  115.58.82.191
  115.58.9.115
  115.58.9.66
  115.58.94.162
  115.58.95.88
-115.59.101.237
+115.59.100.164
  115.59.101.241
  115.59.101.91
  115.59.117.122
@@ -22078,143 +22462,149 @@
  115.59.145.236
  115.59.17.171
  115.59.173.19
-115.59.196.169
-115.59.197.21
+115.59.193.21
+115.59.196.131
  115.59.199.35
-115.59.200.115
-115.59.200.84
-115.59.209.37
+115.59.199.95
+115.59.200.219
+115.59.209.160
+115.59.209.5
+115.59.210.137
  115.59.210.230
+115.59.210.42
  115.59.210.68
+115.59.211.137
  115.59.211.189
+115.59.212.122
+115.59.212.92
+115.59.217.230
  115.59.218.92
  115.59.219.110
  115.59.219.99
-115.59.222.121
+115.59.22.232
+115.59.220.246
  115.59.225.137
  115.59.225.174
  115.59.225.253
  115.59.225.37
  115.59.229.205
+115.59.230.144
  115.59.230.79
  115.59.231.193
  115.59.234.162
  115.59.237.137
-115.59.242.96
  115.59.243.177
+115.59.253.223
  115.59.255.14
+115.59.255.140
+115.59.255.224
  115.59.255.40
  115.59.76.195
  115.59.80.145
+115.59.80.216
  115.59.82.114
  115.59.97.97
-115.59.98.81
-115.60.183.177
  115.60.201.21
  115.60.202.230
  115.60.58.242
-115.60.62.53
+115.60.59.63
+115.60.60.203
+115.60.63.183
  115.61.10.132
-115.61.100.5
+115.61.101.218
  115.61.102.167
-115.61.102.57
+115.61.103.122
  115.61.103.136
  115.61.104.59
+115.61.104.78
  115.61.105.26
  115.61.106.10
+115.61.109.171
+115.61.109.237
+115.61.110.184
  115.61.111.193
  115.61.111.225
  115.61.120.103
  115.61.120.180
  115.61.120.84
  115.61.121.109
-115.61.121.220
  115.61.121.70
  115.61.121.71
  115.61.121.86
  115.61.122.148
-115.61.122.29
  115.61.122.68
-115.61.124.233
-115.61.124.24
-115.61.128.181
+115.61.123.0
+115.61.126.45
  115.61.129.7
-115.61.136.106
  115.61.136.123
-115.61.137.34
  115.61.137.57
  115.61.14.175
-115.61.144.170
  115.61.144.220
-115.61.160.132
-115.61.160.2
+115.61.160.163
  115.61.164.133
-115.61.170.48
-115.61.173.126
-115.61.175.64
-115.61.178.102
+115.61.165.228
+115.61.166.127
+115.61.167.158
+115.61.174.249
  115.61.180.234
-115.61.187.154
+115.61.184.20
  115.61.192.163
  115.61.195.198
  115.61.210.181
-115.61.244.4
  115.61.245.180
  115.61.254.248
  115.61.3.206
-115.61.38.29
  115.61.72.93
  115.61.78.142
  115.61.96.133
-115.61.98.160
+115.61.96.196
  115.61.98.191
  115.61.98.77
  115.62.134.206
  115.62.144.135
-115.62.171.81
+115.62.153.218
  115.62.34.136
  115.62.5.120
  115.63.101.79
+115.63.128.212
  115.63.129.47
  115.63.132.128
  115.63.134.60
-115.63.137.110
+115.63.135.107
  115.63.139.110
  115.63.139.114
+115.63.141.165
  115.63.142.27
-115.63.178.52
  115.63.179.173
  115.63.179.18
  115.63.179.227
-115.63.181.180
+115.63.181.232
+115.63.181.87
+115.63.183.83
  115.63.186.148
  115.63.189.176
  115.63.19.124
-115.63.191.217
+115.63.190.241
  115.63.200.123
  115.63.200.149
  115.63.201.175
-115.63.23.201
-115.63.26.163
+115.63.207.104
+115.63.36.236
  115.63.37.173
  115.63.38.184
  115.63.38.193
  115.63.38.46
-115.63.38.62
  115.63.38.96
-115.63.39.131
-115.63.39.234
-115.63.46.242
  115.63.58.247
-115.63.64.54
  115.63.66.157
  115.63.68.165
+115.63.68.190
  115.63.83.222
  115.63.89.9
  115.63.9.179
-115.64.139.76
  115.64.200.155
  115.64.218.1
+115.64.234.107
  115.66.0.78
  115.66.109.141
  115.66.110.55
@@ -22229,15 +22619,16 @@
  115.68.190.124
  115.68.2.144
  115.68.207.186
+115.68.228.71
  115.68.232.221
  115.68.232.45
  115.68.45.169
  115.68.52.240
  115.69.102.84
+115.69.106.214
  115.69.106.28
  115.69.106.48
  115.69.107.253
-115.69.117.3
  115.69.120.90
  115.69.126.27
  115.69.210.107
@@ -22256,9 +22647,9 @@
  115.71.239.208
  115.72.121.39
  115.72.134.101
-115.72.134.231
  115.72.134.40
  115.72.135.15
+115.72.219.250
  115.72.220.7
  115.72.240.216
  115.72.247.160
@@ -22286,7 +22677,6 @@
  115.74.34.5
  115.74.97.223
  115.74.97.226
-115.75.0.145
  115.75.1.156
  115.75.10.105
  115.75.105.248
@@ -22296,15 +22686,17 @@
  115.75.3.137
  115.75.5.17
  115.75.54.24
-115.75.72.92
+115.75.72.103
+115.75.88.73
  115.76.114.164
  115.76.152.55
  115.76.157.232
  115.76.158.87
+115.76.160.191
  115.76.164.228
-115.76.167.56
  115.76.168.100
  115.76.170.42
+115.76.172.18
  115.76.172.38
  115.76.174.179
  115.76.179.237
@@ -22320,9 +22712,10 @@
  115.77.139.94
  115.77.141.226
  115.77.187.194
+115.77.188.228
  115.77.19.34
  115.77.190.164
-115.77.23.49
+115.77.191.180
  115.77.235.187
  115.77.240.222
  115.77.42.54
@@ -22332,9 +22725,13 @@
  115.78.118.58
  115.78.126.92
  115.78.161.106
+115.78.237.62
+115.78.4.219
  115.78.73.217
+115.78.88.0
  115.78.93.4
  115.79.103.119
+115.79.138.163
  115.79.179.155
  115.79.181.66
  115.79.193.105
@@ -22346,31 +22743,29 @@
  115.79.214.222
  115.79.217.21
  115.79.217.45
+115.79.219.88
  115.79.220.245
  115.79.252.158
  115.79.255.19
  115.79.31.56
  115.79.35.110
-115.79.4.223
  115.79.59.157
  115.79.60.184
+115.79.73.120
  115.79.78.65
  115.79.94.63
  115.84.101.78
  115.84.107.186
+115.84.121.28
  115.84.147.66
  115.84.178.112
  115.84.235.77
-115.84.91.136
  115.84.91.38
  115.84.91.63
  115.84.92.149
-115.84.92.198
  115.84.92.214
-115.84.92.243
  115.84.92.51
  115.84.92.92
-115.84.99.60
  115.84.99.72
  115.85.174.190
  115.85.192.91
@@ -22392,13 +22787,11 @@
  115.86.251.164
  115.86.31.48
  115.86.57.3
-115.86.6.14
  115.86.60.50
  115.86.69.30
  115.87.245.148
  115.87.249.205
  115.88.128.130
-115.88.133.148
  115.88.138.251
  115.88.240.91
  115.88.60.251
@@ -22421,16 +22814,17 @@
  115.96.136.28
  115.96.213.213
  115.96.65.238
+115.96.76.166
+115.97.18.157
  115.97.19.157
  115.97.31.199
  115.97.83.137
  115.98.0.71
-115.98.206.34
+115.98.47.35
  115.98.71.54
  115.99.115.105
  115.99.148.82
  115.99.191.95
-115.99.29.168
  11515-dot-phonic-obelisk-274214.uk.r.appspot.com
  1152crump.com
  115video.com
@@ -22440,6 +22834,7 @@
  116.0.23.221
  116.0.37.130
  116.0.38.35
+116.0.43.238
  116.0.52.118
  116.0.52.242
  116.0.54.30
@@ -22455,12 +22850,12 @@
  116.1.55.221
  116.1.56.203
  116.1.81.240
+116.10.133.198
  116.10.189.116
  116.10.189.21
  116.100.113.187
  116.100.120.243
  116.100.154.157
-116.100.159.116
  116.100.252.175
  116.100.254.53
  116.100.36.17
@@ -22470,6 +22865,7 @@
  116.100.91.136
  116.101.20.83
  116.102.11.220
+116.102.111.239
  116.102.119.86
  116.102.123.201
  116.102.135.222
@@ -22515,8 +22911,8 @@
  116.107.172.156
  116.107.242.16
  116.108.139.96
+116.108.140.217
  116.108.180.221
-116.108.232.105
  116.108.97.58
  116.109.101.159
  116.109.105.230
@@ -22527,23 +22923,27 @@
  116.109.197.64
  116.109.21.194
  116.109.234.145
+116.109.69.195
  116.11.186.63
  116.11.20.42
  116.110.0.103
  116.110.10.91
  116.110.120.255
+116.110.123.122
  116.110.158.243
  116.110.182.142
  116.110.21.118
+116.110.29.249
  116.110.4.183
+116.110.43.86
  116.110.72.96
  116.110.74.227
  116.110.84.232
  116.110.85.35
  116.110.86.113
-116.111.113.106
  116.111.119.118
  116.111.177.48
+116.111.82.219
  116.112.130.238
  116.112.30.108
  116.112.42.234
@@ -22555,7 +22955,7 @@
  116.114.19.204
  116.114.19.211
  116.114.191.206
-116.114.207.39
+116.114.208.60
  116.114.210.64
  116.114.212.60
  116.114.88.68
@@ -22627,6 +23027,7 @@
  116.12.187.58
  116.12.212.244
  116.12.226.222
+116.12.251.132
  116.12.51.206
  116.12.52.141
  116.120.108.26
@@ -22646,8 +23047,8 @@
  116.125.199.23
  116.127.121.116
  116.127.121.39
-116.127.74.80
  116.131.195.238
+116.131.206.207
  116.131.212.180
  116.131.222.189
  116.131.225.125
@@ -22658,6 +23059,7 @@
  116.138.13.131
  116.138.14.37
  116.138.14.39
+116.138.15.207
  116.138.231.127
  116.138.51.45
  116.138.55.31
@@ -22670,6 +23072,7 @@
  116.139.123.136
  116.139.199.62
  116.139.2.110
+116.139.201.244
  116.139.255.208
  116.139.51.178
  116.139.6.137
@@ -22677,18 +23080,14 @@
  116.14.122.110
  116.14.127.155
  116.14.14.168
-116.14.148.129
  116.14.149.146
  116.14.17.87
  116.14.227.211
  116.14.228.23
-116.14.33.43
  116.14.34.160
  116.14.38.41
-116.14.49.49
  116.14.61.160
  116.14.66.240
-116.14.68.85
  116.14.86.212
  116.14.89.27
  116.140.100.121
@@ -22713,6 +23112,7 @@
  116.149.240.29
  116.149.242.230
  116.149.243.161
+116.149.243.201
  116.149.243.48
  116.149.247.125
  116.149.247.146
@@ -22745,10 +23145,13 @@
  116.179.149.121
  116.179.32.138
  116.179.32.15
+116.179.32.155
+116.179.32.172
  116.179.32.19
  116.179.32.20
  116.179.32.22
-116.179.32.77
+116.179.32.239
+116.179.32.46
  116.179.32.79
  116.179.32.97
  116.179.65.62
@@ -22756,7 +23159,6 @@
  116.18.228.63
  116.18.229.222
  116.18.229.42
-116.19.125.41
  116.193.133.12
  116.193.152.7
  116.193.159.66
@@ -22766,13 +23168,17 @@
  116.193.218.18
  116.193.218.84
  116.193.219.251
+116.193.242.253
  116.196.101.168
  116.196.105.232
  116.196.108.9
  116.196.113.254
  116.196.119.146
+116.196.120.254
+116.196.124.159
  116.196.125.112
  116.196.15.69
+116.196.72.227
  116.196.74.197
  116.196.75.171
  116.196.85.150
@@ -22782,7 +23188,7 @@
  116.196.94.108
  116.196.95.239
  116.196.97.240
-116.197.129.243
+116.197.129.245
  116.197.131.18
  116.197.133.146
  116.197.134.146
@@ -22796,21 +23202,24 @@
  116.199.172.209
  116.199.172.213
  116.199.172.29
+116.2.124.236
  116.2.64.96
+116.2.69.91
  116.20.21.119
  116.20.21.121
  116.20.21.128
  116.20.21.183
  116.20.21.184
  116.20.21.199
+116.20.21.208
  116.20.21.209
  116.20.21.54
  116.20.21.86
-116.20.21.97
  116.202.0.237
  116.202.10.123
  116.202.101.142
  116.202.103.223
+116.202.108.137
  116.202.113.53
  116.202.114.112
  116.202.13.16
@@ -22850,6 +23259,7 @@
  116.203.185.207
  116.203.200.229
  116.203.211.9
+116.203.22.140
  116.203.221.74
  116.203.230.250
  116.203.244.214
@@ -22862,12 +23272,12 @@
  116.203.60.216
  116.203.61.61
  116.203.75.230
+116.203.80.38
  116.203.92.131
  116.203.99.87
-116.204.155.123
  116.204.171.107
  116.204.254.1
-116.206.148.82
+116.206.232.11
  116.206.233.10
  116.206.233.130
  116.206.235.2
@@ -22885,6 +23295,7 @@
  116.209.27.241
  116.209.56.156
  116.209.62.0
+116.21.40.85
  116.211.118.242
  116.211.118.246
  116.211.118.247
@@ -22906,16 +23317,17 @@
  116.213.43.147
  116.213.43.172
  116.213.43.42
+116.213.43.5
  116.213.52.200
  116.213.52.205
  116.213.52.252
  116.22.196.145
  116.22.44.22
+116.22.45.24
  116.22.6.219
  116.222.44.191
  116.225.108.225
  116.226.79.41
-116.227.146.123
  116.227.81.207
  116.227.96.120
  116.228.113.2
@@ -22932,23 +23344,29 @@
  116.228.4.50
  116.228.53.227
  116.228.98.42
+116.229.52.147
  116.230.60.185
+116.231.80.148
  116.232.102.168
  116.232.85.114
+116.233.118.62
  116.233.19.80
  116.233.226.80
  116.233.80.155
  116.233.87.190
+116.233.94.219
  116.234.203.35
  116.234.249.136
  116.235.56.162
+116.235.59.153
  116.236.121.78
  116.236.145.14
+116.236.15.171
  116.236.17.59
+116.236.200.254
  116.236.218.66
  116.236.222.106
  116.236.225.218
-116.236.233.3
  116.236.24.140
  116.236.240.101
  116.236.240.102
@@ -22958,36 +23376,27 @@
  116.236.60.114
  116.236.74.78
  116.236.91.34
+116.237.134.61
  116.237.139.23
  116.237.239.42
  116.237.244.51
  116.237.88.199
  116.238.253.26
-116.239.104.148
-116.239.104.38
-116.239.104.41
-116.239.104.80
-116.239.105.150
-116.239.105.176
-116.239.105.190
-116.239.105.249
-116.239.106.210
-116.239.107.123
-116.239.107.184
  116.239.13.149
  116.239.15.26
  116.239.27.145
  116.239.4.130
+116.24.103.216
+116.24.103.45
  116.24.104.17
  116.24.104.65
  116.24.106.190
-116.24.154.255
-116.24.154.69
+116.24.189.241
+116.24.59.109
+116.24.64.164
  116.24.64.85
  116.24.66.69
-116.24.82.19
-116.24.83.140
-116.24.83.168
+116.24.83.180
  116.240.199.84
  116.241.102.247
  116.241.108.189
@@ -23004,6 +23413,7 @@
  116.247.101.100
  116.247.81.100
  116.247.81.99
+116.247.82.9
  116.247.87.66
  116.248.172.151
  116.248.172.187
@@ -23011,14 +23421,15 @@
  116.248.172.219
  116.248.172.223
  116.248.172.31
-116.248.172.43
  116.248.88.225
  116.249.127.46
-116.249.153.85
-116.249.208.177
+116.249.153.220
  116.25.133.12
+116.25.225.176
+116.25.227.99
+116.25.251.147
+116.25.38.80
  116.25.39.184
-116.25.94.87
  116.252.134.40
  116.252.204.88
  116.252.208.123
@@ -23031,6 +23442,7 @@
  116.252.54.230
  116.252.80.130
  116.252.80.181
+116.252.95.211
  116.254.100.165
  116.254.101.173
  116.254.103.181
@@ -23075,23 +23487,25 @@
  116.29.89.139
  116.3.102.225
  116.3.109.131
-116.3.207.241
+116.3.193.135
  116.3.210.205
-116.30.199.78
+116.3.98.41
  116.30.216.169
  116.30.221.237
+116.30.222.153
  116.30.223.104
  116.30.223.152
  116.30.223.178
+116.30.223.60
  116.30.250.69
  116.30.251.62
  116.31.102.81
+116.31.102.82
  116.31.119.129
  116.31.18.66
  116.31.75.162
  116.33.43.41
  116.36.195.112
-116.4.9.5
  116.4.96.114
  116.4.96.132
  116.4.96.133
@@ -23105,15 +23519,14 @@
  116.4.96.83
  116.4.96.95
  116.4.97.117
+116.4.97.141
  116.4.97.149
  116.4.97.151
-116.4.97.191
  116.4.97.250
  116.4.97.57
  116.4.97.76
  116.4.97.86
  116.4.97.90
-116.40.150.131
  116.42.200.146
  116.45.89.236
  116.46.200.162
@@ -23122,6 +23535,7 @@
  116.48.109.35
  116.48.136.128
  116.48.140.186
+116.48.150.247
  116.48.155.39
  116.48.17.59
  116.48.251.131
@@ -23160,7 +23574,6 @@
  116.54.59.238
  116.55.101.228
  116.55.13.36
-116.55.216.71
  116.55.227.143
  116.55.227.177
  116.55.229.234
@@ -23168,24 +23581,23 @@
  116.55.243.36
  116.55.245.26
  116.55.248.101
+116.55.248.214
  116.57.185.0
  116.58.171.67
+116.58.172.118
  116.58.179.3
  116.58.224.56
+116.58.227.100
  116.58.227.40
  116.58.228.124
-116.58.229.173
  116.58.229.21
  116.58.232.114
  116.58.232.127
  116.58.232.135
  116.58.232.143
-116.58.232.148
  116.58.232.151
-116.58.232.155
  116.58.232.227
  116.58.232.236
-116.58.232.240
  116.58.233.29
  116.58.235.18
  116.58.235.69
@@ -23195,10 +23607,15 @@
  116.58.239.170
  116.58.239.180
  116.58.247.160
+116.58.247.167
+116.58.247.203
  116.58.247.222
+116.58.247.40
  116.58.247.69
  116.58.247.70
+116.58.247.84
  116.58.251.214
+116.58.251.27
  116.58.251.85
  116.58.254.205
  116.58.43.35
@@ -23226,7 +23643,6 @@
  116.6.84.186
  116.62.11.138
  116.62.176.10
-116.62.224.200
  116.62.229.19
  116.62.62.135
  116.63.168.75
@@ -23242,16 +23658,11 @@
  116.68.162.99
  116.68.170.218
  116.68.192.130
-116.68.194.113
  116.68.244.154
-116.68.73.41
-116.7.11.210
+116.68.96.111
  116.7.136.182
-116.7.19.157
  116.7.226.66
  116.7.241.162
-116.7.245.182
-116.7.245.185
  116.7.28.21
  116.7.29.193
  116.7.29.234
@@ -23260,26 +23671,32 @@
  116.7.31.194
  116.7.31.82
  116.7.31.88
-116.7.53.192
  116.72.0.41
  116.72.136.91
  116.72.18.85
-116.72.203.131
+116.72.195.63
  116.72.228.77
  116.72.230.210
+116.72.90.162
  116.73.204.181
  116.73.24.9
  116.73.26.238
  116.73.65.223
  116.73.66.179
-116.73.78.183
  116.74.111.230
+116.74.135.5
  116.74.17.255
  116.74.223.188
+116.74.248.248
  116.74.90.117
  116.75.103.58
  116.75.117.40bin.sh
  116.75.194.101
+116.75.194.107
+116.75.194.15
+116.75.195.151
+116.75.197.62
+116.75.213.206
  116.75.34.61
  116.76.60.119
  116.77.219.64
@@ -23287,6 +23704,7 @@
  116.8.36.153
  116.8.37.69
  116.85.13.82
+116.85.18.123
  116.85.19.16
  116.85.21.194
  116.85.26.21
@@ -23299,6 +23717,7 @@
  116.85.57.226
  116.85.59.252
  116.85.64.107
+116.85.64.148
  116.85.66.176
  116.85.71.133
  116.86.123.187
@@ -23315,6 +23734,8 @@
  116.86.240.28
  116.86.248.201
  116.86.253.69
+116.86.37.88
+116.86.40.202
  116.86.5.4
  116.86.61.221
  116.86.7.186
@@ -23322,6 +23743,7 @@
  116.86.88.161
  116.87.117.103
  116.87.125.199
+116.87.127.224
  116.87.136.6
  116.87.15.244
  116.87.153.119
@@ -23372,6 +23794,7 @@
  116.89.1.116
  116.89.116.32
  116.89.116.6
+116.89.127.30
  116.89.17.217
  116.89.25.130
  116.89.36.149
@@ -23390,7 +23813,6 @@
  116.90.229.186
  116.90.230.243
  116.90.231.106
-116.90.237.125
  116.90.59.223
  116.90.82.181
  116.90.82.184
@@ -23408,15 +23830,16 @@
  116.95.129.30
  116.95.207.39
  116.95.58.60
-116.96.106.20
-116.97.41.184
+116.97.53.8
+116.97.77.204
  116.98.140.102
-116.98.142.192
  116.98.160.70
+116.98.163.103
  116.98.166.185
  116.98.167.31
  116.98.167.59
  116.98.169.139
+116.98.170.49
  116.98.246.214
  116.98.254.156
  116.98.81.147
@@ -23425,9 +23848,12 @@
  116151147136715.002.sh.cn
  1164e4989ededf518a4.yolasite.com
  1169732-dot-phonic-obelisk-274214.uk.r.appspot.com
+117.0.136.128
  117.0.162.140
  117.0.204.224
  117.0.34.156
+117.0.38.177
+117.0.56.209
  117.0.58.123
  117.0.59.121
  117.1.120.59
@@ -23440,6 +23866,7 @@
  117.1.169.208
  117.1.20.33
  117.10.211.26
+117.10.52.177
  117.10.93.150
  117.102.102.155
  117.102.104.44
@@ -23465,7 +23892,9 @@
  117.102.84.142
  117.102.86.174
  117.102.87.138
-117.102.92.13
+117.102.92.10
+117.103.155.138
+117.103.168.219
  117.103.192.36
  117.103.2.106
  117.103.2.114
@@ -23492,12 +23921,12 @@
  117.114.171.227
  117.114.175.67
  117.117.149.13
-117.117.165.131
  117.117.96.24
  117.119.83.20
  117.119.97.82
  117.12.193.25
  117.12.197.32
+117.12.237.87
  117.120.58.1
  117.120.58.129
  117.120.58.250
@@ -23508,11 +23937,11 @@
  117.121.100.11
  117.121.204.80
  117.121.213.207
-117.121.213.214
  117.121.215.101
  117.121.241.3
  117.121.38.172
  117.121.38.246
+117.121.38.28
  117.121.9.115
  117.122.208.146
  117.122.225.219
@@ -23524,7 +23953,6 @@
  117.127.16.205
  117.127.16.207
  117.127.16.208
-117.13.244.192
  117.13.245.63
  117.13.8.87
  117.131.179.66
@@ -23536,6 +23964,7 @@
  117.131.43.197
  117.131.43.198
  117.132.1.47
+117.132.1.50
  117.132.3.231
  117.135.226.105
  117.135.226.82
@@ -23554,8 +23983,6 @@
  117.14.216.248
  117.14.220.176
  117.141.105.44
-117.141.112.147
-117.141.116.149
  117.141.117.137
  117.141.117.229
  117.141.132.184
@@ -23581,6 +24008,7 @@
  117.149.10.58
  117.149.164.157
  117.149.20.18
+117.149.21.145
  117.15.169.130
  117.15.235.149
  117.15.53.116
@@ -23589,25 +24017,22 @@
  117.156.119.39
  117.156.130.161
  117.156.40.106
-117.156.40.107
  117.156.54.226
  117.157.101.149
  117.157.71.49
  117.157.78.2
  117.157.94.13
+117.157.98.211
  117.158.107.189
  117.158.112.27
  117.158.116.104
  117.158.152.86
  117.158.175.162
  117.158.208.232
-117.158.208.67
  117.158.208.68
-117.158.228.29
  117.158.61.254
  117.158.65.15
  117.158.66.137
-117.158.77.154
  117.158.77.41
  117.158.78.10
  117.158.78.5
@@ -23623,6 +24048,7 @@
  117.159.246.38
  117.159.246.44
  117.159.7.101
+117.16.136.64
  117.160.210.211
  117.160.220.33
  117.160.220.34
@@ -23662,41 +24088,42 @@
  117.187.136.141
  117.187.251.82
  117.187.64.50
+117.187.66.174
  117.188.39.150
  117.188.57.13
  117.190.105.6
  117.190.242.69
  117.191.101.208
+117.191.50.162
  117.191.56.221
  117.191.67.68
  117.191.68.57
-117.192.224.120
-117.192.224.216
-117.192.224.226
-117.192.225.122
-117.192.227.148
-117.192.227.21
+117.192.221.185
+117.192.224.233
+117.192.226.59
  117.192.42.33
  117.192.46.40
  117.192.8.86
-117.193.162.210
  117.193.79.162
+117.194.160.212
+117.194.160.224
+117.194.160.241
  117.194.160.44
-117.194.161.166
-117.194.161.57
  117.194.161.64
-117.194.161.66
-117.194.162.151
-117.194.163.11
-117.194.163.85
-117.194.164.52
-117.194.165.176
-117.194.165.188
-117.194.165.234
+117.194.162.123
+117.194.162.183
+117.194.162.239
+117.194.163.246
+117.194.164.159
+117.194.164.165
+117.194.165.215
+117.194.165.216
+117.194.165.222
+117.194.166.162
+117.194.166.29
  117.194.167.173
  117.194.167.80
  117.194.253.114
-117.194.51.19
  117.195.117.84
  117.195.119.98
  117.195.49.142
@@ -23704,7 +24131,6 @@
  117.195.51.240
  117.195.55.246
  117.195.62.36
-117.196.178.44
  117.196.235.143
  117.196.237.184
  117.196.237.83
@@ -23712,30 +24138,34 @@
  117.196.237.92
  117.196.238.113
  117.196.238.240
+117.196.238.249
  117.196.238.6
  117.196.238.62
  117.196.239.239
  117.196.250.210
-117.196.49.155
-117.196.49.90
-117.196.51.123
+117.196.51.75
  117.197.102.195
  117.197.126.130
  117.197.127.98
+117.197.60.190
  117.197.60.81
-117.197.62.139
+117.197.63.165
  117.198.101.213
-117.198.204.207
+117.198.106.242
+117.198.108.134
+117.198.109.1
  117.198.218.70
-117.198.232.151
  117.199.112.249
+117.199.203.117
  117.199.226.180
  117.199.231.148
+117.199.34.134
  117.199.46.23
  117.2.133.106
  117.2.137.179
  117.2.139.117
  117.2.165.12
+117.2.165.159
  117.2.184.254
  117.2.185.72
  117.2.193.158
@@ -23743,6 +24173,7 @@
  117.2.22.85
  117.2.42.116
  117.2.59.71
+117.2.67.93
  117.2.97.232
  117.20.192.45
  117.20.195.117
@@ -23772,28 +24203,41 @@
  117.200.74.116
  117.200.76.30
  117.202.162.1
-117.202.64.46
-117.202.65.165
+117.202.64.114
+117.202.64.143
+117.202.64.181
+117.202.65.12
  117.202.65.188
-117.202.65.204
-117.202.66.252
-117.202.67.119
-117.202.68.12
-117.202.69.49
-117.202.71.203
-117.202.71.60
-117.202.71.91
+117.202.65.32
+117.202.65.40
+117.202.66.115
+117.202.66.236
+117.202.66.27
+117.202.66.29
+117.202.66.76
+117.202.68.138
+117.202.68.8
+117.202.70.130
+117.202.71.116
+117.202.71.153
+117.202.71.160
+117.202.71.198
  117.202.78.126
-117.202.78.194
+117.202.78.255
  117.202.78.38
-117.202.79.63
-117.202.79.75
+117.202.78.86
+117.202.79.121
+117.202.79.14
+117.202.8.55
  117.204.252.122
  117.204.253.159
  117.204.255.60
+117.204.37.201
  117.204.87.100
+117.204.94.140
  117.205.7.202
  117.205.8.27
+117.205.84.84
  117.206.149.225
  117.206.155.158
  117.206.155.82
@@ -23803,8 +24247,12 @@
  117.207.215.116
  117.207.46.39
  117.207.52.231
-117.208.134.51
-117.208.134.75
+117.208.133.198
+117.208.133.97
+117.208.134.193
+117.208.134.220
+117.208.134.255
+117.208.134.48
  117.208.51.51
  117.21.178.28
  117.21.178.33
@@ -23812,8 +24260,6 @@
  117.21.178.49
  117.21.246.46
  117.21.77.34
-117.210.131.159
-117.210.211.232
  117.211.10.118
  117.211.100.22
  117.211.126.230
@@ -23821,36 +24267,41 @@
  117.211.166.168
  117.211.169.164
  117.211.192.70
+117.211.208.77
  117.211.210.9
-117.211.40.134
  117.211.40.180
-117.211.40.45
-117.211.40.81
-117.211.40.87
+117.211.40.227
+117.211.40.75
+117.211.41.105
+117.211.41.142
  117.211.41.31
+117.211.42.29
  117.211.42.48
+117.211.42.56
+117.211.42.93
  117.211.43.210
-117.211.43.55
  117.211.49.188
  117.211.72.6
-117.212.112.127
  117.212.194.172
  117.212.195.227
  117.212.242.183
  117.212.51.164
-117.212.84.115
-117.213.202.5
+117.212.93.15
  117.213.203.86
-117.213.40.111
-117.213.41.49
-117.213.43.158
-117.213.43.165
-117.213.44.220
-117.213.45.108
-117.213.46.46
-117.213.47.230
-117.213.47.78
-117.213.47.98
+117.213.40.194
+117.213.41.104
+117.213.41.155
+117.213.41.191
+117.213.41.56
+117.213.42.44
+117.213.42.94
+117.213.43.233
+117.213.43.50
+117.213.45.61
+117.213.46.173
+117.213.46.197
+117.213.46.240
+117.213.46.82
  117.214.123.217
  117.214.128.238
  117.215.129.36
@@ -23862,65 +24313,63 @@
  117.216.120.185
  117.217.122.93
  117.217.123.62
-117.217.126.171
  117.217.14.29
  117.217.199.138
  117.217.34.102
+117.217.38.163
  117.217.69.150
  117.218.174.250
  117.218.176.164
-117.218.186.165
  117.218.59.146
-117.22.144.166
  117.22.144.190
  117.22.144.227
  117.22.187.207
  117.22.230.94
-117.22.68.116
-117.22.68.20
-117.22.68.79
  117.22.72.228
  117.22.77.107
  117.220.110.60
  117.220.12.23
+117.220.12.40
  117.220.15.119
  117.220.17.27
+117.220.170.193
  117.220.171.105
  117.220.171.209
  117.220.19.135
+117.220.22.102
+117.220.22.166
+117.220.220.74
  117.220.220.99
  117.220.4.130
  117.221.193.224
  117.221.20.41
-117.221.226.223
  117.221.65.129
-117.222.160.150
-117.222.160.16
-117.222.160.169
+117.222.160.31
+117.222.160.40
  117.222.161.121
-117.222.162.11
-117.222.162.230
-117.222.163.8
-117.222.163.87
+117.222.161.132
+117.222.162.168
+117.222.162.188
+117.222.162.87
+117.222.163.242
  117.222.164.148
-117.222.164.206
-117.222.164.38
-117.222.164.44
-117.222.165.133
-117.222.165.169
-117.222.166.151
-117.222.167.164
-117.222.167.202
+117.222.164.83
+117.222.166.61
+117.222.166.76
+117.222.167.186
  117.222.57.193
+117.222.62.115
  117.222.62.139
  117.222.63.12
  117.222.63.132
  117.222.85.193
  117.223.136.107
  117.223.181.82
+117.223.185.194
  117.223.185.195
+117.223.76.210
  117.23.5.151
-117.230.59.4
+117.230.240.128
  117.232.96.204
  117.236.147.159
  117.239.136.179
@@ -23939,6 +24388,7 @@
  117.239.69.202
  117.239.85.202
  117.24.13.239
+117.24.135.74
  117.240.160.178
  117.240.189.2
  117.240.238.230
@@ -23946,53 +24396,49 @@
  117.240.59.115
  117.240.66.195
  117.240.94.122
+117.241.150.112
  117.241.150.62
  117.241.150.91
  117.241.169.25
  117.241.172.3
  117.241.173.40
-117.241.64.116
-117.241.65.134
-117.241.65.216
-117.241.65.87
-117.241.66.25
+117.241.64.5
+117.241.66.204
+117.241.67.216
  117.241.74.33
-117.242.116.230
  117.242.147.101
  117.242.147.109
  117.242.147.5
-117.242.147.69
  117.242.147.73
  117.242.147.97
  117.242.154.112
  117.242.188.82
  117.242.188.84
  117.242.188.86
-117.242.208.105
-117.242.208.155
  117.242.208.165
-117.242.208.232
+117.242.208.218
+117.242.208.56
+117.242.208.83
  117.242.208.93
+117.242.209.145
+117.242.209.150
  117.242.209.173
-117.242.209.242
-117.242.210.241
-117.242.210.26
-117.242.211.130
-117.242.211.131
-117.242.211.27
-117.242.211.66
+117.242.210.1
+117.242.210.12
+117.242.210.130
+117.242.210.170
+117.242.211.0
+117.242.211.203
+117.242.211.59
  117.242.36.249
  117.242.45.133
-117.242.55.102
  117.247.191.243
-117.247.204.195
-117.247.207.207
-117.247.207.89
  117.247.208.108
  117.247.209.129
  117.247.209.130
  117.247.209.158
  117.247.209.195
+117.247.226.29
  117.247.233.149
  117.247.236.51
  117.247.238.10
@@ -24004,18 +24450,24 @@
  117.247.89.13
  117.247.92.104
  117.248.161.70
-117.248.62.136
+117.248.60.139
+117.248.60.169
+117.248.61.110
+117.248.61.18
  117.25.107.78
  117.25.131.187
-117.25.139.39
  117.25.145.151
  117.25.149.254
  117.25.182.90
  117.251.200.50
  117.251.21.23
-117.251.62.56
-117.251.63.108
-117.252.208.195
+117.251.56.200
+117.251.57.113
+117.251.59.51
+117.251.60.249
+117.251.61.192
+117.251.61.204
+117.252.211.146
  117.252.216.89
  117.252.223.147
  117.252.64.161
@@ -24028,43 +24480,49 @@
  117.252.71.187
  117.253.175.52
  117.253.232.181
-117.254.153.164
  117.254.186.98
  117.254.197.13
  117.254.50.51
  117.254.79.228
  117.254.93.234
  117.255.220.201
-117.255.220.70
  117.26.104.225
  117.26.105.235
-117.26.110.169
+117.26.110.196
+117.26.242.171
+117.26.79.20
  117.27.0.175
+117.27.111.172
  117.27.136.42
  117.27.138.38
  117.27.141.118
  117.27.143.206
  117.27.154.44
  117.27.170.107
+117.27.172.54
  117.27.88.61
+117.27.89.145
+117.28.242.132
  117.28.25.50
  117.28.254.143
  117.28.255.165
  117.3.141.51
  117.3.150.201
-117.3.153.6
+117.3.152.89
+117.3.192.236
  117.3.210.111
  117.3.69.209
  117.30.164.119
  117.30.196.192
+117.30.208.97
  117.30.222.122
  117.30.222.168
  117.30.222.36
-117.30.223.231
  117.30.232.48
  117.30.236.21
  117.30.237.225
  117.30.237.78
+117.30.38.71
  117.32.192.151
  117.32.96.34
  117.33.128.218
@@ -24094,8 +24552,6 @@
  117.37.125.254
  117.37.125.58
  117.39.63.34
-117.4.100.181
-117.4.101.26
  117.4.107.199
  117.4.136.11
  117.4.139.62
@@ -24103,6 +24559,7 @@
  117.4.241.135
  117.4.98.133
  117.40.138.178
+117.40.139.82
  117.40.174.2
  117.40.194.166
  117.40.196.138
@@ -24123,11 +24580,15 @@
  117.48.217.116
  117.48.234.141
  117.5.42.174
+117.5.54.110
+117.50.10.109
  117.50.10.244
  117.50.100.216
  117.50.101.117
  117.50.104.206
+117.50.106.150
  117.50.11.192
+117.50.11.3
  117.50.110.19
  117.50.115.156
  117.50.116.120
@@ -24139,12 +24600,15 @@
  117.50.2.235
  117.50.2.38
  117.50.20.103
+117.50.20.123
  117.50.20.77
+117.50.21.232
  117.50.22.148
  117.50.22.167
  117.50.23.52
  117.50.25.188
  117.50.3.142
+117.50.34.131
  117.50.34.6
  117.50.36.137
  117.50.39.62
@@ -24157,33 +24621,41 @@
  117.50.5.37
  117.50.50.186
  117.50.55.132
+117.50.6.160
  117.50.60.193
  117.50.63.120
  117.50.63.227
  117.50.63.253
  117.50.65.167
+117.50.82.156
  117.50.84.240
  117.50.9.239
+117.50.9.39
  117.50.92.209
+117.50.93.157
  117.50.93.75
  117.51.137.24
  117.51.137.82
  117.51.138.89
  117.51.142.47
  117.51.147.103
+117.51.148.80
  117.51.150.202
+117.51.152.118
  117.51.153.18
  117.51.156.217
  117.51.158.223
+117.52.252.252
+117.52.252.83
  117.52.31.220
  117.52.91.248
  117.53.255.20
  117.53.45.125
  117.54.112.22
  117.54.13.174
-117.54.156.246
  117.54.200.134
  117.54.200.186
+117.54.221.74
  117.54.234.36
  117.54.236.1
  117.54.236.25
@@ -24196,8 +24668,6 @@
  117.55.241.61
  117.56.247.87
  117.57.52.10
-117.57.95.118
-117.57.95.14
  117.57.99.170
  117.57.99.31
  117.58.240.177
@@ -24205,6 +24675,7 @@
  117.58.245.114
  117.58.245.66
  117.58.247.20
+117.6.112.67
  117.6.128.250
  117.6.132.117
  117.6.160.167
@@ -24213,10 +24684,9 @@
  117.6.216.209
  117.6.254.97
  117.6.86.134
+117.6.95.52
  117.6.95.76
-117.6.97.194
  117.60.105.233
-117.60.141.249
  117.60.204.195
  117.60.21.70
  117.60.23.136
@@ -24228,8 +24698,9 @@
  117.60.8.70
  117.62.123.93
  117.62.175.106
+117.62.175.61
+117.62.22.250
  117.62.79.146
-117.63.0.91
  117.63.103.76
  117.63.156.234
  117.63.157.34
@@ -24257,24 +24728,30 @@
  117.64.148.159
  117.64.153.13
  117.64.249.169
-117.67.226.62
+117.66.172.189
  117.67.244.73
  117.68.116.88
  117.68.116.91
+117.68.192.249
  117.69.12.95
  117.69.13.201
-117.69.230.83
+117.69.231.168
+117.69.231.95
  117.69.236.30
  117.69.33.87
+117.69.47.192
+117.69.50.34
+117.69.51.209
  117.7.184.188
  117.7.236.110
+117.70.193.193
  117.70.246.73
  117.70.247.8
  117.70.61.114
  117.70.61.151
  117.70.74.67
  117.71.107.24
-117.71.141.77
+117.71.158.2
  117.71.158.52
  117.71.178.178
  117.71.57.195
@@ -24288,6 +24765,7 @@
  117.73.8.68
  117.74.120.224
  117.74.136.106
+117.74.45.247
  117.74.98.18
  117.76.1.113
  117.78.2.26
@@ -24296,6 +24774,8 @@
  117.79.80.93
  117.79.80.94
  117.80.186.244
+117.80.186.67
+117.80.212.113
  117.80.224.192
  117.80.237.141
  117.80.237.246
@@ -24303,7 +24783,6 @@
  117.80.3.54
  117.80.3.99
  117.80.57.158
-117.80.57.93
  117.80.83.186
  117.80.83.57
  117.80.87.37
@@ -24314,15 +24793,12 @@
  117.81.214.109
  117.81.242.138
  117.81.36.66
-117.81.37.11
-117.81.38.182
+117.81.38.12
  117.81.60.28
  117.82.147.129
-117.82.147.134
  117.82.156.195
  117.82.163.209
  117.82.176.42
-117.82.78.44
  117.83.15.246
  117.83.152.56
  117.83.22.185
@@ -24334,14 +24810,13 @@
  117.85.218.227
  117.85.89.213
  117.86.10.144
-117.86.14.114
+117.86.12.229
  117.86.14.44
  117.86.15.247
-117.86.155.236
  117.86.177.219
  117.86.212.189
  117.86.24.209
-117.86.9.250
+117.86.8.124
  117.86.94.149
  117.87.128.157
  117.87.131.167
@@ -24368,13 +24843,14 @@
  117.88.151.152
  117.88.173.4
  117.88.25.154
-117.88.26.25
  117.89.12.183
+117.89.12.197
  117.89.128.132
  117.89.141.32
  117.89.173.188
  117.89.30.61
  117.89.5.114
+117.9.247.19
  117.9.43.222
  117.9.88.38
  117.90.119.186
@@ -24396,31 +24872,20 @@
  117.91.250.50
  117.91.254.24
  117.92.115.149
-117.92.120.125
+117.92.145.45
  117.92.202.109
  117.93.114.188
-117.93.115.137
-117.93.115.143
-117.93.115.172
-117.93.115.57
  117.93.118.225
  117.93.118.65
-117.93.118.84
-117.93.119.54
-117.93.119.64
  117.93.12.235
-117.93.120.146
-117.93.127.238
  117.93.133.110
  117.93.170.155
-117.93.170.23
  117.93.176.207
  117.93.177.56
-117.93.182.114
-117.93.195.30
  117.93.216.98
  117.93.33.55
  117.93.6.51
+117.93.63.174
  117.93.69.14
  117.93.79.226
  117.94.174.64
@@ -24433,6 +24898,7 @@
  117.95.173.64
  117.95.184.11
  117.95.186.102
+117.95.192.128
  117.95.194.127
  117.95.199.199
  117.95.201.82
@@ -24445,8 +24911,8 @@
  117.95.233.139
  117.95.32.19
  117.95.83.122
-117.96.217.21
  117.98.190.157
+117.99.173.6
  117.ip-51-178-82.eu
  11716-45741.ws4.pph-server.de
  1171j.projectsbit.org
@@ -24454,10 +24920,10 @@
  117cbf81fba6f4aaa4363ed99db7fce674427f2d.info
  118.100.22.163
  118.100.49.228
-118.100.6.97
  118.100.71.139
  118.101.149.206
  118.101.192.62
+118.101.192.81
  118.101.252.59
  118.101.3.71
  118.101.47.157
@@ -24481,6 +24947,7 @@
  118.113.176.177
  118.113.192.238
  118.113.193.76
+118.113.231.132
  118.113.72.147
  118.114.104.16
  118.114.169.196
@@ -24488,7 +24955,15 @@
  118.114.237.85
  118.114.239.144
  118.114.33.233
+118.114.97.20
+118.116.10.93
+118.116.107.132
+118.116.107.70
+118.116.108.141
+118.116.108.221
  118.116.109.131
+118.116.111.121
+118.116.111.170
  118.116.121.251
  118.116.15.203
  118.116.178.93
@@ -24499,6 +24974,7 @@
  118.118.52.185
  118.119.104.139
  118.120.145.eliterv.ca
+118.120.52.48
  118.121.198.24
  118.121.57.64
  118.121.61.158
@@ -24533,7 +25009,6 @@
  118.123.244.100
  118.123.244.134
  118.123.244.225
-118.123.245.74
  118.123.245.76
  118.123.246.101
  118.123.247.210
@@ -24543,13 +25018,16 @@
  118.123.249.150
  118.123.249.201
  118.125.106.12
-118.125.227.210
  118.125.227.227
+118.125.244.148
  118.125.245.165
  118.125.93.190
+118.126.105.116
+118.126.105.126
  118.126.105.207
  118.126.109.155
  118.126.113.29
+118.126.114.15
  118.126.116.101
  118.126.117.140
  118.126.117.168
@@ -24577,14 +25055,14 @@
  118.131.132.133
  118.131.21.125
  118.131.36.38
+118.136.134.123
  118.136.14.108
-118.136.207.116
  118.136.63.72
-118.137.2.7
+118.136.76.247
  118.137.248.30
+118.137.75.212
  118.139.178.67
  118.140.150.74
-118.140.160.93
  118.140.176.162
  118.140.187.226
  118.140.38.6
@@ -24615,7 +25093,6 @@
  118.160.7.89
  118.160.84.252
  118.160.84.81
-118.160.96.93
  118.161.156.164
  118.161.159.142
  118.161.91.197
@@ -24630,7 +25107,6 @@
  118.163.13.200
  118.163.13.244
  118.163.146.240
-118.163.146.70
  118.163.163.44
  118.163.169.182
  118.163.180.2
@@ -24654,7 +25130,6 @@
  118.163.68.115
  118.163.70.195
  118.163.74.160
-118.163.74.161
  118.163.89.86
  118.163.91.125
  118.163.97.19
@@ -24687,6 +25162,7 @@
  118.168.164.90
  118.168.19.142
  118.168.19.73
+118.168.217.10
  118.168.22.170
  118.168.92.61
  118.168.96.154
@@ -24701,23 +25177,29 @@
  118.170.43.138
  118.170.56.16
  118.170.57.130
+118.171.112.143
+118.171.125.163
  118.171.196.99
  118.171.200.7
  118.171.55.136
  118.171.95.218
+118.172.1.71
+118.172.113.68
  118.172.115.95
-118.172.12.66
+118.172.128.39
  118.172.130.120
  118.172.133.119
+118.172.134.56
  118.172.135.51
  118.172.141.11
-118.172.15.157
  118.172.15.244
  118.172.159.23
-118.172.159.87
+118.172.159.36
  118.172.176.41
  118.172.181.147
+118.172.182.11
  118.172.184.4
+118.172.185.231
  118.172.188.154
  118.172.201.105
  118.172.201.211
@@ -24734,6 +25216,7 @@
  118.172.228.124
  118.172.228.190
  118.172.228.67
+118.172.247.0
  118.172.34.16
  118.172.34.235
  118.172.34.26
@@ -24744,7 +25227,7 @@
  118.172.49.243
  118.172.51.84
  118.172.54.66
-118.172.60.65
+118.172.58.5
  118.172.61.113
  118.172.97.120
  118.173.108.140
@@ -24753,9 +25236,7 @@
  118.173.150.96
  118.173.153.217
  118.173.156.4
-118.173.163.83
  118.173.165.40
-118.173.194.28
  118.173.197.241
  118.173.217.36
  118.173.225.65
@@ -24773,17 +25254,16 @@
  118.173.235.116
  118.173.235.89
  118.173.239.103
+118.173.250.225
+118.173.42.201
  118.173.54.2
  118.173.70.157
  118.173.74.15
-118.173.77.108
-118.173.83.117
  118.173.92.230
  118.173.97.249
  118.174.0.244
  118.174.12.126
  118.174.182.229
-118.174.187.179
  118.174.196.112
  118.174.196.130
  118.174.196.86
@@ -24793,7 +25273,6 @@
  118.174.219.110
  118.174.22.102
  118.174.220.14
-118.174.220.237
  118.174.220.32
  118.174.220.61
  118.174.232.106
@@ -24807,7 +25286,6 @@
  118.174.233.41
  118.174.233.43
  118.174.233.45
-118.174.234.21
  118.174.234.83
  118.174.46.144
  118.174.46.162
@@ -24819,19 +25297,20 @@
  118.174.79.50
  118.174.82.92
  118.174.99.33
+118.175.13.49
  118.175.183.190
  118.175.207.129
-118.175.207.180
  118.175.207.205
  118.175.207.84
  118.175.225.4
  118.175.226.6
  118.175.227.219
  118.175.228.149
+118.175.228.19
  118.175.235.153
-118.175.235.166
  118.175.235.37
  118.175.236.208
+118.175.240.205
  118.175.244.111
  118.175.46.191
  118.175.7.114
@@ -24843,11 +25322,13 @@
  118.175.93.189
  118.175.93.200
  118.175.93.38
+118.175.93.94
  118.175.93.99
  118.176.102.53
  118.176.102.53bin.sh
  118.176.104.35
  118.176.106.54
+118.176.216.120
  118.176.238.219
  118.176.7.132
  118.178.124.240
@@ -24860,7 +25341,6 @@
  118.179.200.131
  118.179.201.114
  118.179.208.162
-118.179.215.130
  118.179.226.248
  118.179.233.219
  118.179.55.190
@@ -24870,6 +25350,7 @@
  118.182.21.13
  118.182.63.184
  118.182.65.82
+118.184.104.230
  118.184.13.225
  118.184.13.228
  118.184.168.111
@@ -24885,8 +25366,8 @@
  118.184.49.164
  118.184.81.4
  118.185.131.177
-118.185.144.178
  118.185.159.137
+118.185.186.162
  118.185.202.82
  118.185.38.173
  118.186.17.38
@@ -24914,6 +25395,7 @@
  118.187.65.147
  118.187.65.34
  118.188.20.229
+118.188.20.5
  118.189.139.212
  118.189.187.219
  118.189.22.244
@@ -24922,7 +25404,6 @@
  118.189.74.228
  118.189.9.99
  118.19.126.68
-118.190.153.214
  118.190.40.252
  118.190.90.36
  118.193.140.131
@@ -24957,9 +25438,9 @@
  118.193.41.142
  118.193.41.145
  118.193.41.198
-118.193.41.217
  118.193.41.221
  118.193.41.249
+118.193.45.28
  118.193.47.130
  118.194.51.162
  118.200.105.74
@@ -24977,7 +25458,9 @@
  118.201.212.230
  118.201.240.6
  118.201.247.28
+118.201.65.165
  118.202.255.141
+118.208.111.197
  118.209.140.114
  118.209.253.89
  118.21.157.106
@@ -25063,6 +25546,7 @@
  118.233.221.209
  118.233.28.64
  118.233.29.163
+118.233.29.6
  118.233.40.108
  118.233.40.125
  118.233.40.43
@@ -25078,20 +25562,22 @@
  118.238.236.25
  118.239.34.183
  118.24.1.9
+118.24.10.13
  118.24.100.198
-118.24.101.196
  118.24.102.189
  118.24.104.160
  118.24.104.185
  118.24.104.38
  118.24.104.55
  118.24.106.210
+118.24.106.33
  118.24.107.179
  118.24.108.239
  118.24.108.3
  118.24.108.75
  118.24.109.221
  118.24.109.222
+118.24.109.70
  118.24.11.226
  118.24.114.205
  118.24.115.181
@@ -25102,12 +25588,12 @@
  118.24.117.134
  118.24.118.97
  118.24.119.36
-118.24.119.45
  118.24.119.49
  118.24.12.102
  118.24.121.168
  118.24.121.227
  118.24.121.69
+118.24.122.226
  118.24.122.242
  118.24.123.34
  118.24.124.59
@@ -25117,6 +25603,7 @@
  118.24.128.19
  118.24.134.15
  118.24.136.188
+118.24.139.160
  118.24.14.106
  118.24.14.64
  118.24.140.195
@@ -25124,6 +25611,7 @@
  118.24.146.186
  118.24.148.18
  118.24.149.173
+118.24.149.248
  118.24.150.138
  118.24.150.71
  118.24.151.103
@@ -25157,7 +25645,6 @@
  118.24.241.97
  118.24.243.39
  118.24.243.53
-118.24.245.56
  118.24.25.220
  118.24.253.100
  118.24.255.210
@@ -25192,6 +25679,8 @@
  118.24.85.21
  118.24.89.224
  118.24.90.64
+118.24.92.39
+118.240.247.75
  118.241.9.15
  118.243.22.87
  118.243.95.37
@@ -25202,8 +25691,9 @@
  118.244.128.4
  118.244.128.6
  118.244.192.13
-118.249.21.62
+118.244.206.195
  118.249.80.41
+118.25.1.48
  118.25.103.178
  118.25.104.200
  118.25.108.201
@@ -25227,6 +25717,7 @@
  118.25.144.49
  118.25.150.183
  118.25.152.169
+118.25.154.146
  118.25.154.210
  118.25.159.106
  118.25.176.15
@@ -25258,6 +25749,7 @@
  118.25.26.111
  118.25.26.75
  118.25.27.67
+118.25.3.65
  118.25.35.202
  118.25.39.110
  118.25.40.183
@@ -25279,6 +25771,7 @@
  118.25.91.103
  118.25.91.168
  118.25.96.246
+118.25.97.217
  118.250.0.166
  118.250.3.148
  118.250.49.189
@@ -25291,9 +25784,9 @@
  118.254.100.53
  118.254.102.163
  118.254.111.235
-118.254.111.24
  118.254.120.95
  118.254.122.21
+118.254.122.80
  118.254.20.187
  118.254.20.19
  118.254.20.61
@@ -25301,6 +25794,7 @@
  118.26.161.61
  118.26.168.179
  118.26.168.39
+118.27.1.124
  118.27.1.192
  118.27.11.126
  118.27.11.79
@@ -25309,6 +25803,7 @@
  118.27.14.194
  118.27.16.42
  118.27.19.93
+118.27.19.96
  118.27.20.138
  118.27.21.150
  118.27.27.122
@@ -25321,7 +25816,6 @@
  118.27.38.41
  118.27.39.94
  118.27.4.225
-118.27.6.66
  118.27.72.122
  118.27.72.178
  118.27.72.200
@@ -25355,10 +25849,11 @@
  118.31.120.119
  118.31.121.93
  118.31.164.48
-118.31.187.234
  118.31.227.163
  118.31.244.29
  118.31.33.126
+118.31.33.174
+118.31.46.54
  118.31.46.67
  118.31.5.216
  118.31.52.208
@@ -25404,19 +25899,23 @@
  118.35.87.242
  118.35.97.124
  118.36.100.137
-118.36.102.192
  118.36.154.73
  118.36.193.82
  118.36.21.147
  118.36.214.221
+118.36.41.8
  118.36.66.178
  118.36.66.178bin.sh
  118.36.74.168
+118.37.105.145
  118.37.163.99
  118.37.197.49
+118.37.231.58
  118.37.53.196
  118.38.122.198
+118.38.143.41
  118.38.162.122
+118.38.183.12
  118.38.183.87
  118.38.217.2
  118.38.252.136
@@ -25433,6 +25932,7 @@
  118.39.248.53
  118.39.251.34
  118.39.253.86
+118.39.41.134
  118.39.77.10
  118.40.114.97
  118.40.122.21
@@ -25449,11 +25949,11 @@
  118.40.93.205
  118.40.94.152
  118.40.95.222
+118.40.95.236
  118.41.116.65
  118.41.121.21
  118.41.134.182
  118.41.17.218
-118.41.177.103
  118.41.23.106
  118.41.246.106
  118.41.28.119
@@ -25463,10 +25963,12 @@
  118.42.125.246
  118.42.173.28
  118.42.177.204
+118.42.199.7
  118.42.208.39
  118.42.210.89
  118.42.227.153
  118.42.233.90
+118.42.254.103
  118.42.67.176
  118.42.69.158
  118.42.74.177
@@ -25482,17 +25984,15 @@
  118.43.236.12
  118.43.238.254
  118.43.241.156
-118.43.242.186
  118.43.76.230
  118.43.97.168
  118.44.148.247
-118.44.213.191
-118.44.236.101
  118.44.37.217
  118.44.48.100
  118.44.6.75
  118.44.70.160
  118.45.13.114
+118.45.130.170
  118.45.144.155
  118.45.16.28
  118.45.182.174
@@ -25506,6 +26006,7 @@
  118.46.115.192
  118.46.7.150
  118.47.109.151
+118.47.13.14
  118.47.138.209
  118.47.138.248
  118.47.220.18
@@ -25526,22 +26027,21 @@
  118.68.101.213
  118.68.134.75
  118.68.136.114
-118.68.165.50
  118.68.180.19
  118.68.187.236
  118.68.194.10
  118.68.196.174
-118.68.203.187
  118.68.208.86
  118.68.242.4
  118.68.255.17
  118.68.45.209
  118.68.71.252
-118.69.109.123
  118.69.117.217
  118.69.161.67
+118.69.172.7
  118.69.173.199
  118.69.176.26
+118.69.178.183
  118.69.181.162
  118.69.181.231
  118.69.183.237
@@ -25554,26 +26054,26 @@
  118.69.32.83
  118.69.34.216
  118.69.35.0
-118.69.35.21
  118.69.35.93
  118.69.50.154
  118.69.52.169
  118.69.52.67
+118.69.55.141
  118.69.56.68
  118.69.61.212
-118.69.64.250
  118.69.71.109
  118.69.71.182
  118.69.77.91
  118.69.78.29
  118.69.82.233
+118.70.117.156
  118.70.12.171
-118.70.126.64
  118.70.129.244
  118.70.133.226
  118.70.170.120
  118.70.175.160
  118.70.175.209
+118.70.176.36
  118.70.177.235
  118.70.180.174
  118.70.180.189
@@ -25586,21 +26086,21 @@
  118.70.233.117
  118.70.233.163
  118.70.233.206
+118.70.233.72
  118.70.240.41
  118.70.53.221
  118.70.72.103
  118.70.72.192
  118.70.80.213
+118.70.81.59
  118.70.85.195
  118.71.106.53
  118.71.115.97
-118.71.117.176
  118.71.118.41
  118.71.118.94
  118.71.137.134
  118.71.140.211
  118.71.140.57
-118.71.152.20
  118.71.160.202
  118.71.161.165
  118.71.162.222
@@ -25609,11 +26109,9 @@
  118.71.168.173
  118.71.168.7
  118.71.172.213
-118.71.172.84
  118.71.180.232
  118.71.187.196
  118.71.206.200
-118.71.210.118
  118.71.210.7
  118.71.227.100
  118.71.227.250
@@ -25625,7 +26123,6 @@
  118.71.76.100
  118.71.76.166
  118.71.78.45
-118.71.82.5
  118.71.95.174
  118.71.96.222
  118.71.97.33
@@ -25634,7 +26131,6 @@
  118.72.20.12
  118.72.21.4
  118.73.164.102
-118.73.166.34
  118.73.188.194
  118.73.54.37
  118.75.119.214
@@ -25644,10 +26140,10 @@
  118.75.162.173
  118.75.184.240
  118.75.185.57
+118.75.187.14
  118.75.190.221
  118.75.46.151
  118.75.46.196
-118.75.48.15
  118.75.48.151
  118.75.79.64
  118.75.86.209
@@ -25659,7 +26155,7 @@
  118.76.83.138
  118.77.115.70
  118.77.185.172
-118.77.215.152
+118.79.110.150
  118.79.136.168
  118.79.142.142
  118.79.145.69
@@ -25670,7 +26166,7 @@
  118.79.194.192
  118.79.195.61
  118.79.202.69
-118.79.223.64
+118.79.220.227
  118.79.226.144
  118.79.226.198
  118.79.229.123
@@ -25681,14 +26177,19 @@
  118.79.30.102
  118.79.4.250
  118.79.58.128
+118.79.60.93
  118.79.66.26
+118.79.70.167
  118.79.74.237
+118.79.75.125
  118.79.75.183
  118.79.76.118
+118.79.84.239
+118.79.99.246
+118.80.38.180
  118.80.79.148
  118.80.84.4
  118.81.16.99
-118.81.18.213
  118.81.196.55
  118.81.236.199
  118.83.154.64
@@ -25717,31 +26218,41 @@
  118.89.171.146
  118.89.173.215
  118.89.177.212
+118.89.186.200
  118.89.19.73
  118.89.191.62
+118.89.217.127
  118.89.228.58
  118.89.229.84
  118.89.230.243
  118.89.231.121
  118.89.235.114
  118.89.235.86
+118.89.236.249
  118.89.237.20
  118.89.237.61
  118.89.239.21
  118.89.240.128
  118.89.240.167
+118.89.241.126
  118.89.241.180
  118.89.241.214
  118.89.245.202
+118.89.246.205
+118.89.246.238
+118.89.247.113
+118.89.248.40
  118.89.25.35
  118.89.27.72
  118.89.30.90
  118.89.46.81
  118.89.47.205
+118.89.48.148
  118.89.52.173
  118.89.61.51
  118.89.63.234
  118.89.66.102
+118.89.66.42
  118.89.69.159
  118.89.91.134
  118.91.0.240
@@ -25758,17 +26269,18 @@
  118.91.28.2
  118.91.34.20
  118.91.41.135
-118.91.42.114
  118.91.42.133
  118.91.42.173
  118.91.42.32
  118.91.60.42
-118.91.63.23
  118.91.91.21
  118.92.41.104
  118.92.5.233
  118.93.127.90
+118.93.251.45
+118.96.184.207
  118.96.64.137
+118.97.100.83
  118.97.107.65
  118.97.108.18
  118.97.119.130
@@ -25776,12 +26288,14 @@
  118.97.16.106
  118.97.16.109
  118.97.164.19
+118.97.184.205
  118.97.186.214
  118.97.191.179
  118.97.191.233
  118.97.195.141
  118.97.203.101
  118.97.204.93
+118.97.213.194
  118.97.221.251
  118.97.224.2
  118.97.23.26
@@ -25798,16 +26312,21 @@
  118.97.95.19
  118.98.104.21
  118.98.121.220
+118.98.127.138
  118.98.218.11
  118.98.233.226
  118.98.90.2
  118.98.96.184
  118.99.100.109
  118.99.102.106
-118.99.102.224
+118.99.102.41
  118.99.102.76
  118.99.104.135
+118.99.104.151
+118.99.104.6
+118.99.108.183
  118.99.114.134
+118.99.115.197
  118.99.122.245
  118.99.122.74
  118.99.124.167
@@ -25817,6 +26336,7 @@
  118.99.187.57
  118.99.188.171
  118.99.28.130
+118.99.76.36
  118.99.79.231
  118.99.79.7
  118.99.88.107
@@ -25832,8 +26352,8 @@
  119.0.241.185
  119.1.105.246
  119.1.192.81
-119.1.209.98
-119.1.53.34
+119.1.210.139
+119.1.234.204
  119.10.114.97
  119.10.175.66
  119.10.177.2
@@ -25841,11 +26361,12 @@
  119.10.177.90
  119.10.177.94
  119.10.180.46
+119.10.180.55
+119.100.24.73
  119.100.64.191
  119.102.144.43
  119.102.153.184
  119.102.57.83
-119.108.119.180
  119.108.14.80
  119.108.163.108
  119.108.172.207
@@ -25853,6 +26374,8 @@
  119.108.179.206
  119.108.245.10
  119.108.255.160
+119.108.98.228
+119.109.144.189
  119.109.170.229
  119.109.219.179
  119.109.242.214
@@ -25869,6 +26392,7 @@
  119.112.48.115
  119.112.56.52
  119.112.61.156
+119.112.62.200
  119.112.80.191
  119.113.192.32
  119.113.196.126
@@ -25888,11 +26412,11 @@
  119.115.221.21
  119.115.31.68
  119.115.34.74
+119.115.35.122
  119.115.40.29
  119.115.43.112
  119.115.43.129
  119.115.51.70
-119.115.54.99
  119.115.57.253
  119.115.57.27
  119.115.76.158
@@ -25909,17 +26433,17 @@
  119.116.28.60
  119.116.97.190
  119.117.106.24
-119.117.12.17
  119.117.139.72
  119.117.14.233
+119.117.205.57
  119.117.244.204
+119.117.30.238
  119.117.42.33
  119.117.44.126
  119.118.114.220
  119.118.149.239
  119.118.229.181
  119.118.239.123
-119.118.241.69
  119.118.244.77
  119.118.245.187
  119.118.246.154
@@ -25930,7 +26454,6 @@
  119.119.107.117
  119.119.169.0
  119.119.177.175
-119.119.191.35
  119.119.97.231
  119.119.99.61
  119.120.183.249
@@ -25939,32 +26462,37 @@
  119.120.61.248
  119.120.62.62
  119.120.7.39
+119.120.91.153
  119.120.91.98
  119.122.112.190
+119.122.113.138
  119.122.113.224
  119.122.113.28
  119.122.114.2
-119.122.91.181
  119.123.100.135
-119.123.125.7
-119.123.127.51
+119.123.124.200
+119.123.125.128
+119.123.125.196
  119.123.172.29
-119.123.175.69
+119.123.176.127
+119.123.176.98
  119.123.177.157
  119.123.177.17
  119.123.178.80
-119.123.215.155
+119.123.179.183
  119.123.216.90
  119.123.219.240
  119.123.222.36
-119.123.227.118
+119.123.225.24
+119.123.227.15
  119.123.227.65
-119.123.236.96
+119.123.236.2
+119.123.238.185
  119.123.240.251
-119.123.240.31
  119.123.241.145
  119.123.244.133
  119.123.244.77
+119.123.245.200
  119.123.46.243
  119.123.59.70
  119.123.75.119
@@ -25977,20 +26505,20 @@
  119.127.10.143
  119.127.11.52
  119.130.114.236
+119.130.155.171
  119.130.213.94
  119.130.215.167
-119.130.228.24
-119.130.231.128
+119.130.231.180
+119.130.231.182
  119.131.244.13
-119.134.110.205
  119.134.251.245
  119.135.183.202
  119.136.18.142
-119.136.89.223
  119.139.196.138
  119.139.197.51
  119.139.198.130
  119.139.199.3
+119.139.199.84
  119.14.143.145
  119.14.161.37
  119.14.168.27
@@ -25998,7 +26526,6 @@
  119.141.24.144
  119.141.24.175
  119.141.24.19
-119.141.24.218
  119.141.24.249
  119.141.24.34
  119.141.25.180
@@ -26013,8 +26540,10 @@
  119.145.23.18
  119.145.29.160
  119.145.33.147
+119.145.41.174
  119.146.131.247
  119.146.131.89
+119.146.150.134
  119.146.189.84
  119.147.137.79
  119.147.144.22
@@ -26033,6 +26562,7 @@
  119.148.160.109
  119.148.162.86
  119.148.36.141
+119.148.7.70
  119.148.8.34
  119.149.136.46
  119.149.229.42
@@ -26046,11 +26576,11 @@
  119.15.91.24
  119.15.93.38
  119.15.95.158
-119.152.143.90
  119.152.246.150
  119.153.134.102
  119.155.101.245
  119.155.152.184
+119.155.42.183
  119.156.31.3
  119.159.147.54
  119.159.150.176
@@ -26059,13 +26589,14 @@
  119.160.130.219
  119.160.135.166
  119.160.172.201
+119.160.192.218
  119.160.219.5
  119.161.137.20
  119.161.98.132
  119.161.98.139
  119.161.98.141
  119.162.162.146
-119.162.63.61
+119.162.252.66
  119.162.65.162
  119.162.74.224
  119.163.172.198
@@ -26074,7 +26605,7 @@
  119.163.217.38
  119.163.228.106
  119.163.94.12
-119.164.151.211
+119.164.150.189
  119.164.23.177
  119.164.254.136
  119.164.64.189
@@ -26082,6 +26613,7 @@
  119.165.107.65
  119.165.108.69
  119.165.11.32
+119.165.119.254
  119.165.147.145
  119.165.155.238
  119.165.165.210
@@ -26102,9 +26634,7 @@
  119.165.77.202
  119.165.80.71
  119.165.83.110
-119.165.95.82
  119.165.96.223
-119.166.122.112
  119.166.123.13
  119.166.145.234
  119.166.154.237
@@ -26137,19 +26667,20 @@
  119.167.98.164
  119.17.12.46
  119.17.151.61
+119.17.221.61
  119.17.7.68
  119.175.155.220
  119.176.58.2
  119.176.95.121
  119.177.218.229
  119.177.240.117
-119.177.65.229
  119.178.178.79
  119.178.246.244
  119.178.42.217
  119.179.101.62
  119.179.106.33
  119.179.119.79
+119.179.124.180
  119.179.150.233
  119.179.153.191
  119.179.157.16
@@ -26158,10 +26689,10 @@
  119.179.165.18
  119.179.18.206
  119.179.19.176
+119.179.190.169
  119.179.190.97
  119.179.191.165
  119.179.197.191
-119.179.197.33
  119.179.2.185
  119.179.226.195
  119.179.237.182
@@ -26204,7 +26735,6 @@
  119.18.38.144
  119.18.38.176
  119.18.64.92
-119.18.75.131
  119.18.88.113
  119.18.88.78
  119.180.108.79
@@ -26214,14 +26744,15 @@
  119.180.13.187
  119.180.134.107
  119.180.179.160
-119.180.192.160
  119.180.193.101
  119.180.204.103
  119.180.220.220
+119.180.231.46
  119.180.25.38
  119.180.32.217
  119.180.35.211
  119.180.55.124
+119.180.63.138
  119.180.78.75
  119.180.96.143
  119.181.103.34
@@ -26235,7 +26766,6 @@
  119.182.8.82
  119.182.83.27
  119.182.84.22
-119.183.11.72
  119.183.123.28
  119.183.14.177
  119.183.143.223
@@ -26243,29 +26773,28 @@
  119.183.148.45
  119.183.18.102
  119.183.204.178
+119.183.24.118
  119.183.34.127
  119.183.45.231
  119.183.46.127
  119.183.47.246
  119.183.47.246bin.sh
-119.183.5.72
  119.183.54.121
  119.183.78.72
  119.184.136.119
  119.184.158.123
  119.184.48.147bin.sh
+119.185.100.29
  119.185.104.237
  119.185.149.74
  119.185.153.86
  119.185.155.1
  119.185.159.81
  119.185.175.13
-119.185.177.156
  119.185.236.116
  119.185.237.13
  119.185.238.163
  119.185.70.100
-119.186.111.71
  119.186.15.123
  119.186.204.74
  119.186.41.245
@@ -26275,6 +26804,7 @@
  119.187.144.206
  119.187.149.238
  119.187.159.241
+119.187.232.132
  119.187.235.145
  119.187.235.23
  119.187.235.5
@@ -26284,14 +26814,14 @@
  119.187.77.195
  119.188.125.31
  119.188.245.108
-119.188.245.12
  119.188.246.185
  119.188.248.7
  119.189.129.35
  119.189.131.154
  119.189.132.158
  119.189.137.208
-119.189.137.252
+119.189.166.182
+119.189.171.108
  119.189.181.172
  119.189.201.195
  119.189.201.50bin.sh
@@ -26299,14 +26829,15 @@
  119.189.207.105
  119.190.144.131
  119.190.180.197
+119.190.207.105
  119.190.211.132
  119.190.216.70
-119.190.221.31
  119.190.240.25
  119.190.242.13
  119.190.247.205
  119.190.63.230
  119.190.64.150
+119.191.177.189
  119.191.177.243
  119.191.178.42
  119.191.182.131
@@ -26316,6 +26847,7 @@
  119.191.200.208
  119.191.207.68
  119.191.208.224
+119.191.211.240
  119.191.215.217
  119.192.206.158
  119.192.254.1
@@ -26331,6 +26863,7 @@
  119.193.239.59
  119.193.244.222
  119.193.244.89
+119.193.33.143
  119.193.33.206
  119.193.47.162
  119.193.58.95
@@ -26341,9 +26874,11 @@
  119.194.240.249
  119.194.240.249bin.sh
  119.194.52.61
+119.194.64.10
  119.194.75.229
  119.195.112.221
  119.195.148.229
+119.195.161.106
  119.195.180.213
  119.195.180.215
  119.195.180.227
@@ -26383,7 +26918,6 @@
  119.197.67.165
  119.198.11.132
  119.198.123.131
-119.198.128.223
  119.198.146.111
  119.198.155.123
  119.198.155.76
@@ -26407,6 +26941,7 @@
  119.199.28.219
  119.199.56.184
  119.199.69.171
+119.2.17.138
  119.2.51.150
  119.2.53.222
  119.2.54.204
@@ -26467,7 +27002,6 @@
  119.206.115.137
  119.206.14.101
  119.206.190.198
-119.206.255.171
  119.206.48.90
  119.206.51.189
  119.206.60.222
@@ -26476,11 +27010,12 @@
  119.206.65.85
  119.206.88.75
  119.207.109.223
-119.207.147.69
+119.207.126.21
  119.207.153.8
  119.207.169.155
  119.207.204.253
  119.207.22.94
+119.207.227.167
  119.207.30.62
  119.207.76.245
  119.209.10.12
@@ -26492,11 +27027,14 @@
  119.23.104.38
  119.23.128.199
  119.23.21.39
+119.23.22.37
  119.23.238.165
  119.23.31.104
  119.230.47.15
+119.231.226.194
  119.235.16.190
  119.235.19.66
+119.235.21.10
  119.235.242.19
  119.235.244.128
  119.235.246.147
@@ -26514,10 +27052,10 @@
  119.235.54.45
  119.235.84.218
  119.236.104.145
+119.236.141.251
  119.236.15.239
  119.236.15.53
  119.236.157.71
-119.236.161.203
  119.236.163.213
  119.236.163.96
  119.236.18.35
@@ -26527,11 +27065,11 @@
  119.236.251.11
  119.236.45.167
  119.236.54.160
+119.236.70.53
  119.236.79.24
  119.236.91.153
  119.237.113.97
  119.237.12.41
-119.237.129.210
  119.237.135.211
  119.237.148.202
  119.237.152.197
@@ -26546,6 +27084,7 @@
  119.237.50.34
  119.237.53.59
  119.237.54.33
+119.237.68.175
  119.237.75.119
  119.237.82.60
  119.238.121.222
@@ -26576,7 +27115,6 @@
  119.247.91.203
  119.248.201.103
  119.249.16.203
-119.249.221.221
  119.249.236.105
  119.250.1.103
  119.250.115.235
@@ -26584,15 +27122,18 @@
  119.250.244.86
  119.251.107.79
  119.251.143.103
+119.251.143.51
  119.251.146.62
  119.251.155.194
  119.251.221.62
  119.251.99.44
  119.252.143.6
-119.252.160.165
+119.252.168.53
  119.252.169.173
+119.252.170.2
  119.252.174.199
  119.252.174.201
+119.254.12.66
  119.254.145.18
  119.254.155.187
  119.254.36.2
@@ -26604,16 +27145,23 @@
  119.27.165.49
  119.27.166.126
  119.27.166.193
-119.27.172.62
  119.27.174.130
  119.27.189.46
+119.27.189.65
  119.27.191.172
  119.27.191.202
+119.28.1.253
  119.28.100.159
  119.28.100.67
+119.28.102.147
  119.28.102.86
+119.28.104.69
+119.28.106.162
  119.28.106.84
+119.28.108.96
+119.28.112.213
  119.28.112.246
+119.28.113.242
  119.28.115.13
  119.28.115.130
  119.28.115.233
@@ -26622,8 +27170,10 @@
  119.28.128.211
  119.28.13.154
  119.28.132.211
+119.28.138.87
  119.28.140.134
  119.28.149.239
+119.28.149.51
  119.28.151.166
  119.28.152.128
  119.28.152.247
@@ -26637,18 +27187,20 @@
  119.28.164.31
  119.28.178.61
  119.28.179.179
+119.28.180.201
  119.28.187.227
  119.28.19.237
  119.28.194.66
  119.28.2.174
  119.28.2.199
-119.28.20.120
  119.28.20.131
  119.28.20.208
  119.28.215.129
  119.28.221.132
+119.28.223.229
  119.28.224.121
  119.28.225.211
+119.28.227.100
  119.28.232.240
  119.28.233.140
  119.28.234.30
@@ -26661,20 +27213,25 @@
  119.28.26.57
  119.28.3.58
  119.28.32.60
+119.28.4.12
+119.28.4.215
  119.28.4.87
  119.28.44.92
  119.28.51.99
+119.28.53.199
  119.28.54.131
  119.28.55.185
  119.28.55.239
  119.28.55.81
  119.28.58.167
  119.28.58.200
-119.28.59.64
  119.28.6.128
  119.28.60.164
  119.28.61.162
+119.28.66.37
+119.28.67.221
  119.28.68.182
+119.28.7.27
  119.28.7.77
  119.28.73.193
  119.28.74.39
@@ -26687,39 +27244,46 @@
  119.28.9.76
  119.28.90.103
  119.28.91.154
-119.28.91.34
  119.28.93.152
  119.28.94.186
+119.28.99.130
  119.29.1.141
  119.29.10.25
  119.29.100.8
  119.29.102.4
+119.29.105.3
  119.29.108.252
  119.29.113.233
  119.29.115.153
  119.29.116.2
  119.29.119.151
+119.29.12.69
  119.29.121.229
  119.29.128.126
+119.29.130.24
  119.29.131.163
  119.29.131.41
  119.29.135.29
  119.29.136.114
+119.29.138.191
  119.29.138.43
  119.29.138.90
  119.29.142.124
+119.29.142.151
  119.29.142.34
  119.29.143.201
+119.29.144.236
  119.29.144.4
  119.29.146.13
  119.29.149.214
  119.29.150.218
  119.29.151.107
+119.29.152.172
  119.29.152.81
  119.29.155.106
  119.29.155.57
  119.29.156.239
-119.29.158.76
+119.29.159.227
  119.29.16.190
  119.29.161.236
  119.29.163.13
@@ -26736,6 +27300,7 @@
  119.29.184.55
  119.29.188.119
  119.29.191.217
+119.29.192.38
  119.29.195.187
  119.29.198.127
  119.29.2.157
@@ -26746,6 +27311,7 @@
  119.29.22.68
  119.29.231.121
  119.29.234.23
+119.29.237.201
  119.29.245.130
  119.29.246.210
  119.29.247.187
@@ -26757,8 +27323,8 @@
  119.29.54.159
  119.29.56.139
  119.29.62.253
+119.29.69.117
  119.29.70.143
-119.29.72.123
  119.29.72.216
  119.29.73.218
  119.29.73.73
@@ -26767,12 +27333,13 @@
  119.29.82.97
  119.29.83.12
  119.29.83.177
+119.29.84.31
  119.29.86.132
  119.29.87.51
+119.29.9.19
  119.29.91.228
  119.29.91.252
  119.29.91.38
-119.29.93.25
  119.29.95.80
  119.29.98.53
  119.3.137.96
@@ -26780,13 +27347,13 @@
  119.3.178.138
  119.3.182.158
  119.3.182.224
-119.3.191.65
  119.3.193.50
  119.3.208.236
  119.3.224.94
  119.3.227.10
  119.3.249.44
  119.3.55.158
+119.36.217.92
  119.36.221.166
  119.36.221.176
  119.36.24.16
@@ -26818,7 +27385,6 @@
  119.40.98.74
  119.41.18.72
  119.41.193.129
-119.41.196.89
  119.41.197.59
  119.41.199.107
  119.41.2.202
@@ -26835,17 +27401,13 @@
  119.42.108.194
  119.42.109.46
  119.42.113.185
-119.42.114.32
  119.42.115.239
-119.42.120.68
-119.42.121.198
  119.42.121.250
  119.42.121.252
  119.42.121.46
  119.42.122.107
+119.42.122.119
  119.42.122.147
-119.42.122.16
-119.42.122.196
  119.42.122.246
  119.42.122.39
  119.42.122.40
@@ -26856,7 +27418,6 @@
  119.42.123.146
  119.42.123.210
  119.42.123.54
-119.42.123.97
  119.42.161.254
  119.42.163.126
  119.42.167.30
@@ -26870,36 +27431,37 @@
  119.42.67.142
  119.42.67.15
  119.42.67.177
+119.42.67.225
  119.42.67.228
  119.42.67.235
-119.42.67.77
  119.42.71.110
+119.42.71.120
+119.42.71.51
  119.42.71.82
-119.42.72.156
-119.42.73.99
  119.42.78.108
  119.42.78.85
+119.42.80.109
  119.42.80.24
  119.42.80.39
  119.42.80.82
-119.42.86.131
  119.42.86.152
-119.42.86.86
  119.42.95.106
-119.42.96.136
  119.42.96.140
  119.42.96.58
  119.42.96.8
  119.44.20.30
+119.45.0.47
  119.45.10.225
  119.45.10.4
  119.45.10.5
  119.45.105.184
  119.45.112.28
  119.45.114.133
+119.45.114.182
  119.45.114.87
  119.45.116.170
  119.45.117.145
+119.45.119.141
  119.45.12.105
  119.45.120.121
  119.45.120.24
@@ -26915,6 +27477,7 @@
  119.45.137.52
  119.45.138.133
  119.45.138.160
+119.45.138.220
  119.45.138.43
  119.45.138.92
  119.45.140.59
@@ -26922,6 +27485,9 @@
  119.45.142.15
  119.45.142.38
  119.45.142.72
+119.45.143.143
+119.45.144.200
+119.45.147.7
  119.45.148.171
  119.45.149.173
  119.45.149.82
@@ -26932,25 +27498,28 @@
  119.45.154.185
  119.45.155.151
  119.45.158.223
+119.45.159.142
  119.45.159.220
-119.45.160.126
  119.45.162.248
  119.45.165.211
  119.45.165.219
  119.45.171.183
  119.45.173.117
+119.45.176.17
  119.45.177.47
  119.45.178.44
  119.45.18.205
  119.45.181.168
  119.45.183.194
  119.45.183.209
+119.45.183.229
  119.45.184.182
  119.45.184.216
  119.45.186.186
  119.45.187.6
  119.45.19.141
  119.45.19.201
+119.45.190.194
  119.45.191.168
  119.45.191.209
  119.45.192.106
@@ -26964,6 +27533,7 @@
  119.45.195.57
  119.45.196.97
  119.45.198.117
+119.45.199.173
  119.45.199.200
  119.45.199.253
  119.45.201.244
@@ -26972,17 +27542,23 @@
  119.45.203.170
  119.45.205.97
  119.45.206.237
+119.45.207.135
  119.45.207.191
  119.45.207.193
+119.45.207.216
  119.45.208.191
  119.45.208.92
  119.45.209.12
  119.45.209.222
+119.45.21.98
  119.45.213.145
+119.45.213.228
  119.45.213.69
  119.45.214.43
  119.45.215.155
+119.45.215.195
  119.45.216.2
+119.45.218.253
  119.45.219.203
  119.45.22.71
  119.45.220.5
@@ -26990,6 +27566,7 @@
  119.45.221.79
  119.45.222.118
  119.45.222.252
+119.45.223.215
  119.45.223.241
  119.45.223.42
  119.45.225.144
@@ -27006,6 +27583,7 @@
  119.45.240.155
  119.45.240.49
  119.45.242.149
+119.45.242.49
  119.45.243.118
  119.45.243.232
  119.45.243.54
@@ -27014,11 +27592,12 @@
  119.45.250.197
  119.45.250.215
  119.45.250.223
+119.45.251.55
  119.45.252.106
+119.45.252.249
  119.45.254.116
  119.45.254.159
  119.45.26.117
-119.45.27.164
  119.45.27.25
  119.45.30.53
  119.45.31.199
@@ -27031,6 +27610,7 @@
  119.45.39.207
  119.45.42.241
  119.45.42.58
+119.45.43.147
  119.45.45.185
  119.45.45.195
  119.45.45.41
@@ -27061,10 +27641,12 @@
  119.45.60.252
  119.45.60.62
  119.45.61.223
+119.45.61.53
  119.45.61.69
  119.45.62.185
  119.45.63.253
  119.45.63.87
+119.46.179.2
  119.46.2.245
  119.46.2.246
  119.46.2.249
@@ -27077,7 +27659,6 @@
  119.49.251.109
  119.49.50.38
  119.5.1.72
-119.5.139.48
  119.5.150.76
  119.5.151.221
  119.5.157.124
@@ -27098,20 +27679,16 @@
  119.51.116.145
  119.51.161.82
  119.51.225.13
-119.51.226.112
  119.51.9.237
  119.51.99.128
  119.52.139.181
  119.52.149.125
-119.52.152.198
  119.52.155.233
  119.52.165.148
  119.52.166.114
-119.52.52.29
  119.53.130.138
  119.53.130.182
  119.53.142.209
-119.53.156.9
  119.53.162.71
  119.53.26.51
  119.53.90.46
@@ -27119,7 +27696,6 @@
  119.54.127.193
  119.54.221.178
  119.54.223.222
-119.55.209.5
  119.55.213.209
  119.55.217.207
  119.55.254.201
@@ -27138,6 +27714,7 @@
  119.56.144.98
  119.56.145.19
  119.56.147.43
+119.56.147.58
  119.56.148.101
  119.56.148.115
  119.56.148.54
@@ -27151,6 +27728,7 @@
  119.56.155.57
  119.56.156.102
  119.56.156.166
+119.56.164.133
  119.56.165.126
  119.56.165.33
  119.56.166.36
@@ -27160,10 +27738,9 @@
  119.56.175.41
  119.56.185.4
  119.56.185.73
+119.56.189.19
  119.56.189.61
  119.56.194.105
-119.56.194.145
-119.56.194.5
  119.56.195.12
  119.56.195.122
  119.56.195.81
@@ -27178,7 +27755,6 @@
  119.56.200.37
  119.56.201.33
  119.56.206.100
-119.56.206.171
  119.56.206.24
  119.56.206.48
  119.56.208.30
@@ -27193,16 +27769,13 @@
  119.56.219.71
  119.56.219.75
  119.56.220.170
-119.56.221.44
  119.56.225.64
  119.56.226.81
-119.56.231.42
  119.56.238.145
  119.56.240.139
  119.56.241.128
  119.56.243.62
  119.56.248.112
-119.57.103.38
  119.57.116.152
  119.57.116.174
  119.57.117.246
@@ -27217,20 +27790,20 @@
  119.59.116.21
  119.59.124.163
  119.59.124.54
-119.59.81.250
  119.6.100.24
  119.6.253.58
  119.6.54.5
  119.6.57.122
  119.60.2.249
  119.60.25.234
-119.60.255.86
+119.60.252.242
  119.60.5.37
  119.61.19.84
  119.61.19.87
  119.62.160.27
  119.62.190.40
  119.62.229.246
+119.63.129.222
  119.63.130.53
  119.63.130.62
  119.63.135.116
@@ -27241,6 +27814,7 @@
  119.63.74.19
  119.63.74.25
  119.64.199.203
+119.65.160.82
  119.65.30.104
  119.65.95.181
  119.68.194.119
@@ -27248,7 +27822,6 @@
  119.7.142.184
  119.7.237.43
  119.7.43.74
-119.70.246.207
  119.73.179.114
  119.74.131.198
  119.74.226.149
@@ -27259,10 +27832,10 @@
  119.75.32.18
  119.76.128.163
  119.76.140.113
-119.76.173.2
  119.76.190.126
  119.77.164.91
  119.77.92.15
+119.8.1.173
  119.8.164.151
  119.8.44.244
  119.8.47.225
@@ -27301,8 +27874,11 @@
  119.84.128.40
  119.84.66.170
  119.84.8.43
+119.86.16.83
+119.86.19.101
  119.86.20.114
-119.86.20.207
+119.86.20.164
+119.86.22.170
  119.9.110.100
  119.9.110.234
  119.9.131.18
@@ -27320,16 +27896,20 @@
  119.90.61.10
  119.90.63.249
  119.92.165.124
+119.92.233.175
  119.92.249.79
+119.93.121.181
  119.93.122.233
  119.93.123.229
  119.93.137.78
  119.93.173.120
+119.93.199.113
  119.93.234.41
  119.93.235.205
  119.93.235.242
  119.93.90.155
  119.94.166.6
+119.94.175.103
  119.95.168.102
  119.95.180.106
  119.96.100.222
@@ -27338,6 +27918,7 @@
  119.96.121.16
  119.96.124.131
  119.96.125.185
+119.96.126.206
  119.96.155.102
  119.96.157.188
  119.96.158.238
@@ -27358,11 +27939,13 @@
  119.96.189.177
  119.96.192.177
  119.96.193.207
+119.96.193.238
  119.96.193.246
  119.96.208.125
  119.96.213.159
  119.96.215.80
  119.96.217.100
+119.96.223.211
  119.96.224.153
  119.96.227.154
  119.96.227.221
@@ -27396,6 +27979,7 @@
  119.97.221.82
  119.97.221.92
  119.97.221.94
+119.97.236.4
  119.97.248.76
  119.97.251.162
  119.97.252.154
@@ -27467,6 +28051,7 @@
  12.20.165.35
  12.202.70.93
  12.203.165.115
+12.205.96.102
  12.207.39.227
  12.215.14.204
  12.218.209.130
@@ -27480,6 +28065,8 @@
  12.232.141.28
  12.232.141.29
  12.237.181.7
+12.24.60.91
+12.24.61.82
  12.244.119.30
  12.247.242.246
  12.25.14.44
@@ -27504,7 +28091,6 @@
  12.97.172.196
  12.97.46.148
  120.0.202.59
-120.1.10.101
  120.1.153.170
  120.1.206.234
  120.1.234.32
@@ -27515,16 +28101,18 @@
  120.11.159.162
  120.11.161.62
  120.11.184.181
+120.11.189.201
+120.11.90.27
  120.11.93.179
  120.12.133.69
  120.12.146.131
  120.12.149.242
-120.12.158.254
  120.12.211.237
  120.12.227.174
  120.12.91.239
  120.12.96.41
  120.131.13.186
+120.131.13.198
  120.131.14.125
  120.131.15.59
  120.131.2.210
@@ -27557,8 +28145,10 @@
  120.132.99.101
  120.133.136.35
  120.133.136.75
+120.133.141.4
  120.133.17.168
  120.133.2.9
+120.133.22.121
  120.133.35.4
  120.133.48.52
  120.133.52.105
@@ -27571,10 +28161,13 @@
  120.138.5.204
  120.138.7.125
  120.138.9.185
+120.14.27.123
  120.142.173.160
  120.142.222.22
  120.143.173.154
  120.144.161.12
+120.148.160.87
+120.148.173.22
  120.148.189.171
  120.148.210.84
  120.148.88.200
@@ -27612,6 +28205,7 @@
  120.193.252.189
  120.193.65.150
  120.193.72.110
+120.193.91.174
  120.193.91.177
  120.193.91.177bin.sh
  120.193.91.178
@@ -27637,6 +28231,7 @@
  120.193.91.201
  120.193.91.202
  120.193.91.202bin.sh
+120.193.91.203
  120.193.91.204
  120.193.91.204bin.sh
  120.193.91.205
@@ -27689,6 +28284,7 @@
  120.2.23.221
  120.201.2.154
  120.201.2.159
+120.201.2.198
  120.202.128.23
  120.202.17.190
  120.202.177.108
@@ -27737,11 +28333,13 @@
  120.209.99.201
  120.209.99.97
  120.210.147.60
+120.210.207.136
+120.210.208.121
+120.210.208.139
  120.210.89.180
  120.210.89.79
  120.211.100.18
  120.211.140.166
-120.211.144.131
  120.211.145.66
  120.211.39.164
  120.211.61.239
@@ -27767,20 +28365,20 @@
  120.224.83.112
  120.224.86.67
  120.224.87.212
+120.227.10.120
  120.227.8.141
-120.228.234.230
-120.229.151.162
+120.227.8.39
  120.229.53.141
  120.229.74.62
  120.230.127.113
  120.232.193.113
  120.232.252.15
+120.234.134.139
  120.234.138.100
  120.234.138.99
  120.234.227.172
  120.234.53.91
  120.236.105.190
-120.236.117.205
  120.236.128.52
  120.236.146.43
  120.236.212.67
@@ -27797,10 +28395,12 @@
  120.236.255.120
  120.236.55.130
  120.236.87.3
+120.236.87.54
  120.237.118.139
+120.237.118.144
  120.237.123.242
+120.237.140.219
  120.237.145.67
-120.237.159.92
  120.237.170.27
  120.237.218.226
  120.238.111.142
@@ -27809,7 +28409,7 @@
  120.238.201.6
  120.238.223.6
  120.239.196.12
-120.24.227.230
+120.239.196.22
  120.24.234.239
  120.24.40.26
  120.240.82.14
@@ -27828,9 +28428,7 @@
  120.25.60.70
  120.25.80.195
  120.253.167.238
-120.253.26.219
  120.253.37.8
-120.253.79.195
  120.26.118.68
  120.26.199.103
  120.26.208.102
@@ -27838,10 +28436,10 @@
  120.26.76.229
  120.26.76.47
  120.27.114.140
-120.27.133.211
  120.27.220.200
  120.28.110.61
  120.28.151.136
+120.28.153.35
  120.28.198.54
  120.28.201.50
  120.28.45.202
@@ -27851,14 +28449,15 @@
  120.29.125.227
  120.29.125.240
  120.29.134.186
-120.29.155.59
-120.29.66.204
+120.29.155.58
  120.29.86.141
  120.31.131.172
  120.31.132.35
  120.31.136.173
  120.31.136.232
+120.31.138.79
  120.31.140.183
+120.31.140.235
  120.31.140.237
  120.31.140.41
  120.31.56.111
@@ -27866,8 +28465,7 @@
  120.32.96.151
  120.34.13.123
  120.34.173.239
-120.34.180.200
-120.34.183.181
+120.34.180.34
  120.34.253.252
  120.35.189.242
  120.35.189.5
@@ -27875,9 +28473,12 @@
  120.36.208.89
  120.36.211.93
  120.36.220.7
+120.36.24.149
  120.36.3.101
  120.37.231.118
+120.38.28.47
  120.38.29.229
+120.38.29.23
  120.38.29.234
  120.39.243.192
  120.39.243.84
@@ -27885,7 +28486,6 @@
  120.4.120.39
  120.40.130.70
  120.40.81.105
-120.41.124.56
  120.41.245.202
  120.41.45.72
  120.43.128.10
@@ -27897,6 +28497,7 @@
  120.48.25.159
  120.48.28.131
  120.48.31.186
+120.48.31.211
  120.48.7.156
  120.48.7.76
  120.48.8.84
@@ -27911,6 +28512,7 @@
  120.50.82.29
  120.50.96.179
  120.51.201.70
+120.51.34.254
  120.52.120.11
  120.52.139.130
  120.52.146.211
@@ -27938,12 +28540,15 @@
  120.53.21.151
  120.53.21.174
  120.53.220.148
+120.53.222.133
  120.53.222.157
  120.53.223.186
  120.53.225.13
  120.53.225.81
  120.53.23.24
  120.53.23.65
+120.53.231.163
+120.53.235.101
  120.53.237.33
  120.53.238.156
  120.53.238.43
@@ -27955,7 +28560,6 @@
  120.53.245.68
  120.53.245.69
  120.53.246.226
-120.53.251.82
  120.53.26.137
  120.53.27.188
  120.53.28.165
@@ -27964,6 +28568,7 @@
  120.55.212.226
  120.55.62.112
  120.56.119.118
+120.57.208.119
  120.57.209.208
  120.57.32.25
  120.57.32.52
@@ -27971,11 +28576,6 @@
  120.57.38.249
  120.57.96.213
  120.57.96.224
-120.57.97.98
-120.59.122.100
-120.59.123.152
-120.59.124.190
-120.59.127.97
  120.59.16.52
  120.6.139.108
  120.6.147.244
@@ -27989,6 +28589,7 @@
  120.63.128.72
  120.63.136.58
  120.63.157.52
+120.63.177.14
  120.63.249.202
  120.68.104.79
  120.68.105.180
@@ -28010,18 +28611,20 @@
  120.69.6.8
  120.69.88.106
  120.69.89.50
-120.7.132.30
  120.7.137.136
  120.7.192.80
  120.7.210.164
  120.7.222.199
+120.70.100.13
+120.70.100.159
+120.70.100.54
  120.70.100.88
  120.70.100.89
  120.70.101.85
  120.70.102.16
  120.70.102.239
+120.70.103.239
  120.70.103.27
-120.70.15.134
  120.70.98.132
  120.70.98.195
  120.71.145.181
@@ -28033,6 +28636,7 @@
  120.71.147.115
  120.71.147.93
  120.71.154.24
+120.71.181.52
  120.71.181.83
  120.72.17.35
  120.72.18.91
@@ -28040,8 +28644,9 @@
  120.72.21.30
  120.76.140.189
  120.76.156.193
+120.76.219.77
  120.76.22.182
-120.76.251.205
+120.76.97.156
  120.77.253.219
  120.77.3.221
  120.77.36.28
@@ -28055,21 +28660,25 @@
  120.78.203.123
  120.78.4.233
  120.78.5.145
+120.78.64.2
  120.78.68.241
  120.78.79.85
  120.79.106.130
-120.79.139.196
+120.79.151.246
  120.79.151.95
  120.79.169.174
+120.79.186.104
  120.79.188.144
  120.79.202.67
  120.79.212.174
  120.79.217.10
  120.79.218.202
+120.79.222.186
  120.79.223.9
  120.79.226.175
  120.79.226.20
  120.79.251.131
+120.79.251.37
  120.79.3.52
  120.79.48.236
  120.79.83.132
@@ -28078,26 +28687,23 @@
  120.8.82.184
  120.8.97.114
  120.84.96.82
-120.85.175.170
-120.85.184.245
-120.85.186.201
-120.85.187.243
-120.85.187.44
-120.85.197.217
-120.85.198.0
-120.85.210.114
-120.85.211.47
-120.85.254.46
+120.85.169.33
+120.85.170.224
+120.85.185.134
+120.85.186.13
+120.85.60.41
+120.85.61.92
  120.86.113.106
  120.86.123.211
-120.86.144.29
-120.86.145.196
+120.88.164.230
  120.88.46.226
+120.9.182.27
  120.9.219.116
  120.92.10.24
  120.92.102.213
  120.92.103.143
  120.92.107.174
+120.92.107.97
  120.92.109.187
  120.92.109.191
  120.92.109.29
@@ -28108,14 +28714,16 @@
  120.92.111.227
  120.92.111.92
  120.92.114.71
+120.92.117.182
  120.92.117.49
  120.92.118.155
  120.92.119.90
  120.92.122.249
  120.92.133.133
-120.92.136.84
  120.92.138.1
+120.92.139.2
  120.92.139.28
+120.92.14.158
  120.92.148.190
  120.92.149.124
  120.92.149.231
@@ -28129,9 +28737,10 @@
  120.92.164.193
  120.92.166.166
  120.92.169.65
-120.92.169.82
+120.92.173.154
  120.92.174.161
  120.92.192.187
+120.92.2.217
  120.92.208.106
  120.92.210.196
  120.92.253.6
@@ -28139,13 +28748,14 @@
  120.92.33.68
  120.92.34.203
  120.92.35.193
+120.92.45.102
  120.92.55.138
  120.92.55.155
  120.92.72.190
-120.92.72.250
  120.92.72.52
  120.92.74.249
  120.92.78.70
+120.92.79.133
  120.92.80.120
  120.92.85.38
  120.92.89.30
@@ -28172,6 +28782,7 @@
  121.100.114.164
  121.100.17.42
  121.100.19.18
+121.100.28.199
  121.100.4.170
  121.100.96.8
  121.101.130.41
@@ -28182,6 +28793,7 @@
  121.101.214.54
  121.101.93.224
  121.102.210.214
+121.105.215.185
  121.11.110.200
  121.11.112.199
  121.11.117.252
@@ -28189,28 +28801,33 @@
  121.11.83.7
  121.11.98.127
  121.111.247.200
+121.114.118.247
  121.114.233.9
  121.117.147.153
  121.119.145.152
  121.119.179.133
+121.12.124.36
+121.12.155.218
  121.12.162.93
  121.12.252.10
  121.12.252.206
  121.121.118.151
-121.121.118.217
  121.121.120.240
  121.121.137.199
  121.121.141.225
  121.121.149.137
+121.121.177.138
+121.121.185.11
  121.121.185.245
-121.121.185.254
  121.121.190.210
  121.121.208.129
  121.121.76.81
  121.121.94.104
  121.122.109.35
+121.122.119.120
  121.122.122.221
  121.122.139.104bin.sh
+121.122.40.109
  121.122.50.157
  121.122.66.226
  121.122.67.249
@@ -28221,12 +28838,15 @@
  121.122.92.139
  121.122.95.148
  121.123.120.114
+121.123.148.211
  121.123.38.3
  121.123.45.6
+121.123.67.139
  121.123.72.132
  121.123.85.135
  121.123.93.123
  121.123.93.222
+121.123.93.39
  121.123.94.254
  121.124.124.145
  121.124.124.200
@@ -28235,11 +28855,13 @@
  121.125.101.88
  121.125.68.90
  121.126.31.66
+121.127.226.150
  121.127.234.54
  121.127.249.45
  121.127.252.30
  121.128.135.74
  121.128.135.75
+121.128.162.156
  121.129.127.209
  121.129.129.23
  121.129.192.177
@@ -28251,6 +28873,7 @@
  121.130.120.130
  121.130.121.1
  121.130.124.57
+121.130.225.89
  121.130.230.142
  121.130.237.78
  121.130.249.227
@@ -28258,6 +28881,7 @@
  121.130.29.21
  121.130.76.251
  121.131.206.165
+121.131.232.156
  121.131.27.8
  121.132.100.14
  121.132.102.218
@@ -28309,6 +28933,7 @@
  121.136.202.12
  121.136.80.58
  121.136.86.72
+121.137.103.81
  121.137.138.140
  121.137.146.45
  121.137.219.129
@@ -28381,14 +29006,12 @@
  121.145.248.189
  121.145.50.191
  121.145.54.134
-121.145.75.234
  121.145.79.150
  121.145.88.169
  121.146.196.203
  121.146.242.251
  121.146.248.235
  121.146.255.57
-121.146.66.226
  121.147.138.143
  121.147.168.11
  121.147.179.199
@@ -28396,6 +29019,9 @@
  121.147.227.130
  121.147.227.133
  121.147.227.142
+121.147.227.155
+121.147.227.157
+121.147.227.160
  121.147.227.184
  121.147.241.223
  121.147.54.178
@@ -28421,12 +29047,10 @@
  121.149.104.60
  121.149.104.83
  121.149.112.111
-121.149.112.99
  121.149.114.172
  121.149.114.59
  121.149.114.70
  121.149.116.38
-121.149.121.199
  121.149.121.199bin.sh
  121.149.168.210
  121.149.20.29
@@ -28445,6 +29069,7 @@
  121.15.137.137
  121.15.170.60
  121.15.2.178
+121.15.2.6
  121.15.220.61
  121.15.244.58
  121.15.245.215
@@ -28456,6 +29081,7 @@
  121.150.209.217
  121.150.32.33
  121.150.7.141
+121.150.7.157
  121.151.108.195
  121.151.150.243
  121.151.152.207
@@ -28467,14 +29093,12 @@
  121.151.85.38
  121.152.10.179
  121.152.130.220
-121.152.147.183
  121.152.161.34
  121.152.183.215
  121.152.195.131
  121.152.215.98
  121.152.32.250
  121.152.49.242
-121.152.50.249
  121.153.103.135
  121.153.131.147
  121.153.147.32
@@ -28493,7 +29117,6 @@
  121.154.94.200
  121.155.104.198
  121.155.117.207
-121.155.133.134
  121.155.135.242
  121.155.156.93
  121.155.156.93bin.sh
@@ -28505,6 +29128,7 @@
  121.155.249.227
  121.155.57.69
  121.155.61.218
+121.155.70.67
  121.155.70.86
  121.155.90.55
  121.155.91.117
@@ -28512,10 +29136,8 @@
  121.156.126.101
  121.156.140.186
  121.156.148.8
-121.156.177.97
  121.156.212.210
  121.156.221.248
-121.156.236.50
  121.156.26.163
  121.156.27.90
  121.156.87.243
@@ -28527,9 +29149,9 @@
  121.157.225.132
  121.157.236.24
  121.157.31.11
+121.157.47.4
  121.157.55.140
  121.157.82.202
-121.157.95.241
  121.158.129.120
  121.158.209.175
  121.158.30.51
@@ -28557,12 +29179,8 @@
  121.161.20.122
  121.161.20.59
  121.161.35.243
-121.162.131.223
-121.162.182.147
-121.162.229.138
  121.162.235.44
  121.162.237.104
-121.162.37.120
  121.162.63.141
  121.163.131.224
  121.163.140.158
@@ -28578,6 +29196,7 @@
  121.164.152.149
  121.164.178.157
  121.164.184.155
+121.164.199.92
  121.164.215.205
  121.164.224.61
  121.164.82.98
@@ -28587,11 +29206,16 @@
  121.165.162.44
  121.165.174.221
  121.165.18.228
+121.165.180.33
+121.165.21.76
  121.165.219.59
  121.165.26.119
+121.165.66.146
+121.165.66.226
  121.165.73.157
  121.166.113.27
  121.166.244.18
+121.166.245.171
  121.166.59.13
  121.166.73.47
  121.167.215.19
@@ -28655,7 +29279,6 @@
  121.170.19.103
  121.170.19.226
  121.170.214.75
-121.170.231.226
  121.170.31.103
  121.170.31.223
  121.170.31.28
@@ -28665,13 +29288,14 @@
  121.170.4.56
  121.170.42.199
  121.170.45.176
+121.170.45.219
  121.170.53.157
  121.170.66.217
  121.170.71.70
  121.170.90.234
  121.171.118.217
  121.171.166.170
-121.171.166.47
+121.172.144.181
  121.172.146.146
  121.172.190.116
  121.172.194.4
@@ -28704,15 +29328,14 @@
  121.175.157.24
  121.175.191.243
  121.175.232.183
-121.175.247.111
  121.175.52.247
  121.175.66.25
  121.175.70.221
  121.175.75.193
  121.175.8.174
+121.176.110.107
  121.176.130.100
  121.176.199.65
-121.176.202.191
  121.176.205.166
  121.176.7.198
  121.176.84.14
@@ -28724,7 +29347,6 @@
  121.177.232.180
  121.178.100.194
  121.178.119.138
-121.178.170.114
  121.178.170.186
  121.178.170.205
  121.178.181.172
@@ -28813,9 +29435,9 @@
  121.183.128.220
  121.183.151.97
  121.183.164.47
-121.183.186.194
  121.183.188.85
  121.183.235.19
+121.183.251.18
  121.183.254.58
  121.183.70.91
  121.183.75.145
@@ -28837,6 +29459,7 @@
  121.186.147.16
  121.186.174.29
  121.186.175.229
+121.186.60.63
  121.186.79.89
  121.186.79.90
  121.186.94.12
@@ -28867,6 +29490,7 @@
  121.196.23.247
  121.196.57.160
  121.196.59.48
+121.199.60.92
  121.20.202.25
  121.20.248.128
  121.20.248.252
@@ -28875,6 +29499,7 @@
  121.200.127.208
  121.200.48.58
  121.200.48.98
+121.200.61.37
  121.200.63.10
  121.200.64.45
  121.200.7.120
@@ -28882,9 +29507,10 @@
  121.200.82.32
  121.200.82.40
  121.201.10.117
+121.201.10.82
  121.201.101.226
  121.201.108.7
-121.201.119.77
+121.201.119.61
  121.201.124.251
  121.201.124.46
  121.201.19.7
@@ -28892,6 +29518,7 @@
  121.201.36.14
  121.201.38.254
  121.201.45.212
+121.201.61.189
  121.201.61.205
  121.201.65.142
  121.201.74.154
@@ -28902,6 +29529,7 @@
  121.201.94.17
  121.201.95.66
  121.201.95.79
+121.202.41.3
  121.203.221.85
  121.204.0.122
  121.204.142.193
@@ -28910,25 +29538,29 @@
  121.204.154.158
  121.204.164.170
  121.204.164.96
+121.204.166.240
+121.204.166.76
  121.204.208.43
  121.204.213.37
  121.204.247.190
+121.204.50.133
  121.205.220.178
  121.205.220.251
-121.205.222.77
  121.205.255.106
  121.205.96.188
  121.206.16.116
  121.206.92.211
  121.206.92.249
  121.207.226.106
+121.209.143.111
  121.21.120.16
  121.21.154.65
-121.21.67.246
  121.21.92.217
  121.211.20.23
  121.211.201.98
+121.214.69.148
  121.215.45.82
+121.216.100.100
  121.218.0.79
  121.22.124.83
  121.22.19.213
@@ -28962,6 +29594,7 @@
  121.224.179.33
  121.224.202.128
  121.224.59.192
+121.225.25.168
  121.225.25.43
  121.225.85.100
  121.226.131.122
@@ -28970,6 +29603,7 @@
  121.226.158.186
  121.226.177.125
  121.226.179.144
+121.226.188.123
  121.226.206.89
  121.226.207.145
  121.226.207.201
@@ -28993,7 +29627,6 @@
  121.228.136.239
  121.228.196.248
  121.228.215.83
-121.228.231.66
  121.229.0.116
  121.229.10.130
  121.229.124.211
@@ -29016,6 +29649,7 @@
  121.23.146.4
  121.23.193.32
  121.23.39.15
+121.23.41.197
  121.23.81.35
  121.23.88.92
  121.230.211.141
@@ -29029,7 +29663,6 @@
  121.231.101.240
  121.231.101.42
  121.231.102.55
-121.231.11.168
  121.231.123.247
  121.231.13.197
  121.231.139.15
@@ -29040,7 +29673,6 @@
  121.231.196.110
  121.231.75.160
  121.231.83.134
-121.231.9.4
  121.232.179.201
  121.232.195.86
  121.232.39.129bin.sh
@@ -29064,6 +29696,7 @@
  121.233.127.206
  121.233.15.177
  121.233.16.42
+121.233.17.184
  121.233.17.27
  121.233.19.170
  121.233.206.148
@@ -29071,12 +29704,9 @@
  121.233.26.8
  121.233.3.207
  121.233.31.125
-121.233.55.78
  121.233.68.89
  121.233.73.203
  121.233.73.233
-121.234.108.127
-121.234.108.32
  121.234.117.73
  121.234.120.237
  121.234.123.20
@@ -29084,30 +29714,29 @@
  121.234.20.155
  121.234.20.205
  121.234.200.32
-121.234.22.137
-121.234.24.158
  121.234.46.5
  121.234.47.75
-121.234.64.75
-121.234.65.129
-121.234.65.50
  121.234.99.53
  121.235.0.11
+121.235.175.55
  121.235.46.19
  121.235.59.129
  121.235.7.22
  121.235.78.207
+121.236.153.32
  121.236.175.251
  121.237.114.52
  121.237.140.165
+121.237.169.232
  121.237.225.11bin.sh
+121.237.35.140
  121.237.76.140
  121.239.143.14
  121.239.147.189
-121.239.147.38
  121.239.169.50
+121.239.188.33
  121.239.46.113
-121.239.49.51
+121.239.49.184
  121.24.124.34
  121.24.139.131
  121.24.139.155
@@ -29119,9 +29748,9 @@
  121.25.148.55
  121.25.201.160
  121.25.204.174
-121.25.30.142
  121.25.55.232
  121.25.55.58
+121.25.71.180
  121.25.78.196
  121.254.120.199
  121.254.123.250
@@ -29158,6 +29787,7 @@
  121.28.38.235
  121.28.56.246
  121.28.95.243
+121.28.96.30
  121.29.77.45
  121.29.82.147
  121.30.41.41
@@ -29175,18 +29805,20 @@
  121.33.144.168
  121.33.144.200
  121.33.145.135
+121.33.146.178
  121.33.146.236
-121.33.147.155
  121.33.147.41
  121.33.200.43
  121.33.220.158
  121.33.237.102
  121.33.254.10
  121.34.148.193
+121.34.148.82
  121.34.150.176
  121.34.35.177
  121.34.48.81
-121.34.49.148
+121.35.184.148
+121.35.184.178
  121.35.240.245
  121.35.98.191
  121.36.100.194
@@ -29214,16 +29846,19 @@
  121.37.220.122
  121.37.240.245
  121.37.26.179
+121.37.69.105
  121.40.105.124
+121.40.128.99
  121.40.141.226
  121.40.162.239
  121.40.199.102
+121.40.222.102
  121.40.55.144
  121.40.66.129
  121.40.70.132
+121.40.71.110
  121.41.82.60
  121.42.227.63
-121.42.38.56
  121.43.163.43
  121.43.186.155
  121.45.205.29
@@ -29241,37 +29876,37 @@
  121.46.26.17
  121.46.31.174
  121.46.4.194
+121.48.165.121
  121.48.165.2
  121.52.132.186
  121.52.150.220
  121.52.153.6
-121.52.154.154
  121.52.154.216
-121.52.155.201
+121.52.154.36
  121.52.155.57
  121.52.157.112
  121.52.214.63
  121.52.215.211
  121.52.215.225
+121.52.41.26
  121.52.66.102
  121.54.164.151
  121.54.168.251
  121.54.168.252
  121.54.168.253
  121.54.169.69
+121.54.189.15
  121.54.216.91
  121.54.58.242
  121.54.71.217
  121.55.103.152
  121.55.106.20
-121.55.148.140
  121.55.149.61
  121.55.162.60
  121.55.240.208
  121.55.244.163
  121.55.246.116
  121.55.73.118
-121.57.100.120
  121.57.177.85
  121.57.178.44
  121.57.179.101
@@ -29292,9 +29927,10 @@
  121.6.39.204
  121.6.54.248
  121.6.73.95
+121.6.90.44
+121.60.87.252
  121.61.104.70
  121.61.106.104
-121.61.110.168
  121.61.111.145
  121.61.16.125
  121.61.17.245
@@ -29303,19 +29939,18 @@
  121.61.56.226
  121.61.65.135
  121.61.67.219
-121.61.68.138
  121.61.75.113
  121.61.75.76
  121.61.76.44
  121.61.78.91
  121.61.96.111
-121.61.99.118
+121.61.99.160
  121.61.99.163
-121.61.99.31
  121.63.207.130
  121.63.247.49
  121.63.247.74
  121.63.64.213
+121.63.80.219
  121.63.82.89
  121.63.82.89bin.sh
  121.65.104.157
@@ -29326,7 +29961,6 @@
  121.66.205.3
  121.66.35.37
  121.67.246.170
-121.67.99.220
  121.69.135.162
  121.69.135.6
  121.69.26.214
@@ -29335,6 +29969,7 @@
  121.69.89.78
  121.69.93.226
  121.7.116.114
+121.7.127.92
  121.7.146.78
  121.7.171.16
  121.7.198.25
@@ -29344,6 +29979,7 @@
  121.7.63.37
  121.7.72.215
  121.74.130.149
+121.74.225.185
  121.75.218.237
  121.78.116.203
  121.78.116.209
@@ -29366,7 +30002,6 @@
  121.88.99.236
  121.89.193.102
  121.89.194.147
-121.89.198.64
  121.9.252.250
  121.94.100.61
  121.94.114.45
@@ -29391,7 +30026,6 @@
  122.100.117.7
  122.100.188.50
  122.100.200.202
-122.100.203.126
  122.100.210.2
  122.100.231.167
  122.100.238.232
@@ -29410,26 +30044,30 @@
  122.112.229.12
  122.112.71.214
  122.114.112.195
+122.114.116.59
  122.114.127.157
  122.114.13.4
  122.114.131.124
+122.114.14.153
  122.114.141.155
  122.114.149.176
  122.114.156.206
  122.114.157.103
  122.114.157.45
-122.114.158.123
  122.114.159.176
  122.114.159.212
  122.114.165.123
  122.114.166.8
  122.114.167.2
  122.114.168.28
+122.114.183.18
  122.114.185.153
  122.114.188.97
  122.114.198.163
+122.114.206.112
  122.114.215.140
  122.114.240.228
+122.114.245.196
  122.114.246.248
  122.114.247.201
  122.114.248.57
@@ -29453,12 +30091,10 @@
  122.114.96.59
  122.114.99.178
  122.115.225.170
-122.115.226.168
  122.115.226.198
  122.115.227.146
  122.115.229.124
  122.115.229.34
-122.115.230.102
  122.115.230.147
  122.115.230.149
  122.115.230.204
@@ -29474,13 +30110,13 @@
  122.116.100.82
  122.116.101.202
  122.116.103.221
+122.116.104.129
  122.116.104.167
  122.116.106.217
  122.116.108.111
  122.116.115.30
  122.116.115.59
  122.116.119.93
-122.116.124.132
  122.116.124.137
  122.116.124.192
  122.116.126.98
@@ -29498,7 +30134,6 @@
  122.116.142.180
  122.116.142.4
  122.116.148.218
-122.116.151.103
  122.116.151.91
  122.116.151.92
  122.116.152.28
@@ -29520,14 +30155,16 @@
  122.116.201.108
  122.116.202.1
  122.116.203.12
+122.116.203.125
  122.116.203.128
  122.116.203.147
  122.116.203.31
  122.116.207.231
-122.116.207.70
  122.116.209.151
  122.116.21.182
+122.116.213.28
  122.116.216.195
+122.116.22.184
  122.116.220.163
  122.116.220.195
  122.116.220.209
@@ -29536,7 +30173,6 @@
  122.116.223.65
  122.116.224.183
  122.116.226.165
-122.116.230.204
  122.116.233.207
  122.116.234.217
  122.116.237.12
@@ -29557,7 +30193,6 @@
  122.116.244.28
  122.116.245.142
  122.116.245.55
-122.116.245.65
  122.116.246.140
  122.116.246.170
  122.116.246.187
@@ -29596,6 +30231,7 @@
  122.116.61.40
  122.116.61.44
  122.116.64.204
+122.116.67.159
  122.116.7.29
  122.116.73.178
  122.116.73.231
@@ -29673,12 +30309,12 @@
  122.117.135.60
  122.117.136.11
  122.117.138.43
+122.117.141.253
  122.117.143.167
  122.117.143.173
  122.117.143.175
  122.117.143.191
  122.117.145.250
-122.117.148.16
  122.117.149.222
  122.117.150.18
  122.117.151.158
@@ -29690,7 +30326,6 @@
  122.117.152.204
  122.117.153.232
  122.117.153.59
-122.117.155.196
  122.117.156.82
  122.117.157.113
  122.117.157.80
@@ -29727,6 +30362,7 @@
  122.117.189.32
  122.117.19.122
  122.117.19.146
+122.117.190.194
  122.117.190.202
  122.117.190.230
  122.117.190.232
@@ -29743,10 +30379,12 @@
  122.117.202.136
  122.117.202.3
  122.117.203.61
+122.117.206.154
  122.117.206.249
  122.117.207.110
  122.117.207.27
  122.117.208.158
+122.117.208.98
  122.117.209.114
  122.117.21.60
  122.117.21.75
@@ -29761,8 +30399,6 @@
  122.117.216.47
  122.117.217.105
  122.117.217.75
-122.117.218.248
-122.117.219.228
  122.117.22.145
  122.117.22.168
  122.117.22.61
@@ -29770,7 +30406,6 @@
  122.117.222.173
  122.117.222.39
  122.117.223.186
-122.117.224.164
  122.117.224.85
  122.117.225.162
  122.117.226.239
@@ -29834,7 +30469,6 @@
  122.117.58.197
  122.117.58.210
  122.117.58.95
-122.117.6.36
  122.117.62.152
  122.117.62.84
  122.117.65.179
@@ -29889,17 +30523,15 @@
  122.117.97.217
  122.117.97.33
  122.117.97.54
-122.117.98.133
  122.117.98.59
  122.117.99.102
  122.117.99.194
  122.117.99.210
  122.117.99.77
  122.118.115.84
+122.118.13.252
  122.118.15.204
  122.118.155.59
-122.118.17.213
-122.118.187.77
  122.118.188.165
  122.118.19.95
  122.118.190.181
@@ -29933,6 +30565,7 @@
  122.136.146.244
  122.136.212.132
  122.136.219.81
+122.136.245.217
  122.136.50.160
  122.136.51.139
  122.136.52.119
@@ -29951,6 +30584,7 @@
  122.137.9.60
  122.138.109.184
  122.138.133.169
+122.138.141.148
  122.138.148.170
  122.138.164.17
  122.138.20.8
@@ -29968,29 +30602,28 @@
  122.14.200.208
  122.14.201.129
  122.14.201.170
+122.14.210.153
  122.14.211.208
  122.14.213.71
  122.14.214.107
  122.14.217.48
  122.14.220.129
+122.14.222.202
  122.14.233.99
  122.140.114.180
  122.140.115.181
  122.140.120.206
  122.140.131.5
  122.140.153.81
-122.140.157.92
-122.140.255.129
  122.140.255.9
  122.140.45.198
  122.140.89.105
  122.140.93.250
  122.140.95.51
-122.140.98.11
  122.141.132.47
+122.141.177.112
  122.141.182.42
  122.141.183.14
-122.141.19.82
  122.141.234.178
  122.141.234.179
  122.141.24.127
@@ -30001,6 +30634,7 @@
  122.141.71.56
  122.142.105.194
  122.142.156.61
+122.142.239.16
  122.142.28.71
  122.142.91.184
  122.143.11.111
@@ -30021,9 +30655,11 @@
  122.144.134.27
  122.144.15.36
  122.144.196.122
+122.144.211.235
  122.144.212.144
  122.144.221.149
  122.146.196.217
+122.146.205.98
  122.147.131.89
  122.147.141.151
  122.147.213.63
@@ -30034,7 +30670,6 @@
  122.15.202.50
  122.15.71.33
  122.152.194.123
-122.152.195.84
  122.152.196.222
  122.152.202.214
  122.152.204.42
@@ -30087,10 +30722,8 @@
  122.156.44.55
  122.157.59.239
  122.158.67.55
-122.159.1.107
  122.159.177.251
  122.159.181.163
-122.159.208.61
  122.159.23.143
  122.159.243.43
  122.159.29.103
@@ -30102,22 +30735,26 @@
  122.160.2.233
  122.160.48.10
  122.160.48.9
-122.160.51.88
  122.160.52.173
  122.160.61.100
  122.160.63.98
  122.160.99.22
-122.161.247.198
+122.161.241.122
+122.161.241.62
  122.162.128.167
+122.162.46.246
  122.162.50.237
  122.162.80.201
  122.163.120.53
  122.163.123.181
  122.164.27.12
+122.164.7.53
  122.165.104.51
+122.165.131.7
  122.165.144.219
  122.165.149.75
  122.165.171.107
+122.165.191.124
  122.165.194.191
  122.165.196.72
  122.165.199.205
@@ -30127,6 +30764,7 @@
  122.165.206.136
  122.165.207.151
  122.165.247.254
+122.166.155.140
  122.166.162.9
  122.166.171.166
  122.166.176.48
@@ -30134,6 +30772,7 @@
  122.166.22.197
  122.166.227.27
  122.167.177.179
+122.168.123.193
  122.168.125.226
  122.169.110.96
  122.169.114.254
@@ -30146,10 +30785,8 @@
  122.170.118.66
  122.170.5.123
  122.170.6.71
-122.171.171.167
+122.173.185.125
  122.174.12.93
-122.175.135.229
-122.175.51.11
  122.175.62.51
  122.176.169.143
  122.176.251.183
@@ -30166,14 +30803,12 @@
  122.178.115.118
  122.178.230.57
  122.178.39.249
+122.178.85.68
  122.178.96.45
  122.179.129.138
  122.179.132.118
  122.179.231.182
-122.179.43.231
-122.179.58.252
  122.180.150.30
-122.180.191.212
  122.180.245.53
  122.180.254.6
  122.180.48.29
@@ -30181,18 +30816,19 @@
  122.183.139.104
  122.183.17.66
  122.183.200.218
+122.185.149.38
  122.185.174.134
  122.185.22.171
  122.188.130.132
-122.188.192.10
  122.189.105.132
  122.189.155.225
+122.190.22.131
  122.191.189.91
-122.192.207.43
  122.192.5.82
  122.193.10.153
  122.193.10.180
  122.193.103.228
+122.193.104.186
  122.193.113.140
  122.193.118.58
  122.193.224.98
@@ -30209,9 +30845,11 @@
  122.194.229.120
  122.194.229.122
  122.194.229.3
+122.194.229.37
  122.194.229.54
  122.194.229.59
  122.194.44.48
+122.194.70.17
  122.195.134.68
  122.195.156.76
  122.195.197.116
@@ -30227,14 +30865,14 @@
  122.199.66.26
  122.199.66.28
  122.199.72.23
-122.199.72.57
  122.199.72.78
  122.199.76.65
  122.199.79.37
  122.199.79.41
  122.199.86.209
+122.2.100.33
  122.2.16.227
-122.2.245.156
+122.2.48.173
  122.200.144.42
  122.200.150.129
  122.200.150.249
@@ -30244,7 +30882,6 @@
  122.200.93.45
  122.200.93.95
  122.200.94.15
-122.201.19.105
  122.201.19.99
  122.201.23.122
  122.201.76.100
@@ -30264,7 +30901,6 @@
  122.224.119.123
  122.224.126.58
  122.224.131.115
-122.224.132.59
  122.224.19.43
  122.224.199.174
  122.224.20.214
@@ -30286,7 +30922,6 @@
  122.225.130.74
  122.225.139.180
  122.225.202.74
-122.225.203.162
  122.225.218.234
  122.225.52.166
  122.225.61.30
@@ -30314,6 +30949,7 @@
  122.227.115.56
  122.227.126.129
  122.227.144.78
+122.227.159.84
  122.227.160.110
  122.227.164.71
  122.227.174.246
@@ -30341,7 +30977,6 @@
  122.228.19.80
  122.228.249.70
  122.23.1.27
-122.230.1.54
  122.230.132.209
  122.230.133.47
  122.230.225.33
@@ -30350,18 +30985,21 @@
  122.230.69.141
  122.230.70.119
  122.231.47.237
+122.232.151.243
  122.232.154.131
+122.232.224.52
  122.233.135.21
  122.233.188.147
  122.233.227.118
  122.233.238.248
-122.233.76.255
+122.234.233.65
  122.234.234.54
  122.234.235.129
  122.234.77.121
  122.235.248.24
  122.235.78.170
  122.236.192.162
+122.237.104.53
  122.237.107.36
  122.237.107.86
  122.239.128.19
@@ -30369,24 +31007,14 @@
  122.239.155.129
  122.239.175.82
  122.24.84.151
-122.240.155.200
-122.242.209.195
-122.242.223.237
-122.242.90.228
-122.242.91.177
-122.242.91.219
-122.242.92.88
-122.242.93.220
-122.242.94.111
-122.242.94.78
-122.243.58.247
+122.241.0.14
  122.244.221.131
  122.244.240.3
  122.245.107.195
-122.245.64.228
  122.245.83.18
-122.247.182.169
+122.247.241.83
  122.247.243.30
+122.247.26.39
  122.247.73.21
  122.248.103.64
  122.248.32.54
@@ -30394,14 +31022,13 @@
  122.248.37.10
  122.248.37.50
  122.248.38.4
-122.248.38.89
  122.252.181.58
  122.252.205.212
  122.252.225.165
  122.252.229.2
-122.252.230.211
  122.252.233.123
  122.252.234.203
+122.252.235.107
  122.252.239.5
  122.252.246.206
  122.252.250.22
@@ -30418,7 +31045,6 @@
  122.254.200.177
  122.254.200.204
  122.254.27.134
-122.254.28.128
  122.254.28.177
  122.254.30.48
  122.254.33.146
@@ -30426,10 +31052,11 @@
  122.254.33.77
  122.254.35.44
  122.254.85.111
+122.254.85.54
  122.254.87.109
  122.255.5.42
  122.255.6.218
-122.28.53.188
+122.27.45.76
  122.3.0.26
  122.3.145.89
  122.3.169.246
@@ -30441,30 +31068,23 @@
  122.4.199.239
  122.4.240.189
  122.4.249.171
-122.4.28.119
  122.4.28.186
+122.4.28.24
  122.4.29.233
-122.4.42.161
+122.4.40.102
+122.4.40.207
+122.4.41.12
  122.4.43.155
  122.4.43.253
-122.4.44.147
-122.4.44.19
  122.4.44.75
-122.4.44.8
-122.4.45.13
  122.4.45.228
-122.4.47.14
  122.4.47.47
-122.4.48.44
  122.4.50.52
+122.4.51.132
  122.4.51.149
-122.4.53.118
  122.4.53.53
-122.4.54.243
  122.4.54.254
-122.4.55.197
  122.4.55.33
-122.4.55.46
  122.40.66.17
  122.42.206.235
  122.42.56.128
@@ -30482,7 +31102,9 @@
  122.51.102.227
  122.51.103.120
  122.51.104.28
-122.51.108.64
+122.51.111.159
+122.51.114.226
+122.51.114.51
  122.51.124.85
  122.51.125.104
  122.51.125.71
@@ -30499,7 +31121,9 @@
  122.51.154.136
  122.51.154.84
  122.51.156.113
+122.51.158.15
  122.51.158.27
+122.51.160.62
  122.51.161.231
  122.51.163.237
  122.51.164.139
@@ -30507,15 +31131,19 @@
  122.51.167.43
  122.51.168.50
  122.51.169.54
+122.51.17.106
  122.51.170.88
  122.51.175.20
+122.51.177.151
  122.51.178.207
  122.51.178.89
  122.51.179.14
  122.51.18.119
+122.51.180.34
  122.51.181.232
  122.51.186.145
  122.51.186.17
+122.51.186.219
  122.51.186.228
  122.51.186.86
  122.51.187.118
@@ -30524,12 +31152,20 @@
  122.51.189.179
  122.51.190.182
  122.51.191.69
+122.51.192.105
+122.51.193.108
  122.51.194.44
  122.51.196.235
+122.51.198.232
  122.51.198.90
+122.51.199.173
  122.51.199.69
  122.51.200.223
  122.51.200.252
+122.51.201.158
+122.51.201.5
+122.51.201.67
+122.51.202.157
  122.51.203.120
  122.51.204.192
  122.51.204.45
@@ -30540,10 +31176,13 @@
  122.51.208.154
  122.51.208.60
  122.51.208.66
+122.51.209.153
+122.51.209.252
  122.51.210.116
  122.51.211.131
  122.51.211.249
  122.51.218.122
+122.51.221.250
  122.51.222.42
  122.51.224.106
  122.51.225.107
@@ -30559,6 +31198,8 @@
  122.51.231.80
  122.51.233.63
  122.51.234.65
+122.51.235.39
+122.51.236.222
  122.51.237.131
  122.51.238.27
  122.51.239.65
@@ -30584,6 +31225,7 @@
  122.51.28.187
  122.51.30.252
  122.51.31.171
+122.51.31.60
  122.51.32.248
  122.51.32.91
  122.51.33.61
@@ -30591,15 +31233,19 @@
  122.51.36.254
  122.51.39.232
  122.51.40.61
+122.51.41.109
  122.51.41.36
  122.51.41.63
  122.51.43.191
  122.51.45.200
+122.51.45.240
  122.51.48.251
  122.51.52.109
  122.51.52.154
  122.51.55.171
+122.51.56.205
  122.51.57.14
+122.51.57.78
  122.51.60.39
  122.51.62.212
  122.51.64.115
@@ -30610,24 +31256,33 @@
  122.51.68.7
  122.51.69.116
  122.51.7.103
+122.51.70.17
  122.51.72.249
+122.51.72.53
  122.51.73.73
  122.51.77.182
+122.51.78.131
  122.51.78.73
  122.51.80.81
  122.51.81.247
+122.51.82.153
  122.51.82.162
+122.51.82.22
  122.51.83.195
+122.51.85.3
  122.51.85.95
  122.51.86.120
  122.51.89.18
  122.51.90.66
+122.51.91.131
  122.51.92.196
  122.51.92.78
  122.51.95.90
  122.51.96.57
+122.51.97.113
  122.51.97.151
  122.51.97.199
+122.51.98.36
  122.51.99.88
  122.52.107.94
  122.52.127.96
@@ -30646,7 +31301,6 @@
  122.54.131.137
  122.54.134.176
  122.54.143.156
-122.54.18.163
  122.54.18.179
  122.54.20.213
  122.54.20.216
@@ -30654,10 +31308,10 @@
  122.54.82.130
  122.55.108.14
  122.55.202.100
+122.55.252.165
  122.55.79.116
  122.56.185.175
  122.58.86.163
-122.6.250.171
  122.60.42.48
  122.60.63.85
  122.7.82.158
@@ -30668,10 +31322,12 @@
  122.9.141.171
  122.9.67.134
  122.96.103.90
+122.96.12.80
  122.96.140.194
  122.96.140.226
  122.96.254.112
  122.96.8.167
+122.97.130.196
  122.97.162.201
  122.97.208.74
  122.97.216.52
@@ -30686,6 +31342,7 @@
  123.0.243.122
  123.0.250.82
  123.0.34.96
+123.1.0.188
  123.1.148.100
  123.1.154.200
  123.1.154.224
@@ -30693,15 +31350,18 @@
  123.1.187.40
  123.1.187.49
  123.1.189.100
+123.1.189.112
  123.1.189.132
+123.1.189.170
  123.1.189.244
  123.1.189.249
  123.1.189.253
  123.1.189.70
  123.1.194.216
-123.10.128.223
  123.10.129.234
+123.10.130.115
  123.10.130.193
+123.10.131.251
  123.10.153.139
  123.10.157.219
  123.10.159.123
@@ -30710,14 +31370,14 @@
  123.10.170.158
  123.10.173.145
  123.10.179.118
-123.10.185.200
  123.10.2.38
  123.10.210.180
  123.10.213.244
-123.10.218.34
+123.10.223.210
  123.10.24.220
  123.10.28.162
  123.10.35.171
+123.10.4.200
  123.10.47.166
  123.10.52.160
  123.10.59.138
@@ -30725,8 +31385,10 @@
  123.10.8.142
  123.10.8.237
  123.10.82.220
+123.100.164.216
  123.101.174.165
  123.101.207.37
+123.101.207.79
  123.103.242.12
  123.103.88.252
  123.108.161.197
@@ -30737,44 +31399,56 @@
  123.108.189.92
  123.108.189.93
  123.108.191.173
+123.108.191.75
  123.108.200.102
  123.108.201.133
+123.108.246.7
  123.108.249.82
  123.108.252.170
+123.108.35.186
  123.108.50.164
+123.108.50.41
  123.108.97.50
+123.109.159.4
  123.109.237.211
  123.109.80.223
-123.11.1.128
-123.11.10.82
-123.11.11.27
+123.11.0.237
+123.11.12.236
  123.11.13.120
-123.11.13.164
  123.11.13.202
  123.11.13.233
+123.11.15.35
+123.11.153.12
  123.11.153.28
  123.11.164.187
-123.11.166.247
-123.11.168.235
+123.11.173.236
  123.11.192.142
  123.11.193.137
  123.11.195.214
  123.11.198.175
  123.11.199.244
-123.11.201.34
+123.11.2.226
+123.11.201.201
  123.11.234.244
  123.11.235.95
+123.11.254.91
+123.11.27.164
+123.11.37.224
+123.11.39.198
+123.11.39.95
+123.11.4.134
  123.11.4.81
  123.11.4.96
  123.11.52.247
  123.11.53.180
  123.11.63.173
-123.11.64.88
  123.11.73.104
  123.11.78.153
  123.11.78.82
  123.11.79.213
  123.11.9.175
+123.11.92.122
+123.11.93.9
  123.110.102.172
  123.110.11.185
  123.110.11.238
@@ -30802,16 +31476,17 @@
  123.110.61.76
  123.110.75.232
  123.110.79.20
+123.110.82.235
  123.110.85.88
  123.110.87.57
  123.110.94.247
  123.110.96.97
  123.112.128.24
+123.112.64.24
  123.113.115.183
  123.113.116.173
  123.113.13.239
  123.113.29.3
-123.113.30.24
  123.114.199.86
  123.114.208.126
  123.114.208.6
@@ -30819,7 +31494,6 @@
  123.114.43.169
  123.114.50.100
  123.114.57.8
-123.115.158.195
  123.115.218.92
  123.115.224.253
  123.116.153.113
@@ -30844,17 +31518,17 @@
  123.119.238.247
  123.119.239.191
  123.119.239.202
+123.119.27.27
  123.119.61.147
-123.12.109.180
  123.12.148.254
-123.12.162.129
  123.12.164.146
-123.12.179.203
+123.12.175.95
  123.12.181.91
  123.12.196.134
  123.12.197.46
-123.12.2.163
  123.12.221.108
+123.12.225.94
+123.12.226.119
  123.12.229.211
  123.12.231.175
  123.12.233.247
@@ -30862,10 +31536,10 @@
  123.12.235.170
  123.12.236.211
  123.12.242.248
-123.12.242.41
  123.12.243.129
-123.12.246.70
  123.12.25.35
+123.12.38.151
+123.12.39.229
  123.12.41.157
  123.12.57.199
  123.12.57.50
@@ -30873,29 +31547,39 @@
  123.12.62.90
  123.12.65.254
  123.12.68.172
-123.12.75.177
+123.12.8.80
  123.120.162.195
  123.120.163.18
-123.120.188.174
  123.120.23.156
  123.120.4.24
  123.121.126.192
  123.121.142.139
-123.121.47.148
  123.122.119.82
  123.122.155.63
+123.122.160.149
  123.122.160.213
+123.122.160.225
+123.122.160.60
+123.122.160.84
  123.122.161.110
  123.122.161.131
  123.122.161.14
+123.122.161.156
+123.122.161.16
  123.122.161.178
  123.122.161.24
+123.122.161.242
+123.122.161.63
+123.122.162.244
+123.122.162.51
  123.122.163.11
  123.122.163.129
+123.122.163.43
+123.122.163.46
+123.122.163.49
  123.122.163.86
  123.122.232.190
  123.123.255.50
-123.123.3.63
  123.124.21.253
  123.124.21.254
  123.124.71.106
@@ -30917,9 +31601,9 @@
  123.128.118.108
  123.128.129.94
  123.128.136.48
+123.128.163.35
  123.128.168.94
  123.128.180.98
-123.128.182.197
  123.128.221.216
  123.128.226.140
  123.128.226.140bin.sh
@@ -30932,6 +31616,7 @@
  123.129.156.42
  123.129.165.10
  123.129.166.147
+123.129.217.141
  123.129.217.182
  123.129.60.134
  123.129.78.150
@@ -30939,32 +31624,29 @@
  123.129.80.5
  123.129.86.168
  123.129.93.210
-123.129.95.213
  123.129.99.24
  123.13.120.172
  123.13.14.133
  123.13.143.145
-123.13.152.112
  123.13.154.144
  123.13.182.16
  123.13.197.221
  123.13.204.178
  123.13.210.89
  123.13.22.7
+123.13.24.135
  123.13.27.197
  123.13.28.245
-123.13.3.100
  123.13.38.147
-123.13.56.28
  123.13.63.225
  123.13.63.37
-123.13.82.124
  123.13.82.28
  123.13.98.186
  123.130.0.231
  123.130.104.11
  123.130.112.6
  123.130.149.229
+123.130.149.249
  123.130.166.249
  123.130.178.94
  123.130.19.225
@@ -30972,10 +31654,9 @@
  123.130.216.110
  123.130.216.147
  123.130.225.12
-123.130.236.220
+123.130.233.91
  123.130.236.87
  123.130.33.81
-123.130.39.162
  123.130.39.167
  123.130.43.58
  123.130.58.14
@@ -30983,6 +31664,7 @@
  123.130.88.76
  123.130.92.27
  123.130.94.147
+123.130.97.22
  123.131.10.220
  123.131.134.18
  123.131.165.105
@@ -30993,21 +31675,19 @@
  123.132.133.34
  123.132.152.78
  123.132.157.4
-123.132.160.193
  123.132.174.126
  123.132.187.24
  123.132.203.164
  123.132.227.30
  123.132.232.254
+123.132.237.18
  123.132.45.55
  123.132.46.188
  123.132.65.176
  123.132.65.76
  123.133.129.22
  123.133.136.244
-123.133.146.2
  123.133.147.228
-123.133.157.241
  123.133.168.134
  123.133.251.19
  123.133.252.118
@@ -31020,16 +31700,15 @@
  123.133.86.55
  123.134.16.254
  123.134.243.223
-123.134.3.4
  123.134.48.181
  123.134.56.92
  123.134.94.40
  123.135.10.227
-123.135.115.201
  123.135.117.136
  123.135.164.203
  123.135.205.139
  123.135.207.197
+123.135.248.63
  123.135.37.141
  123.136.104.2
  123.136.128.13
@@ -31051,49 +31730,53 @@
  123.139.56.148
  123.139.56.171
  123.139.56.238
-123.14.104.11
+123.14.104.177
  123.14.104.224
+123.14.104.33
  123.14.106.154
  123.14.107.209
  123.14.116.89
-123.14.117.35
  123.14.119.103
+123.14.121.27
  123.14.144.22
-123.14.147.75
-123.14.147.95
+123.14.146.221
  123.14.148.217
-123.14.149.210
-123.14.153.250
+123.14.151.247
  123.14.154.13
+123.14.154.181
+123.14.156.25
  123.14.166.183
  123.14.166.99
  123.14.168.31
-123.14.173.159
+123.14.179.42
  123.14.192.204
  123.14.194.236
-123.14.196.168
  123.14.199.130
-123.14.200.41
  123.14.202.209
  123.14.204.100
-123.14.206.220
+123.14.204.106
  123.14.232.62
  123.14.237.160
  123.14.238.42
-123.14.49.66
+123.14.239.214
+123.14.249.125
+123.14.250.78
+123.14.255.94
+123.14.26.129
+123.14.33.255
+123.14.34.36
+123.14.42.14
  123.14.5.115
-123.14.50.73
  123.14.51.196
  123.14.64.182
+123.14.64.201
+123.14.69.146
+123.14.73.12
  123.14.81.195
  123.14.82.242
  123.14.83.47
-123.14.84.17
-123.14.88.39
-123.14.89.24
-123.14.90.23
+123.14.88.89
  123.14.91.113
-123.14.91.92
  123.14.93.162
  123.14.94.100
  123.140.114.196
@@ -31109,7 +31792,6 @@
  123.142.37.166
  123.142.41.244
  123.142.5.138
-123.142.6.107
  123.143.203.194
  123.143.203.67
  123.143.224.42
@@ -31121,17 +31803,20 @@
  123.145.219.178
  123.145.220.216
  123.145.220.218
+123.145.88.97
  123.146.114.40
  123.146.120.121
  123.146.202.181
  123.146.23.149
  123.146.89.90
  123.148.140.145
-123.149.208.39
-123.149.210.184
-123.149.215.135
-123.149.215.206
-123.149.215.242
+123.149.141.193
+123.149.208.208
+123.149.209.159
+123.149.210.245
+123.149.212.118
+123.149.212.177
+123.149.215.168
  123.149.22.119
  123.149.23.43
  123.149.23.45
@@ -31140,12 +31825,13 @@
  123.15.58.214
  123.150.143.184
  123.150.244.226
+123.150.9.163
  123.150.9.74
  123.150.94.82
  123.152.114.180
-123.152.116.37
-123.152.237.96
  123.152.63.119
+123.153.120.49
+123.153.151.222
  123.153.59.38
  123.154.156.170
  123.154.158.186
@@ -31156,21 +31842,26 @@
  123.155.107.74
  123.155.117.9
  123.155.120.60
+123.155.154.202
  123.156.201.205
  123.156.225.30
  123.156.4.17
  123.156.84.175
  123.156.91.254
  123.157.102.179
+123.157.164.142
  123.157.164.85
  123.157.186.15
+123.157.234.230
  123.157.242.106
  123.158.10.237
  123.158.47.157
+123.158.48.178
+123.158.48.22
+123.158.48.79
  123.158.61.104
  123.159.11.126
  123.159.164.32
-123.159.178.43
  123.159.204.162
  123.159.68.81
  123.159.70.163
@@ -31181,6 +31872,7 @@
  123.16.204.161
  123.16.245.34
  123.16.32.175
+123.16.68.150
  123.160.247.161
  123.161.103.25
  123.161.25.169
@@ -31192,15 +31884,16 @@
  123.163.10.58
  123.163.11.251
  123.163.11.56
+123.163.115.63
+123.163.116.132
  123.163.122.122
-123.163.21.88
  123.163.234.44
  123.163.234.94
  123.163.237.119
  123.163.97.210
  123.164.108.177
  123.164.108.6
-123.166.133.119
+123.164.166.140
  123.169.102.82
  123.169.103.130
  123.169.133.153
@@ -31215,8 +31908,10 @@
  123.172.81.115
  123.173.10.197
  123.173.8.135
+123.174.248.166
  123.174.33.221
  123.174.34.10
+123.174.34.42
  123.176.11.184
  123.176.158.247
  123.176.16.60
@@ -31230,53 +31925,57 @@
  123.178.150.230
  123.178.153.42
  123.178.167.90
+123.178.214.189
+123.178.214.195
  123.178.30.66
+123.179.191.247
  123.18.140.21
  123.18.194.146
  123.18.206.15
  123.18.206.39
-123.18.58.85
+123.18.209.25
  123.180.140.101
  123.180.140.32
  123.180.209.20
-123.181.121.120
+123.180.63.211
  123.181.235.123
  123.182.134.194
  123.182.143.222
  123.182.255.52
  123.182.98.191
  123.182.98.245
-123.183.124.18
  123.183.125.7
  123.183.172.85
+123.183.19.110
  123.183.19.209
  123.184.16.66
+123.185.202.96
  123.185.234.7
+123.185.24.26
  123.185.24.98
  123.185.25.218
  123.185.33.168
-123.188.146.92
  123.188.159.45
  123.188.184.16
-123.188.217.2
  123.188.222.154
  123.188.248.58
  123.188.6.70
+123.188.74.172
  123.189.127.111
  123.189.43.217
-123.189.81.129
  123.189.82.141
  123.189.85.131
  123.189.96.162
  123.189.97.217
  123.19.144.98
  123.19.209.128
+123.190.131.254
  123.190.162.88
  123.190.163.247
  123.190.164.83
  123.190.21.88
  123.190.72.247
-123.191.133.137
+123.191.250.229
  123.191.38.76
  123.191.53.106
  123.191.58.0
@@ -31309,7 +32008,6 @@
  123.193.81.252
  123.193.81.88
  123.193.88.51
-123.193.89.102
  123.193.89.161
  123.194.114.131
  123.194.118.231
@@ -31320,6 +32018,7 @@
  123.194.186.211
  123.194.235.145
  123.194.28.183
+123.194.28.241
  123.194.32.208
  123.194.33.6
  123.194.35.82
@@ -31357,17 +32056,14 @@
  123.195.99.9
  123.196.116.245
  123.20.0.254
-123.20.119.38
  123.20.134.220
  123.20.153.96
  123.20.157.253
  123.20.184.42
  123.20.21.219
-123.20.214.141
  123.20.235.150
  123.20.243.52
  123.20.250.77
-123.20.35.207
  123.20.35.38
  123.20.44.21
  123.20.45.189
@@ -31386,6 +32082,7 @@
  123.200.27.217
  123.200.31.226
  123.200.4.42
+123.200.94.152
  123.201.124.74
  123.201.150.244
  123.201.165.121
@@ -31395,9 +32092,11 @@
  123.202.194.67
  123.202.199.143
  123.202.216.69
+123.202.243.124
  123.202.3.226
  123.202.96.137
  123.202.96.193
+123.203.134.234
  123.203.138.210
  123.203.149.167
  123.203.163.128
@@ -31426,9 +32125,11 @@
  123.206.104.110
  123.206.104.162
  123.206.111.27
+123.206.118.47
  123.206.120.120
  123.206.174.21
  123.206.188.77
+123.206.200.204
  123.206.216.65
  123.206.217.32
  123.206.219.211
@@ -31437,6 +32138,7 @@
  123.206.229.59
  123.206.23.106
  123.206.23.158
+123.206.230.43
  123.206.232.235
  123.206.255.181
  123.206.26.133
@@ -31456,6 +32158,7 @@
  123.206.54.218
  123.206.54.78
  123.206.62.112
+123.206.63.78
  123.206.64.111
  123.206.65.38
  123.206.69.81
@@ -31488,6 +32191,7 @@
  123.207.153.52
  123.207.154.28
  123.207.155.210
+123.207.156.55
  123.207.175.111
  123.207.186.215
  123.207.186.225
@@ -31502,11 +32206,11 @@
  123.207.241.112
  123.207.241.226
  123.207.250.132
+123.207.27.242
  123.207.34.86
  123.207.36.21
  123.207.41.17
  123.207.54.49
-123.207.58.160
  123.207.66.80
  123.207.74.24
  123.207.78.83
@@ -31516,18 +32220,21 @@
  123.207.95.121
  123.207.97.250
  123.207.99.184
+123.207.99.189
+123.208.201.236
  123.209.202.47
  123.209.226.107
+123.209.243.236
  123.209.93.122
  123.21.103.40
-123.21.104.55
  123.21.106.221
  123.21.123.38
-123.21.154.141
+123.21.18.110
+123.21.194.142
+123.21.205.46
  123.21.209.221
-123.21.226.31
+123.21.25.203
  123.21.6.135
-123.21.67.10
  123.21.94.185
  123.212.1.151
  123.212.124.25
@@ -31538,13 +32245,13 @@
  123.22.151.221
  123.22.205.104
  123.22.212.99
-123.22.54.182
  123.220.251.190
  123.223.131.228
  123.23.115.61
  123.23.28.246
  123.23.45.117
  123.23.76.48
+123.230.227.89
  123.231.12.97
  123.231.14.1
  123.231.141.58
@@ -31560,11 +32267,13 @@
  123.232.106.2
  123.232.170.69
  123.232.190.74
+123.232.194.251
  123.232.38.50
  123.232.42.210
  123.232.87.181
  123.233.116.131
  123.233.116.36
+123.233.138.83
  123.233.185.116
  123.233.246.3
  123.234.116.110
@@ -31587,7 +32296,9 @@
  123.235.176.55
  123.235.191.87
  123.235.21.146
+123.235.226.18
  123.235.226.187
+123.235.226.9
  123.235.227.107
  123.235.241.109
  123.235.241.49
@@ -31598,13 +32309,15 @@
  123.235.81.223
  123.235.82.206
  123.236.91.45
+123.24.102.91
  123.24.110.93
-123.24.124.40
-123.24.205.125
+123.24.205.79
+123.24.206.9
  123.240.105.252
  123.240.115.170
  123.240.124.159
  123.240.128.236
+123.240.13.21
  123.240.14.246
  123.240.144.173
  123.240.146.61
@@ -31637,6 +32350,7 @@
  123.241.131.224
  123.241.140.20
  123.241.148.58
+123.241.16.238
  123.241.160.188
  123.241.17.187
  123.241.172.97
@@ -31652,18 +32366,16 @@
  123.241.57.57
  123.241.64.244
  123.242.179.10
+123.243.170.245
  123.245.10.70
-123.245.25.87
  123.247.13.183
  123.247.36.132
-123.248.122.207
  123.248.151.77
  123.248.159.164
  123.249.26.47
  123.25.1.66
  123.25.116.228
  123.25.139.31
-123.25.153.137
  123.25.204.233
  123.25.209.69
  123.25.30.146
@@ -31672,23 +32384,26 @@
  123.252.201.206
  123.252.203.196
  123.252.218.62
-123.252.228.210
  123.253.125.117
  123.254.111.40
  123.254.167.233
  123.26.133.162
+123.26.153.152
  123.27.144.30
  123.27.145.207
  123.27.18.255
  123.27.185.191
  123.27.3.246
+123.27.56.144
  123.28.155.113
  123.28.161.20
  123.28.4.243
+123.28.64.71
  123.29.69.17
  123.3.82.79
  123.30.100.180
  123.30.108.115
+123.30.109.198
  123.30.109.21
  123.30.109.56
  123.30.111.19
@@ -31714,14 +32429,15 @@
  123.30.236.149
  123.30.237.51
  123.30.237.68
-123.30.240.59
  123.30.246.169
  123.30.249.49
  123.30.98.114
+123.30.98.115
  123.31.12.113
  123.31.17.69
  123.31.18.107
  123.31.26.130
+123.31.26.144
  123.31.27.102
  123.31.29.14
  123.31.31.12
@@ -31731,22 +32447,20 @@
  123.31.43.238
  123.31.45.224
  123.31.45.49
-123.4.146.148
-123.4.151.71
+123.4.154.136
+123.4.175.196
  123.4.179.206
  123.4.202.241
-123.4.216.126
+123.4.206.140
+123.4.212.68
+123.4.220.214
+123.4.221.209
  123.4.225.0
  123.4.241.239
-123.4.247.53
  123.4.249.127
-123.4.249.7
  123.4.25.87
-123.4.250.159
  123.4.252.132
-123.4.35.155
  123.4.35.243
-123.4.46.176
  123.4.48.173
  123.4.48.201
  123.4.48.70
@@ -31754,90 +32468,79 @@
  123.4.65.46
  123.4.69.229
  123.4.70.154
-123.4.71.8
-123.4.72.213
-123.4.74.231
+123.4.73.216
  123.4.74.233
  123.4.74.59
-123.4.81.185
+123.4.76.171
+123.4.77.176
+123.4.78.248
+123.4.81.121
  123.4.83.114
-123.4.83.183
  123.4.83.215
-123.4.84.27
  123.4.85.69
+123.4.87.112
  123.4.87.146
  123.4.88.226
+123.4.88.6
  123.4.89.128
-123.4.89.181
-123.4.90.166
  123.4.91.169
  123.4.92.227
  123.4.93.210
-123.4.94.223
  123.4.94.253
  123.4.94.29
  123.4.94.45
-123.4.95.114
-123.4.95.25
-123.4.95.35
-123.4.95.67
  123.48.157.61
  123.49.41.129
  123.49.47.238
  123.49.47.241
  123.49.47.26
  123.49.52.134
+123.49.52.30
  123.49.59.150
-123.5.116.71
+123.5.118.165
  123.5.118.25
  123.5.118.96
  123.5.122.39
  123.5.131.5
-123.5.138.230
-123.5.145.202
  123.5.146.231
-123.5.147.215
  123.5.149.197
+123.5.151.179
+123.5.16.187
  123.5.17.56
  123.5.181.164
  123.5.187.118
  123.5.19.67
  123.5.19.83
+123.5.190.174
  123.5.190.232
-123.5.195.242
-123.5.197.168
  123.5.20.92
  123.5.27.181
  123.5.9.119
-123.50.153.161
  123.51.152.54
  123.51.168.240
  123.51.185.103
  123.51.185.39
-123.52.103.174
-123.52.17.121
  123.52.202.58
  123.52.235.250
  123.52.43.85
-123.52.45.190
  123.53.181.10
  123.53.181.8
+123.54.178.6
  123.54.224.101
  123.54.230.115
  123.54.232.89
  123.54.251.225
  123.54.5.197
  123.55.102.154
-123.55.3.130
  123.55.73.209
+123.55.98.30
+123.56.160.202
  123.56.161.63
  123.56.211.157
  123.56.211.174
  123.56.226.102
  123.56.228.50
  123.56.249.154
-123.56.41.101
-123.56.42.218
  123.56.83.239
  123.56.96.131
  123.57.137.43
@@ -31859,24 +32562,26 @@
  123.58.5.36
  123.58.55.162
  123.58.7.223
-123.59.1.82
  123.59.1.83
  123.59.106.73
  123.59.116.47
  123.59.118.224
  123.59.118.251
  123.59.120.251
+123.59.147.250
  123.59.182.184
  123.59.194.116
  123.59.194.242
  123.59.194.42
  123.59.194.83
  123.59.195.125
+123.59.195.16
  123.59.195.173
  123.59.195.207
  123.59.195.34
  123.59.195.53
  123.59.195.7
+123.59.198.48
  123.59.209.197
  123.59.210.198
  123.59.210.240
@@ -31894,56 +32599,68 @@
  123.59.28.66
  123.59.61.147
  123.59.62.57
+123.6.5.104
  123.6.51.133
  123.60.167.10
  123.63.146.45
  123.63.242.115
  123.63.54.229
  123.7.114.134
-123.7.138.249
+123.7.16.116
  123.7.42.55
+123.7.56.99
+123.7.63.49
  123.7.66.13
-123.8.12.226
-123.8.138.4
+123.8.0.221
+123.8.128.58
+123.8.138.88
+123.8.15.17
  123.8.165.134
  123.8.174.74
  123.8.189.177
  123.8.190.0
  123.8.190.236
  123.8.218.211
+123.8.23.212
  123.8.23.87
  123.8.24.19
+123.8.24.193
+123.8.251.53
+123.8.26.145
  123.8.27.155
  123.8.29.250
  123.8.46.178
  123.8.49.104
+123.8.58.70
+123.8.70.189
+123.8.81.89
+123.8.84.173
  123.8.88.235
  123.8.95.238
-123.9.105.124
+123.9.105.49
  123.9.111.195
  123.9.111.220
+123.9.122.221
  123.9.177.30
  123.9.181.216
+123.9.192.129
  123.9.195.242
-123.9.199.232
-123.9.201.147
+123.9.197.135
+123.9.198.170
  123.9.201.7
  123.9.204.224
-123.9.206.1
-123.9.207.156
  123.9.207.160
  123.9.207.43
  123.9.223.200
-123.9.236.173
+123.9.233.10
+123.9.235.15
+123.9.235.6
  123.9.253.229
  123.9.38.251
-123.9.42.51
-123.9.49.233
  123.9.55.119
-123.9.96.8
  123.97.105.44
  123.97.110.69
-123.97.144.2
+123.97.131.90
  123.97.154.113
  123.97.154.165
  123.97.227.59
@@ -31983,6 +32700,7 @@
  124.10.156.66
  124.10.208.73
  124.103.189.56
+124.104.10.10
  124.104.201.179
  124.104.237.94
  124.105.166.41
@@ -31993,8 +32711,11 @@
  124.105.199.128
  124.105.29.181
  124.105.55.176
+124.105.87.254
  124.106.224.44
+124.106.31.181
  124.107.11.115
+124.107.183.35
  124.107.184.28
  124.107.185.3
  124.107.57.216
@@ -32014,9 +32735,7 @@
  124.110.140.120
  124.110.78.97
  124.111.53.213
-124.112.204.110
-124.112.205.142
-124.113.219.205
+124.113.216.244
  124.113.224.207
  124.114.128.90
  124.114.141.46
@@ -32046,6 +32765,7 @@
  124.118.186.230
  124.118.9.75
  124.119.107.231
+124.119.109.145
  124.119.138.104
  124.119.138.243
  124.119.139.137
@@ -32054,20 +32774,20 @@
  124.119.63.243
  124.119.89.207
  124.119.9.34
-124.120.116.210
  124.120.142.124
  124.120.187.152
-124.120.86.73
  124.120.88.118
+124.120.88.125
  124.120.88.202
  124.121.176.122
  124.121.177.45
+124.121.18.41
  124.121.182.226
  124.121.183.190
  124.121.185.154
  124.121.19.10
-124.121.19.206
  124.121.19.247
+124.121.191.123
  124.121.191.13
  124.121.193.81
  124.121.202.58
@@ -32079,7 +32799,6 @@
  124.122.161.133
  124.122.161.227
  124.122.197.85
-124.122.231.115
  124.122.68.185
  124.123.77.175
  124.123.98.19
@@ -32112,6 +32831,7 @@
  124.128.90.220
  124.128.94.206
  124.129.117.61
+124.129.12.35
  124.129.126.228
  124.129.133.172
  124.129.136.27
@@ -32132,22 +32852,22 @@
  124.13.133.216
  124.13.177.99
  124.13.201.68
-124.13.236.244
  124.13.244.244
  124.13.248.147
  124.13.248.206
+124.13.28.191
  124.130.101.19
  124.130.116.34
  124.130.148.2
  124.130.164.173
  124.130.164.91
  124.130.35.151
+124.130.57.12
  124.130.66.234
  124.130.69.133
  124.130.73.97
  124.131.106.208
  124.131.109.149
-124.131.130.85
  124.131.131.184
  124.131.134.248
  124.131.135.61
@@ -32165,17 +32885,16 @@
  124.131.156.60
  124.131.158.220
  124.131.16.31
-124.131.20.113
  124.131.236.70
  124.131.239.254
  124.131.24.144
  124.131.30.79
  124.131.51.163
+124.131.6.49
  124.131.92.104
  124.131.93.243
  124.131.95.178
  124.132.151.53
-124.132.207.254
  124.133.126.165
  124.133.134.197
  124.133.14.229
@@ -32184,6 +32903,7 @@
  124.133.2.16
  124.133.230.74
  124.133.240.170
+124.133.246.74
  124.133.252.204
  124.133.253.178
  124.133.28.50
@@ -32200,7 +32920,6 @@
  124.135.164.79
  124.135.165.168
  124.135.168.225
-124.135.171.143
  124.135.42.214
  124.135.46.97
  124.135.5.0
@@ -32211,14 +32930,17 @@
  124.138.115.131
  124.138.58.3
  124.139.136.86
+124.140.114.158
  124.141.1.24
  124.146.40.99
  124.148.210.208
  124.149.37.20
+124.149.46.220
  124.150.132.74
  124.150.175.133
  124.150.236.51
  124.150.85.45
+124.150.85.83
  124.152.108.35
  124.152.109.123
  124.152.118.131
@@ -32233,7 +32955,9 @@
  124.152.76.174
  124.152.76.191
  124.153.136.175
+124.156.102.21
  124.156.102.254
+124.156.102.42
  124.156.103.155
  124.156.104.250
  124.156.105.251
@@ -32243,6 +32967,7 @@
  124.156.114.53
  124.156.119.150
  124.156.120.214
+124.156.136.112
  124.156.136.225
  124.156.138.134
  124.156.139.91
@@ -32250,7 +32975,8 @@
  124.156.140.217
  124.156.148.119
  124.156.148.156
-124.156.150.174
+124.156.150.254
+124.156.150.31
  124.156.159.144
  124.156.168.117
  124.156.180.189
@@ -32280,6 +33006,7 @@
  124.156.218.80
  124.156.225.138
  124.156.225.159
+124.156.226.68
  124.156.228.197
  124.156.228.210
  124.156.238.241
@@ -32402,9 +33129,11 @@
  124.156.98.172
  124.156.99.101
  124.158.105.58
+124.158.108.79
  124.158.11.197
  124.158.12.202
  124.158.125.75
+124.158.13.134
  124.158.13.48
  124.158.144.186
  124.158.144.187
@@ -32412,14 +33141,11 @@
  124.158.160.131
  124.158.160.132
  124.158.164.146
+124.158.169.50
  124.158.171.107
-124.158.171.109
  124.158.171.110
-124.158.173.112
-124.158.175.19
  124.158.175.2
  124.158.175.214
-124.158.177.171
  124.158.179.122
  124.158.179.13
  124.158.179.158
@@ -32433,6 +33159,9 @@
  124.16.102.20
  124.16.128.251
  124.16.183.248
+124.16.4.5
+124.16.75.147
+124.16.75.148
  124.16.75.150
  124.16.75.28
  124.16.97.97
@@ -32444,10 +33173,12 @@
  124.160.154.28
  124.160.165.27
  124.160.17.218
+124.160.236.218
  124.160.83.138
  124.160.91.132
  124.160.96.242
  124.160.96.249
+124.161.49.250
  124.161.90.114
  124.162.17.73
  124.163.131.196
@@ -32455,6 +33186,7 @@
  124.163.144.140
  124.163.146.72
  124.163.160.87
+124.163.161.16
  124.163.199.31
  124.163.212.124
  124.163.231.73
@@ -32462,22 +33194,24 @@
  124.163.251.25
  124.163.33.159
  124.163.33.96
+124.163.78.160
  124.163.79.134
+124.163.82.107
+124.163.87.189
  124.163.96.71
  124.164.238.12
-124.164.28.14
  124.164.81.119
  124.165.117.25
  124.165.20.188
  124.165.205.126
  124.165.210.78
  124.165.227.18
-124.165.44.51
  124.165.50.166
  124.166.146.115
  124.166.149.162
  124.166.22.25
  124.166.254.253
+124.167.103.175
  124.167.226.214
  124.167.248.230
  124.167.26.100
@@ -32485,13 +33219,17 @@
  124.167.82.187
  124.167.83.25
  124.168.216.237
+124.168.69.37
  124.169.57.45
+124.170.100.48
+124.170.109.83
  124.170.39.11
  124.172.189.59
  124.172.190.9
  124.172.220.150
  124.172.232.49
  124.172.232.57
+124.185.128.97
  124.187.104.241
  124.187.111.160
  124.187.43.80
@@ -32501,6 +33239,7 @@
  124.192.10.117
  124.192.224.230
  124.192.225.164
+124.193.101.194
  124.193.106.107
  124.193.191.52
  124.193.212.34
@@ -32508,15 +33247,19 @@
  124.193.236.144
  124.193.4.120
  124.193.50.218
+124.193.84.34
+124.194.50.21
  124.194.83.172
  124.194.88.196
  124.195.164.216
  124.195.174.59
  124.195.190.126
+124.195.190.172
  124.195.198.43
  124.195.208.56
  124.195.213.0
  124.195.213.235
+124.197.159.114
  124.197.213.137
  124.197.62.103
  124.199.227.241
@@ -32574,6 +33317,7 @@
  124.207.98.213
  124.216.80.191
  124.217.209.215
+124.217.209.66
  124.217.230.195
  124.217.235.180
  124.217.235.186
@@ -32591,6 +33335,7 @@
  124.219.105.17
  124.219.176.139
  124.224.176.82
+124.225.227.158
  124.225.26.58
  124.225.27.179
  124.225.46.150
@@ -32602,9 +33347,9 @@
  124.226.235.42
  124.226.29.18
  124.226.29.245
-124.226.66.27
  124.227.115.39
  124.227.119.143
+124.227.196.114
  124.227.204.81
  124.228.213.231
  124.228.41.148
@@ -32613,7 +33358,6 @@
  124.230.175.141
  124.230.175.167
  124.230.175.209
-124.230.205.31
  124.230.56.223
  124.232.133.205
  124.232.133.98
@@ -32635,13 +33379,11 @@
  124.235.249.87
  124.235.252.73
  124.235.253.196
-124.236.115.112
  124.236.118.135
  124.236.122.167
  124.236.22.12
  124.236.22.92
  124.236.24.220
-124.236.24.229
  124.236.24.232
  124.236.24.233
  124.236.24.236
@@ -32652,9 +33394,10 @@
  124.238.113.126
  124.238.118.20
  124.238.180.212
+124.238.56.73
  124.238.58.228
  124.238.59.181
-124.238.62.166
+124.238.61.153
  124.239.139.42
  124.239.139.43
  124.239.139.46
@@ -32662,33 +33405,32 @@
  124.239.153.215
  124.239.168.74
  124.239.176.178
+124.239.216.233
  124.239.221.236
  124.239.76.99
  124.240.194.126
  124.240.198.66
  124.241.179.188
+124.244.12.242
  124.244.250.53
  124.244.50.67
  124.244.93.38
  124.248.165.247
  124.248.172.228
  124.248.173.184
-124.248.173.185
  124.248.173.186
  124.248.173.190
  124.248.173.208
  124.248.173.215
-124.248.173.226
  124.248.173.26
  124.248.173.51
  124.248.173.55
-124.248.177.106
-124.248.177.32
  124.248.182.139
  124.248.182.188
  124.248.182.205
  124.248.182.209
  124.248.190.215
+124.248.190.76
  124.248.191.247
  124.248.212.13
  124.248.227.130
@@ -32702,19 +33444,20 @@
  124.253.118.46
  124.253.121.158
  124.253.123.142
+124.253.123.88
  124.253.131.1
  124.253.151.210
  124.253.185.193
  124.253.198.206
  124.253.204.157
  124.253.214.151
-124.253.238.193
  124.253.251.51
  124.28.218.130
  124.28.23.31
  124.28.48.206
  124.29.200.215
  124.29.200.46
+124.29.205.2
  124.29.208.70
  124.29.209.22
  124.29.211.53
@@ -32731,6 +33474,7 @@
  124.31.71.13
  124.31.71.83
  124.40.244.254
+124.40.247.142
  124.40.248.202
  124.40.250.246
  124.41.211.110
@@ -32760,13 +33504,10 @@
  124.43.10.169
  124.43.10.63
  124.43.104.141
-124.43.116.150
  124.43.12.185
+124.43.12.200
  124.43.129.107
-124.43.13.239
  124.43.177.160
-124.43.206.19
-124.43.64.74
  124.43.71.149
  124.43.76.45
  124.43.8.43
@@ -32777,6 +33518,7 @@
  124.47.8.10
  124.48.128.162
  124.49.100.254
+124.5.28.41
  124.5.74.161
  124.5.74.161bin.sh
  124.5.92.20
@@ -32792,13 +33534,16 @@
  124.6.15.17
  124.6.153.84
  124.6.16.137
+124.6.4.29
  124.60.73.157
  124.61.214.44
+124.64.16.68
  124.64.237.9
  124.64.40.246
  124.64.45.81
  124.64.46.255
  124.64.8.28
+124.64.9.16
  124.64.93.253
  124.65.117.38
  124.65.120.30
@@ -32817,6 +33562,7 @@
  124.65.250.82
  124.65.50.126
  124.65.51.34
+124.66.169.242
  124.66.49.34
  124.67.110.216
  124.67.132.97
@@ -32857,7 +33603,6 @@
  124.70.223.134
  124.70.223.2
  124.70.223.5
-124.70.43.225
  124.70.50.44
  124.70.67.251
  124.70.68.209
@@ -32905,6 +33650,7 @@
  124.78.213.230
  124.78.252.175
  124.78.9.28
+124.79.216.10
  124.79.73.202
  124.79.78.160
  124.80.18.217
@@ -32917,27 +33663,36 @@
  124.82.222.209
  124.84.193.161
  124.88.113.166
+124.88.218.158
  124.88.218.227
  124.88.34.74
  124.88.72.13
  124.88.87.42
+124.89.116.24
  124.89.13.92
  124.89.157.146
  124.89.2.18
+124.89.2.42
  124.89.218.25
  124.89.220.36
  124.89.32.15
  124.90.48.134
+124.90.48.211
  124.90.48.41
  124.90.49.170
-124.90.52.82
-124.90.53.176
+124.90.50.144
+124.90.51.214
+124.90.52.101
+124.90.52.81
  124.90.53.188
  124.90.53.221
+124.90.53.236
  124.90.53.4
  124.90.54.114
  124.90.54.233
  124.90.54.72
+124.90.54.90
+124.90.55.220
  124.90.55.224
  124.91.132.236
  124.91.133.220
@@ -32955,6 +33710,7 @@
  124.92.165.41
  124.92.182.72
  124.93.12.28
+124.93.160.82
  124.93.201.59
  124.93.222.211
  124.94.132.76
@@ -32980,15 +33736,14 @@
  1241.31cf4fdae.com
  124667.prohoster.biz
  124insta3gram.000webhostapp.com
-125.104.101.84
  125.104.106.27
-125.104.111.216
+125.104.111.42
  125.104.202.20
  125.104.211.208
  125.104.231.209
  125.104.252.53
  125.105.126.25
-125.105.203.255
+125.105.212.51
  125.105.66.87
  125.106.99.97
  125.109.135.23
@@ -32998,38 +33753,34 @@
  125.111.139.19
  125.111.223.246
  125.111.76.228
-125.112.169.75
-125.112.171.214
-125.112.172.123
  125.112.172.149
-125.112.172.4
  125.112.173.8
-125.112.174.62
  125.112.179.4
  125.113.107.249
+125.113.109.112
  125.113.117.0
+125.113.123.195
  125.113.158.215
  125.113.221.83
-125.113.253.218
  125.113.254.106
  125.114.121.116
  125.114.14.186
-125.114.200.225
  125.115.82.224
  125.115.82.80
-125.115.91.227
  125.115.92.98
-125.116.16.49
  125.116.196.39
  125.118.161.94
  125.118.190.117
  125.118.91.141
+125.119.15.1
  125.119.209.230
  125.119.234.17
  125.120.149.124
  125.120.237.87
+125.121.137.245
+125.121.182.88
+125.121.237.146
  125.122.174.7
-125.122.202.218
  125.122.92.153
  125.123.125.135
  125.123.125.166
@@ -33040,10 +33791,9 @@
  125.123.242.163
  125.123.242.45
  125.123.245.122
-125.123.246.79
  125.123.64.152
-125.123.66.55
-125.123.69.122
+125.123.66.30
+125.123.67.90
  125.124.114.169
  125.124.115.158
  125.124.117.226
@@ -33057,7 +33807,6 @@
  125.124.30.186
  125.124.38.96
  125.124.44.135
-125.124.54.29
  125.124.59.64
  125.124.69.65
  125.124.7.74
@@ -33080,6 +33829,7 @@
  125.128.246.183
  125.129.129.233
  125.129.136.38
+125.129.2.104
  125.129.201.23
  125.129.212.72
  125.129.47.169
@@ -33089,7 +33839,6 @@
  125.130.180.140
  125.130.243.33
  125.130.41.143
-125.131.149.4
  125.131.190.162
  125.131.236.179
  125.131.93.42
@@ -33100,6 +33849,7 @@
  125.132.225.217
  125.132.247.74
  125.132.31.116
+125.132.73.14
  125.132.73.28
  125.132.77.44
  125.133.15.117
@@ -33149,17 +33899,18 @@
  125.136.165.99
  125.136.177.108
  125.136.180.102
-125.136.180.167
  125.136.186.20
  125.136.225.170
  125.136.25.70
  125.136.25.86
  125.136.25.89
  125.136.25.93
+125.136.34.142
+125.136.34.146
  125.136.45.200
  125.136.45.8
-125.136.59.162
  125.136.59.168
+125.136.93.202
  125.137.11.141
  125.137.178.69
  125.137.179.149
@@ -33169,16 +33920,17 @@
  125.137.201.206
  125.137.206.208
  125.137.227.71
+125.137.236.50
+125.137.60.235
+125.137.8.133
  125.137.91.56
  125.138.116.227
  125.138.129.101
  125.138.186.87
  125.138.191.58
  125.138.228.2
-125.138.47.62
  125.138.57.18
  125.138.64.28
-125.138.71.211
  125.138.73.59
  125.138.77.79
  125.139.131.45
@@ -33191,6 +33943,7 @@
  125.139.99.47
  125.14.84.6
  125.140.106.67
+125.140.114.7
  125.140.14.201
  125.140.152.242
  125.140.159.29
@@ -33218,6 +33971,7 @@
  125.141.200.54
  125.141.200.55
  125.141.230.79
+125.141.31.218
  125.141.36.60
  125.141.5.251
  125.141.56.231
@@ -33242,6 +33996,7 @@
  125.142.37.245
  125.142.59.245
  125.143.222.109
+125.143.229.253
  125.143.246.51
  125.143.3.230
  125.143.66.146
@@ -33250,51 +34005,55 @@
  125.16.217.170
  125.160.109.87
  125.160.17.200
+125.160.199.168
  125.160.207.65
  125.160.213.234
-125.160.52.77
+125.160.53.88
+125.160.67.125
  125.161.129.230
-125.161.131.26
+125.161.129.87
+125.161.131.2
+125.161.136.241
  125.161.137.153
-125.161.139.32
  125.161.139.80
  125.161.31.225
  125.161.75.253
  125.162.120.80
  125.162.141.70
  125.162.76.131
-125.162.84.34
-125.163.113.189
  125.163.113.195
  125.163.147.240
  125.163.160.229
  125.163.162.49
-125.163.214.220
-125.163.65.42
+125.163.50.187
+125.164.100.159
+125.164.139.233
  125.164.156.62
-125.164.184.176
+125.164.27.176
  125.164.40.178
  125.164.5.121
-125.165.124.251
+125.165.108.205
  125.165.179.254
  125.165.190.185
+125.166.118.207
+125.166.123.132
  125.166.172.162
  125.166.176.19
+125.166.3.165
  125.167.11.100
  125.167.114.74
-125.167.116.162
  125.167.125.138
-125.167.251.4
+125.167.127.9
  125.167.32.158
  125.167.52.93
  125.167.56.184
+125.167.71.89
  125.168.13.64
  125.168.145.66bin.sh
+125.168.85.68
  125.168.98.211
-125.17.115.94
-125.17.90.10
+125.17.65.30
  125.178.227.57
-125.179.61.164
  125.18.26.61
  125.18.79.122
  125.180.198.137
@@ -33321,6 +34080,7 @@
  125.209.16.112
  125.209.16.123
  125.209.167.192
+125.209.173.153
  125.209.235.170
  125.209.235.175
  125.209.235.182
@@ -33345,9 +34105,9 @@
  125.211.197.254
  125.211.197.28
  125.211.197.87
-125.211.216.217
  125.211.216.221
  125.212.145.179
+125.212.158.215
  125.212.192.7
  125.212.193.1
  125.212.193.207
@@ -33363,6 +34123,7 @@
  125.212.226.243
  125.212.227.4
  125.212.233.50
+125.212.233.74
  125.212.241.131
  125.212.251.28
  125.213.128.52
@@ -33374,6 +34135,7 @@
  125.215.207.40
  125.215.207.44
  125.22.246.216
+125.22.9.186
  125.224.102.163
  125.224.104.240
  125.224.164.107
@@ -33394,7 +34156,6 @@
  125.227.141.116
  125.227.183.142
  125.227.186.194
-125.227.198.15
  125.227.199.139
  125.227.200.196
  125.227.209.252
@@ -33441,6 +34202,7 @@
  125.231.117.73
  125.231.128.27
  125.231.131.10
+125.231.162.72
  125.234.139.108
  125.234.162.22
  125.234.254.184
@@ -33452,10 +34214,11 @@
  125.24.1.10
  125.24.101.55
  125.24.104.15
+125.24.108.116
  125.24.118.250
-125.24.121.47
  125.24.125.38
  125.24.132.141
+125.24.14.55
  125.24.15.173
  125.24.175.99
  125.24.190.54
@@ -33468,9 +34231,7 @@
  125.24.55.47
  125.24.6.253
  125.24.6.36
-125.24.66.3
  125.24.72.122
-125.24.81.192
  125.24.85.73
  125.24.86.218
  125.24.87.54
@@ -33482,7 +34243,6 @@
  125.25.116.145
  125.25.142.151
  125.25.143.249
-125.25.159.107
  125.25.160.72
  125.25.165.22
  125.25.165.88
@@ -33494,15 +34254,15 @@
  125.25.187.93
  125.25.193.244
  125.25.198.191
-125.25.204.106
  125.25.204.117
  125.25.204.122
+125.25.218.128
+125.25.22.38
  125.25.224.126
  125.25.28.99
-125.25.45.180
+125.25.40.44
  125.25.53.89
  125.25.6.115
-125.25.80.39
  125.25.80.86
  125.25.82.14
  125.25.83.117
@@ -33512,7 +34272,6 @@
  125.25.89.68
  125.25.89.86
  125.25.89.9
-125.251.116.4
  125.251.133.3
  125.251.136.194
  125.251.147.194
@@ -33525,13 +34284,11 @@
  125.26.100.113
  125.26.108.170
  125.26.109.193
-125.26.112.164
  125.26.119.171
  125.26.124.122
  125.26.126.157
  125.26.130.193
  125.26.15.67
-125.26.15.68
  125.26.151.132
  125.26.155.207
  125.26.163.67
@@ -33544,6 +34301,7 @@
  125.26.178.210
  125.26.178.215
  125.26.178.235
+125.26.182.102
  125.26.182.112
  125.26.182.167
  125.26.183.167
@@ -33555,6 +34313,8 @@
  125.26.7.124
  125.26.7.83
  125.26.81.146
+125.26.97.231
+125.26.98.70
  125.26.99.185
  125.26.99.186
  125.26.99.212
@@ -33564,6 +34324,7 @@
  125.26.99.76
  125.27.10.243
  125.27.10.84
+125.27.121.139
  125.27.13.158
  125.27.209.139
  125.27.24.166
@@ -33577,16 +34338,11 @@
  125.27.251.57
  125.27.251.79
  125.27.251.87
-125.27.252.120
  125.27.253.31
  125.27.27.181
-125.27.27.91
  125.27.29.136
-125.27.30.46
  125.27.31.170
-125.27.45.193
  125.27.48.227
-125.27.55.72
  125.27.56.77
  125.27.57.71
  125.27.58.29
@@ -33597,6 +34353,8 @@
  125.32.172.237
  125.32.174.224
  125.32.95.22
+125.33.193.11
+125.33.197.0
  125.33.29.134
  125.33.39.99
  125.34.240.29
@@ -33614,91 +34372,101 @@
  125.39.11.27
  125.40.0.55
  125.40.1.131
-125.40.10.95
-125.40.105.254
  125.40.113.83
  125.40.114.24
  125.40.123.87
+125.40.144.142
  125.40.145.114
-125.40.145.238
-125.40.151.127
+125.40.145.48
+125.40.150.15
  125.40.152.100
  125.40.152.115
-125.40.152.157
  125.40.152.195
  125.40.152.64
  125.40.17.151
  125.40.17.255
  125.40.17.73
-125.40.184.237
  125.40.187.204
  125.40.19.0
+125.40.19.40
  125.40.199.113
  125.40.199.248
  125.40.2.154
  125.40.2.55
  125.40.22.177
+125.40.24.63
  125.40.26.170
  125.40.3.142
  125.40.3.163
  125.40.3.39
-125.40.35.71
+125.40.65.161
  125.40.72.210
  125.40.72.221
+125.40.73.131
  125.40.73.159
  125.40.73.220
  125.40.75.212
  125.40.75.47
-125.40.9.251
  125.40.91.15
  125.41.0.186
+125.41.0.73
  125.41.1.44
  125.41.10.55
-125.41.10.9
+125.41.102.44
  125.41.103.163
  125.41.109.123
  125.41.118.123
  125.41.12.190
+125.41.13.243
  125.41.13.34
+125.41.136.120
+125.41.14.169
+125.41.140.18
  125.41.141.102
-125.41.143.12
-125.41.148.47
-125.41.150.33
-125.41.153.184
-125.41.165.187
+125.41.149.193
+125.41.161.146
+125.41.164.36
  125.41.166.244
  125.41.167.157
-125.41.173.134
-125.41.200.181
+125.41.172.164
+125.41.174.58
+125.41.175.181
+125.41.187.144
+125.41.188.80
+125.41.204.178
  125.41.204.217
  125.41.205.24bin.sh
+125.41.206.216
+125.41.207.14
  125.41.207.167
  125.41.210.98
+125.41.211.32
+125.41.212.200
  125.41.214.60
  125.41.215.56
  125.41.223.214
+125.41.226.14
  125.41.232.163
-125.41.232.76
-125.41.234.40
-125.41.235.80
+125.41.235.154
  125.41.241.72
+125.41.242.184
  125.41.243.24
-125.41.244.236
  125.41.244.69
-125.41.245.0
+125.41.247.112
  125.41.247.177
  125.41.3.172
-125.41.3.212
  125.41.4.159
-125.41.5.27
+125.41.5.12
  125.41.5.70
-125.41.74.93
+125.41.5.85
+125.41.6.13
+125.41.73.16
+125.41.75.115
  125.41.75.188
  125.41.75.5
  125.41.76.47
  125.41.76.7
  125.41.77.166
-125.41.77.39
  125.41.78.11
  125.41.79.194
  125.41.79.24
@@ -33706,18 +34474,13 @@
  125.41.80.120
  125.41.82.169
  125.41.82.228
-125.41.83.18
-125.41.84.222
  125.41.89.52
  125.41.9.151
+125.41.91.160
  125.41.97.114
  125.41.97.39
-125.42.106.25
-125.42.107.126
-125.42.107.217
  125.42.112.242
  125.42.120.140
-125.42.120.18
  125.42.120.7
  125.42.120.85
  125.42.121.170
@@ -33726,19 +34489,22 @@
  125.42.123.169
  125.42.123.214
  125.42.124.111
+125.42.124.236
+125.42.124.243
  125.42.125.220
+125.42.126.120
  125.42.126.125
  125.42.126.16
-125.42.126.96
  125.42.127.10
  125.42.127.154
+125.42.127.220
+125.42.127.254
  125.42.155.57
  125.42.192.48
-125.42.200.123
+125.42.196.69
  125.42.200.62
+125.42.204.24
  125.42.205.213
-125.42.235.156
-125.42.235.3
  125.42.239.13
  125.42.239.99
  125.42.24.171
@@ -33748,126 +34514,127 @@
  125.42.88.157
  125.42.88.183
  125.42.90.144
-125.42.96.213
-125.43.106.227
+125.42.97.156
+125.43.101.231
+125.43.106.143
  125.43.112.100
-125.43.112.66
  125.43.112.92
  125.43.113.1
  125.43.113.5
  125.43.124.150
-125.43.127.129
-125.43.162.144
-125.43.17.201
+125.43.127.208
+125.43.138.14
+125.43.170.76
+125.43.177.59
  125.43.18.240
  125.43.206.209
  125.43.208.62
+125.43.21.241
  125.43.210.46
  125.43.213.232
-125.43.23.90
+125.43.221.19
  125.43.237.22
-125.43.253.132
-125.43.26.253
+125.43.239.0
+125.43.24.23
+125.43.25.6
  125.43.26.91
-125.43.33.193
+125.43.34.75
+125.43.35.191
+125.43.37.37
  125.43.39.114
-125.43.40.19
+125.43.40.5
  125.43.50.22
+125.43.52.203
  125.43.56.53
-125.43.58.126
-125.43.58.57
-125.43.59.28
+125.43.64.67
  125.43.65.145
  125.43.66.2
+125.43.69.155
+125.43.72.161
  125.43.73.19
-125.43.73.49
-125.43.74.15
+125.43.73.226
  125.43.8.125
-125.43.88.152
-125.43.88.21
+125.43.80.117
+125.43.80.60
+125.43.81.142
  125.43.88.240
  125.43.89.112
-125.43.89.182
+125.43.89.134
+125.43.89.52
  125.43.9.128
  125.43.9.255
-125.43.92.173
+125.43.92.16
  125.43.92.184
  125.43.93.226
  125.43.94.192
-125.43.94.48
-125.43.95.154
-125.43.95.234
-125.44.11.152
-125.44.11.84
-125.44.128.188
+125.43.95.120
+125.43.95.25
+125.44.10.125
+125.44.11.94
+125.44.126.251
  125.44.13.231
-125.44.14.107
+125.44.13.34
  125.44.15.155
-125.44.15.168
  125.44.152.254
  125.44.154.20
-125.44.158.177
+125.44.159.89
+125.44.166.144
  125.44.172.222
  125.44.173.124
-125.44.174.114
  125.44.192.7
  125.44.194.40
  125.44.194.54
  125.44.195.21
-125.44.197.204
  125.44.20.102
-125.44.20.154
  125.44.20.170
+125.44.20.82
  125.44.204.231
-125.44.205.12
-125.44.21.17
  125.44.21.199
  125.44.212.176
+125.44.212.240
  125.44.213.104
  125.44.213.150
  125.44.213.239
  125.44.215.151
  125.44.22.117
-125.44.22.28
-125.44.223.50
  125.44.226.122
+125.44.226.57
+125.44.227.69
  125.44.228.241
  125.44.23.158
+125.44.23.165
  125.44.23.169
  125.44.23.24
  125.44.23.70
-125.44.231.205
  125.44.231.212
-125.44.239.137
+125.44.237.102
  125.44.239.169
-125.44.243.105
-125.44.243.158
  125.44.245.180
-125.44.28.157
-125.44.39.152
-125.44.40.142
-125.44.57.3
-125.44.69.122
+125.44.28.40
+125.44.29.147
+125.44.31.155
+125.44.34.218
+125.44.53.133
  125.44.8.248
-125.44.8.79
-125.44.9.108
  125.44.9.229
-125.45.107.161
-125.45.113.101
+125.44.9.234
  125.45.114.26
  125.45.120.103
+125.45.121.209
  125.45.125.107
+125.45.155.174
  125.45.176.227
  125.45.176.52
+125.45.178.215
  125.45.179.132
  125.45.186.236bin.sh
  125.45.24.101
  125.45.25.13
+125.45.26.5
  125.45.43.33
-125.45.48.154
  125.45.50.30
+125.45.52.69
  125.45.59.3
-125.45.64.228
  125.45.64.231
  125.45.66.170
  125.45.66.43
@@ -33875,45 +34642,47 @@
  125.45.67.42
  125.45.76.10
  125.45.76.160
+125.45.76.181
  125.45.77.157
  125.45.77.161
+125.45.77.190
  125.45.77.212
+125.45.77.72
  125.45.78.176
  125.45.78.204
  125.45.78.24
  125.45.79.109
  125.45.79.125
-125.45.9.171
-125.45.90.184
+125.45.89.125
+125.45.90.198
  125.45.99.1
  125.46.0.62
  125.46.11.67
-125.46.160.181
+125.46.162.175
  125.46.163.117
-125.46.183.44
+125.46.165.132
  125.46.184.47
  125.46.185.249
  125.46.185.8
  125.46.189.114
-125.46.196.163
-125.46.196.254
  125.46.196.53
  125.46.197.170
  125.46.197.224
-125.46.200.92
-125.46.202.86
-125.46.214.89
+125.46.200.185
+125.46.201.248
+125.46.205.211
+125.46.205.30
  125.46.218.126
  125.46.218.211
  125.46.218.72
-125.46.221.5
-125.46.226.224
+125.46.229.2
  125.46.23.166
-125.46.243.142
+125.46.233.214
+125.46.240.213
  125.46.243.189
  125.46.246.35
  125.46.246.42
-125.46.254.94
+125.46.247.47
  125.46.32.106
  125.46.32.112
  125.46.56.111
@@ -33921,68 +34690,62 @@
  125.46.97.138
  125.47.101.99
  125.47.104.216
-125.47.106.111
  125.47.13.21
+125.47.143.224
+125.47.175.166
  125.47.177.238
  125.47.20.119
-125.47.20.166
  125.47.20.194
  125.47.201.93
  125.47.204.111
  125.47.204.174
  125.47.208.133
-125.47.210.242
+125.47.210.247
  125.47.211.71
  125.47.22.173
  125.47.22.75
  125.47.223.8
  125.47.226.219
-125.47.240.62
-125.47.241.149
-125.47.242.15
-125.47.242.238
-125.47.243.152
-125.47.244.47
+125.47.240.132
+125.47.242.190
  125.47.245.184
-125.47.247.123
-125.47.247.16
-125.47.248.29
-125.47.248.9
-125.47.250.137
+125.47.246.251
+125.47.248.102
+125.47.249.209
+125.47.249.96
  125.47.250.18
-125.47.251.128
+125.47.250.87
  125.47.251.254
-125.47.252.235
-125.47.253.154
+125.47.252.109
+125.47.252.189
  125.47.253.238
-125.47.254.27
+125.47.254.210
+125.47.254.25
  125.47.255.41
+125.47.36.125
  125.47.44.189
  125.47.47.176
  125.47.48.113
  125.47.48.223
  125.47.48.29
-125.47.49.111
-125.47.49.85
+125.47.50.154
  125.47.50.170
  125.47.51.125
+125.47.52.153
  125.47.54.47
  125.47.55.90
-125.47.57.131
  125.47.64.149
  125.47.64.54
  125.47.65.10
  125.47.65.136
+125.47.69.80
  125.47.7.154
  125.47.73.94
  125.47.74.190
  125.47.74.206
  125.47.74.248
  125.47.75.216
-125.47.81.171
  125.47.85.43
-125.47.87.211
-125.47.87.76
  125.47.89.14
  125.47.89.238
  125.47.90.166
@@ -33990,7 +34753,6 @@
  125.47.90.73
  125.47.91.93
  125.47.93.107
-125.47.96.182
  125.57.214.79
  125.57.237.51
  125.57.246.29
@@ -34041,13 +34803,12 @@
  125.64.103.98
  125.64.103.99
  125.64.154.34
+125.64.16.40
  125.64.17.40
  125.64.194.140
  125.64.209.113
  125.64.223.183
  125.64.228.173
-125.64.241.100
-125.64.241.161
  125.64.242.156
  125.64.54.23
  125.64.61.105
@@ -34076,7 +34837,7 @@
  125.67.17.152
  125.67.228.232
  125.67.239.82
-125.68.147.65
+125.68.151.164
  125.68.172.20
  125.68.57.100
  125.69.149.161
@@ -34088,6 +34849,7 @@
  125.69.92.5
  125.70.0.248
  125.70.163.216
+125.70.227.25
  125.70.244.4
  125.70.244.58
  125.70.244.59
@@ -34096,15 +34858,16 @@
  125.71.129.202
  125.71.178.65
  125.71.189.108
+125.71.206.3
  125.71.239.135
  125.71.239.216
  125.72.100.110
  125.72.106.136
-125.72.106.199
+125.72.106.139
  125.72.106.208
  125.72.106.22
-125.72.106.229
-125.72.106.96
+125.72.106.33
+125.72.106.75
  125.72.148.242
  125.72.17.5
  125.72.209.78
@@ -34114,6 +34877,7 @@
  125.73.131.213
  125.73.40.12
  125.74.193.194
+125.74.196.136
  125.74.197.100
  125.74.27.185
  125.74.27.36
@@ -34142,19 +34906,18 @@
  125.77.217.179
  125.77.22.106
  125.77.23.30
+125.77.7.73
  125.77.80.232
-125.77.85.110
  125.77.85.69
  125.78.12.74
  125.78.217.88
  125.78.218.181
  125.78.49.82
-125.79.120.237
+125.79.104.35
  125.79.120.28
  125.79.23.32
  125.82.180.136
  125.82.180.214
-125.82.180.62
  125.82.180.87
  125.82.181.221
  125.82.181.222
@@ -34165,13 +34928,18 @@
  125.84.178.2
  125.84.217.97
  125.86.183.175
-125.86.57.153
-125.87.89.57
+125.86.185.192
+125.87.80.146
+125.87.82.226
+125.87.83.141
+125.87.84.159
+125.87.84.242
+125.87.86.174
+125.87.91.71
  125.88.169.233
  125.88.254.178
  125.89.148.99
  125.89.160.151
-125.89.52.126
  125.89.53.156
  125.89.53.16
  125.89.53.241
@@ -34184,7 +34952,6 @@
  125.91.106.231
  125.91.109.200
  125.91.111.197
-125.91.126.92
  125.91.17.134
  125.91.17.216
  125.91.32.168
@@ -34213,6 +34980,8 @@
  125.99.173.162
  125.99.242.202
  125.99.252.110
+125.99.39.234
+125.99.43.126
  125.99.46.49
  125.99.46.50
  125.99.60.171
@@ -34257,7 +35026,9 @@
  128.0.179.234
  128.0.190.26
  128.1.133.114
+128.1.133.165
  128.1.136.185
+128.1.145.153
  128.1.223.242
  128.1.223.243
  128.1.223.244
@@ -34277,6 +35048,7 @@
  128.106.135.14
  128.106.136.18
  128.106.150.252
+128.106.195.126
  128.106.213.231
  128.106.230.20
  128.106.239.48
@@ -34287,7 +35059,6 @@
  128.116.134.251
  128.116.152.1
  128.116.154.5
-128.116.178.181
  128.121.136.192
  128.121.17.146
  128.121.17.148
@@ -34295,8 +35066,8 @@
  128.121.17.155
  128.127.15.27
  128.127.90.34
+128.134.178.1
  128.134.185.145
-128.134.30.79
  128.136.166.141
  128.136.35.30
  128.14.11.107
@@ -34319,7 +35090,6 @@
  128.14.141.104
  128.14.141.106
  128.14.141.107
-128.14.141.98
  128.14.141.99
  128.14.152.42
  128.14.152.43
@@ -34362,6 +35132,9 @@
  128.14.209.252
  128.14.209.253
  128.14.209.254
+128.14.236.157
+128.14.237.239
+128.14.237.240
  128.14.3.110
  128.14.3.84
  128.14.30.178
@@ -34377,12 +35150,14 @@
  128.14.93.156
  128.14.93.157
  128.14.93.158
+128.140.199.85
  128.153.145.125
  128.177.105.221
  128.177.105.222
  128.177.105.224
  128.177.105.225
  128.187.32.223
+128.197.11.187
  128.197.128.198
  128.197.128.205
  128.197.128.210
@@ -34392,11 +35167,13 @@
  128.197.128.229
  128.197.128.243
  128.197.128.248
+128.197.176.113
  128.199.0.133
  128.199.0.222
  128.199.0.70
  128.199.1.140
  128.199.1.174
+128.199.1.184
  128.199.1.186
  128.199.10.155
  128.199.10.90
@@ -34429,6 +35206,7 @@
  128.199.112.240
  128.199.112.66
  128.199.113.233
+128.199.113.46
  128.199.113.8
  128.199.114.104
  128.199.114.138
@@ -34472,11 +35250,13 @@
  128.199.130.137
  128.199.130.162
  128.199.130.202
+128.199.130.217
  128.199.131.150
  128.199.132.6
  128.199.133.186
  128.199.133.47
  128.199.133.8
+128.199.134.146
  128.199.134.45
  128.199.135.243
  128.199.136.113
@@ -34500,6 +35280,7 @@
  128.199.143.240
  128.199.144.113
  128.199.144.192
+128.199.144.226
  128.199.144.54
  128.199.145.214
  128.199.145.5
@@ -34513,11 +35294,9 @@
  128.199.15.205
  128.199.15.85
  128.199.150.71
-128.199.151.120
  128.199.151.123
  128.199.151.172
  128.199.151.198
-128.199.151.48
  128.199.151.77
  128.199.152.154
  128.199.153.131
@@ -34526,12 +35305,14 @@
  128.199.156.25
  128.199.157.160
  128.199.158.12
+128.199.159.148
  128.199.16.4
  128.199.16.6
-128.199.160.116
+128.199.16.96
  128.199.160.192
  128.199.162.108
  128.199.163.94
+128.199.164.114
  128.199.164.132
  128.199.164.234
  128.199.165.253
@@ -34565,11 +35346,15 @@
  128.199.178.41
  128.199.179.164
  128.199.179.171
+128.199.18.67
  128.199.180.123
  128.199.180.162
  128.199.180.80
+128.199.181.226
+128.199.181.27
  128.199.182.11
  128.199.182.19
+128.199.182.55
  128.199.183.226
  128.199.183.34
  128.199.184.127
@@ -34580,6 +35365,7 @@
  128.199.186.230
  128.199.186.46
  128.199.187.177
+128.199.189.137
  128.199.19.101
  128.199.19.153
  128.199.19.31
@@ -34604,11 +35390,12 @@
  128.199.202.206
  128.199.204.164
  128.199.204.219
+128.199.204.26
  128.199.206.90
-128.199.208.93
  128.199.209.227
  128.199.209.250
  128.199.21.1
+128.199.21.155
  128.199.21.216
  128.199.210.101
  128.199.210.138
@@ -34619,9 +35406,9 @@
  128.199.213.157
  128.199.213.25
  128.199.213.59
-128.199.213.96
  128.199.214.19
  128.199.214.36
+128.199.216.125
  128.199.216.36
  128.199.216.53
  128.199.218.126
@@ -34632,8 +35419,11 @@
  128.199.221.231
  128.199.223.178
  128.199.223.233
+128.199.224.105
  128.199.224.178
+128.199.224.183
  128.199.224.249
+128.199.224.34
  128.199.225.104
  128.199.226.44
  128.199.226.68
@@ -34646,6 +35436,7 @@
  128.199.232.56
  128.199.232.6
  128.199.233.143
+128.199.233.20
  128.199.233.87
  128.199.234.115
  128.199.235.176
@@ -34670,7 +35461,9 @@
  128.199.248.118
  128.199.248.200
  128.199.248.35
+128.199.248.88
  128.199.249.142
+128.199.249.19
  128.199.249.43
  128.199.25.120
  128.199.25.223
@@ -34678,7 +35471,6 @@
  128.199.250.33
  128.199.251.65
  128.199.252.204
-128.199.253.159
  128.199.253.208
  128.199.254.107
  128.199.254.188
@@ -34695,7 +35487,9 @@
  128.199.28.21
  128.199.28.210
  128.199.28.3
+128.199.28.57
  128.199.28.71
+128.199.29.126
  128.199.29.37
  128.199.30.127
  128.199.30.160
@@ -34714,7 +35508,6 @@
  128.199.42.106
  128.199.42.110
  128.199.42.166
-128.199.42.220
  128.199.43.133
  128.199.43.76
  128.199.44.20
@@ -34743,6 +35536,7 @@
  128.199.62.166
  128.199.62.187
  128.199.63.115
+128.199.63.176
  128.199.63.19
  128.199.64.10
  128.199.65.26
@@ -34751,11 +35545,14 @@
  128.199.68.220
  128.199.68.43
  128.199.68.49
+128.199.69.208
  128.199.7.196
  128.199.70.58
+128.199.71.227
  128.199.72.240
  128.199.73.173
  128.199.73.213
+128.199.73.25
  128.199.73.94
  128.199.74.117
  128.199.78.225
@@ -34769,7 +35566,6 @@
  128.199.83.2
  128.199.84.143
  128.199.84.201
-128.199.84.242
  128.199.84.251
  128.199.87.107
  128.199.87.167
@@ -34777,7 +35573,6 @@
  128.199.89.19
  128.199.89.67
  128.199.9.24
-128.199.91.205
  128.199.92.162
  128.199.92.187
  128.199.93.4
@@ -34793,10 +35588,8 @@
  128.199.99.242
  128.201.100.84
  128.201.101.28
-128.201.104.99
  128.201.161.2
  128.201.173.20
-128.201.230.253
  128.201.51.244
  128.201.52.38
  128.201.67.170
@@ -34819,9 +35612,8 @@
  128.244.119.161
  128.244.119.162
  128.31.0.13
-128.46.53.249
  128.59.10.116
-128.65.161.197
+128.68.212.52
  128.69.138.122
  128.69.244.122
  128.70.38.184
@@ -34833,17 +35625,19 @@
  128.72.62.167
  128.72.85.127
  128.73.141.124
-128.73.159.208
+128.73.173.22
  128.75.151.66
  128.75.209.162
  128.78.170.162
  128.90.107.121
+128.90.133.76
  128.90.147.214
  128.90.167.31
+128.90.181.239
+128.90.182.123
  128.90.198.161
  128.90.59.58
  128.90.65.124
-128.92.1.162
  128.92.172.35
  128.92.203.42
  128.92.210.156
@@ -34857,16 +35651,13 @@
  129.115.27.34
  129.121.177.81
  129.122.16.156
-129.122.161.62
  129.122.200.233
  129.122.217.203
-129.126.100.158
  129.126.102.10
  129.126.102.14
  129.126.103.114
  129.126.146.118
  129.126.200.81
-129.126.207.94
  129.126.221.21
  129.126.221.37
  129.126.243.113
@@ -34881,41 +35672,50 @@
  129.144.181.142
  129.144.183.81
  129.144.9.93
-129.146.104.91
  129.146.106.78
  129.146.106.85
  129.146.109.154
+129.146.112.55
+129.146.116.115
  129.146.116.141
+129.146.119.22
  129.146.130.179
  129.146.162.96
  129.146.164.97
  129.146.165.255
+129.146.166.253
  129.146.167.203
  129.146.171.254
  129.146.176.216
+129.146.185.87
+129.146.191.254
  129.146.201.116
  129.146.201.28
  129.146.243.66
+129.146.246.249
  129.146.250.102
  129.146.250.11
  129.146.254.139
+129.146.29.10
+129.146.44.129
  129.146.48.164
  129.146.51.15
+129.146.55.123
  129.146.55.85
  129.146.59.92
  129.146.67.150
  129.146.67.29
-129.146.75.180
+129.146.71.40
+129.146.79.127
  129.146.81.43
+129.146.82.3
  129.146.86.56
  129.146.96.214
  129.146.96.59
  129.150.194.230
  129.152.141.71
-129.152.43.85
  129.154.67.65
  129.158.74.141
-129.159.35.24
  129.170.192.41
  129.178.182.133
  129.178.182.140
@@ -34923,13 +35723,10 @@
  129.178.182.142
  129.204.110.114
  129.204.110.14
-129.204.111.158
  129.204.113.65
  129.204.115.121
  129.204.116.250
-129.204.117.118
  129.204.12.9
-129.204.121.109
  129.204.121.113
  129.204.121.245
  129.204.121.71
@@ -34948,6 +35745,7 @@
  129.204.175.119
  129.204.175.252
  129.204.177.133
+129.204.177.32
  129.204.177.7
  129.204.181.118
  129.204.186.151
@@ -34963,6 +35761,7 @@
  129.204.225.65
  129.204.23.5
  129.204.230.227
+129.204.231.225
  129.204.233.194
  129.204.233.214
  129.204.237.30
@@ -34991,14 +35790,12 @@
  129.204.82.4
  129.204.88.17
  129.204.88.29
+129.204.89.21
  129.205.112.253
-129.205.113.239
  129.205.118.115
-129.205.124.168
-129.205.124.174
-129.205.124.176
  129.205.138.194
  129.205.161.232
+129.205.170.182
  129.205.201.133
  129.205.201.239
  129.205.201.27
@@ -35029,7 +35826,9 @@
  129.211.171.31
  129.211.174.145
  129.211.18.180
+129.211.18.234
  129.211.18.65
+129.211.183.213
  129.211.183.61
  129.211.185.246
  129.211.187.67
@@ -35050,11 +35849,14 @@
  129.211.49.44
  129.211.50.239
  129.211.54.120
+129.211.54.147
+129.211.62.131
  129.211.72.48
  129.211.74.252
  129.211.75.184
  129.211.77.44
  129.211.79.208
+129.211.82.59
  129.211.84.224
  129.211.87.88
  129.211.91.170
@@ -35075,6 +35877,7 @@
  129.213.15.42
  129.213.151.198
  129.213.154.213
+129.213.161.37
  129.213.162.120
  129.213.162.147
  129.213.164.185
@@ -35092,13 +35895,17 @@
  129.213.58.148
  129.213.59.19
  129.213.61.111
+129.213.63.125
  129.213.87.96
+129.213.89.205
  129.213.92.193
  129.213.92.194
  129.213.93.202
+129.213.98.196
  129.22.143.241
  129.226.112.181
  129.226.114.97
+129.226.117.160
  129.226.119.176
  129.226.12.233
  129.226.120.69
@@ -35111,22 +35918,26 @@
  129.226.147.146
  129.226.149.146
  129.226.149.160
-129.226.150.37
+129.226.150.63
  129.226.150.93
  129.226.151.51
  129.226.152.223
+129.226.153.187
  129.226.153.24
  129.226.154.123
  129.226.154.201
  129.226.154.236
+129.226.154.6
  129.226.154.67
  129.226.155.12
  129.226.156.168
+129.226.156.186
  129.226.156.4
  129.226.156.98
  129.226.157.108
  129.226.158.40
  129.226.159.12
+129.226.160.128
  129.226.162.5
  129.226.165.250
  129.226.166.126
@@ -35135,11 +35946,15 @@
  129.226.174.26
  129.226.174.44
  129.226.174.57
+129.226.176.5
  129.226.179.238
  129.226.181.229
  129.226.190.18
+129.226.190.74
+129.226.225.117
  129.226.227.234
  129.226.227.72
+129.226.50.36
  129.226.51.112
  129.226.60.49
  129.226.61.157
@@ -35168,7 +35983,6 @@
  129.28.157.148
  129.28.157.199
  129.28.157.97
-129.28.159.80
  129.28.160.215
  129.28.160.44
  129.28.162.79
@@ -35190,14 +36004,18 @@
  129.28.187.169
  129.28.189.173
  129.28.192.71
+129.28.193.24
  129.28.195.191
+129.28.197.164
  129.28.198.205
  129.28.198.23
  129.28.199.85
  129.28.203.122
+129.28.205.124
  129.28.206.142
  129.28.39.234
  129.28.41.113
+129.28.51.226
  129.28.78.8
  129.28.81.162
  129.28.92.64
@@ -35229,7 +36047,6 @@
  13.112.175.43
  13.112.218.4
  13.114.100.101
-13.114.137.195
  13.114.162.117
  13.114.165.12
  13.114.178.225
@@ -35237,6 +36054,7 @@
  13.115.26.69
  13.115.40.246
  13.115.95.157
+13.115.99.84
  13.124.116.7
  13.124.176.17
  13.124.2.45
@@ -35245,11 +36063,13 @@
  13.124.250.6
  13.124.29.164
  13.124.45.30
+13.124.60.74
  13.124.74.157
  13.124.77.12
  13.124.8.244
  13.124.88.142
  13.125.149.103
+13.125.171.57
  13.125.183.71
  13.125.188.128
  13.125.202.178
@@ -35262,7 +36082,6 @@
  13.125.97.172
  13.126.106.203
  13.126.144.12
-13.126.147.15
  13.126.181.139
  13.126.218.145
  13.126.226.37
@@ -35277,6 +36096,7 @@
  13.127.130.18
  13.127.153.0
  13.127.21.204
+13.127.225.183
  13.127.46.147
  13.127.47.128
  13.127.60.65
@@ -35297,7 +36117,7 @@
  13.211.210.18
  13.212.121.215
  13.212.141.79
-13.212.158.90
+13.212.16.28
  13.212.167.50
  13.212.182.30
  13.212.217.254
@@ -35324,6 +36144,7 @@
  13.229.133.26
  13.229.135.249
  13.229.140.55
+13.229.150.180
  13.229.150.245
  13.229.154.1
  13.229.203.245
@@ -35348,10 +36169,12 @@
  13.230.93.97
  13.231.190.71
  13.231.20.249
+13.231.222.146
  13.231.223.46
  13.231.8.224
  13.231.85.192
  13.232.135.122
+13.232.146.139
  13.232.176.217
  13.232.187.242
  13.232.192.219
@@ -35359,15 +36182,15 @@
  13.232.223.53
  13.232.23.143
  13.232.238.113
-13.232.245.170
+13.232.35.153
  13.232.38.92
  13.232.39.95
-13.232.75.110
  13.232.94.246
-13.232.94.70
  13.233.100.124
  13.233.104.103
  13.233.14.14
+13.233.143.110
+13.233.164.215
  13.233.176.4
  13.233.182.207
  13.233.212.14
@@ -35377,16 +36200,21 @@
  13.233.55.127
  13.233.71.109
  13.233.82.105
+13.233.89.110
  13.233.91.252
  13.233.97.177
+13.234.119.179
+13.234.144.149
  13.234.150.155
+13.234.20.233
+13.234.30.113
+13.234.38.59
  13.235.151.71
  13.235.16.58
  13.235.244.150
  13.235.246.134
  13.235.31.163
  13.235.4.221
-13.235.43.39
  13.235.76.20
  13.235.94.245
  13.236.100.67
@@ -35398,7 +36226,6 @@
  13.238.116.2
  13.238.120.8
  13.238.169.251
-13.238.44.121
  13.238.46.9
  13.239.0.31
  13.239.114.62
@@ -35412,6 +36239,7 @@
  13.244.63.164
  13.244.63.90
  13.244.70.8
+13.244.71.100
  13.245.27.50
  13.245.30.239
  13.245.4.171
@@ -35454,13 +36282,14 @@
  13.53.133.190
  13.53.170.167
  13.53.36.154
+13.53.40.179
  13.54.0.52
  13.54.105.229
  13.54.157.115
  13.55.12.109
+13.55.140.47
  13.55.229.31
  13.55.244.216
-13.56.102.222
  13.56.120.30
  13.56.155.237
  13.56.171.121
@@ -35532,12 +36361,17 @@
  13.64.175.205
  13.64.175.221
  13.64.77.225
-13.64.91.141
+13.64.89.143
+13.64.91.221
  13.64.93.82
+13.65.112.43
  13.65.147.163
  13.65.147.40
+13.65.170.233
  13.65.196.73
  13.65.201.35
+13.65.206.37
+13.65.214.72
  13.65.215.106
  13.65.246.58
  13.65.42.254
@@ -35547,6 +36381,7 @@
  13.66.139.162
  13.66.139.2
  13.66.156.59
+13.66.160.88
  13.66.167.123
  13.66.169.218
  13.66.18.39
@@ -35554,6 +36389,7 @@
  13.66.198.243
  13.66.206.201
  13.66.213.21
+13.66.217.166
  13.66.217.251
  13.66.243.4
  13.66.248.91
@@ -35562,36 +36398,57 @@
  13.66.27.121
  13.66.28.137
  13.66.33.220
+13.66.38.127
  13.66.39.248
+13.66.4.248
  13.66.5.76
  13.66.52.131
+13.67.106.162
  13.67.106.218
  13.67.209.202
  13.67.236.36
+13.67.46.188
  13.67.54.103
  13.67.63.143
  13.68.131.171
+13.68.147.197
+13.68.152.200
  13.68.153.168
  13.68.186.224
  13.68.216.44
  13.68.225.165
  13.68.229.202
  13.68.244.143
+13.68.246.188
  13.68.248.57
  13.68.249.191
+13.68.254.96
  13.69.103.14
+13.69.130.216
+13.69.146.175
  13.69.153.185
+13.69.198.148
+13.69.248.55
+13.69.251.11
  13.69.50.143
  13.70.199.80
+13.70.2.105
+13.70.20.99
+13.70.5.80
  13.70.7.22
  13.71.120.139
  13.71.136.69
+13.71.16.51
  13.71.164.135
  13.71.21.123
+13.71.39.228
  13.71.46.226
+13.71.5.194
  13.71.6.47
  13.72.102.159
-13.72.77.141
+13.72.107.109
+13.72.79.186
+13.72.79.240
  13.72.80.225
  13.72.81.198
  13.72.82.82
@@ -35599,12 +36456,16 @@
  13.73.1.69
  13.73.16.128
  13.73.16.134
+13.73.225.91
  13.73.23.121
  13.74.157.69
+13.74.179.181
  13.74.252.234
+13.74.36.28
  13.74.46.65
  13.75.115.100
  13.75.125.174
+13.75.139.43
  13.75.179.194
  13.75.193.159
  13.75.194.31
@@ -35612,22 +36473,27 @@
  13.76.119.203
  13.76.132.123
  13.76.142.50
+13.76.154.111
  13.76.165.246
  13.76.186.140
  13.76.190.188
  13.76.196.132
+13.76.196.239
  13.76.241.217
  13.76.242.131
  13.76.242.146
  13.76.246.8
  13.76.248.36
+13.76.252.236
+13.76.26.35
  13.76.34.31
  13.76.46.136
-13.76.91.125
+13.76.95.227
  13.77.150.217
  13.77.151.83
  13.77.158.3
-13.77.204.123
+13.77.179.19
+13.77.181.51
  13.77.204.247
  13.77.205.241
  13.77.205.248
@@ -35635,14 +36501,23 @@
  13.77.74.124
  13.78.126.105
  13.78.131.155
+13.78.138.54
+13.78.149.65
+13.78.163.14
  13.78.189.149
  13.78.190.103
  13.78.227.187
+13.78.230.118
+13.78.232.229
  13.78.235.113
  13.78.236.203
  13.78.237.115
+13.78.70.233
  13.78.97.141
  13.78.99.2
+13.79.154.188
+13.79.184.70
+13.79.187.159
  13.79.242.9
  13.79.4.40
  13.79.6.157
@@ -35652,32 +36527,38 @@
  13.80.46.69
  13.80.67.162
  13.81.101.205
-13.81.173.145
  13.81.223.168
  13.81.251.173
  13.81.6.165
  13.82.0.119
-13.82.0.138
  13.82.102.20
  13.82.105.123
+13.82.141.63
+13.82.142.199
  13.82.146.132
  13.82.147.112
  13.82.149.166
+13.82.151.14
  13.82.175.242
  13.82.179.224
  13.82.18.238
  13.82.187.131
+13.82.187.195
  13.82.198.161
+13.82.219.14
  13.82.22.80
  13.82.220.196
-13.82.231.231
+13.82.233.17
+13.82.236.59
  13.82.24.91
  13.82.29.22
  13.82.58.15
  13.82.60.6
  13.82.81.171
+13.82.87.55
  13.82.91.18
  13.82.92.111
+13.83.94.147
  13.84.135.5
  13.84.146.71
  13.84.150.149
@@ -35695,35 +36576,47 @@
  13.84.51.165
  13.84.52.63
  13.85.152.27
+13.85.159.223
  13.85.18.13
+13.85.27.116
  13.85.65.196
+13.85.72.71
  13.85.74.198
  13.88.177.3
  13.88.18.211
  13.88.18.49
+13.88.219.172
  13.88.224.151
  13.88.249.148
  13.88.251.59
  13.88.30.112
+13.88.63.201
  13.89.190.30
  13.89.201.215
  13.89.202.14
+13.89.236.77
  13.89.33.27
  13.89.36.235
+13.89.54.170
  13.90.101.160
+13.90.112.129
+13.90.128.104
  13.90.138.102
  13.90.140.180
+13.90.141.168
  13.90.197.127
+13.90.203.143
  13.90.208.238
  13.90.26.128
+13.90.34.170
  13.90.38.253
  13.90.39.244
  13.90.40.214
-13.90.56.153
  13.90.56.67
  13.90.57.183
  13.90.73.131
  13.90.86.224
+13.90.96.133
  13.90.98.107
  13.90.98.3
  13.91.33.126
@@ -35732,40 +36625,57 @@
  13.91.42.81
  13.91.44.93
  13.91.97.179
+13.92.116.167
  13.92.119.142
+13.92.133.6
  13.92.134.151
-13.92.152.120
+13.92.134.70
+13.92.159.193
  13.92.184.128
  13.92.232.23
+13.92.235.169
+13.92.246.97
+13.92.254.18
  13.92.27.130
  13.92.32.34
+13.92.33.79
  13.92.38.69
+13.92.45.163
+13.92.62.94
  13.92.82.166
  13.92.84.233
+13.92.97.12
+13.93.176.207
  13.93.201.67
  13.93.202.142
  13.93.210.251
  13.93.223.243
  13.93.238.15
+13.93.36.67
  13.93.52.193
  13.93.68.121
  13.93.87.165
  13.94.119.209
+13.94.138.81
  13.94.200.157
+13.94.229.227
+13.94.245.44
  13.94.39.125
+13.94.42.255
  13.94.58.212
-13.94.61.208
+13.94.64.49
+13.95.120.16
  13.95.130.2
+13.95.18.49
+13.95.27.133
  130.0.232.227
  130.0.234.16
  130.0.25.194
  130.105.197.224
-130.105.68.165
  130.111.10.87
  130.149.80.199
  130.149.80.221
  130.162.64.72
-130.162.70.193
  130.162.71.237
  130.180.28.106
  130.180.47.146
@@ -35774,8 +36684,9 @@
  130.185.109.17
  130.185.122.52
  130.185.122.56
+130.185.122.84
+130.185.123.140
  130.185.123.190
-130.185.123.75
  130.185.152.185
  130.185.155.10
  130.185.155.34
@@ -35783,14 +36694,12 @@
  130.185.155.82
  130.185.156.170
  130.185.159.177
-130.185.159.209
  130.185.193.160
  130.185.206.248
  130.185.215.254
  130.185.250.194
  130.185.250.76
  130.185.75.178
-130.185.76.142
  130.185.77.105
  130.185.86.194
  130.185.90.151
@@ -35798,6 +36707,7 @@
  130.193.12.61
  130.193.123.162
  130.193.45.165
+130.193.50.169
  130.204.105.4
  130.204.161.3
  130.204.65.84
@@ -35819,13 +36729,11 @@
  130.211.251.232
  130.211.30.154
  130.211.59.117
-130.211.59.76
  130.211.72.243
  130.211.77.101
  130.211.78.62
  130.211.87.95
  130.211.99.13
-130.214.215.187
  130.225.244.90
  130.226.169.137
  130.25.0.109
@@ -35838,6 +36746,7 @@
  130.255.189.68
  130.255.57.199
  130.43.117.60
+130.45.8.17
  130.61.100.68
  130.61.113.65
  130.61.118.231
@@ -35862,9 +36771,7 @@
  130.61.92.43
  130.61.96.72
  130.61.98.193
-130.68.124.40
  130.76.24.29
-130.83.239.98
  130.zuole.ml
  1300345608.jclecardinal.com
  130163-dot-n-e-w-me-ss-age-po-rt-al.wl.r.appspot.com
@@ -35881,11 +36788,15 @@
  131.0.246.158
  131.0.252.101
  131.0.252.126
+131.0.252.132
+131.0.252.92
  131.0.253.194
  131.0.253.196
  131.0.253.219
  131.0.253.225
+131.0.31.3
  131.0.87.225
+131.100.212.230
  131.100.234.14
  131.100.239.122
  131.100.239.21
@@ -35893,12 +36804,14 @@
  131.100.239.62
  131.100.239.94
  131.100.247.137
+131.100.25.223
  131.100.38.12
  131.100.38.226
  131.100.47.32
  131.100.47.47
  131.100.47.53
  131.100.47.64
+131.106.40.210
  131.108.116.92
  131.108.118.103
  131.108.124.253
@@ -35912,6 +36825,7 @@
  131.108.166.217
  131.108.166.218
  131.108.234.72
+131.108.234.91
  131.108.32.147
  131.108.45.72
  131.108.45.78
@@ -35930,8 +36844,10 @@
  131.150.232.218
  131.153.18.84
  131.153.22.134
+131.153.31.219
  131.153.49.120
  131.153.49.72
+131.156.137.114
  131.161.10.200
  131.161.10.206
  131.161.10.232
@@ -35954,6 +36870,7 @@
  131.161.68.17
  131.161.68.37
  131.161.68.41
+131.161.68.45
  131.161.85.30
  131.161.86.77
  131.161.87.98
@@ -35961,7 +36878,6 @@
  131.161.9.225
  131.161.9.239
  131.161.9.251
-131.164.157.153
  131.174.31.35
  131.188.40.191
  131.188.43.61
@@ -35974,30 +36890,28 @@
  131.193.220.15
  131.196.130.188
  131.196.14.242
-131.196.141.1
  131.196.141.104
  131.196.141.107
  131.196.141.112
  131.196.141.114
-131.196.141.121
  131.196.141.130
  131.196.141.132
-131.196.141.139
-131.196.141.154
  131.196.141.156
  131.196.141.161
-131.196.141.162
+131.196.141.167
+131.196.141.178
  131.196.141.182
  131.196.141.192
  131.196.141.200
  131.196.141.213
-131.196.141.23
  131.196.141.241
  131.196.141.37
+131.196.141.39
  131.196.141.47
  131.196.141.60
  131.196.141.65
  131.196.141.68
+131.196.141.77
  131.196.141.90
  131.196.141.98
  131.196.143.113
@@ -36009,17 +36923,16 @@
  131.196.143.161
  131.196.143.192
  131.196.143.206
+131.196.143.210
  131.196.143.226
+131.196.143.239
  131.196.143.253
  131.196.143.3
  131.196.143.34
  131.196.143.38
  131.196.143.4
-131.196.143.50
  131.196.143.54
  131.196.143.62
-131.196.143.67
-131.196.143.9
  131.196.143.90
  131.196.169.137
  131.196.219.90
@@ -36029,6 +36942,7 @@
  131.196.44.136
  131.196.87.198
  131.196.93.105
+131.196.93.16
  131.221.136.45
  131.221.137.125
  131.221.174.82
@@ -36047,7 +36961,6 @@
  131.221.32.41
  131.221.32.56
  131.221.33.140
-131.221.64.152
  131.253.18.11
  131.253.18.12
  131.255.102.158
@@ -36064,8 +36977,8 @@
  131.72.139.150
  131.72.205.98
  131.72.222.136
+131.72.236.178
  131.72.96.50
-131.93.94.41
  13123431043915105561.002.sh.cn
  131425.000webhostapp.com
  1314520bet.com
@@ -36098,15 +37011,18 @@
  132.145.215.51
  132.145.236.84
  132.145.242.131
+132.145.81.240
+132.145.90.22
  132.145.94.79
  132.147.104.183
-132.147.77.13
  132.148.104.133
+132.148.104.135
  132.148.141.147
  132.148.144.101
  132.148.153.156
  132.148.154.8
  132.148.159.44
+132.148.16.60
  132.148.166.149
  132.148.166.225
  132.148.17.38
@@ -36116,11 +37032,11 @@
  132.148.42.109
  132.148.91.227
  132.148.99.126
-132.184.129.143
  132.206.216.141
  132.227.123.9
  132.230.7.2
  132.232.1.155
+132.232.1.8
  132.232.10.144
  132.232.100.223
  132.232.103.60
@@ -36139,14 +37055,15 @@
  132.232.16.135
  132.232.160.102
  132.232.161.51
-132.232.19.197
+132.232.18.227
  132.232.19.205
  132.232.2.100
  132.232.2.249
+132.232.2.70
  132.232.21.175
  132.232.21.19
-132.232.21.26
  132.232.21.67
+132.232.21.72
  132.232.222.117
  132.232.230.220
  132.232.26.42
@@ -36157,15 +37074,19 @@
  132.232.32.203
  132.232.32.228
  132.232.33.160
+132.232.35.108
  132.232.35.199
+132.232.35.65
  132.232.37.63
  132.232.4.140
  132.232.4.33
  132.232.40.187
  132.232.41.170
+132.232.43.111
  132.232.44.166
+132.232.45.171
  132.232.46.158
-132.232.47.138
+132.232.46.230
  132.232.47.59
  132.232.49.143
  132.232.5.28
@@ -36176,17 +37097,17 @@
  132.232.59.78
  132.232.6.207
  132.232.60.183
-132.232.61.196
  132.232.61.48
  132.232.66.128
+132.232.66.227
  132.232.67.253
  132.232.67.52
  132.232.68.138
  132.232.73.139
  132.232.75.27
+132.232.76.77
  132.232.77.85
  132.232.79.28
-132.232.8.58
  132.232.80.76
  132.232.80.87
  132.232.82.237
@@ -36196,6 +37117,7 @@
  132.232.88.59
  132.232.89.147
  132.232.89.186
+132.232.89.31
  132.232.89.96
  132.232.92.86
  132.232.93.78
@@ -36204,10 +37126,10 @@
  132.232.98.228
  132.232.99.203
  132.247.127.66
-132.247.18.65
  132.248.110.203
  132.248.117.152
  132.248.44.99
+132.248.96.3
  132.255.21.58
  132.255.215.2
  132.255.217.151
@@ -36245,21 +37167,24 @@
  133.232.70.132
  133.232.87.13
  133.242.155.85
+133.242.23.130
  133.242.231.162
  133.27.228.131
+13317x.000webhostapp.com
  1336062-dot-oaao-274308.uc.r.appspot.com
  133627593977191-dot-wetransfer-auth-file-343.appspot.com
  1337gang.ddns.net
  133gvb.com
  134.0.104.36
+134.0.116.219
+134.0.117.117
+134.0.119.111
  134.0.119.176
  134.0.63.134
  134.101.179.140
-134.101.223.124
  134.101.223.94
  134.102.228.73
  134.119.179.146
-134.119.216.167
  134.119.218.243
  134.119.220.165
  134.119.220.174
@@ -36268,6 +37193,7 @@
  134.122.0.192
  134.122.100.130
  134.122.102.131
+134.122.102.157
  134.122.103.4
  134.122.103.82
  134.122.105.123
@@ -36289,6 +37215,7 @@
  134.122.125.200
  134.122.130.216
  134.122.135.150
+134.122.139.35
  134.122.145.149
  134.122.16.158
  134.122.162.6
@@ -36306,18 +37233,17 @@
  134.122.25.139
  134.122.25.32
  134.122.26.164
+134.122.26.76
  134.122.28.82
+134.122.31.107
  134.122.32.207
-134.122.32.33
  134.122.33.63
  134.122.33.89
+134.122.34.137
  134.122.35.105
-134.122.35.243
-134.122.36.0
  134.122.36.50
  134.122.36.93
-134.122.38.210
-134.122.38.251
+134.122.38.34
  134.122.39.133
  134.122.39.157
  134.122.39.159
@@ -36325,7 +37251,6 @@
  134.122.39.93
  134.122.40.106
  134.122.40.31
-134.122.40.53
  134.122.40.55
  134.122.44.202
  134.122.44.212
@@ -36342,7 +37267,6 @@
  134.122.45.230
  134.122.46.176
  134.122.46.215
-134.122.46.35
  134.122.47.221
  134.122.47.28
  134.122.47.5
@@ -36365,9 +37289,12 @@
  134.122.62.253
  134.122.64.219
  134.122.66.154
+134.122.69.140
+134.122.69.7
  134.122.72.221
  134.122.72.53
  134.122.76.222
+134.122.77.77
  134.122.78.80
  134.122.78.89
  134.122.80.217
@@ -36386,7 +37313,12 @@
  134.17.26.116
  134.17.94.100
  134.17.94.150
+134.17.94.158
+134.17.94.221
+134.17.94.65
+134.175.102.133
  134.175.104.215
+134.175.11.167
  134.175.111.215
  134.175.113.143
  134.175.121.80
@@ -36396,15 +37328,23 @@
  134.175.13.51
  134.175.130.52
  134.175.134.47
+134.175.136.16
+134.175.138.54
+134.175.144.96
  134.175.146.231
+134.175.148.100
+134.175.150.132
  134.175.152.228
  134.175.154.145
  134.175.154.93
  134.175.157.55
  134.175.161.251
+134.175.166.167
  134.175.17.32
  134.175.18.153
+134.175.186.149
  134.175.19.39
+134.175.19.71
  134.175.191.248
  134.175.196.241
  134.175.197.170
@@ -36418,6 +37358,7 @@
  134.175.223.22
  134.175.224.105
  134.175.227.112
+134.175.228.201
  134.175.230.209
  134.175.236.132
  134.175.236.187
@@ -36441,9 +37382,12 @@
  134.19.177.40
  134.19.215.196
  134.19.231.200
+134.19.249.223
  134.19.254.2
+134.19.96.234
  134.208.10.111
  134.209.100.103
+134.209.102.44
  134.209.102.75
  134.209.103.101
  134.209.103.181
@@ -36453,6 +37397,7 @@
  134.209.111.46
  134.209.112.122
  134.209.113.248
+134.209.114.117
  134.209.115.227
  134.209.116.82
  134.209.117.155
@@ -36475,8 +37420,10 @@
  134.209.144.106
  134.209.146.100
  134.209.146.114
+134.209.147.203
  134.209.148.107
  134.209.149.43
+134.209.149.64
  134.209.150.136
  134.209.150.160
  134.209.150.217
@@ -36487,7 +37434,6 @@
  134.209.152.76
  134.209.155.201
  134.209.155.213
-134.209.157.134
  134.209.157.198
  134.209.157.35
  134.209.158.177
@@ -36498,6 +37444,7 @@
  134.209.159.225
  134.209.16.20
  134.209.161.228
+134.209.163.191
  134.209.164.184
  134.209.164.201
  134.209.166.15
@@ -36506,8 +37453,8 @@
  134.209.172.2
  134.209.172.77
  134.209.174.161
-134.209.178.193
  134.209.179.35
+134.209.179.57
  134.209.18.129
  134.209.181.254
  134.209.181.49
@@ -36517,7 +37464,6 @@
  134.209.186.72
  134.209.188.212
  134.209.189.223
-134.209.193.65
  134.209.194.227
  134.209.194.46
  134.209.195.0
@@ -36533,6 +37479,7 @@
  134.209.208.60
  134.209.208.90
  134.209.21.133
+134.209.21.242
  134.209.211.69
  134.209.216.10
  134.209.216.249
@@ -36542,6 +37489,7 @@
  134.209.223.156
  134.209.223.159
  134.209.223.164
+134.209.223.165
  134.209.223.170
  134.209.223.214
  134.209.223.98
@@ -36559,8 +37507,10 @@
  134.209.241.217
  134.209.241.227
  134.209.241.87
+134.209.246.210
  134.209.248.200
  134.209.254.186
+134.209.254.62
  134.209.26.15
  134.209.27.151
  134.209.30.141
@@ -36584,15 +37534,12 @@
  134.209.64.28
  134.209.64.36
  134.209.64.47
-134.209.64.60
  134.209.65.23
-134.209.65.43
  134.209.66.197
  134.209.67.45
  134.209.67.87
  134.209.69.72
  134.209.7.179
-134.209.71.171
  134.209.71.190
  134.209.71.226
  134.209.72.119
@@ -36631,6 +37578,7 @@
  134.209.88.15
  134.209.89.94
  134.209.91.188
+134.209.91.232
  134.209.91.64
  134.209.92.128
  134.209.92.152
@@ -36645,7 +37593,6 @@
  134.213.138.137
  134.213.138.161
  134.213.138.164
-134.213.237.182
  134.220.183.36
  134.228.109.240
  134.228.15.43
@@ -36656,9 +37603,9 @@
  134.236.115.153
  134.236.16.234
  134.236.2.123
+134.236.2.152
  134.236.2.176
  134.236.2.213
-134.236.2.247
  134.236.205.2
  134.236.21.215
  134.236.212.2
@@ -36672,6 +37619,7 @@
  134.249.114.27
  134.249.116.78
  134.249.117.3
+134.249.133.197
  134.249.141.83
  134.249.144.168
  134.249.146.35
@@ -36680,9 +37628,9 @@
  134.249.152.31
  134.249.155.251
  134.249.156.3
+134.249.161.145
  134.249.165.49
  134.249.167.184
-134.249.184.160
  134.249.189.77
  134.249.53.96
  134.249.54.230
@@ -36696,26 +37644,30 @@
  134.255.243.132
  134.255.254.39
  134.3.227.7
-134.35.112.50
+134.3.246.222
+134.3.9.30
  134.35.13.39
  134.35.16.68
  134.35.194.86
  134.35.208.25
  134.35.214.119
  134.35.224.121
-134.35.242.184
  134.35.33.205
  134.35.39.61
  134.35.51.176
  134.35.64.16
  134.35.86.136
+134.35.98.184
  134.41.12.68
  134.41.140.61
  134.56.103.118
  134.6.65.22
  134.73.121.194
  134.73.154.173
-134.73.171.21
+134.73.175.24
+134.73.175.25
+134.73.175.27
+134.73.175.29
  134.73.199.154
  134.73.26.66
  134.73.30.66
@@ -36726,13 +37678,18 @@
  134.90.149.147
  134.90.149.150
  134.90.229.237
-134.90.250.155
+134.90.250.130
  134.90.251.144
+134.90.251.147
+134.90.251.220
  134.90.251.232
-134.90.252.253
+134.90.252.103
+134.90.252.175
+134.90.252.224
  134.90.252.43
  134.90.252.94
-134.90.253.102
+134.90.253.182
+134.90.254.203
  134.99.4.139
  13453765871837679316.googlegroups.com
  135.0.252.169
@@ -36741,9 +37698,9 @@
  135.148.2.17
  135.148.3.218
  135.148.9.157
-135.180.130.166
  135.181.0.248
  135.181.0.35
+135.181.105.202
  135.181.108.237
  135.181.109.126
  135.181.109.129
@@ -36768,7 +37725,6 @@
  135.181.118.172
  135.181.118.173
  135.181.13.90
-135.181.14.66
  135.181.15.104
  135.181.16.238
  135.181.18.180
@@ -36780,25 +37736,25 @@
  135.181.36.161
  135.181.41.129
  135.181.41.206
+135.181.43.201
  135.181.43.48
-135.181.49.161
  135.181.49.56
  135.181.49.81
  135.181.49.90
  135.181.49.98
  135.181.60.57
  135.181.61.201
-135.181.61.22
+135.181.61.21
+135.181.61.23
+135.181.61.24
  135.181.68.69
+135.181.68.88
  135.181.78.208
-135.181.80.170
-135.181.83.207
  135.181.92.33
  135.181.94.15
  135.19.187.121
  135.19.91.189
  135.23.124.239
-135.23.228.90
  135.23.245.120
  135.23.75.231
  135.23.93.243
@@ -36806,11 +37762,9 @@
  1356657.servicesgsp1.club
  135athome.com
  136.0.16.221
+136.0.56.106
  136.1.1.165
  136.1.1.173
-136.143.144.101
-136.143.149.30
-136.143.157.177
  136.143.210.146
  136.143.43.222
  136.144.174.206
@@ -36868,15 +37822,18 @@
  136.232.116.2
  136.232.171.50
  136.232.171.62
+136.232.199.210
  136.232.199.34
  136.232.209.70
  136.232.210.206
  136.232.214.110
  136.232.226.202
  136.232.229.110
+136.232.236.6
  136.232.250.26
  136.232.30.174
  136.232.54.82
+136.232.57.210
  136.233.116.73
  136.233.136.41
  136.233.7.157
@@ -36906,7 +37863,6 @@
  136.243.152.18
  136.243.155.216
  136.243.167.51
-136.243.171.45
  136.243.172.46
  136.243.176.156
  136.243.201.249
@@ -36929,12 +37885,12 @@
  136.243.58.134
  136.243.6.84
  136.243.60.74
-136.243.65.223
  136.243.68.226
  136.243.70.151
  136.243.70.195
  136.243.89.196
  136.243.91.230
+136.243.94.180
  136.243.94.221
  136.244.101.95
  136.244.106.192
@@ -36959,20 +37915,19 @@
  136.34.230.123
  136.34.243.158
  136.35.54.2
-136.35.57.213
  136.36.137.179
  136.37.176.126
  136.49.107.19
+136.49.109.217
  136.49.140.142
-136.49.48.23
  136.50.53.7
  136.52.114.123
  136.55.140.15
-136.55.169.166
  136.55.36.157
  136.55.40.183
  136.56.165.251
  136.56.170.96
+136.56.27.214
  136.56.33.208
  136.56.91.16
  136.57.182.187
@@ -36988,20 +37943,31 @@
  136.8.33.69
  136.8.33.71
  136710.txtplug.com
+137.101.205.77
  137.101.217.62
  137.101.76.252
  137.103.147.138
+137.103.17.204
  137.116.133.111
  137.116.144.63
+137.116.146.201
+137.116.164.112
  137.116.165.64
+137.116.214.99
+137.116.228.61
  137.116.32.97
  137.116.58.129
-137.116.59.46
+137.116.63.84
  137.116.69.218
  137.116.84.38
+137.117.106.187
  137.117.168.216
+137.117.171.11
+137.117.179.133
  137.117.21.137
  137.117.212.72
+137.117.36.154
+137.117.48.153
  137.117.66.125
  137.117.69.106
  137.117.72.204
@@ -37012,7 +37978,13 @@
  137.119.36.33
  137.119.92.50
  137.135.101.9
-137.135.166.90
+137.135.161.219
+137.135.164.127
+137.135.179.100
+137.135.228.40
+137.135.240.170
+137.135.246.151
+137.135.86.36
  137.175.13.129
  137.175.13.130
  137.175.13.65
@@ -37020,9 +37992,11 @@
  137.175.29.33
  137.175.29.34
  137.175.9.65
+137.186.143.210
  137.186.217.170
  137.186.37.233
  137.208.57.186
+137.220.130.237
  137.220.134.189
  137.220.137.247
  137.220.137.51
@@ -37039,13 +38013,14 @@
  137.25.140.167
  137.25.230.156
  137.255.9.46
+137.26.29.118
  137.27.220.178
-137.59.0.110
  137.59.110.53
  137.59.120.58
-137.59.120.6
  137.59.155.14
  137.59.162.114
+137.59.18.140
+137.59.18.149
  137.59.18.162
  137.59.18.190
  137.59.184.111
@@ -37087,6 +38062,7 @@
  137.74.171.160
  137.74.173.182
  137.74.177.82
+137.74.177.86
  137.74.198.18
  137.74.198.84
  137.74.199.180
@@ -37123,8 +38099,8 @@
  138.0.224.232
  138.0.230.49
  138.0.231.66
-138.0.7.201
-138.0.7.249
+138.0.7.185
+138.0.7.212
  138.0.77.30
  138.117.143.226
  138.117.161.122
@@ -37139,11 +38115,9 @@
  138.117.84.133
  138.117.85.17
  138.117.85.97
-138.118.166.15
  138.118.223.103
  138.118.223.115
  138.118.224.36
-138.118.232.68
  138.118.232.69
  138.118.56.22
  138.118.86.219
@@ -37152,20 +38126,21 @@
  138.121.113.182
  138.121.128.19
  138.121.128.34
+138.121.155.16
+138.121.16.110
  138.121.16.112
  138.121.16.113
-138.121.16.77
  138.121.170.194
  138.121.19.249
  138.121.198.90
-138.121.22.18
+138.121.245.93
  138.121.32.133
  138.121.32.182
  138.121.46.177
  138.121.52.139
+138.121.61.103
  138.122.105.118
  138.122.12.217
-138.122.143.124
  138.122.148.215
  138.122.192.102
  138.122.192.18
@@ -37183,9 +38158,6 @@
  138.122.233.233
  138.122.233.241
  138.122.233.245
-138.122.234.210
-138.122.234.222
-138.122.234.250
  138.122.240.1
  138.122.38.237
  138.122.7.25
@@ -37195,13 +38167,11 @@
  138.124.180.230
  138.124.183.132
  138.128.1.146
-138.128.1.179
-138.128.1.180
-138.128.1.187
  138.128.1.190
  138.128.1.197
  138.128.1.249
  138.128.10.137
+138.128.11.141
  138.128.11.146
  138.128.11.149
  138.128.11.183
@@ -37212,9 +38182,7 @@
  138.128.113.91
  138.128.12.29
  138.128.127.112
-138.128.13.39
  138.128.13.52
-138.128.13.53
  138.128.14.103
  138.128.14.184
  138.128.14.201
@@ -37231,6 +38199,7 @@
  138.128.201.92
  138.128.206.63
  138.128.209.35
+138.128.212.218
  138.128.214.235
  138.128.216.164
  138.128.217.158
@@ -37243,22 +38212,21 @@
  138.128.34.184
  138.128.34.244
  138.128.38.12
-138.128.4.237
-138.128.4.238
-138.128.4.250
+138.128.4.233
+138.128.4.234
  138.128.45.104
  138.128.45.109
  138.128.45.124
  138.128.51.219
  138.128.7.201
-138.128.8.118
+138.128.77.90
  138.128.84.131
  138.128.84.158
  138.128.84.159
  138.128.84.166
-138.128.84.170
+138.128.84.169
  138.128.84.172
-138.128.84.177
+138.128.84.176
  138.134.102.16
  138.185.141.56
  138.185.180.146
@@ -37270,20 +38238,19 @@
  138.186.105.141
  138.186.122.105
  138.186.138.206
-138.186.138.33
-138.186.138.56
+138.186.138.209
+138.186.138.59
  138.186.156.214
  138.186.165.181
  138.186.177.212
  138.186.23.7
  138.186.239.159
-138.186.239.181
+138.186.55.160
  138.186.61.178
  138.186.88.86
  138.19.102.178
  138.19.115.47
  138.19.182.239
-138.19.211.205
  138.19.231.164
  138.19.232.36
  138.19.253.14
@@ -37311,6 +38278,7 @@
  138.197.130.102
  138.197.130.138
  138.197.130.68
+138.197.131.66
  138.197.132.117
  138.197.132.55
  138.197.135.102
@@ -37346,6 +38314,7 @@
  138.197.153.117
  138.197.153.151
  138.197.153.4
+138.197.153.44
  138.197.154.132
  138.197.154.161
  138.197.154.7
@@ -37356,7 +38325,6 @@
  138.197.158.127
  138.197.158.234
  138.197.159.143
-138.197.159.226
  138.197.159.227
  138.197.161.153
  138.197.161.96
@@ -37380,11 +38348,13 @@
  138.197.172.32
  138.197.173.208
  138.197.174.234
+138.197.175.107
  138.197.175.169
  138.197.175.236
  138.197.176.173
  138.197.176.191
  138.197.177.202
+138.197.177.9
  138.197.180.102
  138.197.180.164
  138.197.180.96
@@ -37430,6 +38400,7 @@
  138.197.213.122
  138.197.213.134
  138.197.213.160
+138.197.213.233
  138.197.213.241
  138.197.213.248
  138.197.213.78
@@ -37496,6 +38467,7 @@
  138.201.127.112
  138.201.130.12
  138.201.134.144
+138.201.172.95
  138.201.18.203
  138.201.18.236
  138.201.18.80
@@ -37540,7 +38512,9 @@
  138.204.226.186
  138.204.227.14
  138.204.227.212
+138.204.24.67
  138.204.240.46
+138.204.27.243
  138.204.27.244
  138.204.70.65
  138.204.78.249
@@ -37559,21 +38533,23 @@
  138.219.147.197
  138.219.161.1
  138.219.168.18
+138.219.201.25
  138.219.223.166
  138.219.223.232
  138.219.23.248
  138.219.236.4
-138.219.238.184
+138.219.43.254
  138.219.49.51
  138.219.53.108
+138.229.104.88
  138.229.107.35
  138.229.109.162
  138.229.114.30
  138.229.234.41
  138.229.26.42
+138.255.0.27
  138.255.14.231
  138.255.148.35
-138.255.207.140
  138.255.213.77
  138.255.220.121
  138.255.222.10
@@ -37582,7 +38558,6 @@
  138.255.227.5
  138.255.227.9
  138.255.240.66
-138.255.244.3
  138.255.75.96
  138.36.1.24
  138.36.1.44
@@ -37591,13 +38566,12 @@
  138.36.180.34
  138.36.2.218
  138.36.20.43
-138.36.200.198
+138.36.200.82
  138.36.200.96
  138.36.209.111
  138.36.22.108
  138.36.40.54
  138.36.41.116
-138.36.77.63
  138.36.98.107
  138.41.16.66
  138.41.16.67
@@ -37620,6 +38594,7 @@
  138.59.143.53
  138.59.143.54
  138.59.143.56
+138.59.143.60
  138.59.143.62
  138.59.170.182
  138.59.176.243
@@ -37627,12 +38602,13 @@
  138.59.18.110
  138.59.213.79
  138.59.233.97
-138.59.42.157
  138.68.0.64
  138.68.0.87
  138.68.100.102
  138.68.102.46
  138.68.103.131
+138.68.105.112
+138.68.105.178
  138.68.106.216
  138.68.106.62
  138.68.106.82
@@ -37689,6 +38665,7 @@
  138.68.20.137
  138.68.20.197
  138.68.21.125
+138.68.221.125
  138.68.224.230
  138.68.225.199
  138.68.226.125
@@ -37747,6 +38724,7 @@
  138.68.47.77
  138.68.48.244
  138.68.49.191
+138.68.5.192
  138.68.50.177
  138.68.50.95
  138.68.52.34
@@ -37756,6 +38734,7 @@
  138.68.53.245
  138.68.55.185
  138.68.55.189
+138.68.55.193
  138.68.55.201
  138.68.58.121
  138.68.58.186
@@ -37773,8 +38752,11 @@
  138.68.67.96
  138.68.68.103
  138.68.68.141
+138.68.68.204
  138.68.68.21
+138.68.68.234
  138.68.70.116
+138.68.71.18
  138.68.72.162
  138.68.72.167
  138.68.73.41
@@ -37795,6 +38777,7 @@
  138.68.88.243
  138.68.88.246
  138.68.89.160
+138.68.9.145
  138.68.9.190
  138.68.9.246
  138.68.92.121
@@ -37809,7 +38792,9 @@
  138.68.96.99
  138.68.97.63
  138.68.98.102
+138.68.98.222
  138.75.10.168
+138.75.159.25
  138.75.16.42
  138.75.167.161
  138.75.234.17
@@ -37817,6 +38802,7 @@
  138.75.28.161
  138.75.38.33
  138.75.56.81
+138.75.72.247
  138.75.77.200
  138.75.77.80
  138.75.92.250
@@ -37833,7 +38819,7 @@
  138.91.41.216
  138.91.48.77
  138.91.49.72
-138.91.90.106
+138.91.78.42
  138.94.156.196
  138.94.156.240
  138.94.156.43
@@ -37841,10 +38827,12 @@
  138.94.162.220
  138.94.162.254
  138.94.162.52
+138.94.165.85
  138.94.189.96
  138.94.217.157
  138.94.217.192
  138.94.217.239
+138.94.217.43
  138.94.218.109
  138.94.218.134
  138.94.218.193
@@ -37852,10 +38840,13 @@
  138.94.218.251
  138.94.218.50
  138.94.218.77
+138.94.236.250
  138.94.45.122
  138.94.49.70
  138.94.58.11
+138.94.58.133
  138.94.90.2
+138.97.0.104
  138.97.0.152
  138.97.0.47
  138.97.105.238
@@ -37872,6 +38863,7 @@
  138.97.236.13
  138.97.236.14
  138.97.236.17
+138.97.236.19
  138.97.236.2
  138.97.236.22
  138.97.236.24
@@ -37886,11 +38878,11 @@
  138.97.64.161
  138.97.84.254
  138.97.92.134
-138.97.95.183
+138.97.93.157
+138.97.93.246
  138.97.98.251
  138.99.204.188
  138.99.204.23
-138.99.206.98
  138.99.216.104
  138.99.216.112
  138.99.216.142
@@ -37914,31 +38906,29 @@
  13870112233.mer.lstest.siquality.com
  13871234567.mer.lstest.siquality.com
  139.0.10.183
-139.0.122.245
-139.0.181.178
  139.0.22.50
  139.0.24.187
  139.0.254.90
-139.0.55.73
  139.0.6.36
+139.0.66.28
  139.0.77.165
-139.129.108.135
  139.129.111.4
-139.129.116.237
  139.129.206.8
  139.129.225.173
  139.129.94.95
+139.130.13.204
  139.130.140.184
  139.130.206.73
  139.130.228.72
  139.130.233.254
-139.130.242.30
  139.130.242.43
  139.138.153.194
  139.138.65.250
  139.138.8.214
+139.150.79.164
  139.153.255.107
  139.155.1.46
+139.155.1.62
  139.155.10.97
  139.155.11.173
  139.155.123.84
@@ -37946,6 +38936,7 @@
  139.155.13.21
  139.155.13.245
  139.155.13.59
+139.155.16.188
  139.155.17.13
  139.155.17.18
  139.155.17.74
@@ -37961,9 +38952,11 @@
  139.155.224.175
  139.155.225.13
  139.155.225.246
+139.155.226.161
  139.155.226.188
  139.155.23.172
  139.155.232.32
+139.155.238.60
  139.155.239.207
  139.155.239.5
  139.155.24.139
@@ -37976,6 +38969,8 @@
  139.155.243.101
  139.155.243.41
  139.155.244.180
+139.155.245.25
+139.155.246.185
  139.155.246.196
  139.155.246.221
  139.155.247.183
@@ -37995,6 +38990,7 @@
  139.155.38.67
  139.155.39.22
  139.155.41.161
+139.155.42.189
  139.155.42.30
  139.155.43.100
  139.155.43.222
@@ -38002,21 +38998,26 @@
  139.155.46.147
  139.155.54.93
  139.155.68.58
+139.155.71.61
  139.155.72.204
  139.155.73.60
  139.155.74.147
  139.155.75.8
  139.155.76.42
+139.155.77.44
+139.155.79.110
  139.155.79.24
  139.155.79.7
  139.155.81.79
  139.155.82.119
  139.155.83.18
+139.155.84.160
+139.155.86.123
  139.155.86.130
  139.155.86.214
  139.155.87.64
  139.155.89.11
-139.155.89.13
+139.155.94.123
  139.155.94.131
  139.159.0.38
  139.159.1.1
@@ -38024,11 +39025,9 @@
  139.159.118.14
  139.159.136.243
  139.159.152.237
-139.159.154.0
  139.159.184.18
  139.159.189.67
  139.159.197.228
-139.159.231.152
  139.159.232.235
  139.159.47.22
  139.159.48.155
@@ -38061,6 +39060,7 @@
  139.162.118.251
  139.162.119.235
  139.162.120.76
+139.162.120.98
  139.162.121.165
  139.162.121.170
  139.162.121.251
@@ -38071,7 +39071,6 @@
  139.162.124.224
  139.162.124.226
  139.162.127.185
-139.162.128.181
  139.162.128.239
  139.162.130.39
  139.162.144.235
@@ -38139,7 +39138,6 @@
  139.162.253.168
  139.162.254.78
  139.162.28.242
-139.162.29.211
  139.162.30.134
  139.162.31.115
  139.162.31.228
@@ -38208,15 +39206,22 @@
  139.170.231.168
  139.170.40.12
  139.170.8.116
+139.178.91.84
+139.180.1.11
+139.180.1.65
  139.180.128.190
+139.180.134.177
+139.180.142.250
  139.180.147.93
  139.180.168.23
-139.180.184.162
+139.180.184.19
  139.180.193.170
  139.180.193.222
  139.180.200.103
  139.180.202.99
  139.180.207.34
+139.180.207.75
+139.180.211.249
  139.180.212.34
  139.180.214.15
  139.180.214.151
@@ -38224,9 +39229,9 @@
  139.180.22.43
  139.180.220.15
  139.180.220.179
-139.186.109.22
+139.180.224.63
+139.180.229.182
  139.186.122.226
-139.186.131.174
  139.186.146.152
  139.186.148.93
  139.186.155.45
@@ -38234,33 +39239,39 @@
  139.186.24.82
  139.186.4.114
  139.186.64.239
+139.186.66.109
  139.186.67.94
+139.186.68.226
  139.186.68.53
  139.186.69.133
  139.186.69.195
  139.186.69.92
  139.186.72.74
  139.186.73.140
+139.186.73.162
+139.186.73.248
  139.186.76.101
  139.186.77.120
  139.186.77.174
+139.186.77.243
  139.186.77.46
+139.186.8.212
  139.186.82.43
  139.186.82.72
  139.189.233.23
  139.189.235.70
-139.189.251.59
  139.189.71.28
  139.190.238.15
-139.190.238.89
  139.192.237.253
-139.193.244.147
-139.194.2.21
+139.192.52.22
+139.192.74.145
+139.193.2.101
+139.194.207.241
  139.194.207.25
-139.195.188.40
+139.194.247.207
+139.195.241.98
  139.195.47.195
  139.196.156.254
-139.196.16.10
  139.196.223.104
  139.196.230.184
  139.198.1.16
@@ -38291,13 +39302,16 @@
  139.199.124.131
  139.199.126.221
  139.199.14.128
+139.199.153.163
  139.199.158.21
  139.199.160.102
  139.199.164.31
  139.199.165.189
+139.199.168.18
  139.199.170.101
+139.199.18.194
+139.199.18.200
  139.199.189.158
-139.199.19.100
  139.199.204.61
  139.199.208.176
  139.199.228.133
@@ -38318,6 +39332,7 @@
  139.199.48.124
  139.199.5.50
  139.199.62.142
+139.199.62.48
  139.199.64.247
  139.199.67.185
  139.199.74.11
@@ -38329,6 +39344,7 @@
  139.199.88.244
  139.199.89.157
  139.199.94.100
+139.199.94.51
  139.199.99.77
  139.208.134.81
  139.208.135.55
@@ -38337,42 +39353,40 @@
  139.208.160.165
  139.208.167.167
  139.208.185.22
-139.208.19.190
  139.208.28.39
+139.208.91.192
  139.208.94.129
-139.209.224.16
  139.209.236.209
  139.209.242.57
  139.209.243.86
  139.209.254.167
-139.209.254.41
  139.209.34.34
  139.209.86.159
-139.210.212.104
  139.210.36.66
  139.210.4.206
  139.210.52.54
  139.210.98.218
  139.211.125.216
-139.211.142.197
  139.211.193.186
  139.211.230.243
-139.211.43.74
  139.211.45.177
  139.211.47.57
  139.211.58.123
  139.211.8.32
  139.211.87.152
  139.212.54.193
+139.213.133.217
  139.213.135.158
  139.213.18.93
  139.213.3.46
  139.213.64.215
  139.213.8.22
  139.213.93.243
+139.213.97.23
  139.214.251.109
  139.214.251.141
  139.214.251.173
+139.214.251.205
  139.214.251.230
  139.214.251.45
  139.214.251.7
@@ -38389,9 +39403,12 @@
  139.217.236.198
  139.217.82.115
  139.217.82.205
+139.217.95.45
+139.217.97.195
  139.218.110.204
  139.219.0.154
  139.219.0.186
+139.219.1.228
  139.219.1.61
  139.219.10.11
  139.219.10.167
@@ -38414,6 +39431,7 @@
  139.219.233.114
  139.219.239.76
  139.219.3.210
+139.219.3.64
  139.219.4.181
  139.219.4.224
  139.219.4.89
@@ -38428,16 +39446,20 @@
  139.219.9.34
  139.220.192.57
  139.224.104.83
-139.224.27.2
  139.224.72.224
+139.226.173.10
  139.226.33.245
+139.226.34.78
  139.226.75.66
  139.226.75.82
  139.227.191.2
-139.227.191.47
+139.228.234.81
+139.255.100.235
+139.255.100.237
  139.255.101.244
  139.255.113.194
  139.255.116.122
+139.255.116.30
  139.255.128.244
  139.255.17.58
  139.255.18.36
@@ -38456,7 +39478,6 @@
  139.255.46.2
  139.255.58.94
  139.255.69.149
-139.255.78.174
  139.255.86.189
  139.255.86.19
  139.255.87.234
@@ -38474,8 +39495,6 @@
  139.47.130.253
  139.47.135.215
  139.5.132.105
-139.5.132.245
-139.5.135.42
  139.5.152.81
  139.5.157.131
  139.5.16.174
@@ -38485,12 +39504,14 @@
  139.5.237.163
  139.5.237.238
  139.5.29.97
+139.5.31.211
  139.5.45.37
-139.5.71.46
+139.5.71.70
  139.5.71.80
  139.59.0.68
  139.59.1.195
  139.59.10.186
+139.59.10.27
  139.59.10.90
  139.59.100.62
  139.59.101.59
@@ -38507,6 +39528,8 @@
  139.59.108.41
  139.59.109.146
  139.59.109.223
+139.59.11.154
+139.59.11.66
  139.59.111.188
  139.59.112.158
  139.59.116.115
@@ -38523,9 +39546,9 @@
  139.59.125.50
  139.59.125.61
  139.59.129.216
-139.59.129.219
  139.59.129.44
  139.59.129.45
+139.59.129.59
  139.59.13.160
  139.59.13.178
  139.59.130.184
@@ -38534,14 +39557,15 @@
  139.59.133.207
  139.59.134.64
  139.59.135.148
+139.59.135.208
  139.59.135.84
  139.59.136.64
  139.59.136.84
-139.59.137.221
  139.59.138.115
  139.59.139.1
  139.59.139.32
  139.59.14.103
+139.59.14.54
  139.59.141.179
  139.59.141.245
  139.59.141.56
@@ -38555,7 +39579,6 @@
  139.59.147.218
  139.59.148.209
  139.59.148.56
-139.59.150.19
  139.59.151.124
  139.59.153.133
  139.59.154.228
@@ -38564,6 +39587,8 @@
  139.59.158.239
  139.59.159.0
  139.59.159.204
+139.59.159.42
+139.59.159.75
  139.59.16.118
  139.59.161.202
  139.59.161.78
@@ -38574,6 +39599,7 @@
  139.59.167.38
  139.59.168.182
  139.59.169.103
+139.59.169.37
  139.59.17.105
  139.59.172.23
  139.59.174.107
@@ -38593,6 +39619,7 @@
  139.59.196.82
  139.59.197.250
  139.59.2.146
+139.59.20.249
  139.59.20.81
  139.59.211.160
  139.59.211.245
@@ -38602,6 +39629,7 @@
  139.59.215.103
  139.59.215.171
  139.59.215.185
+139.59.215.241
  139.59.22.194
  139.59.22.201
  139.59.22.98
@@ -38610,6 +39638,7 @@
  139.59.225.118
  139.59.225.255
  139.59.226.129
+139.59.228.154
  139.59.228.20
  139.59.228.235
  139.59.229.150
@@ -38629,34 +39658,37 @@
  139.59.239.104
  139.59.239.38
  139.59.24.62
-139.59.240.17
+139.59.240.39
  139.59.241.143
  139.59.241.75
  139.59.242.108
+139.59.242.161
  139.59.242.22
  139.59.242.50
  139.59.242.62
  139.59.242.70
  139.59.244.238
  139.59.246.187
+139.59.246.63
+139.59.246.79
  139.59.247.161
  139.59.247.201
  139.59.247.235
  139.59.247.243
-139.59.248.102
-139.59.248.105
+139.59.247.98
  139.59.248.116
  139.59.248.126
  139.59.248.248
  139.59.248.84
+139.59.249.12
  139.59.25.153
  139.59.25.238
  139.59.250.118
  139.59.251.222
  139.59.251.99
  139.59.252.136
+139.59.252.33
  139.59.252.49
-139.59.253.238
  139.59.254.221
  139.59.254.44
  139.59.255.101
@@ -38673,7 +39705,6 @@
  139.59.31.28
  139.59.32.156
  139.59.35.52
-139.59.36.107
  139.59.36.45
  139.59.37.245
  139.59.38.252
@@ -38693,6 +39724,7 @@
  139.59.43.75
  139.59.44.130
  139.59.45.128
+139.59.46.243
  139.59.46.79
  139.59.46.88
  139.59.47.192
@@ -38703,7 +39735,10 @@
  139.59.57.39
  139.59.57.60
  139.59.58.25
+139.59.59.102
  139.59.59.157
+139.59.59.165
+139.59.59.187
  139.59.59.210
  139.59.59.63
  139.59.59.68
@@ -38732,9 +39767,13 @@
  139.59.71.128
  139.59.72.62
  139.59.72.96
+139.59.75.111
  139.59.75.162
  139.59.75.249
+139.59.75.74
  139.59.78.239
+139.59.79.138
+139.59.79.152
  139.59.79.216
  139.59.8.10
  139.59.80.147
@@ -38749,6 +39788,7 @@
  139.59.85.41
  139.59.86.47
  139.59.87.254
+139.59.88.119
  139.59.88.246
  139.59.88.86
  139.59.9.114
@@ -38771,6 +39811,7 @@
  139.59.95.60
  139.59.96.235
  139.59.98.178
+139.59.98.54
  139.59.99.35
  139.60.12.238
  139.60.12.89
@@ -38783,14 +39824,12 @@
  139.87.67.24
  139.87.69.145
  139.9.112.169
-139.9.146.250
  139.9.177.227
+139.9.179.96
  139.9.195.191
  139.9.201.67
-139.9.63.189
  139.9.64.237
  139.9.68.144
-139.9.80.115
  139.9.85.215
  139.9.92.109
  139.99.102.114
@@ -38819,10 +39858,10 @@
  139.99.176.63
  139.99.180.103
  139.99.180.74
-139.99.185.81
  139.99.196.183
  139.99.20.49
  139.99.203.12
+139.99.203.23
  139.99.208.34
  139.99.210.46
  139.99.212.246
@@ -38830,6 +39869,7 @@
  139.99.219.208
  139.99.236.237
  139.99.237.109
+139.99.238.150
  139.99.239.230
  139.99.26.68
  139.99.33.94
@@ -38840,17 +39880,19 @@
  139.99.42.75
  139.99.43.235
  139.99.52.183
+139.99.53.207
  139.99.54.20
+139.99.55.149
  139.99.66.210
  139.99.66.231
  139.99.69.189
  139.99.79.185
  139.99.8.31
  139.99.88.182
+139.99.89.202
  139.99.9.87
  139.99.98.191
  139.99.98.248
-139.99.99.151
  13960999999.mer.lstest.siquality.com
  139644804765798-dot-we-secure-file-sh4456.appspot.com
  139banjia.com
@@ -38865,8 +39907,8 @@
  13r.lg.ua
  13stages.com
  13suntrust4.7m.pl
-14.0.67.43
  14.0.67.44
+14.0.82.115
  14.1.112.177
  14.1.28.114
  14.102.101.102
@@ -38884,6 +39926,7 @@
  14.102.61.138
  14.102.62.84
  14.102.64.209
+14.102.69.206
  14.102.69.226
  14.102.7.19
  14.102.71.10
@@ -38893,16 +39936,14 @@
  14.102.93.109
  14.102.97.204
  14.105.38.124
+14.105.62.23
  14.106.226.247
  14.106.98.76
-14.112.19.174
  14.112.33.172
  14.112.34.199
-14.114.29.30
  14.114.32.208
  14.114.33.19
  14.115.207.126
-14.115.28.153
  14.115.28.6
  14.115.30.180
  14.115.31.29
@@ -38942,6 +39983,7 @@
  14.117.188.60
  14.117.189.244
  14.117.189.27
+14.117.189.99
  14.117.190.185
  14.117.190.58
  14.117.190.61
@@ -38950,6 +39992,7 @@
  14.118.215.54
  14.12.147.161
  14.120.121.218
+14.120.181.48
  14.120.183.189
  14.120.225.175
  14.122.63.203
@@ -38985,9 +40028,10 @@
  14.136.192.222
  14.136.201.82
  14.136.249.138
+14.136.32.79
  14.136.40.146
-14.136.42.159
  14.136.51.105
+14.136.7.185
  14.137.7.149
  14.138.109.129
  14.138.109.133
@@ -39002,11 +40046,11 @@
  14.139.185.114
  14.139.208.130
  14.139.209.14
+14.139.209.210
  14.139.225.151
  14.139.229.34
+14.139.237.162
  14.139.239.22
-14.139.240.145
-14.139.242.247
  14.139.56.14
  14.139.87.36
  14.14.71.47
@@ -39033,12 +40077,15 @@
  14.143.3.30
  14.143.37.68
  14.143.46.147
-14.145.164.93
+14.145.172.78
  14.145.174.162
  14.145.174.178
  14.145.175.67
+14.146.93.202
  14.146.94.190
+14.146.94.30
  14.152.41.17
+14.152.49.218
  14.152.77.205
  14.152.85.108
  14.152.90.20
@@ -39046,10 +40093,8 @@
  14.152.95.91
  14.154.178.47
  14.154.28.199
-14.154.31.171
  14.155.112.48
-14.155.17.54
-14.155.223.140
+14.155.19.161
  14.156.51.232
  14.157.105.213
  14.157.107.156
@@ -39058,37 +40103,33 @@
  14.160.23.139
  14.160.26.18
  14.160.33.254
-14.160.52.26
  14.160.70.178
  14.160.93.230
  14.161.0.62
  14.161.10.127
  14.161.13.61
-14.161.14.123
  14.161.14.124
  14.161.147.32
-14.161.16.222
  14.161.18.134
  14.161.18.60
  14.161.19.186
  14.161.19.53
-14.161.20.205
  14.161.203.156
  14.161.254.246
  14.161.29.242
  14.161.38.107
-14.161.43.183
+14.161.42.242
  14.161.43.45
  14.161.44.120
+14.161.45.187
  14.161.46.132
  14.161.47.128
  14.161.48.111
  14.161.48.201
-14.161.49.29
  14.161.5.68
  14.161.50.104
  14.161.6.201
-14.162.130.145
+14.162.136.41
  14.162.139.88
  14.162.144.102
  14.162.144.15
@@ -39096,38 +40137,46 @@
  14.162.145.182
  14.162.146.128
  14.162.146.38
+14.162.155.181
  14.162.186.160
-14.162.203.113
-14.162.233.20
-14.162.31.151
+14.162.33.97
  14.162.44.97
+14.162.80.254
  14.163.156.97
  14.163.182.180
-14.163.48.5
  14.163.93.178
+14.164.180.137
  14.164.188.114
  14.164.78.61
  14.164.99.69
  14.165.109.150
  14.166.124.11
+14.167.124.126
  14.167.135.86
  14.167.168.11
  14.167.198.133
-14.167.241.103
+14.167.207.139
  14.168.20.146
  14.168.66.58
  14.168.76.68
-14.168.80.136
  14.168.93.75
  14.169.105.120
  14.169.112.25
+14.169.112.66
+14.169.116.153
+14.169.135.12
+14.169.148.175
+14.169.149.10
  14.169.168.219
  14.169.171.181
  14.169.175.165
  14.169.202.234
  14.169.205.14
+14.169.231.3
  14.169.240.19
+14.169.248.124
  14.169.31.13
+14.169.99.137
  14.17.100.33
  14.17.114.65
  14.17.65.221
@@ -39136,6 +40185,7 @@
  14.170.201.98
  14.171.199.142
  14.171.71.101
+14.172.101.9
  14.172.16.243
  14.172.213.125
  14.172.26.84
@@ -39143,20 +40193,19 @@
  14.172.64.122
  14.172.85.228
  14.173.70.155
-14.175.134.68
+14.176.157.95
  14.176.186.48
  14.176.231.63
-14.177.128.145
  14.177.139.66
  14.177.154.203
  14.177.156.159
-14.177.177.154
-14.177.185.156
+14.177.160.85
+14.177.184.68
  14.177.226.141
  14.177.231.141
  14.177.232.71
  14.177.235.178
-14.177.89.140
+14.178.108.55
  14.179.127.17
  14.179.134.206
  14.179.151.30
@@ -39180,27 +40229,35 @@
  14.18.90.155
  14.180.217.224
  14.181.165.68
-14.182.205.238
  14.182.98.54
  14.183.248.39
  14.183.53.139
  14.184.157.180
-14.185.135.59
+14.184.176.116
+14.185.106.195
+14.185.136.156
  14.186.142.52
  14.186.154.5
+14.186.189.150
  14.186.199.172
+14.186.199.78
+14.186.200.86
  14.186.202.9
+14.186.211.158
  14.186.213.145
  14.186.235.184
-14.186.33.196
+14.186.32.204
  14.186.35.108
-14.186.62.148
+14.187.11.75
  14.187.136.76
-14.187.141.173
  14.187.142.66
-14.187.33.248
+14.187.38.232
  14.187.68.169
+14.187.96.134
  14.188.56.39
+14.189.142.90
+14.189.172.153
+14.189.2.140
  14.189.207.200
  14.190.240.225
  14.191.127.14
@@ -39215,11 +40272,12 @@
  14.192.197.164
  14.192.208.205
  14.192.208.57
+14.192.208.68
  14.192.208.80
-14.192.209.136
  14.192.209.15
  14.192.212.148
  14.192.244.154
+14.192.244.94
  14.192.247.254
  14.192.248.5
  14.192.27.82
@@ -39232,11 +40290,14 @@
  14.198.132.14
  14.198.15.220
  14.198.163.2
+14.198.45.199
  14.198.5.221
  14.199.117.89
  14.199.136.112
+14.199.139.124
  14.199.208.122
  14.199.219.12
+14.199.39.184
  14.199.40.24
  14.2.71.61
  14.20.180.97
@@ -39245,6 +40306,8 @@
  14.20.183.112
  14.200.1.238
  14.200.197.130
+14.200.208.244
+14.200.7.32
  14.201.234.2
  14.202.179.208
  14.202.219.243
@@ -39254,6 +40317,7 @@
  14.204.211.122
  14.204.5.250
  14.204.84.96
+14.205.92.62
  14.207.0.35
  14.207.117.60
  14.207.119.126
@@ -39263,7 +40327,8 @@
  14.207.14.53
  14.207.144.249
  14.207.153.206
-14.207.167.37
+14.207.176.35
+14.207.179.96
  14.207.180.175
  14.207.19.104
  14.207.20.11
@@ -39273,20 +40338,22 @@
  14.207.21.62
  14.207.23.103
  14.207.24.44
-14.207.25.135
  14.207.27.179
  14.207.27.186
  14.207.36.110
  14.207.36.50
  14.207.4.78
  14.207.5.65
+14.207.56.100
  14.207.56.68
+14.207.59.144
  14.207.59.166
  14.207.65.41
  14.207.66.42
  14.207.68.187
  14.207.74.75
  14.207.75.11
+14.207.78.62
  14.207.85.217
  14.21.36.84
  14.21.42.158
@@ -39310,14 +40377,17 @@
  14.215.46.147
  14.215.49.234
  14.215.50.23
-14.219.236.58
+14.221.98.88
  14.223.92.99
  14.225.17.9
  14.225.5.247
+14.226.134.43
  14.226.200.143
  14.226.200.154
  14.226.235.5
+14.226.244.16
  14.227.114.114
+14.229.120.6
  14.229.164.91
  14.23.110.173
  14.23.122.98
@@ -39327,9 +40397,11 @@
  14.23.91.82
  14.230.129.172
  14.230.78.115
-14.231.110.228
  14.231.123.9
+14.231.132.60
+14.231.43.173
  14.232.113.209
+14.232.121.13
  14.232.152.81
  14.232.160.197
  14.232.160.213
@@ -39337,6 +40409,7 @@
  14.232.160.252
  14.232.161.29
  14.232.163.52
+14.232.176.52
  14.232.208.115
  14.232.208.117
  14.232.214.138
@@ -39344,7 +40417,9 @@
  14.232.221.41
  14.232.245.245
  14.232.25.117
+14.233.129.151
  14.233.191.221
+14.233.224.140
  14.233.224.226
  14.233.35.235
  14.234.188.244
@@ -39352,48 +40427,61 @@
  14.234.241.61
  14.235.173.92
  14.235.185.42
+14.235.61.130
  14.236.41.187
  14.237.155.231
  14.237.200.131
  14.237.244.95
  14.237.98.161
  14.239.250.114
-14.240.172.177
+14.239.4.129
  14.240.55.190
  14.241.136.183
+14.241.136.207
  14.241.209.27
  14.241.228.19
-14.241.234.51
  14.241.235.253
  14.241.240.245
+14.241.244.139
  14.241.245.179
  14.241.39.134
  14.241.39.247
  14.241.40.18
  14.241.48.6
  14.241.63.2
+14.242.178.88
  14.242.186.228
  14.242.189.126
  14.242.229.209
+14.242.86.216
+14.243.144.147
  14.244.97.132
  14.245.166.37
-14.245.203.75
+14.245.237.59
  14.245.6.41
  14.245.62.251
+14.245.86.179
+14.246.14.8
  14.246.25.215
+14.246.27.183
  14.247.76.189
+14.248.119.141
  14.248.137.211
-14.248.153.113
-14.248.8.106
+14.248.83.163
  14.248.83.32
  14.248.84.5
-14.248.85.39
-14.249.71.155
+14.250.40.110
+14.250.62.15
+14.251.176.206
+14.251.198.198
+14.251.74.231
  14.252.130.29
  14.252.15.14
  14.254.232.28
+14.254.80.51
  14.29.118.34
  14.29.126.53
+14.29.148.201
  14.29.156.197
  14.29.162.139
  14.29.171.172
@@ -39403,6 +40491,7 @@
  14.29.184.45
  14.29.196.157
  14.29.197.120
+14.29.198.185
  14.29.201.72
  14.29.202.100
  14.29.205.61
@@ -39410,14 +40499,17 @@
  14.29.210.146
  14.29.221.251
  14.29.222.225
+14.29.223.88
  14.29.227.56
  14.29.228.159
  14.29.232.148
  14.29.239.215
  14.29.242.40
  14.29.247.69
+14.29.249.7
  14.29.250.224
  14.29.254.239
+14.29.255.9
  14.29.64.243
  14.29.64.91
  14.32.164.26
@@ -39436,14 +40528,12 @@
  14.33.65.186
  14.33.77.170
  14.34.111.2
-14.34.165.16
  14.34.189.136
  14.34.189.228
  14.34.204.226
  14.34.207.70
  14.34.213.176
  14.34.244.212
-14.34.3.109
  14.34.99.226
  14.35.229.148
  14.35.253.211
@@ -39451,15 +40541,17 @@
  14.36.106.228
  14.36.115.188
  14.36.13.11
+14.36.184.53
+14.36.184.8
  14.36.212.1
  14.36.233.154
-14.36.233.231
  14.36.233.245
  14.36.244.66
  14.36.251.30
  14.37.180.133
  14.37.181.247
  14.37.230.1
+14.37.244.28
  14.37.31.32
  14.37.43.23
  14.37.9.66
@@ -39481,9 +40573,11 @@
  14.40.85.81
  14.41.119.147
  14.41.119.65
+14.41.90.59
  14.42.131.21
  14.42.144.183
  14.42.144.228
+14.42.144.52
  14.42.155.140
  14.42.156.190
  14.42.163.125
@@ -39495,7 +40589,6 @@
  14.43.64.2
  14.43.78.208
  14.44.34.164
-14.44.36.140
  14.44.40.225
  14.44.52.218
  14.44.69.38
@@ -39504,7 +40597,6 @@
  14.45.184.20
  14.45.2.198
  14.45.20.130
-14.45.23.7
  14.45.236.40
  14.45.50.134
  14.45.53.208
@@ -39515,6 +40607,7 @@
  14.46.190.42bin.sh
  14.46.202.222
  14.46.230.78
+14.46.83.55
  14.47.124.208
  14.47.137.144
  14.47.140.50
@@ -39568,10 +40661,12 @@
  14.52.115.124
  14.52.116.5
  14.52.186.229
+14.52.190.204
  14.52.70.46
  14.53.16.57
  14.53.186.138
  14.53.186.216
+14.53.19.74
  14.53.191.139
  14.53.22.94
  14.53.220.222
@@ -39584,9 +40679,11 @@
  14.54.101.50
  14.54.119.87
  14.54.121.93
+14.54.13.54
  14.54.16.206
  14.54.213.87
  14.54.237.52
+14.54.34.49
  14.55.110.211
  14.55.118.185
  14.55.250.186
@@ -39597,7 +40694,6 @@
  14.55.61.46
  14.55.61.55
  14.55.82.181
-14.55.83.96
  14.56.10.14
  14.56.180.103
  14.56.24.182
@@ -39629,6 +40725,7 @@
  14.63.5.35
  14.63.55.164
  14.7.65.80
+14.80.204.79
  14.85.173.179
  14.95.106.11
  14.98.112.126
@@ -39636,12 +40733,13 @@
  14.98.115.50
  14.98.117.60
  14.98.134.74
-14.98.247.70
+14.98.213.14
  14.98.4.82
  14.98.68.73
  14.98.76.206
  14.99.117.194
  14.99.117.230
+14.99.117.251
  14.99.140.82
  14.99.164.178
  14.99.176.210
@@ -39649,9 +40747,8 @@
  14.99.198.34
  14.99.202.162
  14.99.224.170
-14.99.30.238
-14.99.30.242
  14.99.64.171
+14.99.68.91
  14.99.81.182
  14.99.81.218
  14.ip-51-178-42.eu
@@ -39659,22 +40756,31 @@
  140.113.212.4
  140.113.88.236
  140.114.91.139
-140.114.93.1
+140.121.197.14
  140.128.85.2
-140.130.85.82
  140.143.0.121
  140.143.0.127
+140.143.0.226
+140.143.0.98
  140.143.1.122
+140.143.10.12
+140.143.12.19
  140.143.127.36
  140.143.128.66
+140.143.129.71
  140.143.13.91
+140.143.130.42
  140.143.134.171
  140.143.136.41
  140.143.136.89
+140.143.137.170
+140.143.139.81
  140.143.140.61
  140.143.142.213
  140.143.144.140
  140.143.145.129
+140.143.149.71
+140.143.15.140
  140.143.152.200
  140.143.153.114
  140.143.153.79
@@ -39691,17 +40797,20 @@
  140.143.19.170
  140.143.19.237
  140.143.19.40
-140.143.19.92
  140.143.193.52
  140.143.195.157
  140.143.195.181
  140.143.195.189
+140.143.199.89
  140.143.20.166
  140.143.200.251
+140.143.203.37
  140.143.206.191
  140.143.207.23
+140.143.207.57
  140.143.208.213
  140.143.210.92
+140.143.22.116
  140.143.222.87
  140.143.224.170
  140.143.225.42
@@ -39709,7 +40818,9 @@
  140.143.228.18
  140.143.228.227
  140.143.228.67
+140.143.229.224
  140.143.230.28
+140.143.231.85
  140.143.233.133
  140.143.233.218
  140.143.233.29
@@ -39720,15 +40831,20 @@
  140.143.24.26
  140.143.24.35
  140.143.243.27
+140.143.244.91
  140.143.247.30
  140.143.248.202
  140.143.248.32
  140.143.249.234
  140.143.25.149
+140.143.25.65
+140.143.250.89
  140.143.28.158
  140.143.29.3
  140.143.30.191
+140.143.30.93
  140.143.31.73
+140.143.38.123
  140.143.39.177
  140.143.45.196
  140.143.45.215
@@ -39748,12 +40864,10 @@
  140.143.95.102
  140.143.96.66
  140.147.236.194
-140.148.239.235
-140.182.48.225
  140.186.10.22
  140.186.212.146
+140.186.23.219
  140.186.235.254
-140.186.32.3
  140.186.34.97
  140.186.96.91
  140.190.17.138
@@ -39762,7 +40876,6 @@
  140.206.138.190
  140.206.141.80
  140.206.157.242
-140.206.187.18
  140.206.223.29
  140.206.223.56
  140.206.242.34
@@ -39772,6 +40885,8 @@
  140.206.86.125
  140.207.114.2
  140.207.23.100
+140.207.23.235
+140.207.23.249
  140.207.232.13
  140.207.35.3
  140.207.81.233
@@ -39784,15 +40899,17 @@
  140.237.75.158
  140.237.94.186
  140.238.172.33
+140.238.175.115
  140.238.177.83
  140.238.183.112
  140.238.191.43
  140.238.213.21
  140.238.231.250
-140.238.241.53
  140.238.248.140
  140.238.25.151
  140.238.251.206
+140.238.253.177
+140.238.49.143
  140.238.55.149
  140.238.62.125
  140.238.7.133
@@ -39807,7 +40924,6 @@
  140.246.88.226
  140.249.17.94
  140.249.172.136
-140.249.18.118
  140.249.182.213
  140.249.19.110
  140.249.190.102
@@ -39818,6 +40934,7 @@
  140.249.205.58
  140.249.213.243
  140.249.48.49
+140.250.149.218
  140.250.55.144
  140.250.80.168
  140.255.122.159
@@ -39840,36 +40957,33 @@
  140bd7dca2f0a46e46c62254903e7589-dot-dbenitonline.ey.r.appspot.com
  140teakwood.com
  141.0.226.105
-141.101.105.52
-141.101.107.138
+141.101.104.167
+141.101.104.65
+141.101.105.70
  141.101.143.12
  141.101.143.60
  141.101.143.63
  141.101.25.191
-141.101.76.120
-141.101.77.176
-141.101.77.96
  141.101.8.36
-141.101.96.225
  141.101.98.130
-141.101.98.144
-141.101.98.168
-141.101.98.222
-141.101.98.52
-141.101.98.72
+141.101.98.54
+141.101.98.64
  141.101.99.213
  141.101.99.61
  141.105.104.15
-141.105.104.21
+141.105.104.167
  141.105.104.220
  141.105.104.241
  141.105.104.39
-141.105.104.56
+141.105.104.4
+141.105.105.15
  141.105.105.182
-141.105.105.33
+141.105.105.215
+141.105.105.32
  141.105.132.43
  141.105.141.103
  141.105.197.178
+141.105.65.236
  141.105.65.254
  141.105.66.163
  141.105.66.241
@@ -39878,22 +40992,21 @@
  141.105.69.69
  141.105.96.126
  141.108.255.109
-141.113.11.32
  141.134.172.52
  141.135.117.123
  141.135.2.95
+141.136.35.150
+141.136.39.108
  141.138.141.208
  141.138.33.205
  141.149.36.27
  141.151.238.243
  141.154.10.37
-141.156.20.223
  141.164.49.33
  141.164.58.29
  141.164.87.46
  141.164.90.99
  141.168.109.22
-141.168.28.226
  141.170.15.23
  141.193.115.2
  141.193.155.171
@@ -39909,12 +41022,14 @@
  141.212.123.212
  141.212.123.213
  141.212.123.214
+141.213.13.199
  141.223.108.28
  141.223.108.29
  141.223.5.11
  141.223.82.138
  141.226.1.11
  141.226.122.122
+141.226.18.166
  141.226.18.9
  141.226.22.209
  141.226.29.236
@@ -39951,7 +41066,6 @@
  141.98.10.136
  141.98.10.143
  141.98.10.144
-141.98.10.149
  141.98.10.163
  141.98.10.171
  141.98.10.181
@@ -39968,17 +41082,15 @@
  141.98.103.26
  141.98.134.135
  141.98.191.7
+141.98.217.162
  141.98.236.30
  141.98.252.161
-141.98.252.162
  141.98.252.163
  141.98.255.143
  141.98.80.22
  141.98.80.227
  141.98.80.242
  141.98.80.39
-141.98.80.74
-141.98.80.76
  141.98.80.78
  141.98.80.79
  141.98.81.139
@@ -39993,7 +41105,6 @@
  141.98.81.88
  141.98.82.19
  141.98.82.20
-141.98.83.187
  141.98.85.119
  141.98.85.17
  141.98.85.210
@@ -40064,12 +41175,8 @@
  142.11.242.17
  142.11.243.100
  142.11.244.175
-142.11.245.160
-142.11.245.167
+142.11.245.149
  142.11.245.80
-142.11.248.188
-142.11.248.190
-142.11.248.199
  142.11.249.206
  142.11.249.56
  142.11.68.68
@@ -40085,22 +41192,19 @@
  142.117.9.62
  142.120.100.207
  142.120.217.143
-142.122.39.10
-142.127.171.192
+142.129.132.71
  142.129.134.225
  142.129.31.183
  142.147.111.54
  142.147.96.198
  142.163.206.24
-142.165.167.117
  142.165.181.78
  142.167.100.176
  142.169.145.97
  142.169.165.34
  142.179.227.170
-142.190.12.250
-142.196.203.103
  142.197.24.58
+142.202.222.17
  142.234.202.144
  142.234.202.20
  142.234.202.218
@@ -40112,11 +41216,12 @@
  142.234.203.25
  142.234.203.3
  142.234.203.92
+142.247.12.161
  142.250.74.238
  142.252.248.65
  142.4.102.226
  142.4.109.196
-142.4.16.20
+142.4.198.74
  142.4.203.42
  142.4.204.122
  142.4.208.182
@@ -40147,7 +41252,6 @@
  142.44.167.113
  142.44.173.131
  142.44.173.134
-142.44.179.150
  142.44.184.205
  142.44.185.242
  142.44.199.30
@@ -40156,13 +41260,15 @@
  142.44.211.57
  142.44.212.185
  142.44.213.196
-142.44.213.234
  142.44.214.3
+142.44.218.192
  142.44.232.99
  142.44.242.38
  142.44.246.156
  142.44.247.154
  142.44.251.104
+142.44.252.26
+142.44.254.100
  142.51.192.241
  142.51.216.117
  142.51.243.11
@@ -40194,12 +41300,15 @@
  142.93.1.103
  142.93.10.17
  142.93.100.171
+142.93.100.9
  142.93.101.111
  142.93.101.115
  142.93.101.148
+142.93.101.2
  142.93.102.204
  142.93.102.231
  142.93.103.141
+142.93.104.112
  142.93.104.92
  142.93.105.212
  142.93.106.56
@@ -40208,6 +41317,7 @@
  142.93.109.28
  142.93.11.169
  142.93.11.193
+142.93.111.44
  142.93.112.194
  142.93.113.143
  142.93.113.159
@@ -40219,6 +41329,7 @@
  142.93.117.134
  142.93.118.23
  142.93.118.74
+142.93.120.149
  142.93.121.117
  142.93.121.236
  142.93.121.47
@@ -40227,7 +41338,6 @@
  142.93.123.239
  142.93.124.101
  142.93.124.237
-142.93.126.181
  142.93.130.169
  142.93.130.47
  142.93.131.1
@@ -40236,8 +41346,10 @@
  142.93.134.86
  142.93.135.171
  142.93.137.184
+142.93.138.116
  142.93.138.73
  142.93.139.122
+142.93.14.102
  142.93.142.192
  142.93.143.46
  142.93.143.85
@@ -40253,7 +41365,6 @@
  142.93.153.132
  142.93.153.184
  142.93.153.203
-142.93.154.212
  142.93.155.50
  142.93.156.197
  142.93.158.162
@@ -40276,6 +41387,7 @@
  142.93.172.106
  142.93.172.143
  142.93.172.157
+142.93.174.218
  142.93.174.231
  142.93.174.237
  142.93.179.2
@@ -40292,6 +41404,7 @@
  142.93.186.206
  142.93.187.179
  142.93.191.114
+142.93.191.61
  142.93.191.96
  142.93.192.43
  142.93.194.76
@@ -40325,11 +41438,11 @@
  142.93.213.210
  142.93.213.254
  142.93.214.86
-142.93.215.105
  142.93.215.19
  142.93.215.82
  142.93.216.251
  142.93.216.97
+142.93.217.121
  142.93.217.166
  142.93.217.221
  142.93.217.46
@@ -40344,6 +41457,7 @@
  142.93.223.19
  142.93.223.95
  142.93.224.234
+142.93.225.198
  142.93.225.68
  142.93.228.111
  142.93.23.235
@@ -40380,7 +41494,9 @@
  142.93.250.60
  142.93.251.1
  142.93.252.120
+142.93.253.189
  142.93.254.122
+142.93.254.126
  142.93.255.200
  142.93.3.11
  142.93.3.119
@@ -40390,6 +41506,7 @@
  142.93.34.237
  142.93.35.169
  142.93.35.230
+142.93.36.160
  142.93.37.1
  142.93.37.178
  142.93.38.61
@@ -40416,6 +41533,8 @@
  142.93.58.103
  142.93.58.97
  142.93.6.38
+142.93.62.119
+142.93.62.231
  142.93.62.240
  142.93.65.199
  142.93.65.72
@@ -40442,7 +41561,6 @@
  142.93.79.125
  142.93.8.147
  142.93.8.99
-142.93.83.242
  142.93.85.123
  142.93.85.97
  142.93.89.38
@@ -40464,6 +41582,7 @@
  143.0.149.90
  143.0.151.121
  143.0.166.136
+143.0.166.201
  143.0.167.23
  143.0.177.198
  143.0.178.142
@@ -40488,7 +41607,6 @@
  143.110.147.245
  143.110.147.246
  143.110.147.247
-143.110.148.137
  143.110.150.192
  143.110.150.193
  143.110.150.82
@@ -40499,6 +41617,7 @@
  143.110.155.22
  143.110.157.100
  143.110.157.105
+143.110.157.157
  143.110.157.215
  143.110.158.129
  143.110.158.176
@@ -40525,6 +41644,8 @@
  143.110.170.213
  143.110.170.226
  143.110.170.237
+143.110.171.125
+143.110.171.191
  143.110.172.106
  143.110.172.116
  143.110.172.157
@@ -40691,6 +41812,7 @@
  143.110.230.80
  143.110.234.108
  143.110.234.233
+143.110.234.60
  143.110.236.102
  143.110.238.14
  143.110.238.163
@@ -40721,8 +41843,10 @@
  143.137.127.46
  143.137.130.1
  143.137.145.75
+143.137.147.3
  143.137.147.4
  143.137.180.83
+143.137.9.165
  143.159.73.211
  143.176.224.104
  143.178.139.0
@@ -40744,18 +41868,19 @@
  143.208.128.152
  143.208.128.175
  143.208.128.6
+143.208.137.42
  143.208.152.124
  143.208.180.249
-143.208.248.19
-143.208.57.60
+143.208.79.128
  143.215.130.33
  143.225.81.253
-143.244.43.158
+143.244.43.89
  143.244.54.103
+143.244.57.88
  143.248.144.60
-143.248.230.86
  143.255.116.2
  143.255.130.2
+143.255.140.204
  143.255.140.232
  143.255.142.80
  143.255.162.110
@@ -40764,15 +41889,19 @@
  143.255.2.167
  143.255.242.194
  143.255.243.221
+143.255.34.161
  143.255.40.106
  143.255.52.102
  143.255.52.195
  143.255.52.198
  143.255.52.67
+143.255.8.2
  143.255.87.117
  143.59.105.199
+143.59.208.91
  143.59.74.139
  143.89.60.134
+143.92.42.120
  143.92.43.159
  143.92.44.108
  143.92.51.100
@@ -40784,21 +41913,22 @@
  143.92.51.90
  143.92.51.91
  143.92.51.93
-143.92.53.28
  143.92.56.232
  143.92.57.144
  143.92.57.147
  143.92.57.149
  143.92.57.158
  143.92.57.175
+143.92.57.188
  143.92.57.196
+143.92.57.200
+143.92.57.221
  143.92.57.230
  143.92.61.230
  143.95.101.72
  143.95.156.174
  143.95.34.59
  144.121.29.100
-144.123.160.252
  144.123.160.254
  144.123.36.14
  144.123.5.178
@@ -40815,10 +41945,8 @@
  144.139.56.105
  144.139.91.187
  144.168.107.2
-144.168.138.208
-144.168.138.216
-144.168.138.22
  144.168.164.26
+144.168.188.1
  144.168.201.194
  144.168.201.204
  144.168.213.195
@@ -40826,6 +41954,7 @@
  144.168.230.66
  144.168.45.117
  144.168.56.130
+144.168.58.135
  144.168.62.196
  144.172.118.2
  144.172.118.3
@@ -40866,6 +41995,7 @@
  144.202.22.99
  144.202.27.223
  144.202.28.66
+144.202.30.31
  144.202.37.170
  144.202.54.86
  144.202.58.62
@@ -40929,7 +42059,6 @@
  144.217.29.74
  144.217.34.148
  144.217.34.151
-144.217.39.93
  144.217.40.115
  144.217.50.88
  144.217.54.7
@@ -40952,19 +42081,25 @@
  144.217.87.197
  144.217.89.55
  144.22.102.26
+144.22.108.33
+144.22.98.225
  144.224.27.66
  144.255.240.113
  144.255.31.121
+144.255.31.240
  144.34.130.253
+144.34.136.215
  144.34.144.21
  144.34.161.44
  144.34.161.65
  144.34.162.249
  144.34.163.191
  144.34.165.26
+144.34.170.117
  144.34.172.159
  144.34.172.241
  144.34.178.15
+144.34.178.219
  144.34.178.90
  144.34.182.70
  144.34.184.20
@@ -40977,6 +42112,7 @@
  144.34.196.101
  144.34.201.197
  144.34.203.73
+144.34.207.84
  144.34.226.207
  144.34.234.6
  144.34.240.47
@@ -40986,7 +42122,6 @@
  144.48.109.180
  144.48.109.182
  144.48.123.4
-144.48.151.74
  144.48.165.206
  144.48.168.121
  144.48.168.124
@@ -41018,6 +42153,7 @@
  144.52.178.225
  144.64.12.241
  144.64.131.110
+144.64.146.105
  144.64.5.177
  144.76.1.155
  144.76.1.20
@@ -41037,7 +42173,6 @@
  144.76.13.207
  144.76.134.212
  144.76.136.174
-144.76.14.153
  144.76.15.207
  144.76.15.232
  144.76.15.240
@@ -41051,7 +42186,6 @@
  144.76.176.150
  144.76.176.195
  144.76.176.72
-144.76.179.71
  144.76.185.71
  144.76.19.144
  144.76.19.35
@@ -41126,18 +42260,21 @@
  144.91.69.193
  144.91.70.224
  144.91.71.27
+144.91.72.11
  144.91.73.41
  144.91.77.184
  144.91.78.148
-144.91.81.237
  144.91.82.22
+144.91.83.122
  144.91.83.174
+144.91.84.50
  144.91.87.106
  144.91.87.159
  144.91.88.183
  144.91.90.131
  144.91.90.25
  144.91.95.185
+144.91.97.48
  1441518k4-85975353079.us-south.cf.appdomain.cloud
  1445.3190cfdae.com
  145-365.net
@@ -41216,11 +42353,13 @@
  145.239.82.142
  145.239.82.147
  145.239.82.168
+145.239.82.174
  145.239.82.192
  145.239.82.229
  145.239.82.87
  145.239.85.21
  145.239.86.217
+145.239.87.224
  145.239.87.35
  145.239.88.43
  145.239.89.111
@@ -41234,6 +42373,7 @@
  145.239.95.15
  145.239.95.219
  145.239.95.241
+145.239.95.9
  145.24.145.107
  145.249.104.36
  145.249.105.152
@@ -41241,42 +42381,23 @@
  145.249.106.174
  145.249.107.19
  145.249.107.35
+145.249.143.70
  145.249.153.223
-145.249.196.41
-145.249.218.35
  145.253.118.157
  145.253.133.50
  145.255.0.61
-145.255.1.147
  145.255.1.44
-145.255.160.132
-145.255.160.141
-145.255.160.225
-145.255.162.21
-145.255.163.167
-145.255.163.39
-145.255.163.47
-145.255.165.99
-145.255.166.201
-145.255.168.193
-145.255.168.209
-145.255.172.74
-145.255.173.54
-145.255.178.155
-145.255.178.199
-145.255.180.139
-145.255.181.199
  145.255.2.11
  145.255.2.211
+145.255.2.62
  145.255.202.115
  145.255.248.151
+145.255.27.194
  145.255.28.122
  145.255.28.2
-145.255.3.133
  145.255.3.134
  145.255.4.150
  145.255.4.251
-145.255.8.75
  145.255.9.178
  145.31cf4fdae.com
  145.40.27.154
@@ -41286,6 +42407,7 @@
  14577.000webhostapp.com
  146.0.36.43
  146.0.36.52
+146.0.41.70
  146.0.43.105
  146.0.43.107
  146.0.72.68
@@ -41303,7 +42425,6 @@
  146.0.78.124
  146.0.78.51
  146.115.166.2
-146.115.218.33
  146.115.25.217
  146.115.40.98
  146.115.58.159
@@ -41314,7 +42435,6 @@
  146.120.173.38
  146.120.197.77
  146.120.215.106
-146.120.233.126
  146.148.101.151
  146.148.114.236
  146.148.122.132
@@ -41337,7 +42457,9 @@
  146.185.128.226
  146.185.129.107
  146.185.129.182
+146.185.129.216
  146.185.130.101
+146.185.130.195
  146.185.130.42
  146.185.131.234
  146.185.131.246
@@ -41450,6 +42572,7 @@
  146.185.200.246
  146.185.200.247
  146.185.200.248
+146.185.200.251
  146.185.200.28
  146.185.200.29
  146.185.200.30
@@ -41463,6 +42586,7 @@
  146.185.200.54
  146.185.200.55
  146.185.200.60
+146.185.200.61
  146.185.200.65
  146.185.200.69
  146.185.200.73
@@ -41471,12 +42595,13 @@
  146.185.200.81
  146.185.200.83
  146.185.200.85
+146.185.200.86
  146.185.200.90
  146.185.200.93
-146.185.200.94
  146.185.200.95
  146.185.200.96
  146.185.200.98
+146.185.200.99
  146.185.201.127
  146.185.201.142
  146.185.201.18
@@ -41495,16 +42620,15 @@
  146.185.202.69
  146.185.202.94
  146.185.203.101
-146.185.203.105
  146.185.203.180
  146.185.203.188
-146.185.203.192
  146.185.203.97
  146.185.204.25
  146.185.204.27
  146.185.204.54
  146.185.204.59
  146.185.205.27
+146.185.205.91
  146.185.214.29
  146.185.239.100
  146.185.251.188
@@ -41532,8 +42656,9 @@
  146.20.227.248
  146.20.66.233
  146.200.212.195
-146.200.45.158
  146.212.10.4
+146.212.39.86
+146.241.176.20
  146.241.39.245
  146.247.154.181
  146.247.158.29
@@ -41545,14 +42670,11 @@
  146.255.24.28
  146.255.81.98
  146.255.96.214
-146.52.105.176
  146.52.206.114
  146.52.47.20
-146.52.61.38
  146.56.192.231
  146.56.193.203
  146.56.195.191
-146.56.196.229
  146.56.197.217
  146.56.198.229
  146.56.198.246
@@ -41581,7 +42703,6 @@
  146.59.160.240
  146.59.196.157
  146.59.196.27
-146.59.196.83
  146.59.217.53
  146.59.225.194
  146.59.225.195
@@ -41594,7 +42715,6 @@
  146.59.236.152
  146.59.236.232
  146.59.3.161
-146.66.194.20
  146.67.141.87
  146.71.112.18
  146.71.77.244
@@ -41604,6 +42724,7 @@
  146.83.216.186
  146.83.222.25
  146.88.240.4
+146.88.36.27
  146.88.78.130
  146.90.146.33
  1469-squid.com
@@ -41636,8 +42757,9 @@
  147.135.207.246
  147.135.211.127
  147.135.211.73
+147.135.243.12
  147.135.246.41
-147.135.250.197
+147.135.250.204
  147.135.250.206
  147.135.252.43
  147.135.3.105
@@ -41646,30 +42768,30 @@
  147.135.6.179
  147.135.73.114
  147.135.76.206
+147.135.86.106
  147.135.93.133
  147.139.132.12
  147.139.135.159
  147.139.135.212
  147.139.138.116
-147.139.160.218
-147.139.172.122
+147.139.168.137
  147.139.174.94
  147.139.176.65
+147.139.177.71
  147.139.180.189
-147.139.183.18
  147.139.189.77
-147.139.192.232
-147.139.30.245
  147.139.31.203
  147.139.32.95
  147.139.33.149
+147.139.33.16
  147.139.34.137
+147.139.34.238
  147.139.34.79
+147.139.36.235
  147.139.5.191
  147.139.6.41
  147.139.6.81
  147.147.84.219
-147.148.45.108
  147.158.237.114
  147.194.100.74
  147.194.13.44
@@ -41680,44 +42802,22 @@
  147.231.106.250
  147.234.97.93
  147.27.70.36
-147.30.100.88
-147.30.102.224
-147.30.108.214
-147.30.118.201
-147.30.122.253
-147.30.122.75
-147.30.123.102
-147.30.136.149
-147.30.160.177
-147.30.163.77
-147.30.169.104
-147.30.169.49
-147.30.172.166
-147.30.179.223
-147.30.221.44
-147.30.226.170
-147.30.228.116
  147.30.239.135
-147.30.252.88
-147.30.254.104
-147.30.30.108
-147.30.70.122
  147.30.86.111
-147.30.86.180
  147.30.86.84
  147.30.92.143
  147.30.95.240
  147.30.99.10
  147.46.40.220
  147.75.113.110
-147.75.115.194
  147.75.118.226
  147.75.118.231
-147.75.118.236
+147.75.118.239
  147.75.124.130
  147.75.47.199
-147.78.160.2
+147.78.65.184
  147.78.65.253
+147.78.66.149
  147.78.66.172
  147.83.195.55
  147.91.111.17
@@ -41733,6 +42833,8 @@
  148.0.45.180
  148.0.59.253
  148.0.84.6
+148.101.164.120
+148.101.229.107
  148.101.25.205
  148.101.66.160
  148.102.22.76
@@ -41754,8 +42856,10 @@
  148.163.168.6
  148.163.169.46
  148.170.212.44
+148.204.63.209
  148.204.63.249
  148.208.248.227
+148.212.19.74
  148.216.17.38
  148.217.94.54
  148.222.45.3
@@ -41780,12 +42884,10 @@
  148.243.72.112
  148.244.120.105
  148.245.13.21
-148.247.186.119
  148.251.105.254
  148.251.110.53
  148.251.110.54
  148.251.12.132
-148.251.12.252
  148.251.124.172
  148.251.131.164
  148.251.136.130
@@ -41793,13 +42895,13 @@
  148.251.144.116
  148.251.144.220
  148.251.155.70
+148.251.157.41
  148.251.178.165
  148.251.178.72
  148.251.18.67
  148.251.186.234
  148.251.186.36
  148.251.19.205
-148.251.195.249
  148.251.198.217
  148.251.2.82
  148.251.208.48
@@ -41829,16 +42931,14 @@
  148.255.76.53
  148.56.84.67
  148.59.220.62
-148.63.106.55
  148.63.215.173
  148.66.128.38
  148.66.129.112
-148.66.129.116
  148.66.129.194
  148.66.132.190
  148.66.133.24
-148.66.135.227
  148.66.142.135
+148.66.143.140
  148.66.143.78
  148.66.145.10
  148.66.145.132
@@ -41847,7 +42947,6 @@
  148.66.146.23
  148.66.146.42
  148.66.147.12
-148.66.147.22
  148.66.147.35
  148.66.17.82
  148.66.22.227
@@ -41859,7 +42958,6 @@
  148.66.57.194
  148.66.57.195
  148.66.58.138
-148.66.58.146
  148.66.59.82
  148.66.62.114
  148.66.63.202
@@ -41875,9 +42973,7 @@
  148.70.14.121
  148.70.14.124
  148.70.149.39
-148.70.152.56
  148.70.153.21
-148.70.157.93
  148.70.160.127
  148.70.171.31
  148.70.173.252
@@ -41896,7 +42992,7 @@
  148.70.38.183
  148.70.52.161
  148.70.53.219
-148.70.7.149
+148.70.53.92
  148.70.70.55
  148.70.84.202
  148.70.89.212
@@ -41925,17 +43021,15 @@
  148.72.232.104
  148.72.232.125
  148.72.232.128
-148.72.232.133
  148.72.232.141
  148.72.232.154
  148.72.232.35
  148.72.232.36
-148.72.232.37
  148.72.232.63
+148.72.248.42
  148.72.64.192
  148.72.65.173
  148.72.65.90
-148.72.74.77
  148.74.192.37
  148.74.235.233
  148.75.47.66
@@ -41952,36 +43046,41 @@
  149.12.223.69
  149.129.101.217
  149.129.102.110
+149.129.129.253
  149.129.131.134
-149.129.134.59
  149.129.136.24
-149.129.137.193
  149.129.138.104
+149.129.139.238
  149.129.182.60
  149.129.184.49
-149.129.186.134
  149.129.190.133
  149.129.191.205
+149.129.191.24
+149.129.191.88
  149.129.222.49
-149.129.222.54
  149.129.222.60
-149.129.232.41
+149.129.226.135
+149.129.236.226
  149.129.236.66
-149.129.241.106
+149.129.237.83
+149.129.242.144
  149.129.244.23
-149.129.245.133
+149.129.246.35
  149.129.255.214
  149.129.255.55
  149.129.39.164
+149.129.41.70
  149.129.50.175
  149.129.52.21
  149.129.53.156
-149.129.57.134
+149.129.57.246
+149.129.62.226
  149.129.68.143
  149.129.69.148
  149.129.90.72
  149.129.92.91
  149.129.95.189
+149.140.20.100
  149.140.21.120
  149.140.244.78
  149.147.27.219
@@ -41997,18 +43096,19 @@
  149.200.20.1
  149.200.212.227
  149.200.221.57
-149.200.226.124
+149.200.226.72
  149.200.237.199
  149.200.244.120
  149.200.244.160
  149.200.251.0
+149.200.27.201
  149.202.103.119
+149.202.103.250
  149.202.110.47
  149.202.115.212
  149.202.115.3
  149.202.12.9
  149.202.125.153
-149.202.136.235
  149.202.148.4
  149.202.160.188
  149.202.160.192
@@ -42034,12 +43134,13 @@
  149.202.206.206
  149.202.208.203
  149.202.214.142
-149.202.223.106
  149.202.238.204
  149.202.243.52
  149.202.247.161
  149.202.29.73
+149.202.3.113
  149.202.38.124
+149.202.41.25
  149.202.42.188
  149.202.44.177
  149.202.45.11
@@ -42049,7 +43150,6 @@
  149.202.48.192
  149.202.48.246
  149.202.50.155
-149.202.52.152
  149.202.54.225
  149.202.55.18
  149.202.56.228
@@ -42075,8 +43175,8 @@
  149.210.189.102
  149.210.197.202
  149.224.103.233
+149.224.123.138
  149.224.124.110
-149.224.159.110
  149.224.166.192
  149.224.237.253
  149.224.241.236
@@ -42084,6 +43184,7 @@
  149.224.25.207
  149.224.55.31
  149.224.63.162
+149.224.82.228
  149.224.91.42
  149.248.10.11
  149.248.13.187
@@ -42099,25 +43200,22 @@
  149.255.35.91
  149.255.36.133
  149.255.62.89
-149.27.188.193
-149.27.241.249
  149.28.101.114
  149.28.112.35
  149.28.113.236
  149.28.117.43
  149.28.118.60
  149.28.13.243
-149.28.130.42
  149.28.132.200
  149.28.132.214
  149.28.132.27
  149.28.137.189
  149.28.137.208
-149.28.145.158
  149.28.149.164
+149.28.149.236
  149.28.149.39
  149.28.150.224
-149.28.151.102
+149.28.157.229
  149.28.157.237
  149.28.159.30
  149.28.16.146
@@ -42140,10 +43238,10 @@
  149.28.24.180
  149.28.247.47
  149.28.25.15
+149.28.26.222
  149.28.29.196
  149.28.30.77
  149.28.39.130
-149.28.40.255
  149.28.43.92
  149.28.46.48
  149.28.54.28
@@ -42157,7 +43255,6 @@
  149.28.92.61
  149.28.94.217
  149.29.2.107
-149.3.110.19
  149.3.110.195
  149.3.110.97
  149.3.124.112
@@ -42180,7 +43277,6 @@
  149.3.73.225
  149.3.73.233
  149.3.73.242
-149.3.85.218
  149.3.85.236
  149.3.85.245
  149.3.85.252
@@ -42201,6 +43297,7 @@
  149.56.115.99
  149.56.12.88
  149.56.128.135
+149.56.129.68
  149.56.13.111
  149.56.130.248
  149.56.131.140
@@ -42211,6 +43308,7 @@
  149.56.141.170
  149.56.142.1
  149.56.147.33
+149.56.15.136
  149.56.15.98
  149.56.151.196
  149.56.170.37
@@ -42231,9 +43329,7 @@
  149.56.28.5
  149.56.28.9
  149.56.29.118
-149.56.31.218
  149.56.41.33
-149.56.44.101
  149.56.44.47
  149.56.45.139
  149.56.47.75
@@ -42251,10 +43347,9 @@
  149.56.99.38
  149.62.172.62
  149.62.173.247
-149.62.41.142
-149.62.42.30
  149.7.16.100
  149.7.16.30
+149.7.217.27
  149.71.33.201
  149.74.120.231
  149.81.153.3
@@ -42263,6 +43358,8 @@
  149.90.194.82
  149.91.114.90
  149.91.80.7
+149.91.82.156
+149.91.98.248
  1493-security-dispatch.com
  14978.gucac.com
  149822-dot-n-e-w-me-ss-age-po-rt-al.wl.r.appspot.com
@@ -42277,13 +43374,15 @@
  15.161.153.204
  15.161.212.232
  15.161.245.6
-15.161.33.29
  15.161.54.116
  15.161.90.31
  15.161.92.197
+15.161.99.250
  15.164.181.146
+15.164.200.10
  15.164.203.130
  15.164.227.112
+15.164.234.191
  15.164.237.203
  15.164.241.115
  15.164.241.150
@@ -42297,8 +43396,10 @@
  15.185.172.170
  15.185.182.162
  15.185.193.190
+15.185.204.163
  15.185.209.73
  15.188.193.9
+15.188.65.27
  15.206.136.186
  15.206.146.144
  15.206.159.210
@@ -42308,10 +43409,14 @@
  15.206.93.156
  15.207.108.70
  15.207.111.189
+15.207.112.138
  15.207.112.66
  15.207.116.17
  15.207.19.192
+15.207.19.34
  15.207.203.184
+15.207.247.178
+15.207.50.109
  15.223.114.10
  15.223.116.208
  15.223.30.154
@@ -42343,6 +43448,8 @@
  150.107.76.138
  150.107.77.12
  150.107.92.192
+150.107.92.215
+150.107.93.155
  150.109.100.65
  150.109.102.177
  150.109.104.153
@@ -42350,7 +43457,10 @@
  150.109.113.116
  150.109.114.58
  150.109.118.237
+150.109.12.207
+150.109.12.71
  150.109.120.253
+150.109.123.35
  150.109.13.121
  150.109.145.113
  150.109.146.235
@@ -42395,6 +43505,7 @@
  150.109.170.73
  150.109.170.84
  150.109.170.97
+150.109.18.221
  150.109.180.100
  150.109.180.125
  150.109.180.126
@@ -42454,12 +43565,15 @@
  150.109.37.160
  150.109.39.220
  150.109.47.167
+150.109.49.174
  150.109.5.248
  150.109.5.82
  150.109.50.64
+150.109.52.213
  150.109.57.135
  150.109.57.43
  150.109.6.251
+150.109.6.69
  150.109.61.134
  150.109.63.146
  150.109.63.204
@@ -42467,6 +43581,7 @@
  150.109.76.59
  150.109.82.109
  150.109.84.143
+150.109.93.101
  150.109.93.241
  150.109.99.243
  150.109.99.68
@@ -42488,19 +43603,16 @@
  150.129.178.194
  150.129.182.164
  150.129.201.30
-150.129.206.72
  150.129.239.44
  150.129.250.28
  150.129.52.74
  150.129.54.111
  150.129.56.138
-150.129.58.190
  150.129.63.162
  150.129.8.10
  150.129.8.32
  150.129.8.7
  150.136.10.63
-150.136.101.219
  150.136.105.202
  150.136.116.126
  150.136.12.174
@@ -42514,6 +43626,7 @@
  150.136.145.88
  150.136.152.190
  150.136.160.141
+150.136.169.139
  150.136.170.31
  150.136.176.53
  150.136.183.102
@@ -42524,11 +43637,9 @@
  150.136.210.196
  150.136.216.10
  150.136.220.58
-150.136.220.59
  150.136.224.69
  150.136.228.136
  150.136.228.138
-150.136.231.227
  150.136.238.124
  150.136.238.74
  150.136.240.70
@@ -42578,16 +43689,15 @@
  150.158.152.232
  150.158.152.244
  150.158.153.22
+150.158.153.58
  150.158.154.126
  150.158.155.236
  150.158.155.44
-150.158.155.52
  150.158.155.64
  150.158.156.160
  150.158.156.214
  150.158.157.29
  150.158.158.34
-150.158.159.248
  150.158.159.37
  150.158.161.133
  150.158.161.204
@@ -42617,11 +43727,14 @@
  150.158.175.122
  150.158.175.63
  150.158.176.98
+150.158.178.137
  150.158.179.35
  150.158.181.16
  150.158.185.227
  150.158.186.50
  150.158.187.126
+150.158.187.180
+150.158.193.244
  150.158.196.205
  150.158.198.131
  150.158.198.220
@@ -42634,7 +43747,6 @@
  150.158.6.42
  150.162.80.240
  150.165.74.41
-150.185.10.125
  150.185.8.180
  150.187.5.100
  150.203.186.145
@@ -42644,6 +43756,7 @@
  150.242.182.98
  150.242.185.17
  150.242.219.5
+150.242.22.235
  150.242.24.152
  150.242.249.193
  150.242.254.51
@@ -42667,6 +43780,7 @@
  150.95.131.174
  150.95.131.184
  150.95.132.74
+150.95.137.9
  150.95.138.39
  150.95.141.172
  150.95.148.208
@@ -42694,7 +43808,6 @@
  150.95.223.208
  150.95.223.41
  150.95.223.60
-150.95.24.237
  150.95.27.32
  150.95.31.150
  150.95.52.70
@@ -42713,13 +43826,15 @@
  151.0.56.202
  151.0.56.211
  151.0.56.78
-151.0.57.75
  151.0.58.129
  151.0.58.215
+151.0.59.30
  151.0.60.226
+151.0.60.242
  151.0.61.75
  151.0.62.159
  151.0.62.182
+151.0.62.233
  151.0.62.71
  151.0.62.73
  151.0.63.19
@@ -42731,7 +43846,6 @@
  151.101.1.21
  151.101.129.21
  151.101.193.21
-151.106.11.188
  151.106.13.150
  151.106.13.158
  151.106.15.42
@@ -42745,7 +43859,6 @@
  151.106.6.142
  151.106.62.86
  151.106.8.107
-151.106.8.108
  151.115.32.138
  151.115.32.139
  151.115.33.110
@@ -42754,6 +43867,7 @@
  151.115.36.190
  151.115.38.99
  151.115.39.166
+151.115.40.144
  151.115.40.252
  151.115.40.92
  151.115.43.144
@@ -42773,6 +43887,7 @@
  151.124.247.200
  151.13.11.231
  151.14.92.86
+151.15.86.210
  151.16.206.34
  151.177.108.50
  151.177.133.228
@@ -42783,12 +43898,9 @@
  151.177.225.150
  151.177.231.179
  151.177.63.86
-151.18.144.254
-151.18.175.24
  151.182.29.25
  151.182.44.17
-151.19.136.206
-151.19.19.231
+151.19.169.61
  151.19.56.20
  151.192.151.213
  151.192.225.191
@@ -42796,6 +43908,7 @@
  151.192.248.125
  151.196.57.128
  151.197.61.55
+151.20.142.88
  151.20.175.50
  151.20.232.201
  151.20.239.224
@@ -42805,26 +43918,21 @@
  151.205.182.125
  151.21.106.50
  151.21.168.138
-151.21.42.149
-151.21.51.234
  151.217.31.131
  151.224.130.168
  151.226.169.59
  151.227.87.117
  151.228.114.115
+151.229.251.112
+151.230.166.202
  151.231.130.16
-151.234.131.64
-151.234.140.96
-151.234.56.6
-151.235.211.236
-151.235.43.232
+151.234.26.128
+151.234.27.32
+151.234.28.169
  151.236.193.195
  151.236.218.195
-151.236.33.74
  151.236.34.161
-151.236.35.245
  151.236.38.234
-151.236.39.126
  151.236.58.222
  151.236.59.246
  151.236.60.57
@@ -42849,7 +43957,6 @@
  151.250.218.235
  151.250.37.41
  151.250.59.60
-151.252.105.136
  151.252.105.137
  151.252.105.138
  151.252.105.139
@@ -42867,30 +43974,37 @@
  151.27.31.107
  151.28.198.252
  151.28.223.141
-151.29.29.141
  151.30.225.52
  151.31.201.99
  151.32.248.136
-151.32.92.129
  151.33.122.242
-151.34.156.103
-151.34.238.241
-151.34.70.223
  151.35.1.149
+151.35.139.53
  151.35.83.239
-151.35.84.66
+151.36.11.37
+151.36.142.198
+151.36.148.17
+151.36.152.146
+151.36.184.109
  151.36.36.151
+151.37.187.22
+151.38.141.94
+151.38.171.159
+151.38.188.65
  151.40.125.91
  151.40.169.254
  151.41.110.41
  151.41.41.123
-151.43.186.117
  151.44.130.210
+151.45.115.0
+151.45.155.161
  151.46.0.245
+151.47.130.221
+151.47.205.94
  151.47.95.208
+151.48.111.68
  151.48.122.146
  151.48.136.222
-151.48.178.61
  151.49.118.123
  151.49.170.162
  151.49.177.185
@@ -42898,13 +44012,14 @@
  151.50.131.158
  151.50.142.80
  151.50.148.244
+151.50.167.10
  151.50.234.16
  151.50.241.50
-151.50.91.94
  151.50.96.141
  151.50.97.232
  151.51.121.187
  151.51.33.159
+151.52.123.214
  151.52.75.103
  151.52.85.159
  151.52.95.14
@@ -42912,15 +44027,16 @@
  151.55.84.241
  151.56.210.156
  151.56.218.210
+151.57.145.9
  151.57.159.180
+151.57.213.3
  151.60.1.201
-151.60.195.2
-151.60.251.105
-151.61.235.160
  151.61.86.157
  151.62.113.58
  151.62.121.83
+151.62.15.224
  151.62.73.247
+151.62.92.46
  151.64.204.75
  151.64.216.111
  151.64.25.29
@@ -42933,7 +44049,6 @@
  151.67.27.21
  151.67.41.68
  151.67.96.131
-151.68.146.162
  151.68.212.49
  151.69.170.146
  151.69.206.10
@@ -42960,7 +44075,6 @@
  151.77.160.229
  151.77.209.54
  151.77.5.171
-151.8.105.244
  151.8.98.66
  151.80.100.101
  151.80.108.200
@@ -42993,17 +44107,18 @@
  151.80.20.39
  151.80.201.162
  151.80.203.46
+151.80.209.134
  151.80.211.158
  151.80.212.34
  151.80.212.46
  151.80.230.21
-151.80.233.170
  151.80.237.96
  151.80.245.160
  151.80.248.125
  151.80.255.19
  151.80.26.227
  151.80.29.98
+151.80.34.123
  151.80.38.19
  151.80.40.72
  151.80.41.169
@@ -43016,16 +44131,17 @@
  151.80.61.159
  151.80.65.175
  151.80.70.167
+151.80.77.132
  151.80.80.7
  151.80.83.249
  151.80.9.153
  151.80.96.140
  151.80.99.2
-151.81.197.126
  151.81.198.254
  151.81.199.147
  151.81.199.26
  151.81.225.241
+151.84.135.188
  151.95.153.236
  151.95.76.15
  151.rs
@@ -43042,6 +44158,7 @@
  152.136.100.204
  152.136.101.207
  152.136.101.65
+152.136.102.101
  152.136.104.57
  152.136.107.36
  152.136.109.116
@@ -43052,25 +44169,33 @@
  152.136.114.118
  152.136.115.27
  152.136.116.72
+152.136.119.164
  152.136.121.150
  152.136.122.172
+152.136.124.150
  152.136.126.129
  152.136.128.30
-152.136.130.191
+152.136.130.13
  152.136.130.218
+152.136.130.29
  152.136.130.86
  152.136.131.171
  152.136.131.242
  152.136.133.34
  152.136.134.77
+152.136.137.227
  152.136.137.62
  152.136.139.71
+152.136.139.74
+152.136.143.44
  152.136.145.235
  152.136.145.25
  152.136.145.69
+152.136.148.36
  152.136.149.102
  152.136.149.160
  152.136.150.115
+152.136.150.219
  152.136.151.194
  152.136.151.70
  152.136.152.45
@@ -43078,6 +44203,7 @@
  152.136.165.226
  152.136.169.111
  152.136.169.198
+152.136.17.25
  152.136.170.159
  152.136.170.27
  152.136.173.246
@@ -43101,9 +44227,11 @@
  152.136.230.126
  152.136.232.25
  152.136.234.179
+152.136.237.229
  152.136.237.47
  152.136.252.216
  152.136.254.204
+152.136.30.135
  152.136.31.184
  152.136.34.209
  152.136.36.250
@@ -43111,9 +44239,7 @@
  152.136.90.196
  152.136.90.84
  152.136.96.220
-152.136.97.217
  152.136.98.80
-152.165.38.171
  152.168.232.142
  152.168.61.2
  152.169.106.145
@@ -43124,6 +44250,7 @@
  152.169.208.63
  152.169.22.67
  152.169.32.143
+152.169.48.128
  152.170.205.196
  152.170.65.133
  152.170.66.244
@@ -43143,12 +44270,14 @@
  152.207.234.2
  152.208.33.54
  152.231.102.229
+152.231.108.132
  152.231.120.179
  152.231.120.43
  152.231.140.150
  152.231.145.88
  152.231.164.98
  152.231.29.72
+152.231.68.18
  152.231.76.210
  152.231.80.106
  152.231.89.226
@@ -43157,7 +44286,10 @@
  152.237.74.251
  152.242.59.124
  152.243.181.3
+152.245.144.183
  152.245.211.62
+152.247.31.84
+152.247.86.47
  152.249.175.62
  152.250.243.148
  152.250.73.32
@@ -43167,44 +44299,57 @@
  152.32.112.194
  152.32.129.40
  152.32.130.79
+152.32.132.240
  152.32.133.119
+152.32.139.56
  152.32.144.204
  152.32.144.26
  152.32.150.8
+152.32.161.11
  152.32.161.94
+152.32.162.4
+152.32.165.88
+152.32.166.14
+152.32.167.129
+152.32.173.160
  152.32.175.24
  152.32.222.107
+152.32.223.180
+152.32.223.231
+152.32.223.89
  152.32.227.145
+152.32.229.70
  152.32.239.128
  152.32.240.104
  152.32.253.118
  152.32.64.105
  152.32.65.230
-152.32.75.71
+152.32.72.122
  152.32.75.74
  152.32.78.24
  152.32.98.141
  152.36.193.2
  152.36.194.14
-152.44.100.71
  152.44.107.15
  152.44.135.18
  152.65.45.28
  152.67.0.197
+152.67.10.125
  152.67.199.110
+152.67.224.67
+152.67.225.33
  152.67.24.187
  152.67.25.98
-152.67.30.187
  152.67.30.228
  152.67.35.185
  152.67.41.131
  152.67.46.245
  152.67.47.139
-152.67.47.146
+152.67.5.91
  152.67.54.32
  152.67.54.87
-152.67.63.172
  152.67.8.114
+152.89.160.118
  152.89.239.104
  152.89.239.115
  152.89.239.197
@@ -43219,6 +44364,7 @@
  153.101.128.174
  153.101.167.242
  153.101.226.188
+153.101.230.22
  153.101.232.10
  153.101.29.178
  153.101.37.132
@@ -43254,7 +44400,6 @@
  153.137.36.142
  153.142.49.250
  153.145.134.55
-153.149.184.190
  153.149.230.30
  153.149.36.61
  153.156.189.219
@@ -43262,10 +44407,10 @@
  153.162.163.56
  153.165.155.66
  153.165.86.103
+153.167.248.210
  153.168.51.231
  153.178.224.27
  153.183.25.24
-153.183.69.137
  153.189.170.182
  153.19.33.231
  153.2.224.50
@@ -43279,18 +44424,19 @@
  153.231.170.26
  153.246.90.133
  153.254.105.16
-153.254.157.90
  153.3.124.100
  153.3.124.234
+153.3.140.183
  153.3.37.6
  153.3.39.83
  153.3.45.8
  153.3.56.162
  153.3.99.51
  153.3.99.51bin.sh
+153.34.107.3
  153.34.131.59
  153.34.135.92
-153.34.184.177
+153.34.152.62
  153.34.224.224
  153.34.52.54
  153.34.65.168
@@ -43337,7 +44483,6 @@
  154.0.15.166
  154.0.168.252
  154.0.175.203
-154.0.27.142
  154.0.53.53
  154.0.7.58
  154.113.1.142
@@ -43349,12 +44494,12 @@
  154.117.155.42
  154.117.159.228
  154.117.176.102
-154.118.243.138
  154.118.52.188
  154.118.52.216
  154.118.55.42
  154.119.7.3
  154.119.79.254
+154.12.163.164
  154.120.101.147
  154.120.133.190
  154.120.217.250
@@ -43368,37 +44513,31 @@
  154.124.205.144
  154.124.227.30
  154.124.37.68
+154.124.78.131
  154.125.109.118
-154.125.124.67
+154.125.30.172
  154.126.32.138
  154.126.79.130
  154.127.120.18
-154.127.129.104
  154.127.251.224
-154.127.253.168
+154.127.253.176
  154.127.32.105
-154.127.42.23
-154.127.42.35
-154.127.43.232
  154.127.52.52
  154.127.82.66
-154.127.91.114
  154.16.0.201
  154.16.0.222
  154.16.113.203
  154.16.136.119
+154.16.136.73
  154.16.137.132
  154.16.138.48
  154.16.149.66
  154.16.168.6
  154.16.173.92
  154.16.2.197
-154.16.20.172
-154.16.202.141
  154.16.206.52
  154.16.206.66
  154.16.206.68
-154.16.206.8
  154.16.206.83
  154.16.226.187
  154.16.245.226
@@ -43421,28 +44560,35 @@
  154.16.49.148
  154.16.50.236
  154.16.53.182
+154.16.55.37
  154.16.61.75
  154.16.62.140
  154.16.89.54
+154.16.91.113
  154.16.91.19
-154.160.11.155
-154.160.16.220
-154.160.3.226
+154.160.19.202
+154.160.7.99
+154.179.42.23
  154.181.142.254
  154.196.199.8
  154.198.2.4
  154.20.182.195
-154.20.227.115
  154.20.248.160
  154.20.29.184
  154.20.3.240
  154.20.81.121
  154.20.94.22
  154.202.3.44
+154.204.10.246
  154.204.26.130
-154.204.30.168
  154.204.31.234
  154.204.50.16
+154.209.228.156
+154.209.228.222
+154.209.228.228
+154.209.228.237
+154.209.228.244
+154.209.228.247
  154.209.235.21
  154.209.4.178
  154.209.4.76
@@ -43450,6 +44596,7 @@
  154.209.69.123
  154.209.72.179
  154.209.77.59
+154.211.13.133
  154.211.14.244
  154.211.7.19
  154.212.191.35
@@ -43705,28 +44852,38 @@
  154.216.55.254
  154.219.216.194
  154.220.3.218
+154.221.1.129
  154.221.16.143
+154.221.17.184
  154.221.17.208
+154.221.17.32
  154.221.18.237
+154.221.19.204
  154.221.22.233
+154.221.22.236
  154.221.23.18
+154.221.23.210
  154.221.23.90
  154.221.24.5
  154.221.24.65
  154.221.25.187
  154.221.255.86
  154.221.27.21
+154.221.27.28
  154.221.28.2
  154.221.28.49
  154.221.30.164
  154.221.30.173
  154.223.189.86
+154.238.161.171
+154.27.69.112
  154.27.72.103
  154.27.72.195
  154.27.77.196
  154.27.78.81
  154.27.92.61
-154.28.188.239
+154.28.188.163
+154.28.188.80
  154.3.44.166
  154.34.24.212
  154.41.3.166
@@ -43736,20 +44893,22 @@
  154.48.241.25
  154.48.251.89
  154.57.193.2
+154.57.3.132
  154.58.22.18
  154.58.23.3bin.sh
  154.61.227.8
  154.62.250.61
  154.62.250.81
  154.65.14.19
+154.65.80.8
  154.66.107.148
  154.66.107.189
  154.66.109.105
  154.66.11.89
+154.66.110.216
  154.66.122.130
  154.66.122.90
  154.66.125.18
-154.66.170.106
  154.66.193.57
  154.66.198.186
  154.66.208.12
@@ -43761,9 +44920,11 @@
  154.67.93.185
  154.68.195.101
  154.68.195.194
+154.68.4.197
  154.68.49.86
  154.68.5.45
  154.68.5.49
+154.70.115.215
  154.70.116.130
  154.70.153.175
  154.70.158.97
@@ -43792,7 +44953,6 @@
  154.73.137.157
  154.73.141.126
  154.73.159.138
-154.73.167.21
  154.73.175.193
  154.73.65.142
  154.73.84.37
@@ -43812,9 +44972,9 @@
  154.79.248.124
  154.79.250.100
  154.79.250.161
+154.79.251.102
  154.79.252.214
  154.79.252.234
-154.79.252.70
  154.79.252.72
  154.79.254.112
  154.79.254.152
@@ -43825,6 +44985,7 @@
  154.79.254.176
  154.79.254.206
  154.8.137.54
+154.8.144.203
  154.8.146.181
  154.8.147.238
  154.8.149.6
@@ -43846,42 +45007,63 @@
  154.8.232.15
  154.8.232.212
  154.8.232.34
+154.8.234.34
+154.83.12.107
  154.83.12.129
  154.83.12.242
  154.83.13.81
+154.83.14.164
  154.83.15.83
  154.83.15.91
  154.83.16.122
+154.83.16.140
+154.83.16.63
+154.83.17.163
  154.85.48.163
  154.85.48.57
+154.85.49.196
  154.85.49.245
  154.85.50.185
  154.85.52.187
+154.85.52.23
+154.85.53.217
  154.85.55.104
+154.85.55.141
+154.85.55.187
  154.85.56.150
-154.86.16.212
+154.85.57.68
  154.86.2.141
+154.86.24.250
+154.89.75.44
  154.90.14.41
  154.91.144.44
-154.91.146.158
+154.91.148.89
  154.91.2.187
  154.91.33.137
+154.92.14.131
+154.92.14.211
+154.92.14.85
  154.92.15.95
  154.92.16.191
+154.92.17.129
+154.92.17.192
  154.92.18.41
+154.92.19.140
  154.92.23.198
  154.92.99.51
  154.93.2.32
+154.93.5.190
+154.94.5.212
  155.0.161.250
  155.0.181.254
  155.0.202.254
  155.0.253.135
  155.0.54.15
  155.12.20.182
-155.12.21.118
  155.133.129.18
  155.133.131.208
  155.133.18.45
+155.133.4.195
  155.133.83.1
  155.133.83.109
  155.133.83.117
@@ -43891,11 +45073,12 @@
  155.133.83.45
  155.133.83.61
  155.138.135.29
-155.138.142.100
  155.138.147.151
+155.138.154.145
  155.138.154.184
  155.138.160.156
  155.138.160.98
+155.138.175.7
  155.138.197.254
  155.138.198.164
  155.138.201.126
@@ -43906,10 +45089,14 @@
  155.138.224.233
  155.138.234.174
  155.138.237.187
+155.159.252.25
+155.186.173.67
+155.186.65.230
  155.186.9.160
  155.230.107.91
  155.230.28.190
  155.235.2.132
+155.235.245.46
  155.254.28.168
  155.254.35.8
  155.254.49.4
@@ -43923,28 +45110,30 @@
  155.4.221.154
  155.4.221.222
  155.4.222.95
+155.4.234.183
  155.4.240.169
  155.4.28.243
  155.4.61.15
  155.4.70.11
  155.4.86.196
+155.4.90.200
  155.93.108.170
  155.93.109.218
  155.93.181.238
-155.94.128.249
  155.94.131.150
+155.94.134.152
+155.94.144.58
  155.94.145.193
-155.94.171.102
+155.94.149.156
  155.94.171.103
-155.94.171.112
  155.94.171.122
  155.94.171.97
  155.94.182.121
  155.94.184.179
-155.94.215.130
+155.94.196.144
+155.94.196.171
  155.94.220.148
  155.94.224.207
-155.94.243.43
  155.94.250.167
  155.94.252.252
  155.94.67.7
@@ -43960,7 +45149,6 @@
  156.146.36.205
  156.146.54.83
  156.146.55.183
-156.146.55.196
  156.146.57.38
  156.146.60.103
  156.155.163.232
@@ -43968,21 +45156,24 @@
  156.17.15.61
  156.19.19.90
  156.19.245.75
+156.194.221.111
  156.194.25.108
  156.194.34.36
  156.195.199.76
  156.196.198.201
-156.201.156.98
  156.204.192.18
+156.205.162.223
  156.205.208.190
  156.208.177.199
  156.212.108.176
  156.212.111.228
  156.212.155.138
+156.213.120.61
  156.213.78.128
  156.215.103.154
  156.217.5.182
  156.218.139.246
+156.218.16.67
  156.218.180.42
  156.218.96.167
  156.219.87.189
@@ -43990,35 +45181,48 @@
  156.222.189.247
  156.223.27.113
  156.225.6.226
+156.227.25.168
  156.230.55.124
  156.230.55.158
  156.231.36.134
  156.232.7.221
  156.236.106.214
+156.236.69.234
+156.236.70.37
  156.236.70.73
  156.236.70.79
  156.236.71.155
+156.236.72.209
  156.236.73.68
-156.239.153.86
  156.241.5.190
-156.247.1.106
  156.247.12.158
  156.247.12.78
  156.247.12.91
  156.247.14.227
+156.247.14.248
  156.251.125.148
  156.253.68.71
  156.255.213.198
  156.34.177.80
-156.38.117.242
+156.34.37.0
  156.38.137.42
+156.54.102.1
+156.54.109.225
+156.54.122.60
  156.54.148.152
+156.54.164.97
+156.54.169.143
+156.54.169.159
+156.54.170.112
+156.54.170.71
+156.54.174.197
  156.54.177.131
  156.57.208.14
  156.67.106.36
-156.67.115.5
  156.67.214.80
+156.67.217.63
  156.67.221.92
+156.96.107.216
  156.96.107.219
  156.96.107.230
  156.96.107.247
@@ -44029,12 +45233,10 @@
  156.96.113.131
  156.96.114.195
  156.96.114.73
-156.96.115.151
  156.96.117.151
  156.96.117.158
  156.96.117.160
  156.96.117.164
-156.96.117.166
  156.96.117.183
  156.96.117.204
  156.96.118.160
@@ -44066,7 +45268,6 @@
  156.96.156.138
  156.96.156.218
  156.96.156.24
-156.96.156.240
  156.96.156.246
  156.96.156.248
  156.96.156.48
@@ -44074,6 +45275,7 @@
  156.96.156.75
  156.96.157.99
  156.96.44.167
+156.96.45.105
  156.96.45.165
  156.96.46.122
  156.96.46.203
@@ -44089,9 +45291,11 @@
  156.96.56.12
  156.96.56.180
  156.96.56.184
+156.96.56.21
  156.96.56.29
  156.96.56.3
  156.96.56.35
+156.96.56.46
  156.96.56.71
  156.96.56.84
  156.96.56.9
@@ -44113,8 +45317,6 @@
  157.0.234.132
  157.100.230.82
  157.119.117.22
-157.119.121.161
-157.119.186.114
  157.119.186.174
  157.119.207.10
  157.119.207.13
@@ -44132,6 +45334,7 @@
  157.119.50.70
  157.119.50.74
  157.119.83.234
+157.122.183.220
  157.13.61.66
  157.13.61.69
  157.13.61.72
@@ -44182,11 +45385,9 @@
  157.185.177.66
  157.185.179.115
  157.185.179.66
-157.185.179.67
  157.185.179.73
  157.185.179.87
  157.191.147.146
-157.230.1.103
  157.230.1.157
  157.230.100.192
  157.230.103.189
@@ -44196,6 +45397,7 @@
  157.230.11.65
  157.230.112.195
  157.230.114.180
+157.230.115.150
  157.230.117.175
  157.230.118.118
  157.230.12.231
@@ -44205,6 +45407,7 @@
  157.230.125.204
  157.230.125.207
  157.230.128.135
+157.230.13.169
  157.230.13.99
  157.230.131.34
  157.230.132.100
@@ -44223,8 +45426,9 @@
  157.230.164.216
  157.230.166.98
  157.230.176.138
-157.230.176.48
  157.230.180.148
+157.230.180.187
+157.230.182.14
  157.230.183.169
  157.230.184.206
  157.230.185.182
@@ -44238,11 +45442,13 @@
  157.230.2.161
  157.230.2.178
  157.230.2.208
+157.230.208.124
  157.230.209.141
  157.230.210.74
  157.230.211.169
  157.230.211.219
  157.230.212.45
+157.230.214.116
  157.230.214.244
  157.230.215.2
  157.230.215.87
@@ -44262,6 +45468,7 @@
  157.230.227.248
  157.230.227.94
  157.230.228.171
+157.230.229.156
  157.230.229.23
  157.230.230.152
  157.230.230.183
@@ -44279,6 +45486,7 @@
  157.230.238.19
  157.230.238.91
  157.230.239.99
+157.230.24.226
  157.230.24.80
  157.230.240.140
  157.230.240.157
@@ -44288,6 +45496,7 @@
  157.230.243.22
  157.230.244.19
  157.230.244.46
+157.230.245.243
  157.230.245.91
  157.230.247.57
  157.230.248.89
@@ -44312,6 +45521,7 @@
  157.230.31.237
  157.230.33.158
  157.230.36.200
+157.230.36.55
  157.230.37.52
  157.230.38.102
  157.230.38.176
@@ -44320,10 +45530,10 @@
  157.230.41.225
  157.230.42.11
  157.230.42.155
+157.230.42.76
  157.230.43.113
  157.230.43.40
  157.230.45.31
-157.230.46.103
  157.230.46.26
  157.230.46.86
  157.230.47.143
@@ -44348,15 +45558,19 @@
  157.230.81.78
  157.230.82.112
  157.230.82.214
+157.230.83.142
+157.230.83.80
  157.230.84.139
  157.230.85.106
  157.230.89.219
  157.230.9.227
+157.230.9.242
  157.230.90.16
  157.230.92.129
  157.230.93.237
  157.230.93.62
  157.230.94.83
+157.230.95.244
  157.230.96.179
  157.231.102.250
  157.231.110.14
@@ -44371,7 +45585,9 @@
  157.245.103.90
  157.245.104.163
  157.245.104.19
+157.245.105.81
  157.245.106.153
+157.245.108.109
  157.245.108.35
  157.245.109.222
  157.245.111.122
@@ -44385,6 +45601,7 @@
  157.245.127.232
  157.245.13.160
  157.245.130.232
+157.245.130.4
  157.245.130.55
  157.245.133.123
  157.245.134.132
@@ -44392,12 +45609,14 @@
  157.245.137.145
  157.245.137.179
  157.245.139.201
+157.245.139.224
  157.245.140.204
  157.245.140.49
  157.245.140.69
  157.245.140.86
  157.245.143.47
  157.245.150.18
+157.245.154.123
  157.245.16.168
  157.245.160.108
  157.245.160.163
@@ -44411,6 +45630,7 @@
  157.245.162.63
  157.245.163.0
  157.245.164.148
+157.245.164.4
  157.245.164.84
  157.245.165.131
  157.245.166.156
@@ -44419,6 +45639,7 @@
  157.245.168.191
  157.245.168.24
  157.245.168.35
+157.245.168.85
  157.245.170.125
  157.245.172.147
  157.245.172.236
@@ -44439,7 +45660,6 @@
  157.245.182.234
  157.245.182.63
  157.245.182.75
-157.245.183.140
  157.245.184.13
  157.245.184.148
  157.245.184.96
@@ -44456,17 +45676,25 @@
  157.245.190.108
  157.245.190.146
  157.245.190.172
+157.245.190.177
  157.245.190.86
+157.245.192.230
+157.245.194.145
  157.245.194.231
+157.245.196.164
+157.245.196.56
+157.245.198.120
  157.245.198.64
  157.245.201.119
+157.245.201.232
  157.245.203.130
+157.245.204.142
+157.245.204.149
  157.245.208.152
  157.245.211.1
  157.245.211.180
  157.245.212.8
  157.245.213.225
-157.245.214.204
  157.245.217.198
  157.245.218.105
  157.245.220.153
@@ -44478,6 +45706,7 @@
  157.245.227.84
  157.245.231.62
  157.245.232.243
+157.245.232.85
  157.245.233.164
  157.245.235.243
  157.245.236.3
@@ -44491,7 +45720,10 @@
  157.245.243.14
  157.245.244.123
  157.245.244.127
+157.245.244.202
  157.245.245.159
+157.245.249.154
+157.245.249.158
  157.245.249.232
  157.245.250.10
  157.245.250.251
@@ -44500,13 +45732,13 @@
  157.245.252.5
  157.245.253.142
  157.245.253.245
+157.245.255.113
  157.245.3.152
  157.245.32.33
  157.245.32.41
  157.245.35.47
  157.245.37.203
  157.245.39.243
-157.245.42.253
  157.245.45.99
  157.245.46.171
  157.245.5.133
@@ -44524,6 +45756,7 @@
  157.245.68.204
  157.245.69.103
  157.245.69.233
+157.245.70.68
  157.245.72.129
  157.245.73.221
  157.245.74.101
@@ -44535,13 +45768,13 @@
  157.245.79.248
  157.245.80.19
  157.245.81.56
+157.245.85.53
  157.245.85.90
  157.245.86.248
  157.245.87.206
  157.245.89.124
  157.245.90.49
  157.245.91.105
-157.245.91.33
  157.245.91.36
  157.245.91.72
  157.245.91.88
@@ -44550,7 +45783,6 @@
  157.245.94.69
  157.245.96.239
  157.245.97.107
-157.245.97.118
  157.245.97.17
  157.245.97.173
  157.245.97.243
@@ -44563,8 +45795,7 @@
  157.245.98.68
  157.245.99.39
  157.25.23.231
-157.25.67.194
-157.39.86.111
+157.39.226.219
  157.44.64.76
  157.52.151.84
  157.52.193.130
@@ -44574,6 +45805,9 @@
  157.55.183.194
  157.55.188.111
  157.55.192.131
+157.55.198.184
+157.55.202.184
+157.55.202.235
  157.55.39.0
  157.55.39.104
  157.55.39.105
@@ -44695,6 +45929,7 @@
  157.55.80.72
  157.55.83.107
  157.56.182.43
+157.65.25.144
  157.7.106.170
  157.7.143.24
  157.7.164.178
@@ -44702,35 +45937,37 @@
  157.7.211.107
  157.7.85.245
  157.88.125.240
+157.92.13.105
  157.92.13.155
  157.92.38.14
  157.92.49.151
  157.97.120.30
  157.97.132.44
+157.97.132.45
  157.97.132.46
  157.97.182.82
  157.97.2.215
+157.97.80.205
  15705924073.mer.lstest.siquality.com
  1572599.com
  15780.url.7878j.com
  1579850.xyz
  158.101.10.69
  158.101.100.20
-158.101.108.162
  158.101.11.105
  158.101.11.113
  158.101.11.135
  158.101.113.102
  158.101.114.99
  158.101.116.39
-158.101.12.235
  158.101.120.79
  158.101.124.78
  158.101.13.146
+158.101.141.54
  158.101.144.173
  158.101.151.37
+158.101.157.58
  158.101.173.116
-158.101.19.129
  158.101.21.146
  158.101.22.156
  158.101.7.100
@@ -44740,6 +45977,7 @@
  158.106.84.137
  158.110.145.243
  158.110.30.197
+158.116.202.32
  158.129.140.201
  158.130.48.250
  158.140.136.26
@@ -44750,6 +45988,8 @@
  158.140.167.148
  158.140.169.104
  158.140.173.212
+158.140.173.22
+158.140.173.94
  158.140.181.157
  158.140.237.153
  158.140.63.162
@@ -44758,14 +45998,12 @@
  158.174.105.184
  158.174.107.222
  158.174.11.171
-158.174.111.37
  158.174.121.254
  158.174.122.199
  158.174.126.228
  158.174.127.190
  158.174.133.112
  158.174.133.194
-158.174.142.95
  158.174.166.88
  158.174.18.149
  158.174.183.202
@@ -44788,6 +46026,7 @@
  158.174.235.165
  158.174.25.109
  158.174.25.132
+158.174.45.112
  158.174.49.48
  158.174.54.161
  158.174.6.12
@@ -44797,17 +46036,17 @@
  158.177.12.124
  158.177.224.36
  158.181.125.150
+158.181.149.71
  158.181.157.83
-158.181.16.53
  158.181.18.158
  158.181.226.33
  158.222.11.130
-158.222.11.17
  158.222.11.205
  158.222.11.43
  158.222.14.115
  158.222.14.117
  158.222.14.127
+158.222.14.171
  158.222.14.184
  158.222.14.189
  158.222.14.44
@@ -44815,18 +46054,14 @@
  158.222.165.33
  158.222.4.16
  158.222.4.3
-158.222.4.60
  158.222.6.119
  158.222.6.61
-158.222.8.91
+158.222.8.143
  158.222.90.98
-158.247.209.198
  158.248.198.75
  158.248.64.234
-158.255.208.33
  158.255.213.71
  158.255.23.146
-158.255.239.115
  158.255.249.219
  158.255.249.58
  158.255.26.229
@@ -44848,11 +46083,12 @@
  158.51.127.185
  158.58.130.151
  158.58.131.27
+158.58.133.106
  158.58.133.187
  158.58.168.61
  158.58.170.186
  158.58.170.222
-158.58.188.37
+158.58.184.51
  158.58.197.227
  158.64.79.183
  158.69.0.200
@@ -44860,7 +46096,6 @@
  158.69.100.192
  158.69.100.194
  158.69.110.31
-158.69.115.206
  158.69.116.169
  158.69.127.117
  158.69.128.56
@@ -44890,6 +46125,7 @@
  158.69.201.47
  158.69.202.69
  158.69.208.131
+158.69.210.168
  158.69.211.201
  158.69.218.145
  158.69.220.67
@@ -44911,24 +46147,25 @@
  158.69.245.223
  158.69.248.120
  158.69.252.83
-158.69.253.57
  158.69.254.105
  158.69.26.144
  158.69.26.193
  158.69.27.192
  158.69.31.229
  158.69.35.227
-158.69.38.243
  158.69.42.209
+158.69.5.175
  158.69.54.200
  158.69.59.241
  158.69.60.13
  158.69.62.6
  158.69.63.54
+158.69.68.232
  158.69.69.187
  158.69.72.200
  158.69.72.5
  158.69.74.240
+158.69.78.32
  158.69.79.136
  158.69.87.231
  158.69.87.97
@@ -44948,6 +46185,7 @@
  159.100.248.234
  159.100.249.179
  159.100.250.198
+159.100.254.107
  159.100.255.18
  159.117.65.167
  159.122.144.23
@@ -44986,11 +46224,11 @@
  159.192.104.53
  159.192.105.152
  159.192.114.231
-159.192.114.232
  159.192.114.236
  159.192.114.237
  159.192.120.228
  159.192.121.240
+159.192.123.222
  159.192.131.197
  159.192.136.166
  159.192.137.24
@@ -45000,8 +46238,10 @@
  159.192.143.249
  159.192.146.250
  159.192.152.211
+159.192.164.45
  159.192.167.85
  159.192.169.188
+159.192.193.134
  159.192.203.228
  159.192.227.218
  159.192.229.148
@@ -45011,10 +46251,11 @@
  159.192.246.100
  159.192.249.254
  159.192.250.156
+159.192.250.20
  159.192.253.131
-159.192.253.174
  159.192.253.212
  159.192.253.58
+159.192.66.172
  159.192.8.4
  159.192.91.184
  159.192.97.181
@@ -45032,6 +46273,7 @@
  159.203.11.194
  159.203.11.3
  159.203.110.210
+159.203.110.73
  159.203.111.100
  159.203.114.189
  159.203.115.201
@@ -45048,7 +46290,6 @@
  159.203.120.151
  159.203.120.196
  159.203.121.11
-159.203.122.57
  159.203.124.134
  159.203.124.98
  159.203.125.129
@@ -45110,7 +46351,6 @@
  159.203.2.156
  159.203.2.227
  159.203.2.230
-159.203.2.242
  159.203.2.6
  159.203.2.73
  159.203.209.87
@@ -45130,14 +46370,16 @@
  159.203.242.122
  159.203.242.199
  159.203.25.14
+159.203.25.76
  159.203.254.187
  159.203.255.95
  159.203.26.120
  159.203.26.252
  159.203.26.38
  159.203.26.91
+159.203.27.149
  159.203.28.251
-159.203.3.64
+159.203.28.56
  159.203.30.113
  159.203.30.127
  159.203.30.226
@@ -45170,7 +46412,6 @@
  159.203.44.244
  159.203.46.190
  159.203.47.131
-159.203.47.196
  159.203.47.203
  159.203.47.216
  159.203.47.63
@@ -45188,6 +46429,7 @@
  159.203.63.22
  159.203.64.53
  159.203.65.139
+159.203.66.114
  159.203.67.100
  159.203.67.177
  159.203.68.109
@@ -45240,19 +46482,16 @@
  159.224.236.187
  159.224.243.185
  159.224.244.11
-159.224.255.154
  159.224.37.181
  159.224.44.19
  159.224.91.220
  159.226.124.134
  159.226.165.11
-159.226.165.133
  159.226.165.173
  159.226.165.67
  159.226.73.176
  159.226.73.79
  159.242.234.15
-159.242.234.181
  159.242.234.75
  159.242.234.89
  159.246.29.101
@@ -45287,6 +46526,7 @@
  159.255.163.238
  159.255.167.89
  159.255.250.241
+159.28.132.130
  159.28.170.60
  159.45.146.133
  159.45.146.135
@@ -45317,24 +46557,27 @@
  159.65.110.27
  159.65.111.89
  159.65.112.7
+159.65.113.110
  159.65.113.13
  159.65.114.233
-159.65.114.238
  159.65.114.59
+159.65.114.69
  159.65.115.112
  159.65.115.115
  159.65.115.218
  159.65.117.243
  159.65.119.132
  159.65.119.25
+159.65.119.84
  159.65.12.108
  159.65.12.43
  159.65.120.167
  159.65.120.56
  159.65.121.129
  159.65.121.243
+159.65.122.111
  159.65.123.255
-159.65.123.91
+159.65.124.186
  159.65.124.47
  159.65.125.0
  159.65.125.24
@@ -45347,6 +46590,7 @@
  159.65.130.198
  159.65.130.72
  159.65.131.226
+159.65.131.92
  159.65.132.243
  159.65.132.97
  159.65.133.13
@@ -45381,8 +46625,10 @@
  159.65.148.231
  159.65.148.240
  159.65.149.105
+159.65.149.139
  159.65.149.251
  159.65.149.54
+159.65.15.106
  159.65.15.143
  159.65.150.135
  159.65.150.139
@@ -45391,9 +46637,11 @@
  159.65.151.183
  159.65.152.201
  159.65.152.215
+159.65.152.45
  159.65.152.86
  159.65.153.147
  159.65.154.48
+159.65.154.65
  159.65.155.104
  159.65.155.229
  159.65.156.139
@@ -45405,6 +46653,8 @@
  159.65.159.178
  159.65.159.59
  159.65.162.189
+159.65.163.59
+159.65.169.158
  159.65.169.25
  159.65.169.76
  159.65.171.69
@@ -45442,10 +46692,10 @@
  159.65.224.137
  159.65.224.8
  159.65.225.95
+159.65.226.101
  159.65.226.229
  159.65.227.64
  159.65.227.80
-159.65.228.105
  159.65.228.224
  159.65.229.162
  159.65.229.200
@@ -45454,6 +46704,7 @@
  159.65.233.97
  159.65.234.65
  159.65.234.71
+159.65.236.252
  159.65.236.67
  159.65.236.82
  159.65.237.31
@@ -45478,6 +46729,7 @@
  159.65.39.11
  159.65.4.119
  159.65.4.159
+159.65.4.84
  159.65.41.104
  159.65.41.159
  159.65.5.164
@@ -45494,7 +46746,6 @@
  159.65.66.80
  159.65.67.149
  159.65.67.175
-159.65.67.60
  159.65.68.152
  159.65.68.208
  159.65.68.239
@@ -45516,11 +46767,14 @@
  159.65.81.49
  159.65.84.164
  159.65.84.183
+159.65.85.131
  159.65.86.243
  159.65.86.35
  159.65.88.193
  159.65.88.87
  159.65.88.97
+159.65.89.214
+159.65.9.229
  159.65.91.105
  159.65.94.14
  159.65.97.233
@@ -45537,6 +46791,7 @@
  159.69.167.254
  159.69.193.12
  159.69.196.197
+159.69.249.70
  159.69.26.123
  159.69.32.15
  159.69.57.170
@@ -45544,6 +46799,7 @@
  159.69.7.135
  159.69.85.172
  159.69.85.209
+159.69.89.159
  159.8.157.187
  159.8.64.60
  159.8.93.184
@@ -45555,8 +46811,8 @@
  159.89.101.193
  159.89.101.254
  159.89.102.206
-159.89.103.106
  159.89.103.207
+159.89.104.111
  159.89.104.48
  159.89.104.55
  159.89.105.233
@@ -45581,7 +46837,7 @@
  159.89.116.255
  159.89.119.127
  159.89.120.240
-159.89.121.168
+159.89.121.102
  159.89.121.240
  159.89.121.86
  159.89.122.249
@@ -45658,6 +46914,7 @@
  159.89.172.207
  159.89.172.219
  159.89.172.68
+159.89.173.162
  159.89.173.165
  159.89.174.217
  159.89.174.51
@@ -45701,6 +46958,8 @@
  159.89.200.80
  159.89.202.113
  159.89.203.135
+159.89.203.230
+159.89.203.94
  159.89.205.184
  159.89.205.186
  159.89.205.205
@@ -45714,8 +46973,8 @@
  159.89.224.18
  159.89.224.99
  159.89.225.82
+159.89.226.18
  159.89.229.173
-159.89.229.208
  159.89.23.207
  159.89.230.105
  159.89.230.116
@@ -45726,10 +46985,12 @@
  159.89.235.15
  159.89.236.71
  159.89.237.201
+159.89.237.235
  159.89.237.254
  159.89.237.57
  159.89.239.14
  159.89.24.170
+159.89.24.203
  159.89.24.212
  159.89.245.59
  159.89.245.69
@@ -45767,6 +47028,7 @@
  159.89.55.36
  159.89.7.14
  159.89.8.152
+159.89.81.46
  159.89.82.29
  159.89.84.231
  159.89.84.50
@@ -45775,11 +47037,14 @@
  159.89.86.176
  159.89.87.139
  159.89.87.233
+159.89.88.119
  159.89.89.191
  159.89.89.224
  159.89.89.44
+159.89.89.65
  159.89.9.140
  159.89.9.147
+159.89.9.22
  159.89.9.84
  159.89.9.86
  159.89.90.212
@@ -45813,15 +47078,10 @@
  15s4g.xyz
  15uaer.coragem.cf
  15w12pa9khzfq658043xrdgv7e2yi84sb076.xyz
-160.0.195.144
  160.0.197.35
  160.0.201.137
  160.0.203.136
-160.0.203.18
  160.1.93.241
-160.116.223.129
-160.116.247.141
-160.116.76.229
  160.119.128.102
  160.119.128.66
  160.119.128.70
@@ -45847,29 +47107,34 @@
  160.124.50.93
  160.153.146.153
  160.153.146.165
-160.153.147.137
  160.153.147.142
-160.153.147.153
-160.153.147.158
+160.153.147.151
  160.153.147.16
  160.153.147.161
  160.153.147.23
  160.153.147.36
+160.153.153.28
  160.153.153.29
  160.153.153.30
  160.153.153.31
  160.153.154.1
+160.153.154.147
  160.153.154.19
  160.153.154.2
  160.153.154.21
+160.153.154.24
+160.153.154.27
+160.153.154.29
  160.153.154.31
+160.153.154.5
+160.153.154.6
  160.153.154.7
  160.153.154.8
  160.153.156.130
-160.153.156.133
  160.153.156.135
  160.153.156.136
  160.153.156.137
+160.153.156.138
  160.153.203.129
  160.153.234.236
  160.153.235.106
@@ -45878,18 +47143,19 @@
  160.153.251.87
  160.153.252.187
  160.153.252.9
-160.154.131.187
-160.154.145.44
+160.154.145.68
  160.154.43.146
+160.155.113.22
  160.155.161.229
  160.155.193.220
  160.155.197.194
-160.155.214.248
  160.155.37.149
+160.155.53.22
  160.16.0.30
  160.16.101.124
  160.16.101.33
  160.16.110.195
+160.16.114.155
  160.16.124.250
  160.16.126.155
  160.16.133.38
@@ -45897,19 +47163,18 @@
  160.16.145.25
  160.16.198.89
  160.16.203.190
-160.16.208.139
  160.16.219.87
  160.16.230.197
  160.16.235.128
  160.16.63.41
  160.16.76.83
  160.162.79.225
-160.164.170.39
  160.174.130.100
+160.178.122.95
  160.179.235.146
  160.179.32.54
-160.179.72.153
  160.19.246.57
+160.19.49.7
  160.2.187.116
  160.2.218.33
  160.2.52.234
@@ -45933,6 +47198,7 @@
  160.202.42.132
  160.202.42.195
  160.226.173.115
+160.226.224.81
  160.226.230.90
  160.226.238.243
  160.238.163.18
@@ -45941,12 +47207,14 @@
  160.238.163.29
  160.238.181.9
  160.238.189.5
-160.238.218.211
  160.238.227.153
+160.238.229.12
  160.238.229.24
+160.238.74.133
  160.242.192.126
  160.242.88.48
  160.251.0.114
+160.251.13.147
  160.251.16.81
  160.251.2.158
  160.251.2.167
@@ -45960,6 +47228,7 @@
  160.3.19.6
  160.3.7.73
  160.32.193.70
+160.39.192.136
  160.39.48.77
  160.39.56.53
  160.40.53.136
@@ -45977,12 +47246,13 @@
  161.117.186.48
  161.117.189.115
  161.117.189.30
-161.117.235.45
+161.117.191.59
  161.117.248.141
  161.117.255.189
+161.117.56.255
  161.117.57.88
+161.117.7.137
  161.117.7.172
-161.117.88.24
  161.117.9.216
  161.117.9.99
  161.129.144.75
@@ -46003,6 +47273,7 @@
  161.156.160.12
  161.184.145.158
  161.189.109.42
+161.189.114.127
  161.189.141.133
  161.200.98.10
  161.202.124.146
@@ -46012,12 +47283,9 @@
  161.22.35.210
  161.22.53.33
  161.230.111.128
-161.230.99.54
  161.29.182.234
  161.35.0.174
  161.35.10.226
-161.35.10.34
-161.35.10.55
  161.35.10.62
  161.35.101.166
  161.35.101.70
@@ -46033,10 +47301,13 @@
  161.35.116.113
  161.35.118.14
  161.35.120.184
+161.35.120.214
  161.35.121.130
  161.35.122.195
  161.35.122.197
+161.35.124.170
  161.35.124.171
+161.35.124.229
  161.35.127.147
  161.35.13.123
  161.35.13.134
@@ -46057,9 +47328,12 @@
  161.35.15.45
  161.35.150.254
  161.35.152.252
+161.35.154.107
+161.35.154.151
  161.35.154.24
  161.35.158.191
  161.35.158.5
+161.35.161.13
  161.35.161.91
  161.35.162.109
  161.35.162.137
@@ -46067,8 +47341,14 @@
  161.35.162.192
  161.35.163.188
  161.35.164.203
+161.35.164.91
+161.35.164.98
+161.35.165.122
  161.35.165.80
+161.35.167.145
  161.35.167.148
+161.35.168.40
+161.35.168.50
  161.35.172.109
  161.35.172.251
  161.35.173.114
@@ -46077,6 +47357,7 @@
  161.35.173.212
  161.35.173.29
  161.35.174.107
+161.35.174.136
  161.35.174.187
  161.35.174.205
  161.35.18.102
@@ -46085,9 +47366,9 @@
  161.35.193.16
  161.35.193.6
  161.35.194.6
+161.35.195.211
  161.35.195.30
  161.35.197.166
-161.35.2.242
  161.35.200.233
  161.35.205.180
  161.35.206.173
@@ -46095,6 +47376,7 @@
  161.35.212.246
  161.35.218.147
  161.35.225.155
+161.35.225.185
  161.35.225.49
  161.35.227.139
  161.35.227.204
@@ -46108,6 +47390,7 @@
  161.35.232.103
  161.35.232.146
  161.35.232.16
+161.35.233.130
  161.35.233.230
  161.35.234.25
  161.35.235.0
@@ -46119,7 +47402,6 @@
  161.35.24.244
  161.35.26.90
  161.35.3.169
-161.35.3.18
  161.35.30.208
  161.35.32.111
  161.35.32.43
@@ -46131,10 +47413,12 @@
  161.35.41.208
  161.35.41.237
  161.35.45.62
+161.35.46.85
  161.35.47.220
  161.35.49.47
  161.35.49.78
  161.35.5.47
+161.35.51.18
  161.35.51.53
  161.35.52.67
  161.35.53.134
@@ -46184,14 +47468,15 @@
  161.35.94.236
  161.35.94.244
  161.35.94.41
+161.35.95.130
  161.35.95.168
  161.35.95.173
  161.35.95.195
-161.35.95.56
  161.35.95.69
  161.35.95.91
  161.35.97.206
  161.35.98.45
+161.35.99.100
  161.35.99.173
  161.35.99.242
  161.35.99.73
@@ -46204,26 +47489,25 @@
  161.53.179.233
  161.53.201.178
  161.53.201.185
-161.53.240.25
  161.77.38.98
  161.8.17.234
  161.8.17.238
  161.81.194.222
  161.81.199.40
  161.81.209.19
+161.81.219.0
  161.81.45.111
  161.82.136.56
  161.97.100.124
  161.97.100.76
  161.97.107.17
-161.97.107.231
  161.97.110.38
+161.97.111.195
  161.97.111.43
  161.97.114.148
  161.97.119.27
-161.97.120.193
  161.97.121.103
-161.97.121.192
+161.97.123.248
  161.97.123.48
  161.97.124.181
  161.97.128.127
@@ -46238,15 +47522,15 @@
  161.97.68.59
  161.97.70.157
  161.97.70.20
-161.97.71.103
+161.97.70.3
  161.97.72.101
  161.97.73.29
-161.97.75.168
  161.97.77.59
  161.97.78.179
-161.97.80.66
+161.97.82.97
  161.97.83.114
  161.97.84.78
+161.97.87.67
  161.97.87.96
  161.97.88.253
  161.97.91.103
@@ -46275,7 +47559,6 @@
  162.0.227.62
  162.0.227.86
  162.0.228.57
-162.0.230.74
  162.0.231.190
  162.0.233.227
  162.0.234.152
@@ -46291,10 +47574,9 @@
  162.14.134.114
  162.14.177.172
  162.14.177.181
+162.14.177.182
  162.14.177.184
  162.14.177.193
-162.14.177.218
-162.14.177.219
  162.14.18.148
  162.14.18.58
  162.14.22.99
@@ -46318,8 +47600,6 @@
  162.142.125.38
  162.142.125.39
  162.142.125.40
-162.142.125.54
-162.142.125.55
  162.142.125.56
  162.142.125.64
  162.142.125.65
@@ -46365,6 +47645,7 @@
  162.144.146.65
  162.144.150.118
  162.144.152.46
+162.144.159.196
  162.144.213.238
  162.144.221.185
  162.144.233.29
@@ -46378,6 +47659,8 @@
  162.144.38.240
  162.144.39.157
  162.144.46.168
+162.144.48.139
+162.144.48.236
  162.144.49.154
  162.144.50.197
  162.144.51.3
@@ -46407,26 +47690,17 @@
  162.157.245.39
  162.157.71.213
  162.157.98.9
-162.158.106.144
-162.158.107.172
-162.158.107.231
-162.158.111.125
+162.158.111.187
+162.158.111.97
  162.158.142.101
  162.158.154.101
  162.158.154.107
  162.158.154.167
-162.158.154.173
-162.158.154.53
  162.158.154.89
-162.158.155.138
-162.158.155.198
+162.158.155.204
  162.158.158.165
  162.158.158.185
  162.158.158.217
-162.158.158.225
-162.158.159.12
-162.158.159.123
-162.158.159.38
  162.158.159.94
  162.158.165.129
  162.158.165.133
@@ -46452,6 +47726,7 @@
  162.158.166.210
  162.158.166.224
  162.158.166.232
+162.158.166.236
  162.158.166.70
  162.158.166.72
  162.158.166.84
@@ -46467,15 +47742,20 @@
  162.158.167.53
  162.158.167.57
  162.158.167.9
-162.158.18.92
-162.158.183.133
-162.158.183.137
-162.158.183.213
+162.158.183.117
+162.158.183.127
+162.158.183.166
+162.158.183.203
+162.158.183.207
  162.158.183.221
-162.158.183.223
-162.158.183.233
-162.158.62.45
+162.158.183.237
+162.158.187.155
+162.158.210.138
+162.158.210.154
+162.158.62.101
+162.158.63.16
  162.158.63.191
+162.158.74.187
  162.158.88.135
  162.158.91.54
  162.158.92.107
@@ -46487,7 +47767,9 @@
  162.17.147.37
  162.17.167.210
  162.17.252.5
+162.191.197.222
  162.191.49.51
+162.194.223.38
  162.198.89.189
  162.198.98.220
  162.199.19.25
@@ -46569,9 +47851,6 @@
  162.212.133.131
  162.212.168.115
  162.212.168.76
-162.212.169.146
-162.212.169.153
-162.212.169.156
  162.212.169.190
  162.212.169.213
  162.212.169.225
@@ -46604,7 +47883,6 @@
  162.214.101.36
  162.214.101.56
  162.214.102.16
-162.214.102.3
  162.214.103.187
  162.214.111.167
  162.214.113.163
@@ -46614,6 +47892,7 @@
  162.214.28.25
  162.214.3.98
  162.214.54.162
+162.214.55.183
  162.214.64.156
  162.214.64.229
  162.214.74.253
@@ -46622,6 +47901,7 @@
  162.214.92.22
  162.214.97.24
  162.216.0.166
+162.216.133.29
  162.216.142.83
  162.216.16.4
  162.216.161.107
@@ -46636,12 +47916,10 @@
  162.218.233.230
  162.218.234.56
  162.219.122.165
-162.219.176.3
  162.219.179.101
  162.219.4.93
  162.219.5.83
  162.219.57.21
-162.220.14.181
  162.220.144.191
  162.220.146.69
  162.220.151.98
@@ -46657,6 +47935,7 @@
  162.221.200.177
  162.221.206.10
  162.221.4.117
+162.222.178.80
  162.222.183.190
  162.222.215.164
  162.222.217.113
@@ -46668,7 +47947,6 @@
  162.223.88.243
  162.223.88.251
  162.223.88.42
-162.223.89.220
  162.223.89.221
  162.223.89.69
  162.223.90.202
@@ -46678,9 +47956,7 @@
  162.227.78.128
  162.227.98.110
  162.229.183.99
-162.237.149.63
  162.238.152.19
-162.239.28.145
  162.241.117.105
  162.241.117.179
  162.241.117.37
@@ -46845,6 +48121,7 @@
  162.243.140.91
  162.243.141.142
  162.243.141.185
+162.243.141.49
  162.243.143.145
  162.243.144.210
  162.243.144.85
@@ -46864,7 +48141,7 @@
  162.243.163.122
  162.243.164.40
  162.243.165.205
-162.243.169.210
+162.243.166.183
  162.243.171.112
  162.243.172.179
  162.243.173.29
@@ -46955,7 +48232,6 @@
  162.244.9.13
  162.244.9.190
  162.244.9.70
-162.244.95.196
  162.245.218.125
  162.245.239.235
  162.245.81.151
@@ -46967,7 +48243,6 @@
  162.247.132.167
  162.247.146.238
  162.247.155.129
-162.247.208.45
  162.247.227.79
  162.247.72.199
  162.247.72.216
@@ -46988,11 +48263,9 @@
  162.248.160.220
  162.248.242.254
  162.248.243.15
-162.248.243.233
  162.248.243.41
-162.248.243.7
+162.248.243.6
  162.248.243.8
-162.248.243.9
  162.248.53.224
  162.248.55.137
  162.249.220.190
@@ -47005,15 +48278,18 @@
  162.250.188.87
  162.250.189.53
  162.250.235.127
+162.250.97.78
  162.251.152.109
  162.251.18.223
  162.251.18.235
+162.251.203.212
  162.252.57.132
  162.252.57.90
  162.253.122.85
  162.253.168.86
  162.253.66.50
  162.253.66.76
+162.254.204.8
  162.254.250.6
  162.255.116.244
  162.255.117.11
@@ -47021,7 +48297,7 @@
  162.255.117.35
  162.255.125.231
  162.255.127.90
-162.255.4.31
+162.255.3.23
  162.39.119.102
  162.41.8.12
  162.62.14.159
@@ -47074,80 +48350,22 @@
  162.72.157.113
  162.83.143.149
  162.83.253.137
-162.95.160.16
-162.95.160.237
-162.95.200.11
-162.95.219.30
-162.95.219.31
-162.95.220.105
-162.95.220.121
-162.95.220.14
-162.95.220.146
-162.95.220.155
-162.95.220.156
-162.95.220.162
-162.95.220.181
-162.95.220.20
-162.95.220.22
-162.95.220.28
-162.95.220.30
-162.95.220.42
-162.95.220.86
-162.95.220.89
-162.95.220.96
-162.95.221.109
-162.95.221.115
-162.95.221.12
-162.95.221.122
-162.95.221.153
-162.95.221.201
-162.95.221.220
-162.95.221.221
-162.95.221.222
-162.95.221.246
-162.95.221.83
-162.95.222.128
-162.95.222.130
-162.95.222.132
-162.95.222.133
-162.95.222.135
-162.95.222.155
-162.95.222.174
-162.95.222.176
-162.95.222.177
-162.95.222.179
-162.95.222.210
-162.95.222.50
-162.95.223.114
-162.95.223.222
-162.95.223.235
-162.95.223.247
-162.95.223.49
-162.95.223.61
-162.95.223.96
-162.95.223.97
-162.95.223.98
-162.95.241.172
-162.95.242.160
-162.95.242.246
  162266.bibigor.com
  162783-dot-n-e-w-me-ss-age-po-rt-al.wl.r.appspot.com
  162840-dot-n-e-w-me-ss-age-po-rt-al.wl.r.appspot.com
  163.121.188.3
-163.125.173.75
+163.125.29.202
  163.13.182.105
  163.131.167.23
  163.131.64.105
  163.131.66.106
  163.139.169.79
-163.139.233.235
  163.152.219.192
  163.152.219.201
  163.152.223.25
  163.152.26.77
  163.153.214.50
  163.158.154.126
-163.158.181.113
  163.158.202.112
  163.158.228.81
  163.158.243.230
@@ -47169,10 +48387,16 @@
  163.172.111.182
  163.172.113.177
  163.172.113.19
+163.172.113.47
+163.172.114.14
+163.172.114.29
+163.172.114.31
+163.172.114.42
  163.172.115.160
  163.172.115.25
  163.172.117.155
  163.172.117.248
+163.172.120.204
  163.172.121.98
  163.172.123.20
  163.172.125.230
@@ -47193,9 +48417,9 @@
  163.172.140.8
  163.172.142.149
  163.172.143.114
-163.172.143.181
  163.172.145.74
  163.172.147.94
+163.172.148.34
  163.172.148.62
  163.172.151.250
  163.172.151.47
@@ -47205,7 +48429,6 @@
  163.172.154.105
  163.172.154.178
  163.172.154.72
-163.172.156.51
  163.172.157.193
  163.172.158.208
  163.172.160.125
@@ -47223,10 +48446,10 @@
  163.172.181.191
  163.172.184.172
  163.172.185.11
-163.172.187.114
  163.172.189.32
  163.172.19.226
  163.172.190.160
+163.172.192.170
  163.172.193.248
  163.172.197.211
  163.172.198.85
@@ -47236,7 +48459,6 @@
  163.172.211.176
  163.172.212.115
  163.172.213.104
-163.172.213.140
  163.172.214.148
  163.172.214.76
  163.172.215.78
@@ -47245,13 +48467,17 @@
  163.172.219.130
  163.172.220.221
  163.172.223.177
+163.172.226.142
  163.172.226.7
-163.172.229.166
+163.172.226.90
+163.172.227.110
  163.172.229.188
  163.172.230.102
  163.172.230.144
  163.172.231.193
+163.172.235.33
  163.172.237.18
+163.172.24.135
  163.172.24.40
  163.172.27.213
  163.172.27.234
@@ -47305,15 +48531,18 @@
  163.172.81.70
  163.172.81.79
  163.172.82.118
+163.172.82.238
  163.172.83.228
  163.172.83.41
  163.172.86.64
  163.172.88.136
  163.172.88.67
  163.172.89.133
+163.172.93.131
  163.172.95.196
  163.172.97.112
  163.172.97.118
+163.179.126.39
  163.179.157.182
  163.179.97.16
  163.180.96.123
@@ -47329,6 +48558,7 @@
  163.27.182.223
  163.44.149.204
  163.44.152.32
+163.44.153.98
  163.44.158.143
  163.44.159.123
  163.44.159.154
@@ -47378,6 +48608,7 @@
  164.10.46.101
  164.10.46.102
  164.100.146.28
+164.100.6.145
  164.109.80.134
  164.115.22.45
  164.115.241.74
@@ -47400,18 +48631,21 @@
  164.132.151.175
  164.132.159.58
  164.132.160.230
+164.132.189.181
  164.132.195.231
  164.132.195.233
  164.132.196.98
  164.132.199.114
  164.132.200.121
  164.132.205.148
+164.132.217.11
  164.132.222.249
  164.132.224.68
  164.132.225.151
  164.132.228.134
  164.132.229.117
  164.132.23.43
+164.132.230.14
  164.132.230.244
  164.132.230.98
  164.132.235.147
@@ -47423,6 +48657,8 @@
  164.132.24.255
  164.132.38.166
  164.132.40.238
+164.132.41.167
+164.132.41.67
  164.132.42.32
  164.132.44.25
  164.132.45.213
@@ -47432,7 +48668,6 @@
  164.132.48.179
  164.132.49.140
  164.132.54.215
-164.132.55.144
  164.132.56.243
  164.132.57.16
  164.132.73.220
@@ -47448,12 +48683,16 @@
  164.155.231.251
  164.155.66.10
  164.155.74.36
+164.155.93.8
  164.160.128.100
  164.160.128.104
  164.160.128.90
  164.160.161.85
  164.160.225.242
+164.160.33.164
+164.160.33.20
  164.163.201.49
+164.163.204.207
  164.163.21.10
  164.163.23.19
  164.163.239.168
@@ -47461,12 +48700,9 @@
  164.163.40.51
  164.163.73.122
  164.163.99.10
-164.164.87.57
  164.177.104.186
  164.177.30.7
  164.177.60.173
-164.215.176.187
-164.215.187.20
  164.39.137.193
  164.52.116.2
  164.52.24.164
@@ -47526,6 +48762,7 @@
  164.77.221.125
  164.77.221.139
  164.77.221.248
+164.77.40.104
  164.77.87.82
  164.8.233.75
  164.90.144.182
@@ -47541,16 +48778,29 @@
  164.90.152.130
  164.90.152.90
  164.90.154.119
+164.90.155.117
  164.90.155.145
-164.90.156.45
+164.90.156.14
  164.90.158.57
  164.90.158.82
  164.90.159.110
  164.90.164.165
-164.90.181.196
+164.90.180.159
+164.90.182.227
+164.90.186.5
  164.90.190.224
+164.90.194.229
+164.90.194.249
  164.90.194.89
  164.90.201.56
+164.90.202.60
+164.90.202.63
+164.90.202.8
+164.90.204.105
+164.90.204.129
+164.90.204.218
+164.90.204.250
+164.90.204.89
  164.90.208.125
  164.90.210.8
  164.90.212.168
@@ -47565,7 +48815,6 @@
  164.90.238.53
  164.90.241.64
  1643.31cf4fdae.com
-165.0.131.40
  165.120.30.73
  165.132.30.11
  165.138.55.107
@@ -47598,6 +48847,7 @@
  165.165.140.187
  165.165.144.251
  165.165.147.154
+165.169.204.241
  165.169.241.28
  165.19.208.4
  165.19.208.9
@@ -47606,6 +48856,7 @@
  165.22.0.61
  165.22.10.136
  165.22.101.100
+165.22.101.76
  165.22.103.169
  165.22.103.235
  165.22.103.237
@@ -47615,7 +48866,9 @@
  165.22.113.168
  165.22.113.251
  165.22.113.66
+165.22.118.246
  165.22.119.149
+165.22.121.12
  165.22.121.56
  165.22.123.19
  165.22.123.86
@@ -47632,6 +48885,7 @@
  165.22.163.18
  165.22.163.227
  165.22.171.67
+165.22.172.238
  165.22.186.178
  165.22.192.120
  165.22.195.238
@@ -47683,7 +48937,6 @@
  165.22.226.147
  165.22.226.249
  165.22.227.100
-165.22.227.126
  165.22.227.159
  165.22.227.235
  165.22.228.11
@@ -47714,6 +48967,7 @@
  165.22.247.221
  165.22.250.142
  165.22.250.229
+165.22.252.212
  165.22.253.164
  165.22.254.134
  165.22.254.26
@@ -47722,16 +48976,17 @@
  165.22.26.140
  165.22.26.97
  165.22.28.239
+165.22.29.165
  165.22.33.32
  165.22.33.45
  165.22.33.47
  165.22.35.21
  165.22.35.80
-165.22.36.54
  165.22.36.75
  165.22.38.171
  165.22.40.128
  165.22.40.86
+165.22.43.225
  165.22.46.248
  165.22.48.140
  165.22.49.42
@@ -47739,10 +48994,13 @@
  165.22.50.208
  165.22.52.83
  165.22.53.233
+165.22.55.66
  165.22.57.164
  165.22.57.175
+165.22.57.36
  165.22.58.237
  165.22.59.208
+165.22.61.112
  165.22.61.205
  165.22.61.82
  165.22.62.238
@@ -47755,10 +49013,12 @@
  165.22.71.185
  165.22.71.24
  165.22.73.20
+165.22.75.225
  165.22.75.227
  165.22.76.190
  165.22.76.96
  165.22.77.163
+165.22.8.26
  165.22.81.128
  165.22.81.30
  165.22.88.129
@@ -47806,6 +49066,7 @@
  165.227.127.49
  165.227.128.19
  165.227.128.199
+165.227.129.197
  165.227.13.185
  165.227.130.157
  165.227.130.76
@@ -47815,6 +49076,8 @@
  165.227.132.234
  165.227.132.8
  165.227.133.48
+165.227.135.41
+165.227.135.49
  165.227.136.123
  165.227.137.12
  165.227.137.216
@@ -47830,9 +49093,12 @@
  165.227.142.135
  165.227.142.184
  165.227.142.230
+165.227.142.62
+165.227.143.177
  165.227.144.49
  165.227.144.61
  165.227.145.138
+165.227.145.57
  165.227.146.112
  165.227.146.232
  165.227.146.39
@@ -47856,6 +49122,7 @@
  165.227.163.100
  165.227.163.238
  165.227.163.85
+165.227.164.135
  165.227.165.102
  165.227.165.159
  165.227.166.125
@@ -47865,9 +49132,7 @@
  165.227.166.67
  165.227.169.12
  165.227.169.7
-165.227.17.54
  165.227.170.182
-165.227.170.185
  165.227.171.142
  165.227.173.181
  165.227.174.21
@@ -47876,6 +49141,7 @@
  165.227.175.52
  165.227.175.57
  165.227.175.74
+165.227.175.86
  165.227.176.208
  165.227.180.243
  165.227.181.9
@@ -47936,8 +49202,8 @@
  165.227.232.103
  165.227.232.183
  165.227.233.165
-165.227.234.193
  165.227.239.56
+165.227.24.208
  165.227.24.229
  165.227.24.42
  165.227.24.7
@@ -47958,17 +49224,20 @@
  165.227.33.50
  165.227.34.65
  165.227.34.70
+165.227.34.9
  165.227.35.21
  165.227.36.162
  165.227.38.68
  165.227.4.106
  165.227.4.30
  165.227.4.60
+165.227.41.64
  165.227.42.51
  165.227.45.150
  165.227.45.249
  165.227.46.89
  165.227.48.100
+165.227.49.204
  165.227.5.162
  165.227.5.45
  165.227.50.44
@@ -48019,10 +49288,8 @@
  165.227.92.148
  165.227.92.243
  165.227.94.118
-165.227.94.27
  165.227.95.201
  165.227.96.127
-165.227.96.190
  165.228.14.173
  165.231.101.125
  165.231.101.137
@@ -48035,14 +49302,11 @@
  165.231.105.68
  165.231.105.90
  165.231.105.98
-165.231.120.168
-165.231.120.90
  165.231.130.100
  165.231.130.134
  165.231.130.222
  165.231.130.69
  165.231.143.107
-165.231.143.116
  165.231.143.125
  165.231.143.129
  165.231.143.145
@@ -48057,6 +49321,7 @@
  165.231.143.197
  165.231.143.200
  165.231.143.202
+165.231.143.204
  165.231.143.227
  165.231.143.247
  165.231.143.249
@@ -48067,39 +49332,51 @@
  165.231.54.26
  165.231.54.35
  165.231.92.10
-165.231.92.11
  165.231.92.126
-165.231.92.147
  165.231.92.149
  165.231.92.49
-165.231.92.67
  165.231.95.109
  165.231.95.149
  165.231.98.36
+165.232.100.144
  165.232.100.193
  165.232.100.234
+165.232.101.57
+165.232.102.14
+165.232.102.2
+165.232.102.211
  165.232.102.53
+165.232.102.62
  165.232.103.11
  165.232.103.152
  165.232.103.3
+165.232.104.100
+165.232.104.203
+165.232.104.224
+165.232.104.36
+165.232.105.226
+165.232.105.29
  165.232.105.80
  165.232.106.115
  165.232.106.135
  165.232.106.175
  165.232.107.168
  165.232.107.250
+165.232.107.71
  165.232.108.10
  165.232.108.13
  165.232.108.43
  165.232.108.54
  165.232.108.84
-165.232.109.144
-165.232.109.152
+165.232.110.62
  165.232.113.27
+165.232.116.7
  165.232.122.135
  165.232.122.187
+165.232.122.214
  165.232.32.126
  165.232.32.173
+165.232.32.243
  165.232.33.17
  165.232.33.229
  165.232.33.231
@@ -48109,53 +49386,80 @@
  165.232.35.131
  165.232.35.189
  165.232.35.95
+165.232.35.96
+165.232.37.222
+165.232.37.224
  165.232.38.162
  165.232.38.247
+165.232.39.132
  165.232.39.16
  165.232.39.218
+165.232.39.237
+165.232.39.245
  165.232.39.41
+165.232.40.170
  165.232.40.209
  165.232.40.86
+165.232.41.121
+165.232.41.133
+165.232.41.191
  165.232.41.216
  165.232.41.229
  165.232.41.55
  165.232.42.183
  165.232.43.17
+165.232.43.231
  165.232.43.44
  165.232.43.49
  165.232.44.141
  165.232.45.141
+165.232.46.138
  165.232.46.209
+165.232.46.52
  165.232.46.98
  165.232.47.112
  165.232.47.173
  165.232.47.2
+165.232.47.213
+165.232.47.232
  165.232.47.76
  165.232.54.187
  165.232.63.210
+165.232.64.46
  165.232.64.90
  165.232.66.234
  165.232.67.41
+165.232.69.213
  165.232.70.243
  165.232.76.218
-165.232.97.139
+165.232.77.72
+165.232.96.24
+165.232.96.250
+165.232.97.122
  165.232.97.194
-165.232.97.66
+165.232.97.202
+165.232.97.225
+165.232.97.247
+165.232.97.68
  165.232.97.78
  165.232.98.175
  165.232.98.27
+165.232.98.35
  165.232.98.36
+165.232.99.10
  165.232.99.140
+165.246.163.155
  165.255.254.204
  165.255.63.210
  165.255.67.217
  165.255.99.16
+165.3.113.26
  165.3.86.134
-165.3.86.227
  165.3.87.110
  165.3.87.121
  165.3.87.123
  165.3.87.162
+165.3.87.253
  165.3.87.4
  165.3.87.49
  165.3.89.14
@@ -48172,6 +49476,7 @@
  165.3.92.240
  165.3.93.81
  165.49.57.14
+165.56.7.94
  165.73.102.17
  165.73.43.154
  165.84.145.75
@@ -48190,7 +49495,7 @@
  166.111.131.20
  166.111.152.230
  166.111.60.108
-166.130.73.79
+166.111.68.25
  166.137.10.116
  166.137.10.23
  166.137.10.85
@@ -48219,16 +49524,19 @@
  166.137.252.93
  166.137.8.113
  166.137.90.15
-166.143.226.106
+166.151.5.193
+166.152.31.31
  166.154.23.224
  166.155.19.234
  166.159.43.126
  166.166.84.239
+166.168.3.178
  166.170.0.117
  166.170.14.108
  166.170.14.59
  166.170.15.75
  166.170.5.47
+166.210.65.37
  166.216.165.124
  166.216.165.58
  166.48.211.21
@@ -48239,7 +49547,6 @@
  166.62.218.221
  166.62.28.107
  166.62.37.57
-166.62.37.69
  166.62.39.186
  166.62.45.148
  166.62.84.149
@@ -48269,8 +49576,10 @@
  167.114.1.58
  167.114.10.97
  167.114.103.140
+167.114.113.141
  167.114.113.16
  167.114.113.219
+167.114.114.107
  167.114.114.66
  167.114.115.33
  167.114.118.135
@@ -48278,6 +49587,7 @@
  167.114.12.138
  167.114.122.37
  167.114.129.9
+167.114.136.27
  167.114.140.235
  167.114.144.159
  167.114.150.100
@@ -48347,6 +49657,7 @@
  167.114.65.240
  167.114.68.197
  167.114.85.125
+167.114.86.47
  167.114.96.156
  167.114.98.229
  167.114.98.233
@@ -48361,17 +49672,19 @@
  167.146.208.8
  167.157.38.136
  167.160.12.178
+167.160.184.122
  167.160.184.15
  167.160.184.37
+167.160.184.43
  167.160.184.47
  167.160.184.55
  167.160.184.62
  167.160.36.151
  167.160.74.223
  167.160.74.225
+167.160.75.127
  167.160.76.44
  167.160.76.60
-167.160.78.36
  167.172.0.218
  167.172.102.128
  167.172.109.12
@@ -48380,16 +49693,16 @@
  167.172.115.176
  167.172.116.232
  167.172.117.26
-167.172.118.210
  167.172.120.144
-167.172.120.182
  167.172.121.253
+167.172.121.6
  167.172.124.2
  167.172.125.15
  167.172.126.253
  167.172.127.13
  167.172.130.49
  167.172.131.7
+167.172.133.119
  167.172.133.221
  167.172.134.157
  167.172.135.131
@@ -48402,12 +49715,10 @@
  167.172.142.103
  167.172.142.125
  167.172.142.39
-167.172.144.31
  167.172.145.148
  167.172.145.168
  167.172.146.98
  167.172.147.171
-167.172.148.206
  167.172.149.95
  167.172.150.210
  167.172.151.135
@@ -48422,7 +49733,6 @@
  167.172.155.39
  167.172.155.86
  167.172.156.12
-167.172.156.227
  167.172.158.51
  167.172.158.68
  167.172.16.47
@@ -48437,7 +49747,6 @@
  167.172.179.135
  167.172.181.231
  167.172.182.17
-167.172.184.166
  167.172.185.137
  167.172.186.163
  167.172.186.32
@@ -48447,6 +49756,7 @@
  167.172.193.249
  167.172.194.231
  167.172.195.99
+167.172.196.255
  167.172.20.158
  167.172.20.25
  167.172.200.70
@@ -48454,24 +49764,28 @@
  167.172.203.100
  167.172.204.125
  167.172.205.116
+167.172.206.246
  167.172.207.139
  167.172.209.140
  167.172.209.209
  167.172.209.22
  167.172.212.150
  167.172.212.197
-167.172.213.0
+167.172.213.116
  167.172.213.83
+167.172.215.83
  167.172.216.125
  167.172.217.219
  167.172.219.157
  167.172.22.209
  167.172.222.127
+167.172.222.221
  167.172.222.63
  167.172.226.175
  167.172.23.200
  167.172.23.70
  167.172.235.137
+167.172.235.221
  167.172.235.25
  167.172.238.159
  167.172.239.116
@@ -48484,7 +49798,9 @@
  167.172.247.19
  167.172.247.37
  167.172.248.19
+167.172.249.82
  167.172.25.123
+167.172.25.74
  167.172.251.241
  167.172.251.74
  167.172.255.121
@@ -48500,6 +49816,7 @@
  167.172.38.238
  167.172.38.93
  167.172.39.220
+167.172.42.166
  167.172.42.18
  167.172.42.30
  167.172.43.117
@@ -48507,6 +49824,7 @@
  167.172.45.143
  167.172.46.220
  167.172.46.71
+167.172.46.87
  167.172.47.197
  167.172.49.139
  167.172.52.42
@@ -48514,23 +49832,26 @@
  167.172.54.27
  167.172.55.57
  167.172.55.6
-167.172.56.36
  167.172.57.1
  167.172.58.67
  167.172.59.163
  167.172.61.145
+167.172.61.49
  167.172.63.139
  167.172.63.16
  167.172.63.17
+167.172.69.52
  167.172.78.207
  167.172.78.73
+167.172.98.198
+167.172.98.207
  167.172.98.89
  167.179.13.185
  167.179.13.196
  167.179.139.79
  167.179.153.249
-167.179.161.32
  167.179.4.134
+167.179.4.142
  167.179.64.113
  167.179.77.92
  167.179.80.162
@@ -48538,7 +49859,6 @@
  167.179.88.31
  167.179.96.13
  167.179.96.172
-167.224.212.209
  167.233.7.66
  167.239.226.24
  167.248.133.16
@@ -48557,9 +49877,7 @@
  167.248.133.29
  167.248.133.30
  167.248.133.31
-167.248.133.37
  167.248.133.39
-167.248.133.40
  167.248.133.53
  167.248.133.54
  167.248.133.55
@@ -48598,33 +49916,29 @@
  167.248.133.95
  167.249.11.57
  167.249.170.26
-167.249.206.23
+167.249.183.66
  167.249.212.17
-167.249.220.79
-167.249.254.1
  167.249.255.129
  167.249.66.0
  167.249.9.37
  167.250.11.234
+167.250.127.235
  167.250.140.145
  167.250.140.146
  167.250.140.168
  167.250.160.206
+167.250.178.44
  167.250.189.103
  167.250.206.195
-167.250.217.98
  167.250.49.155
+167.250.55.181
  167.250.65.246
  167.250.81.54
  167.250.96.170
  167.250.99.232
  167.56.252.192
-167.56.49.88
  167.56.7.75
-167.57.165.209
-167.57.61.114
-167.60.253.167
-167.60.99.64
+167.61.130.178
  167.62.164.64
  167.62.214.72
  167.62.91.83
@@ -48632,12 +49946,14 @@
  167.71.1.6
  167.71.10.37
  167.71.102.102
+167.71.102.17
  167.71.102.181
  167.71.102.201
  167.71.102.95
  167.71.103.23
  167.71.104.1
  167.71.104.233
+167.71.109.96
  167.71.11.115
  167.71.11.57
  167.71.110.14
@@ -48663,7 +49979,6 @@
  167.71.125.85
  167.71.127.113
  167.71.127.147
-167.71.128.55
  167.71.128.64
  167.71.128.88
  167.71.13.196
@@ -48703,10 +50018,11 @@
  167.71.175.10
  167.71.177.236
  167.71.177.87
-167.71.183.82
  167.71.184.89
  167.71.185.113
  167.71.186.157
+167.71.188.215
+167.71.195.173
  167.71.196.176
  167.71.197.10
  167.71.202.109
@@ -48719,6 +50035,8 @@
  167.71.209.193
  167.71.209.2
  167.71.210.7
+167.71.211.104
+167.71.211.45
  167.71.213.125
  167.71.213.179
  167.71.213.19
@@ -48726,18 +50044,23 @@
  167.71.216.193
  167.71.216.201
  167.71.216.37
+167.71.218.150
+167.71.218.222
  167.71.218.243
+167.71.218.38
  167.71.219.179
  167.71.219.86
  167.71.220.147
  167.71.223.147
  167.71.224.129
+167.71.224.234
  167.71.225.166
  167.71.225.60
  167.71.226.130
  167.71.226.154
  167.71.227.113
  167.71.227.169
+167.71.227.75
  167.71.228.222
  167.71.228.224
  167.71.228.241
@@ -48757,20 +50080,23 @@
  167.71.237.130
  167.71.238.204
  167.71.243.218
+167.71.244.58
  167.71.245.230
-167.71.246.105
  167.71.252.55
  167.71.254.137
  167.71.254.95
  167.71.36.101
  167.71.37.163
+167.71.38.104
  167.71.39.132
  167.71.4.250
+167.71.40.105
  167.71.41.253
  167.71.43.36
  167.71.46.139
  167.71.46.162
  167.71.46.185
+167.71.47.142
  167.71.5.86
  167.71.50.123
  167.71.51.223
@@ -48807,6 +50133,7 @@
  167.71.94.198
  167.71.95.157
  167.71.96.148
+167.71.96.32
  167.71.98.172
  167.71.98.201
  167.78.4.18
@@ -48816,14 +50143,17 @@
  167.86.102.174
  167.86.103.221
  167.86.105.53
+167.86.106.222
  167.86.109.171
  167.86.110.76
  167.86.113.5
  167.86.116.198
  167.86.116.202
+167.86.117.193
+167.86.117.63
  167.86.120.160
+167.86.126.200
  167.86.67.67
-167.86.71.24
  167.86.73.32
  167.86.73.56
  167.86.75.216
@@ -48832,17 +50162,19 @@
  167.86.79.47
  167.86.80.173
  167.86.81.74
+167.86.83.12
  167.86.85.191
  167.86.87.90
-167.86.88.228
  167.86.90.148
  167.86.90.239
+167.86.90.94
  167.86.93.224
  167.86.94.107
  167.86.95.104
  167.86.98.179
  167.86.98.237
  167.86.99.118
+167.88.112.141
  167.88.15.198
  167.88.161.51
  167.88.177.213
@@ -48853,9 +50185,7 @@
  167.88.181.200
  167.88.181.219
  167.88.7.134
-167.89.102.162
  167.89.106.34
-167.89.27.74
  167.89.72.11
  167.98.119.77
  167.99.0.124
@@ -48879,12 +50209,14 @@
  167.99.112.243
  167.99.12.47
  167.99.128.199
-167.99.129.62
+167.99.129.36
  167.99.13.63
  167.99.13.90
  167.99.131.238
  167.99.131.243
  167.99.132.92
+167.99.133.17
+167.99.134.244
  167.99.134.58
  167.99.136.147
  167.99.137.75
@@ -48894,12 +50226,12 @@
  167.99.139.208
  167.99.139.36
  167.99.14.237
-167.99.140.96
  167.99.141.124
  167.99.141.21
  167.99.142.69
  167.99.143.148
  167.99.144.235
+167.99.148.145
  167.99.148.91
  167.99.155.36
  167.99.159.142
@@ -48909,6 +50241,7 @@
  167.99.162.47
  167.99.163.148
  167.99.164.171
+167.99.166.195
  167.99.166.74
  167.99.167.151
  167.99.167.77
@@ -48917,6 +50250,8 @@
  167.99.169.179
  167.99.170.150
  167.99.170.79
+167.99.170.83
+167.99.170.91
  167.99.172.154
  167.99.172.193
  167.99.172.96
@@ -48932,8 +50267,10 @@
  167.99.183.120
  167.99.183.137
  167.99.183.212
+167.99.183.237
  167.99.184.107
  167.99.185.209
+167.99.185.217
  167.99.185.222
  167.99.185.235
  167.99.186.115
@@ -48943,8 +50280,8 @@
  167.99.189.132
  167.99.189.195
  167.99.190.116
-167.99.191.130
  167.99.192.133
+167.99.194.74
  167.99.195.45
  167.99.199.35
  167.99.2.104
@@ -48984,7 +50321,10 @@
  167.99.242.1
  167.99.242.54
  167.99.243.188
+167.99.243.61
+167.99.244.123
  167.99.244.151
+167.99.245.178
  167.99.245.237
  167.99.246.116
  167.99.246.213
@@ -48995,6 +50335,7 @@
  167.99.250.65
  167.99.251.157
  167.99.251.192
+167.99.251.234
  167.99.253.218
  167.99.253.42
  167.99.253.77
@@ -49040,6 +50381,7 @@
  167.99.67.142
  167.99.68.139
  167.99.68.65
+167.99.69.130
  167.99.69.167
  167.99.7.113
  167.99.7.149
@@ -49047,6 +50389,7 @@
  167.99.7.223
  167.99.7.239
  167.99.7.52
+167.99.70.194
  167.99.70.45
  167.99.70.54
  167.99.71.171
@@ -49056,6 +50399,7 @@
  167.99.75.240
  167.99.76.67
  167.99.77.111
+167.99.77.171
  167.99.77.94
  167.99.78.164
  167.99.78.74
@@ -49115,6 +50459,7 @@
  168.119.161.168
  168.119.161.172
  168.119.161.65
+168.119.162.109
  168.119.163.115
  168.119.165.1
  168.119.165.115
@@ -49174,6 +50519,7 @@
  168.121.137.64
  168.121.139.199
  168.121.139.31
+168.121.227.215
  168.121.45.208
  168.121.54.139
  168.121.56.171
@@ -49201,16 +50547,12 @@
  168.144.170.33
  168.144.91.77
  168.149.227.132
-168.151.226.149
  168.151.228.112
-168.151.228.148
-168.151.228.153
  168.151.228.219
  168.151.228.224
  168.151.228.228
  168.151.228.34
  168.151.228.51
-168.151.228.97
  168.151.229.122
  168.151.229.138
  168.151.229.215
@@ -49259,32 +50601,34 @@
  168.181.56.38
  168.181.62.74
  168.184.14.14
+168.194.13.178
  168.194.13.4
  168.194.14.126
  168.194.161.177
  168.194.161.75
+168.194.162.156
  168.194.164.46
  168.194.165.74
  168.194.201.6
  168.194.207.58
  168.194.229.55
+168.194.238.97
  168.194.48.101
  168.194.76.137
  168.194.83.25
  168.194.83.45
-168.195.132.165
  168.195.135.46
  168.195.140.1
  168.195.181.14
  168.195.182.62
+168.195.187.24
+168.195.188.53
  168.195.196.14
  168.195.196.18
  168.195.196.25
  168.195.196.29
  168.195.229.60
-168.195.252.160
  168.195.252.167
-168.195.252.177
  168.195.252.190
  168.195.252.209
  168.195.252.249
@@ -49299,6 +50643,7 @@
  168.196.114.205
  168.196.114.241
  168.196.114.7
+168.196.148.18
  168.196.255.38
  168.196.52.80
  168.196.52.82
@@ -49306,32 +50651,27 @@
  168.196.52.86
  168.196.96.37
  168.197.152.193
-168.197.17.155
  168.197.173.26
  168.197.18.197
  168.197.252.162
  168.197.52.224
  168.205.110.119
-168.205.110.94
+168.205.111.71
+168.205.124.246
  168.205.124.51
  168.205.125.65
  168.205.140.224
  168.205.154.124
  168.205.190.176
-168.205.193.150
-168.205.193.43
-168.205.194.113
-168.205.195.32
  168.205.217.121
  168.205.217.126
  168.205.217.18
  168.205.217.192
  168.205.217.207
-168.205.217.22
  168.205.217.226
+168.205.217.8
  168.205.218.109
  168.205.218.113
-168.205.218.143
  168.205.218.72
  168.205.218.87
  168.205.220.135
@@ -49346,6 +50686,7 @@
  168.226.214.98
  168.226.218.253
  168.227.106.100
+168.227.116.14
  168.227.133.76
  168.227.146.34
  168.227.147.243
@@ -49353,26 +50694,21 @@
  168.227.15.62
  168.227.158.17
  168.227.158.29
-168.227.158.33
  168.227.158.41
  168.227.158.45
  168.227.158.5
  168.227.158.53
  168.227.158.57
  168.227.158.61
-168.227.158.9
-168.227.162.162
  168.227.169.12
  168.227.212.130
-168.227.76.101
  168.227.76.103
  168.227.78.251
  168.227.88.39
-168.227.90.189
  168.227.99.11
  168.228.118.25
+168.228.150.5
  168.228.157.25
-168.228.165.17
  168.228.179.254
  168.228.192.13
  168.228.197.47
@@ -49387,6 +50723,7 @@
  168.232.13.50
  168.232.14.202
  168.232.15.162
+168.232.152.254
  168.232.172.4
  168.232.189.138
  168.232.189.243
@@ -49400,7 +50737,6 @@
  168.232.20.5
  168.232.214.26
  168.232.214.29
-168.234.106.2
  168.235.144.53
  168.235.64.100
  168.235.67.138
@@ -49411,23 +50747,33 @@
  168.235.83.139
  168.235.90.188
  168.235.98.150
-168.244.164.90
-168.245.96.169
  168.253.117.138
-168.61.181.202
+168.61.0.44
  168.61.187.121
  168.61.208.222
  168.61.39.125
+168.61.43.198
  168.61.48.144
+168.61.54.57
+168.61.66.7
+168.62.160.120
  168.62.174.233
  168.62.175.22
+168.62.176.217
  168.62.218.152
  168.62.248.25
+168.62.43.33
+168.62.50.138
+168.62.56.230
+168.62.63.104
  168.63.137.51
  168.63.14.93
  168.63.151.21
+168.63.16.141
+168.63.213.173
  168.63.54.181
  168.63.68.147
+168.70.107.167
  168.70.109.97
  168.70.37.71
  168.70.51.139
@@ -49435,7 +50781,6 @@
  168.70.62.74
  168.70.8.188
  168.80.119.4
-168.80.244.6
  168.90.113.136
  168.90.139.20
  168.90.196.156
@@ -49445,7 +50790,6 @@
  168.90.196.43
  168.90.196.71
  168.90.197.100
-168.90.197.127
  168.90.199.113
  168.90.199.135
  168.90.199.188
@@ -49455,6 +50799,7 @@
  168.90.199.45
  168.90.229.209
  168.90.253.8
+168.90.254.110
  168.90.28.62
  168.90.29.245
  168.90.50.118
@@ -49468,9 +50813,6 @@
  168.90.92.34
  168.91.37.1
  168.91.46.217
-168.91.76.109
-168.91.76.2
-168.91.76.31
  168.wtuo100.com
  1685602.servicesbpd.club
  16873.url.snwxn.com
@@ -49499,6 +50841,7 @@
  169.239.45.37
  169.239.45.78
  169.239.45.99
+169.255.106.62
  169.255.125.8
  169.255.126.211
  169.255.136.8
@@ -49516,10 +50859,11 @@
  169.44.34.203
  169.45.99.51
  169.47.122.114
-169.47.2.89
  169.47.242.86
+169.48.152.135
  169.48.163.176
  169.48.179.124
+169.48.94.101
  169.50.3.171
  169.50.62.69
  169.50.62.71
@@ -49532,6 +50876,7 @@
  169.56.71.180
  169.56.71.185
  169.56.82.101
+169.57.144.237
  169.57.144.238
  169.60.128.104
  169.60.177.102
@@ -49548,21 +50893,24 @@
  170.0.126.252
  170.0.154.189
  170.0.190.5
-170.0.198.103
  170.0.202.6
  170.0.203.0
  170.0.203.117
  170.0.44.236
+170.0.45.208
+170.0.45.73
  170.0.52.146
  170.0.52.226
  170.0.52.29
  170.0.52.6
  170.10.240.246
+170.106.100.128
  170.106.104.152
  170.106.143.105
  170.106.151.211
  170.106.155.8
  170.106.158.156
+170.106.3.225
  170.106.33.223
  170.106.33.94
  170.106.34.74
@@ -49693,10 +51041,10 @@
  170.146.221.13
  170.146.221.230
  170.150.102.69
-170.150.103.93
  170.150.52.210
  170.150.52.5
  170.150.52.65
+170.150.53.164
  170.150.72.28
  170.150.8.1
  170.151.0.4
@@ -49706,17 +51054,18 @@
  170.177.253.26
  170.177.253.32
  170.177.253.34
-170.178.178.194
  170.185.68.14
  170.199.77.67
  170.199.81.81
  170.210.121.208
+170.210.121.66
  170.210.136.56
  170.210.176.254
  170.210.192.78
  170.210.203.201
  170.210.203.215
  170.210.214.50
+170.210.214.51
  170.210.221.48
  170.210.4.222
  170.210.71.10
@@ -49732,20 +51081,22 @@
  170.233.138.115
  170.233.138.50
  170.233.177.62
+170.233.30.33
  170.233.47.12
  170.233.47.14
+170.233.68.169
+170.233.69.207
  170.233.73.83
  170.238.113.214
  170.238.117.187
  170.238.119.77
  170.238.141.101
-170.238.143.120
  170.238.156.30
  170.238.208.3
  170.238.231.31
-170.238.255.90
  170.238.58.49
  170.238.58.50
+170.238.65.215
  170.238.74.20
  170.238.74.61
  170.239.108.10
@@ -49755,7 +51106,6 @@
  170.239.128.7
  170.239.148.99
  170.239.223.38
-170.239.40.8
  170.239.47.251
  170.244.0.178
  170.244.0.179
@@ -49786,8 +51136,8 @@
  170.245.241.76
  170.245.244.70
  170.245.249.13
-170.246.123.198
-170.246.207.53
+170.246.199.110
+170.246.204.125
  170.246.77.6
  170.246.85.106
  170.246.85.108
@@ -49806,7 +51156,6 @@
  170.247.200.1
  170.247.200.5
  170.247.201.17
-170.247.202.129
  170.247.203.5
  170.247.43.142
  170.249.178.19
@@ -49818,7 +51167,6 @@
  170.253.24.53
  170.253.26.182
  170.253.26.68
-170.253.31.208
  170.253.33.200
  170.253.39.158
  170.253.44.215
@@ -49827,9 +51175,8 @@
  170.254.148.94
  170.254.162.165
  170.254.224.7
-170.254.226.145
+170.254.226.100
  170.254.248.61
-170.254.26.67
  170.254.83.94
  170.254.84.59
  170.51.216.41
@@ -49839,24 +51186,23 @@
  170.75.149.14
  170.75.150.50
  170.75.162.97
-170.78.120.141
  170.78.120.213
  170.78.160.42
  170.78.172.46
  170.78.21.138
  170.78.232.96
-170.78.37.33
+170.78.31.52
  170.78.38.96
  170.78.39.132
+170.78.39.54
  170.78.39.58bin.sh
  170.78.6.130
  170.78.96.2
  170.78.96.71
  170.78.96.72
+170.79.148.21
  170.79.167.84
-170.79.180.150
  170.79.180.154
-170.79.180.156
  170.79.181.118
  170.79.181.166
  170.79.181.74
@@ -49869,14 +51215,15 @@
  170.79.87.178
  170.79.9.54
  170.79.91.98
+170.79.95.208
+170.79.95.240
+170.79.97.166
  170.79.97.29
  170.79.97.30
  170.80.12.129
-170.80.204.25
-170.80.204.87
+170.80.204.106
  170.80.207.31
-170.80.21.154
-170.80.225.224
+170.80.226.83
  170.80.226.95
  170.80.36.150
  170.80.36.2
@@ -49885,7 +51232,6 @@
  170.80.51.206
  170.80.58.202
  170.80.68.242
-170.80.71.19
  170.80.91.1
  170.80.91.10
  170.80.91.2
@@ -49903,12 +51249,14 @@
  170.81.19.89
  170.81.231.150
  170.81.231.187
+170.81.252.202
  170.81.34.54
  170.81.35.26
  170.81.37.33
  170.81.48.2
  170.81.59.2
  170.81.59.37
+170.81.80.34
  170.81.92.102
  170.81.93.44
  170.82.138.32
@@ -49916,7 +51264,6 @@
  170.82.180.65
  170.82.184.189
  170.82.194.163
-170.82.231.26
  170.82.43.83
  170.82.5.12
  170.82.52.48
@@ -49926,19 +51273,15 @@
  170.83.125.146
  170.83.156.14
  170.83.17.251
-170.83.177.114
  170.83.177.134
-170.83.177.19
  170.83.177.70
  170.83.178.100
  170.83.178.125
-170.83.178.126
  170.83.178.130
  170.83.178.146
  170.83.178.176
  170.83.178.193
  170.83.178.61
-170.83.178.83
  170.83.178.85
  170.83.178.86
  170.83.179.168
@@ -49946,12 +51289,13 @@
  170.83.179.217
  170.83.179.229
  170.83.179.92
-170.83.188.133
  170.83.199.9
+170.83.25.233
  170.83.41.73
  170.83.76.140
  170.84.113.112
  170.84.140.186
+170.84.140.44
  170.84.141.159
  170.84.141.82
  170.84.182.145
@@ -49973,9 +51317,7 @@
  1700restaurant.com
  1702525-dot-n-e-w-me-ss-age-po-rt-al.wl.r.appspot.com
  171.100.102.154
-171.100.11.50
  171.100.21.202
-171.100.29.14
  171.100.56.54
  171.100.58.6
  171.100.69.230
@@ -49984,7 +51326,7 @@
  171.101.229.169
  171.101.52.160
  171.101.68.157
-171.103.190.158
+171.103.161.26
  171.103.197.18
  171.103.9.22
  171.104.126.183
@@ -49992,7 +51334,6 @@
  171.104.221.112
  171.105.4.2
  171.105.5.23
-171.105.5.236
  171.106.28.113
  171.106.30.46
  171.107.184.195
@@ -50012,6 +51353,7 @@
  171.110.231.214
  171.110.239.85
  171.110.28.26
+171.110.28.32
  171.110.83.83
  171.111.153.150
  171.111.153.151
@@ -50026,7 +51368,6 @@
  171.115.84.184
  171.116.146.126
  171.116.38.60
-171.117.191.128
  171.117.227.170
  171.118.24.229
  171.118.244.234
@@ -50037,9 +51378,7 @@
  171.119.219.217
  171.119.223.219
  171.119.241.86
-171.119.250.112
  171.12.182.42
-171.120.115.19
  171.120.28.56
  171.121.122.102
  171.121.123.88
@@ -50053,29 +51392,29 @@
  171.123.109.137
  171.123.111.96
  171.123.120.177
+171.123.121.23
  171.123.134.224
  171.123.145.164
  171.123.15.218
-171.123.195.118
  171.123.233.157
  171.123.3.101
-171.124.135.84
  171.124.78.58
  171.125.113.225
-171.125.136.63
  171.125.139.15
-171.125.158.161
+171.125.190.170
  171.125.195.122
  171.125.2.121
  171.125.21.189
-171.125.214.27
  171.125.223.180
  171.125.236.64
  171.125.237.18
-171.125.26.105
+171.125.36.103
+171.125.4.172
+171.125.46.147
  171.125.50.166
-171.125.77.90
  171.125.80.84
+171.125.82.146
+171.125.9.65
  171.125.97.244
  171.126.212.227
  171.126.44.183
@@ -50084,32 +51423,34 @@
  171.127.59.12
  171.13.138.173
  171.13.234.204
-171.14.238.129
  171.15.0.152
  171.15.132.54
  171.15.16.116
  171.15.17.161
  171.15.2.204
  171.211.24.241
+171.212.103.245
  171.212.113.188
  171.212.113.190
  171.212.137.176
  171.212.137.177
  171.212.139.227
+171.212.200.233
  171.212.208.202
+171.214.129.119
  171.214.204.23
  171.214.204.30
-171.214.204.59
  171.217.104.202
+171.217.59.13
  171.217.71.131
  171.217.92.33
  171.22.121.37
  171.22.123.118
  171.22.123.6
  171.22.123.68
+171.22.145.248
  171.22.253.115
  171.22.253.144
-171.22.253.150
  171.22.253.186
  171.22.253.201
  171.22.255.135
@@ -50119,6 +51460,7 @@
  171.22.255.9
  171.220.191.175
  171.220.191.53
+171.220.233.85
  171.220.243.213
  171.221.151.191
  171.221.199.187
@@ -50130,6 +51472,7 @@
  171.221.236.226
  171.221.242.23
  171.221.26.6
+171.223.110.188
  171.223.111.237
  171.223.210.8
  171.223.215.215
@@ -50137,6 +51480,7 @@
  171.224.177.74
  171.224.178.87
  171.224.179.211
+171.224.180.50
  171.224.191.225
  171.224.228.92
  171.226.135.8
@@ -50145,10 +51489,13 @@
  171.226.197.110
  171.226.3.168
  171.226.4.116
+171.226.4.39
+171.226.6.53
  171.226.6.70
  171.226.7.60
  171.227.105.68
  171.227.116.5
+171.227.168.94
  171.227.172.174
  171.227.210.150
  171.227.212.238
@@ -50157,15 +51504,17 @@
  171.227.214.237
  171.227.215.155
  171.227.215.222
+171.227.215.29
  171.227.215.98
  171.227.252.213
  171.227.79.199
-171.228.173.63
  171.228.178.101
  171.228.222.123
  171.228.255.86
  171.228.68.79
+171.229.175.134
  171.229.203.34
+171.229.218.23
  171.229.49.86
  171.231.123.2
  171.231.128.43
@@ -50174,14 +51523,14 @@
  171.231.54.101
  171.232.119.171
  171.232.170.81
+171.232.240.47
  171.232.244.102
  171.232.246.202
  171.232.26.172
  171.232.70.249
  171.233.227.123
-171.233.60.83
  171.233.86.35
-171.234.206.176
+171.234.36.212
  171.235.147.18
  171.235.160.153
  171.235.169.234
@@ -50196,6 +51545,7 @@
  171.235.61.139
  171.235.61.34
  171.235.61.48
+171.235.64.190
  171.235.64.66
  171.235.72.64
  171.235.73.5
@@ -50207,20 +51557,22 @@
  171.235.82.66
  171.235.83.45
  171.235.85.47
+171.235.85.61
  171.235.86.165
  171.236.125.139
  171.236.125.88
  171.236.158.47
-171.236.191.52
  171.236.231.92
  171.237.154.231
+171.237.199.91
  171.237.213.169
+171.238.126.87
  171.238.53.21
  171.238.53.244
+171.238.90.128
  171.239.130.54
  171.239.158.249
  171.239.169.246
-171.239.170.240
  171.239.176.136
  171.239.176.47
  171.239.180.241
@@ -50248,7 +51600,6 @@
  171.240.192.30
  171.240.195.10
  171.240.196.170
-171.240.198.250
  171.240.199.109
  171.240.199.65
  171.240.200.20
@@ -50257,15 +51608,14 @@
  171.240.202.22
  171.240.203.222
  171.240.207.103
+171.240.207.93
  171.240.210.217
-171.240.213.254
  171.240.217.98
  171.240.249.203
  171.240.32.142
  171.241.109.252
  171.241.120.156
-171.241.126.114
-171.241.132.205
+171.241.121.120
  171.241.133.92
  171.241.14.170
  171.241.149.89
@@ -50274,6 +51624,7 @@
  171.241.72.143
  171.242.111.191
  171.242.24.114
+171.242.90.92
  171.243.116.79
  171.243.234.27
  171.243.36.123
@@ -50290,9 +51641,9 @@
  171.244.18.14
  171.244.18.197
  171.244.184.30
-171.244.27.185
  171.244.33.189
  171.244.38.56
+171.244.43.183
  171.244.45.137
  171.244.48.33
  171.244.49.242
@@ -50300,11 +51651,15 @@
  171.244.68.19
  171.244.68.7
  171.245.157.38
+171.245.199.115
+171.245.224.52
  171.245.228.40
  171.245.251.191
  171.246.17.116
+171.246.22.181
  171.246.42.99
  171.247.101.169
+171.247.101.187
  171.247.101.37
  171.247.103.164
  171.247.145.61
@@ -50314,7 +51669,6 @@
  171.247.171.226
  171.247.172.56
  171.247.177.120
-171.247.178.146
  171.247.254.143
  171.247.55.182
  171.247.75.208
@@ -50328,13 +51682,13 @@
  171.248.57.108
  171.248.63.238
  171.248.72.118
-171.249.101.251
  171.249.136.149
  171.249.136.175
  171.249.136.238
  171.249.137.228
  171.249.137.255
  171.249.137.5
+171.249.147.226
  171.249.176.32
  171.249.26.113
  171.249.40.51
@@ -50364,11 +51718,13 @@
  171.250.39.151
  171.250.50.83
  171.251.159.3
+171.251.19.125
  171.251.239.137
  171.251.24.13
  171.251.24.172
  171.251.27.188
  171.252.100.28
+171.252.102.101
  171.252.113.217
  171.252.116.64
  171.252.120.254
@@ -50380,95 +51736,87 @@
  171.252.95.27
  171.254.10.34
  171.254.204.79
+171.254.209.12
  171.254.224.32
  171.254.8.216
  171.255.199.129
  171.34.113.168
+171.34.114.180
  171.34.115.212
  171.34.176.13
+171.34.177.244
  171.34.178.74
  171.34.178.93
  171.34.179.79
  171.34.42.155
  171.34.70.28
-171.35.160.92
-171.35.162.182
-171.35.162.21
+171.34.78.119
+171.35.161.103
+171.35.161.202
  171.35.163.145
  171.35.166.155
  171.35.166.206
-171.35.167.140
  171.35.167.42
  171.35.170.253
  171.35.170.35
-171.35.172.170
+171.35.172.25
  171.35.173.162
-171.35.175.56
  171.35.65.80
+171.37.84.178
  171.37.86.53
-171.38.147.140
-171.38.192.212
-171.38.194.62
-171.38.20.113
+171.38.147.193
+171.38.150.1
+171.38.193.37
+171.38.216.111
+171.38.219.151
  171.39.0.8
+171.4.131.153
  171.42.161.164bin.sh
  171.43.175.85
  171.43.175.92
  171.44.143.79
-171.44.143.98
  171.44.242.58
-171.48.15.122
+171.49.183.95
  171.5.161.194
+171.5.163.56
  171.5.164.136
  171.5.165.251
  171.5.167.212
  171.5.25.55
-171.5.30.109
  171.5.31.247
  171.5.31.8
-171.50.162.181
  171.6.101.50
  171.6.129.197
  171.6.131.126
  171.6.152.133
  171.6.160.121
  171.6.229.229
-171.6.74.62
-171.60.147.183
  171.60.193.126
  171.60.251.170
-171.61.194.106
  171.7.12.45
  171.7.17.182
  171.7.21.141
+171.7.23.140
  171.7.24.182
  171.7.75.2
  171.7.77.242
  171.8.105.216
  171.8.106.237
-171.8.134.195
  171.8.6.111
  171.8.68.2
  171.8.69.13
-171.80.161.154
-171.80.161.206
-171.80.161.70
-171.80.162.152
-171.80.163.244
-171.80.185.157
-171.80.185.192
-171.80.185.194
-171.80.186.180
-171.80.187.10
-171.80.187.202
-171.80.187.226
-171.80.187.8
+171.80.161.52
+171.80.162.32
+171.80.186.243
+171.80.186.78
  171.81.80.23
+171.83.14.83
  171.84.3.43
  171.88.142.46
  171.88.188.120
  171.88.35.53
  171.88.42.35
+171.88.53.188
  171.90.251.167
  171.90.251.169
  171.90.251.98
@@ -50477,22 +51825,21 @@
  171.92.198.220
  171.92.198.226
  171.95.70.17
-171.96.174.197
  171.96.247.18
  171.97.107.42
+171.97.122.221
  171.97.129.201
+171.97.19.68
  171.97.239.70
  171.97.42.182
-171.97.42.209
  171.97.9.98
  171.98.73.6
  171298-dot-n-e-w-me-ss-age-po-rt-al.wl.r.appspot.com
  1717jackwills.000webhostapp.com
-172.10.44.238
  172.100.227.199
+172.101.70.129
  172.103.211.146
  172.103.240.142
-172.103.28.143
  172.104.108.126
  172.104.108.70
  172.104.109.160
@@ -50504,6 +51851,7 @@
  172.104.112.161
  172.104.112.244
  172.104.116.36
+172.104.118.175
  172.104.120.102
  172.104.120.61
  172.104.122.237
@@ -50564,6 +51912,7 @@
  172.104.227.51
  172.104.227.6
  172.104.233.225
+172.104.234.160
  172.104.236.86
  172.104.237.86
  172.104.239.61
@@ -50588,7 +51937,6 @@
  172.104.4.209
  172.104.4.223
  172.104.4.47
-172.104.4.91
  172.104.42.185
  172.104.47.242
  172.104.5.26
@@ -50606,6 +51954,7 @@
  172.104.75.136
  172.104.76.217
  172.104.80.117
+172.104.82.83
  172.104.87.107
  172.104.9.251
  172.104.90.95
@@ -50634,7 +51983,6 @@
  172.105.105.87
  172.105.106.200
  172.105.106.57
-172.105.106.62
  172.105.106.64
  172.105.107.134
  172.105.107.233
@@ -50653,7 +52001,6 @@
  172.105.15.118
  172.105.15.33
  172.105.15.70
-172.105.150.224
  172.105.154.151
  172.105.155.137
  172.105.155.211
@@ -50722,8 +52069,8 @@
  172.105.24.200
  172.105.241.190
  172.105.242.140
-172.105.244.15
  172.105.246.20
+172.105.247.217
  172.105.250.36
  172.105.251.61
  172.105.26.181
@@ -50802,20 +52149,20 @@
  172.107.92.18
  172.107.94.66
  172.107.95.30
+172.110.30.81
+172.110.6.104
  172.111.144.45
  172.111.144.90
  172.111.192.141
-172.112.113.246
-172.113.124.84
  172.114.161.190
  172.114.72.186
  172.114.84.139
  172.115.192.99
  172.115.51.194
+172.118.31.76
  172.118.75.53
  172.119.196.96
  172.119.74.163
-172.119.83.149
  172.120.77.58
  172.120.80.186
  172.120.80.210
@@ -50856,6 +52203,7 @@
  172.172.26.142
  172.172.26.143
  172.172.26.144
+172.172.26.145
  172.172.26.146
  172.172.26.147
  172.172.26.148
@@ -50929,10 +52277,12 @@
  172.219.78.44
  172.219.82.125
  172.220.241.91
+172.221.34.69
  172.222.209.169
  172.222.231.52
  172.222.71.62
-172.241.168.10
+172.222.85.254
+172.223.87.24
  172.243.228.72
  172.245.10.85
  172.245.103.131
@@ -50943,6 +52293,7 @@
  172.245.110.114
  172.245.110.143
  172.245.112.72
+172.245.113.196
  172.245.12.109
  172.245.135.133
  172.245.153.123
@@ -50952,7 +52303,9 @@
  172.245.159.11
  172.245.159.184
  172.245.163.48
+172.245.179.52
  172.245.181.157
+172.245.181.211
  172.245.181.236
  172.245.184.199
  172.245.185.165
@@ -50964,14 +52317,16 @@
  172.245.210.127
  172.245.210.129
  172.245.211.58
+172.245.214.117
  172.245.218.53
  172.245.220.82
  172.245.224.155
+172.245.228.28
  172.245.228.69
  172.245.228.73
+172.245.230.134
  172.245.24.161
  172.245.241.142
-172.245.242.177
  172.245.244.25
  172.245.244.28
  172.245.25.3
@@ -50985,6 +52340,7 @@
  172.245.26.140
  172.245.36.124
  172.245.36.128
+172.245.41.221
  172.245.43.90
  172.245.44.95
  172.245.5.11
@@ -50995,6 +52351,7 @@
  172.245.52.142
  172.245.52.225
  172.245.52.231
+172.245.6.16
  172.245.60.27
  172.245.64.180
  172.245.64.203
@@ -51002,12 +52359,16 @@
  172.245.64.237
  172.245.64.243
  172.245.64.246
+172.245.66.90
+172.245.68.251
  172.245.7.103
  172.245.7.157
  172.245.7.159
+172.245.7.189
  172.245.71.145
  172.245.79.127
  172.245.79.138
+172.245.79.143
  172.245.79.179
  172.245.8.102
  172.245.8.9
@@ -51021,17 +52382,19 @@
  172.245.97.184
  172.247.143.146
  172.247.246.144
+172.247.31.90
  172.247.5.13
+172.248.13.224
  172.248.174.64
  172.248.22.98
-172.248.95.193
  172.249.171.9
  172.249.80.162
  172.250.104.217
  172.250.94.19
  172.251.35.35
+172.252.15.130
+172.252.180.10
  172.252.180.90
-172.252.209.122
  172.252.242.58
  172.254.154.243
  172.254.236.78
@@ -51042,16 +52405,17 @@
  172.255.82.173
  172.255.83.104
  172.255.83.107
+172.255.83.116
  172.255.83.14
  172.255.83.169
  172.255.83.42
  172.58.22.236
  172.65.198.86
  172.68.10.14
-172.68.10.146
  172.68.10.198
-172.68.102.143
-172.68.11.33
+172.68.10.220
+172.68.10.46
+172.68.102.101
  172.68.144.140
  172.68.144.144
  172.68.146.133
@@ -51060,38 +52424,30 @@
  172.68.146.175
  172.68.146.199
  172.68.211.5
-172.68.214.170
-172.68.238.118
+172.68.238.108
+172.68.238.126
  172.68.238.130
  172.68.238.132
  172.68.238.137
  172.68.238.146
  172.68.238.234
-172.68.238.236
  172.68.238.240
-172.68.239.107
  172.68.239.13
  172.68.239.16
-172.68.239.163
  172.68.239.169
-172.68.239.186
  172.68.239.213
-172.68.239.27
-172.68.239.47
-172.68.239.53
+172.68.239.54
  172.68.239.7
-172.68.244.65
  172.68.245.253
-172.68.246.26
-172.68.37.16
+172.68.246.128
+172.68.37.44
  172.68.46.192
-172.68.65.129
+172.68.63.121
+172.68.63.147
  172.69.10.114
-172.69.10.152
  172.69.10.162
  172.69.10.180
  172.69.10.182
-172.69.10.199
  172.69.134.146
  172.69.134.182
  172.69.134.212
@@ -51102,26 +52458,27 @@
  172.69.135.57
  172.69.135.99
  172.69.170.68
-172.69.190.11
+172.69.190.16
  172.69.190.52
-172.69.190.64
+172.69.190.58
  172.69.190.66
  172.69.190.69
+172.69.190.70
  172.69.190.72
+172.69.190.77
  172.69.22.231
-172.69.33.245
-172.69.54.139
  172.69.77.16
+172.69.77.18
+172.69.77.20
  172.74.184.175
  172.76.4.246
-172.81.108.112
  172.81.140.146
  172.81.177.138
  172.81.182.34
  172.81.183.236
+172.81.204.249
  172.81.204.58
  172.81.204.95
-172.81.206.168
  172.81.207.201
  172.81.208.125
  172.81.208.50
@@ -51131,6 +52488,7 @@
  172.81.227.243
  172.81.234.10
  172.81.235.238
+172.81.235.48
  172.81.239.21
  172.81.239.224
  172.81.240.237
@@ -51138,6 +52496,8 @@
  172.81.242.147
  172.81.242.40
  172.81.243.195
+172.81.246.136
+172.81.253.133
  172.81.254.131
  172.82.128.202
  172.82.149.130
@@ -51150,12 +52510,10 @@
  172.83.43.134
  172.83.64.47
  172.83.73.56
-172.84.243.226
  172.86.120.215
  172.86.121.11
  172.86.126.233
  172.86.127.13
-172.86.181.58
  172.86.186.21
  172.86.188.251
  172.86.64.15
@@ -51170,21 +52528,20 @@
  172.88.54.147
  172.9.104.170
  172.90.13.91
+172.90.194.175
  172.90.198.97
  172.90.37.142
  172.91.208.86
-172.92.144.116
-172.92.157.131
+172.91.39.2
+172.93.101.49
  172.93.101.73
  172.93.120.184
-172.93.165.159
  172.93.166.12
  172.93.166.135
  172.93.38.228
  172.93.39.189
  172.93.4.78
  172.93.40.173
-172.93.43.250
  172.93.49.142
  172.93.5.130
  172.94.23.24
@@ -51192,18 +52549,20 @@
  172.94.23.9
  172.94.24.126
  172.94.24.26
-172.94.24.27
  172.94.24.70
  172.94.24.71
  172.94.24.90
  172.95.161.66
  172.95.161.71
+172.95.44.153
  172.96.16.214
+172.96.160.195
  172.96.161.244
  172.96.166.188
  172.96.176.129
  172.96.184.39
  172.96.190.154
+172.96.190.217
  172.96.191.17
  172.96.194.241
  172.96.208.126
@@ -51219,11 +52578,10 @@
  172.96.241.139
  172.96.251.203
  172.96.254.108
-172.96.93.76
  172.97.218.132
-172.97.49.163
  172.98.193.43
  172.98.193.62
+172.98.195.214
  172.98.67.34
  172.98.67.59
  172.98.67.74
@@ -51255,12 +52613,10 @@
  173.13.139.133
  173.13.190.147
  173.13.234.122
-173.14.36.86
  173.15.162.151
  173.15.162.156
  173.15.162.157
  173.15.189.86
-173.15.211.225
  173.15.28.165
  173.15.85.9
  173.161.156.201
@@ -51273,17 +52629,18 @@
  173.166.196.185
  173.167.85.89
  173.168.91.148
-173.169.46.85
  173.170.210.251
  173.170.66.25
  173.173.254.105
  173.174.181.12
  173.174.197.99
+173.174.241.123
  173.176.184.54
  173.177.165.194
  173.177.237.29
  173.177.32.179
  173.178.227.164
+173.178.76.54
  173.178.89.119
  173.179.100.75
  173.179.37.145
@@ -51293,7 +52650,6 @@
  173.181.30.127
  173.181.44.179
  173.181.58.123
-173.182.141.43
  173.183.191.153
  173.183.191.79
  173.184.104.166
@@ -51305,6 +52661,7 @@
  173.193.219.168
  173.193.22.6
  173.195.15.33
+173.196.146.66
  173.198.209.101
  173.198.52.58
  173.199.114.115
@@ -51324,15 +52681,10 @@
  173.199.143.137
  173.199.186.15
  173.199.71.150
-173.201.196.1
-173.201.196.168
-173.201.196.170
+173.201.196.197
  173.201.196.203
-173.201.196.209
-173.201.196.218
-173.201.196.220
-173.201.196.32
  173.201.196.67
+173.201.196.96
  173.201.196.97
  173.201.31.88
  173.201.39.206
@@ -51342,6 +52694,7 @@
  173.202.80.16
  173.203.126.125
  173.203.215.83
+173.206.12.170
  173.206.131.123
  173.206.88.248
  173.208.128.10
@@ -51359,11 +52712,13 @@
  173.208.153.130
  173.208.155.34
  173.208.157.186
+173.208.166.235
  173.208.166.237
  173.208.166.82
  173.208.168.194
  173.208.169.26
  173.208.169.42
+173.208.173.114
  173.208.176.146
  173.208.177.58
  173.208.177.59
@@ -51415,6 +52770,7 @@
  173.212.222.97
  173.212.223.94
  173.212.225.214
+173.212.226.164
  173.212.226.236
  173.212.228.180
  173.212.231.228
@@ -51447,6 +52803,7 @@
  173.218.133.118
  173.218.191.194
  173.219.43.147
+173.219.81.243
  173.219.86.196
  173.22.198.85
  173.220.112.156
@@ -51475,28 +52832,11 @@
  173.230.252.250
  173.231.200.117
  173.231.200.98
+173.231.241.171
  173.231.55.10
  173.231.63.88
  173.232.146.141
  173.232.146.53
-173.232.220.10
-173.232.220.11
-173.232.220.12
-173.232.220.13
-173.232.220.14
-173.232.220.15
-173.232.220.16
-173.232.220.18
-173.232.220.19
-173.232.220.20
-173.232.220.21
-173.232.220.22
-173.232.220.23
-173.232.220.24
-173.232.220.5
-173.232.220.6
-173.232.220.7
-173.232.220.8
  173.232.226.210
  173.232.226.220
  173.232.226.94
@@ -51508,6 +52848,7 @@
  173.234.100.150
  173.234.100.207
  173.234.100.47
+173.234.100.58
  173.234.143.176
  173.234.153.122
  173.234.154.143
@@ -52289,9 +53630,11 @@
  173.234.227.99
  173.236.144.82
  173.236.152.135
+173.236.176.108
  173.236.176.109
  173.236.176.111
  173.236.176.119
+173.236.176.129
  173.236.176.156
  173.236.176.167
  173.236.176.169
@@ -52299,10 +53642,19 @@
  173.236.176.197
  173.236.176.198
  173.236.176.201
+173.236.176.205
+173.236.176.207
+173.236.176.209
+173.236.176.213
  173.236.176.23
+173.236.176.24
+173.236.176.242
  173.236.176.254
+173.236.176.27
  173.236.176.31
  173.236.176.40
+173.236.176.46
+173.236.176.60
  173.236.176.67
  173.236.176.85
  173.236.176.93
@@ -52313,25 +53665,41 @@
  173.236.177.14
  173.236.177.167
  173.236.177.168
+173.236.177.176
  173.236.177.193
  173.236.177.217
  173.236.177.221
  173.236.177.255
  173.236.177.47
  173.236.177.50
+173.236.177.59
+173.236.177.60
+173.236.177.78
  173.236.177.87
  173.236.178.116
+173.236.178.130
  173.236.178.148
  173.236.178.17
  173.236.178.175
+173.236.178.19
  173.236.178.192
+173.236.178.205
  173.236.178.210
+173.236.178.224
+173.236.178.230
+173.236.178.242
  173.236.178.245
  173.236.178.42
  173.236.178.59
  173.236.178.65
+173.236.178.71
+173.236.178.76
+173.236.178.78
+173.236.179.101
  173.236.179.121
+173.236.179.128
  173.236.179.13
+173.236.179.132
  173.236.179.134
  173.236.179.15
  173.236.179.150
@@ -52339,33 +53707,67 @@
  173.236.179.157
  173.236.179.167
  173.236.179.211
+173.236.179.22
+173.236.179.222
  173.236.179.224
  173.236.179.226
  173.236.179.229
+173.236.179.234
  173.236.179.246
+173.236.179.52
  173.236.179.6
  173.236.179.76
  173.236.179.86
  173.236.180.110
-173.236.180.13
+173.236.180.116
+173.236.180.12
  173.236.180.138
  173.236.180.180
+173.236.180.184
+173.236.180.208
  173.236.180.215
  173.236.180.241
  173.236.180.242
+173.236.180.246
  173.236.180.248
+173.236.180.251
  173.236.180.32
  173.236.180.79
+173.236.180.85
  173.236.180.87
  173.236.180.91
+173.236.181.0
+173.236.181.105
+173.236.181.106
+173.236.181.108
+173.236.181.130
+173.236.181.132
+173.236.181.135
  173.236.181.154
  173.236.181.227
+173.236.181.35
+173.236.181.63
+173.236.181.76
  173.236.182.124
+173.236.182.136
+173.236.182.156
  173.236.182.188
  173.236.182.2
+173.236.182.233
+173.236.183.133
  173.236.183.134
+173.236.183.136
  173.236.183.144
+173.236.183.183
+173.236.183.192
+173.236.183.2
+173.236.183.229
  173.236.183.234
+173.236.183.241
+173.236.183.244
+173.236.183.38
+173.236.183.64
+173.236.183.71
  173.236.194.65
  173.236.224.16
  173.236.242.79
@@ -52382,6 +53784,7 @@
  173.24.15.157
  173.241.100.18
  173.242.112.93
+173.242.115.171
  173.242.118.66
  173.242.122.149
  173.243.112.231
@@ -52389,14 +53792,27 @@
  173.244.165.29
  173.244.180.50
  173.244.200.154
+173.244.200.159
  173.244.209.5
  173.244.36.48
  173.244.48.66
+173.245.202.103
+173.245.202.128
+173.245.202.136
+173.245.202.146
+173.245.202.153
  173.245.202.176
-173.245.202.192
+173.245.202.177
+173.245.202.213
+173.245.202.66
+173.245.203.118
+173.245.203.21
+173.245.203.232
  173.245.203.34
-173.245.203.46
+173.245.203.69
  173.245.203.75
+173.245.203.82
+173.245.203.93
  173.245.209.153
  173.245.71.147
  173.245.87.26
@@ -52418,12 +53834,14 @@
  173.248.242.211
  173.249.0.235
  173.249.1.160
+173.249.1.59
  173.249.12.221
  173.249.14.102
-173.249.19.204
+173.249.17.176
  173.249.2.209
  173.249.2.32
  173.249.22.26
+173.249.22.52
  173.249.24.64
  173.249.25.217
  173.249.29.113
@@ -52447,12 +53865,12 @@
  173.249.48.168
  173.249.48.175
  173.249.48.73
-173.249.49.120
  173.249.49.237
  173.249.5.217
  173.249.5.240
  173.249.51.179
  173.249.51.85
+173.249.52.86
  173.249.53.194
  173.249.54.32
  173.249.55.108
@@ -52464,7 +53882,6 @@
  173.249.8.112
  173.249.9.243
  173.249.9.82
-173.25.105.59
  173.252.18.240
  173.252.208.10
  173.252.25.66
@@ -52478,6 +53895,7 @@
  173.254.216.66
  173.254.222.162
  173.254.222.170
+173.254.225.12
  173.254.225.17
  173.254.225.31
  173.254.225.55
@@ -52485,19 +53903,14 @@
  173.254.225.98
  173.254.225.99
  173.254.231.36
-173.254.24.28
-173.254.24.33
  173.254.242.215
  173.254.247.16
  173.254.247.21
  173.254.247.52
  173.254.247.7
  173.254.250.14
-173.254.56.20
-173.254.56.26
  173.254.87.47
  173.255.115.135
-173.255.166.24
  173.255.191.16
  173.255.192.249
  173.255.193.118
@@ -52526,6 +53939,7 @@
  173.255.240.205
  173.255.248.135
  173.255.250.144
+173.26.101.232
  173.29.53.29
  173.29.92.163
  173.3.31.132
@@ -52547,16 +53961,21 @@
  173.44.164.225
  173.44.164.25
  173.44.165.133
+173.44.165.147
+173.44.165.148
  173.44.165.151
  173.44.165.155
-173.44.165.173
+173.44.165.208
  173.44.165.234
  173.44.165.46
+173.44.165.82
+173.44.165.85
+173.44.165.98
  173.44.166.108
  173.44.166.115
-173.44.166.147
+173.44.166.137
  173.44.166.170
-173.44.166.231
+173.44.166.252
  173.44.166.48
  173.44.166.49
  173.44.166.82
@@ -52566,7 +53985,6 @@
  173.44.223.19
  173.44.223.218
  173.44.223.227
-173.44.223.245
  173.44.223.91
  173.44.227.166
  173.44.227.37
@@ -52576,8 +53994,8 @@
  173.44.42.135
  173.44.42.137
  173.45.100.18
+173.45.167.50
  173.45.238.23
-173.45.35.140
  173.45.79.178
  173.45.82.82
  173.45.93.202
@@ -52587,6 +54005,7 @@
  173.48.83.37
  173.49.133.128
  173.49.86.3
+173.49.88.102
  173.51.177.2
  173.52.122.181
  173.52.38.127
@@ -52599,8 +54018,8 @@
  173.62.236.28
  173.62.253.103
  173.63.217.110
-173.63.222.65
  173.63.55.123
+173.63.73.8
  173.63.87.183
  173.63.97.174
  173.64.106.110
@@ -52627,6 +54046,7 @@
  173.78.219.97
  173.79.107.81
  173.79.252.210
+173.79.59.86
  173.8.134.217
  173.8.161.5
  173.8.46.74
@@ -52648,7 +54068,7 @@
  173.82.129.241
  173.82.129.250
  173.82.143.219
-173.82.174.213
+173.82.171.34
  173.82.180.220
  173.82.180.253
  173.82.193.75
@@ -52663,11 +54083,9 @@
  173.82.22.82
  173.82.22.86
  173.82.22.89
-173.82.226.206
  173.82.239.141
  173.82.243.98
  173.82.255.36
-173.82.6.226
  173.82.60.91
  173.82.97.197
  173.82.97.198
@@ -52694,7 +54112,6 @@
  174.0.187.106
  174.0.252.47
  174.0.84.93
-174.1.55.251
  174.1.69.54
  174.100.134.211
  174.100.209.2
@@ -52741,6 +54158,7 @@
  174.128.226.101
  174.128.235.243
  174.128.245.209
+174.128.65.135
  174.129.10.127
  174.129.107.95
  174.129.116.139
@@ -52769,7 +54187,9 @@
  174.136.47.243
  174.136.47.244
  174.136.5.169
+174.136.5.177
  174.137.50.72
+174.137.55.140
  174.137.60.247
  174.138.0.164
  174.138.10.156
@@ -52884,6 +54304,8 @@
  174.21.86.74
  174.27.70.18
  174.28.78.35
+174.29.166.110
+174.3.106.45
  174.3.14.10
  174.3.154.99
  174.30.96.209
@@ -52893,25 +54315,24 @@
  174.37.231.112
  174.37.60.226
  174.4.137.104
+174.4.21.207
  174.4.30.3
  174.4.43.125
+174.4.47.130
  174.4.53.174
  174.4.72.133
-174.44.40.192
  174.45.112.144
  174.46.41.30
  174.48.180.23
  174.48.248.40
+174.48.98.61
  174.50.204.190
  174.50.230.87
  174.51.16.33
  174.52.101.82
  174.52.145.246
-174.52.233.43
  174.53.205.4
-174.55.155.68
  174.56.10.8
-174.56.7.208
  174.57.140.209
  174.58.99.42
  174.59.111.141
@@ -52924,11 +54345,13 @@
  174.63.236.83
  174.64.199.79
  174.64.199.82
+174.66.106.22
  174.67.239.42
  174.7.236.255
  174.7.29.42
  174.70.241.10
  174.70.241.14
+174.70.241.17
  174.70.241.27
  174.70.241.7
  174.70.241.8
@@ -52939,7 +54362,6 @@
  174.73.246.193
  174.73.31.65
  174.75.211.222
-174.76.35.15
  174.76.35.7
  174.76.48.225
  174.76.48.228
@@ -52954,19 +54376,18 @@
  174.77.209.94
  174.78.198.170
  174.79.125.130
-174.80.133.48
-174.80.8.118
  174.81.20.48
-174.81.229.190
-174.82.174.236
  174.82.216.89
  174.83.78.228
-174.83.84.232
  174.84.148.29
  174.84.183.72
-174.84.66.17
-174.85.40.97
  174.85.6.114
+174.86.244.58
+174.86.83.184
+174.87.100.122
+174.87.16.123
+174.88.141.103
+174.88.142.171
  174.88.159.10
  174.88.165.121
  174.89.183.229
@@ -52984,9 +54405,7 @@
  174.94.155.224
  174.95.178.64
  175-365.net
-175.0.134.251
  175.0.235.83
-175.10.104.216
  175.10.129.122
  175.10.13.25
  175.10.14.68
@@ -52997,7 +54416,8 @@
  175.10.185.109
  175.10.185.40
  175.10.25.210
-175.10.49.75
+175.10.48.17
+175.10.48.236
  175.10.75.44
  175.100.103.132
  175.100.103.170
@@ -53013,12 +54433,13 @@
  175.100.73.206
  175.100.74.202
  175.100.86.17
+175.101.117.8
  175.101.129.85
  175.101.13.125
-175.101.67.132
  175.102.16.120
  175.102.6.163
  175.102.8.25
+175.103.38.146
  175.103.47.1
  175.106.10.226
  175.106.12.182
@@ -53043,6 +54464,7 @@
  175.11.194.56
  175.11.195.108
  175.11.195.90
+175.11.215.222
  175.11.64.169
  175.11.64.170
  175.11.94.110
@@ -53057,6 +54479,7 @@
  175.111.54.77
  175.111.91.143
  175.112.247.61
+175.112.89.171
  175.114.15.229
  175.115.224.95
  175.116.199.21
@@ -53067,6 +54490,7 @@
  175.117.184.136
  175.117.40.19
  175.118.126.20
+175.118.126.81
  175.118.126.99
  175.118.152.100
  175.119.227.223
@@ -53079,7 +54503,6 @@
  175.123.253.220
  175.123.253.79
  175.123.98.240
-175.124.208.103
  175.124.21.65
  175.124.230.157
  175.125.216.117
@@ -53092,7 +54515,7 @@
  175.127.128.165
  175.127.211.136
  175.136.130.156
-175.136.172.244
+175.136.172.75
  175.136.2.222
  175.136.220.21
  175.136.226.231
@@ -53104,9 +54527,11 @@
  175.137.121.75
  175.137.192.122
  175.137.230.251
+175.137.71.248
  175.137.99.197
  175.138.108.78
  175.138.15.87
+175.138.229.130
  175.138.233.116
  175.138.48.167
  175.138.70.145
@@ -53114,7 +54539,9 @@
  175.138.99.100
  175.139.161.92
  175.139.166.200
+175.139.170.126
  175.139.179.65
+175.139.191.169
  175.139.202.201
  175.139.226.12
  175.139.226.120
@@ -53130,6 +54557,8 @@
  175.140.189.159
  175.140.217.55
  175.140.230.109
+175.140.84.208
+175.140.86.79
  175.140.89.82
  175.141.137.165
  175.141.147.189
@@ -53138,15 +54567,17 @@
  175.141.163.36
  175.141.168.226
  175.141.171.247
+175.141.20.111
+175.141.232.215
  175.141.53.229
  175.141.63.74
  175.141.69.201
  175.142.110.107
+175.142.161.92
  175.142.186.5
  175.143.115.179
  175.143.208.63
  175.143.228.210
-175.143.248.217
  175.143.254.232
  175.143.51.221
  175.144.198.225
@@ -53156,7 +54587,6 @@
  175.144.228.204
  175.144.251.146
  175.144.44.2
-175.145.190.205
  175.145.195.250
  175.145.209.109
  175.145.214.70
@@ -53172,7 +54602,6 @@
  175.146.250.231
  175.146.252.106
  175.146.34.222
-175.147.0.241
  175.147.119.3
  175.147.21.193
  175.147.44.214
@@ -53182,16 +54611,17 @@
  175.148.11.223
  175.148.12.207
  175.148.195.28
+175.148.42.115
  175.148.62.6
  175.148.86.1
  175.149.169.106
  175.149.181.125
  175.149.186.155
  175.149.199.77
-175.149.245.4
  175.149.248.96
  175.149.48.31
  175.149.94.102
+175.149.94.44
  175.150.128.216
  175.150.129.234
  175.150.46.246
@@ -53207,23 +54637,25 @@
  175.151.82.184
  175.151.86.18
  175.152.11.254
-175.153.139.24
-175.153.160.122
  175.153.174.196
  175.153.228.78
  175.153.237.90
  175.153.251.88
+175.155.178.66
  175.155.237.185
  175.155.61.122
  175.158.156.76
  175.158.170.213
+175.158.38.177
  175.158.38.249
  175.158.40.140
  175.158.40.97
  175.158.57.210
  175.158.6.250
+175.16.19.238
  175.16.216.241
  175.16.236.21
+175.16.27.79
  175.16.3.69
  175.16.5.93
  175.16.6.188
@@ -53236,6 +54668,7 @@
  175.161.245.21
  175.161.253.194
  175.161.29.105
+175.162.10.93
  175.162.150.58
  175.162.197.87
  175.162.199.178
@@ -53243,6 +54676,7 @@
  175.163.45.186
  175.163.46.143
  175.164.215.75
+175.164.49.54
  175.164.58.124
  175.165.124.61
  175.165.143.205
@@ -53250,8 +54684,10 @@
  175.165.173.168
  175.165.2.252
  175.165.225.101
+175.165.228.179
  175.165.228.249
  175.165.230.246
+175.165.231.83
  175.165.237.184
  175.165.30.46
  175.165.92.8
@@ -53265,13 +54701,13 @@
  175.166.68.217
  175.166.96.40
  175.167.163.193
-175.167.179.199
  175.167.33.149
  175.167.35.15
  175.168.137.38
  175.168.20.226
  175.168.204.21
  175.168.231.207
+175.168.248.51
  175.168.54.248
  175.169.163.237
  175.169.167.29
@@ -53281,10 +54717,8 @@
  175.169.187.80
  175.169.189.8
  175.169.75.72
-175.17.177.38
  175.17.192.83
  175.17.7.50
-175.17.94.50
  175.170.12.166
  175.170.14.189
  175.170.14.6
@@ -53292,6 +54726,7 @@
  175.170.3.150
  175.170.40.253
  175.170.6.235
+175.170.70.64
  175.170.74.7
  175.170.8.206
  175.171.118.113
@@ -53302,15 +54737,14 @@
  175.172.164.112
  175.172.174.191
  175.172.184.24
-175.172.187.95
-175.172.238.180
  175.172.239.59
+175.172.254.179
+175.172.44.213
+175.172.44.86
  175.172.45.36
  175.172.57.108
-175.172.60.74
  175.172.84.100
  175.172.93.252
-175.173.178.22
  175.173.220.227
  175.173.223.38
  175.173.227.103
@@ -53320,6 +54754,7 @@
  175.174.247.42
  175.174.62.4
  175.175.149.186
+175.175.168.165
  175.175.177.76
  175.175.32.226
  175.175.70.94
@@ -53351,6 +54786,7 @@
  175.180.167.218
  175.181.112.143
  175.181.175.157
+175.181.213.101
  175.181.34.50
  175.182.107.224
  175.182.185.36
@@ -53371,12 +54807,12 @@
  175.184.232.74
  175.184.233.23
  175.184.248.39
+175.186.0.200
  175.186.0.240
  175.188.188.205
  175.19.143.215
  175.19.209.244
  175.19.219.10
-175.19.30.46
  175.192.12.211
  175.192.12.27
  175.192.128.217
@@ -53417,9 +54853,7 @@
  175.196.191.240
  175.196.191.70
  175.196.243.107
-175.196.47.32
  175.196.61.1
-175.196.69.174
  175.197.159.122
  175.197.217.35
  175.197.221.220
@@ -53448,6 +54882,7 @@
  175.199.149.150
  175.199.173.66
  175.199.196.178
+175.199.227.29
  175.199.229.203
  175.199.229.203bin.sh
  175.199.238.225
@@ -53457,12 +54892,10 @@
  175.199.28.29
  175.20.161.43
  175.20.57.112
-175.20.57.41
  175.20.58.75
  175.20.59.40
  175.20.59.43
  175.20.60.75
-175.20.79.42
  175.200.130.145
  175.200.155.244
  175.200.3.32
@@ -53473,6 +54906,7 @@
  175.201.126.39
  175.201.126.41
  175.201.126.48
+175.201.126.49
  175.201.126.5
  175.201.127.67
  175.201.14.91
@@ -53504,11 +54938,13 @@
  175.204.248.141
  175.204.82.83
  175.204.98.66
+175.205.111.109
  175.205.134.235
  175.205.134.238
  175.205.143.26
  175.205.159.186
  175.205.169.137
+175.205.180.28
  175.205.182.150
  175.205.188.219
  175.205.194.153
@@ -53517,6 +54953,7 @@
  175.206.109.101
  175.206.109.18
  175.206.111.174
+175.206.125.111
  175.206.130.123
  175.206.147.232
  175.206.169.221
@@ -53535,12 +54972,14 @@
  175.207.107.199
  175.207.109.209
  175.207.12.52
+175.207.13.22
  175.207.13.25
  175.207.193.7
  175.207.29.235
  175.207.55.232
  175.208.119.125
  175.208.123.158
+175.208.176.189
  175.208.191.37
  175.208.191.43
  175.208.194.66
@@ -53550,10 +54989,10 @@
  175.209.141.227
  175.209.160.43
  175.209.179.142
-175.209.200.105
  175.209.231.97
  175.209.47.237
  175.21.186.69
+175.21.189.91
  175.21.79.118
  175.210.120.81
  175.210.146.250
@@ -53593,6 +55032,8 @@
  175.212.89.108
  175.213.104.231
  175.213.168.136
+175.213.24.199
+175.213.81.201
  175.213.81.209
  175.213.81.6
  175.213.82.57
@@ -53603,6 +55044,7 @@
  175.214.172.162
  175.214.191.78
  175.214.204.217
+175.214.206.113
  175.214.220.231
  175.214.37.176
  175.214.57.165
@@ -53626,9 +55068,12 @@
  175.22.216.222
  175.22.221.88
  175.22.223.8
+175.23.111.151
  175.23.154.109
  175.23.249.212
  175.24.100.238
+175.24.101.141
+175.24.101.37
  175.24.102.249
  175.24.103.60
  175.24.103.72
@@ -53639,7 +55084,9 @@
  175.24.107.201
  175.24.107.214
  175.24.112.11
+175.24.113.23
  175.24.113.82
+175.24.114.222
  175.24.116.10
  175.24.116.15
  175.24.116.33
@@ -53652,7 +55099,6 @@
  175.24.123.88
  175.24.124.105
  175.24.124.141
-175.24.125.226
  175.24.125.231
  175.24.126.7
  175.24.128.182
@@ -53674,12 +55120,14 @@
  175.24.16.61
  175.24.17.53
  175.24.18.134
+175.24.18.86
  175.24.186.132
  175.24.189.12
  175.24.189.160
  175.24.190.175
  175.24.190.27
  175.24.230.44
+175.24.24.159
  175.24.24.250
  175.24.34.90
  175.24.36.114
@@ -53710,33 +55158,32 @@
  175.24.81.123
  175.24.81.207
  175.24.81.65
-175.24.84.160
  175.24.85.71
  175.24.88.227
  175.24.90.42
+175.24.93.7
  175.24.95.240
  175.24.96.90
  175.24.97.164
  175.24.97.62
  175.25.16.28
  175.28.14.2
+175.29.177.38
  175.29.183.2
  175.29.188.27
  175.29.188.9
  175.29.197.226
-175.30.205.153
  175.30.74.186
  175.30.75.175
  175.31.172.238
  175.34.8.55
  175.36.140.79
-175.36.146.244
  175.36.202.62
  175.37.143.229
  175.37.205.21
  175.37.220.72
-175.37.30.167
  175.37.92.189
+175.4.223.127
  175.41.218.218
  175.41.219.163
  175.41.44.26
@@ -53748,6 +55195,7 @@
  175.42.100.24
  175.42.41.170
  175.42.96.95
+175.43.151.192
  175.43.176.182
  175.43.241.34
  175.44.158.139
@@ -53762,15 +55210,14 @@
  175.45.187.182
  175.45.187.30
  175.5.38.41
-175.5.66.230
  175.6.1.177
  175.6.102.248
  175.6.108.125
  175.6.108.213
-175.6.115.99
  175.6.130.39
  175.6.135.122
  175.6.137.38
+175.6.146.174
  175.6.146.207
  175.6.148.219
  175.6.21.77
@@ -53790,7 +55237,6 @@
  175.6.35.52
  175.6.35.82
  175.6.35.93
-175.6.36.97
  175.6.40.14
  175.6.40.19
  175.6.40.66
@@ -53803,6 +55249,7 @@
  175.6.77.131
  175.6.99.102
  175.7.161.192
+175.7.184.18
  175.8.140.92
  175.8.142.21
  175.8.174.170
@@ -53813,6 +55260,7 @@
  175.9.222.2
  175.9.31.85
  175.97.136.186
+175.98.34.63
  175.98.46.88
  1758681625.rsc.cdn77.org
  176.10.104.240
@@ -53829,7 +55277,6 @@
  176.10.235.175
  176.10.251.34
  176.10.44.190
-176.10.48.224
  176.10.63.16
  176.10.99.196
  176.10.99.200
@@ -53846,6 +55293,8 @@
  176.100.75.27
  176.101.119.72
  176.101.221.119
+176.101.237.210
+176.101.24.167
  176.102.193.16
  176.102.196.162
  176.102.224.53
@@ -53864,7 +55313,6 @@
  176.103.74.89
  176.103.91.40
  176.103.99.155
-176.104.11.77
  176.104.184.187
  176.104.25.140
  176.104.37.122
@@ -53873,18 +55321,18 @@
  176.104.52.46
  176.104.76.63
  176.105.195.122
+176.105.199.251
  176.105.202.158
  176.105.202.96
-176.105.209.68
  176.106.132.131
  176.106.186.35
  176.106.186.99
  176.106.191.2
-176.106.246.72
  176.106.26.85
  176.106.41.214
  176.106.84.1
  176.106.9.181
+176.107.131.181
  176.107.176.111
  176.107.176.164
  176.107.176.178
@@ -53926,7 +55374,9 @@
  176.111.173.11
  176.111.173.12
  176.111.173.17
+176.111.173.24
  176.111.173.29
+176.111.173.64
  176.111.180.204
  176.111.180.209
  176.111.210.40
@@ -53934,9 +55384,7 @@
  176.111.60.55
  176.111.73.57
  176.112.113.20
-176.112.136.71
  176.112.79.111
-176.113.115.132
  176.113.126.34
  176.113.157.149
  176.113.161.101
@@ -53993,10 +55441,8 @@
  176.113.161.95
  176.113.174.139
  176.113.205.44
-176.113.206.4
  176.113.209.13
  176.113.227.121
-176.113.228.24
  176.113.251.7
  176.113.252.130
  176.113.252.145
@@ -54008,18 +55454,17 @@
  176.113.52.6
  176.113.72.133
  176.113.80.252
-176.113.82.190
  176.114.0.120
  176.114.0.74
  176.114.15.81
  176.114.153.126
  176.114.153.68
  176.114.153.78
+176.114.153.92
  176.114.199.56
  176.114.209.115
  176.114.228.40
  176.115.139.225
-176.115.194.198
  176.115.197.118
  176.115.51.114
  176.115.51.177
@@ -54039,13 +55484,11 @@
  176.118.165.90
  176.118.209.247
  176.118.220.185
-176.118.26.52
  176.118.40.240
  176.118.46.219
  176.118.48.221
  176.118.48.226
  176.118.49.54
-176.118.50.77
  176.118.51.176
  176.118.54.104
  176.118.54.134
@@ -54055,7 +55498,9 @@
  176.119.1.180
  176.119.1.182
  176.119.109.177
-176.119.141.63
+176.119.134.230
+176.119.141.14
+176.119.141.209
  176.119.141.84
  176.119.156.8
  176.119.157.162
@@ -54069,14 +55514,12 @@
  176.120.37.82
  176.120.59.85
  176.120.63.35
-176.120.99.36
  176.121.14.109
  176.121.14.151
  176.121.190.15
  176.121.207.157
  176.121.224.97
  176.121.235.236
-176.121.81.51
  176.122.129.114
  176.122.141.223
  176.122.146.45
@@ -54097,15 +55540,11 @@
  176.122.189.129
  176.122.236.30
  176.122.74.152
-176.122.87.102
-176.122.87.91
  176.123.10.158
  176.123.164.240
  176.123.2.195
  176.123.2.196
  176.123.2.36
-176.123.20.92
-176.123.245.206
  176.123.29.241
  176.123.29.249
  176.123.3.129
@@ -54141,7 +55580,6 @@
  176.123.9.13
  176.123.9.171
  176.123.9.32
-176.124.188.13
  176.124.188.3
  176.124.231.76
  176.125.38.129
@@ -54153,11 +55591,11 @@
  176.126.84.210
  176.126.85.207
  176.127.109.70
+176.127.163.24
  176.127.202.132
  176.127.28.120
  176.127.3.92
  176.127.60.12
-176.134.163.155
  176.139.179.9
  176.14.135.119
  176.14.137.126
@@ -54171,18 +55609,19 @@
  176.144.65.173
  176.145.11.22
  176.15.163.216
+176.15.77.45
  176.150.179.226
-176.151.196.117
  176.154.4.240
  176.157.61.145
  176.158.56.29
  176.158.71.34
+176.159.198.245
  176.163.6.57
  176.165.48.246
  176.174.199.40
  176.175.1.113
-176.175.186.14
  176.181.56.34
+176.187.68.157
  176.191.182.3
  176.192.112.154
  176.192.182.15
@@ -54192,8 +55631,6 @@
  176.193.71.50
  176.193.74.103
  176.194.140.85
-176.194.189.39
-176.194.32.227
  176.194.43.85
  176.195.12.108
  176.196.240.34
@@ -54214,18 +55651,18 @@
  176.20.174.12
  176.20.181.128
  176.20.198.78
+176.202.138.37
  176.202.169.139
+176.202.226.181
  176.202.40.61
+176.202.43.189
  176.202.93.78
  176.202.95.217
  176.205.10.41
  176.206.133.185
-176.207.13.132
  176.210.99.14
  176.212.100.0
-176.212.100.10
  176.212.100.11
-176.212.100.12
  176.212.100.34
  176.212.100.4
  176.212.100.41
@@ -54242,10 +55679,8 @@
  176.212.104.162
  176.212.104.172
  176.212.104.173
-176.212.104.175
  176.212.104.197
  176.212.104.20
-176.212.104.203
  176.212.104.213
  176.212.104.218
  176.212.104.225
@@ -54257,7 +55692,6 @@
  176.212.104.27
  176.212.104.3
  176.212.104.40
-176.212.104.53
  176.212.104.6
  176.212.104.63
  176.212.104.65
@@ -54266,12 +55700,10 @@
  176.212.104.83
  176.212.104.84
  176.212.104.86
-176.212.108.113
  176.212.108.118
  176.212.108.121
  176.212.108.122
  176.212.108.128
-176.212.108.144
  176.212.108.147
  176.212.108.148
  176.212.108.163
@@ -54282,9 +55714,7 @@
  176.212.108.195
  176.212.108.20
  176.212.108.202
-176.212.108.234
  176.212.108.249
-176.212.108.30
  176.212.108.41
  176.212.108.53
  176.212.108.54
@@ -54300,7 +55730,6 @@
  176.212.57.207
  176.212.96.0
  176.212.96.11
-176.212.96.20
  176.212.96.24
  176.212.96.4
  176.212.96.43
@@ -54319,7 +55748,6 @@
  176.214.40.42
  176.214.40.44
  176.214.40.56
-176.214.40.57
  176.214.40.63
  176.214.44.10
  176.214.44.102
@@ -54335,12 +55763,10 @@
  176.214.44.116
  176.214.44.117
  176.214.44.119
-176.214.44.120
  176.214.44.122
  176.214.44.123
  176.214.44.125
  176.214.44.126
-176.214.44.127
  176.214.44.134
  176.214.44.137
  176.214.44.14
@@ -54354,7 +55780,6 @@
  176.214.44.157
  176.214.44.158
  176.214.44.159
-176.214.44.161
  176.214.44.171
  176.214.44.172
  176.214.44.173
@@ -54363,7 +55788,6 @@
  176.214.44.185
  176.214.44.186
  176.214.44.191
-176.214.44.193
  176.214.44.194
  176.214.44.196
  176.214.44.199
@@ -54423,7 +55847,9 @@
  176.216.72.13
  176.217.138.229
  176.217.179.170
+176.217.227.115
  176.217.35.69
+176.217.41.56
  176.217.9.127
  176.218.14.131
  176.218.200.239
@@ -54432,6 +55858,7 @@
  176.218.82.61
  176.221.104.2
  176.221.116.10
+176.221.123.149
  176.221.166.166
  176.221.188.104
  176.221.188.168
@@ -54459,11 +55886,12 @@
  176.221.251.238
  176.221.251.87
  176.221.42.32
+176.221.43.131
  176.221.48.214
-176.222.141.166
-176.222.159.163
+176.221.7.220
  176.222.226.8
  176.222.34.111
+176.222.58.36
  176.223.1.70
  176.223.111.116
  176.223.111.190
@@ -54474,9 +55902,9 @@
  176.226.158.131
  176.226.184.88
  176.226.188.110
-176.226.188.248
  176.226.224.47
  176.226.229.208
+176.226.241.116
  176.227.188.16
  176.227.188.66
  176.227.246.168
@@ -54486,7 +55914,6 @@
  176.234.42.4
  176.235.137.2
  176.235.139.114
-176.235.139.23
  176.235.159.225
  176.235.164.177
  176.235.178.178
@@ -54529,7 +55956,6 @@
  176.241.92.38
  176.241.94.146
  176.241.94.228
-176.25.179.34
  176.25.18.22
  176.250.75.193
  176.251.164.205
@@ -54537,6 +55963,7 @@
  176.252.72.167
  176.253.217.45
  176.254.90.73
+176.26.166.66
  176.26.189.40
  176.28.116.58
  176.30.212.184
@@ -54562,7 +55989,9 @@
  176.31.165.144
  176.31.17.187
  176.31.18.148
+176.31.181.168
  176.31.182.125
+176.31.182.58
  176.31.182.79
  176.31.193.24
  176.31.200.125
@@ -54591,6 +56020,7 @@
  176.31.255.223
  176.31.255.63
  176.31.31.185
+176.31.34.12
  176.31.46.178
  176.31.46.240
  176.31.54.244
@@ -54611,7 +56041,9 @@
  176.35.212.240
  176.35.242.118
  176.35.248.160
+176.36.109.96
  176.36.131.100
+176.36.192.193
  176.36.20.11
  176.36.20.67
  176.36.255.12
@@ -54634,43 +56066,56 @@
  176.40.124.52
  176.40.167.253
  176.40.48.61
+176.40.80.224
  176.41.145.57
  176.41.147.177
  176.41.178.252
+176.41.4.171
  176.42.114.128
  176.42.247.110
  176.44.76.124
  176.46.123.40
  176.48.138.207
+176.48.16.119
  176.48.20.69
  176.48.50.193
-176.49.19.15
+176.49.207.250
  176.50.157.109
-176.51.109.8
+176.51.189.21
+176.51.216.243
  176.52.200.130
  176.52.219.6
  176.52.253.14
-176.52.34.224
-176.53.10.187
  176.53.112.108
  176.53.160.170
  176.53.81.67
  176.53.90.26
+176.56.107.133
+176.56.107.138
+176.56.107.143
  176.56.107.147
+176.56.107.166
  176.56.107.184
-176.56.107.198
  176.56.107.210
-176.56.107.224
+176.56.107.214
+176.56.107.240
+176.56.107.246
  176.56.107.252
+176.56.107.253
+176.56.107.67
+176.56.107.73
  176.56.107.77
+176.56.107.90
+176.56.107.93
+176.56.140.131
  176.56.182.71
  176.56.225.110
  176.56.225.111
  176.56.236.158
  176.56.236.76
  176.56.237.165
+176.56.237.242
  176.56.61.4
-176.56.91.145
  176.56.91.92
  176.57.128.87
  176.57.71.45
@@ -54695,13 +56140,8 @@
  176.58.61.49
  176.58.89.182
  176.58.93.123
-176.59.100.50
-176.59.143.165
+176.59.102.124
  176.59.151.38
-176.59.48.53
-176.59.55.156
-176.59.72.210
-176.59.8.233
  176.60.193.156
  176.61.1.4
  176.61.137.230
@@ -54718,15 +56158,13 @@
  176.62.188.138
  176.62.188.158
  176.62.85.42
+176.63.10.96
+176.63.17.144
  176.63.18.66
-176.63.205.248
  176.63.23.105
  176.63.26.85
  176.63.56.31
  176.63.82.33
-176.64.20.93
-176.64.31.109
-176.65.190.50
  176.65.241.209
  176.67.16.108
  176.67.59.98
@@ -54761,16 +56199,18 @@
  176.74.95.3
  176.78.29.155
  176.79.187.133
+176.79.84.115
  176.79.88.189
  176.8.90.171
  176.8.91.58
-176.82.202.205
+176.84.31.219
  176.85.220.153
+176.85.238.199
  176.85.239.191
  176.86.165.85
  176.88.224.211
+176.88.31.24
  176.88.47.46
-176.9.1.234
  176.9.10.227
  176.9.101.122
  176.9.101.91
@@ -54790,6 +56230,7 @@
  176.9.15.75
  176.9.156.51
  176.9.165.169
+176.9.172.105
  176.9.188.7
  176.9.219.38
  176.9.22.148
@@ -54799,7 +56240,6 @@
  176.9.30.46
  176.9.32.126
  176.9.38.164
-176.9.41.169
  176.9.42.253
  176.9.47.132
  176.9.47.5
@@ -54843,6 +56283,7 @@
  176.93.82.140
  176.93.93.52
  176.95.184.111
+176.96.11.7
  176.96.236.20
  176.96.241.1
  176.96.241.253
@@ -54881,14 +56322,13 @@
  177.1.202.137
  177.1.213.19
  177.1.214.207
+177.1.214.84
  177.1.26.130
  177.10.116.72
-177.10.144.174
  177.10.144.22
  177.10.144.222
  177.10.144.94
  177.10.193.91
-177.10.196.143
  177.10.197.202
  177.10.200.110
  177.10.200.245
@@ -54896,18 +56336,15 @@
  177.10.211.198
  177.10.212.166
  177.10.231.97
-177.10.240.102
-177.10.241.104
  177.10.84.121
  177.100.130.96
-177.100.9.200
  177.101.0.252
  177.101.124.34
  177.101.125.251
-177.101.131.138
  177.101.172.14
  177.101.180.192
  177.101.184.132
+177.102.164.54
  177.102.165.196
  177.102.19.240
  177.103.152.191
@@ -54927,10 +56364,12 @@
  177.104.115.16
  177.104.115.26
  177.104.124.235
+177.104.125.229
  177.104.192.122
  177.104.50.63
  177.104.83.16
  177.105.116.214
+177.105.117.131
  177.105.159.83
  177.105.192.121
  177.105.192.76
@@ -54945,7 +56384,6 @@
  177.106.151.137
  177.106.179.186
  177.106.218.178
-177.106.96.199
  177.107.125.142
  177.107.134.94
  177.107.235.38
@@ -54957,7 +56395,6 @@
  177.107.90.191
  177.11.136.76
  177.11.156.246
-177.11.184.18
  177.11.19.208
  177.11.232.73
  177.11.251.105
@@ -54969,7 +56406,6 @@
  177.11.85.9
  177.11.92.241
  177.118.184.168
-177.12.163.114
  177.12.2.53
  177.12.227.131
  177.12.239.130
@@ -54978,6 +56414,7 @@
  177.124.10.53
  177.124.101.103
  177.124.102.135
+177.124.112.12
  177.124.184.72
  177.124.185.0
  177.124.195.194
@@ -54985,11 +56422,12 @@
  177.124.217.185
  177.124.225.106
  177.124.40.7
+177.125.144.114
  177.125.16.12
+177.125.160.17
  177.125.161.103
  177.125.161.32
  177.125.162.105
-177.125.163.114
  177.125.163.205
  177.125.163.95
  177.125.165.207
@@ -54999,7 +56437,7 @@
  177.125.169.6
  177.125.192.234
  177.125.20.35
-177.125.204.136
+177.125.204.177
  177.125.204.241
  177.125.204.31
  177.125.205.44
@@ -55009,12 +56447,13 @@
  177.125.40.166
  177.125.90.226
  177.126.0.115
-177.126.10.242
  177.126.123.82
  177.126.130.112
  177.126.154.102
+177.126.208.111
  177.126.212.166
  177.126.220.58
+177.126.224.24
  177.126.238.200
  177.126.78.10
  177.126.81.33
@@ -55040,12 +56479,15 @@
  177.129.17.52
  177.129.202.92
  177.129.202.97
+177.129.206.124
  177.129.206.128
+177.129.206.133
+177.129.206.173
  177.129.206.204
-177.129.206.78
  177.129.207.23
  177.129.24.194
  177.129.250.217
+177.129.252.185
  177.129.40.117
  177.129.48.34
  177.129.8.18
@@ -55054,10 +56496,13 @@
  177.130.110.87
  177.130.140.227
  177.130.141.181
+177.130.163.130
  177.130.51.198
  177.130.60.243
  177.130.95.154
  177.130.95.172
+177.131.100.196
+177.131.121.174
  177.131.13.9
  177.131.136.130
  177.131.22.186
@@ -55065,13 +56510,16 @@
  177.132.71.197
  177.132.84.51
  177.133.196.70
+177.133.198.2
  177.134.166.10
+177.134.170.38
  177.134.239.16
  177.134.242.179
-177.134.89.115
  177.135.101.101
  177.135.101.5
+177.135.103.54
  177.135.241.75
+177.135.93.227
  177.136.121.145
  177.136.129.2
  177.136.14.178
@@ -55093,17 +56541,16 @@
  177.137.160.233
  177.137.160.236
  177.137.163.55
-177.137.163.61
-177.137.168.128
  177.137.168.130
  177.137.168.132
  177.137.168.143
  177.137.168.147
-177.137.168.149
+177.137.168.148
  177.137.168.151
  177.137.168.155
  177.137.170.170
  177.137.170.202
+177.137.207.202
  177.137.207.51
  177.137.222.70
  177.137.227.14
@@ -55112,7 +56559,9 @@
  177.137.40.86
  177.137.96.14
  177.137.96.2
+177.137.96.24
  177.138.254.162
+177.139.100.143
  177.139.129.17
  177.139.130.157
  177.139.132.179
@@ -55138,15 +56587,13 @@
  177.144.134.91
  177.144.135.2
  177.144.141.144
-177.145.146.31
  177.145.220.81
-177.149.38.175
+177.147.19.196
  177.152.124.19
  177.152.124.20
  177.152.124.21
  177.152.124.23
  177.152.124.24
-177.152.177.208
  177.152.190.253
  177.152.54.10
  177.152.54.12
@@ -55154,10 +56601,14 @@
  177.152.54.6
  177.154.16.102
  177.154.224.206
+177.154.226.60
+177.154.226.86
  177.154.230.149
+177.154.230.238
+177.154.236.233
  177.154.237.186
-177.154.237.97
-177.154.238.44
+177.154.237.79
+177.154.238.71
  177.154.49.130
  177.154.49.132
  177.154.49.184
@@ -55166,25 +56617,24 @@
  177.154.52.34
  177.154.52.48
  177.154.55.114
-177.154.72.24
+177.154.72.23
+177.154.8.144
  177.155.134.68
  177.155.16.219
  177.155.180.2
  177.155.185.214
  177.155.232.15
  177.155.248.159
-177.155.252.124
  177.155.94.32
  177.156.192.198
-177.156.230.111
  177.156.230.130
  177.157.103.203
-177.157.114.139
  177.157.158.96
  177.157.253.143
  177.158.13.126
  177.158.5.11
  177.159.120.182
+177.159.146.68
  177.159.198.38
  177.159.234.74
  177.16.100.113
@@ -55205,6 +56655,7 @@
  177.175.236.137
  177.175.253.78
  177.177.104.117
+177.179.81.8
  177.18.116.251
  177.18.198.168
  177.18.48.136
@@ -55217,12 +56668,14 @@
  177.182.175.245
  177.182.26.43
  177.182.40.23
+177.182.77.194
  177.184.101.158
  177.184.137.165
  177.184.139.81
  177.184.140.222
  177.184.191.22
  177.184.192.50
+177.184.202.217
  177.184.207.125
  177.184.245.98
  177.184.246.244
@@ -55230,7 +56683,6 @@
  177.184.44.190
  177.184.44.197
  177.184.44.230
-177.184.44.231
  177.184.44.24
  177.184.44.64
  177.184.44.7
@@ -55256,9 +56708,10 @@
  177.185.32.1
  177.188.121.26
  177.188.160.67
+177.188.168.54
  177.189.228.188
+177.189.244.193
  177.19.111.143
-177.19.129.196
  177.19.164.149
  177.19.187.79
  177.19.238.230
@@ -55275,19 +56728,21 @@
  177.190.74.41
  177.190.83.226
  177.190.83.45
-177.191.148.110
+177.190.83.97
  177.191.173.222
  177.191.253.4
  177.192.144.249
+177.193.110.69
+177.194.49.140
  177.194.49.35
  177.194.65.21
  177.195.154.42
  177.195.18.99
  177.198.97.56
  177.20.213.173
-177.20.220.89
  177.200.16.10
  177.200.189.205
+177.200.204.145
  177.200.243.50
  177.200.247.235
  177.200.35.217
@@ -55304,9 +56759,8 @@
  177.200.35.37
  177.200.35.41
  177.200.65.255
-177.200.66.11
  177.200.72.214
-177.200.76.53
+177.200.76.54
  177.200.89.62
  177.200.90.94
  177.200.94.150
@@ -55318,6 +56772,7 @@
  177.204.159.49
  177.204.167.141
  177.204.43.242
+177.205.115.255
  177.205.154.237
  177.205.20.200
  177.205.218.12
@@ -55327,21 +56782,25 @@
  177.206.138.43
  177.206.143.105
  177.206.181.186
-177.206.61.42
+177.207.110.127
  177.207.192.137
  177.207.204.230
  177.207.58.211
+177.207.94.161
  177.21.120.102
  177.21.121.10
  177.21.19.87
-177.21.213.1
+177.21.213.18
+177.21.213.51
  177.21.30.36
+177.21.30.45
  177.21.33.193
  177.21.36.73
  177.21.37.106
  177.21.54.115
  177.21.60.18
  177.21.96.222
+177.22.119.216
  177.22.124.170
  177.22.14.250
  177.22.188.15
@@ -55357,12 +56816,15 @@
  177.220.133.158
  177.220.141.134
  177.220.148.62
+177.220.173.135
  177.220.173.136
  177.220.174.15
+177.220.174.238
  177.220.174.41
  177.220.178.192
  177.220.178.196
  177.220.178.203
+177.220.178.246
  177.220.188.143
  177.220.188.213
  177.220.188.216
@@ -55371,26 +56833,27 @@
  177.220.206.138
  177.220.226.122
  177.221.108.100
+177.221.176.26
  177.221.176.66
  177.221.176.77
  177.221.34.141
  177.222.144.124
+177.222.224.6
  177.222.254.169
  177.222.46.83
  177.223.16.58
-177.223.226.29
  177.223.226.85
  177.223.48.126
  177.223.50.130
  177.223.58.68
  177.223.59.201
  177.223.63.26
-177.223.65.201
-177.223.81.210
+177.224.35.86
  177.224.90.29
  177.226.25.78
  177.227.44.114
  177.227.44.127
+177.227.44.37
  177.227.44.71
  177.23.138.92
  177.23.149.18
@@ -55400,6 +56863,7 @@
  177.23.184.166
  177.23.184.99
  177.23.191.244
+177.23.212.57
  177.23.227.136
  177.23.58.23
  177.23.7.151
@@ -55412,24 +56876,26 @@
  177.234.154.77
  177.234.166.226
  177.235.19.251
-177.236.3.72
  177.238.248.101
  177.238.249.14
  177.239.160.121
  177.239.51.129
  177.240.102.153
+177.240.107.34
  177.240.174.84
  177.240.187.74
-177.240.195.235
  177.240.204.200
  177.240.206.74
+177.240.214.202
  177.241.245.226
  177.241.248.22
  177.242.49.94
  177.244.220.235
+177.244.28.66
  177.244.36.134
+177.244.44.98
  177.247.70.91
-177.248.235.229
+177.249.160.60
  177.255.76.47
  177.27.212.168
  177.30.47.9
@@ -55450,7 +56916,6 @@
  177.35.7.42
  177.36.128.162
  177.36.159.34
-177.36.176.120
  177.36.221.11
  177.36.246.159
  177.36.248.221
@@ -55459,8 +56924,9 @@
  177.36.89.10
  177.37.161.4
  177.37.164.125
+177.37.165.36
  177.37.165.88
-177.37.175.3
+177.37.166.211
  177.37.176.210
  177.37.240.140
  177.37.240.52
@@ -55476,16 +56942,13 @@
  177.38.215.73
  177.38.22.209
  177.38.232.40
-177.38.234.33
-177.38.234.50
-177.38.235.106
  177.38.243.90
  177.38.253.121
  177.38.35.66
  177.38.39.130
  177.38.69.111
  177.38.76.5
-177.39.125.247
+177.39.129.116
  177.39.155.220
  177.39.187.70
  177.39.191.94
@@ -55495,15 +56958,18 @@
  177.39.84.104
  177.4.121.4
  177.42.118.254
+177.42.242.148
  177.42.71.208
  177.42.74.48
  177.43.249.42
+177.43.35.6
  177.43.63.62
  177.43.83.122
+177.43.94.109
+177.44.16.142
+177.44.16.229
  177.44.161.5
-177.44.17.178
  177.44.17.237
-177.44.17.64
  177.44.17.75
  177.44.18.114
  177.44.18.124
@@ -55514,11 +56980,13 @@
  177.44.70.8
  177.44.82.232
  177.44.88.168
+177.45.19.92
+177.45.201.188
  177.46.141.143
  177.46.147.89
  177.46.147.94
  177.46.192.213
-177.47.135.246
+177.47.140.136
  177.47.193.74
  177.47.194.59
  177.47.224.1
@@ -55530,12 +56998,11 @@
  177.52.25.8
  177.52.255.235
  177.52.26.194
-177.52.26.220
  177.52.26.234
  177.52.48.225
  177.52.54.72
-177.52.74.49
  177.53.105.88
+177.53.106.76
  177.53.152.36
  177.53.7.211
  177.53.7.234
@@ -55552,15 +57019,15 @@
  177.54.152.38
  177.54.152.57
  177.54.195.48
+177.54.195.55
  177.54.201.168
  177.54.224.203
  177.54.224.222
  177.54.224.245
-177.54.251.233
-177.54.28.251
  177.54.34.9
  177.54.41.185
  177.54.46.248
+177.54.55.219
  177.55.114.21
  177.55.143.141
  177.55.157.11
@@ -55568,6 +57035,7 @@
  177.56.26.255
  177.56.84.138
  177.57.168.220
+177.57.225.28
  177.58.222.170
  177.62.54.220
  177.62.80.237
@@ -55599,6 +57067,7 @@
  177.67.241.127
  177.67.244.77
  177.67.245.197
+177.67.4.131
  177.67.5.142
  177.67.8.15
  177.67.8.223
@@ -55617,7 +57086,6 @@
  177.69.19.49
  177.69.203.7
  177.69.227.169
-177.69.227.170
  177.69.23.177
  177.69.237.54
  177.69.237.60
@@ -55638,8 +57106,10 @@
  177.72.113.193
  177.72.113.246
  177.72.13.80
+177.72.14.158
  177.72.185.94
  177.72.21.98
+177.72.4.74
  177.72.6.18
  177.72.6.195
  177.72.72.217
@@ -55660,17 +57130,19 @@
  177.73.248.26
  177.73.248.38
  177.73.248.6
-177.73.25.180
+177.73.25.141
  177.73.25.249
  177.73.25.251
  177.73.250.160
  177.73.250.193
  177.73.250.253
+177.73.28.199
  177.73.3.206
  177.73.30.10
  177.73.4.96
  177.73.44.169
  177.73.47.110
+177.73.68.132
  177.73.68.138
  177.73.8.230
  177.73.8.42
@@ -55682,18 +57154,21 @@
  177.74.153.190
  177.74.2.10
  177.74.252.95
+177.74.254.101
+177.74.254.84
  177.74.63.197
  177.75.143.241
  177.75.15.162
  177.75.159.200
-177.75.242.192
+177.75.159.24
  177.75.246.189
-177.75.247.90
  177.75.248.131
  177.75.252.229
+177.75.254.146
  177.75.254.30
  177.75.58.84
  177.75.69.142
+177.75.7.171
  177.76.128.176
  177.76.161.239
  177.76.161.59
@@ -55707,13 +57182,14 @@
  177.76.224.194
  177.78.156.50
  177.78.197.133
-177.79.7.163
  177.8.124.3
  177.8.126.127
  177.8.126.61
  177.8.172.137
+177.8.172.141
  177.8.174.110
  177.8.216.114
+177.8.24.9
  177.8.55.155
  177.8.55.44
  177.80.132.178
@@ -55721,6 +57197,7 @@
  177.80.132.30
  177.80.133.16
  177.80.16.234
+177.80.184.216
  177.80.26.209
  177.81.142.169
  177.81.152.247
@@ -55728,6 +57205,7 @@
  177.81.24.26
  177.81.242.235
  177.81.25.145
+177.81.27.78
  177.81.34.69
  177.81.37.23
  177.81.65.127
@@ -55758,7 +57236,6 @@
  177.85.116.78
  177.85.117.165
  177.85.121.36
-177.85.167.10
  177.85.200.241
  177.85.200.45
  177.85.203.110
@@ -55786,27 +57263,31 @@
  177.86.64.93
  177.86.80.19
  177.87.10.186
+177.87.10.76
  177.87.108.93
+177.87.11.109
+177.87.186.90
  177.87.223.194
  177.87.230.1
  177.87.252.18
  177.87.36.193
  177.87.37.28
-177.87.68.225
+177.87.60.131
  177.87.68.240
  177.87.9.141
  177.9.156.96
  177.9.187.44
-177.9.227.31
+177.9.28.148
  177.91.111.233
  177.91.113.68
+177.91.165.49
  177.91.181.234
  177.91.182.242
  177.91.186.60
  177.91.188.192
-177.91.188.28
-177.91.188.40
+177.91.211.124
  177.91.214.89
+177.91.219.249
  177.91.33.131
  177.91.33.17
  177.91.33.55
@@ -55817,20 +57298,20 @@
  177.91.75.107
  177.91.75.193
  177.91.78.253
+177.91.79.21
  177.91.80.8
  177.91.9.17
  177.92.12.74
-177.92.132.0
-177.92.132.88
+177.92.155.6
  177.92.160.254
  177.92.160.70
  177.92.160.72
  177.92.165.73
  177.92.21.2
+177.92.240.126
  177.92.247.133
  177.92.247.145
  177.92.249.112
-177.92.38.180
  177.92.38.187
  177.92.38.62
  177.92.4.58
@@ -55844,12 +57325,14 @@
  177.93.251.45
  177.93.253.8
  177.93.66.153
+177.93.66.28
  177.93.70.231
  177.93.79.18
  177.93.79.34
  177.93.79.57
  177.93.79.65
  177.94.155.190
+177.94.201.56
  177.94.203.150
  177.94.204.150
  177.94.205.59
@@ -55862,11 +57345,11 @@
  177.96.56.36
  177.97.105.212
  177.97.253.175
+177.97.43.252
  177.98.110.153
  177.98.118.197
  177.98.152.202
  177.98.157.134
-177.98.223.76
  177.98.223.78
  177.99.116.221
  177.99.175.58
@@ -55877,33 +57360,40 @@
  1775114384.jclecardinal.com
  177momo.com
  178-365.net
+178.1.138.123
+178.1.138.250
+178.10.196.40
  178.10.236.175
+178.11.178.58
  178.11.179.71
  178.11.213.49
-178.11.223.55
+178.112.134.45
  178.112.73.73
+178.113.110.96
  178.116.120.90
  178.116.213.31
  178.116.96.223
+178.118.161.146
  178.12.221.130
  178.120.181.255
  178.120.22.2
  178.120.48.199
-178.120.5.153
-178.120.82.90
  178.120.86.114
  178.121.128.17
-178.121.202.125
+178.121.221.131
  178.121.236.129
  178.121.238.63
  178.121.69.188
  178.121.69.232
+178.121.7.20
+178.122.0.130
  178.122.148.122
  178.122.205.228
+178.122.30.113
  178.122.48.251
  178.123.210.151
  178.123.210.24
-178.123.81.191
+178.123.25.148
  178.123.96.31
  178.124.131.178
  178.124.134.75
@@ -55915,20 +57405,17 @@
  178.124.202.93
  178.124.209.209
  178.124.217.197
+178.124.218.125
  178.124.28.11
  178.124.7.7
  178.125.140.61
  178.125.17.15
  178.125.183.115
  178.125.221.124
-178.126.222.35
-178.126.235.25
-178.127.171.46
-178.127.172.26
  178.127.190.155
-178.127.24.197
  178.127.241.64
  178.127.43.75
+178.127.96.173
  178.128.1.219
  178.128.100.167
  178.128.101.34
@@ -55945,6 +57432,7 @@
  178.128.107.65
  178.128.108.106
  178.128.108.166
+178.128.109.164
  178.128.11.149
  178.128.11.189
  178.128.110.241
@@ -55952,6 +57440,7 @@
  178.128.111.69
  178.128.112.14
  178.128.112.53
+178.128.113.211
  178.128.114.118
  178.128.114.145
  178.128.114.40
@@ -55984,7 +57473,6 @@
  178.128.123.151
  178.128.124.89
  178.128.125.118
-178.128.125.16
  178.128.125.4
  178.128.126.173
  178.128.127.186
@@ -55998,12 +57486,12 @@
  178.128.147.114
  178.128.147.244
  178.128.149.186
-178.128.15.105
  178.128.150.21
  178.128.152.178
  178.128.152.19
  178.128.152.194
  178.128.153.145
+178.128.153.221
  178.128.154.242
  178.128.154.65
  178.128.155.24
@@ -56019,9 +57507,12 @@
  178.128.16.146
  178.128.161.170
  178.128.162.115
+178.128.164.112
  178.128.164.145
+178.128.166.156
  178.128.169.88
  178.128.17.153
+178.128.171.124
  178.128.171.59
  178.128.172.203
  178.128.172.59
@@ -56031,11 +57522,13 @@
  178.128.176.213
  178.128.18.102
  178.128.18.14
-178.128.18.247
  178.128.18.29
  178.128.181.61
+178.128.186.168
+178.128.187.109
  178.128.188.61
  178.128.189.108
+178.128.19.183
  178.128.19.198
  178.128.193.234
  178.128.196.198
@@ -56055,10 +57548,11 @@
  178.128.21.228
  178.128.21.38
  178.128.211.191
-178.128.211.198
  178.128.211.49
  178.128.211.85
  178.128.212.164
+178.128.212.17
+178.128.212.19
  178.128.212.84
  178.128.213.127
  178.128.215.134
@@ -56066,6 +57560,7 @@
  178.128.215.172
  178.128.215.76
  178.128.217.135
+178.128.217.168
  178.128.217.210
  178.128.217.42
  178.128.217.58
@@ -56080,6 +57575,7 @@
  178.128.224.143
  178.128.225.100
  178.128.225.74
+178.128.226.142
  178.128.226.2
  178.128.227.22
  178.128.228.15
@@ -56087,7 +57583,6 @@
  178.128.228.239
  178.128.23.93
  178.128.230.120
-178.128.230.35
  178.128.230.50
  178.128.230.80
  178.128.231.38
@@ -56113,6 +57608,7 @@
  178.128.243.141
  178.128.243.225
  178.128.243.250
+178.128.243.251
  178.128.244.128
  178.128.244.143
  178.128.244.17
@@ -56164,22 +57660,25 @@
  178.128.39.110
  178.128.39.158
  178.128.39.170
-178.128.39.211
+178.128.39.2
  178.128.39.246
  178.128.39.39
  178.128.40.142
  178.128.40.56
  178.128.41.106
+178.128.41.141
  178.128.41.212
  178.128.42.164
  178.128.42.33
  178.128.45.173
  178.128.45.52
+178.128.48.11
  178.128.48.87
  178.128.48.96
  178.128.49.110
  178.128.49.224
  178.128.49.29
+178.128.5.224
  178.128.51.162
  178.128.52.193
  178.128.52.226
@@ -56188,17 +57687,23 @@
  178.128.53.79
  178.128.54.106
  178.128.54.110
+178.128.54.182
  178.128.54.44
  178.128.55.198
  178.128.55.214
+178.128.56.239
+178.128.56.254
  178.128.56.89
  178.128.58.12
  178.128.58.95
+178.128.59.146
  178.128.60.11
  178.128.61.133
  178.128.61.148
  178.128.61.211
+178.128.62.125
  178.128.62.238
+178.128.63.180
  178.128.63.182
  178.128.63.183
  178.128.63.232
@@ -56220,6 +57725,7 @@
  178.128.83.30
  178.128.84.200
  178.128.84.47
+178.128.85.92
  178.128.86.47
  178.128.87.73
  178.128.88.244
@@ -56232,6 +57738,7 @@
  178.128.91.99
  178.128.92.109
  178.128.93.251
+178.128.95.43
  178.128.96.56
  178.128.96.96
  178.128.97.198
@@ -56245,7 +57752,6 @@
  178.130.27.202
  178.130.35.187
  178.130.85.180
-178.131.31.105
  178.132.2.246
  178.132.200.244
  178.132.206.95
@@ -56263,6 +57769,7 @@
  178.134.185.23
  178.134.185.28
  178.134.185.30
+178.134.185.36
  178.134.185.42
  178.134.185.49
  178.134.185.55
@@ -56566,14 +58073,16 @@
  178.137.93.28
  178.137.95.244
  178.138.195.221
+178.140.105.20
  178.141.0.246
  178.141.1.128
  178.141.123.154
  178.141.126.118
+178.141.126.77
+178.141.127.193
  178.141.13.237
  178.141.132.216
  178.141.133.39
-178.141.135.114
  178.141.136.21
  178.141.136.214
  178.141.140.2
@@ -56584,6 +58093,7 @@
  178.141.161.58
  178.141.17.185
  178.141.171.59
+178.141.177.222
  178.141.177.90
  178.141.18.37
  178.141.182.187
@@ -56593,12 +58103,14 @@
  178.141.199.160
  178.141.199.194
  178.141.2.168
+178.141.20.255
  178.141.203.142
  178.141.206.127
  178.141.21.133
  178.141.213.210
  178.141.215.172
  178.141.215.211
+178.141.218.193
  178.141.22.123
  178.141.22.207
  178.141.22.233
@@ -56609,13 +58121,10 @@
  178.141.230.154
  178.141.232.209
  178.141.237.29
-178.141.238.85
  178.141.253.174
  178.141.26.71
-178.141.28.125
  178.141.29.79
  178.141.3.124
-178.141.3.74
  178.141.30.147
  178.141.31.45
  178.141.31.80
@@ -56626,10 +58135,9 @@
  178.141.5.27
  178.141.51.126
  178.141.51.62
-178.141.53.100
  178.141.6.24
  178.141.61.218
-178.141.64.77
+178.141.64.203
  178.141.66.137
  178.141.69.178
  178.141.69.208
@@ -56642,7 +58150,9 @@
  178.141.91.145
  178.141.91.192
  178.141.94.4
+178.142.59.185
  178.143.52.84
+178.147.232.10
  178.148.114.68
  178.148.168.147
  178.148.172.209
@@ -56650,7 +58160,7 @@
  178.149.157.252
  178.149.185.77
  178.149.192.80
-178.149.47.34
+178.149.92.217
  178.15.51.20
  178.150.102.252
  178.150.129.230
@@ -56658,7 +58168,6 @@
  178.150.146.245
  178.150.15.194
  178.150.175.196
-178.150.185.158
  178.150.194.243
  178.150.20.188
  178.150.237.198
@@ -56669,39 +58178,44 @@
  178.151.114.99
  178.151.143.112
  178.151.182.123
-178.151.198.251
  178.151.2.107
  178.151.205.154
  178.151.238.148
  178.151.24.64
  178.151.241.122
+178.151.34.43
  178.151.62.233
  178.151.70.23
  178.151.83.166
+178.151.97.195
+178.153.101.9
  178.153.107.168
  178.153.23.50
  178.153.35.32
+178.153.41.33
  178.153.41.44
  178.153.94.200
  178.154.227.101
  178.154.235.245
  178.155.12.177
-178.155.36.153
  178.155.5.1
  178.155.5.117
+178.155.5.176
+178.155.5.191
  178.155.5.210
  178.155.5.219
  178.155.72.107
  178.156.31.233
  178.156.44.128
-178.156.67.182
  178.156.67.31
+178.156.77.158
  178.157.91.113
  178.158.11.28
  178.158.182.211
  178.158.197.35
  178.158.226.210
  178.158.64.20
+178.158.67.162
  178.158.70.147
  178.159.107.156
  178.159.107.194
@@ -56710,14 +58224,12 @@
  178.159.107.41
  178.159.107.75
  178.159.107.94
-178.159.112.214
  178.159.208.203
  178.159.237.219
  178.159.240.240
  178.159.242.73
  178.159.242.91
  178.159.245.55
-178.159.3.185
  178.159.36.172
  178.159.36.185
  178.159.37.1
@@ -56726,7 +58238,6 @@
  178.159.37.128
  178.159.37.139
  178.159.37.142
-178.159.37.155
  178.159.37.157
  178.159.37.171
  178.159.37.172
@@ -56770,14 +58281,13 @@
  178.162.221.115
  178.162.222.227
  178.162.27.252
-178.164.182.78
  178.165.103.188
-178.165.128.170
-178.165.21.58
  178.165.44.122
  178.165.48.209
  178.165.72.177
+178.165.99.208
  178.167.10.176
+178.167.53.155
  178.168.120.136
  178.168.120.169
  178.168.144.58
@@ -56788,17 +58298,18 @@
  178.168.204.81
  178.168.21.28
  178.168.43.131
-178.168.6.112
  178.168.67.89
  178.168.99.136
  178.168.99.32
  178.169.110.132
+178.169.152.155
  178.169.170.112
  178.169.191.216
  178.169.217.246
  178.169.248.92
  178.169.254.113
  178.169.80.150
+178.169.87.197
  178.17.127.210
  178.17.145.83
  178.17.166.110
@@ -56850,7 +58361,6 @@
  178.174.136.148
  178.174.136.16
  178.174.136.18
-178.174.136.205
  178.174.136.21
  178.174.136.220
  178.174.136.240
@@ -56873,6 +58383,7 @@
  178.174.148.234
  178.174.148.58
  178.174.176.12
+178.174.227.153
  178.174.237.91
  178.174.246.157
  178.175.119.165
@@ -56897,10 +58408,11 @@
  178.175.245.54
  178.175.8.111
  178.176.112.248
-178.176.165.55
+178.176.175.111
  178.176.193.41
  178.176.194.24
  178.176.194.62
+178.176.218.207
  178.176.249.104
  178.176.249.143
  178.176.61.193
@@ -56915,44 +58427,44 @@
  178.18.94.247
  178.183.1.9
  178.183.99.149
-178.184.122.103
+178.184.120.104
  178.184.180.33
  178.184.78.56
  178.185.34.157
-178.187.80.64
  178.188.67.190
  178.19.106.234
  178.19.107.27
  178.19.247.25
  178.190.217.95
+178.191.190.122
+178.191.248.214
  178.192.162.246
+178.192.175.226
  178.192.52.100
  178.193.22.161
  178.193.89.142
  178.194.188.6
-178.194.193.94
  178.194.67.42
  178.194.87.238
  178.195.113.202
-178.195.218.144
+178.195.53.244
  178.196.1.133
  178.196.1.210
  178.196.19.216
  178.196.25.114
  178.196.57.3
  178.198.104.56
-178.198.130.101
  178.198.152.152
  178.198.35.158
  178.198.48.104
  178.199.127.28
+178.199.133.90
  178.199.39.47
  178.199.64.96
  178.199.86.19
  178.2.154.77
  178.20.100.35
  178.20.137.178
-178.20.140.84
  178.20.212.123
  178.20.212.149
  178.20.212.151
@@ -56963,6 +58475,7 @@
  178.20.55.18
  178.20.74.212
  178.200.152.49
+178.200.234.84
  178.201.247.152
  178.202.130.86
  178.202.3.93
@@ -56976,18 +58489,18 @@
  178.205.109.107
  178.205.136.73
  178.205.141.180
+178.205.165.200
  178.205.253.205
  178.205.253.206
  178.205.254.106
  178.206.224.16
  178.206.228.141
-178.206.229.89
  178.207.196.229
  178.207.9.210
-178.208.143.150
  178.208.163.147
  178.208.255.8
  178.208.75.227
+178.208.82.120
  178.209.121.5
  178.209.126.217
  178.209.126.68
@@ -56995,7 +58508,6 @@
  178.209.170.75
  178.209.42.84
  178.209.43.118
-178.209.55.89
  178.209.66.112
  178.209.67.73
  178.21.20.102
@@ -57011,12 +58523,14 @@
  178.211.45.66
  178.212.131.99
  178.212.133.252
+178.212.133.63
  178.212.134.160
  178.212.176.82
  178.212.216.5
  178.212.54.137
  178.212.64.52
  178.212.65.201
+178.212.9.93
  178.212.90.16
  178.213.0.207
  178.213.112.33
@@ -57026,7 +58540,6 @@
  178.213.184.108
  178.213.184.158
  178.213.185.41
-178.213.185.79
  178.213.186.103
  178.213.186.163
  178.213.186.43
@@ -57036,15 +58549,13 @@
  178.213.190.121
  178.213.190.29
  178.213.190.30
+178.213.190.34
  178.213.191.183
-178.213.53.35
-178.213.53.42
-178.213.53.43
  178.213.53.46
  178.213.53.47
  178.213.53.8
-178.213.53.9
  178.214.212.2
+178.214.243.19
  178.214.244.146
  178.214.245.131
  178.214.245.133
@@ -57074,9 +58585,8 @@
  178.216.126.72
  178.216.2.229
  178.216.200.48
-178.216.202.97
+178.216.232.173
  178.216.233.110
-178.216.233.111
  178.216.24.44
  178.216.24.49
  178.216.24.53
@@ -57090,13 +58600,10 @@
  178.216.77.165
  178.217.106.245
  178.217.112.55
-178.217.113.102
  178.217.140.68
  178.217.152.218
  178.217.152.234
-178.217.168.85
  178.217.169.10
-178.217.169.194
  178.217.172.234
  178.217.173.54
  178.217.184.212
@@ -57113,13 +58620,10 @@
  178.218.115.96
  178.218.121.21
  178.218.200.161
-178.218.200.190
-178.218.207.3
-178.218.207.36
  178.218.21.169
  178.218.22.200
  178.218.222.185
-178.218.58.234
+178.219.120.63
  178.219.123.76
  178.219.171.43
  178.219.173.193
@@ -57129,12 +58633,14 @@
  178.219.49.61
  178.219.62.208
  178.219.9.40
+178.22.117.153
  178.22.120.102
  178.22.123.150
+178.22.123.174
  178.22.168.44
-178.22.168.85
  178.22.221.201
  178.22.65.147
+178.220.251.128
  178.220.66.141
  178.221.110.179
  178.221.139.245
@@ -57146,32 +58652,30 @@
  178.222.228.190
  178.222.249.214
  178.222.8.202
+178.223.125.4
  178.223.178.103
  178.223.68.233
  178.23.236.40
  178.23.244.208
+178.234.120.17
  178.234.37.197
  178.234.40.163
-178.235.186.183
  178.236.137.63
+178.236.43.184
  178.236.61.27
  178.237.56.4
-178.238.131.112
  178.238.133.232
-178.238.189.248
-178.238.203.98
  178.238.224.146
  178.238.224.166
-178.238.224.216
  178.238.224.98
  178.238.225.45
  178.238.229.148
  178.238.232.57
  178.238.234.57
  178.238.237.56
-178.238.79.196
  178.238.79.93
  178.238.8.32
+178.239.157.232
  178.239.167.15
  178.239.168.57
  178.239.169.130
@@ -57187,7 +58691,6 @@
  178.242.91.27
  178.243.184.59
  178.245.224.70
-178.248.1.71
  178.248.108.51
  178.248.115.134
  178.248.115.47
@@ -57202,10 +58705,12 @@
  178.248.87.44
  178.249.122.203
  178.249.148.227
+178.249.209.4
  178.249.219.91
  178.249.95.43
  178.250.156.229
  178.250.157.177
+178.250.214.30
  178.250.54.208
  178.251.111.109
  178.251.140.3
@@ -57229,32 +58734,23 @@
  178.254.149.33
  178.254.149.37
  178.254.169.10
-178.254.171.112
-178.254.171.117
-178.254.171.118
-178.254.171.119
-178.254.171.130
  178.254.171.144
  178.254.171.146
  178.254.171.153
-178.254.171.156
  178.254.171.158
  178.254.171.182
  178.254.171.210
  178.254.171.34
-178.254.171.62
-178.254.171.73
-178.254.171.78
+178.254.171.41
  178.254.171.81
  178.254.171.95
  178.254.174.196
-178.254.179.132
-178.254.179.143
-178.254.179.152
+178.254.179.141
  178.254.179.156
-178.254.179.201
-178.254.179.243
+178.254.179.192
+178.254.179.249
  178.254.179.5
+178.254.179.6
  178.254.31.72
  178.254.34.108
  178.254.35.104
@@ -57286,9 +58782,11 @@
  178.30.49.3
  178.30.79.224
  178.32.1.128
+178.32.121.151
  178.32.121.17
  178.32.123.182
  178.32.125.98
+178.32.163.202
  178.32.167.73
  178.32.181.66
  178.32.189.89
@@ -57299,11 +58797,14 @@
  178.32.205.2
  178.32.213.61
  178.32.215.88
+178.32.215.90
  178.32.216.133
+178.32.217.133
  178.32.218.149
-178.32.218.72
+178.32.218.192
  178.32.219.210
  178.32.220.61
+178.32.221.225
  178.32.223.117
  178.32.244.169
  178.32.251.97
@@ -57312,10 +58813,10 @@
  178.32.53.131
  178.32.53.94
  178.32.58.209
-178.32.62.253
  178.32.79.49
  178.32.88.23
  178.32.97.34
+178.32.98.98
  178.33.131.26
  178.33.132.214
  178.33.132.215
@@ -57326,13 +58827,13 @@
  178.33.145.40
  178.33.145.43
  178.33.145.46
-178.33.15.8
  178.33.150.97
  178.33.152.188
  178.33.159.185
  178.33.167.120
  178.33.18.165
  178.33.209.195
+178.33.212.220
  178.33.216.187
  178.33.216.209
  178.33.227.167
@@ -57342,7 +58843,6 @@
  178.33.255.189
  178.33.3.16
  178.33.38.55
-178.33.48.26
  178.33.50.85
  178.33.64.76
  178.33.67.12
@@ -57360,9 +58860,10 @@
  178.42.182.179
  178.42.48.18
  178.42.69.243
+178.44.243.39
+178.45.22.163
  178.46.107.129
  178.46.128.121
-178.46.136.122
  178.46.163.191
  178.46.206.56
  178.46.208.10
@@ -57387,11 +58888,13 @@
  178.46.208.86
  178.46.209.106
  178.46.209.130
+178.46.209.137
  178.46.209.166
  178.46.209.180
  178.46.209.212
  178.46.209.232
  178.46.209.4
+178.46.209.66
  178.46.209.84
  178.46.210.110
  178.46.210.12
@@ -57403,10 +58906,8 @@
  178.46.210.31
  178.46.210.38
  178.46.210.4
-178.46.210.44
  178.46.210.45
  178.46.210.47
-178.46.210.58
  178.46.210.66
  178.46.210.96
  178.46.211.10
@@ -57438,31 +58939,31 @@
  178.46.212.204
  178.46.212.225
  178.46.212.226
-178.46.212.233
  178.46.212.24
  178.46.212.33
  178.46.212.37
  178.46.212.46
  178.46.212.57
-178.46.213.10
  178.46.213.114
  178.46.213.117
  178.46.213.15
  178.46.213.213
-178.46.213.22
  178.46.213.226
  178.46.213.254
  178.46.213.255
  178.46.213.40
  178.46.213.46
  178.46.213.49
+178.46.213.50
  178.46.213.76
  178.46.213.81
  178.46.213.95
  178.46.214.106
  178.46.214.107
+178.46.214.121
  178.46.214.136
  178.46.214.17
+178.46.214.188
  178.46.214.198
  178.46.214.201
  178.46.214.213
@@ -57474,7 +58975,6 @@
  178.46.214.71
  178.46.214.85
  178.46.214.93
-178.46.215.114
  178.46.215.150
  178.46.215.161
  178.46.215.162
@@ -57483,7 +58983,6 @@
  178.46.215.194
  178.46.215.196
  178.46.215.231
-178.46.215.247
  178.46.215.29
  178.46.215.37
  178.46.215.44
@@ -57513,19 +59012,19 @@
  178.48.68.189
  178.48.68.61
  178.49.13.230
-178.49.143.82
  178.49.144.151
+178.49.9.210
  178.5.111.34
  178.54.121.123
  178.54.121.174
  178.54.155.51
+178.54.203.255
  178.54.219.178
  178.54.231.253
  178.54.78.190
  178.54.86.113
  178.55.153.8
  178.55.170.135
-178.55.203.236
  178.55.230.133
  178.55.231.252
  178.57.111.107
@@ -57565,9 +59064,11 @@
  178.62.117.223
  178.62.118.53
  178.62.119.15
+178.62.119.73
  178.62.119.91
  178.62.12.192
  178.62.121.182
+178.62.123.101
  178.62.124.26
  178.62.125.239
  178.62.127.104
@@ -57575,21 +59076,23 @@
  178.62.139.49
  178.62.147.134
  178.62.17.143
+178.62.18.156
  178.62.18.173
  178.62.18.9
  178.62.183.92
  178.62.187.136
  178.62.19.106
  178.62.192.150
+178.62.192.63
  178.62.194.248
  178.62.195.132
  178.62.195.139
  178.62.195.55
  178.62.195.58
-178.62.197.90
  178.62.198.108
  178.62.199.240
  178.62.2.80
+178.62.20.115
  178.62.203.116
  178.62.203.118
  178.62.204.42
@@ -57597,6 +59100,7 @@
  178.62.207.65
  178.62.209.102
  178.62.209.152
+178.62.209.85
  178.62.210.151
  178.62.211.224
  178.62.212.233
@@ -57621,13 +59125,13 @@
  178.62.225.191
  178.62.225.62
  178.62.226.177
+178.62.227.11
  178.62.227.177
  178.62.228.162
  178.62.23.28
  178.62.230.5
  178.62.233.90
  178.62.237.49
-178.62.238.37
  178.62.24.120
  178.62.240.196
  178.62.241.30
@@ -57636,12 +59140,14 @@
  178.62.243.166
  178.62.243.50
  178.62.244.21
+178.62.244.247
  178.62.245.218
  178.62.246.130
  178.62.246.169
  178.62.247.109
  178.62.247.22
  178.62.247.57
+178.62.248.61
  178.62.248.90
  178.62.25.71
  178.62.250.186
@@ -57672,6 +59178,7 @@
  178.62.44.102
  178.62.44.28
  178.62.46.102
+178.62.46.37
  178.62.47.147
  178.62.47.158
  178.62.47.207
@@ -57692,6 +59199,7 @@
  178.62.57.199
  178.62.57.36
  178.62.59.36
+178.62.6.114
  178.62.6.215
  178.62.60.233
  178.62.63.15
@@ -57723,6 +59231,7 @@
  178.62.9.39
  178.62.92.247
  178.62.98.233
+178.62.99.41
  178.63.127.148
  178.63.127.150
  178.63.13.15
@@ -57755,9 +59264,9 @@
  178.63.98.228
  178.65.144.180
  178.65.214.71
-178.65.72.103
+178.65.70.5
+178.65.71.85
  178.66.26.235
-178.67.148.131
  178.67.195.64
  178.67.205.104
  178.67.38.241
@@ -57769,43 +59278,67 @@
  178.69.191.120
  178.70.13.32
  178.71.184.240
+178.71.7.139
  178.72.162.242
  178.72.163.252
  178.72.68.100
+178.72.68.105
  178.72.68.110
+178.72.68.113
+178.72.68.117
  178.72.68.121
  178.72.68.129
+178.72.68.13
  178.72.68.138
  178.72.68.146
  178.72.68.148
  178.72.68.149
+178.72.68.158
  178.72.68.160
  178.72.68.163
+178.72.68.170
  178.72.68.177
  178.72.68.178
  178.72.68.18
  178.72.68.182
  178.72.68.185
+178.72.68.193
  178.72.68.206
+178.72.68.219
  178.72.68.222
  178.72.68.224
  178.72.68.229
  178.72.68.232
  178.72.68.245
  178.72.68.28
+178.72.68.29
  178.72.68.35
+178.72.68.38
  178.72.68.40
  178.72.68.5
+178.72.68.50
  178.72.68.52
  178.72.68.64
+178.72.68.66
  178.72.68.73
+178.72.68.80
  178.72.68.83
+178.72.68.85
  178.72.68.87
+178.72.68.90
+178.72.68.92
  178.72.69.10
+178.72.69.107
+178.72.69.116
+178.72.69.120
  178.72.69.13
+178.72.69.139
+178.72.69.142
  178.72.69.143
  178.72.69.156
  178.72.69.16
+178.72.69.17
+178.72.69.170
  178.72.69.172
  178.72.69.173
  178.72.69.177
@@ -57813,17 +59346,26 @@
  178.72.69.181
  178.72.69.194
  178.72.69.196
+178.72.69.201
  178.72.69.212
  178.72.69.217
  178.72.69.223
  178.72.69.227
+178.72.69.234
+178.72.69.236
  178.72.69.240
+178.72.69.25
  178.72.69.254
  178.72.69.29
  178.72.69.33
+178.72.69.39
+178.72.69.60
  178.72.69.62
  178.72.69.67
+178.72.69.7
  178.72.69.71
+178.72.69.82
+178.72.69.87
  178.72.69.90
  178.72.69.92
  178.72.69.94
@@ -57834,7 +59376,9 @@
  178.72.70.135
  178.72.70.137
  178.72.70.139
+178.72.70.146
  178.72.70.148
+178.72.70.152
  178.72.70.153
  178.72.70.154
  178.72.70.158
@@ -57842,21 +59386,37 @@
  178.72.70.164
  178.72.70.170
  178.72.70.173
+178.72.70.178
+178.72.70.179
  178.72.70.184
  178.72.70.186
+178.72.70.194
  178.72.70.195
+178.72.70.196
  178.72.70.197
+178.72.70.207
  178.72.70.209
+178.72.70.211
+178.72.70.212
  178.72.70.213
+178.72.70.217
  178.72.70.218
  178.72.70.22
+178.72.70.222
  178.72.70.223
  178.72.70.233
  178.72.70.234
  178.72.70.240
  178.72.70.241
  178.72.70.247
+178.72.70.251
  178.72.70.254
+178.72.70.26
+178.72.70.36
+178.72.70.4
+178.72.70.41
+178.72.70.50
+178.72.70.51
  178.72.70.56
  178.72.70.58
  178.72.70.63
@@ -57865,11 +59425,16 @@
  178.72.70.7
  178.72.70.79
  178.72.70.81
+178.72.70.83
  178.72.70.84
+178.72.70.85
+178.72.70.90
+178.72.70.99
  178.72.71.100
  178.72.71.118
  178.72.71.121
  178.72.71.122
+178.72.71.13
  178.72.71.130
  178.72.71.142
  178.72.71.144
@@ -57878,23 +59443,32 @@
  178.72.71.164
  178.72.71.171
  178.72.71.172
+178.72.71.180
+178.72.71.182
  178.72.71.184
  178.72.71.189
  178.72.71.191
+178.72.71.203
+178.72.71.208
+178.72.71.211
  178.72.71.225
  178.72.71.230
+178.72.71.237
  178.72.71.238
  178.72.71.244
+178.72.71.249
  178.72.71.252
  178.72.71.26
+178.72.71.35
  178.72.71.5
+178.72.71.54
+178.72.71.77
+178.72.71.78
  178.72.71.86
  178.72.71.95
  178.72.74.40
-178.73.212.20
  178.73.215.171
  178.73.6.18
-178.74.122.163
  178.74.37.90
  178.74.56.144
  178.75.27.131
@@ -57905,6 +59479,7 @@
  178.77.154.111
  178.77.217.37
  178.77.238.2
+178.77.78.246
  178.78.104.202
  178.79.128.152
  178.79.128.243
@@ -57918,8 +59493,9 @@
  178.79.166.155
  178.79.169.92
  178.79.170.28
+178.79.171.83
  178.79.172.14
-178.79.180.176
+178.79.182.33
  178.79.183.171
  178.79.183.193
  178.79.187.33
@@ -57935,86 +59511,18 @@
  178.85.103.251
  178.85.133.89
  178.85.82.198
+178.86.156.65
  178.86.160.56
-178.88.113.122
  178.88.142.108
-178.88.153.60
-178.88.211.113
  178.88.222.209
-178.88.225.99
-178.88.229.23
-178.88.243.27
-178.88.244.109
-178.88.245.49
-178.88.246.83
-178.88.247.20
-178.88.249.157
  178.88.70.18
-178.88.80.37
-178.88.83.175
-178.88.84.36
-178.88.85.138
-178.89.100.60
-178.89.130.204
-178.89.130.58
-178.89.142.176
-178.89.142.95
-178.89.143.114
-178.89.157.82
-178.89.164.39
-178.89.183.111
-178.89.196.161
-178.89.198.78
  178.89.21.175
  178.89.210.200
-178.89.210.229
-178.89.223.128
-178.89.247.114
  178.89.32.171
-178.89.85.116
-178.89.94.84
-178.90.137.50
-178.90.14.88
-178.90.144.239
-178.90.154.22
  178.90.159.114
-178.90.160.46
-178.90.174.218
-178.90.22.170
-178.90.223.226
-178.90.224.236
-178.90.226.181
-178.90.249.77
-178.90.249.93
-178.90.250.154
-178.90.250.56
-178.90.253.95
+178.90.227.161
  178.90.50.54
-178.90.57.224
-178.90.63.161
-178.90.81.76
-178.90.93.231
-178.90.94.9
-178.91.109.210
-178.91.126.230
-178.91.17.199
  178.91.179.201
-178.91.180.253
-178.91.189.206
-178.91.19.126
-178.91.20.16
-178.91.20.66
-178.91.21.247
-178.91.21.8
-178.91.219.35
-178.91.246.243
-178.91.37.16
-178.91.46.199
-178.91.72.115
-178.91.8.136
-178.91.85.161
-178.91.89.182
-178.91.89.90
  178.92.244.88
  178.93.12.24
  178.93.137.129
@@ -58024,29 +59532,23 @@
  178.93.39.248
  178.93.49.210
  178.93.50.94
-178.93.51.68
  178.93.52.40
  178.93.53.112
-178.93.55.174
-178.93.59.175
  178.93.6.134
  178.93.60.60
  178.93.99.196
  178.94.112.235
  178.94.146.50
  178.94.149.31
-178.94.171.114
  178.94.173.6
-178.94.59.170
  178.94.87.197
-178.95.113.130
  178.95.195.240
  178.95.73.240
  178j.life
  179.1.1.11
  179.1.91.130
-179.102.148.180
  179.104.173.90
+179.104.230.28
  179.104.42.215
  179.104.48.241
  179.105.125.141
@@ -58066,9 +59568,8 @@
  179.106.83.157
  179.106.96.74
  179.107.102.150
-179.107.11.129
+179.107.11.244
  179.107.15.234
-179.107.189.184
  179.107.189.76
  179.107.190.27
  179.107.192.123
@@ -58077,12 +59578,10 @@
  179.107.193.6
  179.107.194.186
  179.107.34.178
-179.107.57.96
  179.107.59.45
  179.107.59.87
  179.107.59.89
  179.107.59.99
-179.107.61.147
  179.107.67.80
  179.107.84.10
  179.107.90.36
@@ -58123,6 +59622,7 @@
  179.110.98.246
  179.111.160.35
  179.111.212.162
+179.111.232.205
  179.111.9.254
  179.111.97.199
  179.112.151.122
@@ -58133,7 +59633,6 @@
  179.113.194.145
  179.113.80.32
  179.113.97.108
-179.124.136.37
  179.124.144.69
  179.124.197.151
  179.124.24.17
@@ -58152,8 +59651,7 @@
  179.125.39.230
  179.125.43.89
  179.125.53.102
-179.126.117.245
-179.127.129.233
+179.127.107.89
  179.127.140.113
  179.127.140.142
  179.127.144.142
@@ -58170,37 +59668,39 @@
  179.127.71.25
  179.127.93.122
  179.127.93.52
-179.129.121.114
  179.131.10.103
  179.131.11.234
  179.144.233.234
  179.146.186.90
  179.150.137.166
-179.151.25.126
  179.153.55.122
  179.155.108.27
  179.155.127.61
+179.155.57.213
  179.155.87.147
  179.156.19.123
  179.156.99.114
  179.157.206.101
  179.157.207.193
+179.157.74.30
  179.159.247.21
  179.159.251.87
  179.159.42.233
  179.159.79.250
-179.162.107.50
  179.162.202.58
  179.162.203.50
+179.162.207.113
  179.162.231.236
  179.162.254.153
  179.162.30.188
  179.162.41.112
  179.162.89.102
-179.172.158.197
+179.171.14.185
  179.173.200.207
  179.174.32.166
+179.174.53.226
  179.176.100.232
+179.176.117.133
  179.176.96.222
  179.177.211.205
  179.177.215.195
@@ -58209,25 +59709,29 @@
  179.178.146.11
  179.178.181.88
  179.178.238.142
+179.178.96.23
  179.179.203.118
  179.179.54.182
  179.179.75.2
+179.180.171.53
+179.180.61.6
  179.180.73.80
  179.180.95.45
  179.181.106.79
  179.181.129.181
  179.181.179.13
+179.182.130.122
  179.182.63.104
  179.183.230.91
  179.184.0.112
  179.184.161.221
  179.184.230.194
-179.185.212.214
  179.185.50.182
  179.185.65.220
  179.185.66.242
  179.185.89.241
  179.186.121.43
+179.186.148.127
  179.186.241.7
  179.186.46.11
  179.187.239.180
@@ -58244,13 +59748,15 @@
  179.189.48.70
  179.189.85.206
  179.190.199.206
+179.191.123.46
  179.191.15.59
  179.191.235.238
  179.191.238.239
  179.191.245.58
-179.191.52.92
+179.191.52.158
  179.191.53.121
-179.197.59.128
+179.191.53.88
+179.191.87.166
  179.208.167.192
  179.208.176.208
  179.208.75.108
@@ -58258,18 +59764,19 @@
  179.209.232.229
  179.209.55.149
  179.209.88.167
+179.209.88.230
  179.210.121.225
+179.210.168.97
  179.211.32.189
  179.212.138.1
-179.213.12.149
  179.213.95.241
-179.214.238.210
  179.214.43.31
  179.215.62.112
  179.217.154.41
  179.217.184.236
  179.217.40.116
  179.219.96.136
+179.219.96.69
  179.219.98.106
  179.220.227.28
  179.221.113.119
@@ -58280,6 +59787,7 @@
  179.222.96.70
  179.225.140.127
  179.225.245.170
+179.228.128.144
  179.228.2.152
  179.228.230.69
  179.228.74.3
@@ -58287,7 +59795,7 @@
  179.229.77.4
  179.232.1.252
  179.232.15.58
-179.233.3.103
+179.232.63.243
  179.234.1.38
  179.234.232.150
  179.234.251.225
@@ -58297,14 +59805,17 @@
  179.235.137.203
  179.235.150.219
  179.235.169.203
-179.236.156.111
-179.24.15.53
+179.24.0.179
  179.242.79.117
+179.243.0.68
  179.243.81.157
  179.243.82.199
  179.243.82.221
  179.247.141.210
+179.249.68.54
+179.25.73.9
  179.250.249.251
+179.251.204.179
  179.252.114.253
  179.252.92.123
  179.253.179.216
@@ -58314,16 +59825,16 @@
  179.27.67.250
  179.27.73.234
  179.27.83.222
+179.33.137.117
+179.33.139.66
  179.33.188.139
  179.36.214.227
  179.4.136.174
  179.40.75.1
  179.42.105.0
  179.42.105.144
-179.42.105.146
  179.42.105.189
-179.42.107.231
-179.42.107.238
+179.42.121.237
  179.42.205.50
  179.43.101.47
  179.43.128.245
@@ -58368,44 +59879,46 @@
  179.48.251.188
  179.49.10.85
  179.49.144.239
+179.49.20.50
  179.49.57.150
  179.5.118.12
  179.5.194.9
+179.50.13.249
  179.50.197.100
  179.51.196.10
  179.52.14.142
  179.52.18.155
+179.52.180.85
  179.52.238.96
  179.52.24.21
  179.53.73.70
  179.54.191.14
  179.55.225.17
-179.55.238.53
+179.55.69.166
  179.56.134.203
  179.56.157.146
  179.56.248.64
-179.56.59.194
  179.57.254.34
  179.57.254.69
  179.57.45.150
  179.57.45.168
-179.6.47.189
-179.6.56.155
+179.6.48.42
  179.60.127.234
  179.60.127.45
  179.60.127.80
  179.60.243.38
+179.61.130.12
  179.61.145.53
  179.61.160.196
+179.61.160.219
+179.61.162.127
  179.61.164.45
  179.61.166.74
  179.61.168.0
-179.61.179.172
-179.61.184.197
  179.61.185.194
  179.61.185.253
  179.61.188.221
-179.61.188.249
+179.61.191.181
  179.61.251.117
  179.61.87.86
  179.63.219.236
@@ -58416,7 +59929,6 @@
  179.67.21.157
  179.7.195.122
  179.70.102.164
-179.70.71.103
  179.83.104.48
  179.83.133.242
  179.83.201.128
@@ -58426,11 +59938,12 @@
  179.83.4.186
  179.9.160.50
  179.91.34.99
+179.93.106.102
  179.93.120.11
  179.93.146.186
  179.93.147.22
  179.93.149.17
-179.93.55.28
+179.93.57.222
  179.93.59.141
  179.93.60.52
  179.93.80.122
@@ -58449,7 +59962,6 @@
  179.97.230.16
  179.97.242.252
  179.97.45.2
-179.97.9.227
  179.98.0.38
  179.98.2.93
  179.98.5.185
@@ -58457,11 +59969,10 @@
  179.99.195.60
  179.99.200.39
  179.99.203.139
-179.99.214.142
+179.99.24.10
  179.99.73.56
  179381017012724-dot-aql-rkl-evh.appspot.com
  17ab3d2e4638facf.icu
-17alert-dot-avian-safeguard.ey.r.appspot.com
  17bofa71.systeminformationoursecure.com
  17e9af34-dc73-42d3-8332-1482e3035d80.htmlcomponentservice.com
  17thstreet.co
@@ -58486,6 +59997,7 @@
  18.130.21.204
  18.130.242.64
  18.130.244.18
+18.130.244.84
  18.130.246.105
  18.130.63.181
  18.130.68.77
@@ -58496,6 +60008,7 @@
  18.132.210.81
  18.132.37.244
  18.132.48.243
+18.133.183.249
  18.134.242.0
  18.134.246.255
  18.134.246.87
@@ -58503,11 +60016,11 @@
  18.136.142.174
  18.136.144.35
  18.136.200.216
+18.136.208.132
  18.136.231.183
  18.136.72.135
  18.136.74.240
  18.138.11.173
-18.138.22.172
  18.138.254.166
  18.139.179.138
  18.139.212.16
@@ -58518,6 +60031,7 @@
  18.140.214.227
  18.140.30.220
  18.140.51.231
+18.141.12.231
  18.141.175.198
  18.141.200.138
  18.141.210.87
@@ -58526,9 +60040,9 @@
  18.144.49.66
  18.144.54.86
  18.144.73.74
-18.156.120.175
  18.156.135.91
  18.156.166.51
+18.156.173.242
  18.156.64.16
  18.156.81.115
  18.157.86.215
@@ -58544,6 +60058,9 @@
  18.162.45.214
  18.162.46.146
  18.162.53.135
+18.162.71.44
+18.162.97.182
+18.163.100.62
  18.163.111.172
  18.163.183.198
  18.163.194.25
@@ -58563,6 +60080,7 @@
  18.179.39.98
  18.179.50.95
  18.18.248.17
+18.180.157.147
  18.181.109.120
  18.181.173.197
  18.181.194.135
@@ -58574,12 +60092,12 @@
  18.182.68.214
  18.183.139.213
  18.183.186.156
+18.183.189.102
  18.183.19.86
  18.183.76.89
  18.184.117.78
  18.184.168.100
  18.184.178.241
-18.184.252.74
  18.184.42.248
  18.184.83.65
  18.185.124.103
@@ -58587,7 +60105,6 @@
  18.185.132.90
  18.185.149.145
  18.185.18.243
-18.185.34.220
  18.185.70.145
  18.188.10.196
  18.188.105.216
@@ -58609,6 +60126,7 @@
  18.189.171.33
  18.190.125.175
  18.191.109.28
+18.191.135.80
  18.191.145.149
  18.191.159.221
  18.191.17.165
@@ -58661,12 +60179,12 @@
  18.197.41.88
  18.197.75.37
  18.198.16.76
-18.198.23.37
-18.198.26.249
+18.198.203.56
  18.198.93.234
  18.200.177.101
  18.202.116.130
  18.202.173.173
+18.202.194.229
  18.202.230.228
  18.202.48.131
  18.202.91.9
@@ -58707,11 +60225,13 @@
  18.209.98.50
  18.210.131.127
  18.210.151.106
+18.210.248.154
  18.211.184.174
  18.211.61.27
  18.212.144.128
  18.212.155.144
  18.212.169.223
+18.212.191.232
  18.212.222.147
  18.212.25.96
  18.212.57.172
@@ -58743,7 +60263,6 @@
  18.217.104.172
  18.217.133.245
  18.217.156.113
-18.217.158.104
  18.217.158.182
  18.217.164.147
  18.217.170.105
@@ -58773,6 +60292,7 @@
  18.218.226.80
  18.218.252.188
  18.218.252.37
+18.218.26.90
  18.218.38.55
  18.218.44.183
  18.218.47.21
@@ -58786,13 +60306,11 @@
  18.219.151.45
  18.219.162.70
  18.219.171.94
-18.219.2.240
  18.219.21.39
  18.219.249.229
  18.219.26.31
  18.219.36.106
  18.219.38.235
-18.219.40.58
  18.219.47.10
  18.219.55.235
  18.219.63.79
@@ -58851,6 +60369,7 @@
  18.222.57.180
  18.222.99.113
  18.223.1.180
+18.223.117.32
  18.223.121.192
  18.223.149.246
  18.223.169.31
@@ -58859,7 +60378,9 @@
  18.223.225.61
  18.223.29.35
  18.224.139.209
+18.224.169.123
  18.224.185.112
+18.224.199.171
  18.224.228.223
  18.224.229.143
  18.224.234.85
@@ -58870,6 +60391,7 @@
  18.225.17.4
  18.225.32.55
  18.225.34.180
+18.225.6.54
  18.228.0.28
  18.228.10.250
  18.228.122.94
@@ -58896,11 +60418,9 @@
  18.231.83.8
  18.232.123.157
  18.232.177.20
-18.232.38.127
  18.232.77.159
  18.232.82.199
  18.232.83.28
-18.233.102.81
  18.233.150.125
  18.233.151.136
  18.233.171.117
@@ -58911,6 +60431,7 @@
  18.234.208.74
  18.234.221.133
  18.234.228.180
+18.234.253.174
  18.234.67.145
  18.234.79.31
  18.235.86.90
@@ -58922,6 +60443,7 @@
  18.236.163.88
  18.236.193.189
  18.236.213.97
+18.236.215.164
  18.236.68.61
  18.236.73.214
  18.236.94.102
@@ -58941,6 +60463,7 @@
  18.27.197.252
  18.27.79.17
  180.100.206.35
+180.100.213.63
  180.100.243.210
  180.100.74.4
  180.101.145.234
@@ -58960,7 +60483,6 @@
  180.102.133.99
  180.102.198.249
  180.102.214.130
-180.102.43.187
  180.102.60.55
  180.103.158.169
  180.103.166.93
@@ -58968,7 +60490,6 @@
  180.103.210.68
  180.103.219.117
  180.103.28.20
-180.103.58.217
  180.104.13.145
  180.104.13.50
  180.104.175.217
@@ -58991,7 +60512,6 @@
  180.104.59.28
  180.104.61.229
  180.104.74.135
-180.104.76.182
  180.104.76.83
  180.104.79.77
  180.104.85.70
@@ -59001,10 +60521,10 @@
  180.106.226.248
  180.106.228.106
  180.106.81.126
-180.106.81.168
  180.107.109.21
  180.107.190.176
  180.107.76.147
+180.108.10.38
  180.108.3.163
  180.108.64.71
  180.108.9.34
@@ -59012,6 +60532,7 @@
  180.109.165.51
  180.109.19.125
  180.109.32.2
+180.109.32.20
  180.109.33.141
  180.109.36.200
  180.109.90.246
@@ -59046,6 +60567,7 @@
  180.115.112.173
  180.115.117.241
  180.115.119.121
+180.115.201.59
  180.115.249.164
  180.115.3.162
  180.115.66.239
@@ -59083,6 +60605,7 @@
  180.116.96.229
  180.117.110.98
  180.117.115.213
+180.117.163.90
  180.117.18.244
  180.117.195.21
  180.117.208.121
@@ -59099,24 +60622,22 @@
  180.118.50.46
  180.118.69.134
  180.119.181.105
-180.119.183.207
-180.119.92.73
  180.120.12.85
  180.120.175.141
  180.120.20.203
  180.120.210.21
+180.120.213.166
+180.120.214.116
  180.120.214.195
  180.120.34.228
  180.120.79.159
  180.120.89.209
  180.120.89.229
  180.121.128.71
-180.121.131.104
+180.121.131.245
  180.121.133.168
  180.121.133.174
  180.121.133.205
-180.121.133.237
-180.121.134.158
  180.121.135.254
  180.121.247.122
  180.122.158.218
@@ -59167,11 +60688,11 @@
  180.124.134.163
  180.124.135.35
  180.124.146.205
-180.124.146.43
  180.124.167.252
  180.124.174.33
  180.124.184.132
  180.124.184.136
+180.124.187.145
  180.124.188.129
  180.124.195.61
  180.124.214.4
@@ -59189,16 +60710,15 @@
  180.124.67.205
  180.124.73.160
  180.124.75.190
-180.124.76.241
  180.124.76.76
+180.124.77.117
+180.124.77.158
+180.124.79.83
  180.124.80.233
  180.124.90.224
  180.125.11.13
  180.125.169.29
  180.125.170.131
-180.125.171.223
-180.125.174.179
-180.125.175.146
  180.125.206.63
  180.125.227.194
  180.125.239.161
@@ -59206,22 +60726,25 @@
  180.125.245.38
  180.125.249.94
  180.125.44.203
-180.125.5.42
  180.125.58.103
  180.125.96.10
  180.125.98.225
-180.126.113.202
  180.126.130.162
  180.126.218.152
+180.126.220.183
  180.126.235.204
-180.127.111.163
+180.127.110.7
+180.127.78.229
  180.128.0.237
  180.128.1.30
  180.128.1.87
+180.128.8.6
  180.129.111.255
  180.129.18.107
  180.129.19.11
+180.129.252.23
  180.129.34.84
+180.129.5.123
  180.129.89.233
  180.129.99.84
  180.130.154.158
@@ -59239,11 +60762,12 @@
  180.137.239.39
  180.137.40.7
  180.137.45.182
+180.138.48.144
  180.138.48.33
  180.138.76.125
  180.139.113.30
  180.139.124.109
-180.139.124.237
+180.139.124.170
  180.139.130.36
  180.139.220.179
  180.140.135.66
@@ -59264,6 +60788,7 @@
  180.143.145.164
  180.143.156.4
  180.143.242.216
+180.147.214.59
  180.148.215.101
  180.148.33.203
  180.148.4.194
@@ -59311,14 +60836,12 @@
  180.149.126.80
  180.149.126.93
  180.149.225.29
-180.149.234.7
  180.149.240.54
  180.149.243.178
  180.149.245.78
  180.149.247.250
  180.149.96.131
  180.150.19.243
-180.150.21.129
  180.150.21.41
  180.150.226.44
  180.150.226.98
@@ -59338,9 +60861,11 @@
  180.151.130.96
  180.151.201.122
  180.151.3.43
+180.151.43.134
  180.151.56.114
  180.151.56.124
  180.151.56.99
+180.151.63.66
  180.152.239.218
  180.153.183.174
  180.153.43.78
@@ -59349,7 +60874,6 @@
  180.153.68.54
  180.153.91.17
  180.153.91.83
-180.156.116.56
  180.157.100.5
  180.157.134.17
  180.157.249.25
@@ -59376,11 +60900,13 @@
  180.163.220.96
  180.163.220.97
  180.163.220.99
-180.164.123.19
+180.164.177.21
  180.164.221.45
  180.164.255.12
  180.164.41.248
+180.164.58.165
  180.164.58.29
+180.165.224.171
  180.165.229.156
  180.165.229.187
  180.166.114.14
@@ -59400,7 +60926,6 @@
  180.167.201.243
  180.167.207.234
  180.167.216.198
-180.167.220.230
  180.167.225.118
  180.167.227.11
  180.167.240.222
@@ -59438,6 +60963,7 @@
  180.169.246.230
  180.169.32.52
  180.169.52.242
+180.169.76.210
  180.173.180.239
  180.173.227.5
  180.174.165.118
@@ -59445,7 +60971,6 @@
  180.174.250.255
  180.175.199.165
  180.175.72.149
-180.175.74.217
  180.175.87.64
  180.176.110.243
  180.176.128.88
@@ -59479,6 +61004,7 @@
  180.176.247.42
  180.176.247.83
  180.176.96.215
+180.176.97.232
  180.176.99.28
  180.177.117.142
  180.177.128.163
@@ -59532,16 +61058,15 @@
  180.180.152.98
  180.180.156.15
  180.180.157.32
-180.180.164.41
  180.180.167.171
  180.180.170.188
  180.180.171.113
  180.180.175.37
  180.180.175.70
  180.180.177.95
-180.180.183.246
  180.180.19.254
  180.180.190.237
+180.180.196.192
  180.180.216.177
  180.180.217.18
  180.180.217.212
@@ -59601,7 +61126,6 @@
  180.182.245.135
  180.182.245.136
  180.182.245.137
-180.182.245.139
  180.182.245.140
  180.182.245.141
  180.182.245.143
@@ -59623,15 +61147,15 @@
  180.182.245.95
  180.182.47.132
  180.183.0.8
+180.183.1.10
  180.183.1.42
-180.183.123.39
+180.183.121.103
  180.183.127.44
-180.183.133.204
  180.183.139.12
  180.183.15.101
-180.183.152.197
  180.183.159.17
  180.183.180.18
+180.183.2.11
  180.183.200.131
  180.183.226.142
  180.183.226.17
@@ -59639,16 +61163,13 @@
  180.183.230.91
  180.183.234.212
  180.183.244.34
-180.183.247.206
  180.183.249.183
-180.183.251.242
  180.183.26.50
-180.183.27.156
  180.183.28.4
  180.183.3.74
  180.183.4.127
  180.183.44.213
-180.183.5.57
+180.183.7.37
  180.183.98.122
  180.188.16.59
  180.188.196.22
@@ -59658,7 +61179,6 @@
  180.188.247.106
  180.188.247.110
  180.188.247.111
-180.188.247.115
  180.188.247.117
  180.188.247.118
  180.188.247.119
@@ -59748,7 +61268,6 @@
  180.188.247.243
  180.188.247.244
  180.188.247.245
-180.188.247.249
  180.188.247.25
  180.188.247.252
  180.188.247.254
@@ -59777,19 +61296,16 @@
  180.188.247.53
  180.188.247.54
  180.188.247.56
-180.188.247.57
  180.188.247.60
  180.188.247.62
  180.188.247.63
  180.188.247.64
  180.188.247.65
-180.188.247.66
  180.188.247.67
  180.188.247.68
  180.188.247.69
  180.188.247.7
  180.188.247.70
-180.188.247.73
  180.188.247.75
  180.188.247.76
  180.188.247.77
@@ -59808,18 +61324,12 @@
  180.188.247.97
  180.189.107.12
  180.189.94.243
-180.190.116.113
  180.190.118.71
-180.190.130.15
-180.190.130.217
-180.190.130.220
-180.190.163.217
+180.190.163.36
  180.190.243.7
-180.190.55.34
  180.191.158.14
  180.191.159.4
  180.197.25.10
-180.198.30.58
  180.210.201.54
  180.210.201.57
  180.210.205.53
@@ -59853,7 +61363,6 @@
  180.211.102.186
  180.211.115.155
  180.211.120.61
-180.211.135.242
  180.211.137.8
  180.211.141.158
  180.211.158.26
@@ -59870,7 +61379,6 @@
  180.211.193.74
  180.211.193.78
  180.211.193.82
-180.211.194.254
  180.211.195.18
  180.211.243.222
  180.211.91.178
@@ -59883,8 +61391,9 @@
  180.211.95.234
  180.211.97.204
  180.213.4.122
+180.214.132.40
+180.214.138.68
  180.214.148.44
-180.214.149.105
  180.214.185.131
  180.214.236.211
  180.214.236.98
@@ -59894,6 +61403,7 @@
  180.214.239.165
  180.214.239.180
  180.214.239.186
+180.214.239.233
  180.214.239.250
  180.214.239.54
  180.215.197.150
@@ -59911,7 +61421,9 @@
  180.215.215.190
  180.215.215.191
  180.215.215.192
+180.215.215.207
  180.215.215.211
+180.215.215.216
  180.215.215.240
  180.215.215.250
  180.215.221.210
@@ -59947,36 +61459,43 @@
  180.233.231.83
  180.233.242.169
  180.234.83.202
+180.235.122.74
  180.235.131.131
  180.235.138.114
  180.235.138.247
  180.235.138.96
  180.24.145.134
+180.241.144.14
  180.241.153.203
  180.241.208.84
  180.241.75.230
-180.242.161.47
+180.241.90.149
  180.242.180.134
  180.242.180.19
+180.242.180.230
  180.242.180.30
  180.242.180.73
+180.242.182.11
  180.242.183.154
  180.242.183.178
  180.242.70.86
+180.244.107.83
  180.244.233.36
  180.244.234.211
  180.244.252.5
  180.244.49.120
-180.245.192.129
+180.245.206.197
  180.245.85.36
+180.245.97.68
  180.246.175.238
  180.246.19.195
  180.246.205.208
  180.246.209.14
  180.246.209.90
+180.246.214.60
  180.246.75.83
+180.246.76.165
  180.246.94.151
-180.247.1.108
  180.247.156.153
  180.247.181.72
  180.247.183.8
@@ -59984,14 +61503,24 @@
  180.247.28.139
  180.247.51.42
  180.248.105.227
+180.248.120.19
+180.248.120.3
+180.248.120.30
+180.248.121.181
+180.248.121.68
+180.248.123.236
  180.248.228.198
+180.248.86.206
  180.249.119.12
+180.249.166.183
+180.249.166.208
  180.249.231.79
  180.249.41.254
  180.249.79.148
  180.249.8.236
  180.249.94.253
  180.25.1.243
+180.250.108.130
  180.250.115.121
  180.250.12.10
  180.250.124.227
@@ -60019,19 +61548,19 @@
  180.250.68.154
  180.250.77.218
  180.250.88.165
-180.251.106.191
  180.251.116.198
  180.251.146.136
  180.251.150.106
+180.251.220.190
+180.252.20.188
+180.252.236.66
+180.253.137.143
  180.253.138.182
  180.253.147.182
  180.253.161.94
  180.253.162.182
-180.253.164.175
-180.253.164.94
  180.253.166.135
  180.253.53.95
-180.253.66.8
  180.254.12.125
  180.254.34.139
  180.254.37.199
@@ -60053,6 +61582,7 @@
  180.68.251.67
  180.68.49.93
  180.68.88.11
+180.69.194.16
  180.69.254.177
  180.69.27.217
  180.70.141.10
@@ -60061,6 +61591,7 @@
  180.71.47.198
  180.71.58.134
  180.76.101.165
+180.76.101.202
  180.76.101.229
  180.76.101.241
  180.76.101.244
@@ -60068,24 +61599,29 @@
  180.76.104.101
  180.76.105.165
  180.76.105.81
+180.76.106.172
  180.76.106.175
  180.76.106.21
  180.76.106.65
+180.76.107.10
+180.76.108.118
  180.76.108.66
  180.76.108.73
  180.76.109.16
  180.76.109.31
  180.76.111.214
+180.76.111.242
+180.76.112.166
  180.76.114.145
  180.76.114.218
  180.76.115.123
  180.76.115.226
  180.76.116.98
+180.76.118.175
  180.76.118.181
  180.76.120.135
  180.76.121.95
  180.76.124.150
-180.76.124.173
  180.76.125.161
  180.76.133.173
  180.76.134.238
@@ -60105,13 +61641,17 @@
  180.76.144.99
  180.76.146.229
  180.76.146.248
+180.76.146.54
  180.76.146.60
  180.76.147.183
  180.76.147.221
+180.76.147.52
  180.76.148.147
  180.76.148.87
+180.76.149.15
  180.76.150.17
  180.76.151.189
+180.76.151.90
  180.76.152.157
  180.76.152.17
  180.76.152.65
@@ -60123,6 +61663,7 @@
  180.76.158.139
  180.76.158.224
  180.76.158.36
+180.76.159.211
  180.76.159.37
  180.76.160.148
  180.76.160.35
@@ -60131,10 +61672,11 @@
  180.76.163.31
  180.76.163.33
  180.76.163.4
-180.76.163.86
  180.76.165.10
+180.76.165.107
  180.76.165.254
  180.76.165.92
+180.76.166.27
  180.76.167.16
  180.76.167.221
  180.76.167.78
@@ -60145,6 +61687,7 @@
  180.76.171.57
  180.76.172.103
  180.76.172.202
+180.76.173.75
  180.76.174.39
  180.76.174.59
  180.76.174.95
@@ -60152,32 +61695,41 @@
  180.76.175.170
  180.76.175.211
  180.76.176.126
+180.76.176.223
  180.76.177.194
  180.76.177.217
  180.76.178.253
  180.76.178.46
  180.76.179.213
+180.76.179.67
  180.76.180.140
  180.76.180.231
+180.76.180.9
  180.76.181.115
  180.76.181.47
+180.76.182.19
  180.76.182.238
  180.76.183.218
  180.76.183.245
  180.76.184.50
+180.76.185.121
  180.76.186.109
  180.76.187.216
+180.76.188.4
  180.76.188.72
  180.76.188.98
  180.76.189.220
  180.76.190.251
  180.76.190.78
+180.76.228.68
  180.76.230.172
  180.76.230.173
  180.76.230.211
  180.76.231.121
  180.76.232.66
+180.76.233.250
  180.76.234.185
+180.76.236.5
  180.76.236.65
  180.76.238.128
  180.76.238.183
@@ -60237,14 +61789,10 @@
  180.92.239.217
  180.93.160.251
  180.94.138.193
-180.94.165.56
+180.94.140.41
  180.94.170.166
  180.94.64.114
-180.94.68.34
-180.94.68.78
  180.94.71.82
-180.94.75.58
-180.94.81.180
  180.94.81.181
  180.95.183.214
  180.95.214.60
@@ -60289,7 +61837,6 @@
  180jxlh.com
  181.10.129.85
  181.10.133.10
-181.10.134.139
  181.10.18.188
  181.10.204.106
  181.10.210.99
@@ -60301,16 +61848,16 @@
  181.101.111.237
  181.101.113.197
  181.101.117.123
-181.101.122.231
  181.101.123.123
-181.101.125.199
  181.101.21.9
  181.101.22.27
  181.101.23.186
  181.101.24.17
+181.101.5.209
  181.101.5.49
  181.101.50.238
  181.101.56.90
+181.101.6.211
  181.101.80.157
  181.101.81.224
  181.101.82.57
@@ -60319,16 +61866,13 @@
  181.101.87.224
  181.101.89.17
  181.101.90.9
-181.101.91.1
  181.101.93.101
-181.101.95.215
  181.101.97.196
  181.101.98.140
+181.102.116.31
  181.102.117.76
  181.102.118.159
  181.102.119.191
-181.102.121.122
-181.102.122.14
  181.102.13.53
  181.102.134.25
  181.102.138.179
@@ -60338,6 +61882,7 @@
  181.102.144.64
  181.102.150.12
  181.102.155.63
+181.102.158.193
  181.102.162.164
  181.102.168.152
  181.102.203.11
@@ -60347,33 +61892,27 @@
  181.102.40.26
  181.102.40.44
  181.102.42.76
-181.102.46.188
+181.102.45.61
  181.102.54.2
+181.102.59.57
  181.102.68.243
  181.102.69.185
-181.102.74.200
-181.102.77.117
  181.102.79.75
-181.102.80.247
-181.102.82.157
  181.102.88.23
  181.102.92.141
-181.102.93.203
  181.102.93.28
  181.102.94.189
  181.102.94.213
-181.102.95.176
-181.105.5.66
+181.105.126.172
  181.106.205.84
-181.106.206.58
  181.106.214.41
  181.106.215.184
  181.106.215.61
  181.106.216.250
+181.106.217.208
  181.106.217.254
  181.106.226.17
  181.106.230.123
-181.106.230.219
  181.106.230.64
  181.106.230.89
  181.106.231.165
@@ -60385,6 +61924,7 @@
  181.106.248.151
  181.110.95.54
  181.111.18.26
+181.111.181.50
  181.111.60.13
  181.112.152.14
  181.112.157.42
@@ -60402,13 +61942,13 @@
  181.112.57.62
  181.113.114.90
  181.113.121.158
+181.113.131.98
  181.113.135.214
  181.113.135.254
  181.113.17.134
  181.113.22.158
  181.113.225.114
  181.113.225.130
-181.113.225.198
  181.113.229.139
  181.113.28.150
  181.113.32.66
@@ -60420,8 +61960,8 @@
  181.114.101.78
  181.114.131.52
  181.114.132.202
+181.114.208.132
  181.114.208.145
-181.114.211.86
  181.114.212.131
  181.114.222.250
  181.114.81.223
@@ -60439,6 +61979,7 @@
  181.117.169.173
  181.117.197.34
  181.117.202.5
+181.117.24.40
  181.117.33.237
  181.117.35.243
  181.118.101.22
@@ -60449,16 +61990,17 @@
  181.119.20.201
  181.119.27.62
  181.119.30.26
-181.120.210.85
  181.120.218.241
  181.120.245.43
  181.120.29.49
  181.120.59.30
+181.121.147.52
  181.121.72.54
  181.123.12.241
  181.123.12.89
  181.123.216.165
  181.123.36.39
+181.123.52.105
  181.123.6.86
  181.124.39.223
  181.126.201.255
@@ -60478,10 +62020,12 @@
  181.129.181.250
  181.129.183.19
  181.129.184.123
+181.129.184.124
  181.129.222.130
  181.129.30.18
  181.129.30.20
  181.129.30.22
+181.129.33.76
  181.129.36.139
  181.129.41.146
  181.129.42.253
@@ -60504,12 +62048,14 @@
  181.129.96.35
  181.129.98.146
  181.13.110.44
+181.13.51.177
  181.130.133.135
  181.134.15.194
  181.134.31.219
  181.135.153.203
  181.137.229.1
  181.143.10.130
+181.143.10.148
  181.143.101.18
  181.143.101.194
  181.143.106.162
@@ -60531,7 +62077,7 @@
  181.15.121.74
  181.15.154.154
  181.15.154.156
-181.15.170.169
+181.15.170.101
  181.15.193.66
  181.16.136.1
  181.16.136.41
@@ -60546,10 +62092,12 @@
  181.164.1.228
  181.164.11.129
  181.164.132.26
+181.164.202.200
  181.164.203.22
  181.164.229.24
  181.164.237.201
  181.164.95.113
+181.165.112.64
  181.165.179.225
  181.165.200.185
  181.165.68.127
@@ -60566,15 +62114,13 @@
  181.169.225.172
  181.169.235.110
  181.169.37.247
-181.169.98.175
  181.170.162.205
  181.170.167.227
-181.170.71.133
+181.170.26.114
  181.171.172.147
-181.171.36.86
  181.174.100.66
  181.174.102.239
-181.174.144.243
+181.174.144.138
  181.174.144.75
  181.174.166.112
  181.174.166.113
@@ -60614,7 +62160,6 @@
  181.176.222.68
  181.176.242.168
  181.177.111.13
-181.177.111.142
  181.177.111.148
  181.177.111.160
  181.177.111.197
@@ -60629,6 +62174,7 @@
  181.177.112.114
  181.177.112.122
  181.177.112.130
+181.177.112.131
  181.177.112.143
  181.177.112.56
  181.177.112.65
@@ -60644,7 +62190,6 @@
  181.188.155.45
  181.188.156.58
  181.188.166.74
-181.188.43.182
  181.189.143.106
  181.189.144.206
  181.189.221.209
@@ -60666,7 +62211,6 @@
  181.193.45.180
  181.193.48.228
  181.194.224.192
-181.196.1.12
  181.196.145.106
  181.196.177.30
  181.196.181.146
@@ -60741,16 +62285,19 @@
  181.211.38.62
  181.211.6.34
  181.211.8.34
+181.213.118.141
  181.214.156.26
  181.214.208.151
  181.214.209.40
  181.214.211.93
  181.214.243.59
  181.214.32.216
-181.214.54.72
  181.214.54.74
-181.214.63.111
+181.214.58.179
+181.214.58.255
+181.214.63.25
  181.214.87.25
+181.214.88.212
  181.214.91.132
  181.214.91.188
  181.214.91.68
@@ -60758,10 +62305,11 @@
  181.215.114.160
  181.215.14.149
  181.215.18.39
+181.215.18.46
  181.215.18.50
-181.215.8.106
  181.220.64.145
  181.221.152.209
+181.221.156.219
  181.221.89.99
  181.223.119.245
  181.223.149.24
@@ -60781,6 +62329,7 @@
  181.225.65.242
  181.225.65.244
  181.226.156.197
+181.226.166.29
  181.226.176.227
  181.226.41.20
  181.228.55.57
@@ -60800,8 +62349,8 @@
  181.239.185.129
  181.239.194.19
  181.239.241.72
-181.28.101.14
  181.28.152.133
+181.29.74.235
  181.29.74.37
  181.3.101.201
  181.3.102.179
@@ -60811,26 +62360,20 @@
  181.3.106.48
  181.3.106.92
  181.3.109.76
-181.3.11.152
  181.3.110.243
  181.3.116.79
  181.3.120.42
  181.3.120.56
-181.3.121.88
  181.3.122.72
  181.3.122.96
  181.3.123.97
-181.3.124.13
  181.3.126.68
  181.3.128.21
  181.3.128.70
  181.3.130.13
  181.3.131.17
  181.3.131.192
-181.3.131.197
  181.3.132.45
-181.3.133.79
-181.3.135.116
  181.3.135.223
  181.3.136.121
  181.3.137.10
@@ -60841,30 +62384,26 @@
  181.3.143.46
  181.3.146.157
  181.3.148.193
-181.3.148.254
  181.3.150.58
  181.3.151.213
-181.3.154.16
  181.3.158.8
  181.3.159.178
  181.3.163.24
  181.3.165.160
  181.3.165.27
  181.3.165.39
+181.3.166.113
  181.3.168.34
-181.3.17.76
  181.3.171.85
  181.3.172.86
  181.3.173.217
  181.3.175.199
  181.3.175.22
-181.3.175.73
  181.3.176.246
  181.3.177.104
  181.3.177.121
+181.3.178.176
  181.3.178.200
-181.3.178.62
-181.3.179.219
  181.3.181.163
  181.3.183.241
  181.3.186.92
@@ -60882,6 +62421,7 @@
  181.3.205.215
  181.3.208.141
  181.3.209.151
+181.3.209.158
  181.3.209.236
  181.3.211.102
  181.3.212.16
@@ -60892,6 +62432,7 @@
  181.3.217.8
  181.3.218.187
  181.3.218.244
+181.3.221.87
  181.3.225.95
  181.3.226.96
  181.3.228.163
@@ -60902,11 +62443,9 @@
  181.3.231.192
  181.3.232.119
  181.3.233.215
-181.3.238.245
  181.3.238.36
  181.3.241.124
  181.3.241.50
-181.3.242.149
  181.3.242.183
  181.3.242.46
  181.3.246.11
@@ -60915,24 +62454,21 @@
  181.3.248.237
  181.3.248.64
  181.3.249.149
-181.3.249.195
  181.3.249.34
  181.3.251.2
  181.3.254.100
+181.3.254.138
+181.3.5.110
  181.3.77.212
  181.3.78.97
  181.3.80.31
  181.3.82.180
-181.3.83.16
  181.3.83.66
  181.3.84.25
  181.3.86.233
  181.3.86.55
  181.3.87.158
-181.3.88.100
  181.3.89.201
-181.3.89.250
-181.3.90.201
  181.3.90.94
  181.3.94.141
  181.3.95.236
@@ -60941,7 +62477,9 @@
  181.30.101.242
  181.30.126.66
  181.30.169.222
+181.30.28.133
  181.30.28.174
+181.30.28.198
  181.30.28.201
  181.30.28.219
  181.30.28.22
@@ -60962,9 +62500,9 @@
  181.39.32.99
  181.4.1.72
  181.4.10.139
-181.4.10.231
  181.4.11.179
  181.4.11.99
+181.4.12.254
  181.4.15.254
  181.4.16.12
  181.4.16.193
@@ -60977,23 +62515,24 @@
  181.4.25.157
  181.4.26.149
  181.4.26.216
-181.4.26.78
  181.4.27.134
-181.4.27.42
  181.4.28.116
+181.4.31.11
  181.4.31.43
-181.4.31.45
+181.4.32.81
  181.4.33.128
  181.4.33.33
  181.4.33.46
+181.4.36.117
  181.4.36.246
  181.4.36.68
  181.4.37.9
  181.4.39.244
+181.4.39.77
  181.4.40.81
-181.4.46.23
  181.4.47.215
  181.4.49.113
+181.4.5.107
  181.4.5.134
  181.4.5.200
  181.4.52.99
@@ -61008,11 +62547,8 @@
  181.4.63.122
  181.4.64.101
  181.4.64.103
-181.4.64.119
  181.4.65.235
  181.4.67.129
-181.4.67.30
-181.4.69.253
  181.4.7.214
  181.4.72.231
  181.4.73.203
@@ -61024,45 +62560,47 @@
  181.4.8.114
  181.4.80.238
  181.4.80.63
+181.4.82.230
  181.4.84.64
-181.4.85.194
  181.4.85.94
+181.4.9.46
  181.40.108.95
  181.40.116.150
  181.40.122.102
  181.40.122.2
  181.40.66.11
  181.40.73.86
+181.40.76.162
  181.40.84.38
  181.40.84.50
  181.41.80.40
  181.43.111.52
  181.44.130.176
-181.44.130.8
  181.44.183.65
  181.44.6.160
  181.45.136.144
  181.45.191.64
-181.46.137.190
-181.46.223.6
  181.46.234.8
  181.47.100.137
  181.47.113.213
  181.48.105.6
+181.48.111.246
+181.48.115.227
  181.48.120.220
  181.48.134.66
  181.48.134.70
+181.48.138.242
  181.48.139.118
  181.48.14.154
  181.48.145.28
  181.48.15.227
+181.48.155.149
  181.48.18.130
  181.48.184.162
  181.48.19.161
  181.48.225.126
  181.48.28.13
  181.48.46.195
-181.48.47.26
  181.48.54.202
  181.48.58.74
  181.48.7.146
@@ -61072,7 +62610,6 @@
  181.49.106.227
  181.49.106.228
  181.49.107.180
-181.49.117.166
  181.49.118.185
  181.49.122.12
  181.49.131.82
@@ -61090,23 +62627,22 @@
  181.49.50.226
  181.49.53.106
  181.49.54.250
-181.49.55.29
  181.49.96.186
  181.50.251.25
  181.50.99.8
  181.51.253.136
  181.52.121.54
+181.52.148.104
  181.52.172.107
  181.52.223.52
  181.52.237.106
+181.52.249.177
  181.52.249.181
  181.52.249.213
  181.52.85.249
-181.53.13.252
  181.53.251.181
  181.53.251.199
  181.55.95.52
-181.56.73.27
  181.56.9.15
  181.57.151.214
  181.57.167.193
@@ -61117,20 +62653,19 @@
  181.57.218.210
  181.57.33.248
  181.57.98.228
+181.58.120.115
  181.58.181.9
  181.58.189.155
+181.59.252.136
  181.59.56.102
  181.59.59.54
-181.6.0.159
  181.6.105.190
  181.6.106.23
-181.6.107.209
  181.6.107.252
-181.6.111.180
+181.6.109.66
  181.6.114.123
  181.6.116.104
  181.6.123.234
-181.6.125.45
  181.6.127.127
  181.6.128.234
  181.6.133.168
@@ -61138,14 +62673,12 @@
  181.6.136.168
  181.6.137.133
  181.6.137.85
-181.6.139.199
  181.6.140.197
+181.6.144.45
  181.6.145.154
  181.6.147.120
  181.6.152.160
-181.6.152.77
  181.6.155.43
-181.6.156.114
  181.6.156.247
  181.6.16.149
  181.6.162.217
@@ -61160,20 +62693,17 @@
  181.6.200.98
  181.6.202.139
  181.6.208.99
-181.6.211.193
  181.6.217.233
  181.6.217.79
  181.6.22.21
-181.6.221.126
  181.6.221.206
+181.6.228.162
  181.6.230.59
  181.6.232.102
-181.6.233.7
  181.6.237.20
  181.6.250.63
  181.6.254.179
  181.6.254.195
-181.6.30.100
  181.6.4.141
  181.6.40.181
  181.6.41.109
@@ -61183,15 +62713,12 @@
  181.6.68.160
  181.6.74.242
  181.6.8.71
-181.6.82.178
  181.6.83.161
  181.6.83.226
-181.6.85.205
  181.6.9.67
  181.60.78.91
  181.60.79.253
  181.61.182.143
-181.61.222.245
  181.62.245.247
  181.63.248.149
  181.64.160.234
@@ -61203,14 +62730,16 @@
  181.66.130.211
  181.72.201.229
  181.73.4.137
+181.78.0.45
  181.82.224.51
  181.82.224.65
  181.82.228.117
  181.82.229.83
  181.83.237.84
-181.84.20.129
  181.88.176.122
+181.90.108.37
  181.90.249.89
+181.94.221.144
  181.94.221.15
  181.94.222.179
  181.94.226.164
@@ -61227,9 +62756,9 @@
  182.101.207.11
  182.101.207.128
  182.107.123.205
-182.107.176.141
  182.107.176.166
  182.107.96.88
+182.108.0.146
  182.110.126.79
  182.110.15.51
  182.111.103.33
@@ -61237,40 +62766,41 @@
  182.111.148.38
  182.111.151.29
  182.111.153.177
+182.111.169.148
  182.111.24.105
  182.111.24.177
  182.111.24.203
-182.112.0.120
-182.112.12.70
  182.112.13.21
+182.112.14.211
  182.112.146.176
  182.112.156.163
-182.112.156.8
+182.112.156.61
  182.112.16.174
-182.112.20.225
-182.112.223.190
-182.112.223.242
+182.112.202.55
+182.112.220.155
  182.112.23.206
  182.112.243.128
  182.112.26.166
-182.112.27.143
-182.112.45.183
+182.112.26.175
+182.112.26.45
+182.112.30.194
+182.112.41.184
+182.112.42.3
+182.112.45.44
  182.112.48.35
-182.112.49.69
  182.112.49.89
-182.112.53.61
+182.112.5.222
  182.112.57.127
  182.112.57.19
  182.112.58.209
  182.112.58.74
  182.112.59.120
+182.112.59.59
+182.112.61.166
  182.112.62.252
-182.112.63.245
-182.112.67.200
  182.112.68.179
-182.112.68.50
  182.112.72.216
-182.112.79.245
+182.112.78.59
  182.112.9.196
  182.113.0.82
  182.113.114.33
@@ -61278,73 +62808,71 @@
  182.113.168.245
  182.113.169.247
  182.113.171.130
-182.113.18.212
  182.113.18.88
-182.113.198.197
+182.113.200.179
+182.113.201.127
  182.113.201.167
-182.113.201.18
+182.113.201.7
  182.113.202.243
  182.113.202.44
-182.113.204.133
+182.113.203.22
  182.113.204.186
-182.113.204.234
+182.113.205.50
+182.113.21.204
  182.113.211.248
+182.113.213.183
+182.113.213.227
  182.113.215.240
-182.113.215.9
-182.113.222.170
+182.113.218.105
+182.113.218.215
  182.113.228.239
-182.113.244.62
-182.113.27.176
  182.113.3.211
-182.113.4.160
+182.113.3.233
+182.113.42.69
  182.113.43.246
-182.113.44.146
+182.113.5.106
  182.113.58.37
-182.113.63.23
  182.113.98.18
  182.114.100.83
  182.114.101.156
+182.114.103.252
+182.114.103.5
  182.114.104.181
-182.114.127.121
-182.114.128.21
+182.114.127.19
  182.114.145.16
  182.114.145.199
  182.114.146.132
  182.114.16.114
  182.114.173.50
+182.114.18.232
  182.114.18.6
+182.114.192.43
  182.114.2.117
  182.114.20.91
  182.114.208.219
  182.114.21.120
  182.114.23.164
-182.114.25.218
  182.114.254.27
  182.114.254.79
  182.114.64.21
  182.114.64.33
-182.114.71.140
-182.114.71.252
+182.114.69.175
+182.114.77.31
  182.114.80.224
-182.114.80.31
-182.114.83.192
-182.114.83.196
-182.114.83.213
-182.114.83.225
+182.114.84.105
  182.114.84.75
  182.114.85.89
-182.114.86.154
-182.114.86.45
-182.114.87.119
+182.114.86.127
+182.114.88.192
  182.114.88.208
+182.114.89.24
  182.114.90.158
-182.114.91.180
-182.114.91.221
  182.114.92.204
-182.114.93.214
-182.114.95.243
+182.114.93.235
  182.114.98.52
  182.115.167.213
+182.115.181.117
+182.115.193.91
  182.115.194.78
  182.115.199.21
  182.115.215.183
@@ -61352,182 +62880,182 @@
  182.115.84.51
  182.115.86.245
  182.115.86.87
-182.116.100.132
  182.116.100.149
  182.116.101.122
  182.116.101.141
-182.116.101.206
+182.116.101.162
+182.116.101.176
  182.116.101.36
-182.116.102.163
  182.116.102.170
+182.116.102.243
  182.116.104.54
  182.116.104.88
  182.116.105.27
  182.116.106.175
-182.116.106.22
-182.116.106.7
+182.116.106.18
  182.116.106.74
  182.116.108.16
-182.116.108.238
-182.116.109.128
  182.116.109.252
  182.116.109.93
-182.116.109.94
  182.116.110.102
  182.116.110.177
-182.116.111.196
  182.116.111.230
  182.116.111.64
  182.116.114.164
-182.116.114.202
-182.116.114.21
  182.116.115.128
  182.116.115.46
+182.116.115.65
  182.116.115.78
  182.116.116.196
  182.116.116.92
+182.116.118.53
  182.116.119.168
-182.116.158.173
  182.116.167.192
  182.116.178.183
-182.116.204.134
+182.116.37.92
  182.116.38.160
+182.116.43.255
  182.116.43.40
+182.116.45.193
+182.116.46.152
  182.116.64.11
+182.116.64.147
+182.116.65.230
  182.116.65.7
  182.116.67.130
  182.116.67.225
  182.116.70.143
+182.116.70.58
  182.116.71.231
-182.116.71.45
+182.116.71.62
+182.116.72.201
+182.116.72.222
  182.116.74.217
  182.116.76.129
  182.116.77.67
+182.116.81.65
  182.116.91.86
-182.116.93.43
  182.116.96.194
+182.116.96.61
+182.116.97.116
+182.116.97.51
  182.116.98.31
-182.116.99.56
  182.116.99.66
  182.117.10.20
  182.117.100.136
  182.117.100.79
-182.117.102.107
+182.117.100.8
+182.117.101.153
  182.117.102.54
-182.117.102.98
+182.117.103.145
  182.117.103.176
-182.117.104.206
+182.117.104.47
  182.117.105.200
-182.117.106.229
-182.117.106.32
+182.117.106.249
  182.117.106.41
-182.117.108.132
-182.117.109.190
  182.117.111.133
-182.117.111.237
  182.117.111.54
  182.117.111.74
+182.117.112.48
  182.117.129.124
  182.117.130.204
-182.117.169.252
-182.117.174.138
-182.117.185.97
  182.117.187.95
  182.117.190.222
+182.117.2.252
  182.117.207.206
  182.117.227.55
  182.117.230.78
-182.117.24.242
  182.117.241.113
  182.117.245.44
-182.117.26.41
+182.117.27.209
  182.117.27.218
  182.117.28.104
-182.117.28.126
+182.117.28.255
+182.117.28.67
+182.117.29.101
  182.117.29.116
  182.117.29.231
  182.117.29.80
  182.117.3.225
  182.117.31.32
-182.117.34.228
  182.117.36.128
-182.117.38.121
+182.117.37.195
  182.117.40.199
  182.117.40.23
-182.117.40.241
  182.117.41.103
  182.117.41.199
  182.117.42.121
  182.117.42.150
  182.117.42.198
  182.117.42.209
-182.117.42.52
+182.117.42.94
  182.117.43.233
-182.117.43.5
-182.117.48.146
+182.117.50.124
  182.117.66.0
  182.117.66.7
  182.117.66.93
  182.117.67.215
  182.117.67.71
+182.117.68.20
  182.117.69.205
  182.117.70.171
  182.117.70.237
  182.117.71.133
  182.117.71.196
  182.117.72.158
-182.117.72.19
-182.117.73.41
+182.117.73.194
  182.117.73.74
-182.117.74.152
+182.117.75.141
  182.117.75.235
  182.117.76.242
+182.117.77.138
+182.117.78.26
  182.117.78.39
  182.117.79.102
  182.117.79.115
-182.117.79.122
-182.117.79.65
+182.117.8.154
+182.117.80.123
  182.117.80.241
  182.117.81.130
-182.117.81.29
  182.117.82.10
  182.117.83.13
  182.117.83.88
  182.117.84.110
-182.117.84.159
-182.117.84.190
+182.117.84.188
  182.117.85.50
-182.117.87.114
  182.117.87.127
  182.117.87.181
-182.117.87.48
-182.117.88.66
+182.117.88.39
  182.117.89.194
-182.117.91.146
  182.117.91.214
  182.117.91.235
+182.117.92.245
  182.117.93.173
+182.117.93.176
  182.117.93.42
  182.117.94.187
+182.117.95.124
+182.117.95.162
  182.117.96.14
  182.117.97.145
  182.117.97.185
+182.117.98.135
  182.117.98.201
-182.117.99.5
+182.117.99.182
  182.117.99.64
  182.118.135.39
-182.118.147.157
-182.118.162.81
+182.118.144.78
+182.118.145.59
+182.118.168.209
  182.118.170.207
  182.118.173.50
  182.118.174.46
  182.118.46.94
  182.119.0.204
-182.119.10.146
  182.119.10.210
  182.119.10.25
  182.119.10.28
-182.119.10.68
+182.119.100.13
  182.119.101.139
  182.119.102.136
  182.119.107.169
@@ -61535,31 +63063,29 @@
  182.119.119.102
  182.119.12.199
  182.119.12.22
-182.119.121.34
  182.119.123.192
-182.119.123.7
+182.119.13.107
  182.119.13.160
  182.119.13.205
  182.119.138.143
-182.119.139.241
  182.119.139.92
-182.119.14.124
+182.119.14.214
  182.119.15.113
+182.119.15.131
  182.119.15.189
-182.119.15.193
-182.119.15.24
-182.119.15.49
+182.119.15.201
+182.119.15.96
  182.119.16.71
  182.119.160.219
  182.119.160.254
  182.119.161.181
-182.119.161.197
-182.119.163.163
  182.119.163.20
  182.119.164.146
  182.119.164.247
  182.119.165.114
+182.119.165.204
  182.119.166.30
+182.119.166.78
  182.119.167.121
  182.119.167.172
  182.119.167.175
@@ -61567,17 +63093,12 @@
  182.119.167.59
  182.119.17.205
  182.119.17.21
-182.119.177.125
-182.119.180.11
-182.119.180.130
+182.119.176.178
+182.119.178.73
  182.119.181.4
-182.119.186.68
-182.119.187.167
  182.119.189.90
-182.119.190.173
-182.119.191.217
  182.119.20.35
-182.119.201.206
+182.119.201.188
  182.119.202.219
  182.119.202.99
  182.119.203.210
@@ -61592,23 +63113,21 @@
  182.119.210.156
  182.119.215.94
  182.119.218.133
-182.119.218.159
  182.119.218.184
  182.119.219.132
  182.119.225.146
-182.119.226.39
-182.119.229.90
-182.119.249.157
+182.119.228.191
+182.119.228.227
+182.119.23.15
+182.119.248.214
+182.119.248.255
  182.119.249.2
  182.119.251.147
  182.119.251.197
-182.119.251.243
  182.119.252.152
-182.119.252.210
+182.119.252.239
  182.119.252.80
  182.119.253.121
-182.119.254.119
-182.119.254.139
  182.119.254.41
  182.119.255.126
  182.119.255.28
@@ -61616,17 +63135,22 @@
  182.119.32.89
  182.119.47.254
  182.119.48.103
-182.119.51.214
-182.119.52.185
+182.119.52.70
  182.119.53.13
  182.119.53.95
-182.119.57.106
-182.119.58.126
+182.119.56.115
+182.119.56.248
+182.119.57.29
+182.119.58.158
  182.119.58.167
+182.119.58.234
  182.119.58.36
  182.119.59.235
  182.119.61.10
  182.119.61.162
+182.119.63.85
+182.119.83.33
+182.119.87.247
  182.119.9.51
  182.119.98.151
  182.120.1.143
@@ -61634,85 +63158,92 @@
  182.120.15.148
  182.120.15.40
  182.120.155.197
-182.120.157.211
  182.120.16.115
+182.120.16.71
  182.120.160.239
  182.120.161.131
-182.120.165.60
+182.120.162.164
  182.120.186.131
  182.120.33.50
-182.120.34.97
+182.120.35.154
  182.120.36.28bin.sh
  182.120.40.42
-182.120.44.136
  182.120.47.214
-182.120.48.192
+182.120.51.206
  182.120.53.110
-182.120.53.73
+182.120.53.93
  182.120.55.67
  182.120.56.138
-182.120.58.250
-182.120.60.177
+182.120.56.158
+182.120.57.62
+182.120.58.206
+182.120.59.204
  182.120.61.19
-182.120.67.227
+182.120.65.132
  182.120.8.88
-182.120.80.226
  182.120.83.212
-182.121.103.110
  182.121.112.12
-182.121.113.213
-182.121.114.167
-182.121.117.145
-182.121.117.239
+182.121.112.134
+182.121.113.168
  182.121.117.254
+182.121.118.198
  182.121.122.63
+182.121.127.13
+182.121.127.63
+182.121.128.31
+182.121.129.0
  182.121.129.154
  182.121.129.188
+182.121.129.233
  182.121.130.175
-182.121.130.97
+182.121.130.233
  182.121.131.14
  182.121.132.112
-182.121.132.214
-182.121.133.110
-182.121.135.118
+182.121.134.175
+182.121.134.95
  182.121.150.5
-182.121.151.47
  182.121.152.32
+182.121.153.15
  182.121.154.126
+182.121.154.60
  182.121.155.91
-182.121.157.151
  182.121.157.170
  182.121.159.236
-182.121.169.102
-182.121.186.40
+182.121.168.4
+182.121.20.102
  182.121.204.233
  182.121.204.69
  182.121.205.92
  182.121.206.150
+182.121.207.227
  182.121.207.66
-182.121.209.50
-182.121.213.146
+182.121.213.178
  182.121.214.241
  182.121.217.78
+182.121.220.4
+182.121.227.106
  182.121.23.17
+182.121.231.192
+182.121.233.116
  182.121.238.175
  182.121.242.125
-182.121.245.252
+182.121.244.253
  182.121.248.170
  182.121.248.97
+182.121.249.108
  182.121.25.182
  182.121.254.127
  182.121.255.87
-182.121.30.133
+182.121.27.19
  182.121.30.20
-182.121.33.81
-182.121.40.53
-182.121.45.134
+182.121.33.231
+182.121.41.131
+182.121.46.248
  182.121.47.107
  182.121.47.144
-182.121.48.144
-182.121.50.229
+182.121.52.227
  182.121.52.26
+182.121.54.0
  182.121.65.65
  182.121.66.219
  182.121.66.45
@@ -61720,80 +63251,89 @@
  182.121.68.136
  182.121.70.15
  182.121.70.24
-182.121.81.119
+182.121.75.102
+182.121.83.231
+182.121.83.91
+182.121.84.77
  182.121.85.120
  182.121.85.4
-182.121.9.107
-182.121.9.216
+182.121.88.113
+182.121.89.162
  182.121.9.92
-182.121.90.252
-182.121.98.124
+182.121.91.182
+182.121.92.210
+182.121.92.227
+182.121.93.85
+182.121.96.218
  182.122.116.28
  182.122.117.37
+182.122.131.247
  182.122.155.192
  182.122.156.218
  182.122.160.137
  182.122.169.247
  182.122.172.171
-182.122.202.121
-182.122.204.122
+182.122.201.136
+182.122.205.29
  182.122.207.94
  182.122.208.28
-182.122.216.203
  182.122.219.16
-182.122.222.221
-182.122.224.2
  182.122.224.225
+182.122.224.55
  182.122.226.78
+182.122.23.154
  182.122.245.41
+182.122.249.52
  182.122.249.8
  182.122.25.85
  182.122.250.111
-182.122.250.124
  182.122.251.231bin.sh
  182.122.252.203
-182.122.253.238
+182.122.253.157
  182.122.255.221
  182.122.27.55
  182.122.56.237
+182.122.71.179
+182.122.73.12
  182.122.81.231
  182.122.82.167
  182.122.95.128
  182.123.181.47
-182.123.197.156
-182.123.198.150
+182.123.191.148
  182.123.208.31
  182.123.208.43
  182.123.210.216
  182.123.210.25
  182.123.211.164
  182.123.211.187
-182.123.246.31
-182.123.247.105
  182.123.247.218
+182.123.250.214
  182.123.251.182
-182.124.141.69
+182.124.128.158
  182.124.142.119
  182.124.159.26
  182.124.162.4
-182.124.235.70
-182.124.237.210
-182.124.242.132
+182.124.208.10
+182.124.218.225
  182.124.252.214
-182.124.27.45
-182.124.35.209
+182.124.28.241
+182.124.32.134
  182.124.5.172
  182.124.52.23
-182.124.59.57
-182.125.111.38
+182.124.62.179
+182.124.83.219
+182.124.86.147
  182.125.35.2
  182.125.38.176
  182.126.101.66
  182.126.101.85
  182.126.102.140
+182.126.102.205
  182.126.104.196
-182.126.105.169
+182.126.112.22
+182.126.112.62
  182.126.113.107
+182.126.116.6
  182.126.117.212
  182.126.117.219
  182.126.118.161
@@ -61801,14 +63341,12 @@
  182.126.119.123
  182.126.119.34
  182.126.120.203
-182.126.121.139
-182.126.124.152
-182.126.124.233
+182.126.120.249
+182.126.122.252
  182.126.124.254
-182.126.125.108
  182.126.125.182
-182.126.125.52
  182.126.126.181
+182.126.128.136
  182.126.128.140
  182.126.143.136
  182.126.166.12
@@ -61819,64 +63357,66 @@
  182.126.198.248
  182.126.199.209
  182.126.199.9
-182.126.211.56
-182.126.215.148
  182.126.234.24
  182.126.241.124
  182.126.52.195
+182.126.52.47
  182.126.65.75
  182.126.69.180
  182.126.69.88
  182.126.71.233
-182.126.81.69
+182.126.80.101
  182.126.82.11
  182.126.82.128
  182.126.82.220
  182.126.82.52
-182.126.83.115
  182.126.85.166
  182.126.86.59
-182.126.87.132
-182.126.88.76
+182.126.87.227
  182.126.89.114
-182.126.93.96
-182.126.94.72
+182.126.91.142
+182.126.92.207
+182.126.94.227
  182.127.102.64
-182.127.107.213
  182.127.108.196
+182.127.109.62
  182.127.123.213
-182.127.136.175
+182.127.130.169
+182.127.131.2
+182.127.131.84
+182.127.136.126
  182.127.137.139
-182.127.138.45
+182.127.15.130
  182.127.152.142
  182.127.152.32
  182.127.155.174
  182.127.156.246
  182.127.171.4
-182.127.181.29
-182.127.181.44
-182.127.183.104
-182.127.184.52
+182.127.177.155
+182.127.183.93
  182.127.185.157
-182.127.187.216
+182.127.185.191
+182.127.187.184
+182.127.187.23
  182.127.188.45
+182.127.191.8
  182.127.207.162
-182.127.211.57
+182.127.209.184
+182.127.210.179
+182.127.210.18
  182.127.219.151
  182.127.219.22
-182.127.222.240
+182.127.223.171
  182.127.29.87
-182.127.36.136
-182.127.36.138
-182.127.66.201
+182.127.40.92
  182.127.66.46
-182.127.73.212
  182.127.75.230
-182.127.78.99
-182.127.84.62
+182.127.77.75
+182.127.88.221
  182.127.89.226
  182.127.92.14
-182.127.92.78
+182.127.96.100
+182.127.96.171
  182.127.96.77
  182.127.97.153
  182.127.97.155
@@ -61892,6 +63432,7 @@
  182.135.237.182
  182.135.63.227
  182.138.137.34
+182.138.167.108
  182.138.191.238
  182.140.138.172
  182.140.138.55
@@ -61909,20 +63450,22 @@
  182.142.112.88
  182.142.115.84
  182.142.118.25
+182.143.16.66
  182.143.17.178
  182.143.18.188
  182.145.110.181
  182.145.40.110
  182.145.43.204
  182.146.231.164
+182.147.96.120
  182.148.106.131
  182.148.107.157
  182.148.107.252
  182.148.112.148
+182.148.120.192
  182.148.122.10
  182.148.122.11
  182.148.122.12
-182.148.122.13
  182.148.122.14
  182.148.122.15
  182.148.122.16
@@ -61940,9 +63483,10 @@
  182.148.122.8
  182.148.122.9
  182.148.13.194
+182.148.13.246
  182.148.14.16
+182.148.15.26
  182.148.251.113
-182.148.92.39
  182.149.83.251
  182.149.83.62
  182.149.83.68
@@ -61952,10 +63496,8 @@
  182.150.20.11
  182.150.3.106
  182.150.3.63
-182.150.45.153
  182.150.45.30
  182.150.57.34
-182.150.58.24
  182.150.99.98
  182.151.101.121
  182.151.15.213
@@ -61973,9 +63515,9 @@
  182.151.32.144
  182.151.37.230
  182.151.46.222
-182.152.19.94
  182.155.149.145
  182.155.152.129
+182.155.188.223
  182.155.199.177
  182.155.201.26
  182.155.202.48
@@ -61988,11 +63530,13 @@
  182.155.92.182
  182.156.209.222
  182.156.213.183
+182.156.216.51
  182.156.229.90
  182.156.251.155
  182.16.10.90
  182.16.10.91
  182.16.10.94
+182.16.117.204
  182.16.161.161
  182.16.161.18
  182.16.162.29
@@ -62027,11 +63571,9 @@
  182.16.5.99
  182.16.82.250
  182.160.104.213
-182.160.109.202
  182.160.109.214
  182.160.110.178
  182.160.115.180
-182.160.116.145
  182.160.117.107
  182.160.117.130
  182.160.118.50
@@ -62044,14 +63586,16 @@
  182.160.96.46
  182.161.137.194
  182.161.19.122
+182.162.104.153
  182.162.104.239
  182.162.17.171
  182.162.17.202
+182.162.17.245
+182.162.17.51
  182.165.90.235
  182.167.119.158
  182.171.246.142
  182.172.36.95
-182.172.94.114
  182.176.114.200
  182.176.129.75
  182.176.132.99
@@ -62062,6 +63606,7 @@
  182.176.90.252
  182.176.91.11
  182.176.93.182
+182.176.97.49
  182.18.139.59
  182.18.144.99
  182.18.152.36
@@ -62085,6 +63630,7 @@
  182.18.72.25
  182.18.72.26
  182.18.72.27
+182.18.72.28
  182.18.72.29
  182.18.72.4
  182.18.72.5
@@ -62105,6 +63651,7 @@
  182.180.83.118
  182.180.83.54
  182.180.95.121
+182.183.147.66
  182.184.112.215
  182.184.58.173
  182.184.66.153
@@ -62113,46 +63660,40 @@
  182.185.223.183
  182.185.54.124
  182.185.64.101
-182.185.65.153
  182.185.90.202
  182.185.92.230
-182.186.13.170
  182.186.41.168
  182.187.139.159
  182.187.143.135
-182.187.66.208
  182.188.38.174
  182.188.40.89
-182.189.101.0
-182.189.101.153
-182.189.229.194
  182.189.253.87
  182.189.32.68
-182.189.46.20
+182.189.42.213
  182.19.162.22
  182.19.166.153
  182.19.38.21
  182.19.41.145
  182.19.65.177
  182.19.85.20
+182.190.104.158
+182.190.108.0
  182.190.209.220
-182.190.97.166
  182.191.114.25
-182.191.204.134
-182.191.61.7
+182.191.203.40
  182.191.75.88
  182.191.84.39
-182.191.87.143
  182.200.185.136
+182.200.186.67
  182.204.167.251
  182.207.222.190
+182.208.112.240
  182.208.124.155
  182.208.177.41
  182.208.213.104
  182.208.247.233
  182.208.252.91
  182.208.30.18
-182.208.90.83
  182.208.98.210
  182.209.199.174
  182.210.203.218
@@ -62161,7 +63702,7 @@
  182.210.46.119
  182.213.179.92
  182.213.195.21
-182.214.5.6
+182.215.139.141
  182.218.152.87
  182.218.64.155
  182.220.24.30
@@ -62170,6 +63711,7 @@
  182.222.195.145
  182.222.195.192
  182.222.195.217
+182.222.204.79
  182.222.28.14
  182.222.28.27
  182.224.198.84
@@ -62193,13 +63735,16 @@
  182.23.35.242
  182.23.43.116
  182.23.51.2
+182.23.51.212
  182.23.54.0
  182.23.54.146
  182.23.54.210
+182.23.56.138
  182.23.62.195
  182.23.67.49
  182.23.79.162
  182.23.82.22
+182.23.93.140
  182.230.183.103
  182.230.61.80
  182.233.8.171
@@ -62207,14 +63752,12 @@
  182.233.8.5
  182.234.62.249
  182.234.79.219
-182.235.208.160
  182.235.208.23
  182.235.209.100
  182.235.209.89
  182.235.212.121
  182.235.239.212
  182.235.29.125
-182.237.13.197
  182.237.214.20
  182.239.163.125
  182.239.169.172
@@ -62236,9 +63779,9 @@
  182.245.15.219
  182.245.172.61
  182.245.190.68
+182.245.57.127
  182.247.166.52
  182.247.192.214
-182.247.194.35
  182.247.239.24
  182.252.131.200
  182.253.104.50
@@ -62252,6 +63795,8 @@
  182.253.115.90
  182.253.117.99
  182.253.119.34
+182.253.119.50
+182.253.122.110
  182.253.140.202
  182.253.141.3
  182.253.142.9
@@ -62261,10 +63806,7 @@
  182.253.16.174
  182.253.16.3
  182.253.168.195
-182.253.170.67
-182.253.171.81
-182.253.175.149
-182.253.175.179
+182.253.173.76
  182.253.18.141
  182.253.184.20
  182.253.190.12
@@ -62272,6 +63814,7 @@
  182.253.191.122
  182.253.191.125
  182.253.192.186
+182.253.195.35
  182.253.196.218
  182.253.196.221
  182.253.197.100
@@ -62288,12 +63831,15 @@
  182.253.226.88
  182.253.232.130
  182.253.232.32
+182.253.233.169
  182.253.233.178
-182.253.234.34
  182.253.234.49
  182.253.234.63
  182.253.234.99
+182.253.235.239
  182.253.244.152
+182.253.38.4
+182.253.43.24
  182.253.6.234
  182.253.60.170
  182.253.62.194
@@ -62303,7 +63849,7 @@
  182.253.68.18
  182.253.70.25
  182.253.70.89
-182.253.72.100
+182.253.75.216
  182.253.78.34
  182.253.86.139
  182.253.93.5
@@ -62320,21 +63866,25 @@
  182.254.146.230
  182.254.147.247
  182.254.149.130
+182.254.149.147
  182.254.149.33
  182.254.149.99
  182.254.151.2
  182.254.152.219
  182.254.159.133
  182.254.161.109
+182.254.161.125
  182.254.161.202
+182.254.162.72
  182.254.163.149
  182.254.164.34
  182.254.165.138
-182.254.166.136
  182.254.166.97
  182.254.168.205
  182.254.171.125
  182.254.172.63
+182.254.173.231
+182.254.178.101
  182.254.178.192
  182.254.180.17
  182.254.184.127
@@ -62345,6 +63895,7 @@
  182.254.210.199
  182.254.210.233
  182.254.211.192
+182.254.211.79
  182.254.213.32
  182.254.215.66
  182.254.216.215
@@ -62386,7 +63937,6 @@
  182.47.27.120
  182.48.114.11
  182.48.119.121
-182.48.212.59
  182.48.70.145
  182.48.70.154
  182.48.81.222
@@ -62394,21 +63944,17 @@
  182.48.84.58
  182.48.87.170
  182.48.88.205
-182.48.88.218
  182.48.90.130
  182.50.117.244
  182.50.120.194
  182.50.120.204
-182.50.130.145
  182.50.130.173
+182.50.130.22
  182.50.132.101
-182.50.132.113
  182.50.132.79
-182.50.135.32
  182.50.135.52
  182.50.135.54
  182.50.135.59
-182.50.135.72
  182.50.135.73
  182.50.141.145
  182.50.151.12
@@ -62423,6 +63969,7 @@
  182.50.4.192
  182.50.65.135
  182.50.69.70
+182.52.103.141
  182.52.103.219
  182.52.108.104
  182.52.136.107
@@ -62434,6 +63981,7 @@
  182.52.149.200
  182.52.21.2
  182.52.22.58
+182.52.224.39
  182.52.229.57
  182.52.23.206
  182.52.23.244
@@ -62443,6 +63991,7 @@
  182.52.238.119
  182.52.238.52
  182.52.33.229
+182.52.33.4
  182.52.40.170
  182.52.51.10
  182.52.51.154
@@ -62453,30 +64002,29 @@
  182.52.63.95
  182.52.65.7
  182.52.67.122
-182.52.67.17
  182.52.7.191
  182.52.70.117
+182.52.70.18
  182.52.70.196
  182.52.74.76
  182.52.86.149
-182.52.90.117
  182.52.90.164
  182.52.90.42
  182.52.91.116
  182.52.91.235
-182.53.0.212
  182.53.10.130
  182.53.135.213
  182.53.174.83
  182.53.180.43
-182.53.181.187
  182.53.181.26
+182.53.185.199
  182.53.19.34
  182.53.193.171
  182.53.193.205
  182.53.197.156
  182.53.197.223
  182.53.201.158
+182.53.201.178
  182.53.201.184
  182.53.201.239
  182.53.201.252
@@ -62490,12 +64038,13 @@
  182.53.206.26
  182.53.206.40
  182.53.206.44
-182.53.250.180
-182.53.30.32
+182.53.215.214
+182.53.50.146
  182.53.50.226
  182.53.60.18
  182.53.67.170
  182.53.70.204
+182.53.75.226
  182.53.76.97
  182.53.78.27
  182.53.96.103
@@ -62521,29 +64070,32 @@
  182.55.26.152
  182.55.27.161
  182.55.83.186
-182.57.169.116
-182.57.54.24
-182.58.129.141
+182.56.40.217
+182.57.136.205
+182.57.52.244
+182.57.83.169
  182.58.137.70
+182.58.166.110
  182.58.192.5
  182.58.223.206
  182.58.238.246
-182.58.243.139
-182.58.245.46
  182.58.49.77
-182.59.103.220
+182.59.104.173
+182.59.119.178
  182.59.177.9
  182.59.2.193
+182.59.200.156
  182.59.3.33
-182.59.40.208
-182.59.60.65
-182.59.65.238
-182.59.78.213
-182.61.1.203
+182.59.33.86
+182.59.48.155
+182.59.51.142
+182.59.97.139
+182.61.1.161
  182.61.1.248
  182.61.1.88
  182.61.10.28
  182.61.104.246
+182.61.109.84
  182.61.12.12
  182.61.12.58
  182.61.12.9
@@ -62558,17 +64110,22 @@
  182.61.133.98
  182.61.136.149
  182.61.136.17
+182.61.136.3
  182.61.139.51
  182.61.14.93
  182.61.144.110
  182.61.146.188
  182.61.149.188
+182.61.149.29
  182.61.150.12
  182.61.150.42
  182.61.16.73
+182.61.161.121
+182.61.161.219
  182.61.164.198
  182.61.164.235
  182.61.165.33
+182.61.167.24
  182.61.168.185
  182.61.171.65
  182.61.173.200
@@ -62578,18 +64135,24 @@
  182.61.18.154
  182.61.18.216
  182.61.184.155
+182.61.19.118
  182.61.19.225
  182.61.2.135
+182.61.2.231
+182.61.2.238
  182.61.21.155
  182.61.21.209
  182.61.22.46
  182.61.25.156
+182.61.26.165
  182.61.26.73
  182.61.27.149
  182.61.29.203
+182.61.29.241
  182.61.3.13
-182.61.32.178
+182.61.3.157
  182.61.33.145
+182.61.35.17
  182.61.35.185
  182.61.36.44
  182.61.36.56
@@ -62597,48 +64160,56 @@
  182.61.37.34
  182.61.38.191
  182.61.39.203
+182.61.39.49
+182.61.4.60
  182.61.40.124
  182.61.40.161
  182.61.40.214
  182.61.40.227
  182.61.40.252
+182.61.40.83
  182.61.41.171
  182.61.42.74
  182.61.43.127
  182.61.43.196
  182.61.43.202
+182.61.44.177
+182.61.46.54
  182.61.47.88
  182.61.49.107
  182.61.50.68
  182.61.52.111
+182.61.52.135
+182.61.54.45
  182.61.55.39
  182.61.55.79
+182.61.6.182
  182.61.6.184
+182.61.6.64
  182.61.60.191
  182.61.61.58
  182.61.65.209
  182.64.249.86
  182.65.229.177
-182.65.32.46
  182.68.251.215
-182.68.28.32
-182.68.44.133
+182.70.126.198
  182.70.242.155
  182.71.10.18
  182.71.111.138
+182.71.116.54
  182.71.163.244
-182.71.188.10
  182.71.197.195
  182.71.232.178
  182.71.247.84
  182.71.52.98
  182.71.85.94
  182.71.87.34
+182.71.87.39
  182.71.88.132
  182.71.90.202
  182.71.90.22
  182.72.122.149
-182.72.147.170
+182.72.146.2
  182.72.161.90
  182.72.162.16
  182.72.162.7
@@ -62648,11 +64219,12 @@
  182.72.28.210
  182.72.30.66
  182.72.94.146
+182.72.99.196
  182.73.136.210
+182.73.136.26
  182.73.143.146
  182.73.15.70
  182.73.208.125
-182.73.212.10
  182.73.230.106
  182.73.39.13
  182.73.41.110
@@ -62663,9 +64235,10 @@
  182.74.18.26
  182.74.197.50
  182.74.25.246
+182.74.37.226
  182.74.61.136
+182.74.86.27
  182.74.87.194
-182.75.112.254
  182.75.115.59
  182.75.123.6
  182.75.125.50
@@ -62674,11 +64247,10 @@
  182.75.139.26
  182.75.165.202
  182.75.176.107
-182.75.211.22
  182.75.216.74
+182.75.227.62
  182.75.249.98
  182.75.40.70
-182.75.48.98
  182.75.56.226
  182.75.90.137
  182.75.99.50
@@ -62687,8 +64259,8 @@
  182.76.160.138
  182.76.168.232
  182.76.169.195
+182.76.200.6
  182.76.213.139
-182.76.224.174
  182.76.237.118
  182.76.242.74
  182.76.28.148
@@ -62698,17 +64270,21 @@
  182.76.6.218
  182.76.74.78
  182.76.80.185
+182.77.69.29
  182.78.194.78
-182.84.124.25
+182.84.124.104
+182.84.124.231
+182.84.124.250
  182.84.47.181
-182.86.224.117
  182.86.225.15
+182.86.225.195
  182.87.223.76
  182.88.224.153
+182.88.27.4
  182.90.248.25
  182.92.113.148
+182.92.121.8
  182.92.129.11
-182.92.189.98
  182.92.195.165
  182.92.199.94
  182.92.216.63
@@ -62724,10 +64300,9 @@
  182.93.80.28
  182.93.80.3
  182.93.80.85
-182.93.84.136
  182.93.94.80
  182.93.95.146
-182.99.217.127
+182.96.241.159
  1821456.dg398993.web.hosting-test.net
  182elexusbet.com
  183.100.104.143
@@ -62735,6 +64310,8 @@
  183.100.185.72
  183.100.189.194
  183.100.199.224
+183.100.216.133
+183.100.236.215
  183.100.31.47
  183.100.79.19
  183.101.104.68
@@ -62746,6 +64323,7 @@
  183.101.185.36
  183.101.237.159
  183.101.65.178
+183.101.68.71
  183.101.8.110
  183.101.88.190
  183.102.129.78
@@ -62756,7 +64334,7 @@
  183.103.115.2
  183.103.12.247
  183.103.120.89
-183.103.140.231
+183.103.14.82
  183.103.173.46
  183.103.204.213
  183.103.213.221
@@ -62783,7 +64361,7 @@
  183.105.39.48
  183.105.46.241
  183.105.5.48
-183.105.93.79
+183.105.60.223
  183.105.99.30
  183.106.132.159
  183.106.134.77
@@ -62804,6 +64382,7 @@
  183.107.206.110
  183.107.51.106
  183.107.96.148
+183.108.105.194
  183.108.117.99
  183.108.23.87
  183.108.241.56
@@ -62832,26 +64411,27 @@
  183.109.247.8
  183.109.80.156
  183.109.82.108
+183.11.238.29
  183.110.220.210
  183.110.223.149
  183.111.148.118
  183.111.204.148
  183.111.206.111
  183.12.238.251
-183.12.240.101
  183.12.241.209
  183.12.26.150
  183.12.27.69
  183.128.164.194
  183.128.165.120
+183.128.81.65
  183.129.136.78
  183.129.138.166
+183.129.148.82
  183.129.152.53
  183.129.159.211
  183.129.159.242
  183.129.159.243
  183.129.163.142
-183.129.170.114
  183.129.174.68
  183.129.175.34
  183.129.177.196
@@ -62859,7 +64439,6 @@
  183.129.185.170
  183.129.198.133
  183.129.202.10
-183.129.202.11
  183.129.202.12
  183.129.202.14
  183.129.202.2
@@ -62870,6 +64449,7 @@
  183.129.202.8
  183.129.202.9
  183.129.212.251
+183.129.213.74
  183.129.214.194
  183.129.222.78
  183.129.224.2
@@ -62884,6 +64464,7 @@
  183.131.110.90
  183.131.110.91
  183.131.110.95
+183.131.126.58
  183.131.180.89
  183.131.19.93
  183.131.200.88
@@ -62900,6 +64481,8 @@
  183.131.66.7
  183.131.84.239
  183.131.85.11
+183.131.85.6
+183.131.88.186
  183.132.102.94
  183.132.11.54
  183.132.123.110
@@ -62929,9 +64512,9 @@
  183.134.75.216
  183.135.152.121
  183.135.154.59
+183.135.155.154
  183.135.155.190
  183.136.132.14
-183.136.132.2
  183.136.145.234
  183.136.148.202
  183.136.149.181
@@ -62940,16 +64523,18 @@
  183.136.194.146
  183.136.223.226
  183.136.225.45
-183.136.225.56
  183.136.233.133
  183.138.101.71
-183.138.128.145
  183.138.96.63
+183.14.132.143
  183.14.134.18
-183.14.134.222
+183.14.135.238
+183.14.28.106
+183.14.29.80
+183.14.30.22
  183.141.2.113
+183.141.2.183
  183.141.65.55
-183.142.115.155
  183.142.153.88
  183.142.162.112
  183.142.18.39
@@ -62963,24 +64548,24 @@
  183.142.83.72
  183.142.84.92
  183.142.95.75
+183.143.104.139
  183.143.18.170
  183.143.18.4
  183.143.85.134
  183.144.110.136
-183.144.55.134
+183.144.53.85
  183.145.123.9
  183.145.125.81
+183.145.15.152
  183.145.168.172
-183.145.168.198
+183.145.170.141
  183.145.172.93
  183.145.175.200
  183.145.207.183
  183.145.58.140
  183.146.16.68
-183.146.184.232
  183.146.213.157
  183.146.213.198
-183.147.1.224
  183.148.168.159
  183.148.171.206
  183.148.172.211
@@ -62992,80 +64577,67 @@
  183.15.172.26
  183.15.172.36
  183.15.172.5
+183.15.180.158
  183.15.205.149
  183.15.88.36
  183.15.89.45
  183.15.89.96
+183.15.91.122
+183.15.91.75
  183.150.208.219
-183.150.25.61
  183.150.28.20
  183.150.34.71
-183.150.64.150
-183.150.86.53
-183.151.170.20
-183.154.20.228
+183.151.1.217
  183.154.25.226
+183.154.59.129
+183.155.198.205
  183.156.180.94
  183.156.2.119
  183.156.244.63
  183.157.133.33
  183.157.138.251
  183.157.147.197
-183.157.167.122
+183.157.166.186
  183.157.168.12
  183.157.168.133
  183.157.168.144
-183.157.168.160
+183.157.168.15
  183.157.168.163
-183.157.168.169
  183.157.168.176
  183.157.168.191
-183.157.168.192
  183.157.168.196
  183.157.168.204
-183.157.168.211
-183.157.168.22
  183.157.168.235
  183.157.168.246
  183.157.168.27
  183.157.168.52
  183.157.168.55
-183.157.169.118
-183.157.169.125
+183.157.168.75
+183.157.168.99
  183.157.169.17
  183.157.169.182
-183.157.169.195
+183.157.169.19
  183.157.169.230
-183.157.169.33
  183.157.170.114
  183.157.170.135
  183.157.170.190
-183.157.170.207
-183.157.170.211
-183.157.170.221
  183.157.170.223
  183.157.170.248
-183.157.170.250
  183.157.170.252
  183.157.170.37
-183.157.170.45
+183.157.170.44
  183.157.170.46
  183.157.170.47
-183.157.170.7
+183.157.170.64
  183.157.170.72
  183.157.170.77
-183.157.170.84
  183.157.171.102
  183.157.171.110
  183.157.171.113
-183.157.171.123
  183.157.171.128
  183.157.171.148
  183.157.171.160
-183.157.171.163
  183.157.171.184
-183.157.171.186
-183.157.171.201
  183.157.171.208
  183.157.171.238
  183.157.171.82
@@ -63074,64 +64646,44 @@
  183.157.172.132
  183.157.172.144
  183.157.172.160
-183.157.172.200
-183.157.172.230
-183.157.172.241
+183.157.172.179
+183.157.172.185
  183.157.172.245
-183.157.172.247
  183.157.172.249
  183.157.172.36
  183.157.172.37
+183.157.172.42
  183.157.172.52
-183.157.172.74
  183.157.172.90
  183.157.173.101
  183.157.173.153
  183.157.173.170
  183.157.173.188
-183.157.173.203
-183.157.173.221
-183.157.173.23
  183.157.173.238
-183.157.173.245
-183.157.173.247
-183.157.173.248
  183.157.173.255
+183.157.173.49
  183.157.173.56
  183.157.173.57
-183.157.173.65
-183.157.173.9
+183.157.173.88
  183.157.174.106
  183.157.174.11
-183.157.174.157
  183.157.174.169
  183.157.174.180
  183.157.174.183
-183.157.174.195
+183.157.174.196
  183.157.174.2
  183.157.174.217
-183.157.174.219
-183.157.174.22
-183.157.174.239
  183.157.174.241
-183.157.174.252
  183.157.174.31
-183.157.174.35
  183.157.174.38
-183.157.174.40
  183.157.174.49
-183.157.174.57
  183.157.174.66
-183.157.174.75
  183.157.174.76
-183.157.174.90
-183.157.175.0
  183.157.175.100
  183.157.175.131
  183.157.175.136
  183.157.175.14
  183.157.175.144
-183.157.175.162
  183.157.175.166
  183.157.175.172
  183.157.175.186
@@ -63141,54 +64693,41 @@
  183.157.175.210
  183.157.175.217
  183.157.175.226
-183.157.175.228
  183.157.175.230
-183.157.175.234
  183.157.175.238
  183.157.175.24
-183.157.175.252
-183.157.175.35
-183.157.175.40
-183.157.175.57
  183.157.175.62
-183.157.175.8
  183.157.175.85
  183.157.175.97
  183.157.45.158
  183.157.8.70
-183.158.153.59
  183.158.241.229
  183.158.241.249
  183.158.242.29
  183.158.55.229
+183.158.98.177
  183.159.74.192
-183.16.209.95
  183.160.35.6
  183.162.79.37
  183.162.79.39
  183.162.93.6
+183.164.245.135
  183.164.245.225
-183.165.28.119
-183.165.28.39
-183.165.28.80
  183.165.29.143
-183.165.40.224
-183.165.41.201
-183.165.61.180
-183.165.61.244
-183.165.61.98
+183.165.40.107
+183.166.1.249
+183.166.137.174
+183.166.149.245
  183.166.18.146
  183.166.59.149
-183.166.86.177
  183.167.208.66
+183.167.229.180
  183.167.230.197
  183.17.124.73
  183.17.144.190
-183.17.146.159
  183.17.146.172
-183.17.146.185
  183.17.147.106
-183.17.224.119
+183.17.147.234
  183.17.228.24
  183.17.228.99
  183.17.230.162
@@ -63196,7 +64735,6 @@
  183.17.230.58
  183.17.231.109
  183.17.231.127
-183.17.56.214
  183.171.197.47
  183.171.197.51
  183.175.42.43
@@ -63209,24 +64747,20 @@
  183.179.137.63
  183.179.192.173
  183.179.248.213
+183.179.3.78
  183.179.96.148
  183.18.52.2
  183.181.164.180
  183.181.168.48
  183.181.174.169
+183.181.85.53
  183.181.88.119
-183.182.101.163
  183.182.101.32
  183.182.107.104
-183.182.122.170
  183.184.210.184
  183.184.59.152
-183.185.168.187
  183.185.193.29
-183.185.83.148
-183.186.113.63
  183.186.118.154
-183.186.120.26
  183.186.170.91
  183.186.28.49
  183.186.78.69
@@ -63241,26 +64775,24 @@
  183.188.103.56
  183.188.134.235
  183.188.140.128
-183.188.151.166
-183.188.159.189
+183.188.143.228
  183.188.174.208
  183.188.174.79
  183.188.198.118
-183.188.20.87
  183.188.204.2
  183.188.207.37
  183.188.54.28
  183.188.55.170
  183.188.75.86
+183.189.99.64
  183.190.148.241
  183.190.198.4
-183.190.24.165
  183.191.216.103
  183.194.212.16
+183.195.121.197
  183.196.132.209
  183.196.210.48
  183.196.213.214
-183.196.214.63
  183.196.218.169
  183.196.233.193
  183.196.60.137
@@ -63271,12 +64803,12 @@
  183.197.56.159
  183.197.56.2
  183.197.56.208
-183.197.56.225
+183.197.56.209
+183.197.56.228
  183.197.56.233
+183.197.56.40
  183.197.56.43
-183.197.56.44
  183.197.56.73
-183.199.125.11
  183.199.125.156
  183.199.125.161
  183.199.125.172
@@ -63287,13 +64819,11 @@
  183.199.125.230
  183.199.125.24
  183.199.125.255
-183.199.125.42
  183.199.125.6
  183.199.125.78
  183.199.125.79
  183.199.125.92
  183.2.157.219
-183.20.156.101
  183.20.156.25
  183.203.157.188
  183.203.161.195
@@ -63303,7 +64833,6 @@
  183.213.26.107
  183.214.81.128
  183.214.85.202
-183.214.92.114
  183.214.93.74
  183.215.194.14
  183.215.200.20
@@ -63341,6 +64870,7 @@
  183.224.170.137
  183.224.226.21
  183.224.228.51
+183.224.252.19
  183.224.38.56
  183.224.8.133
  183.228.110.161
@@ -63362,7 +64892,7 @@
  183.230.248.93
  183.230.32.127
  183.232.250.146
-183.232.33.177
+183.233.143.22
  183.233.146.199
  183.233.221.204
  183.233.235.248
@@ -63371,6 +64901,9 @@
  183.234.11.43
  183.234.160.38
  183.234.17.149
+183.234.184.4
+183.234.185.108
+183.234.36.42
  183.234.64.2
  183.235.245.86
  183.236.102.76
@@ -63379,8 +64912,8 @@
  183.237.15.14
  183.237.15.16
  183.237.154.180
+183.237.175.97
  183.237.191.186
-183.237.243.50
  183.237.73.86
  183.238.0.242
  183.238.137.21
@@ -63388,7 +64921,9 @@
  183.238.198.88
  183.238.199.178
  183.238.243.30
+183.238.72.82
  183.238.78.13
+183.239.156.146
  183.239.170.26
  183.239.193.149
  183.239.195.215
@@ -63409,7 +64944,6 @@
  183.247.214.63
  183.249.10.142
  183.25.117.227
-183.25.135.146
  183.250.129.50
  183.250.154.149
  183.250.154.54
@@ -63417,7 +64951,7 @@
  183.250.166.175
  183.250.168.221
  183.250.203.16
-183.250.206.40
+183.250.206.42
  183.250.216.67
  183.250.26.178
  183.250.88.118
@@ -63442,18 +64976,18 @@
  183.30.201.177
  183.30.201.188
  183.30.201.197
+183.30.201.214
  183.30.201.216
  183.30.201.223
  183.30.201.35
  183.30.201.68
-183.30.201.76
  183.30.201.84
  183.30.201.96
  183.32.216.178
  183.32.89.7
-183.33.77.240
  183.36.126.113
  183.36.126.195
+183.4.224.193
  183.4.28.24
  183.4.30.105
  183.4.30.251
@@ -63463,10 +64997,9 @@
  183.47.30.134
  183.47.30.191
  183.47.45.115
+183.47.50.8
  183.48.124.191
-183.49.47.56
  183.5.91.85
-183.53.159.80
  183.54.208.200
  183.54.209.16
  183.54.209.220
@@ -63502,6 +65035,7 @@
  183.56.216.122
  183.57.156.10
  183.57.157.132
+183.57.240.156
  183.57.248.54
  183.57.249.19
  183.57.249.8
@@ -63512,14 +65046,15 @@
  183.6.102.54
  183.6.107.20
  183.6.107.227
+183.6.107.248
  183.6.107.68
  183.6.107.75
+183.6.114.229
  183.6.132.4
  183.6.135.227
  183.6.152.11
-183.6.159.35
  183.6.17.5
-183.6.177.234
+183.60.104.12
  183.60.108.155
  183.60.110.85
  183.60.141.171
@@ -63531,16 +65066,17 @@
  183.61.1.33
  183.61.1.34
  183.61.1.35
-183.61.1.59
  183.61.109.23
  183.61.109.252
  183.61.5.13
  183.61.5.198
+183.62.101.90
  183.62.132.46
  183.62.139.167
  183.62.150.75
  183.62.175.139
  183.62.196.164
+183.62.197.117
  183.62.234.101
  183.62.238.34
  183.62.25.218
@@ -63550,20 +65086,22 @@
  183.63.158.51
  183.63.233.238
  183.63.25.194
+183.63.3.226
  183.63.37.69
  183.63.37.70
  183.63.37.71
  183.63.52.3
  183.63.88.244
  183.64.239.19
+183.64.247.122
  183.64.79.115
  183.65.30.2
  183.65.30.53
  183.66.171.253
  183.66.250.118
+183.69.195.98
  183.7.172.56
  183.7.32.245
-183.76.87.101
  183.77.157.168
  183.77.162.208
  183.77.72.44
@@ -63577,7 +65115,7 @@
  183.80.107.15
  183.80.124.205
  183.80.136.227
-183.80.154.76
+183.80.155.214
  183.80.165.117
  183.80.17.56
  183.80.175.140
@@ -63586,18 +65124,16 @@
  183.80.199.151
  183.80.20.215
  183.80.20.71
-183.80.21.186
  183.80.21.198
  183.80.233.68
  183.80.242.139
  183.80.242.210
  183.80.248.214
  183.80.41.131
-183.80.46.250
+183.80.46.49
  183.80.56.91
  183.80.56.94
  183.80.57.64
-183.80.58.254
  183.80.67.56
  183.80.85.112
  183.80.89.100
@@ -63615,7 +65151,6 @@
  183.80.89.247
  183.80.89.38
  183.80.89.56
-183.80.89.58
  183.80.89.76
  183.80.89.87
  183.80.90.20
@@ -63623,7 +65158,6 @@
  183.81.1.156
  183.81.1.236
  183.81.101.224
-183.81.122.52
  183.81.152.82
  183.81.152.85
  183.81.154.113
@@ -63645,8 +65179,6 @@
  183.81.57.185
  183.81.57.43
  183.81.77.188
-183.81.84.19
-183.81.97.233
  183.82.0.15
  183.82.0.21
  183.82.100.141
@@ -63655,13 +65187,14 @@
  183.82.119.101
  183.82.121.174
  183.82.121.34
+183.82.121.81
  183.82.123.14
  183.82.144.136
-183.82.152.219
+183.82.152.114
  183.82.156.193
  183.82.158.157
  183.82.32.153
-183.82.34.162
+183.82.34.246
  183.82.41.250
  183.82.42.67
  183.82.55.61
@@ -63675,16 +65208,17 @@
  183.83.89.226
  183.86.194.68
  183.86.194.79
-183.86.88.39
  183.87.106.220
  183.87.110.22
  183.87.114.130
  183.87.14.250
  183.87.153.182
  183.87.153.98
+183.87.157.202
  183.87.180.243
  183.87.20.71
  183.87.205.249
+183.87.219.100
  183.87.221.252
  183.87.221.50
  183.87.39.174
@@ -63696,11 +65230,16 @@
  183.87.76.17
  183.88.105.121
  183.88.105.170
+183.88.120.253
  183.88.132.29
  183.88.135.48
  183.88.16.250
  183.88.16.50
+183.88.192.42
+183.88.195.109
+183.88.212.140
  183.88.212.141
+183.88.212.161
  183.88.214.143
  183.88.214.88
  183.88.219.206
@@ -63710,7 +65249,8 @@
  183.88.224.150
  183.88.224.206
  183.88.225.4
-183.88.227.76
+183.88.230.98
+183.88.232.183
  183.88.237.226
  183.88.239.107
  183.88.24.31
@@ -63718,11 +65258,12 @@
  183.88.240.53
  183.88.252.5
  183.88.253.14
-183.88.35.211
  183.88.49.237
+183.88.50.148
  183.88.6.183
  183.88.67.88
  183.88.75.215
+183.88.75.60
  183.88.89.194
  183.88.96.254
  183.88.99.147
@@ -63737,15 +65278,15 @@
  183.89.116.43
  183.89.117.70
  183.89.119.179
+183.89.123.80
  183.89.147.159
-183.89.157.239
+183.89.157.37
  183.89.157.50
  183.89.157.61
  183.89.158.4
  183.89.160.241
  183.89.163.196
  183.89.163.213
-183.89.171.73
  183.89.188.152
  183.89.188.154
  183.89.191.26
@@ -63754,11 +65295,9 @@
  183.89.246.242
  183.89.28.238
  183.89.3.3
+183.89.34.153
  183.89.34.19
-183.89.39.237
  183.89.40.4
-183.89.61.49
-183.89.62.219
  183.89.72.163
  183.89.99.130
  183.90.232.20
@@ -63770,6 +65309,7 @@
  183.91.204.74
  183.91.254.99
  183.91.33.41
+183.91.4.119
  183.91.6.225
  183.91.65.42
  183.91.66.99
@@ -63778,13 +65318,13 @@
  183.91.77.38
  183.91.81.162
  183.92.214.38
+183.92.218.85
  183.92.255.135
  183.92.36.228
  183.92.89.45
  183.93.10.36
  183.93.10.57
  183.95.144.236
-183.95.147.73
  183.95.246.160
  183.95.36.2
  183.95.36.75
@@ -63811,10 +65351,12 @@
  183.97.59.160
  183.97.6.132
  183.97.7.219
+183.97.7.66
  183.97.92.240
  183.97.99.84
  183.98.14.109
  183.98.152.104
+183.98.204.123
  183.98.31.32
  183.98.8.223
  183.99.128.152
@@ -63824,7 +65366,6 @@
  1830488.synergyglobal.one
  1834.31cf4fdae.com
  183da2ac-98c9-41cf-9f59-0c377e76b19b.htmlcomponentservice.com
-184.0.116.252
  184.0.128.172
  184.0.131.89
  184.0.134.252
@@ -63911,6 +65452,7 @@
  184.105.220.24
  184.105.230.240
  184.105.242.147
+184.105.244.141
  184.105.247.194
  184.105.247.195
  184.105.247.196
@@ -63968,7 +65510,7 @@
  184.147.103.234
  184.148.54.222
  184.148.55.165
-184.153.119.188
+184.152.103.133
  184.153.135.2
  184.153.247.218
  184.153.80.179
@@ -64017,7 +65559,6 @@
  184.158.66.206
  184.158.70.206
  184.158.73.218
-184.159.130.149
  184.160.180.89
  184.160.203.112
  184.161.122.238
@@ -64028,42 +65569,19 @@
  184.166.81.78
  184.167.66.36
  184.168.146.10
-184.168.152.165
-184.168.152.21
-184.168.152.212
-184.168.152.214
-184.168.152.6
-184.168.152.72
+184.168.152.191
  184.168.166.154
-184.168.193.121
-184.168.193.130
-184.168.193.139
  184.168.193.155
-184.168.193.160
-184.168.193.168
-184.168.193.187
-184.168.193.201
-184.168.193.214
+184.168.193.200
  184.168.193.60
-184.168.193.61
-184.168.193.66
-184.168.193.74
  184.168.200.173
  184.168.200.205
-184.168.200.224
-184.168.200.45
  184.168.221.17
  184.168.27.144
-184.168.27.159
-184.168.27.170
  184.168.27.26
-184.168.27.59
-184.168.27.62
-184.168.27.68
-184.168.46.101
-184.168.46.152
-184.168.46.165
+184.168.27.60
  184.168.46.187
+184.168.46.22
  184.170.145.60
  184.170.212.94
  184.170.223.148
@@ -64076,10 +65594,8 @@
  184.173.190.42
  184.173.190.58
  184.173.222.71
-184.174.131.240
  184.174.71.70
  184.175.21.81
-184.176.108.193
  184.176.58.40
  184.178.172.13
  184.178.172.18
@@ -64088,16 +65604,21 @@
  184.178.172.5
  184.180.129.98
  184.180.181.202
-184.183.170.162
  184.185.2.190
+184.185.2.45
  184.187.22.44
  184.189.123.68
  184.19.26.15
  184.191.58.33
  184.2.203.46
+184.22.125.169
+184.22.199.84
  184.22.234.114
  184.22.5.54
+184.22.82.199
+184.22.95.73
  184.23.190.112
+184.23.254.198
  184.3.162.169
  184.3.173.143
  184.3.195.166
@@ -64139,8 +65660,9 @@
  184.57.17.34
  184.57.184.168
  184.57.66.197
+184.59.57.189
+184.59.66.47
  184.6.214.169
-184.60.188.106
  184.64.198.14
  184.66.129.200
  184.66.244.102
@@ -64148,8 +65670,6 @@
  184.67.184.10
  184.68.152.178
  184.68.18.59
-184.68.8.242
-184.69.10.170
  184.69.51.34
  184.7.171.88
  184.7.178.237
@@ -64157,6 +65677,7 @@
  184.7.184.202
  184.7.185.174
  184.7.55.99
+184.70.15.166
  184.70.244.67
  184.70.33.190
  184.70.46.94
@@ -64179,7 +65700,6 @@
  184.74.150.189
  184.74.240.157
  184.75.214.210
-184.75.221.115
  184.75.221.3
  184.75.221.43
  184.75.247.14
@@ -64201,19 +65721,23 @@
  184.82.146.6
  184.82.194.168
  184.82.196.236
+184.82.200.226
  184.82.200.89
  184.82.201.194
  184.82.224.13
  184.82.226.38
+184.82.228.45
  184.82.229.251
-184.82.234.28
+184.82.239.35
  184.82.29.169
  184.82.65.59
  184.82.78.159
  184.82.92.72
  184.83.147.227
+184.83.219.205
  184.91.124.58
  184.94.184.48
+184.95.38.138
  184.95.48.13
  184.95.58.162
  184.95.58.164
@@ -64226,7 +65750,6 @@
  185-24-53-218.com
  185.10.107.69
  185.10.16.41
-185.10.23.60
  185.10.49.189
  185.10.68.147
  185.10.68.156
@@ -64240,8 +65763,8 @@
  185.10.68.66
  185.10.73.233
  185.10.74.15
-185.100.13.119
  185.100.13.74
+185.100.13.97
  185.100.44.233
  185.100.84.149
  185.100.84.85
@@ -64276,7 +65799,6 @@
  185.101.105.189
  185.101.105.232
  185.101.107.100
-185.101.130.47
  185.101.159.156
  185.101.219.230
  185.101.238.120
@@ -64291,7 +65813,7 @@
  185.103.110.198
  185.103.110.199
  185.103.110.86
-185.103.168.41
+185.103.179.185
  185.103.181.2
  185.103.196.5
  185.103.219.150
@@ -64316,8 +65838,8 @@
  185.104.187.93
  185.104.187.94
  185.104.216.164
+185.104.219.7
  185.104.242.3
-185.104.255.88
  185.104.29.4
  185.104.85.50
  185.105.121.70
@@ -64335,9 +65857,7 @@
  185.106.121.142
  185.106.121.32
  185.106.122.100
-185.106.157.164
  185.106.157.199
-185.106.45.132
  185.106.92.164
  185.106.92.47
  185.106.94.2
@@ -64347,6 +65867,7 @@
  185.106.96.228
  185.107.106.68
  185.107.15.161
+185.107.237.246
  185.107.44.41
  185.107.45.130
  185.107.45.150
@@ -64399,10 +65920,14 @@
  185.107.94.233
  185.107.95.215
  185.108.105.127
+185.108.106.207
  185.108.106.214
+185.108.106.229
+185.108.106.242
  185.108.107.25
  185.108.107.31
  185.108.107.37
+185.108.107.42
  185.108.107.49
  185.108.107.55
  185.108.197.122
@@ -64416,20 +65941,19 @@
  185.11.167.190
  185.11.180.171
  185.11.240.175
+185.11.248.150
  185.11.248.155
  185.110.134.20
  185.110.134.38
  185.110.187.33
-185.110.190.38
  185.110.216.1
  185.110.217.65
  185.110.237.34
  185.110.31.249
  185.111.100.184
+185.111.157.10
  185.111.157.25
  185.111.190.176
-185.111.208.178
-185.111.210.171
  185.111.216.164
  185.112.144.119
  185.112.148.142
@@ -64447,7 +65971,6 @@
  185.112.82.40
  185.113.128.30
  185.113.129.154
-185.113.134.36
  185.113.140.155
  185.113.58.107
  185.113.6.254
@@ -64455,7 +65978,6 @@
  185.114.137.14
  185.114.157.61
  185.114.23.40
-185.116.194.138
  185.116.214.194
  185.116.214.58
  185.116.23.104
@@ -64480,7 +66002,6 @@
  185.117.72.9
  185.117.72.90
  185.117.73.241
-185.117.8.216
  185.118.15.50
  185.118.48.206
  185.118.65.230
@@ -64515,27 +66036,24 @@
  185.123.164.52
  185.123.164.54
  185.123.194.28
-185.123.42.20
-185.123.42.37
-185.124.112.171
  185.124.153.176
  185.124.182.184
  185.124.183.102
  185.124.229.83
+185.125.230.10
  185.125.230.203
  185.125.231.156
  185.125.231.178
  185.125.32.14
-185.125.52.172
  185.126.178.243
  185.126.183.127
+185.126.202.229
  185.127.126.233
  185.127.246.224
  185.127.255.92
  185.128.126.18
  185.128.235.174
  185.128.27.106
-185.128.37.4
  185.128.38.100
  185.128.38.146
  185.128.40.220
@@ -64546,8 +66064,6 @@
  185.129.2.77
  185.129.201.72
  185.129.203.122
-185.129.217.250
-185.129.242.126
  185.129.3.162
  185.129.3.99
  185.129.62.62
@@ -64556,6 +66072,7 @@
  185.13.199.162
  185.13.37.132
  185.13.38.235
+185.13.39.143
  185.13.39.199
  185.13.46.241
  185.13.78.92
@@ -64579,6 +66096,7 @@
  185.130.5.244
  185.130.5.247
  185.130.6.49
+185.131.62.250
  185.131.62.50
  185.131.63.83
  185.132.125.171
@@ -64600,6 +66118,7 @@
  185.132.53.115
  185.132.53.116
  185.132.53.139
+185.132.53.14
  185.132.53.142
  185.132.53.143
  185.132.53.144
@@ -64619,7 +66138,6 @@
  185.132.53.238
  185.132.53.239
  185.132.53.251
-185.132.53.254
  185.132.53.27
  185.132.53.31
  185.132.53.36
@@ -64632,16 +66150,15 @@
  185.132.53.98
  185.132.83.5
  185.133.163.218
-185.133.208.46
  185.133.225.26
  185.133.42.39
-185.134.23.197
-185.134.23.198
+185.133.58.40
  185.134.233.121
  185.134.30.164
  185.134.98.110
  185.134.99.238
  185.135.10.154
+185.135.123.96
  185.135.156.94
  185.135.157.120
  185.135.157.138
@@ -64658,46 +66175,26 @@
  185.136.170.15
  185.136.204.3
  185.136.242.193
+185.136.52.158
+185.136.53.218
  185.137.175.150
  185.137.233.121
  185.137.233.123
  185.137.233.125
  185.137.233.213
-185.137.233.230
  185.137.234.10
  185.137.234.205
  185.137.88.240
  185.137.92.48
+185.138.121.142
  185.138.123.78
  185.138.216.126
  185.138.94.139
-185.139.136.240
-185.139.136.242
-185.139.136.245
-185.139.136.247
-185.139.136.253
-185.139.136.254
-185.139.136.255
-185.139.137.133
-185.139.137.142
-185.139.137.148
-185.139.137.150
-185.139.137.16
-185.139.137.170
-185.139.137.182
-185.139.137.186
-185.139.137.2
-185.139.137.24
-185.139.137.3
-185.139.137.60
-185.139.137.73
-185.139.137.76
-185.139.137.86
-185.139.137.95
  185.139.239.66
  185.139.56.133
  185.14.149.61
  185.14.184.143
+185.14.186.121
  185.14.186.15
  185.14.187.101
  185.14.187.134
@@ -64713,6 +66210,7 @@
  185.14.192.82
  185.14.194.107
  185.14.194.151
+185.14.194.174
  185.14.194.39
  185.14.194.64
  185.14.194.72
@@ -64722,7 +66220,6 @@
  185.14.251.211
  185.14.251.4
  185.14.31.113
-185.14.59.15
  185.140.126.254
  185.140.242.82
  185.140.252.253
@@ -64734,7 +66231,6 @@
  185.140.53.7
  185.140.53.8
  185.140.53.9
-185.140.58.33
  185.140.59.11
  185.140.60.234
  185.141.10.67
@@ -64747,6 +66243,8 @@
  185.141.27.112
  185.141.27.116
  185.141.36.130
+185.141.36.26
+185.141.39.110
  185.141.39.3
  185.141.60.33
  185.141.60.36
@@ -64806,7 +66304,6 @@
  185.146.232.28
  185.147.116.103
  185.147.116.198
-185.147.212.12
  185.147.213.104
  185.147.213.133
  185.147.213.145
@@ -64816,25 +66313,22 @@
  185.147.213.37
  185.147.213.44
  185.147.213.56
-185.147.213.85
+185.147.213.73
  185.147.213.86
-185.147.214.43
+185.147.214.26
  185.147.214.76
  185.148.102.152
  185.148.145.92
  185.148.147.47
-185.148.216.9
  185.148.3.142
  185.148.3.227
  185.148.38.70
  185.148.44.65
  185.148.84.122
  185.148.84.157
-185.148.84.59
  185.148.84.76
  185.148.84.97
  185.149.107.19
-185.149.112.77
  185.149.201.137
  185.15.145.214
  185.15.63.166
@@ -64842,19 +66336,23 @@
  185.15.92.18
  185.150.10.199
  185.150.190.19
+185.150.24.72
  185.150.8.157
  185.151.151.190
  185.151.204.9
  185.151.242.196
  185.151.243.250
-185.151.31.69
  185.152.12.49
  185.152.12.68
  185.152.138.74
  185.152.164.135
  185.152.191.5
  185.152.66.226
+185.153.150.12
  185.153.150.16
+185.153.151.12
+185.153.151.21
+185.153.151.23
  185.153.180.112
  185.153.180.45
  185.153.196.126
@@ -64870,13 +66368,14 @@
  185.153.196.50
  185.153.196.81
  185.153.197.104
-185.153.197.208
  185.153.197.32
  185.153.197.52
  185.153.198.177
+185.153.198.221
  185.153.198.229
  185.153.199.102
  185.153.199.104
+185.153.199.113
  185.153.199.132
  185.153.199.145
  185.153.199.146
@@ -64885,12 +66384,15 @@
  185.153.199.51
  185.153.199.60
  185.153.199.94
+185.153.208.26
  185.153.208.50
  185.153.242.11
  185.153.45.174
  185.154.131.4
  185.154.159.164
+185.154.2.3
  185.154.204.242
+185.154.254.219
  185.154.255.231
  185.154.52.140
  185.154.52.207
@@ -64903,7 +66405,7 @@
  185.155.34.80
  185.156.1.216
  185.156.173.116
-185.156.179.206
+185.156.174.155
  185.156.179.233
  185.156.214.34
  185.156.35.156
@@ -64981,14 +66483,14 @@
  185.162.8.125
  185.162.94.9
  185.163.1.11
-185.163.111.118
  185.163.126.12
-185.163.127.201
  185.163.166.89
  185.163.45.42
  185.163.46.148
  185.163.46.149
  185.163.46.29
+185.164.138.21
+185.164.30.198
  185.164.72.222
  185.164.72.248
  185.164.74.21
@@ -65007,7 +66509,6 @@
  185.165.190.34
  185.165.221.123
  185.165.221.139
-185.165.221.140
  185.165.221.224
  185.165.221.95
  185.165.29.138
@@ -65032,6 +66533,7 @@
  185.169.181.16
  185.169.181.24
  185.169.181.28
+185.169.187.132
  185.169.19.17
  185.169.243.125
  185.17.121.212
@@ -65050,7 +66552,6 @@
  185.17.38.1
  185.170.114.25
  185.170.210.47
-185.170.249.152
  185.170.42.18
  185.171.0.75
  185.171.52.101
@@ -65132,6 +66633,7 @@
  185.172.144.12
  185.172.215.74
  185.172.215.79
+185.172.229.6
  185.172.56.213
  185.173.104.47
  185.173.105.74
@@ -65178,27 +66680,12 @@
  185.176.174.148
  185.176.175.210
  185.176.220.239
-185.176.220.5
  185.176.221.101
  185.176.221.32
  185.176.221.96
-185.176.59.124
-185.177.0.226
-185.177.0.227
-185.177.0.229
-185.177.0.230
-185.177.0.231
-185.177.0.234
-185.177.104.107
  185.177.124.144
  185.177.125.40
  185.177.2.108
-185.177.2.130
-185.177.2.131
-185.177.2.133
-185.177.2.135
-185.177.2.143
-185.177.2.155
  185.177.54.1
  185.177.54.10
  185.177.54.2
@@ -65221,7 +66708,6 @@
  185.180.254.235
  185.181.10.234
  185.181.102.18
-185.181.176.19
  185.181.176.246
  185.181.230.74
  185.181.245.67
@@ -65236,6 +66722,7 @@
  185.181.40.196
  185.181.43.100
  185.181.61.140
+185.181.8.241
  185.182.56.123
  185.183.107.164
  185.183.107.168
@@ -65253,19 +66740,19 @@
  185.183.98.244
  185.183.99.214
  185.183.99.215
-185.184.12.132
-185.185.170.248
  185.185.170.27
  185.185.26.141
  185.185.44.2
  185.186.142.137
  185.186.146.108
  185.186.208.160
+185.186.240.174
  185.186.243.133
  185.186.246.141
  185.186.69.114
  185.186.71.56
  185.186.77.133
+185.186.77.219
  185.186.81.250
  185.187.198.10
  185.188.182.181
@@ -65320,20 +66807,21 @@
  185.189.243.32
  185.189.252.121
  185.189.48.150
+185.19.0.47
  185.19.1.151
  185.19.176.237
+185.19.2.150
  185.19.24.111
  185.19.28.195
  185.19.29.110
  185.19.30.68
  185.19.31.6
  185.19.78.214
-185.190.113.130
  185.190.152.159
  185.190.152.23
+185.190.16.70
  185.190.165.122
  185.190.165.83
-185.191.107.56
  185.191.204.254
  185.191.204.3
  185.191.32.155
@@ -65347,6 +66835,7 @@
  185.193.125.168
  185.193.125.190
  185.193.127.137
+185.193.177.82
  185.193.227.36
  185.193.233.248
  185.193.70.71
@@ -65366,7 +66855,6 @@
  185.194.49.132
  185.194.6.93
  185.194.62.79
-185.195.128.254
  185.195.18.105
  185.195.18.107
  185.195.201.148
@@ -65397,7 +66885,6 @@
  185.199.226.109
  185.199.87.243
  185.2.140.155
-185.2.150.189
  185.2.154.15
  185.2.4.105
  185.2.4.110
@@ -65412,18 +66899,18 @@
  185.2.5.81
  185.2.5.90
  185.2.81.90
-185.20.124.196
  185.20.184.165
  185.20.184.166
  185.20.185.18
  185.20.185.247
  185.20.187.20
  185.20.187.23
+185.20.226.78
  185.20.245.4
-185.20.44.244
  185.200.116.185
  185.200.117.168
  185.200.118.35
+185.200.118.36
  185.200.118.37
  185.200.118.38
  185.200.118.39
@@ -65479,15 +66966,12 @@
  185.202.0.112
  185.202.0.78
  185.202.1.6
-185.202.101.40
  185.202.172.246
  185.202.174.84
  185.202.174.91
-185.202.2.131
  185.202.245.237
  185.202.246.209
  185.202.85.236
-185.202.87.153
  185.203.117.232
  185.203.117.254
  185.203.117.35
@@ -65495,14 +66979,17 @@
  185.203.240.247
  185.203.242.41
  185.203.243.88
+185.203.72.149
  185.204.1.236
  185.204.1.74
  185.204.1.75
  185.204.183.144
  185.204.183.248
+185.204.3.36
  185.204.56.34
  185.205.108.166
  185.205.108.206
+185.205.12.106
  185.205.17.17
  185.205.209.166
  185.205.209.205
@@ -65522,6 +67009,7 @@
  185.206.224.201
  185.206.224.203
  185.206.224.204
+185.206.224.206
  185.206.224.208
  185.206.224.216
  185.206.224.246
@@ -65565,13 +67053,12 @@
  185.211.42.172
  185.211.42.174
  185.211.48.17
-185.211.48.207
  185.211.58.175
  185.211.59.50
  185.211.59.7
  185.212.129.198
-185.212.129.34
  185.212.129.54
+185.212.130.11
  185.212.130.34
  185.212.130.53
  185.212.139.208
@@ -65582,15 +67069,14 @@
  185.212.169.187
  185.212.201.26
  185.212.47.150
-185.212.49.173
  185.213.154.235
-185.213.155.163
  185.213.155.164
  185.213.155.169
  185.213.73.150
  185.214.165.113
  185.214.166.158
  185.214.187.38
+185.214.203.66
  185.214.213.82
  185.215.144.4
  185.215.150.209
@@ -65605,8 +67091,11 @@
  185.216.140.31
  185.216.140.32
  185.216.140.41
+185.216.140.43
  185.216.140.6
+185.216.140.68
  185.216.215.13
+185.216.26.24
  185.216.32.130
  185.216.32.156
  185.216.33.137
@@ -65618,9 +67107,8 @@
  185.217.1.244
  185.217.1.245
  185.217.1.30
+185.217.162.107
  185.217.188.252
-185.217.189.196
-185.217.189.209
  185.217.189.243
  185.217.241.142
  185.217.90.140
@@ -65642,7 +67130,6 @@
  185.22.172.201
  185.22.172.99
  185.22.174.119
-185.22.175.133
  185.22.175.137
  185.22.175.52
  185.22.31.226
@@ -65795,16 +67282,16 @@
  185.222.57.142
  185.222.57.183
  185.222.57.246
-185.222.57.250
  185.222.57.252
  185.222.58.102
  185.222.58.123
+185.222.58.134
  185.222.58.148
  185.222.58.158
  185.222.66.113
  185.222.66.121
  185.222.66.122
-185.223.188.12
+185.222.7.221
  185.223.28.89
  185.223.29.137
  185.223.67.195
@@ -65842,15 +67329,13 @@
  185.226.113.180
  185.226.145.140
  185.226.145.15
-185.226.145.152
  185.226.145.163
  185.226.145.17
  185.226.145.186
-185.226.145.207
-185.226.145.62
+185.226.145.201
  185.226.61.78
+185.226.64.114
  185.226.90.141
-185.226.93.229
  185.227.109.30
  185.227.111.133
  185.227.118.181
@@ -65859,15 +67344,12 @@
  185.227.68.78
  185.227.82.32
  185.227.82.42
-185.227.82.88
  185.228.113.65
  185.228.119.186
  185.228.133.4
  185.228.137.238
  185.228.155.26
  185.228.4.195
-185.23.128.180
-185.23.131.112
  185.23.151.171
  185.23.200.162
  185.23.40.12
@@ -65876,10 +67358,8 @@
  185.230.168.147
  185.230.4.220
  185.230.4.39
-185.230.6.14
  185.230.81.96
  185.231.155.153
-185.231.70.145
  185.232.21.116
  185.232.21.118
  185.232.21.157
@@ -65892,12 +67372,14 @@
  185.233.148.146
  185.233.186.129
  185.233.187.46
+185.233.187.70
+185.233.195.91
  185.233.27.25
  185.234.216.198
  185.234.216.237
+185.234.216.38
  185.234.216.56
  185.234.216.59
-185.234.216.62
  185.234.216.63
  185.234.216.64
  185.234.216.66
@@ -65926,6 +67408,7 @@
  185.234.217.222
  185.234.217.224
  185.234.217.225
+185.234.217.231
  185.234.217.28
  185.234.217.29
  185.234.217.30
@@ -65960,11 +67443,12 @@
  185.234.219.229
  185.234.219.230
  185.234.219.28
-185.234.5.216
+185.234.7.84
  185.234.72.64
  185.235.166.9
  185.235.241.221
  185.235.40.155
+185.235.40.165
  185.236.202.151
  185.236.203.49
  185.236.217.170
@@ -65983,15 +67467,12 @@
  185.238.128.48
  185.238.129.113
  185.238.131.19
-185.238.165.47
-185.238.165.5
-185.238.166.114
  185.238.166.178
  185.238.169.171
  185.238.171.97
  185.238.250.200
  185.238.29.11
-185.239.146.35
+185.239.106.241
  185.239.226.19
  185.239.227.63
  185.239.236.116
@@ -66016,7 +67497,6 @@
  185.239.242.221
  185.239.242.222
  185.239.242.231
-185.239.242.233
  185.239.242.242
  185.239.242.247
  185.239.242.249
@@ -66036,14 +67516,15 @@
  185.239.242.90
  185.239.242.92
  185.239.68.18
+185.239.68.93
  185.239.70.31
  185.24.233.117
-185.24.233.125
  185.24.233.139
  185.24.233.209
  185.24.233.48
  185.24.234.230
  185.24.235.206
+185.240.96.123
  185.241.100.1
  185.241.101.5
  185.241.102.1
@@ -66060,7 +67541,6 @@
  185.242.160.154
  185.242.163.160
  185.242.174.140
-185.242.217.195
  185.242.5.120
  185.242.5.46
  185.242.6.228
@@ -66080,6 +67560,7 @@
  185.243.241.3
  185.243.49.46
  185.243.56.115
+185.243.56.201
  185.243.57.201
  185.243.57.211
  185.244.148.95
@@ -66096,17 +67577,20 @@
  185.244.214.115
  185.244.214.117
  185.244.214.121
+185.244.214.122
  185.244.214.123
  185.244.214.195
+185.244.214.20
+185.244.214.238
  185.244.214.248
  185.244.214.39
  185.244.214.40
  185.244.214.42
+185.244.214.43
  185.244.214.45
  185.244.214.46
  185.244.217.126
  185.244.217.138
-185.244.217.74
  185.244.218.40
  185.244.219.195
  185.244.25.107
@@ -66125,13 +67609,16 @@
  185.244.39.87
  185.244.41.12
  185.244.41.13
+185.244.41.14
  185.244.41.15
  185.244.41.18
  185.244.41.19
  185.244.41.20
  185.244.41.21
+185.244.41.32
  185.244.41.6
  185.244.41.7
+185.244.41.9
  185.244.43.183
  185.244.43.220
  185.244.9.112
@@ -66142,11 +67629,9 @@
  185.245.2.168
  185.245.246.169
  185.245.84.153
-185.245.84.20
  185.245.84.28
  185.245.84.30
  185.245.84.48
-185.245.84.50
  185.245.84.52
  185.245.84.56
  185.245.85.138
@@ -66156,23 +67641,21 @@
  185.245.86.226
  185.246.128.26
  185.246.128.3
-185.246.162.3
-185.246.210.77
+185.246.130.69
  185.246.211.104
  185.246.231.28
  185.246.38.233
  185.246.65.34
-185.246.8.140
-185.246.8.248
-185.246.89.121
+185.246.8.114
+185.246.8.196
+185.246.8.233
  185.246.9.105
-185.246.9.85
+185.246.9.28
  185.247.116.43
  185.247.224.14
  185.247.224.191
  185.247.228.36
  185.247.228.65
-185.247.58.122
  185.248.103.100
  185.248.140.206
  185.248.160.146
@@ -66182,8 +67665,6 @@
  185.248.160.65
  185.248.245.241
  185.249.133.123
-185.249.133.222
-185.249.133.30
  185.249.133.71
  185.249.198.100
  185.249.199.106
@@ -66192,6 +67673,8 @@
  185.25.148.240
  185.25.151.159
  185.25.206.123
+185.25.206.99
+185.25.207.193
  185.25.224.202
  185.25.48.114
  185.25.48.148
@@ -66211,7 +67694,6 @@
  185.250.206.56
  185.250.207.56
  185.250.221.105
-185.250.221.145
  185.250.221.175
  185.250.39.104
  185.250.39.106
@@ -66228,6 +67710,7 @@
  185.250.39.189
  185.250.39.192
  185.250.39.198
+185.250.39.20
  185.250.39.203
  185.250.39.204
  185.250.39.207
@@ -66253,8 +67736,9 @@
  185.250.39.92
  185.250.39.96
  185.250.39.97
-185.250.44.163
+185.250.44.190
  185.250.45.79
+185.250.47.120
  185.251.161.54
  185.251.193.129
  185.251.193.150
@@ -66263,40 +67747,36 @@
  185.252.101.3
  185.252.101.4
  185.252.147.119
+185.252.147.185
  185.252.183.160
  185.252.41.232
  185.252.77.220
  185.253.101.89
  185.253.162.133
  185.253.162.4
-185.253.162.7
-185.253.184.106
  185.253.218.209
  185.253.219.185
  185.253.74.206
-185.253.96.7
-185.253.97.2
  185.253.97.246
  185.253.99.148
  185.254.141.80
+185.254.238.39
  185.254.44.102
  185.255.104.195
  185.255.107.35
  185.255.130.196
  185.255.133.51
+185.255.134.117
  185.255.135.33
  185.255.46.100
  185.255.46.171
-185.255.46.241
  185.255.47.115
-185.255.47.182
  185.255.47.27
  185.255.47.50
-185.255.96.99
  185.26.126.48
  185.26.171.236
-185.26.181.241
  185.26.197.11
+185.26.197.148
  185.26.206.0
  185.26.206.109
  185.26.206.135
@@ -66327,31 +67807,25 @@
  185.29.9.171
  185.29.9.222
  185.3.133.11
-185.3.134.149
  185.3.216.79
  185.3.232.226
  185.3.5.25
  185.3.94.131
-185.3.94.64
  185.30.166.38
  185.30.32.183
-185.30.46.102
-185.30.47.164
+185.30.46.201
+185.30.68.36
  185.30.83.110
  185.30.96.198
  185.31.166.155
  185.32.120.177
  185.32.124.152
-185.32.126.132
  185.32.126.196
  185.32.126.197
-185.32.126.198
-185.32.126.199
  185.32.137.88
  185.32.153.2
  185.32.165.78
  185.32.201.122
-185.32.222.13
  185.32.222.167
  185.32.222.168
  185.32.222.169
@@ -66359,7 +67833,6 @@
  185.32.222.171
  185.32.222.172
  185.32.222.173
-185.32.222.7
  185.32.231.84
  185.32.45.57
  185.32.46.142
@@ -66384,8 +67857,8 @@
  185.35.137.219
  185.35.138.22
  185.35.142.70
-185.35.201.136
  185.35.202.222
+185.35.217.51
  185.35.67.109
  185.35.78.77
  185.36.100.145
@@ -66393,10 +67866,10 @@
  185.36.189.6
  185.36.189.8
  185.36.191.0
-185.36.248.110
  185.36.63.212
  185.36.81.174
  185.36.81.204
+185.36.81.23
  185.36.81.33
  185.36.81.39
  185.36.81.42
@@ -66405,7 +67878,6 @@
  185.37.161.129
  185.37.211.222
  185.37.213.76
-185.37.27.69
  185.37.56.253
  185.37.56.254
  185.37.57.47
@@ -66427,7 +67899,6 @@
  185.39.10.89
  185.39.10.91
  185.39.11.109
-185.39.11.122
  185.39.11.32
  185.39.11.63
  185.39.212.172
@@ -66440,22 +67911,17 @@
  185.4.142.87
  185.4.227.194
  185.4.66.131
-185.40.242.243
-185.40.242.53
  185.40.4.108
  185.40.4.175
  185.40.4.206
  185.40.50.131
  185.41.154.203
  185.41.212.214
-185.41.213.142
-185.41.28.103
  185.41.52.94
  185.42.170.203
  185.42.223.211
  185.42.223.91
  185.42.224.195
-185.42.97.138
  185.43.108.13
  185.43.108.132
  185.43.108.133
@@ -66473,11 +67939,12 @@
  185.43.4.227
  185.43.8.43
  185.44.107.143
+185.44.229.114
  185.44.229.227
+185.44.231.2
  185.44.231.63
  185.44.231.68
  185.44.231.70
-185.44.87.197
  185.45.12.126
  185.45.165.225
  185.45.193.123
@@ -66498,12 +67965,12 @@
  185.46.18.99
  185.46.222.74
  185.46.223.198
-185.46.84.181
+185.46.84.192
+185.46.84.198
  185.47.131.112
  185.47.184.253
  185.47.49.209
  185.47.65.30
-185.48.149.171
  185.48.56.34
  185.49.14.190
  185.49.15.23
@@ -66528,11 +67995,14 @@
  185.50.194.54
  185.50.250.120
  185.50.250.129
+185.50.250.152
  185.50.250.155
  185.50.250.156
-185.50.250.169
+185.50.251.152
+185.51.10.18
  185.51.201.102
  185.51.202.235
+185.51.203.179
  185.51.246.4
  185.51.247.233
  185.51.39.171
@@ -66542,10 +68012,11 @@
  185.51.92.108
  185.51.92.84
  185.52.1.53
+185.52.1.71
  185.52.1.89
-185.52.134.253
  185.52.159.79
  185.52.2.130
+185.52.2.79
  185.52.55.237
  185.52.8.81
  185.53.133.109
@@ -66563,10 +68034,9 @@
  185.54.178.40
  185.55.1.182
  185.55.242.187
-185.55.242.220
  185.55.243.33
  185.56.136.106
-185.56.153.236
+185.56.153.229
  185.56.171.94
  185.56.80.55
  185.56.80.66
@@ -66577,7 +68047,6 @@
  185.56.82.82
  185.57.166.177
  185.57.29.193
-185.57.30.97
  185.57.70.149
  185.58.195.232
  185.58.216.126
@@ -66667,11 +68136,8 @@
  185.66.228.149
  185.66.230.206
  185.66.233.61
-185.66.252.27
-185.66.254.13
-185.66.254.55
+185.66.56.2
  185.66.57.101
-185.66.57.104
  185.66.57.106
  185.66.57.109
  185.66.57.110
@@ -66688,6 +68154,7 @@
  185.66.57.142
  185.66.57.145
  185.66.57.147
+185.66.57.150
  185.66.57.152
  185.66.57.158
  185.66.57.160
@@ -66695,12 +68162,14 @@
  185.66.57.167
  185.66.57.169
  185.66.57.170
-185.66.57.177
-185.66.57.179
+185.66.57.172
+185.66.57.174
+185.66.57.176
  185.66.57.181
  185.66.57.182
  185.66.57.185
-185.66.57.186
+185.66.57.187
+185.66.57.188
  185.66.57.193
  185.66.57.195
  185.66.57.196
@@ -66720,7 +68189,6 @@
  185.66.58.148
  185.66.58.155
  185.66.58.164
-185.66.58.166
  185.66.58.174
  185.66.58.180
  185.66.58.189
@@ -66728,23 +68196,24 @@
  185.66.59.192
  185.66.59.198
  185.66.59.201
-185.66.59.217
+185.66.59.216
  185.66.59.218
  185.66.59.220
-185.66.59.228
-185.66.59.230
+185.66.59.223
  185.66.59.234
+185.66.59.236
  185.66.59.240
  185.66.59.252
-185.66.59.254
  185.66.59.3
+185.67.19.77
  185.67.45.160
-185.67.57.216
  185.67.82.114
  185.67.95.179
  185.68.164.208
  185.68.168.139
  185.68.177.99
+185.68.184.85
+185.68.185.107
  185.68.93.27
  185.69.154.206
  185.69.168.112
@@ -66760,17 +68229,16 @@
  185.70.185.34
  185.70.185.56
  185.70.189.82
-185.71.194.49
  185.72.42.138
  185.72.42.221
  185.73.156.1
  185.73.168.163
-185.74.103.13
  185.74.145.29
  185.74.4.17
  185.74.4.189
  185.74.4.20
  185.74.4.47
+185.74.5.156
  185.74.5.253
  185.74.85.184
  185.75.117.124
@@ -66784,6 +68252,7 @@
  185.76.83.115
  185.77.129.163
  185.77.129.165
+185.77.149.213
  185.77.248.3
  185.77.248.4
  185.77.248.5
@@ -66797,7 +68266,6 @@
  185.78.72.204
  185.78.86.34
  185.79.156.167
-185.79.156.83
  185.79.243.137
  185.79.37.250
  185.8.202.254
@@ -66817,6 +68285,7 @@
  185.80.50.33
  185.80.53.147
  185.81.106.52
+185.81.152.213
  185.81.157.116
  185.81.157.12
  185.81.157.121
@@ -66838,17 +68307,15 @@
  185.81.157.59
  185.81.157.60
  185.81.157.66
-185.81.157.73
  185.81.158.101
  185.81.158.120
  185.81.158.124
  185.81.158.139
  185.81.158.149
-185.81.163.180
  185.81.166.77
  185.81.95.180
+185.81.99.110
  185.82.139.78
-185.82.200.52
  185.82.202.102
  185.82.202.109
  185.82.202.132
@@ -66868,7 +68335,8 @@
  185.82.216.149
  185.82.217.154
  185.82.217.39
-185.82.218.185
+185.82.218.254
+185.82.218.49
  185.82.219.109
  185.82.219.12
  185.82.99.178
@@ -66882,10 +68350,7 @@
  185.85.152.97
  185.85.162.242
  185.85.189.90
-185.85.191.196
-185.85.191.201
  185.85.219.74
-185.85.239.195
  185.85.3.140
  185.85.38.54
  185.86.148.172
@@ -66904,13 +68369,7 @@
  185.86.151.146
  185.86.151.152
  185.86.151.177
-185.86.164.101
-185.86.164.102
-185.86.164.103
-185.86.164.106
-185.86.164.109
-185.86.164.98
-185.86.164.99
+185.86.157.229
  185.86.166.174
  185.86.180.167
  185.87.122.86
@@ -66919,20 +68378,17 @@
  185.87.48.123
  185.87.51.159
  185.87.70.237
-185.88.100.150
+185.88.100.134
  185.88.100.219
  185.88.100.26
-185.88.101.125
  185.88.101.16
-185.88.101.215
-185.88.101.34
-185.88.101.43
  185.88.101.47
+185.88.102.26
  185.88.105.40
  185.88.159.85
  185.88.179.172
+185.88.36.68
  185.88.37.148
-185.88.37.157
  185.88.37.178
  185.88.37.237
  185.88.37.24
@@ -66944,6 +68400,7 @@
  185.88.37.95
  185.89.0.22
  185.89.0.237
+185.89.100.100
  185.89.100.138
  185.89.100.141
  185.89.100.160
@@ -66957,6 +68414,7 @@
  185.89.161.157bin.sh
  185.89.181.5
  185.89.244.23
+185.9.147.4
  185.9.51.4
  185.9.62.140
  185.9.90.193
@@ -66964,12 +68422,12 @@
  185.90.210.112
  185.90.240.6
  185.90.61.33
-185.90.81.144
  185.90.84.115
  185.91.142.202
  185.91.166.37
  185.91.252.109
  185.91.80.181
+185.92.149.66
  185.92.220.7
  185.92.73.100
  185.92.73.125
@@ -66977,7 +68435,6 @@
  185.92.73.99
  185.92.84.25
  185.93.182.138
-185.93.2.92
  185.93.226.162
  185.93.226.164
  185.93.81.107
@@ -67001,12 +68458,11 @@
  185.94.97.190
  185.94.98.98
  185.95.156.10
-185.95.156.166
  185.95.156.194
  185.95.162.84
+185.95.163.152
  185.95.187.220
  185.95.219.53
-185.96.117.64
  185.96.162.165
  185.96.162.172
  185.96.162.177
@@ -67021,13 +68477,11 @@
  185.96.55.121
  185.96.6.106
  185.97.113.5
+185.97.116.222
  185.97.12.130
  185.97.133.50
  185.97.134.4
  185.98.26.21
-185.99.125.101
-185.99.125.8
-185.99.184.149
  185.99.184.151
  1851kitchen.com
  18552beguni.000webhostapp.com
@@ -67043,14 +68497,16 @@
  186.0.185.135
  186.0.88.128
  186.0.89.194
+186.0.94.166
  186.0.95.172
  186.1.10.218
-186.1.14.152
  186.1.181.242
  186.1.195.134
+186.1.40.105
  186.1.41.138
  186.1.41.143
  186.1.48.25
+186.1.49.78
  186.1.5.35
  186.10.0.116
  186.10.102.198
@@ -67075,18 +68531,20 @@
  186.103.148.204
  186.103.215.118
  186.103.234.178
+186.105.114.119
  186.109.88.179
  186.109.88.187
  186.113.21.156
  186.114.184.195
+186.115.37.47
  186.116.13.64
  186.116.150.98
+186.116.8.179
  186.119.116.226
  186.119.119.233
  186.119.122.11
  186.12.134.65
  186.12.142.114
-186.12.194.36
  186.121.204.10
  186.121.206.234
  186.121.206.237
@@ -67111,6 +68569,7 @@
  186.13.140.118
  186.136.187.71
  186.136.250.31
+186.136.45.239
  186.137.159.131
  186.137.79.39
  186.138.116.146
@@ -67125,9 +68584,9 @@
  186.145.120.68
  186.145.239.222
  186.145.239.237
-186.145.254.158
  186.146.1.186
  186.146.2.111
+186.146.229.172
  186.147.129.110
  186.147.159.21
  186.147.160.161
@@ -67138,6 +68597,7 @@
  186.148.172.19
  186.148.190.78
  186.149.143.2
+186.149.156.122
  186.149.199.27
  186.149.199.90
  186.15.116.27
@@ -67156,10 +68616,9 @@
  186.151.122.187
  186.151.160.174
  186.151.197.189
-186.151.218.93
  186.153.124.124
  186.154.1.11
-186.154.171.152
+186.154.189.86
  186.154.197.178
  186.154.221.154
  186.154.241.229
@@ -67167,12 +68626,12 @@
  186.154.33.235
  186.154.34.157
  186.154.36.143
-186.154.36.144
  186.154.36.91
  186.154.37.49
  186.154.38.131
  186.154.40.229
  186.154.40.239
+186.154.6.2
  186.154.73.232
  186.154.73.83
  186.154.74.30
@@ -67190,6 +68649,7 @@
  186.155.19.89
  186.155.192.172
  186.155.21.210
+186.155.22.101
  186.155.226.43
  186.155.227.234
  186.155.250.204
@@ -67199,6 +68659,7 @@
  186.157.132.132
  186.157.133.24
  186.157.176.5
+186.157.240.18
  186.158.248.235
  186.159.1.217
  186.159.1.58
@@ -67210,20 +68671,26 @@
  186.159.3.193
  186.159.3.41
  186.159.8.218
+186.16.14.107
  186.16.209.222
  186.160.127.32
  186.167.16.242
  186.167.33.244
  186.167.48.45
+186.170.176.255
  186.170.28.46
  186.170.36.137
  186.176.223.82
  186.177.165.196
-186.178.4.190
-186.178.58.71
+186.178.56.37
+186.178.59.229
  186.178.59.248
+186.178.61.54
+186.178.62.180
  186.179.100.217
-186.179.100.86
+186.179.100.231
+186.179.100.36
+186.179.100.99
  186.179.103.118
  186.179.112.254
  186.179.118.59
@@ -67231,9 +68698,7 @@
  186.179.219.105
  186.179.243.112
  186.179.243.77
-186.179.42.180
  186.179.42.229
-186.179.42.71
  186.179.43.131
  186.179.43.151
  186.179.43.177
@@ -67244,10 +68709,13 @@
  186.182.106.5
  186.182.140.18
  186.183.151.2
+186.183.151.4
  186.183.151.5
  186.183.158.195
  186.183.199.203
  186.183.251.155
+186.188.183.198
+186.188.195.60
  186.188.58.137
  186.189.139.167
  186.189.195.45
@@ -67256,6 +68724,7 @@
  186.189.238.44
  186.189.249.2
  186.19.14.180
+186.190.183.142
  186.190.224.130
  186.192.17.242
  186.192.195.252
@@ -67287,7 +68756,6 @@
  186.194.22.70
  186.194.25.20
  186.194.26.240
-186.20.154.22
  186.200.181.130
  186.200.205.170
  186.200.65.242
@@ -67304,7 +68772,6 @@
  186.206.164.39
  186.207.131.216
  186.207.74.8
-186.207.86.32
  186.207.91.154
  186.208.106.62
  186.208.115.222
@@ -67331,10 +68798,10 @@
  186.210.10.46
  186.210.153.43
  186.210.157.96
-186.210.159.154
  186.210.159.83
  186.210.242.10
  186.210.245.29
+186.210.55.85
  186.210.9.89
  186.211.103.240
  186.211.105.202
@@ -67375,17 +68842,18 @@
  186.215.200.13
  186.215.202.34
  186.215.206.250
+186.215.235.9
  186.215.70.40
  186.215.70.67
-186.216.68.124
+186.216.67.114
+186.216.68.243
  186.216.69.68
-186.216.70.141
-186.216.70.17
-186.216.70.209
+186.216.69.7
+186.216.70.12
+186.216.70.184
  186.216.70.34
  186.216.71.160
-186.216.71.166
-186.216.71.207
+186.216.71.174
  186.216.81.21
  186.216.82.107
  186.219.103.166
@@ -67402,7 +68870,6 @@
  186.219.3.67
  186.219.3.68
  186.219.3.71
-186.219.3.73
  186.219.3.74
  186.219.3.78
  186.219.34.210
@@ -67415,14 +68882,16 @@
  186.22.144.140
  186.220.212.101
  186.221.115.239
+186.221.177.201
  186.222.217.146
  186.222.224.238
+186.222.35.66
  186.222.50.187
+186.223.116.50
  186.223.144.163
  186.223.144.185
  186.223.161.185
  186.223.164.152
-186.223.164.247
  186.223.165.121
  186.223.248.8
  186.224.159.114
@@ -67435,6 +68904,7 @@
  186.224.247.74
  186.224.249.215
  186.224.249.234
+186.224.74.161
  186.224.80.30
  186.224.9.73
  186.225.100.74
@@ -67468,10 +68938,12 @@
  186.225.61.182
  186.225.63.134
  186.225.63.82
-186.225.82.245
+186.225.80.194
+186.225.82.255
  186.225.87.50
  186.225.98.234
  186.226.160.4
+186.226.165.99
  186.226.169.162
  186.226.170.240
  186.226.171.94
@@ -67493,8 +68965,8 @@
  186.228.147.58
  186.229.16.220
  186.229.24.194
-186.229.25.18
  186.23.142.83
+186.23.211.154
  186.23.211.16
  186.231.99.22
  186.232.119.58
@@ -67515,10 +68987,13 @@
  186.233.94.46
  186.233.98.146
  186.233.98.173
+186.234.249.196
+186.234.80.102
  186.234.80.143
  186.234.80.200
  186.234.80.23
  186.234.80.246
+186.234.80.249
  186.234.80.61
  186.234.80.92
  186.235.43.7
@@ -67528,9 +69003,11 @@
  186.235.84.34
  186.236.111.154
  186.236.162.5
+186.236.18.99
  186.236.23.188
  186.236.237.248
  186.236.237.27
+186.236.76.66
  186.237.114.95
  186.237.129.26
  186.237.131.122
@@ -67542,11 +69019,13 @@
  186.237.223.42
  186.237.238.44
  186.237.3.250
+186.237.38.233
  186.237.76.45
  186.237.78.81
  186.237.79.76
  186.237.87.238
  186.238.23.10
+186.239.155.106
  186.24.218.195
  186.24.34.227
  186.24.5.98
@@ -67560,7 +69039,6 @@
  186.248.175.131
  186.248.175.133
  186.248.175.138
-186.248.175.139
  186.248.175.152
  186.248.175.3
  186.249.13.62
@@ -67577,22 +69055,17 @@
  186.249.23.87
  186.249.231.162
  186.249.240.146
-186.250.105.160
  186.250.161.254
  186.250.161.69
  186.250.161.70
  186.250.163.72
  186.250.17.103
-186.250.193.88
-186.250.202.145
  186.250.202.170
  186.250.203.11
  186.250.203.134
  186.250.203.200
-186.250.203.39
-186.250.203.95
  186.250.204.39
-186.250.207.68
+186.250.207.189
  186.250.253.42
  186.250.253.49
  186.250.253.53
@@ -67600,14 +69073,11 @@
  186.250.53.145
  186.250.55.5
  186.250.56.135
-186.251.135.7
-186.251.162.137
  186.251.166.245
  186.251.208.121
  186.251.208.139
  186.251.224.200
  186.251.224.46
-186.251.228.166
  186.251.228.186
  186.251.229.2
  186.251.247.58
@@ -67624,15 +69094,12 @@
  186.251.255.113
  186.251.255.117
  186.251.255.121
-186.251.255.129
  186.251.255.133
  186.251.255.137
  186.251.255.141
  186.251.255.157
  186.251.255.17
  186.251.255.177
-186.251.255.181
-186.251.255.185
  186.251.255.193
  186.251.255.197
  186.251.255.201
@@ -67653,9 +69120,9 @@
  186.251.255.45
  186.251.255.53
  186.251.255.57
+186.251.255.61
  186.251.255.65
  186.251.255.73
-186.251.255.77
  186.251.255.81
  186.251.255.89
  186.251.255.93
@@ -67681,6 +69148,7 @@
  186.29.27.99
  186.29.34.136
  186.29.70.82
+186.29.70.85
  186.3.123.66
  186.3.13.150
  186.3.142.2
@@ -67688,13 +69156,13 @@
  186.3.215.109
  186.3.58.27
  186.30.148.162
+186.30.151.8
  186.30.156.1
  186.30.158.143
  186.30.158.52
  186.30.17.174
  186.30.171.213
  186.30.178.91
-186.30.4.250
  186.30.58.56
  186.30.7.180
  186.31.116.154
@@ -67717,6 +69185,7 @@
  186.35.35.250
  186.35.50.22
  186.36.74.116
+186.37.83.226
  186.38.26.5
  186.38.38.129
  186.38.38.2
@@ -67747,7 +69216,6 @@
  186.46.136.70
  186.46.138.194
  186.46.184.182
-186.46.187.19
  186.46.187.26
  186.46.198.122
  186.46.199.115
@@ -67772,8 +69240,8 @@
  186.5.206.1
  186.5.207.1
  186.50.47.170
-186.52.56.2
  186.53.148.112
+186.54.100.108
  186.54.29.252
  186.55.26.196
  186.56.57.14
@@ -67782,17 +69250,17 @@
  186.58.164.52
  186.58.172.230
  186.58.208.239
-186.58.74.8
  186.59.132.129
+186.59.255.196
  186.6.193.231
  186.6.196.185
  186.6.238.8
+186.6.26.4
  186.61.34.123
-186.61.61.83
  186.64.117.95
  186.64.118.125
-186.64.118.25
  186.64.119.85
+186.65.114.159
  186.66.171.22
  186.66.20.125
  186.66.22.182
@@ -67815,11 +69283,10 @@
  186.67.159.100
  186.67.159.101
  186.67.224.156
-186.67.27.174
+186.67.38.166
  186.67.60.174
  186.67.74.53
  186.67.77.171
-186.67.9.172
  186.68.113.181
  186.68.126.224
  186.68.136.121
@@ -67871,7 +69338,9 @@
  186.69.58.182
  186.69.60.242
  186.69.60.244
+186.69.64.58
  186.7.150.54
+186.7.193.203
  186.7.22.92
  186.7.253.196
  186.7.52.101
@@ -67911,12 +69380,10 @@
  186.71.144.66
  186.71.156.20
  186.71.176.231
-186.71.177.160
  186.71.206.102
  186.71.206.177
  186.71.215.220
  186.71.228.152
-186.71.231.120
  186.71.233.23
  186.71.240.100
  186.71.252.111
@@ -67935,9 +69402,7 @@
  186.74.221.210
  186.75.130.46
  186.75.241.230
-186.79.168.229
  186.79.24.76
-186.79.41.104
  186.80.27.227
  186.80.57.68
  186.83.106.133
@@ -67946,12 +69411,11 @@
  186.83.66.200
  186.84.172.7
  186.84.173.153
-186.84.20.19
+186.84.88.254
  186.85.149.21
  186.85.159.135
  186.86.247.169
  186.86.32.245
-186.87.255.114
  186.87.32.46
  186.88.114.124
  186.88.137.195
@@ -67968,7 +69432,6 @@
  186.91.240.234
  186.91.44.36
  186.92.169.240
-186.92.218.246
  186.92.225.185
  186.93.74.12
  186.94.222.0
@@ -67978,8 +69441,6 @@
  186.96.109.181
  186.96.110.5
  186.96.127.221
-186.96.192.200
-186.96.197.18
  186.96.36.94
  186.96.72.166
  186.97.144.202
@@ -67988,17 +69449,18 @@
  18655.aqq.ru
  186bahsegel.com
  187.0.177.153
-187.0.184.250
  187.0.195.66
-187.1.67.169
+187.1.188.158
  187.1.81.155
  187.1.81.161
  187.10.133.100
  187.10.135.26
  187.10.237.178
  187.10.59.67
+187.10.72.128
  187.10.72.201
  187.10.72.50
+187.101.40.128
  187.102.146.222
  187.102.16.70
  187.102.71.1
@@ -68008,25 +69470,24 @@
  187.103.15.17
  187.103.15.54
  187.103.74.137
+187.103.81.21
  187.103.81.4
+187.103.81.49
  187.103.82.110
  187.103.82.80
+187.103.82.93
  187.103.82.95
  187.103.82.97
  187.103.82.98
  187.104.151.8
  187.104.202.249
-187.105.98.15
  187.106.203.217
  187.106.81.102
-187.107.14.240
  187.107.186.87
  187.107.68.86
  187.108.218.32
-187.108.222.223
  187.108.38.170
  187.108.46.204
-187.108.67.103
  187.108.76.113
  187.109.10.100
  187.109.181.77
@@ -68036,11 +69497,11 @@
  187.109.36.248
  187.109.36.251
  187.109.40.9
-187.109.46.83
  187.11.113.231
  187.11.216.80
  187.11.232.71
  187.110.208.2
+187.110.234.145
  187.110.238.251
  187.111.160.10
  187.111.160.23
@@ -68082,9 +69543,9 @@
  187.115.10.50
  187.115.111.148
  187.115.122.2
-187.115.160.220
  187.115.18.6
  187.115.67.118
+187.115.80.122
  187.116.124.253
  187.116.3.240
  187.116.96.186
@@ -68130,6 +69591,7 @@
  187.121.109.251
  187.121.109.92
  187.121.111.221
+187.121.114.140
  187.121.114.216
  187.121.114.250
  187.121.115.165
@@ -68163,11 +69625,9 @@
  187.123.167.16
  187.123.56.57
  187.125.106.34
-187.130.139.197
  187.131.192.59
  187.131.217.1
  187.131.251.187
-187.132.131.203
  187.133.59.220
  187.134.1.187
  187.134.211.219
@@ -68202,12 +69662,15 @@
  187.148.182.104
  187.148.63.47
  187.148.90.241
+187.149.137.250
  187.149.223.239
+187.149.40.124
  187.149.50.65
  187.149.72.101
  187.149.73.15
  187.149.80.229
  187.149.82.16
+187.151.11.182
  187.151.38.34
  187.151.7.126
  187.152.102.244
@@ -68230,6 +69693,7 @@
  187.156.43.186
  187.157.115.238
  187.157.189.84
+187.157.23.226
  187.157.32.35
  187.158.21.71
  187.159.10.106
@@ -68243,6 +69707,8 @@
  187.16.189.36
  187.16.255.199
  187.16.4.126
+187.16.45.218
+187.16.96.35
  187.160.140.130
  187.160.239.75
  187.160.245.156
@@ -68250,7 +69716,6 @@
  187.161.206.24
  187.162.11.94
  187.162.116.220
-187.162.118.242
  187.162.195.168
  187.162.246.198
  187.162.248.237
@@ -68258,12 +69723,12 @@
  187.162.251.26
  187.162.41.111
  187.162.44.90
-187.162.60.54
  187.162.61.184
  187.163.124.62
  187.163.201.75
  187.163.39.133
  187.167.218.84
+187.168.215.87
  187.168.65.133
  187.168.65.54
  187.17.145.237
@@ -68273,7 +69738,9 @@
  187.17.242.58
  187.17.63.66
  187.170.147.171
+187.170.147.84
  187.170.16.34
+187.170.243.182
  187.170.7.203
  187.170.76.13
  187.170.92.199
@@ -68286,34 +69753,31 @@
  187.176.185.65
  187.177.155.123
  187.177.165.88
-187.178.167.172
  187.178.238.192
  187.178.241.208
  187.178.69.224
  187.18.108.73
  187.18.116.158
  187.18.125.34
+187.180.102.108
  187.180.181.220
  187.180.92.7
  187.181.144.212
  187.181.189.182
  187.182.114.105
  187.182.121.25
-187.184.115.44
  187.185.68.99
-187.187.205.27
-187.187.207.107
  187.188.10.169
  187.188.102.237
  187.188.102.9
  187.188.107.115
+187.188.11.234
  187.188.111.161
  187.188.116.224
  187.188.124.229
+187.188.137.154
  187.188.148.188
-187.188.149.151
  187.188.16.178
-187.188.160.98
  187.188.166.192
  187.188.167.138
  187.188.168.69
@@ -68328,6 +69792,7 @@
  187.188.213.4
  187.188.240.7
  187.188.241.216
+187.188.33.195
  187.188.34.221
  187.188.37.254
  187.188.45.19
@@ -68343,6 +69808,7 @@
  187.189.149.224
  187.189.153.136
  187.189.154.99
+187.189.17.249
  187.189.170.100
  187.189.184.243
  187.189.190.69
@@ -68354,27 +69820,25 @@
  187.189.241.135
  187.189.241.98
  187.189.243.167
-187.189.243.22
  187.189.26.198
-187.189.27.240
  187.189.27.30
+187.189.31.243
  187.189.35.36
  187.189.45.8
  187.189.51.117
  187.189.52.132
  187.189.52.17
  187.189.52.49
+187.189.55.37
  187.189.60.10
-187.189.64.71
+187.189.65.187
  187.189.65.241
-187.189.7.31
  187.189.74.203
  187.189.75.245
  187.189.77.71
  187.189.82.7
  187.189.83.154
  187.189.92.38
-187.189.97.91
  187.19.112.124
  187.19.114.2
  187.19.127.178
@@ -68393,18 +69857,21 @@
  187.19.204.146
  187.19.204.23
  187.19.205.226
+187.19.217.17
  187.19.219.60
  187.19.6.150
  187.190.10.242
  187.190.109.142
  187.190.109.201
+187.190.109.222
  187.190.114.244
  187.190.131.75
  187.190.133.135
+187.190.137.200
  187.190.159.248
  187.190.176.19
  187.190.184.189
-187.190.221.66
+187.190.22.29
  187.190.236.88
  187.190.237.67
  187.190.237.69
@@ -68412,14 +69879,15 @@
  187.190.250.138
  187.190.254.161
  187.190.254.219
-187.190.255.230
  187.190.40.101
+187.190.40.112
  187.190.58.39
  187.191.20.10
  187.191.20.12
  187.191.20.14
  187.191.38.80
  187.191.4.88
+187.191.45.42
  187.191.96.60
  187.191.98.123
  187.192.119.193
@@ -68428,8 +69896,10 @@
  187.194.203.167
  187.194.80.233
  187.195.231.121
+187.195.53.52
  187.195.74.33
  187.195.90.208
+187.199.176.150
  187.199.198.153
  187.199.65.185
  187.2.32.222
@@ -68447,8 +69917,9 @@
  187.205.62.204
  187.205.79.241
  187.205.8.21
+187.207.135.249
+187.207.203.89
  187.207.242.6
-187.207.98.99
  187.208.163.132
  187.208.21.61
  187.208.221.206
@@ -68456,7 +69927,6 @@
  187.208.8.43
  187.21.170.249
  187.210.122.62
-187.210.149.82
  187.210.226.214
  187.210.82.3
  187.212.189.131
@@ -68470,7 +69940,6 @@
  187.213.126.146
  187.213.94.58
  187.214.150.224
-187.216.232.6
  187.216.81.178
  187.216.81.180
  187.216.81.182
@@ -68479,13 +69948,13 @@
  187.216.81.188
  187.216.81.189
  187.216.81.190
-187.216.90.46
  187.216.93.20
  187.217.199.20
  187.217.246.82
  187.22.126.122
  187.220.12.19
  187.220.73.211
+187.220.85.60
  187.225.157.241
  187.225.181.113
  187.225.187.171
@@ -68498,6 +69967,7 @@
  187.227.49.68
  187.228.128.122
  187.228.131.191
+187.228.131.57
  187.228.134.119
  187.229.12.227
  187.229.24.113
@@ -68505,7 +69975,6 @@
  187.23.86.108
  187.230.29.125
  187.232.161.196
-187.232.63.159
  187.232.74.66
  187.232.75.145
  187.235.100.216
@@ -68514,17 +69983,16 @@
  187.237.16.197
  187.237.164.212
  187.237.164.37
+187.242.160.33
  187.243.250.222
  187.243.253.182
  187.243.253.2
-187.243.255.174
  187.245.102.112
  187.247.158.247
  187.247.231.220
  187.248.80.173
  187.25.240.128
  187.25.240.141
-187.25.250.197
  187.250.154.103
  187.250.17.247
  187.254.14.121
@@ -68532,10 +70000,10 @@
  187.254.15.2
  187.254.15.41
  187.255.92.142
-187.26.2.136
  187.26.33.47
  187.27.184.208
  187.3.45.78
+187.32.132.113
  187.32.153.90
  187.32.160.173
  187.32.17.105
@@ -68549,16 +70017,19 @@
  187.33.208.180
  187.33.245.2
  187.33.60.201
+187.33.95.6
+187.34.122.190
  187.34.5.218
+187.35.129.125
  187.35.176.89
  187.35.188.203
-187.35.30.33
+187.35.30.26
+187.35.37.117
  187.35.38.126
  187.36.111.60
  187.36.186.3
  187.36.34.175
  187.37.38.154
-187.38.213.54
  187.38.43.127
  187.38.53.245
  187.39.146.201
@@ -68588,10 +70059,12 @@
  187.44.254.62
  187.44.27.154
  187.44.64.22
+187.44.86.102
  187.44.89.211
  187.44.93.223
  187.44.93.225
  187.45.10.138
+187.45.103.15
  187.45.106.54
  187.45.116.207
  187.45.123.110
@@ -68599,6 +70072,7 @@
  187.45.127.73
  187.45.127.87
  187.45.147.193
+187.45.190.68
  187.45.193.159
  187.45.24.131
  187.45.96.8
@@ -68638,6 +70112,7 @@
  187.61.222.195
  187.62.147.177
  187.62.150.28
+187.62.186.226
  187.62.191.3
  187.62.195.145
  187.62.195.76
@@ -68646,11 +70121,11 @@
  187.62.206.65
  187.62.220.89
  187.62.224.245
+187.62.60.150
  187.62.67.1
  187.62.98.33
  187.63.10.28
  187.63.232.64
-187.63.33.254
  187.63.47.230
  187.63.9.19
  187.65.151.91
@@ -68661,6 +70136,7 @@
  187.66.108.180
  187.66.128.85
  187.66.86.49
+187.67.41.125
  187.68.37.234
  187.68.45.39
  187.68.48.235
@@ -68668,20 +70144,23 @@
  187.68.96.221
  187.69.160.38
  187.69.24.117
+187.69.31.249
  187.7.213.24
  187.70.130.98
  187.71.223.192
-187.71.47.50
  187.71.60.11
  187.71.75.6
  187.72.124.8
+187.72.167.232
  187.72.177.131
+187.72.202.129
  187.72.221.123
  187.72.221.237
  187.72.223.29
  187.72.231.193
  187.72.239.185
  187.72.243.97
+187.72.53.89
  187.72.66.1
  187.72.66.10
  187.72.66.16
@@ -68696,8 +70175,8 @@
  187.73.214.161
  187.73.222.193
  187.73.26.92
-187.73.33.43
  187.73.68.14
+187.73.7.159
  187.73.74.13
  187.74.130.124
  187.74.130.211
@@ -68712,6 +70191,7 @@
  187.74.133.19
  187.74.248.121
  187.74.72.49
+187.74.78.130
  187.75.151.181
  187.75.209.161
  187.75.65.246
@@ -68721,6 +70201,7 @@
  187.8.116.12
  187.8.182.30
  187.8.226.10
+187.8.78.101
  187.84.129.14
  187.84.132.20
  187.84.141.140
@@ -68751,11 +70232,10 @@
  187.86.129.122
  187.86.129.132
  187.86.129.134
+187.86.137.141
  187.86.200.42
  187.86.201.4
-187.87.10.34
  187.87.12.139
-187.87.14.51
  187.87.204.202
  187.87.204.205
  187.87.204.210
@@ -68765,14 +70245,12 @@
  187.87.204.220
  187.87.8.178
  187.87.84.51
-187.87.9.42
  187.9.6.157
  187.9.86.122
-187.93.176.2
+187.91.77.175
  187.94.102.102
  187.94.16.59
  187.94.221.0
-187.94.253.214
  187.94.253.222
  187.94.253.253
  187.94.30.18
@@ -68790,8 +70268,10 @@
  187.95.194.125
  187.95.194.145
  187.95.236.245
+187.95.49.1
  187.95.49.105
  187.95.82.146
+187.95.82.175
  187.95.82.49
  187.95.82.53
  187.95.82.57
@@ -68799,7 +70279,6 @@
  1875-financeinvest.com
  187bahsegel.com
  188.0.10.123
-188.0.131.97
  188.0.135.108
  188.0.135.237
  188.0.138.11
@@ -68812,43 +70291,43 @@
  188.0.24.190
  188.0.240.38
  188.10.143.3
-188.10.161.2
  188.10.210.132
  188.10.231.246
  188.10.32.1
  188.10.45.53
  188.103.126.6
  188.105.52.53
-188.108.55.253
+188.109.9.199
  188.11.61.14
-188.112.145.230
  188.112.148.163
-188.112.9.122
+188.112.82.220
  188.113.106.183
  188.113.116.133
  188.113.154.189
  188.113.158.112
+188.113.166.167
  188.113.176.12
  188.113.183.12
-188.113.203.190
-188.113.207.235
  188.113.90.94
  188.114.103.6
  188.114.140.233
  188.114.155.58
+188.114.22.146
  188.114.88.183
  188.114.89.29
  188.115.136.167
  188.115.254.170
  188.115.42.153
  188.115.56.155
-188.116.36.152
+188.116.40.120
+188.116.49.123
  188.117.158.7
  188.117.176.56
  188.117.193.42
  188.119.11.96
  188.119.120.126
  188.119.120.151
+188.119.24.64
  188.119.30.65
  188.119.30.71
  188.119.30.72
@@ -68867,20 +70346,20 @@
  188.120.235.130
  188.120.235.217
  188.120.243.11
-188.120.96.180
  188.121.3.75
  188.121.57.10
  188.121.57.5
  188.121.8.146
  188.122.2.55
-188.122.82.146
  188.123.121.16
  188.123.126.152
  188.123.126.177
  188.124.10.46
  188.124.181.6
+188.124.227.26
  188.124.37.232
  188.124.42.108
+188.124.42.119
  188.124.42.125
  188.124.69.201
  188.124.94.140
@@ -68905,31 +70384,26 @@
  188.126.73.219
  188.126.73.221
  188.126.81.155
-188.126.82.100
  188.126.89.4
  188.126.94.125
  188.126.94.176
  188.126.94.57
  188.126.94.68
  188.127.183.132
+188.127.190.193
  188.127.191.21
-188.127.225.100
  188.127.229.105
  188.127.232.71
  188.127.249.210
-188.127.37.23
-188.127.37.44
  188.127.37.94
  188.128.202.35.bc.googleusercontent.com
  188.128.39.127
  188.128.83.10
  188.129.153.88
  188.129.161.55
-188.129.192.132
  188.129.246.244
  188.130.128.190
  188.130.129.138
-188.130.130.54
  188.130.136.251
  188.130.137.104
  188.130.142.250
@@ -68937,6 +70411,7 @@
  188.130.149.125
  188.130.185.220
  188.130.187.210
+188.130.187.243
  188.130.188.72
  188.130.197.199
  188.130.218.85
@@ -68944,40 +70419,52 @@
  188.130.220.235
  188.130.7.221
  188.131.128.71
+188.131.129.240
  188.131.130.86
  188.131.131.228
+188.131.131.52
  188.131.132.83
  188.131.133.196
-188.131.133.79
  188.131.134.216
  188.131.135.18
  188.131.135.227
+188.131.136.130
+188.131.136.177
+188.131.136.191
+188.131.137.239
  188.131.138.215
  188.131.140.160
  188.131.141.129
  188.131.143.134
  188.131.143.146
  188.131.145.150
+188.131.145.158
  188.131.146.143
  188.131.146.251
  188.131.146.52
  188.131.147.254
  188.131.149.116
  188.131.154.183
+188.131.154.81
  188.131.155.173
  188.131.155.39
  188.131.157.174
+188.131.157.61
  188.131.160.183
  188.131.169.178
  188.131.173.220
+188.131.176.142
  188.131.176.36
  188.131.176.62
  188.131.177.130
  188.131.177.59
+188.131.178.32
  188.131.179.87
  188.131.181.13
  188.131.191.40
  188.131.192.122
+188.131.192.131
+188.131.204.154
  188.131.218.217
  188.131.233.36
  188.131.235.218
@@ -68992,7 +70479,6 @@
  188.134.34.43
  188.134.5.47
  188.134.6.84
-188.134.75.152
  188.134.8.104
  188.134.8.36
  188.134.81.196
@@ -69020,12 +70506,14 @@
  188.138.84.69
  188.138.88.47
  188.138.92.211
+188.14.121.243
  188.14.85.21
  188.141.233.87
  188.141.240.59
  188.141.34.156
  188.141.72.94
  188.141.79.43
+188.143.126.236
  188.143.220.152
  188.143.232.0
  188.143.232.1
@@ -69541,7 +71029,6 @@
  188.143.233.99
  188.143.235.21
  188.143.235.83
-188.143.56.151
  188.143.58.82
  188.147.169.150
  188.148.143.153
@@ -69576,24 +71063,21 @@
  188.152.246.130
  188.152.27.111
  188.152.7.140
-188.153.163.179
  188.153.196.205
  188.153.196.240
+188.153.208.82
  188.153.22.242
  188.153.7.113
  188.153.82.47
  188.154.199.93
  188.155.219.114
  188.155.91.186
-188.156.240.240
  188.156.97.88
  188.157.101.114
  188.157.143.144
  188.157.24.68
  188.157.9.166
  188.157.94.40
-188.159.139.101
-188.159.243.253
  188.16.144.162
  188.16.144.18
  188.16.145.74
@@ -69610,12 +71094,13 @@
  188.16.150.84
  188.16.151.207
  188.16.75.20
-188.161.164.128
  188.161.217.47
+188.162.132.119
  188.162.65.45
  188.163.104.113
  188.163.109.142
  188.163.113.152
+188.163.116.127
  188.163.170.130
  188.163.19.0
  188.163.42.254
@@ -69627,7 +71112,6 @@
  188.165.138.11
  188.165.140.127
  188.165.180.120
-188.165.194.99
  188.165.196.203
  188.165.198.108
  188.165.201.139
@@ -69636,7 +71120,6 @@
  188.165.207.8
  188.165.210.14
  188.165.210.176
-188.165.211.206
  188.165.212.171
  188.165.218.62
  188.165.222.158
@@ -69694,6 +71177,7 @@
  188.166.111.81
  188.166.112.149
  188.166.112.188
+188.166.112.201
  188.166.112.207
  188.166.114.148
  188.166.114.151
@@ -69726,18 +71210,16 @@
  188.166.122.214
  188.166.122.56
  188.166.125.85
-188.166.125.86
  188.166.125.90
  188.166.125.92
  188.166.125.96
-188.166.125.97
  188.166.144.207
  188.166.145.53
  188.166.150.17
  188.166.150.241
  188.166.150.243
+188.166.150.254
  188.166.153.212
-188.166.153.254
  188.166.159.127
  188.166.16.36
  188.166.161.103
@@ -69745,18 +71227,19 @@
  188.166.161.20
  188.166.164.10
  188.166.165.121
+188.166.165.223
  188.166.165.25
  188.166.170.70
  188.166.172.189
  188.166.177.33
  188.166.177.99
  188.166.178.39
+188.166.178.42
  188.166.178.52
  188.166.18.102
  188.166.18.230
  188.166.181.190
  188.166.182.246
-188.166.182.56
  188.166.183.160
  188.166.183.217
  188.166.183.237
@@ -69766,6 +71249,7 @@
  188.166.187.179
  188.166.188.185
  188.166.188.247
+188.166.189.234
  188.166.190.146
  188.166.190.166
  188.166.190.187
@@ -69781,6 +71265,7 @@
  188.166.209.13
  188.166.209.175
  188.166.209.76
+188.166.21.137
  188.166.21.143
  188.166.21.245
  188.166.21.247
@@ -69797,12 +71282,12 @@
  188.166.214.80
  188.166.214.96
  188.166.216.67
+188.166.217.166
  188.166.219.160
  188.166.22.13
  188.166.22.183
  188.166.22.22
  188.166.220.180
-188.166.222.119
  188.166.222.147
  188.166.222.220
  188.166.222.233
@@ -69811,6 +71296,7 @@
  188.166.223.100
  188.166.223.102
  188.166.223.220
+188.166.223.3
  188.166.223.37
  188.166.224.24
  188.166.224.51
@@ -69819,23 +71305,30 @@
  188.166.225.37
  188.166.226.188
  188.166.226.67
+188.166.228.229
  188.166.229.193
  188.166.229.235
  188.166.229.254
  188.166.23.215
  188.166.230.60
+188.166.231.134
  188.166.231.212
  188.166.231.248
  188.166.231.44
  188.166.232.158
  188.166.232.159
+188.166.232.4
+188.166.232.56
  188.166.233.216
+188.166.233.31
  188.166.234.1
  188.166.234.135
-188.166.234.253
+188.166.234.5
  188.166.235.123
  188.166.235.139
  188.166.235.141
+188.166.235.153
+188.166.236.109
  188.166.236.56
  188.166.236.57
  188.166.237.0
@@ -69843,10 +71336,10 @@
  188.166.237.234
  188.166.237.41
  188.166.24.63
-188.166.240.173
  188.166.240.30
  188.166.240.66
  188.166.241.194
+188.166.241.85
  188.166.242.12
  188.166.242.30
  188.166.244.121
@@ -69865,14 +71358,16 @@
  188.166.250.107
  188.166.250.35
  188.166.250.4
+188.166.250.93
  188.166.251.156
  188.166.251.87
+188.166.252.134
  188.166.252.204
-188.166.252.235
  188.166.253.84
-188.166.254.135
  188.166.254.200
  188.166.254.248
+188.166.254.66
+188.166.254.95
  188.166.255.113
  188.166.255.227
  188.166.255.49
@@ -69887,8 +71382,10 @@
  188.166.33.15
  188.166.34.129
  188.166.34.137
+188.166.34.234
  188.166.35.206
  188.166.35.81
+188.166.38.40
  188.166.4.178
  188.166.4.248
  188.166.40.70
@@ -69915,10 +71412,10 @@
  188.166.58.96
  188.166.6.130
  188.166.60.138
-188.166.61.141
  188.166.61.49
  188.166.64.245
  188.166.65.239
+188.166.68.132
  188.166.69.103
  188.166.69.56
  188.166.71.168
@@ -69927,7 +71424,6 @@
  188.166.72.130
  188.166.72.22
  188.166.72.62
-188.166.72.70
  188.166.73.160
  188.166.73.180
  188.166.73.252
@@ -69946,10 +71442,10 @@
  188.166.80.107
  188.166.80.133
  188.166.80.140
+188.166.81.148
  188.166.81.188
  188.166.82.188
  188.166.82.19
-188.166.82.23
  188.166.83.13
  188.166.83.209
  188.166.86.101
@@ -69995,7 +71491,6 @@
  188.166.99.62
  188.166.99.74
  188.167.158.203
-188.168.155.15
  188.168.27.71
  188.168.27.73
  188.168.30.47
@@ -70011,7 +71506,6 @@
  188.169.167.172
  188.169.167.204
  188.169.167.214
-188.169.167.227
  188.169.167.24
  188.169.167.249
  188.169.167.74
@@ -70020,13 +71514,13 @@
  188.169.179.127
  188.169.179.214
  188.169.179.216
-188.169.179.48
  188.169.199.144
  188.169.199.5
  188.169.199.59
  188.169.199.84
  188.169.20.174
  188.169.20.203
+188.169.20.222
  188.169.20.25
  188.169.20.48
  188.169.237.144
@@ -70043,12 +71537,10 @@
  188.169.36.214
  188.169.36.216
  188.169.36.224
-188.169.36.244
  188.169.36.83
  188.169.45.114
  188.169.45.115
  188.169.45.140
-188.169.45.159
  188.169.45.223
  188.169.45.234
  188.169.45.237
@@ -70062,7 +71554,6 @@
  188.169.61.127
  188.169.61.162
  188.169.61.181
-188.169.61.250
  188.169.64.16
  188.169.64.169
  188.169.64.3
@@ -70086,7 +71577,6 @@
  188.170.52.188
  188.170.63.9
  188.170.8.109
-188.170.87.171
  188.172.220.70
  188.172.220.71
  188.172.246.67
@@ -70095,8 +71585,8 @@
  188.173.80.134
  188.173.84.9
  188.173.97.144
+188.174.10.206
  188.174.103.98
-188.174.11.156
  188.174.25.102
  188.174.30.214
  188.174.30.251
@@ -70105,22 +71595,23 @@
  188.177.179.8
  188.178.169.129
  188.179.204.169
-188.18.104.70
  188.18.104.73
  188.18.105.202
-188.18.163.221
  188.18.52.66
  188.18.54.242
  188.18.91.255
  188.181.73.110
+188.186.126.53
  188.186.180.135
  188.186.182.56
  188.186.200.51
  188.186.237.180
  188.187.0.42
  188.187.108.131
-188.187.144.193
+188.187.149.85
  188.187.62.173
+188.189.112.165
+188.19.123.164
  188.19.124.120
  188.19.13.56
  188.19.176.103
@@ -70128,6 +71619,7 @@
  188.19.176.195
  188.19.177.0
  188.19.177.132
+188.19.177.236
  188.19.178.106
  188.19.178.156
  188.19.179.134
@@ -70159,10 +71651,8 @@
  188.19.187.23
  188.19.188.111
  188.19.188.142
-188.19.189.212
  188.19.190.107
  188.19.190.47
-188.19.190.61
  188.19.191.102
  188.19.191.172
  188.19.191.178
@@ -70174,10 +71664,12 @@
  188.190.124.1
  188.190.232.175
  188.190.243.241
+188.190.245.135
  188.190.3.110
  188.190.33.120
  188.190.36.72
  188.190.51.181
+188.190.79.249
  188.190.81.135
  188.191.103.67
  188.191.16.66
@@ -70189,7 +71681,6 @@
  188.191.204.77
  188.191.205.125
  188.191.206.109
-188.191.23.226
  188.191.232.137
  188.191.232.149
  188.191.232.59
@@ -70201,35 +71692,52 @@
  188.191.239.83
  188.191.239.92
  188.192.12.35
+188.192.175.128
  188.192.44.142
  188.192.46.137
+188.193.117.90
+188.193.166.54
  188.194.203.203
-188.194.56.137
-188.194.59.113
+188.195.138.176
  188.195.139.20
  188.195.169.0
-188.2.86.244
+188.195.252.141
+188.195.252.36
  188.205.25.124
  188.207.42.137
+188.208.122.54
+188.208.143.114
  188.209.232.18
  188.209.49.164
  188.21.152.205
-188.210.48.104
-188.210.51.164
-188.210.51.5
+188.210.50.32
+188.210.53.169
+188.210.54.128
  188.210.55.242
  188.210.85.34
  188.212.100.2
-188.213.134.164
  188.213.168.110
  188.213.170.40
+188.213.212.133
  188.213.212.134
+188.213.212.141
  188.213.212.142
+188.213.212.47
+188.213.212.48
+188.213.212.49
+188.213.212.50
+188.213.212.51
+188.213.212.61
+188.213.212.62
+188.213.212.63
+188.213.212.84
+188.213.212.85
  188.213.25.203
  188.213.34.102
  188.213.34.109
  188.213.34.11
  188.213.34.13
+188.213.34.14
  188.213.34.23
  188.213.34.24
  188.213.34.26
@@ -70252,16 +71760,16 @@
  188.214.132.45
  188.214.132.85
  188.214.133.114
+188.214.204.137
  188.214.30.238
  188.214.30.78
-188.215.214.90
  188.215.232.1
  188.215.70.115
  188.215.83.52
  188.216.126.157
+188.216.228.198
  188.216.254.72
  188.216.58.247
-188.217.123.128
  188.217.132.184
  188.217.139.127
  188.217.140.175
@@ -70320,8 +71828,8 @@
  188.226.180.234
  188.226.188.45
  188.226.192.115
-188.226.22.101
  188.226.233.196
+188.226.250.187
  188.227.106.56
  188.227.170.139
  188.227.193.27
@@ -70341,7 +71849,6 @@
  188.231.235.82
  188.233.191.121
  188.234.116.68
-188.234.134.42
  188.234.134.47
  188.234.212.116
  188.234.216.99
@@ -70374,17 +71881,13 @@
  188.239.127.139
  188.239.22.247
  188.239.27.18
-188.24.144.137
  188.24.188.147
  188.24.32.79
-188.24.57.133
  188.240.136.75
  188.240.191.163
  188.240.208.26
  188.240.24.236
-188.240.249.187
  188.240.26.111
-188.241.121.171
  188.241.24.13
  188.241.39.65
  188.241.45.61
@@ -70410,6 +71913,7 @@
  188.244.137.55
  188.244.142.17
  188.244.144.90
+188.244.179.228
  188.244.19.206
  188.244.190.98
  188.244.20.242
@@ -70421,77 +71925,68 @@
  188.246.181.50
  188.246.20.122
  188.246.224.126
+188.246.224.140
  188.246.224.29
+188.246.224.67
  188.246.226.71
  188.246.236.122
-188.246.239.114
-188.246.239.170
  188.247.112.37
  188.247.144.165
  188.247.144.62
-188.247.179.213
-188.247.192.231
  188.247.31.26
  188.247.39.14
+188.247.65.179
  188.247.69.26
  188.25.123.244
  188.25.211.162
  188.25.213.93
-188.25.56.84
+188.25.79.211
  188.250.249.131
  188.251.213.180
  188.252.14.236
  188.252.64.154
-188.253.224.225
-188.253.229.225
-188.253.230.20
-188.253.231.59
-188.253.235.201
-188.253.237.214
  188.254.0.116
  188.254.0.160
  188.254.0.182
-188.254.0.184
  188.254.0.2
  188.254.126.189
  188.254.159.122
  188.254.159.164
  188.254.172.147
-188.254.198.139
  188.254.240.48
  188.254.76.69
  188.254.76.98
  188.255.118.20
  188.255.120.102
  188.255.120.9
-188.255.131.0
-188.255.131.10
  188.255.131.104
+188.255.131.105
+188.255.131.110
  188.255.131.138
  188.255.131.158
-188.255.131.172
+188.255.131.161
+188.255.131.167
  188.255.131.188
-188.255.131.216
-188.255.131.230
-188.255.131.242
+188.255.131.237
  188.255.131.243
  188.255.131.4
-188.255.131.48
+188.255.131.5
+188.255.131.58
  188.255.131.64
+188.255.131.67
+188.255.131.88
  188.255.131.89
  188.255.131.90
-188.255.131.97
-188.255.131.99
-188.255.132.109
  188.255.132.119
+188.255.132.127
+188.255.132.158
  188.255.132.19
-188.255.132.192
-188.255.132.211
-188.255.132.218
+188.255.132.37
  188.255.132.53
  188.255.132.92
  188.255.14.136
  188.255.208.129
+188.255.208.17
  188.255.208.250
  188.255.208.69
  188.255.209.149
@@ -70504,44 +71999,56 @@
  188.255.213.97
  188.255.214.121
  188.255.214.9
-188.255.237.108
-188.255.237.112
  188.255.237.118
+188.255.237.152
+188.255.237.166
  188.255.237.168
-188.255.237.217
+188.255.237.171
+188.255.237.182
+188.255.237.185
+188.255.237.220
+188.255.237.237
+188.255.237.245
+188.255.237.248
+188.255.237.53
+188.255.237.56
  188.255.237.59
-188.255.25.55
+188.255.237.99
+188.255.250.35
+188.255.252.121
  188.255.4.208
  188.26.105.108
  188.26.106.150
  188.26.113.129
  188.26.125.127
  188.26.196.155
+188.26.231.113
  188.26.43.102
  188.26.5.254
  188.26.6.188
  188.26.7.21
+188.26.87.15
  188.27.107.169
  188.27.129.152
  188.27.137.163
-188.27.163.30
  188.27.227.38
  188.27.235.141
  188.27.241.145
+188.27.241.253
  188.27.86.27
  188.3.138.198
  188.3.36.167
  188.3.74.195
  188.31.78.164
  188.32.121.140
+188.32.128.165
  188.32.128.29
  188.32.145.79
-188.32.224.114
  188.35.167.7
  188.36.242.255
+188.37.152.138
  188.37.24.190
  188.38.102.54
-188.38.134.252
  188.38.141.246
  188.38.198.254
  188.38.209.128
@@ -70554,7 +72061,7 @@
  188.40.155.227
  188.40.155.228
  188.40.164.152
-188.40.21.44
+188.40.210.30
  188.40.217.185
  188.40.34.185
  188.40.44.177
@@ -70571,14 +72078,13 @@
  188.43.29.81
  188.43.51.154
  188.43.52.166
-188.43.52.196
  188.44.13.253
  188.47.4.132
  188.47.45.128
  188.50.127.101
+188.50.143.124
  188.50.144.142
  188.50.161.202
-188.51.20.121
  188.51.41.172
  188.51.50.17
  188.51.66.194
@@ -70618,6 +72124,7 @@
  188.64.175.211
  188.64.183.169
  188.64.186.224
+188.64.220.157
  188.65.236.165
  188.65.237.16
  188.65.73.110
@@ -70640,7 +72147,6 @@
  188.72.6.98
  188.72.82.196
  188.73.127.228
-188.75.129.138
  188.75.138.234
  188.75.139.60
  188.75.16.163
@@ -70661,10 +72167,13 @@
  188.85.143.170
  188.85.166.88
  188.85.218.246
+188.86.180.110
  188.9.104.199
+188.9.246.107
  188.9.65.88
  188.9.71.68
  188.92.190.38
+188.92.209.136
  188.92.244.38
  188.92.73.91
  188.92.75.219
@@ -70681,11 +72190,12 @@
  188.93.64.242
  188.94.164.178
  188.94.38.100
+188.94.42.24
  188.94.66.42
  188.95.20.84
  188.95.234.6
  188.98.204.183
-188.98.98.116
+188.99.165.180
  18850306919.mer.lstest.siquality.com
  18850306929.mer.lstest.siquality.com
  188elexusbet.blogspot.com
@@ -70706,14 +72216,15 @@
  189.106.252.225
  189.107.22.107
  189.107.88.89
-189.108.108.45
  189.108.236.148
  189.108.95.99
  189.109.252.155
  189.11.126.17
+189.110.167.3
  189.111.105.208
  189.111.216.202
  189.111.223.25
+189.111.252.97
  189.111.96.65
  189.112.125.131
  189.112.125.209
@@ -70724,11 +72235,11 @@
  189.112.196.1
  189.112.228.153
  189.112.4.168
+189.112.42.197
  189.112.72.29
  189.112.89.17
  189.113.185.0
  189.113.185.116
-189.113.185.13
  189.113.185.134
  189.113.185.14
  189.113.185.142
@@ -70748,9 +72259,9 @@
  189.113.185.218
  189.113.185.235
  189.113.185.26
+189.113.185.28
  189.113.185.29
  189.113.185.3
-189.113.185.31
  189.113.185.36
  189.113.185.52
  189.113.185.54
@@ -70773,10 +72284,8 @@
  189.113.186.243
  189.113.186.46
  189.113.186.60
-189.113.186.70
  189.113.186.72
  189.113.186.77
-189.113.186.81
  189.113.186.95
  189.113.187.108
  189.113.187.11
@@ -70790,33 +72299,29 @@
  189.113.187.197
  189.113.187.198
  189.113.187.199
-189.113.187.205
  189.113.187.212
  189.113.187.213
  189.113.187.217
  189.113.187.228
-189.113.187.255
  189.113.187.29
  189.113.187.3
  189.113.187.51
  189.113.187.65
  189.113.187.97
  189.113.2.23
-189.113.217.23
  189.113.217.35
  189.113.32.117
  189.113.36.166
  189.114.204.100
  189.114.218.22
-189.114.249.60
+189.114.223.96
  189.114.67.195
  189.114.67.217
-189.114.93.191
  189.115.120.155
  189.115.129.6
-189.120.77.252
  189.120.91.67
  189.121.174.91
+189.121.186.147
  189.121.226.181
  189.122.131.45
  189.122.185.116
@@ -70824,6 +72329,7 @@
  189.122.229.17
  189.123.103.233
  189.123.173.24
+189.123.233.104
  189.124.134.58
  189.124.17.106
  189.124.180.40
@@ -70833,6 +72339,7 @@
  189.124.8.180
  189.124.8.192
  189.124.94.171
+189.125.93.48
  189.126.105.66
  189.126.168.43
  189.126.169.179
@@ -70841,6 +72348,7 @@
  189.126.67.230
  189.126.70.202
  189.126.71.203
+189.126.76.43
  189.127.106.16
  189.127.107.43
  189.127.128.226
@@ -70887,15 +72395,17 @@
  189.134.9.73
  189.135.11.218
  189.135.193.169
+189.135.231.246
  189.135.233.171
+189.135.26.187
  189.138.59.0
  189.138.94.172
  189.138.94.69
-189.139.104.34
  189.139.106.62
  189.139.118.156
  189.139.118.189
-189.139.124.22
+189.139.33.248
+189.139.38.200
  189.14.122.4
  189.14.193.242
  189.14.193.94
@@ -70917,12 +72427,14 @@
  189.146.178.65
  189.146.183.121
  189.146.41.176
+189.146.50.22
+189.147.166.41
  189.147.250.120
  189.147.71.95
  189.147.94.196
  189.147.98.40
  189.148.103.223
-189.148.172.247
+189.148.161.145
  189.148.174.186
  189.148.178.169
  189.148.203.129
@@ -70932,11 +72444,12 @@
  189.149.50.143
  189.149.57.19
  189.15.17.127
-189.15.250.85
+189.15.232.140
  189.15.27.166
  189.15.30.106
  189.15.48.53
  189.15.68.3
+189.151.111.20
  189.151.125.244
  189.151.196.196
  189.151.199.34
@@ -70953,8 +72466,10 @@
  189.154.11.102
  189.154.15.35
  189.154.192.26
+189.154.229.5
  189.154.71.146
-189.154.85.179
+189.154.74.46
+189.154.89.87
  189.156.80.110
  189.157.12.243
  189.157.27.209
@@ -70971,19 +72486,17 @@
  189.162.177.43
  189.162.178.188
  189.162.183.5
-189.162.55.210
+189.162.99.17
  189.163.187.189
-189.164.132.49
-189.164.151.9
-189.164.168.11
-189.164.204.62
-189.164.217.104
-189.164.229.37
-189.164.95.80
+189.164.121.180
+189.164.134.75
+189.164.164.212
+189.164.166.172
+189.164.182.184
+189.164.200.187
  189.166.212.235
  189.167.230.200
  189.167.255.244
-189.167.28.250
  189.167.39.203
  189.17.42.19
  189.170.126.209
@@ -70999,7 +72512,6 @@
  189.173.18.229
  189.173.65.60
  189.173.83.56
-189.173.89.89
  189.174.143.230
  189.175.198.143
  189.175.243.200
@@ -71013,13 +72525,16 @@
  189.178.113.25
  189.178.114.46
  189.178.120.194
-189.178.139.36
+189.178.14.25
+189.178.157.245
+189.178.2.232
  189.178.202.196
  189.178.206.211
  189.178.226.122
  189.178.28.103
  189.178.29.227
  189.178.46.164
+189.178.68.136
  189.178.80.188
  189.178.82.69
  189.178.90.135
@@ -71036,15 +72551,13 @@
  189.18.122.139
  189.18.179.196
  189.18.180.111
-189.18.3.28
+189.18.243.210
  189.18.91.218
  189.180.114.184
+189.180.21.3
  189.180.34.244
-189.180.4.202
-189.180.4.224
  189.181.1.155
  189.186.13.31
-189.186.28.63
  189.186.56.26
  189.186.75.147
  189.187.21.84
@@ -71058,6 +72571,8 @@
  189.19.220.75
  189.190.212.21
  189.190.231.191
+189.190.32.92
+189.191.56.155
  189.192.133.225
  189.194.190.56
  189.194.48.26
@@ -71089,12 +72604,14 @@
  189.201.191.69
  189.201.242.186
  189.201.242.24
+189.201.248.254
  189.201.250.173
+189.201.250.87
+189.202.204.230
  189.202.204.88
  189.202.204.94
  189.203.105.93
  189.203.130.134
-189.203.139.37
  189.203.145.131
  189.203.163.199
  189.203.182.73
@@ -71103,7 +72620,7 @@
  189.203.237.120
  189.203.240.2
  189.203.26.46
-189.203.36.31
+189.203.36.215
  189.203.72.138
  189.203.73.102
  189.203.79.116
@@ -71114,6 +72631,7 @@
  189.205.192.140
  189.205.249.204
  189.206.147.226
+189.206.160.153
  189.206.165.62
  189.206.166.12
  189.206.216.18
@@ -71123,7 +72641,9 @@
  189.207.250.88
  189.207.37.10
  189.207.37.70
+189.207.46.15
  189.207.46.32
+189.207.99.209
  189.208.236.232
  189.208.35.232
  189.209.110.202
@@ -71131,14 +72651,13 @@
  189.209.7.168
  189.210.134.170
  189.210.249.225
-189.210.52.157
  189.210.97.111
  189.211.183.151
  189.211.214.94
  189.212.103.237
  189.212.120.114
  189.212.120.18
-189.212.249.122
+189.212.124.120
  189.212.90.217
  189.213.12.127
  189.213.142.176
@@ -71146,13 +72665,11 @@
  189.213.164.253
  189.213.225.226
  189.213.228.237
+189.213.228.57
  189.213.85.3
  189.213.92.76
  189.214.64.34
-189.216.189.170
  189.216.50.36
-189.216.93.61
-189.217.143.94
  189.218.107.128
  189.218.156.138
  189.219.147.141
@@ -71160,12 +72677,12 @@
  189.219.69.229
  189.219.72.148
  189.22.180.250
-189.220.246.19
  189.222.116.68
  189.222.122.83
  189.222.139.231
  189.222.14.145
  189.222.140.255
+189.222.148.6
  189.222.175.66
  189.222.199.66
  189.222.212.23
@@ -71188,11 +72705,13 @@
  189.23.8.180
  189.230.230.250
  189.231.167.128
+189.231.195.84
  189.231.252.136
  189.232.0.63
  189.232.36.143
  189.232.48.230
  189.232.75.111
+189.234.196.146
  189.235.87.72
  189.236.110.195
  189.236.122.23
@@ -71215,6 +72734,7 @@
  189.237.235.233
  189.237.240.89
  189.237.35.160
+189.237.39.57
  189.238.51.165
  189.238.58.155
  189.238.71.100
@@ -71224,20 +72744,20 @@
  189.240.15.66
  189.240.225.205
  189.240.62.227
+189.241.8.100
  189.243.115.185
  189.243.124.51
  189.243.126.116
  189.243.135.254
  189.243.139.30
-189.243.244.127
-189.243.51.211
+189.243.45.197
  189.243.64.103
-189.244.140.222
  189.244.150.177
+189.244.66.223
  189.244.83.156
+189.244.92.175
  189.248.131.101
  189.248.143.235
-189.248.154.4
  189.248.93.110
  189.249.223.10
  189.249.55.3
@@ -71248,6 +72768,8 @@
  189.252.154.166
  189.252.168.107
  189.252.171.66
+189.252.182.32
+189.252.188.107
  189.252.3.162
  189.253.101.247
  189.253.16.65
@@ -71255,11 +72777,13 @@
  189.253.233.203
  189.253.86.161
  189.253.92.225
-189.254.117.97
+189.254.21.6
  189.254.255.180
  189.254.255.3
  189.26.128.138
+189.26.183.80
  189.26.251.122
+189.26.65.15
  189.26.78.155
  189.28.186.26
  189.28.254.206
@@ -71268,24 +72792,26 @@
  189.30.181.98
  189.31.20.254
  189.32.214.28
+189.33.0.254
+189.33.113.166
  189.33.53.14
  189.33.54.19
  189.34.104.177
  189.34.11.58
  189.34.127.45
-189.34.153.113
  189.34.181.88
+189.35.91.154
  189.38.88.105
  189.38.90.83
  189.39.102.67
  189.39.127.118
+189.39.130.205
  189.39.177.11
  189.39.45.87
  189.4.111.100
  189.4.111.57
  189.4.128.122
  189.4.15.190
-189.4.150.236
  189.4.150.58
  189.4.188.165
  189.4.2.58
@@ -71300,7 +72826,9 @@
  189.41.7.213
  189.41.7.233
  189.41.7.53
+189.42.210.84
  189.44.178.170
+189.44.212.165
  189.44.39.226
  189.45.144.26
  189.45.172.100
@@ -71309,6 +72837,7 @@
  189.45.78.104
  189.46.20.237
  189.46.236.164
+189.47.10.23
  189.47.156.120
  189.5.124.232
  189.5.244.181
@@ -71316,7 +72845,7 @@
  189.50.219.192
  189.51.101.126
  189.51.101.145
-189.51.102.42
+189.51.102.240
  189.51.103.125
  189.51.116.5
  189.51.118.22
@@ -71328,18 +72857,10 @@
  189.51.164.77
  189.51.164.78
  189.51.164.81
-189.51.165.0
-189.51.165.26
-189.51.165.4
-189.51.166.105
-189.51.167.181
-189.51.167.251
-189.51.167.99
  189.51.96.151
  189.51.97.126
  189.51.97.35
  189.51.98.182
-189.52.154.213
  189.52.165.134
  189.52.165.84
  189.54.216.47
@@ -71349,6 +72870,7 @@
  189.55.24.72
  189.57.121.10
  189.57.157.50
+189.57.229.5
  189.57.62.34
  189.57.73.18
  189.58.211.14
@@ -71375,7 +72897,7 @@
  189.63.92.173
  189.68.140.227
  189.68.145.6
-189.68.76.202
+189.69.114.90
  189.69.243.113
  189.7.129.60
  189.7.217.152
@@ -71384,6 +72906,7 @@
  189.70.11.159
  189.70.115.128
  189.70.51.167
+189.70.62.189
  189.75.115.204
  189.76.176.186
  189.78.155.203
@@ -71393,12 +72916,15 @@
  189.78.246.83
  189.78.247.136
  189.78.47.239
+189.79.170.194
  189.79.193.173
  189.79.245.241
+189.79.71.194
  189.79.77.161
  189.8.108.50
  189.8.16.174
  189.8.23.170
+189.8.68.19
  189.8.86.38
  189.8.95.30
  189.80.111.66
@@ -71423,10 +72949,12 @@
  189.84.65.144
  189.85.112.69
  189.85.144.75
+189.85.146.85
  189.85.40.2
  189.85.85.10
  189.88.240.103
  189.89.135.78
+189.89.168.130
  189.89.168.131
  189.89.168.132
  189.89.18.86
@@ -71435,33 +72963,33 @@
  189.89.242.122
  189.89.27.17
  189.9.25.66
+189.9.25.67
  189.9.25.69
  189.9.25.89
  189.9.25.91
  189.9.25.92
  189.9.25.94
+189.9.5.252
  189.90.114.1
  189.90.114.37
+189.90.14.101
  189.90.210.107
  189.90.244.46
  189.90.244.82
  189.90.255.173
-189.90.255.242
  189.91.1.206
  189.91.100.50
  189.91.101.54
  189.91.115.6
  189.91.188.174
  189.91.192.195
-189.91.2.198
  189.91.238.124
-189.91.238.21
  189.91.239.194
  189.91.4.220
-189.91.4.245
  189.91.84.25
+189.93.106.4
  189.93.126.161
-189.93.40.34
+189.93.89.70
  189.94.224.220
  189.95.234.34
  189cj.cn
@@ -71494,13 +73022,13 @@
  190.0.159.86
  190.0.242.217
  190.0.246.9
+190.0.26.69
  190.0.53.213
  190.0.61.18
  190.0.8.134
  190.1.111.114
  190.1.203.180
  190.10.136.136
-190.10.140.142
  190.10.140.202
  190.10.146.112
  190.10.158.226
@@ -71510,9 +73038,8 @@
  190.10.177.60
  190.10.179.177
  190.10.8.67
-190.100.170.253
+190.100.164.103
  190.100.71.234
-190.101.156.139
  190.101.168.19
  190.101.183.38
  190.102.147.3
@@ -71528,7 +73055,6 @@
  190.103.28.76
  190.103.29.236
  190.103.31.106
-190.104.150.2
  190.104.17.3
  190.104.209.62
  190.104.213.73
@@ -71547,7 +73073,6 @@
  190.104.64.242
  190.104.68.246
  190.104.69.241
-190.104.69.66
  190.104.73.9
  190.105.184.2
  190.105.213.165
@@ -71563,8 +73088,8 @@
  190.108.226.1
  190.108.228.27
  190.108.228.48
-190.108.28.8
  190.108.67.138
+190.108.84.167
  190.108.9.9
  190.109.160.73
  190.109.164.58
@@ -71580,8 +73105,7 @@
  190.109.196.44
  190.109.223.50
  190.109.224.231
-190.109.43.120
-190.109.43.244
+190.109.228.51
  190.109.64.104
  190.109.64.92
  190.109.72.10
@@ -71594,7 +73118,6 @@
  190.109.75.87
  190.11.15.14
  190.11.158.152
-190.11.168.226
  190.11.198.89
  190.11.21.43
  190.11.31.90
@@ -71607,6 +73130,7 @@
  190.111.211.52
  190.111.231.8
  190.111.245.154
+190.111.246.168
  190.111.246.85
  190.111.25.133
  190.111.251.232
@@ -71622,11 +73146,12 @@
  190.113.123.187
  190.113.133.244
  190.113.134.32
+190.113.140.134
  190.113.153.132
  190.113.156.127
  190.113.162.53
  190.113.215.142
-190.113.215.53
+190.113.215.22
  190.113.224.12
  190.113.236.48
  190.113.237.108
@@ -71635,17 +73160,16 @@
  190.114.152.235
  190.114.168.97
  190.114.253.78
-190.114.255.23
  190.114.70.166
-190.114.71.167
  190.115.10.45
+190.115.174.56
  190.115.18.139
  190.115.218.2
-190.115.254.17
  190.115.30.146
-190.116.41.227
+190.117.108.106
  190.117.126.169
  190.117.127.45
+190.117.186.171
  190.117.206.153
  190.117.214.61
  190.117.250.61
@@ -71654,7 +73178,6 @@
  190.119.171.165
  190.119.199.18
  190.119.217.204
-190.119.218.7
  190.119.242.38
  190.12.102.205
  190.12.119.180
@@ -71673,7 +73196,6 @@
  190.120.225.11
  190.120.23.157
  190.120.248.30
-190.120.253.113
  190.121.114.60
  190.121.136.3
  190.121.142.158
@@ -71684,10 +73206,14 @@
  190.121.231.58
  190.121.5.210
  190.121.6.65
-190.122.112.32
+190.122.112.3
  190.122.112.36
+190.122.112.37
  190.122.112.57
+190.122.128.145
  190.122.3.113
+190.122.3.219
+190.122.3.94
  190.123.23.22
  190.123.31.247
  190.123.35.138
@@ -71714,7 +73240,6 @@
  190.124.191.65
  190.124.247.250
  190.124.250.10
-190.124.30.235
  190.124.34.221
  190.124.60.10
  190.128.118.185
@@ -71723,6 +73248,7 @@
  190.128.142.218
  190.128.148.198
  190.128.154.222
+190.128.171.250
  190.128.186.218
  190.128.226.54
  190.128.231.18
@@ -71746,7 +73272,6 @@
  190.13.176.106
  190.13.178.65
  190.13.182.178
-190.13.32.128
  190.13.82.242
  190.13.84.2
  190.13.84.221
@@ -71755,7 +73280,7 @@
  190.131.205.80
  190.131.206.106
  190.131.208.146
-190.134.20.66
+190.131.222.210
  190.136.178.52
  190.136.183.199
  190.136.95.239
@@ -71768,10 +73293,10 @@
  190.14.231.211
  190.14.39.239
  190.14.42.27
+190.140.113.99
  190.140.194.62
  190.140.53.173
  190.140.9.126
-190.140.92.234
  190.141.1.88
  190.141.133.115
  190.141.238.178
@@ -71788,7 +73313,6 @@
  190.143.117.178
  190.143.212.173
  190.143.39.211
-190.144.104.154
  190.144.135.118
  190.144.139.76
  190.144.14.170
@@ -71820,6 +73344,7 @@
  190.145.200.126
  190.145.224.18
  190.145.233.162
+190.145.24.148
  190.145.254.138
  190.145.255.246
  190.145.33.211
@@ -71844,6 +73369,7 @@
  190.147.158.104
  190.147.158.196
  190.147.16.184
+190.147.162.41
  190.147.165.128
  190.147.165.13
  190.147.19.117
@@ -71871,6 +73397,7 @@
  190.15.226.115
  190.15.42.109
  190.15.46.93
+190.151.105.182
  190.151.123.26
  190.151.143.140
  190.151.170.133
@@ -71886,7 +73413,6 @@
  190.152.180.90
  190.152.181.106
  190.152.181.74
-190.152.182.150
  190.152.183.174
  190.152.19.190
  190.152.19.62
@@ -71897,7 +73423,6 @@
  190.152.37.174
  190.152.39.78
  190.152.44.55
-190.152.5.126
  190.152.5.130
  190.152.5.134
  190.152.5.170
@@ -71919,7 +73444,6 @@
  190.154.111.241
  190.154.128.227
  190.154.14.239
-190.154.151.117
  190.154.153.183
  190.154.156.110
  190.154.156.143
@@ -71940,8 +73464,6 @@
  190.154.99.80
  190.155.106.74
  190.155.115.196
-190.155.132.146
-190.155.132.24
  190.155.132.26
  190.155.132.3
  190.155.140.194
@@ -71962,6 +73484,7 @@
  190.156.227.27
  190.156.229.215
  190.156.231.182
+190.156.231.183
  190.156.231.245
  190.156.238.155
  190.157.138.66
@@ -71969,7 +73492,6 @@
  190.159.72.55
  190.16.155.176
  190.16.159.223
-190.16.183.24
  190.16.37.98
  190.160.53.126
  190.161.67.63
@@ -71982,11 +73504,13 @@
  190.164.35.84
  190.166.177.82
  190.166.188.161
+190.166.23.151
  190.166.90.2
  190.167.1.60
-190.167.139.27
  190.167.215.170
  190.167.220.7
+190.167.34.152
+190.167.5.118
  190.167.87.209
  190.17.4.90
  190.17.44.48
@@ -72003,10 +73527,10 @@
  190.171.236.43
  190.171.240.51
  190.171.241.125
+190.171.90.147
  190.177.6.109
  190.18.10.68
  190.18.145.210
-190.18.184.113
  190.18.207.58
  190.18.216.131
  190.18.63.166
@@ -72018,9 +73542,11 @@
  190.181.4.133
  190.181.4.26
  190.181.60.196
+190.181.60.2
  190.182.208.210
  190.182.23.52
  190.182.232.250
+190.182.84.146
  190.182.88.214
  190.182.88.226
  190.183.129.18
@@ -72033,6 +73559,7 @@
  190.184.169.231
  190.184.201.146
  190.184.201.154
+190.184.203.165
  190.185.118.58
  190.185.119.44
  190.185.150.101
@@ -72049,10 +73576,10 @@
  190.186.194.78
  190.186.198.18
  190.186.198.68
-190.186.238.96
  190.186.240.84
  190.186.243.67
  190.186.250.245
+190.186.42.130
  190.186.42.131
  190.186.50.107
  190.186.50.45
@@ -72062,7 +73589,6 @@
  190.186.89.150
  190.186.9.227
  190.187.112.66
-190.187.253.29
  190.187.58.50
  190.187.6.153
  190.188.124.118
@@ -72077,7 +73603,6 @@
  190.19.142.144
  190.19.27.186
  190.19.5.32
-190.190.127.109
  190.190.194.194
  190.190.219.184
  190.190.41.87
@@ -72087,6 +73612,7 @@
  190.191.171.72
  190.192.136.110
  190.192.39.136
+190.192.40.18
  190.192.84.18
  190.193.107.202
  190.193.8.28
@@ -72096,7 +73622,6 @@
  190.194.161.157
  190.195.129.227
  190.195.148.163
-190.195.170.83
  190.195.189.232
  190.195.235.56
  190.195.static.wline.lns.sme.cust.swisscom-ipv6.ch
@@ -72105,6 +73630,7 @@
  190.196.23.170
  190.196.44.245
  190.196.60.122
+190.196.64.93
  190.196.66.74
  190.196.66.76
  190.196.66.78
@@ -72114,12 +73640,13 @@
  190.198.137.118
  190.198.189.86
  190.198.207.209
+190.198.217.58
  190.198.81.192
-190.199.136.89
  190.199.175.76
  190.199.82.38
  190.2.109.108
  190.2.113.178
+190.2.113.228
  190.2.117.140
  190.2.130.195
  190.2.130.44
@@ -72135,7 +73662,6 @@
  190.2.209.46
  190.2.21.153
  190.2.210.106
-190.2.213.129
  190.2.31.172
  190.2.55.250
  190.20.97.244
@@ -72156,30 +73682,35 @@
  190.202.32.2
  190.202.8.140
  190.202.89.198
-190.202.89.202
  190.203.146.97
  190.203.219.47
  190.203.22.108
  190.203.227.156
+190.203.39.20
  190.204.155.52
  190.205.122.242
  190.205.156.139
+190.205.179.11
  190.205.185.95
  190.205.3.224
  190.205.35.106
  190.206.113.156
  190.206.61.61
+190.206.79.238
  190.207.100.201
  190.207.113.135
  190.207.79.153
+190.207.98.18
  190.208.17.136
  190.208.22.227
  190.208.59.53
+190.21.36.214
+190.21.47.185
+190.210.104.157
  190.210.142.45
  190.210.15.194
  190.210.151.152
  190.210.161.210
-190.210.164.141
  190.210.166.140
  190.210.182.179
  190.210.184.138
@@ -72187,6 +73718,7 @@
  190.210.236.139
  190.210.238.77
  190.210.47.73
+190.210.60.4
  190.210.72.84
  190.210.8.69
  190.210.93.41
@@ -72201,11 +73733,9 @@
  190.213.107.226
  190.213.125.112
  190.213.153.68
-190.213.177.39
  190.213.209.112
  190.213.245.69
  190.213.29.118
-190.213.4.130
  190.213.49.207
  190.213.71.109
  190.213.84.115
@@ -72213,7 +73743,7 @@
  190.214.13.2
  190.214.13.90
  190.214.18.70
-190.214.20.10
+190.214.27.106
  190.214.27.26
  190.214.27.46
  190.214.30.146
@@ -72232,12 +73762,15 @@
  190.215.220.34
  190.215.220.36
  190.215.88.61
+190.216.102.67
  190.216.166.200
+190.216.175.157
  190.216.175.158
  190.216.2.136
  190.216.224.54
  190.216.229.86
  190.216.244.132
+190.216.250.11
  190.216.254.85
  190.217.1.101
  190.217.1.121
@@ -72251,6 +73784,7 @@
  190.217.1.9
  190.217.116.207
  190.217.13.217
+190.217.13.220
  190.217.171.176
  190.217.223.104
  190.217.241.105
@@ -72269,9 +73803,11 @@
  190.219.172.72
  190.219.175.242
  190.219.176.79
+190.219.179.200
  190.219.19.146
  190.219.240.124
  190.219.29.4
+190.219.33.109
  190.219.6.150
  190.219.85.93
  190.220.17.34
@@ -72279,6 +73815,7 @@
  190.221.46.78
  190.223.24.241
  190.223.26.38
+190.223.41.18
  190.224.232.158
  190.224.232.31
  190.224.243.1
@@ -72287,6 +73824,7 @@
  190.226.46.114
  190.226.46.115
  190.226.46.116
+190.228.147.172
  190.228.171.126
  190.228.171.6
  190.228.29.70
@@ -72300,10 +73838,8 @@
  190.234.135.153
  190.235.86.137
  190.236.225.222
+190.236.26.85
  190.236.58.65
-190.236.82.21
-190.237.140.165
-190.237.143.25
  190.238.35.27
  190.239.1.225
  190.24.116.28
@@ -72317,6 +73853,8 @@
  190.24.57.179
  190.24.58.60
  190.24.59.199
+190.24.59.247
+190.24.6.162
  190.242.119.220
  190.242.126.114
  190.242.41.133
@@ -72334,6 +73872,7 @@
  190.245.187.164
  190.245.22.47
  190.246.120.123
+190.246.155.29
  190.246.33.57
  190.246.38.4
  190.246.60.98
@@ -72368,6 +73907,7 @@
  190.253.59.162
  190.254.122.125
  190.254.58.196
+190.255.222.2
  190.255.4.26
  190.255.49.83
  190.26.153.134
@@ -72396,12 +73936,10 @@
  190.28.153.171
  190.28.88.92
  190.29.110.135
-190.29.112.209
  190.29.166.0
  190.29.26.190
  190.29.96.187
  190.3.117.18
-190.3.190.177
  190.3.194.209
  190.3.23.35
  190.30.180.83
@@ -72421,6 +73959,7 @@
  190.4.0.246
  190.4.187.228
  190.4.202.123
+190.4.202.14
  190.4.204.163
  190.4.205.226
  190.4.31.25
@@ -72430,13 +73969,12 @@
  190.41.94.93
  190.41.94.94
  190.43.172.141
-190.43.38.64
  190.44.137.65
  190.44.188.179
+190.44.66.190
  190.45.149.98
  190.45.24.210
  190.45.48.92
-190.45.79.80
  190.46.140.125
  190.46.198.151
  190.47.117.248
@@ -72447,8 +73985,10 @@
  190.5.122.174
  190.5.162.204
  190.5.216.131
+190.5.228.74
  190.5.242.114
  190.5.243.179
+190.5.70.102
  190.5.85.242
  190.52.131.234
  190.52.160.6
@@ -72471,7 +74011,6 @@
  190.53.46.14
  190.53.46.2
  190.53.46.50
-190.53.91.32
  190.54.22.66
  190.54.22.67
  190.54.97.154
@@ -72487,7 +74026,7 @@
  190.56.142.198
  190.56.244.94
  190.56.255.118
-190.57.143.66
+190.56.70.131
  190.57.150.110
  190.57.173.122
  190.57.176.22
@@ -72495,7 +74034,6 @@
  190.57.20.115bin.sh
  190.57.236.124
  190.57.30.139
-190.57.30.141
  190.58.130.230
  190.58.4.185
  190.6.111.251
@@ -72511,7 +74049,6 @@
  190.63.191.83
  190.63.7.166
  190.64.131.130
-190.64.135.122
  190.64.137.172
  190.64.137.173
  190.64.141.18
@@ -72524,10 +74061,9 @@
  190.64.88.186
  190.64.90.154
  190.64.90.50
-190.65.220.94
  190.66.10.152
+190.66.24.45
  190.69.27.137
-190.7.0.249
  190.7.141.66
  190.7.141.90
  190.7.155.43
@@ -72547,17 +74083,18 @@
  190.72.121.69
  190.73.17.171
  190.73.251.44
+190.73.27.95
  190.73.32.35
  190.74.116.116
+190.74.162.179
  190.75.24.89
  190.75.243.77
+190.77.134.255
  190.77.135.36
-190.77.21.148
  190.77.36.150
  190.77.5.174
  190.79.113.224
  190.79.131.206
-190.79.173.121
  190.79.191.63
  190.79.198.148
  190.79.65.174
@@ -72568,10 +74105,11 @@
  190.8.169.206
  190.8.46.139
  190.8.82.58
+190.80.159.182
  190.80.243.251
  190.80.61.113
  190.80.96.244
-190.81.115.218
+190.82.101.10
  190.82.111.22
  190.82.65.101
  190.82.74.165
@@ -72580,6 +74118,7 @@
  190.83.129.32
  190.83.139.29
  190.83.180.220
+190.83.248.160
  190.83.255.23
  190.83.84.208
  190.84.225.4
@@ -72591,6 +74130,7 @@
  190.85.115.84
  190.85.12.42
  190.85.124.245
+190.85.128.218
  190.85.129.117
  190.85.129.118
  190.85.130.174
@@ -72603,6 +74143,7 @@
  190.85.186.254
  190.85.197.67
  190.85.213.51
+190.85.23.118
  190.85.235.84
  190.85.28.154
  190.85.34.142
@@ -72611,16 +74152,12 @@
  190.85.67.171
  190.85.96.74
  190.86.203.60
+190.86.31.80
  190.88.186.86
-190.88.225.84
-190.88.228.185
-190.88.228.216
-190.88.229.222
-190.88.231.11
-190.88.236.238
-190.88.238.51
-190.88.238.68
-190.88.243.104
+190.88.226.34
+190.88.229.126
+190.88.239.73
+190.88.254.252
  190.89.166.123
  190.89.166.24
  190.89.236.145
@@ -72655,6 +74192,7 @@
  190.89.28.50
  190.89.28.52
  190.89.28.56
+190.89.28.58
  190.89.28.6
  190.89.28.61
  190.89.28.62
@@ -72662,6 +74200,7 @@
  190.89.29.10
  190.89.29.102
  190.9.128.96
+190.9.132.186
  190.9.169.22
  190.9.249.221
  190.90.156.90
@@ -72676,9 +74215,7 @@
  190.92.81.42
  190.92.87.77
  190.93.176.70
-190.93.181.165
  190.93.208.190
-190.93.208.82
  190.94.144.157
  190.94.148.130
  190.94.166.113
@@ -72706,13 +74243,15 @@
  190.97.219.241
  190.97.219.4
  190.97.240.82
-190.97.246.2
  190.97.30.167
  190.97.35.149
+190.98.104.203
  190.98.228.54
+190.98.231.87
  190.98.36.178
  190.98.37.135
  190.98.44.61
+190.99.231.117
  190.99.76.98
  190.99.92.206
  190.99.93.138
@@ -72729,18 +74268,19 @@
  191.100.28.217
  191.101.109.187
  191.101.109.195
+191.101.110.195
  191.101.110.211
  191.101.110.225
  191.101.110.227
+191.101.110.228
  191.101.110.236
  191.101.110.248
-191.101.114.156
  191.101.118.54
-191.101.165.228
  191.101.166.80
  191.101.166.81
  191.101.171.70
  191.101.180.74
+191.101.207.128
  191.101.230.216
  191.101.243.42
  191.101.250.166
@@ -72756,9 +74296,8 @@
  191.101.39.208
  191.101.39.8
  191.101.44.141
+191.101.82.183
  191.101.87.146
-191.101.92.118
-191.101.96.127
  191.101.99.10
  191.101.99.11
  191.101.99.154
@@ -72766,6 +74305,7 @@
  191.102.113.107
  191.102.120.50
  191.102.120.63
+191.102.122.227
  191.102.148.105
  191.102.148.107
  191.102.148.117
@@ -72781,7 +74321,8 @@
  191.102.151.112
  191.102.151.160
  191.102.151.197
-191.102.151.217
+191.102.151.21
+191.102.151.210
  191.102.151.225
  191.102.151.248
  191.102.151.249
@@ -72791,6 +74332,7 @@
  191.102.151.46
  191.102.151.51
  191.102.151.76
+191.102.151.79
  191.102.151.8
  191.102.153.104
  191.102.153.142
@@ -72802,28 +74344,23 @@
  191.102.153.40
  191.102.153.48
  191.102.153.65
-191.102.153.71
  191.102.153.80
  191.102.154.158
  191.102.154.226
  191.102.154.35
  191.102.154.76
  191.102.156.105
+191.102.156.11
  191.102.156.143
-191.102.156.157
+191.102.156.155
  191.102.156.159
  191.102.156.165
-191.102.156.166
+191.102.156.174
  191.102.156.186
  191.102.156.232
  191.102.156.247
-191.102.156.250
-191.102.156.37
-191.102.156.49
-191.102.156.51
-191.102.156.76
+191.102.156.7
  191.102.156.80
-191.102.164.104
  191.102.164.109
  191.102.164.118
  191.102.164.203
@@ -72834,12 +74371,12 @@
  191.102.166.227
  191.102.166.38
  191.102.166.8
-191.102.167.110
  191.102.189.206
  191.102.197.47
  191.102.232.130
  191.102.35.238
-191.102.83.167
+191.102.65.132
+191.102.72.178
  191.102.86.91
  191.102.88.218
  191.102.95.171
@@ -72851,35 +74388,35 @@
  191.114.228.97
  191.115.59.255
  191.13.137.128
+191.13.168.77
  191.13.202.104
  191.13.231.218
  191.13.24.150
  191.14.6.243
-191.143.197.159
  191.162.130.247
  191.162.135.196
  191.162.194.17
+191.162.205.126
  191.162.208.178
  191.17.150.10
  191.17.65.36
+191.177.186.56
  191.177.92.204
-191.177.94.103
  191.177.94.158
  191.178.36.239
  191.178.64.109
  191.178.84.239
  191.180.224.239
-191.182.208.108
  191.182.6.118
+191.183.114.59
  191.183.21.190
-191.183.213.144
  191.184.184.219
  191.185.42.248
  191.186.233.32
  191.186.28.191
-191.188.70.30
  191.189.30.144
  191.189.74.161
+191.19.108.96
  191.19.182.105
  191.19.229.119
  191.19.42.115
@@ -72890,7 +74427,6 @@
  191.193.70.142
  191.195.172.38
  191.195.188.48
-191.20.157.206
  191.202.213.196
  191.208.29.228
  191.209.114.65
@@ -72898,24 +74434,24 @@
  191.209.21.188
  191.209.21.39
  191.209.21.52
-191.209.219.189
-191.211.52.206
  191.215.87.129
  191.217.170.33
+191.217.84.226
  191.220.231.200
  191.221.111.245
  191.222.154.83
  191.222.161.80
-191.223.63.106
  191.223.66.127
  191.232.136.43
  191.232.136.87
  191.232.160.245
  191.232.169.208
+191.232.172.31
  191.232.172.50
  191.232.174.130
  191.232.176.226
  191.232.193.231
+191.232.195.8
  191.232.197.189
  191.232.198.49
  191.232.211.168
@@ -72927,23 +74463,30 @@
  191.232.238.25
  191.232.242.195
  191.232.243.132
+191.232.244.119
  191.232.244.135
+191.232.245.241
  191.232.247.35
  191.232.247.86
  191.232.251.219
  191.232.252.88
  191.232.255.95
  191.232.48.102
+191.232.50.137
  191.232.51.79
  191.233.192.104
  191.233.192.40
+191.233.193.102
  191.233.193.6
+191.233.195.188
+191.233.195.250
  191.233.198.107
  191.233.199.123
  191.233.232.133
  191.233.232.175
  191.233.232.243
  191.233.254.251
+191.234.160.112
  191.234.162.205
  191.234.163.70
  191.234.168.151
@@ -72952,14 +74495,16 @@
  191.234.175.191
  191.234.175.56
  191.234.179.79
+191.234.180.43
  191.234.187.194
  191.234.188.83
  191.234.189.215
  191.235.100.197
+191.235.100.66
  191.235.103.114
  191.235.103.154
+191.235.104.167
  191.235.104.32
-191.235.110.78
  191.235.111.159
  191.235.112.72
  191.235.64.156
@@ -72968,41 +74513,44 @@
  191.235.70.69
  191.235.71.181
  191.235.72.144
+191.235.79.171
+191.235.80.118
  191.235.83.177
  191.235.83.242
  191.235.84.120
+191.235.84.162
  191.235.89.181
  191.235.89.204
  191.235.91.109
-191.235.92.73
  191.235.93.150
  191.235.98.36
+191.235.99.194
  191.236.119.223
+191.237.251.241
  191.237.253.183
  191.237.42.132
  191.238.208.198
  191.238.213.86
  191.238.215.5
+191.238.220.140
  191.239.118.89
  191.239.240.25
  191.239.246.25
  191.239.247.246
+191.239.247.63
  191.239.249.144
  191.239.249.178
  191.239.251.246
  191.239.255.175
-191.240.113.219
+191.240.118.172
  191.240.152.129
  191.240.152.132
  191.240.152.134
  191.240.157.186
-191.240.221.43
  191.240.228.41
  191.240.28.25
+191.240.63.204
  191.240.99.142
-191.241.160.167
-191.241.160.231
-191.241.160.98
  191.241.164.15
  191.241.174.233
  191.241.2.195
@@ -73025,10 +74573,12 @@
  191.242.177.118
  191.242.182.132
  191.242.210.140
+191.242.217.110
  191.242.232.10
  191.242.232.33
  191.243.11.117
  191.243.11.96
+191.243.216.1
  191.243.221.6
  191.243.227.164
  191.243.232.245
@@ -73038,24 +74588,25 @@
  191.243.54.245
  191.243.72.2
  191.243.72.34
-191.243.75.45
  191.243.8.173
  191.243.93.95
+191.245.100.25
  191.246.117.239
  191.246.252.60
  191.246.71.163
  191.248.113.22
+191.248.206.225
  191.248.208.145
  191.249.193.179
  191.249.217.73
  191.249.217.79
-191.249.98.162
  191.250.136.157
  191.250.140.114
  191.250.240.155
  191.251.158.220
  191.252.113.123
  191.252.153.191
+191.252.179.143
  191.252.195.130
  191.252.205.120
  191.252.5.99
@@ -73068,30 +74619,30 @@
  191.253.207.5
  191.253.4.10
  191.253.47.44
+191.253.8.202
  191.253.80.114
  191.253.89.73
  191.254.18.161
+191.254.197.71
  191.254.32.83
+191.254.71.1
  191.255.210.82
  191.255.221.168
-191.255.228.105
  191.255.232.53
  191.255.250.51
  191.255.49.104
+191.28.33.155
  191.30.117.220
  191.30.134.179
  191.30.235.31
  191.30.44.83
-191.31.1.116
  191.31.104.17
  191.31.132.29
-191.31.174.212
  191.31.31.224
  191.31.92.51
  191.32.190.45
  191.32.88.139
  191.33.144.162
-191.33.160.36
  191.33.228.162
  191.33.24.94
  191.33.7.67
@@ -73109,79 +74660,87 @@
  191.37.203.174
  191.37.220.93
  191.37.227.133
-191.37.24.110
  191.37.37.238
  191.37.79.238
  191.40.94.91
  191.43.12.85
  191.43.35.67
  191.47.93.174
+191.5.100.109
+191.5.100.127
+191.5.100.158
  191.5.100.200
  191.5.100.206
+191.5.100.211
  191.5.100.22
-191.5.100.228
+191.5.100.235
+191.5.100.251
+191.5.100.254
  191.5.100.91
  191.5.100.96
-191.5.101.102
  191.5.101.114
-191.5.101.126
+191.5.101.131
  191.5.101.133
-191.5.101.28
-191.5.101.71
-191.5.101.79
-191.5.102.18
+191.5.101.4
+191.5.101.97
+191.5.102.135
  191.5.102.3
+191.5.102.36
+191.5.102.47
  191.5.102.59
  191.5.102.68
+191.5.102.82
  191.5.102.92
+191.5.102.94
+191.5.103.30
  191.5.103.32
-191.5.103.51
  191.5.46.31
  191.5.55.7
-191.5.97.163
-191.5.97.179
+191.5.97.18
  191.5.97.182
-191.5.97.184
+191.5.97.199
+191.5.97.221
+191.5.97.229
  191.5.97.232
  191.5.97.54
+191.5.97.64
+191.5.97.87
  191.5.99.11
  191.5.99.114
  191.5.99.118
-191.5.99.122
-191.5.99.15
  191.5.99.176
-191.5.99.177
  191.5.99.190
-191.5.99.211
-191.5.99.224
-191.5.99.24
-191.5.99.4
+191.5.99.215
+191.5.99.248
  191.5.99.62
  191.53.105.93
  191.53.112.170
-191.53.168.225
+191.53.193.130
  191.53.193.132
  191.53.193.191
  191.53.194.226
-191.53.223.127
-191.53.236.148
+191.53.194.27
+191.53.195.142
+191.53.196.233
+191.53.220.163
+191.53.221.81
+191.53.249.49
  191.53.251.139
  191.53.50.32
  191.53.52.0
  191.53.52.55
-191.54.104.2
  191.54.117.159
  191.54.131.239
  191.54.132.127
+191.54.16.64
  191.54.209.189
  191.54.211.205
  191.54.212.184
  191.54.214.228
-191.54.4.49
+191.54.30.105
+191.54.58.34
  191.54.62.184
-191.54.81.163
  191.55.13.202
-191.55.14.99
  191.55.178.130
  191.55.77.136
  191.6.132.104
@@ -73202,7 +74761,7 @@
  191.6.143.184
  191.6.92.81
  191.6.94.2
-191.7.116.10
+191.7.145.246
  191.7.192.10
  191.7.192.149
  191.7.192.5
@@ -73225,6 +74784,7 @@
  191.8.187.245
  191.8.83.229
  191.88.143.17
+191.92.124.82
  191.96.149.36
  191.96.164.95
  191.96.170.107
@@ -73236,15 +74796,13 @@
  191.96.249.3
  191.96.249.4
  191.96.25.226
-191.96.251.159
  191.96.63.167
-191.97.12.212
  191.97.3.195
  191.97.35.189
  191.97.53.43
  191.97.7.165
  191.98.144.217
-191.98.155.181
+191.98.161.236
  191.98.168.125
  191.98.181.218
  191.98.184.122
@@ -73266,13 +74824,12 @@
  191gm.com
  192-168-1-45.000webhostapp.com
  192.0.102.194
-192.0.103.4
-192.0.119.68
  192.0.197.123
  192.0.240.80
  192.0.82.48
-192.0.91.201
  192.100.213.83
+192.101.136.182
+192.101.136.76
  192.109.110.194
  192.109.110.217
  192.109.165.177
@@ -73311,10 +74868,8 @@
  192.119.64.163
  192.119.65.59
  192.119.66.66
-192.119.67.174
  192.119.67.207
  192.119.67.234
-192.119.67.246
  192.119.67.250
  192.119.68.113
  192.119.68.121
@@ -73337,18 +74892,12 @@
  192.12.112.102
  192.12.112.66
  192.12.112.68
-192.12.112.9
  192.12.114.184
-192.121.102.21
-192.121.102.24
-192.121.102.79
-192.121.102.85
  192.121.252.153
  192.124.170.12
  192.124.170.145
  192.124.170.162
  192.124.170.240
-192.124.170.40
  192.126.156.1
  192.126.156.108
  192.126.156.42
@@ -73368,9 +74917,9 @@
  192.129.245.69
  192.138.210.125
  192.138.210.23
+192.140.145.127
  192.140.224.230
  192.140.230.43
-192.140.38.14
  192.140.42.28
  192.140.42.81
  192.140.42.83
@@ -73380,12 +74929,10 @@
  192.141.11.17
  192.141.12.223
  192.141.12.70
+192.141.168.192
  192.141.208.1
  192.141.233.65
-192.141.247.96
-192.141.28.232
  192.141.84.67
-192.142.186.96
  192.144.104.1
  192.144.104.33
  192.144.118.110
@@ -73398,13 +74945,15 @@
  192.144.143.101
  192.144.148.220
  192.144.154.209
-192.144.156.250
+192.144.155.110
  192.144.156.68
  192.144.157.134
  192.144.157.33
  192.144.160.53
  192.144.171.165
  192.144.172.241
+192.144.176.136
+192.144.181.85
  192.144.185.74
  192.144.186.22
  192.144.188.237
@@ -73438,15 +74987,18 @@
  192.144.235.147
  192.144.235.195
  192.144.237.219
+192.144.253.167
  192.144.253.70
  192.144.254.245
  192.144.31.201
  192.144.31.91
  192.144.65.46
+192.145.124.230
  192.145.124.238
  192.145.127.42
  192.145.205.74
  192.145.232.221
+192.145.232.40
  192.145.239.17
  192.145.239.209
  192.145.239.210
@@ -73464,16 +75016,21 @@
  192.151.155.242
  192.151.158.26
  192.151.219.123
-192.151.247.226
+192.153.51.18
+192.153.51.236
  192.154.105.21
  192.154.145.138
  192.154.149.220
+192.154.150.38
  192.154.227.193
  192.154.228.190
+192.154.46.71
+192.154.47.140
  192.155.89.38
  192.155.89.94
  192.155.93.237
  192.155.94.15
+192.156.110.196
  192.157.201.202
  192.157.202.178
  192.157.233.175
@@ -73488,7 +75045,9 @@
  192.160.102.169
  192.160.102.170
  192.161.172.215
+192.161.179.93
  192.161.190.122
+192.161.190.124
  192.161.190.171
  192.161.190.78
  192.161.227.156
@@ -73500,15 +75059,18 @@
  192.162.143.109
  192.162.150.241
  192.162.167.200
+192.162.177.203
+192.162.192.148
  192.162.193.243
  192.162.238.77
  192.162.27.108
  192.162.27.155
  192.162.48.97
+192.162.51.110
  192.162.62.197
  192.162.81.246
  192.162.96.79
-192.162.98.131
+192.162.98.222
  192.163.192.224
  192.163.199.254
  192.163.199.39
@@ -73522,8 +75084,6 @@
  192.166.134.173
  192.166.134.179
  192.166.223.155
-192.166.230.104
-192.166.230.67
  192.166.245.138
  192.166.245.176
  192.166.47.32
@@ -73542,21 +75102,10 @@
  192.169.7.152
  192.169.7.80
  192.169.87.22
+192.171.110.5
  192.171.62.227
-192.171.82.8
-192.171.91.135
+192.171.62.230
  192.175.111.212
-192.175.111.228
-192.175.111.229
-192.175.111.231
-192.175.111.233
-192.175.111.240
-192.175.111.241
-192.175.111.242
-192.175.111.243
-192.175.111.252
-192.175.14.170
-192.175.14.98
  192.176.223.112
  192.181.53.255
  192.181.88.225
@@ -73569,24 +75118,32 @@
  192.186.134.92
  192.186.145.62
  192.186.150.194
+192.186.153.188
  192.186.153.226
+192.186.153.232
  192.186.153.234
  192.186.153.235
  192.186.157.77
+192.186.161.141
  192.186.161.194
+192.186.161.226
  192.186.164.95
+192.186.169.63
  192.186.169.75
  192.186.171.133
  192.186.171.156
  192.186.171.237
+192.186.174.107
  192.186.174.60
  192.186.177.16
  192.186.180.146
  192.186.181.158
  192.186.181.233
-192.186.182.1
  192.186.182.121
  192.186.182.43
+192.186.182.6
+192.186.182.62
+192.186.182.68
  192.187.110.198
  192.187.121.46
  192.187.123.242
@@ -73604,18 +75161,14 @@
  192.198.114.140
  192.198.114.184
  192.198.115.206
-192.198.115.207
  192.198.119.28
  192.198.119.41
  192.198.124.172
-192.198.125.221
-192.198.125.223
-192.198.125.49
+192.198.125.53
  192.198.125.59
  192.198.127.19
-192.198.127.27
-192.198.127.28
  192.198.127.30
+192.198.205.242
  192.198.80.186
  192.198.80.62
  192.198.82.51
@@ -73625,19 +75178,17 @@
  192.198.91.138
  192.198.91.198
  192.198.93.7
-192.199.247.105
  192.199.247.106
  192.199.53.131
  192.200.122.226
  192.200.158.101
+192.200.158.105
  192.200.158.109
  192.200.158.113
  192.200.158.125
  192.200.158.186
-192.200.158.244
  192.200.192.2
  192.200.207.100
-192.200.211.206
  192.200.211.221
  192.200.215.162
  192.200.215.90
@@ -73646,20 +75197,24 @@
  192.207.61.178
  192.210.132.110
  192.210.140.199
-192.210.144.105
  192.210.146.104
+192.210.167.173
  192.210.168.241
  192.210.170.109
  192.210.170.111
  192.210.172.2
+192.210.172.90
  192.210.174.31
  192.210.180.103
  192.210.180.134
  192.210.181.24
  192.210.181.30
  192.210.181.32
+192.210.185.118
  192.210.185.120
  192.210.185.125
+192.210.185.197
+192.210.185.216
  192.210.185.98
  192.210.186.195
  192.210.187.42
@@ -73668,6 +75223,7 @@
  192.210.191.131
  192.210.195.23
  192.210.198.34
+192.210.200.216
  192.210.201.108
  192.210.214.146
  192.210.214.51
@@ -73681,7 +75237,6 @@
  192.210.228.39
  192.210.230.137
  192.210.231.101
-192.210.231.210
  192.210.236.212
  192.210.236.218
  192.210.236.38
@@ -73704,39 +75259,38 @@
  192.227.131.159
  192.227.133.221
  192.227.137.232
+192.227.137.239
  192.227.138.112
+192.227.138.114
  192.227.138.116
  192.227.138.119
-192.227.138.124
  192.227.138.125
  192.227.138.126
  192.227.138.175
  192.227.152.136
  192.227.158.103
-192.227.158.237
  192.227.158.50
  192.227.159.102
  192.227.161.110
+192.227.171.46
  192.227.171.60
  192.227.172.139
  192.227.172.251
  192.227.176.61
  192.227.179.28
  192.227.180.108
-192.227.180.111
  192.227.180.119
  192.227.180.47
+192.227.180.94
  192.227.180.98
  192.227.206.125
-192.227.209.203
  192.227.209.21
-192.227.209.227
  192.227.209.33
  192.227.211.215
  192.227.214.146
  192.227.215.147
  192.227.217.122
-192.227.219.210
+192.227.231.159
  192.227.233.8
  192.227.237.40
  192.227.239.81
@@ -73750,7 +75304,6 @@
  192.228.100.200
  192.228.100.222
  192.228.100.250
-192.228.100.98
  192.228.107.187
  192.229.22.18
  192.232.205.102
@@ -73787,16 +75340,16 @@
  192.236.194.48
  192.236.195.248
  192.236.198.174
-192.236.208.139
  192.236.208.241
  192.236.232.172
  192.24.158.46
  192.240.150.133
+192.241.106.65
  192.241.106.74
  192.241.111.3
-192.241.113.206
  192.241.12.185
  192.241.130.116
+192.241.130.53
  192.241.130.65
  192.241.131.150
  192.241.132.169
@@ -73974,6 +75527,7 @@
  192.241.216.242
  192.241.216.26
  192.241.216.32
+192.241.216.57
  192.241.216.68
  192.241.217.10
  192.241.217.104
@@ -74014,7 +75568,6 @@
  192.241.218.84
  192.241.218.89
  192.241.218.91
-192.241.218.92
  192.241.219.117
  192.241.219.133
  192.241.219.165
@@ -74090,6 +75643,7 @@
  192.241.227.240
  192.241.227.59
  192.241.228.138
+192.241.228.251
  192.241.229.140
  192.241.229.204
  192.241.229.228
@@ -74548,7 +76102,6 @@
  192.241.239.9
  192.241.239.92
  192.241.239.94
-192.241.240.135
  192.241.241.222
  192.241.244.232
  192.241.246.167
@@ -74560,24 +76113,23 @@
  192.241.255.77
  192.241.64.114
  192.241.64.245
-192.241.64.252
  192.241.64.3
-192.241.64.89
  192.241.64.92
  192.241.65.35
  192.241.70.54
  192.241.73.198
  192.241.76.61
  192.241.77.173
+192.241.80.147
  192.241.80.158
  192.241.80.161
-192.241.80.235
-192.241.80.239
-192.241.80.248
+192.241.80.247
+192.241.80.252
  192.241.92.6
  192.243.100.114
  192.243.102.171
  192.243.114.21
+192.243.116.235
  192.243.119.81
  192.243.215.234
  192.243.55.129
@@ -74593,7 +76145,8 @@
  192.248.144.91
  192.248.146.74
  192.248.168.159
-192.248.182.124
+192.248.177.197
+192.248.43.153
  192.249.47.172
  192.249.53.158
  192.249.53.67
@@ -74870,10 +76423,8 @@
  192.252.214.17
  192.252.214.20
  192.252.215.3
-192.252.215.5
  192.253.243.25
  192.253.245.222
-192.254.111.142
  192.254.173.31
  192.254.193.145
  192.254.210.74
@@ -74910,16 +76461,18 @@
  192.3.147.201
  192.3.147.223
  192.3.147.233
+192.3.154.24
  192.3.161.156
  192.3.162.2
  192.3.165.228
  192.3.166.83
  192.3.170.110
  192.3.172.173
-192.3.176.43
  192.3.178.14
  192.3.178.76
  192.3.178.85
+192.3.180.214
+192.3.180.228
  192.3.180.232
  192.3.180.233
  192.3.182.215
@@ -74937,23 +76490,19 @@
  192.3.195.121
  192.3.199.135
  192.3.2.92
-192.3.203.140
-192.3.203.155
-192.3.203.158
-192.3.203.168
-192.3.203.177
+192.3.203.182
  192.3.203.188
  192.3.203.39
-192.3.203.55
-192.3.205.181
  192.3.207.121
  192.3.207.170
+192.3.208.116
  192.3.208.121
-192.3.208.124
  192.3.208.126
+192.3.208.36
+192.3.208.92
+192.3.208.98
  192.3.209.168
  192.3.213.17
-192.3.214.13
  192.3.214.29
  192.3.214.8
  192.3.224.229
@@ -74973,6 +76522,7 @@
  192.3.255.169
  192.3.27.185
  192.3.28.114
+192.3.28.233
  192.3.31.212
  192.3.31.213
  192.3.31.219
@@ -74989,11 +76539,12 @@
  192.3.73.162
  192.3.8.178
  192.3.80.156
+192.3.9.201
  192.3.91.66
  192.3.92.10
  192.3.93.195
  192.3.93.56
-192.30.89.27
+192.30.89.59
  192.34.56.82
  192.34.57.210
  192.34.57.220
@@ -75186,7 +76737,6 @@
  192.35.169.17
  192.35.169.18
  192.35.169.19
-192.35.169.20
  192.35.169.22
  192.35.169.23
  192.35.169.24
@@ -75248,6 +76798,7 @@
  192.35.222.90
  192.36.155.56
  192.36.27.4
+192.40.57.233
  192.40.95.28
  192.40.95.31
  192.40.95.32
@@ -75297,6 +76848,7 @@
  192.65.170.15
  192.65.170.50
  192.69.235.189
+192.71.166.25
  192.72.190.56
  192.73.242.140
  192.74.235.226
@@ -75304,6 +76856,7 @@
  192.80.96.50
  192.81.129.60
  192.81.129.82
+192.81.130.132
  192.81.135.190
  192.81.135.30
  192.81.209.167
@@ -75313,6 +76866,7 @@
  192.81.211.71
  192.81.212.110
  192.81.212.16
+192.81.212.163
  192.81.212.234
  192.81.213.42
  192.81.214.141
@@ -75328,7 +76882,6 @@
  192.81.223.236
  192.81.38.31
  192.87.172.121
-192.92.97.67
  192.95.12.175
  192.95.16.165
  192.95.18.190
@@ -75346,6 +76899,7 @@
  192.95.37.160
  192.95.49.93
  192.95.52.242
+192.95.53.14
  192.95.55.146
  192.95.6.110
  192.96.159.234
@@ -75417,12 +76971,12 @@
  192.99.31.119
  192.99.31.122
  192.99.32.109
-192.99.34.107
  192.99.34.142
  192.99.35.135
  192.99.35.149
  192.99.36.177
  192.99.39.157
+192.99.4.179
  192.99.4.59
  192.99.4.63
  192.99.41.83
@@ -75435,9 +76989,9 @@
  192.99.7.106
  192.99.7.71
  192.99.70.54
-192.99.8.102
  192.99.8.157
  192.99.8.58
+192.99.81.252
  192.99.83.47
  192.99.98.86
  1929128.servicesbpd.club
@@ -75446,6 +77000,7 @@
  193.0.88.1
  193.1.101.222
  193.104.115.8
+193.104.197.13
  193.104.41.59
  193.104.68.80
  193.105.112.22
@@ -75470,24 +77025,21 @@
  193.106.30.90
  193.106.30.99
  193.106.31.106
-193.106.31.138
-193.106.31.146
-193.106.49.254
+193.106.31.210
  193.106.57.177
  193.106.57.239
  193.106.58.51
-193.106.60.145
-193.106.61.20
  193.106.95.186
  193.107.111.135
  193.107.112.79
  193.107.16.111
  193.107.16.183
  193.107.19.203
-193.107.201.56
+193.107.201.161
  193.107.221.176
  193.107.236.167
  193.107.48.3
+193.107.74.36
  193.107.75.42
  193.107.85.56
  193.107.96.32
@@ -75497,7 +77049,6 @@
  193.109.69.247
  193.109.78.254
  193.109.79.233
-193.109.85.4
  193.110.115.220
  193.110.149.12
  193.110.149.230
@@ -75527,9 +77078,9 @@
  193.112.108.135
  193.112.108.148
  193.112.109.108
+193.112.11.242
  193.112.110.35
  193.112.111.207
-193.112.113.26
  193.112.117.113
  193.112.118.135
  193.112.123.100
@@ -75551,6 +77102,7 @@
  193.112.174.15
  193.112.18.214
  193.112.180.221
+193.112.19.133
  193.112.191.228
  193.112.195.243
  193.112.196.101
@@ -75568,8 +77120,13 @@
  193.112.218.253
  193.112.23.105
  193.112.247.98
+193.112.248.85
+193.112.249.29
  193.112.250.77
  193.112.251.36
+193.112.27.122
+193.112.28.27
+193.112.30.127
  193.112.39.179
  193.112.39.2
  193.112.4.12
@@ -75589,6 +77146,7 @@
  193.112.73.244
  193.112.74.169
  193.112.74.230
+193.112.77.103
  193.112.79.20
  193.112.82.128
  193.112.82.160
@@ -75601,6 +77159,7 @@
  193.112.98.79
  193.112.98.8
  193.112.99.188
+193.113.42.113
  193.118.53.138
  193.118.53.139
  193.118.53.140
@@ -75635,7 +77194,7 @@
  193.122.153.175
  193.122.163.242
  193.122.166.29
-193.123.204.150
+193.124.130.190
  193.124.131.63
  193.124.183.187
  193.135.144.228
@@ -75644,19 +77203,16 @@
  193.138.204.251
  193.138.218.72
  193.138.219.231
-193.138.38.75
+193.140.135.230
  193.140.245.7
  193.142.146.125
  193.142.146.202
-193.142.146.216
  193.142.146.53
  193.142.219.75
  193.142.30.161
  193.142.59.135
-193.142.59.168
  193.142.59.169
  193.142.59.173
-193.142.59.175
  193.142.59.18
  193.142.59.201
  193.142.59.78
@@ -75674,14 +77230,17 @@
  193.150.121.66
  193.150.15.65
  193.150.153.32
+193.150.21.138
  193.150.233.115
-193.150.253.66
  193.150.53.157
  193.150.6.150
  193.151.118.207
  193.151.12.117
  193.151.128.135
+193.151.128.140
  193.151.128.233
+193.151.128.41
+193.151.128.91
  193.151.89.76
  193.158.75.34
  193.159.135.115
@@ -75718,7 +77277,6 @@
  193.169.245.78
  193.169.245.81
  193.169.245.87
-193.169.252.205
  193.169.252.206
  193.169.252.208
  193.169.252.210
@@ -75729,7 +77287,6 @@
  193.169.252.82
  193.169.252.83
  193.169.253.114
-193.169.253.118
  193.169.253.126
  193.169.253.128
  193.169.253.136
@@ -75738,10 +77295,9 @@
  193.169.253.153
  193.169.253.173
  193.169.253.178
+193.169.253.190
  193.169.253.192
-193.169.253.199
  193.169.253.206
-193.169.253.27
  193.169.253.32
  193.169.253.35
  193.169.253.48
@@ -75755,12 +77311,14 @@
  193.169.254.107
  193.169.254.109
  193.169.254.116
+193.169.254.167
  193.169.254.24
  193.169.254.27
  193.169.254.99
  193.169.5.14
  193.169.61.162
-193.176.242.137
+193.176.242.81
+193.176.243.197
  193.176.251.232
  193.176.84.121
  193.176.84.122
@@ -75815,14 +77373,16 @@
  193.178.118.12
  193.178.118.4
  193.178.118.5
-193.178.146.237
  193.178.169.252
+193.181.245.235
+193.181.246.208
  193.181.51.163
  193.183.217.22
+193.183.217.99
  193.183.246.194
  193.187.101.114
-193.187.101.138
  193.187.119.139
+193.187.119.69
  193.188.254.67
  193.189.117.189
  193.189.117.243
@@ -75837,12 +77397,12 @@
  193.19.167.21
  193.19.243.246
  193.19.96.130
+193.19.96.143
  193.192.122.65
+193.192.179.160
  193.192.48.145
  193.193.194.194
  193.193.224.170
-193.193.228.194
-193.193.229.66
  193.193.240.34
  193.193.240.36
  193.193.71.178
@@ -75860,6 +77420,7 @@
  193.196.39.5
  193.196.39.95
  193.198.34.24
+193.200.151.153
  193.200.151.69
  193.200.241.132
  193.200.241.195
@@ -75868,21 +77429,28 @@
  193.200.50.241
  193.200.50.246
  193.201.105.148
+193.201.216.170
  193.201.224.177
  193.201.224.213
  193.201.224.220
  193.201.224.221
  193.201.224.24
  193.201.227.83
+193.202.12.192
+193.202.14.35
  193.202.80.183
  193.202.81.68
  193.202.81.72
-193.202.82.129
+193.202.82.176
+193.202.82.39
  193.202.82.42
+193.202.83.214
+193.202.83.58
+193.202.86.84
+193.202.9.214
  193.203.10.204
  193.203.10.252
  193.203.10.31
-193.203.10.53
  193.203.11.124
  193.203.8.60
  193.203.9.80
@@ -75909,7 +77477,7 @@
  193.218.118.90
  193.218.118.95
  193.219.38.56
-193.22.97.151
+193.219.97.244
  193.222.130.14
  193.224.96.3
  193.225.126.2
@@ -75922,6 +77490,7 @@
  193.227.13.20
  193.227.16.160
  193.227.248.248
+193.227.32.2
  193.227.47.157
  193.227.49.81
  193.227.5.24
@@ -75929,21 +77498,21 @@
  193.228.53.78
  193.228.57.193
  193.228.57.76
+193.228.58.125
  193.228.58.163
  193.228.58.229
  193.228.58.25
  193.228.58.251
-193.228.58.45
  193.228.58.61
-193.228.58.87
  193.228.58.89
  193.228.59.129
  193.228.59.13
  193.228.59.130
-193.228.59.239
+193.228.59.80
  193.228.59.97
  193.228.60.220
  193.228.91.105
+193.228.91.108
  193.228.91.109
  193.228.91.110
  193.228.91.119
@@ -75958,13 +77527,13 @@
  193.232.36.7
  193.232.68.70
  193.233.14.18
-193.233.149.171
  193.233.155.219
  193.233.6.156
  193.233.9.167
  193.234.113.97
  193.234.224.132
  193.234.224.213
+193.234.50.227
  193.238.152.198
  193.238.152.67
  193.238.37.63
@@ -75973,6 +77542,7 @@
  193.239.127.25
  193.239.147.100
  193.239.147.102
+193.239.147.106
  193.239.147.125
  193.239.147.130
  193.239.147.175
@@ -75980,6 +77550,9 @@
  193.239.147.20
  193.239.147.201
  193.239.147.211
+193.239.147.213
+193.239.147.214
+193.239.147.220
  193.239.147.229
  193.239.147.26
  193.239.147.3
@@ -75998,6 +77571,8 @@
  193.239.86.18
  193.242.104.31
  193.242.108.63
+193.242.151.43
+193.242.151.44
  193.242.177.105
  193.242.213.18
  193.243.159.105
@@ -76018,10 +77593,10 @@
  193.248.253.121
  193.25.197.129
  193.25.215.187
+193.25.252.31
  193.25.6.206
  193.250.107.205
  193.251.12.126
-193.251.162.45
  193.251.45.221
  193.251.6.236
  193.251.73.101
@@ -76033,13 +77608,12 @@
  193.252.53.194
  193.252.54.240
  193.252.8.76
-193.253.49.11
+193.253.113.78
+193.253.177.69
  193.254.184.188
  193.254.245.10
-193.254.245.90
  193.254.245.98
  193.27.13.180
-193.27.14.30
  193.27.228.100
  193.27.228.130
  193.27.228.153
@@ -76357,7 +77931,6 @@
  193.30.244.7
  193.31.127.154
  193.31.127.167
-193.31.127.177
  193.31.127.209
  193.31.127.224
  193.31.127.228
@@ -76407,7 +77980,6 @@
  193.32.8.70
  193.32.8.71
  193.32.8.73
-193.32.8.74
  193.32.8.76
  193.32.8.77
  193.32.8.9
@@ -76418,12 +77990,10 @@
  193.34.166.216
  193.34.166.96
  193.34.167.192
-193.34.218.115
-193.34.232.19
+193.34.186.154
  193.34.55.64
  193.34.93.221
  193.36.15.173
-193.36.224.48
  193.37.192.243
  193.37.212.20
  193.37.213.3
@@ -76447,7 +78017,9 @@
  193.41.122.48
  193.41.123.103
  193.41.123.121
+193.41.123.15
  193.41.123.76
+193.41.123.87
  193.41.123.90
  193.41.86.135
  193.41.86.144
@@ -76457,26 +78029,26 @@
  193.41.87.139
  193.41.87.179
  193.41.87.189
-193.41.87.209
  193.41.87.217
  193.41.87.223
  193.41.87.235
+193.41.88.58
  193.42.110.124
-193.42.110.198
  193.42.110.30
  193.42.136.88
  193.42.137.11
  193.42.137.113
  193.42.137.116
  193.42.137.127
+193.42.137.138
  193.42.137.140
  193.42.137.141
  193.42.137.144
  193.42.137.145
  193.42.137.146
  193.42.96.108
-193.43.118.125
  193.43.118.163
+193.43.13.122
  193.43.252.210
  193.43.72.250
  193.46.198.216
@@ -76484,23 +78056,24 @@
  193.46.202.3
  193.46.80.101
  193.47.240.11
-193.47.69.102
+193.47.69.14
+193.47.69.181
  193.5.111.18
-193.5.175.131
+193.52.185.13
+193.55.180.51
  193.56.107.31
  193.56.20.128
  193.56.20.15
  193.56.20.161
-193.56.20.190
  193.56.20.21
  193.56.20.220
  193.56.20.244
-193.56.20.249
  193.56.20.40
  193.56.240.204
  193.56.240.212
  193.56.242.57
  193.56.252.210
+193.56.28.0
  193.56.28.102
  193.56.28.104
  193.56.28.107
@@ -76540,18 +78113,18 @@
  193.56.28.83
  193.56.28.87
  193.56.28.92
+193.56.28.93
  193.56.29.251
  193.56.64.137
  193.56.64.151
-193.56.64.153
  193.56.64.186
  193.56.64.247
  193.56.72.101
  193.56.72.131
  193.56.72.173
  193.56.72.26
-193.56.72.81
-193.56.72.91
+193.56.72.29
+193.57.121.145
  193.57.40.15
  193.57.40.20
  193.57.40.31
@@ -76572,12 +78145,10 @@
  193.7.200.102
  193.70.0.228
  193.70.0.42
-193.70.110.202
  193.70.125.186
  193.70.2.50
  193.70.21.159
  193.70.32.13
-193.70.33.51
  193.70.34.209
  193.70.38.187
  193.70.39.203
@@ -76594,6 +78165,7 @@
  193.70.91.79
  193.71.141.104
  193.71.191.134
+193.75.54.35
  193.77.113.37
  193.77.117.97
  193.77.150.35
@@ -76605,8 +78177,11 @@
  193.77.35.9
  193.77.51.6
  193.77.82.38
+193.8.56.217
+193.8.83.204
  193.8.83.28
  193.80.200.63
+193.81.212.126
  193.83.122.144
  193.84.116.22
  193.85.145.251
@@ -76630,7 +78205,6 @@
  193.92.104.159
  193.92.16.119
  193.92.166.180
-193.92.233.138
  193.93.121.33
  193.93.192.137
  193.93.192.16
@@ -76640,7 +78214,6 @@
  193.93.192.23
  193.93.192.231
  193.93.192.237
-193.93.192.246
  193.93.192.29
  193.93.192.45
  193.93.192.62
@@ -76650,29 +78223,26 @@
  193.93.193.243
  193.93.193.81
  193.93.194.17
-193.93.194.196
  193.93.194.219
+193.93.195.118
  193.93.195.36
  193.93.219.102
  193.93.237.1
  193.93.62.58
  193.93.62.61
  193.93.63.10
-193.93.79.50
  193.95.228.13
  193.95.24.114
  193.95.247.90
  193.95.81.121
  1933611911.findprofile.net.pl
  194-58-108-245.ovz.vps.regruhosting.ru
-194.0.126.174
  194.0.157.1
  194.0.163.116
  194.1.247.250
  194.1.249.27
  194.102.40.134
-194.104.10.157
-194.104.11.69
+194.104.11.67
  194.104.9.114
  194.104.9.152
  194.104.9.182
@@ -76694,12 +78264,10 @@
  194.113.235.123
  194.113.235.125
  194.113.235.126
-194.114.128.149
-194.116.162.238
-194.116.246.173
  194.12.121.100
  194.12.237.36
  194.12.66.56
+194.12.73.223
  194.12.78.206
  194.12.80.47
  194.12.81.20
@@ -76738,6 +78306,7 @@
  194.141.2.21
  194.141.2.254
  194.141.86.251
+194.143.136.122
  194.143.137.124
  194.143.151.96
  194.143.194.107
@@ -76746,17 +78315,18 @@
  194.143.248.174
  194.143.248.193
  194.143.248.209
-194.143.249.16
+194.143.249.94
  194.143.250.160
-194.143.250.69
+194.143.250.253
  194.143.250.9
-194.143.251.114
  194.143.251.98
  194.145.175.76
  194.145.199.26
  194.146.200.41
  194.146.225.214
  194.147.115.46
+194.147.203.36
+194.147.32.111
  194.147.32.14
  194.147.34.16
  194.147.34.198
@@ -76772,16 +78342,17 @@
  194.15.36.133
  194.15.36.143
  194.15.36.150
+194.15.36.166
  194.15.36.175
  194.15.36.18
  194.15.36.183
  194.15.36.19
-194.15.36.21
  194.15.36.212
  194.15.36.240
  194.15.36.242
  194.15.36.245
  194.15.36.246
+194.15.36.253
  194.15.36.255
  194.15.36.34
  194.15.36.41
@@ -76800,14 +78371,10 @@
  194.150.215.142
  194.150.215.149
  194.150.215.186
-194.150.215.194
-194.150.215.202
-194.150.215.219
-194.150.215.236
-194.150.215.243
+194.150.215.201
  194.150.215.45
-194.150.215.90
-194.150.215.93
+194.150.215.60
+194.150.215.66
  194.150.253.204
  194.150.255.200
  194.150.66.65
@@ -76818,13 +78385,16 @@
  194.152.214.252
  194.152.220.157
  194.154.148.69
-194.156.123.245
+194.156.104.120
+194.156.105.23
  194.156.123.30
+194.156.123.56
  194.156.124.199
  194.156.124.219
  194.156.124.248
  194.156.124.250
  194.156.124.32
+194.156.124.99
  194.156.125.94
  194.156.175.130
  194.156.175.190
@@ -76855,6 +78425,7 @@
  194.165.16.4
  194.165.16.5
  194.165.16.6
+194.165.99.231
  194.166.62.94
  194.169.88.39
  194.170.156.9
@@ -76864,7 +78435,6 @@
  194.176.227.56
  194.18.111.54
  194.180.110.10
-194.180.179.178
  194.180.224.10
  194.180.224.103
  194.180.224.106
@@ -76888,7 +78458,6 @@
  194.182.86.11
  194.183.15.230
  194.183.244.147
-194.186.138.214
  194.186.168.50
  194.186.17.14
  194.186.172.10
@@ -76930,6 +78499,7 @@
  194.187.249.52
  194.187.249.56
  194.187.249.76
+194.187.251.26
  194.190.143.48
  194.190.49.103
  194.190.67.75
@@ -76945,10 +78515,8 @@
  194.204.123.123
  194.204.194.11
  194.207.221.24
-194.208.93.9
  194.209.10.105
  194.213.43.166
-194.218.209.135
  194.219.127.242
  194.219.220.50
  194.219.7.29
@@ -76958,8 +78526,10 @@
  194.226.98.16
  194.228.128.32
  194.228.129.189
+194.228.32.27
  194.228.84.10
  194.230.146.20
+194.242.101.10
  194.242.2.18
  194.243.165.4
  194.243.28.84
@@ -76970,7 +78540,6 @@
  194.247.184.194
  194.247.22.2
  194.247.24.222
-194.247.8.36
  194.247.9.149
  194.250.240.160
  194.254.163.71
@@ -76993,7 +78562,6 @@
  194.26.25.127
  194.26.25.128
  194.26.25.13
-194.26.25.166
  194.26.25.40
  194.26.25.46
  194.26.25.66
@@ -77005,12 +78573,12 @@
  194.26.27.104
  194.26.27.106
  194.26.27.107
+194.26.29.23
  194.26.29.31
  194.26.29.33
  194.26.29.44
  194.27.68.207
  194.28.112.12
-194.28.215.201
  194.28.222.1
  194.28.223.242
  194.28.89.30
@@ -77031,7 +78599,7 @@
  194.34.132.90
  194.34.132.91
  194.34.248.120
-194.35.113.73
+194.35.113.23
  194.35.12.204
  194.35.184.150
  194.35.248.23
@@ -77064,6 +78632,7 @@
  194.38.123.211
  194.38.146.73
  194.39.127.40
+194.39.196.42
  194.42.108.226
  194.42.139.129
  194.42.16.25
@@ -77072,7 +78641,6 @@
  194.44.146.181
  194.44.153.239
  194.44.160.246
-194.44.172.254
  194.44.175.156
  194.44.198.53
  194.44.20.22
@@ -77089,12 +78657,12 @@
  194.44.86.243
  194.44.94.103
  194.48.152.60
-194.49.106.63
  194.49.127.30
  194.49.51.148
  194.49.60.74
-194.5.12.105
  194.5.159.197
+194.5.177.67
+194.5.178.148
  194.5.188.193
  194.5.192.244
  194.5.193.246
@@ -77105,10 +78673,11 @@
  194.5.249.226
  194.5.249.247
  194.5.79.166
+194.5.79.83
  194.5.96.60
  194.50.85.117
+194.54.160.105
  194.54.160.248
-194.54.66.150
  194.58.154.74
  194.58.182.73
  194.58.70.206
@@ -77116,12 +78685,14 @@
  194.58.70.84
  194.58.88.189
  194.58.97.42
+194.59.164.26
  194.59.204.187
  194.59.244.29
  194.59.244.33
  194.59.244.93
  194.6.231.122
  194.60.236.121
+194.60.236.83
  194.60.238.56
  194.60.239.112
  194.60.239.25
@@ -77150,8 +78721,11 @@
  194.63.235.156
  194.65.71.247
  194.67.108.46
+194.67.108.68
  194.67.203.67
  194.67.215.180
+194.67.91.60
+194.67.93.153
  194.67.93.243
  194.68.225.68
  194.68.27.32
@@ -77159,19 +78733,23 @@
  194.68.44.127
  194.68.56.145
  194.68.56.146
+194.69.42.71
  194.71.126.76
  194.72.112.130
  194.73.218.58
  194.73.218.62
+194.75.223.91
  194.78.242.245
+194.78.46.36
  194.79.157.171
-194.79.62.217
  194.8.136.62
  194.8.145.62
  194.8.146.167
  194.8.146.220
  194.8.147.18
  194.84.0.85
+194.87.116.127
+194.87.116.232
  194.87.138.0
  194.87.138.10
  194.87.138.102
@@ -77197,30 +78775,38 @@
  194.87.138.190
  194.87.138.199
  194.87.138.2
+194.87.138.202
  194.87.138.204
+194.87.138.211
  194.87.138.214
-194.87.138.217
  194.87.138.225
  194.87.138.23
  194.87.138.230
-194.87.138.26
  194.87.138.31
  194.87.138.35
  194.87.138.51
  194.87.138.52
+194.87.138.57
+194.87.138.60
  194.87.138.67
  194.87.138.70
  194.87.138.71
  194.87.138.72
  194.87.138.74
  194.87.138.78
+194.87.138.79
  194.87.138.8
  194.87.138.86
  194.87.139.108
  194.87.139.113
  194.87.139.136
  194.87.139.145
+194.87.139.169
  194.87.139.172
+194.87.139.198
+194.87.139.200
+194.87.139.201
+194.87.139.202
  194.87.139.207
  194.87.139.230
  194.87.139.248
@@ -77234,18 +78820,22 @@
  194.87.18.147
  194.87.190.89
  194.87.226.188
+194.87.234.78
  194.87.238.60
  194.87.33.139
  194.87.37.231
  194.87.51.44
+194.87.54.245
  194.88.107.222
  194.88.107.53
  194.88.143.20
+194.88.143.24
  194.88.143.32
  194.88.143.44
  194.88.143.48
  194.88.143.50
  194.88.143.66
+194.88.198.191
  194.88.224.113
  194.9.172.49
  194.9.177.10
@@ -77254,11 +78844,10 @@
  194.9.178.17
  194.9.70.248
  194.9.71.232
+194.9.80.121
  194.90.160.133
  194.90.73.231
  194.96.119.185
-194.99.104.115
-194.99.105.206
  194.99.20.29
  194.99.25.104
  194.99.25.11
@@ -77276,12 +78865,13 @@
  195.113.144.230
  195.113.147.69
  195.114.145.118
+195.114.145.4
  195.114.9.46
  195.116.235.23
-195.116.72.230
  195.117.107.182
  195.117.107.190
  195.117.193.1
+195.12.137.73
  195.12.49.210
  195.122.226.164
  195.122.3.246
@@ -77292,14 +78882,14 @@
  195.123.212.199
  195.123.212.86
  195.123.213.15
+195.123.214.133
  195.123.220.225
  195.123.225.112
-195.123.233.121
  195.123.233.21
  195.123.234.33
  195.123.237.110
+195.123.240.136
  195.123.240.236
-195.123.241.207
  195.123.241.84
  195.123.242.97
  195.123.245.175
@@ -77312,7 +78902,6 @@
  195.128.126.36
  195.128.174.132
  195.13.201.98
-195.13.39.130
  195.130.131.38
  195.130.152.71
  195.130.73.229
@@ -77321,11 +78910,15 @@
  195.133.146.135
  195.133.207.117
  195.133.220.18
+195.133.24.187
  195.133.243.87
+195.133.32.98
+195.133.59.62
  195.135.194.8
  195.135.213.241
  195.135.51.246
  195.136.172.22
+195.136.205.8
  195.136.206.230
  195.136.27.227
  195.136.27.30
@@ -77335,6 +78928,7 @@
  195.138.73.54
  195.138.74.25
  195.138.82.198
+195.138.83.218
  195.138.85.161
  195.138.90.121
  195.138.92.152
@@ -77347,6 +78941,7 @@
  195.140.214.19
  195.140.232.216
  195.142.112.244
+195.143.151.82
  195.144.205.25
  195.144.21.161
  195.144.21.219
@@ -77365,10 +78960,11 @@
  195.154.102.122
  195.154.102.211
  195.154.105.60
+195.154.106.29
+195.154.108.135
  195.154.111.146
  195.154.113.90
  195.154.114.117
-195.154.114.191
  195.154.114.202
  195.154.114.24
  195.154.134.100
@@ -77378,6 +78974,7 @@
  195.154.162.174
  195.154.163.75
  195.154.164.243
+195.154.165.153
  195.154.166.219
  195.154.168.82
  195.154.17.225
@@ -77389,6 +78986,7 @@
  195.154.174.135
  195.154.176.37
  195.154.177.139
+195.154.177.173
  195.154.179.3
  195.154.181.15
  195.154.181.162
@@ -77401,7 +78999,9 @@
  195.154.185.20
  195.154.187.115
  195.154.187.6
+195.154.188.108
  195.154.188.9
+195.154.19.209
  195.154.191.64
  195.154.191.97
  195.154.194.111
@@ -77435,10 +79035,12 @@
  195.154.225.74
  195.154.226.126
  195.154.231.8
-195.154.232.63
+195.154.232.38
  195.154.233.102
  195.154.233.88
+195.154.237.156
  195.154.240.184
+195.154.241.213
  195.154.242.189
  195.154.242.205
  195.154.242.89
@@ -77460,6 +79062,7 @@
  195.154.45.133
  195.154.47.113
  195.154.48.129
+195.154.48.140
  195.154.48.218
  195.154.50.29
  195.154.54.229
@@ -77476,44 +79079,18 @@
  195.155.232.36
  195.155.232.37
  195.158.109.248
-195.158.11.165
-195.158.14.116
-195.158.14.179
-195.158.14.206
-195.158.18.90
  195.158.2.197
-195.158.20.29
-195.158.20.90
  195.158.20.94
-195.158.22.102
  195.158.22.251
-195.158.22.42
-195.158.23.125
-195.158.23.60
  195.158.26.101
  195.158.26.238
  195.158.26.70
-195.158.28.34
  195.158.28.62
-195.158.29.188
-195.158.30.100
-195.158.31.14
-195.158.31.153
-195.158.31.181
-195.158.4.138
-195.158.4.19
-195.158.4.22
-195.158.6.186
  195.158.6.55
-195.158.6.99
-195.158.7.130
-195.158.7.66
-195.158.8.153
  195.158.8.206
  195.158.8.210
-195.158.8.226
-195.158.8.71
  195.158.82.138
+195.158.9.82
  195.159.180.19
  195.159.28.229
  195.159.28.66
@@ -77525,6 +79102,7 @@
  195.161.162.46
  195.161.2.66
  195.161.38.150
+195.162.24.114
  195.162.81.91
  195.170.15.66
  195.170.38.230
@@ -77545,10 +79123,7 @@
  195.18.23.85
  195.18.33.130
  195.181.161.4
-195.181.168.216
  195.181.170.225
-195.181.172.75
-195.181.175.102
  195.181.215.65
  195.181.37.44
  195.181.37.87
@@ -77591,6 +79166,7 @@
  195.2.93.50
  195.20.133.161
  195.200.224.74
+195.200.244.73
  195.201.109.60
  195.201.11.58
  195.201.113.108
@@ -77602,6 +79178,7 @@
  195.201.146.46
  195.201.164.162
  195.201.171.162
+195.201.194.151
  195.201.2.24
  195.201.202.225
  195.201.219.200
@@ -77618,6 +79195,7 @@
  195.201.77.196
  195.201.87.244
  195.201.88.102
+195.201.89.11
  195.201.94.183
  195.201.95.119
  195.201.95.251
@@ -77627,6 +79205,7 @@
  195.204.173.39
  195.205.173.1
  195.206.105.217
+195.206.105.22
  195.206.105.27
  195.206.105.42
  195.206.106.73
@@ -77636,7 +79215,6 @@
  195.206.55.154
  195.207.15.79
  195.208.103.30
-195.208.130.126
  195.208.136.227
  195.208.160.137
  195.208.218.95
@@ -77644,7 +79222,6 @@
  195.209.236.77
  195.209.249.164
  195.209.96.42
-195.21.141.52
  195.210.172.43
  195.210.172.46
  195.211.1.114
@@ -77654,8 +79231,8 @@
  195.211.155.227
  195.211.156.193
  195.211.160.88
+195.211.161.124
  195.211.163.22
-195.211.173.143
  195.211.219.47
  195.211.239.254
  195.211.252.197
@@ -77670,21 +79247,19 @@
  195.214.157.34
  195.214.196.234
  195.214.214.253
+195.214.223.84
  195.214.252.110
  195.214.253.108
  195.216.160.149
  195.218.174.50
-195.218.26.230
  195.22.101.58
  195.22.117.1
  195.22.148.53
  195.22.153.170
  195.22.153.197
-195.22.153.202
  195.22.239.150
  195.22.239.238
  195.22.253.234
-195.22.253.237
  195.22.253.238
  195.22.28.35
  195.222.104.157
@@ -77698,7 +79273,6 @@
  195.223.215.190
  195.224.116.20
  195.224.138.61
-195.225.118.41
  195.225.168.186
  195.225.48.113
  195.225.48.177
@@ -77720,12 +79294,14 @@
  195.228.8.8
  195.228.80.166
  195.23.181.218
+195.230.115.115
  195.230.141.2
  195.230.141.68
  195.230.154.2
  195.230.158.1
  195.230.158.20
  195.230.158.9
+195.231.11.93
  195.231.8.43
  195.231.80.253
  195.231.82.44
@@ -77734,7 +79310,6 @@
  195.234.215.26
  195.234.215.81
  195.234.239.20
-195.234.50.235
  195.234.87.211
  195.234.93.39
  195.238.109.226
@@ -77744,7 +79319,6 @@
  195.238.71.52
  195.239.115.106
  195.239.178.110
-195.239.183.246
  195.239.185.251
  195.239.220.96
  195.239.239.161
@@ -77753,9 +79327,7 @@
  195.239.26.38
  195.239.48.166
  195.239.7.18
-195.239.71.134
  195.24.129.234
-195.24.138.218
  195.24.207.199
  195.24.207.221
  195.24.207.222
@@ -77764,11 +79336,10 @@
  195.24.207.250
  195.24.61.7
  195.241.146.206
+195.242.125.177
  195.242.93.88
  195.244.209.70
  195.245.112.235
-195.245.96.199
-195.245.97.112
  195.246.120.141
  195.246.120.143
  195.246.120.146
@@ -77780,6 +79351,7 @@
  195.246.120.156
  195.246.120.157
  195.246.120.160
+195.246.120.164
  195.246.120.165
  195.246.120.169
  195.246.120.171
@@ -77791,6 +79363,7 @@
  195.248.242.117
  195.248.242.249
  195.25.101.25
+195.25.209.182
  195.25.24.43
  195.250.143.182
  195.250.253.134
@@ -77805,9 +79378,9 @@
  195.254.134.194
  195.254.135.76
  195.26.55.27
-195.26.76.94
  195.28.11.57
  195.29.102.29
+195.29.102.37
  195.29.102.39
  195.29.102.42
  195.29.106.2
@@ -77825,12 +79398,16 @@
  195.32.106.250
  195.32.44.245
  195.32.47.161
-195.32.73.25
-195.32.73.67
+195.32.73.18
+195.32.73.70
  195.32.74.179
-195.32.74.182
+195.32.74.220
  195.32.74.56
+195.32.74.57
+195.32.75.113
+195.32.75.183
  195.32.75.236
+195.32.75.62
  195.32.79.10
  195.33.206.179
  195.33.246.1
@@ -77845,9 +79422,11 @@
  195.39.114.210
  195.39.148.97
  195.39.157.114
+195.39.86.185
  195.40.181.55
  195.43.7.203
  195.46.105.233
+195.46.109.249
  195.46.110.66
  195.46.20.146
  195.47.243.254
@@ -77860,10 +79439,10 @@
  195.5.12.90
  195.5.163.212
  195.5.246.162
-195.52.66.218
  195.53.165.150
  195.53.237.122
  195.54.160.155
+195.54.160.183
  195.54.160.20
  195.54.160.228
  195.54.160.62
@@ -77879,7 +79458,6 @@
  195.54.161.59
  195.54.162.38
  195.54.163.83
-195.54.167.122
  195.54.167.123
  195.54.167.124
  195.54.167.127
@@ -77894,6 +79472,7 @@
  195.57.96.56
  195.58.38.103
  195.58.38.109
+195.58.38.118
  195.58.38.146
  195.58.38.207
  195.58.39.104
@@ -77917,8 +79496,8 @@
  195.60.190.235
  195.62.16.111
  195.62.227.99
+195.62.233.83
  195.62.32.156
-195.62.32.164
  195.62.32.203
  195.62.32.206
  195.62.32.209
@@ -77926,7 +79505,6 @@
  195.62.32.215
  195.62.32.224
  195.62.32.227
-195.62.46.98
  195.62.53.253
  195.66.179.90
  195.66.216.134
@@ -77939,14 +79517,14 @@
  195.69.187.6
  195.69.221.198
  195.69.76.159
-195.7.9.141
  195.70.32.203
  195.70.59.121
  195.72.145.211
-195.74.138.9
+195.74.38.135
  195.74.91.118
  195.74.91.167
  195.74.91.208
+195.74.91.68
  195.74.91.78
  195.77.162.201
  195.77.162.205
@@ -77969,8 +79547,6 @@
  195.86.221.44
  195.86.221.45
  195.86.221.46
-195.88.121.113
-195.88.142.229
  195.88.192.46
  195.88.208.35
  195.88.4.18
@@ -77984,19 +79560,18 @@
  195.9.225.238
  195.9.33.162
  195.9.33.186
+195.9.44.110
  195.9.49.26
  195.9.61.22
  195.9.80.22
  195.9.89.66
  195.9.89.68
  195.9.89.70
-195.91.148.184
  195.91.186.78
  195.91.239.8
  195.91.48.34
  195.93.248.49
  195.94.189.12
-195.94.189.81
  195.94.232.102
  195.95.131.211
  195.95.131.214
@@ -78023,17 +79598,17 @@
  195.95.228.30
  195.95.229.230
  195.97.19.2
+195.97.222.92
  195.97.75.174
  195.97.83.206
  195.98.176.62
  19536.psdzy.com
  195479-dot-n-e-w-me-ss-age-po-rt-al.wl.r.appspot.com
-196.0.110.194
+196.0.110.186
  196.0.111.186
  196.0.111.194
  196.0.113.10
  196.0.115.130
-196.0.117.10
  196.0.117.146
  196.0.122.146
  196.0.122.94
@@ -78046,14 +79621,11 @@
  196.0.87.198
  196.0.87.234
  196.0.87.78
-196.1.238.130
  196.1.253.28
  196.1.97.206
  196.1.97.216
  196.11.62.85
  196.11.80.154
-196.11.80.178
-196.112.219.19
  196.112.81.120
  196.12.186.34
  196.121.205.250
@@ -78066,20 +79638,18 @@
  196.15.249.151
  196.16.223.109
  196.16.223.18
+196.16.223.186
  196.16.223.28
  196.16.223.30
  196.16.223.6
  196.16.223.72
  196.16.241.53
-196.17.162.110
  196.17.162.212
  196.17.232.48
  196.178.21.53
  196.179.246.213
  196.18.175.189
  196.18.187.154
-196.18.207.173
-196.18.207.33
  196.18.3.166
  196.180.54.59
  196.181.184.191
@@ -78089,7 +79659,6 @@
  196.188.0.172
  196.188.1.33
  196.188.104.50
-196.188.115.248
  196.188.157.41
  196.188.192.242
  196.188.30.27
@@ -78097,8 +79666,8 @@
  196.188.51.243
  196.188.74.72
  196.188.92.51
+196.189.160.213
  196.189.5.132
-196.189.63.184
  196.189.91.162
  196.189.91.196
  196.190.7.64
@@ -78106,7 +79675,6 @@
  196.194.254.249
  196.195.163.68
  196.196.148.185
-196.196.148.254
  196.196.148.34
  196.196.148.68
  196.196.160.109
@@ -78124,19 +79692,15 @@
  196.196.224.157
  196.196.224.171
  196.196.224.18
-196.196.246.128
  196.196.246.134
  196.196.246.232
  196.196.246.24
  196.196.246.31
  196.196.247.113
-196.196.253.90
  196.196.254.231
-196.196.254.25
  196.196.255.205
  196.196.34.11
  196.196.34.136
-196.196.37.171
  196.196.47.108
  196.196.47.128
  196.196.47.195
@@ -78145,7 +79709,6 @@
  196.196.50.159
  196.196.50.237
  196.196.50.25
-196.196.68.149
  196.196.8.53
  196.196.85.199
  196.196.85.245
@@ -78159,6 +79722,7 @@
  196.199.122.236
  196.199.122.252
  196.199.122.58
+196.199.122.62
  196.2.12.232
  196.2.13.12
  196.2.14.137
@@ -78170,8 +79734,9 @@
  196.2.9.178
  196.2.9.9
  196.200.181.2
+196.200.39.117
  196.200.39.140
-196.200.45.235
+196.200.39.204
  196.201.225.20
  196.201.233.58
  196.202.117.157
@@ -78181,9 +79746,8 @@
  196.202.168.130
  196.202.174.62
  196.202.202.197
-196.202.209.77
-196.202.209.83
  196.202.220.95
+196.202.25.149
  196.202.40.219
  196.202.5.21
  196.202.71.16
@@ -78202,23 +79766,24 @@
  196.206.228.199
  196.206.228.220
  196.206.228.246
-196.206.64.117
  196.206.83.31
  196.206.87.210
+196.207.172.59
  196.213.65.166
  196.215.192.62
  196.216.10.15
  196.216.220.196
  196.216.220.204
+196.216.73.90
  196.217.240.243
  196.217.241.174
  196.218.101.245
-196.218.110.31
  196.218.112.123
+196.218.133.62
  196.218.180.49
+196.218.19.221
  196.218.222.76
  196.218.23.67
-196.218.246.141
  196.218.26.251
  196.218.37.150
  196.218.41.184
@@ -78230,7 +79795,6 @@
  196.219.163.197
  196.219.85.247
  196.219.89.214
-196.219.92.66
  196.22.215.233
  196.22.215.250
  196.22.215.6
@@ -78249,24 +79813,19 @@
  196.221.165.32
  196.221.165.81
  196.221.167.186
+196.221.208.149
  196.221.39.2
  196.221.44.128
  196.223.157.7
  196.223.162.130
  196.223.162.38
-196.224.158.85
  196.23.22.27
-196.231.10.159
-196.234.148.118
  196.234.234.188
-196.235.28.35
-196.240.104.104
  196.240.104.113
  196.240.104.22
  196.240.105.112
  196.240.105.119
  196.240.105.136
-196.240.105.245
  196.240.105.44
  196.240.109.121
  196.240.109.127
@@ -78282,6 +79841,7 @@
  196.240.109.237
  196.240.109.242
  196.240.109.3
+196.240.109.37
  196.240.109.56
  196.240.109.82
  196.240.143.166
@@ -78291,7 +79851,8 @@
  196.240.143.217
  196.240.143.218
  196.240.143.242
-196.240.173.126
+196.240.143.8
+196.240.143.9
  196.240.173.157
  196.240.173.178
  196.240.173.187
@@ -78300,18 +79861,19 @@
  196.240.237.116
  196.240.237.191
  196.240.237.36
+196.240.250.112
  196.240.250.117
  196.240.250.118
  196.240.250.13
-196.240.250.198
+196.240.250.179
  196.240.250.199
-196.240.250.233
  196.240.250.37
  196.240.250.39
  196.240.250.49
  196.240.250.82
  196.240.250.86
  196.240.254.143
+196.240.254.154
  196.240.254.97
  196.240.58.127
  196.240.58.138
@@ -78334,16 +79896,16 @@
  196.242.20.243
  196.242.20.68
  196.242.20.78
-196.242.21.151
-196.242.3.22
+196.242.200.90
+196.242.3.184
  196.242.47.118
-196.242.47.192
-196.242.47.222
+196.242.47.18
  196.242.47.3
  196.242.47.5
  196.242.47.66
  196.244.192.56
  196.244.4.125
+196.244.4.179
  196.244.4.220
  196.245.148.101
  196.245.148.106
@@ -78351,14 +79913,15 @@
  196.245.148.151
  196.245.148.187
  196.245.148.37
+196.245.149.11
  196.245.149.211
  196.245.149.226
  196.245.149.228
  196.245.149.244
-196.245.149.75
-196.245.159.245
  196.245.159.35
  196.245.159.37
+196.245.161.15
+196.245.163.112
  196.245.163.69
  196.245.184.124
  196.245.184.144
@@ -78380,10 +79943,8 @@
  196.245.219.194
  196.245.219.201
  196.245.219.22
+196.245.236.135
  196.245.236.145
-196.245.236.17
-196.245.236.248
-196.245.236.85
  196.245.239.117
  196.245.239.15
  196.245.244.225
@@ -78401,7 +79962,6 @@
  196.245.250.171
  196.245.250.174
  196.245.250.184
-196.245.250.205
  196.245.250.207
  196.245.250.215
  196.245.250.222
@@ -78434,14 +79994,17 @@
  196.247.162.50
  196.247.162.64
  196.247.162.77
+196.247.163.11
  196.247.163.195
-196.247.163.203
  196.247.163.23
  196.247.163.243
  196.247.163.62
  196.247.192.59
+196.247.224.15
+196.247.224.183
  196.247.224.190
  196.247.224.204
+196.247.224.22
  196.247.224.220
  196.247.224.46
  196.247.224.83
@@ -78450,11 +80013,13 @@
  196.247.229.172
  196.247.229.234
  196.247.229.241
+196.247.5.147
  196.247.5.242
  196.247.5.245
  196.247.5.27
  196.25.230.69
  196.25.237.218
+196.25.35.242
  196.25.94.134
  196.250.150.244
  196.250.176.17
@@ -78463,19 +80028,21 @@
  196.250.223.196
  196.250.39.65
  196.250.54.104
-196.251.234.8
+196.251.1.242
+196.251.238.159
  196.251.36.60
  196.27.106.112
  196.27.107.173
  196.27.107.231
+196.27.115.50
  196.27.127.170
+196.27.127.61
  196.27.73.219
  196.28.101.116
  196.28.101.117
  196.28.226.33
  196.28.234.66
  196.28.243.140
-196.29.193.130
  196.3.100.45
  196.3.102.50
  196.3.171.138
@@ -78487,6 +80054,7 @@
  196.3.97.70
  196.3.99.197
  196.3.99.210
+196.32.105.141
  196.33.226.72
  196.34.217.228
  196.35.193.107
@@ -78497,19 +80065,21 @@
  196.37.111.171
  196.37.111.217
  196.38.70.24
+196.40.156.50
  196.40.83.18
  196.40.97.14
  196.41.102.130
  196.41.122.94
  196.41.130.159
  196.41.17.62
+196.41.195.10
  196.41.2.166
  196.41.48.84
  196.41.51.22
  196.42.30.51
  196.43.169.12
  196.43.171.28
-196.43.196.30
+196.43.172.6
  196.44.10.207
  196.44.104.5
  196.44.176.155
@@ -78517,15 +80087,10 @@
  196.44.202.122
  196.44.236.202
  196.45.141.38
-196.46.202.186
-196.46.202.204
  196.46.39.53
  196.46.55.2
-196.49.1.25
-196.49.1.5
  196.50.13.218
  196.50.196.82
-196.50.247.254
  196.52.10.12
  196.52.10.29
  196.52.10.7
@@ -78617,18 +80182,19 @@
  196.6.112.70
  196.6.232.32
  196.61.32.34
-196.61.74.21
  196.64.12.43
+196.64.154.225
+196.64.161.167
  196.65.210.179
  196.65.79.243
  196.66.194.166
  196.67.139.109
  196.68.238.98
  196.69.155.161
-196.70.249.177
+196.70.102.241
  196.70.252.2
-196.74.175.63
  196.74.98.30
+196.77.16.26
  196.90.145.102
  196.92.4.155
  196.92.5.68
@@ -78638,6 +80204,7 @@
  197.1.6.184
  197.1.94.79
  197.112.0.40
+197.114.140.83
  197.128.117.150
  197.128.28.251
  197.13.2.215
@@ -78656,7 +80223,6 @@
  197.148.91.218
  197.149.128.25
  197.149.148.110
-197.149.86.194
  197.155.193.115
  197.155.6.43
  197.155.71.246
@@ -78671,6 +80237,7 @@
  197.157.195.1
  197.157.195.15
  197.157.195.169
+197.157.219.168
  197.157.219.169
  197.157.22.166
  197.157.222.227
@@ -78702,8 +80269,9 @@
  197.158.64.90
  197.159.0.214
  197.159.12.167
-197.159.136.225
  197.159.197.92
+197.159.217.33
+197.159.217.34
  197.159.218.209
  197.159.23.174
  197.159.3.35
@@ -78712,23 +80280,20 @@
  197.162.252.152
  197.164.238.54
  197.164.97.71
+197.165.161.19
  197.166.74.216
-197.185.103.238
-197.185.109.99
-197.185.118.8
  197.188.144.160
-197.188.146.222
-197.188.148.104
-197.188.149.105
+197.188.144.194
+197.188.144.61
+197.188.147.129
+197.188.147.239
  197.188.149.114
-197.188.150.60
-197.188.160.190
-197.188.162.52
-197.188.163.34
-197.188.165.130
-197.188.165.169
+197.188.151.92
+197.188.162.42
+197.188.164.155
+197.188.165.38
+197.188.166.43
  197.188.167.221
-197.188.167.250
  197.188.223.132
  197.198.72.196
  197.2.143.125
@@ -78767,20 +80332,19 @@
  197.220.163.230
  197.220.169.143
  197.220.68.74
-197.220.84.85
  197.221.129.106
  197.221.132.2
-197.221.149.166
  197.221.158.186
  197.221.254.146
+197.221.255.213
  197.221.28.59
  197.221.90.54
-197.230.162.119
+197.227.8.186
  197.230.17.94
  197.230.26.130
  197.230.63.190
+197.231.171.117
  197.231.186.148
-197.231.196.44
  197.231.198.172
  197.231.201.37
  197.231.202.106
@@ -78797,10 +80361,9 @@
  197.232.55.224
  197.232.76.135
  197.232.88.167
-197.232.95.180
  197.232.98.232
  197.234.13.10
-197.234.13.12
+197.234.13.13
  197.234.13.16
  197.234.13.2
  197.234.13.32
@@ -78821,33 +80384,30 @@
  197.234.13.88
  197.234.13.96
  197.234.179.102
-197.234.201.238
  197.234.219.29
-197.234.219.32
  197.234.221.109
-197.234.221.177
+197.234.221.171
  197.234.221.191
-197.234.221.228
-197.234.221.234
+197.234.221.205
+197.234.221.67
  197.234.35.82
  197.234.48.242
  197.234.83.186
  197.235.10.121
-197.235.17.74
+197.237.134.110
  197.237.137.151
+197.237.161.58
  197.237.161.64
-197.237.167.26
-197.237.211.47
-197.237.243.68
-197.237.243.72
-197.237.246.172
-197.237.246.222
+197.237.246.42
  197.237.90.67
+197.24.241.39
  197.240.209.56
+197.240.226.227
  197.240.76.29
  197.242.114.124
  197.242.145.163
  197.242.147.47
+197.242.148.218
  197.242.203.180
  197.242.203.246
  197.242.206.64
@@ -78861,22 +80421,26 @@
  197.245.190.234
  197.246.193.63
  197.246.40.161
+197.247.213.120
+197.247.231.100
  197.248.114.226
  197.248.136.250
  197.248.190.170
  197.248.2.229
  197.248.230.67
  197.248.231.230
-197.248.236.134
  197.248.29.234
+197.248.7.229
  197.249.11.20
  197.249.20.247
  197.249.231.148
-197.249.40.119
  197.249.46.152
  197.250.8.162
  197.251.182.74
+197.251.184.144
  197.251.189.107
+197.251.192.103
+197.251.192.29
  197.251.224.215
  197.251.25.200
  197.253.124.204
@@ -78903,9 +80467,9 @@
  197.255.255.113
  197.32.144.247
  197.35.46.71
-197.36.109.113
  197.36.205.82
  197.36.216.254
+197.36.40.233
  197.37.114.148
  197.39.210.11
  197.40.158.14
@@ -78930,15 +80494,18 @@
  197.45.110.217
  197.45.138.52
  197.45.155.10
+197.45.155.12
  197.45.163.117
  197.45.181.206
  197.45.196.87
  197.45.23.219
  197.45.47.140
  197.45.68.167
+197.45.72.171
  197.45.86.113
  197.45.86.197
  197.46.82.171
+197.48.100.178
  197.48.127.229
  197.48.190.53
  197.48.247.48
@@ -78957,12 +80524,15 @@
  197.5.145.88
  197.5.145.93
  197.50.114.6
+197.50.153.140
  197.50.17.54
  197.50.176.238
  197.50.179.254
+197.50.250.124
  197.50.251.52
  197.50.251.56
  197.50.28.92
+197.50.44.19
  197.50.5.252
  197.50.71.2
  197.50.75.226
@@ -78982,13 +80552,17 @@
  197.51.78.130
  197.52.30.33
  197.52.93.117
+197.53.201.129
  197.53.218.213
+197.53.58.111
+197.53.7.43
  197.58.235.145
  197.59.77.120
+197.61.122.144
  197.61.160.124
+197.62.123.26
  197.62.143.24
  197.62.230.163
-197.62.54.170
  197.62.99.144
  197.85.185.156
  197.86.217.241
@@ -78997,11 +80571,11 @@
  197.89.103.103
  197.89.145.60
  197.89.35.107
+197.89.55.177
  197.89.73.96
  197.89.89.119
  197.91.169.179
  197.91.181.176
-197.92.4.58
  197.94.21.219
  197.94.221.17
  197.95.143.44
@@ -79013,7 +80587,6 @@
  19725.psdzy.com
  1975365.com
  198.0.198.132
-198.1.107.44
  198.1.116.158
  198.1.231.6
  198.1.67.59
@@ -79021,7 +80594,6 @@
  198.100.118.177
  198.100.144.20
  198.100.145.189
-198.100.146.121
  198.100.146.132
  198.100.146.191
  198.100.146.22
@@ -79036,29 +80608,28 @@
  198.100.159.86
  198.106.189.76
  198.11.177.170
-198.12.108.113
-198.12.108.115
+198.12.105.83
  198.12.108.116
  198.12.110.89
+198.12.121.172
  198.12.121.184
  198.12.123.132
  198.12.123.154
  198.12.125.228
+198.12.125.253
  198.12.248.100
  198.12.249.249
  198.12.250.116
  198.12.64.100
-198.12.64.113
  198.12.66.104
  198.12.66.106
  198.12.66.107
  198.12.66.108
  198.12.66.109
  198.12.66.110
-198.12.66.206
  198.12.68.57
  198.12.73.127
-198.12.80.148
+198.12.80.147
  198.12.80.155
  198.12.80.157
  198.12.80.175
@@ -79094,6 +80665,7 @@
  198.143.133.158
  198.143.146.34
  198.143.146.35
+198.143.146.36
  198.143.146.37
  198.143.146.38
  198.143.147.114
@@ -79136,13 +80708,12 @@
  198.143.190.68
  198.143.4.54
  198.144.120.177
-198.144.120.221
-198.144.120.224
  198.144.120.234
-198.144.120.30
  198.144.121.93
  198.144.149.253
  198.144.149.254
+198.144.154.56
+198.144.154.6
  198.144.158.120
  198.144.176.137
  198.144.176.147
@@ -79163,21 +80734,22 @@
  198.154.113.151
  198.154.60.143
  198.154.63.131
-198.154.81.123
+198.154.81.117
  198.154.81.200
  198.154.81.239
-198.154.81.6
+198.154.85.251
  198.154.92.252
  198.16.59.186
  198.166.243.209
  198.166.43.68
  198.167.136.150
+198.167.137.53
  198.167.138.148
  198.167.140.237
+198.167.141.69
  198.17.119.229
  198.175.126.119
  198.178.120.5
-198.179.6.175
  198.181.43.204
  198.187.28.137
  198.187.28.79
@@ -79199,13 +80771,13 @@
  198.199.113.36
  198.199.114.69
  198.199.115.23
-198.199.117.222
  198.199.117.246
  198.199.119.104
  198.199.120.16
  198.199.122.245
  198.199.122.67
  198.199.122.68
+198.199.123.159
  198.199.123.206
  198.199.125.32
  198.199.125.87
@@ -79233,12 +80805,14 @@
  198.199.82.190
  198.199.83.58
  198.199.85.178
+198.199.87.240
  198.199.88.9
  198.199.89.152
  198.199.89.155
  198.199.89.226
  198.199.91.213
  198.199.91.215
+198.199.91.226
  198.199.91.245
  198.199.91.6
  198.199.92.246
@@ -79269,26 +80843,26 @@
  198.20.124.218
  198.20.124.219
  198.20.124.220
+198.20.124.221
  198.20.124.222
  198.20.163.226
  198.20.163.69
  198.20.164.43
-198.20.172.77
-198.20.174.131
  198.20.174.164
  198.20.174.173
-198.20.174.91
  198.20.175.146
  198.20.176.188
  198.20.176.190
-198.20.176.238
  198.20.180.149
-198.20.180.153
  198.20.231.157
  198.20.235.1
  198.20.69.98
  198.20.70.114
  198.20.70.58
+198.20.70.59
+198.20.70.60
+198.20.70.61
+198.20.70.62
  198.20.87.98
  198.20.99.130
  198.200.43.215
@@ -79335,6 +80909,8 @@
  198.211.113.207
  198.211.114.136
  198.211.115.194
+198.211.115.226
+198.211.116.13
  198.211.116.135
  198.211.116.68
  198.211.116.75
@@ -79361,8 +80937,6 @@
  198.211.99.153
  198.211.99.227
  198.211.99.79
-198.22.81.88
-198.22.81.89
  198.23.137.142
  198.23.140.218
  198.23.141.34
@@ -79373,6 +80947,7 @@
  198.23.149.110
  198.23.154.185
  198.23.172.148
+198.23.172.149
  198.23.172.169
  198.23.172.170
  198.23.172.190
@@ -79382,7 +80957,6 @@
  198.23.174.151
  198.23.174.152
  198.23.174.185
-198.23.174.189
  198.23.174.49
  198.23.174.62
  198.23.176.210
@@ -79391,30 +80965,37 @@
  198.23.197.32
  198.23.200.241
  198.23.201.187
-198.23.206.131
  198.23.206.135
  198.23.209.128
  198.23.209.205
  198.23.209.207
+198.23.210.50
+198.23.211.42
  198.23.212.138
  198.23.212.152
  198.23.212.188
  198.23.213.30
  198.23.217.205
+198.23.217.64
  198.23.217.84
  198.23.217.89
  198.23.221.151
  198.23.226.150
-198.23.227.88
  198.23.235.216
  198.23.235.218
  198.23.236.144
-198.23.238.190
+198.23.238.15
+198.23.238.38
  198.23.239.142
  198.23.239.144
+198.23.240.210
+198.23.242.153
+198.23.242.154
  198.23.242.210
  198.23.247.188
+198.23.251.238
  198.23.57.226
+198.23.58.158
  198.23.59.60
  198.23.60.180
  198.23.71.113
@@ -79422,6 +81003,7 @@
  198.24.131.83
  198.24.149.162
  198.240.212.205
+198.245.174.40
  198.245.49.14
  198.245.49.186
  198.245.49.215
@@ -79437,7 +81019,7 @@
  198.245.62.228
  198.245.67.46
  198.245.67.49
-198.245.72.143
+198.245.75.77
  198.245.76.237
  198.245.76.247
  198.251.80.252
@@ -79451,7 +81033,6 @@
  198.251.89.80
  198.251.89.99
  198.252.110.55
-198.252.99.73
  198.255.236.2
  198.255.92.170
  198.27.108.198
@@ -79483,25 +81064,29 @@
  198.27.90.106
  198.35.47.13
  198.36.31.119
+198.36.31.124
  198.38.82.127
  198.38.85.88
+198.38.86.161
  198.38.92.65
  198.38.94.199
  198.40.56.50
  198.41.49.132
  198.41.85.5
  198.44.0.158
+198.44.188.75
  198.44.191.149
  198.44.214.175
+198.44.216.77
  198.44.40.72
  198.44.66.59
+198.45.212.244
  198.46.131.179
  198.46.131.183
  198.46.132.213
  198.46.138.98
  198.46.149.165
  198.46.158.43
-198.46.159.20
  198.46.159.248
  198.46.166.35
  198.46.168.25
@@ -79510,7 +81095,6 @@
  198.46.178.103
  198.46.178.107
  198.46.178.119
-198.46.178.88
  198.46.193.232
  198.46.194.140
  198.46.198.115
@@ -79520,7 +81104,6 @@
  198.46.202.121
  198.46.202.154
  198.46.203.162
-198.46.203.37
  198.46.205.78
  198.46.205.89
  198.46.209.159
@@ -79532,11 +81115,13 @@
  198.46.222.29
  198.46.223.119
  198.46.223.23
-198.46.226.112
+198.46.226.115
  198.46.226.119
+198.46.226.91
  198.46.232.249
  198.46.240.154
  198.46.249.201
+198.46.249.202
  198.46.249.206
  198.46.81.12
  198.46.81.34
@@ -79548,7 +81133,6 @@
  198.48.223.179
  198.48.225.88
  198.48.229.137
-198.48.229.77
  198.49.68.101
  198.49.73.50
  198.50.128.237
@@ -79585,6 +81169,7 @@
  198.50.196.140
  198.50.200.139
  198.50.212.177
+198.50.215.168
  198.50.222.102
  198.50.223.185
  198.50.224.232
@@ -79596,7 +81181,6 @@
  198.50.234.111
  198.50.240.58
  198.50.251.198
-198.50.252.26
  198.52.100.36
  198.52.119.103
  198.52.122.180
@@ -79620,7 +81204,6 @@
  198.54.128.70
  198.54.128.76
  198.54.128.78
-198.54.131.38
  198.55.107.164
  198.55.109.115
  198.55.109.130
@@ -79658,7 +81241,6 @@
  198.71.227.45
  198.71.227.47
  198.71.227.55
-198.71.228.13
  198.71.228.28
  198.71.228.33
  198.71.228.43
@@ -79670,22 +81252,20 @@
  198.71.231.35
  198.71.231.39
  198.71.231.4
+198.71.234.40
  198.71.235.23
  198.71.235.70
-198.71.235.73
  198.71.236.12
  198.71.236.25
  198.71.236.32
  198.71.236.46
  198.71.237.24
-198.71.237.7
  198.71.237.9
-198.71.238.10
  198.71.238.17
  198.71.238.19
  198.71.238.21
+198.71.238.23
  198.71.238.3
-198.71.238.5
  198.71.238.6
  198.71.238.7
  198.71.238.8
@@ -79693,20 +81273,13 @@
  198.71.239.14
  198.71.239.15
  198.71.239.20
-198.71.239.26
-198.71.239.29
-198.71.239.30
-198.71.239.31
-198.71.239.33
  198.71.239.36
  198.71.239.41
  198.71.239.43
-198.71.239.44
-198.71.239.49
+198.71.239.7
  198.71.240.42
  198.71.241.14
  198.71.241.40
-198.71.241.42
  198.71.58.92
  198.71.63.95
  198.74.121.153
@@ -79720,7 +81293,6 @@
  198.74.58.104
  198.74.59.21
  198.8.85.230
-198.8.94.170
  198.8.94.174
  198.84.141.219
  198.84.147.50
@@ -79728,7 +81300,6 @@
  198.89.97.196
  198.91.178.108
  198.91.188.76
-198.91.58.90
  198.96.155.3
  198.96.95.65
  198.98.48.123
@@ -79739,16 +81310,19 @@
  198.98.49.180
  198.98.49.198
  198.98.50.112
+198.98.51.151
  198.98.51.196
  198.98.51.197
  198.98.51.212
  198.98.51.240
  198.98.51.71
+198.98.52.100
  198.98.52.119
  198.98.52.155
  198.98.52.169
  198.98.52.75
  198.98.53.109
+198.98.53.133
  198.98.53.153
  198.98.53.221
  198.98.54.14
@@ -79792,6 +81366,7 @@
  19858327-dot-sydneyma.appspot.com
  198663092739365.cf
  199.10.64.84
+199.101.103.5
  199.101.121.225
  199.101.127.168
  199.102.224.190
@@ -79809,11 +81384,11 @@
  199.116.118.145
  199.116.118.149
  199.119.139.4
+199.119.180.86
  199.119.74.245
  199.126.168.230
  199.126.198.116
  199.126.203.49
-199.127.59.193
  199.127.62.34
  199.15.233.139
  199.15.233.140
@@ -79826,11 +81401,8 @@
  199.15.233.172
  199.15.233.176
  199.15.250.210
-199.16.223.153
  199.16.243.107
-199.16.243.144
  199.16.243.195
-199.16.243.235
  199.16.243.38
  199.167.138.22
  199.168.100.74
@@ -79862,6 +81434,8 @@
  199.187.28.54
  199.187.28.58
  199.187.29.1
+199.188.103.214
+199.188.103.75
  199.188.200.101
  199.188.200.151
  199.188.204.174
@@ -79876,13 +81450,13 @@
  199.19.225.10
  199.19.225.130
  199.19.225.212
+199.19.225.67
  199.19.225.78
  199.19.226.123
  199.19.226.211
  199.19.226.227
  199.19.226.253
  199.19.226.83
-199.191.56.218
  199.192.121.53
  199.192.156.212
  199.192.16.206
@@ -79896,6 +81470,7 @@
  199.192.28.11
  199.192.31.145
  199.193.14.126
+199.193.183.180
  199.193.6.182
  199.195.192.248
  199.195.248.138
@@ -79927,7 +81502,6 @@
  199.204.248.136
  199.204.248.168
  199.204.249.212
-199.204.45.193
  199.204.45.6
  199.21.220.69
  199.21.66.105
@@ -79950,19 +81524,17 @@
  199.229.238.69
  199.229.250.50
  199.229.250.94
-199.230.121.17
  199.231.166.210
-199.231.188.213
  199.231.189.251
  199.231.189.99
  199.231.223.4
  199.231.233.20
  199.231.240.25
-199.233.237.42
  199.233.246.195
  199.237.62.138
  199.241.145.219
  199.241.200.197
+199.243.205.47
  199.247.14.193
  199.247.15.117
  199.247.15.234
@@ -79970,6 +81542,7 @@
  199.247.24.116
  199.247.249.188
  199.247.29.89
+199.247.30.57
  199.247.4.230
  199.247.4.54
  199.247.5.204
@@ -80092,6 +81665,8 @@
  199.34.78.183
  199.34.78.210
  199.36.94.6
+199.38.121.73
+199.38.122.133
  199.38.243.111
  199.4.18.206
  199.47.55.213
@@ -80101,7 +81676,6 @@
  199.58.86.211
  199.59.243.120
  199.66.68.144
-199.66.91.163
  199.76.38.123
  199.79.62.115
  199.79.62.144
@@ -80362,103 +81936,34 @@
  2-mansyur.com
  2-praca-zaloguj.co.pl
  2-upd.co.uk
+2.10.137.187
  2.101.177.182
-2.104.14.161
  2.112.240.141
+2.119.3.137
  2.123.156.227
  2.132.102.224
-2.132.122.143
-2.132.134.199
-2.132.17.75
  2.132.172.133
-2.132.178.114
  2.132.186.146
  2.132.202.41
  2.132.202.48
  2.132.204.112
-2.132.215.68
-2.132.233.139
-2.132.234.100
-2.132.234.130
-2.132.234.157
-2.132.234.192
  2.132.241.171
-2.132.246.112
  2.132.249.34
-2.132.81.235
-2.132.84.80
-2.132.87.10
+2.132.254.54
+2.132.38.46
  2.132.91.60
-2.132.92.153
  2.132.94.157
-2.133.140.117
-2.133.16.91
-2.133.198.17
-2.133.209.105
-2.133.211.83
-2.133.223.77
-2.133.227.236
+2.133.177.64
  2.133.248.129
-2.133.253.72
-2.133.27.61
  2.133.33.153
  2.133.42.218
-2.133.50.218
  2.133.61.161
-2.133.61.6
-2.133.68.250
-2.133.69.101
-2.133.70.73
  2.133.72.132
-2.133.84.148
-2.133.91.39
-2.134.101.81
-2.134.118.204
-2.134.131.111
-2.134.134.151
-2.134.135.222
  2.134.141.130
-2.134.143.172
-2.134.153.31
-2.134.157.72
-2.134.163.72
-2.134.166.115
-2.134.169.18
-2.134.171.46
-2.134.176.98
-2.134.187.42
-2.134.194.10
-2.134.199.80
-2.134.219.115
-2.134.238.190
-2.134.244.239
-2.134.51.236
-2.134.53.167
-2.134.55.245
-2.134.9.116
  2.134.90.156
-2.134.97.98
-2.135.114.75
-2.135.117.98
  2.135.132.14
-2.135.133.126
  2.135.135.153
  2.135.15.56
-2.135.151.243
-2.135.159.132
-2.135.172.48
-2.135.178.60
-2.135.185.230
-2.135.189.190
-2.135.222.114
-2.135.222.2
-2.135.223.222
-2.135.226.135
-2.135.239.218
-2.135.243.218
-2.135.34.58
-2.135.86.196
-2.135.93.26
  2.136.127.178
  2.136.179.77
  2.136.182.204
@@ -80476,6 +81981,7 @@
  2.139.155.90
  2.139.162.80
  2.139.189.242
+2.139.209.78
  2.139.237.110
  2.139.252.47
  2.139.69.101
@@ -80483,71 +81989,42 @@
  2.144.242.146
  2.144.243.102
  2.15.159.18
+2.15.254.208
  2.152.225.146
  2.152.45.133
-2.153.117.68
  2.154.144.228
-2.176.12.33
-2.176.198.138
-2.176.82.225
-2.177.150.103
  2.178.255.157
-2.178.32.43
  2.178.55.112
-2.178.62.26
  2.179.164.112
-2.179.166.7
  2.179.64.63
  2.180.11.55
-2.180.133.140
-2.180.140.185
-2.180.153.254
  2.180.3.39
  2.180.31.88
+2.181.100.9
  2.181.179.55
  2.181.247.190
  2.181.247.40
-2.181.84.99
-2.182.46.107
-2.182.73.136
-2.183.103.4
-2.183.230.16
-2.184.131.212
-2.184.185.44
+2.182.112.250
  2.184.4.3
  2.184.52.194
  2.184.52.204
-2.185.129.114
  2.185.144.60
  2.185.149.129
  2.185.149.214
-2.185.151.161
-2.185.181.21
-2.185.228.156
-2.185.82.205
-2.185.86.188
-2.186.114.228
-2.186.114.240
  2.186.156.110
-2.186.246.125
  2.187.100.151
-2.187.161.187
+2.187.18.194
  2.187.18.70
  2.187.251.247
-2.189.27.42
  2.190.160.225
-2.190.3.24
  2.190.87.162
-2.191.20.135
  2.192.225.155
+2.192.66.216
  2.192.98.207
-2.194.128.90
  2.194.133.78
  2.194.134.228
  2.194.163.63
-2.194.18.130
  2.194.18.38
-2.194.19.114
  2.194.27.149
  2.194.28.240
  2.194.33.250
@@ -80563,18 +82040,23 @@
  2.195.228.107
  2.195.234.4
  2.196.161.111
-2.201.149.1
-2.201.149.94
+2.200.83.22
+2.200.98.129
+2.201.149.2
+2.201.149.248
  2.201.16.4
-2.202.112.80
+2.202.194.4
+2.202.194.92
  2.203.118.180
  2.203.180.79
-2.207.79.33
+2.205.158.64
  2.217.44.77
  2.217.45.18
  2.218.193.131
  2.220.235.50
  2.223.175.7
+2.224.166.158
+2.224.168.43
  2.225.249.9
  2.226.135.239
  2.226.156.242
@@ -80610,7 +82092,6 @@
  2.236.140.22
  2.236.242.77
  2.236.251.49
-2.237.116.238
  2.237.19.137
  2.237.29.22
  2.237.76.22
@@ -80623,9 +82104,9 @@
  2.238.77.60
  2.24.199.59
  2.243.145.121
-2.244.102.103
+2.244.165.188
  2.247.244.178
-2.247.246.8
+2.247.250.253
  2.249.160.194
  2.249.168.27
  2.249.177.101
@@ -80633,8 +82114,8 @@
  2.26.232.27
  2.28.108.207
  2.29.59.251
+2.30.17.61
  2.31.165.149
-2.31.20.254
  2.32.23.239
  2.34.1.72
  2.35.150.233
@@ -80650,10 +82131,12 @@
  2.38.214.35
  2.38.99.79
  2.39.114.34
+2.39.139.10
  2.39.173.126
  2.39.33.240
  2.42.168.69
  2.42.173.240
+2.42.185.164
  2.42.196.30
  2.44.166.148
  2.44.189.221
@@ -80689,11 +82172,11 @@
  2.50.8.199
  2.51.26.64
  2.51.68.106
+2.53.6.172
  2.55.110.138
  2.55.90.134
  2.55.90.80
  2.55.92.184
-2.56.101.212
  2.56.121.154
  2.56.168.201
  2.56.168.213
@@ -80707,18 +82190,19 @@
  2.57.121.109
  2.57.121.111
  2.57.121.113
+2.57.121.19
  2.57.122.10
  2.57.122.11
  2.57.122.14
  2.57.122.15
  2.57.122.167
-2.57.122.174
  2.57.122.18
  2.57.122.181
-2.57.122.184
+2.57.122.185
  2.57.122.186
  2.57.122.19
  2.57.122.190
+2.57.122.192
  2.57.122.196
  2.57.122.20
  2.57.122.207
@@ -80728,28 +82212,23 @@
  2.57.122.26
  2.57.122.7
  2.57.122.8
-2.57.122.9
  2.57.122.98
  2.57.19.154
-2.57.204.16
  2.57.204.59
  2.57.207.136
  2.57.207.43
-2.57.9.139
  2.57.91.110
  2.57.91.98
-2.58.12.110
+2.58.12.104
  2.58.12.115
-2.58.12.122
  2.58.12.145
-2.58.12.151
  2.58.12.152
  2.58.12.158
  2.58.12.182
  2.58.12.188
-2.58.12.194
  2.58.12.200
  2.58.12.212
+2.58.12.218
  2.58.12.223
  2.58.12.230
  2.58.12.242
@@ -80758,38 +82237,33 @@
  2.58.12.31
  2.58.12.32
  2.58.12.44
-2.58.12.62
  2.58.12.68
  2.58.12.91
-2.58.12.98
  2.58.13.129
+2.58.13.75
  2.58.136.143
  2.58.16.86
  2.58.16.89
  2.58.228.117
-2.58.46.250
+2.58.230.41
  2.59.117.190
  2.59.117.65
-2.59.119.37
  2.59.119.42
  2.59.132.244
-2.59.21.247
  2.59.235.224
  2.59.247.214
  2.6.185.246
  2.61.151.166
+2.62.46.119
  2.64.252.95
  2.67.250.37
  2.7.248.51
-2.72.104.84
-2.75.63.6
+2.7.91.176
  2.78.58.187
  2.80.19.193
+2.80.67.216
  2.81.147.94
-2.81.15.25
  2.81.219.150
-2.81.22.80
-2.81.6.175
  2.82.170.124
  2.82.175.119
  2.82.75.215
@@ -80799,25 +82273,23 @@
  2.83.152.16
  2.83.21.114
  2.83.222.129
-2.83.58.233
  2.84.21.80
  2.84.232.100
  2.84.243.220
  2.84.9.137
  2.84.9.192
  2.85.37.102
-2.85.7.130
  2.85.83.224
  2.86.136.140
  2.86.163.168
  2.86.165.229
  2.86.32.71
-2.87.11.155
  2.87.11.97
  2.87.135.49
  2.87.156.101
  2.87.225.195
  2.87.23.7
+2.87.238.75
  2.88.105.174
  2.88.67.92
  2.88.68.17
@@ -80826,14 +82298,17 @@
  2.89.82.192
  2.90.103.16
  2.90.126.153
+2.90.184.81
  2.91.123.236
  2.91.13.189
  2.92.108.26
+2.92.181.19
  2.92.39.39
  2.92.51.124
  2.95.129.33
  2.95.232.205
  2.96.36.182
+2.97.185.65
  2.99.228.139
  2.gabung-grup-whatsapp.getsviip7.com
  2.indexsinas.me
@@ -80848,9 +82323,15 @@
  20.151.11.51
  20.151.19.163
  20.184.15.116
+20.184.2.58
  20.185.191.38
+20.185.218.232
+20.185.222.24
  20.185.225.23
+20.185.231.189
+20.185.233.37
  20.185.247.149
+20.185.30.253
  20.185.39.51
  20.185.57.236
  20.185.58.96
@@ -80860,16 +82341,29 @@
  20.186.19.91
  20.186.32.122
  20.186.66.148
+20.186.71.193
  20.188.107.54
  20.188.108.164
+20.188.111.142
  20.188.250.110
+20.188.44.177
+20.188.58.70
+20.188.60.14
  20.188.60.188
  20.188.61.54
+20.188.61.90
+20.188.63.152
  20.191.121.229
+20.191.251.172
+20.193.64.26
  20.194.1.172
+20.194.22.163
  20.194.24.86
+20.194.3.84
  20.194.34.207
+20.194.40.75
  20.194.47.81
+20.195.25.52
  20.195.56.55
  20.195.9.179
  20.36.162.187
@@ -80889,21 +82383,31 @@
  20.43.35.45
  20.43.39.121
  20.43.39.32
+20.43.56.138
  20.43.59.45
  20.43.60.99
  20.44.98.121
  20.46.114.59
+20.46.183.211
  20.46.224.110
  20.46.41.35
+20.48.105.35
+20.48.19.154
+20.48.4.201
  20.49.178.149
  20.49.178.57
  20.49.186.22
-20.49.204.0
+20.49.194.214
+20.49.2.187
+20.49.6.117
  20.4buyuklergazete.com
  20.50.114.95
  20.51.112.101
  20.51.120.172
+20.51.209.11
+20.51.209.147
  20.51.211.19
+20.52.128.69
  20.52.137.129
  20.52.153.108
  20.52.153.64
@@ -80911,16 +82415,21 @@
  20.52.157.215
  20.52.158.101
  20.52.233.214
-20.55.101.47
+20.52.38.207
+20.52.41.121
+20.52.43.14
+20.52.46.241
  20.55.19.1
+20.55.2.33
  20.55.203.249
  20.55.205.210
  20.55.243.78
  20.55.25.62
+20.55.26.138
+20.55.4.26
  20.55.96.58
  20.56.112.79
-20.57.171.103
-20.58.7.164
+20.61.113.143
  20.62.41.3
  20.62.94.40
  20.64.157.95
@@ -80943,10 +82452,11 @@
  200.101.209.240
  200.103.112.53
  200.103.16.43
+200.105.144.202
  200.105.157.218
+200.105.157.238
  200.105.169.181
  200.105.174.182
-200.105.174.20
  200.105.179.250
  200.105.181.74
  200.105.182.106
@@ -80955,7 +82465,6 @@
  200.105.201.198
  200.105.208.202
  200.105.209.170
-200.105.215.18
  200.105.242.58
  200.105.74.140
  200.106.147.35
@@ -80966,10 +82475,11 @@
  200.107.62.10
  200.108.131.234
  200.108.132.163
+200.108.132.92
  200.108.139.242
  200.108.143.6
+200.108.183.2
  200.108.196.108
-200.108.196.110
  200.108.197.199
  200.109.112.50
  200.109.172.54
@@ -81002,7 +82512,6 @@
  200.114.157.38
  200.114.175.90
  200.114.236.19
-200.115.108.2
  200.115.157.211
  200.115.48.82
  200.115.53.225
@@ -81013,7 +82522,6 @@
  200.116.198.140
  200.116.198.160
  200.116.198.177
-200.116.198.222
  200.116.206.10
  200.116.226.210
  200.116.3.133
@@ -81022,9 +82530,7 @@
  200.117.144.248
  200.117.185.116
  200.118.57.190
-200.118.57.238
  200.119.125.194
-200.119.198.188
  200.119.204.19
  200.119.40.13
  200.12.221.38
@@ -81044,15 +82550,8 @@
  200.123.150.89
  200.123.2.171
  200.123.208.29
-200.123.232.116
-200.123.232.150
  200.123.232.185bin.sh
-200.123.232.195
-200.123.232.196
-200.123.232.204
  200.123.232.219bin.sh
-200.123.232.223
-200.123.232.249
  200.123.232.250
  200.123.232.255
  200.123.232.93
@@ -81060,33 +82559,27 @@
  200.123.233.1
  200.123.233.10
  200.123.233.10bin.sh
-200.123.233.127
-200.123.233.163
  200.123.233.21
-200.123.233.218
-200.123.233.23
  200.123.233.33
  200.123.233.33bin.sh
-200.123.233.37
-200.123.233.47
  200.123.248.136
  200.123.50.44
  200.124.243.62
  200.125.181.94
  200.125.182.230
-200.125.190.170
  200.125.236.58
  200.125.44.242
-200.126.129.246
  200.126.160.225
  200.126.213.143
  200.126.47.8
  200.127.1.233
  200.127.14.97
  200.128.62.2
+200.129.242.4
  200.13.160.125
  200.13.253.154
  200.130.99.116
+200.133.1.76
  200.133.39.84
  200.135.228.230
  200.137.5.195
@@ -81100,11 +82593,9 @@
  200.142.120.90
  200.143.186.21
  200.145.250.11
-200.146.197.186
  200.146.227.146
  200.146.229.129
  200.146.236.217
-200.146.247.251
  200.146.46.194
  200.146.46.197
  200.146.46.198
@@ -81115,10 +82606,10 @@
  200.148.25.60
  200.148.38.40
  200.149.1.106
-200.149.130.166
  200.149.214.6
  200.149.232.242
  200.149.244.202
+200.150.106.205
  200.150.114.227
  200.150.124.3
  200.150.129.62
@@ -81128,6 +82619,7 @@
  200.150.82.106
  200.150.86.130
  200.150.86.138
+200.152.107.104
  200.152.70.103
  200.152.70.192
  200.152.78.48
@@ -81136,14 +82628,13 @@
  200.155.57.213
  200.155.74.81
  200.158.124.146
-200.159.1.218
  200.159.105.20
  200.159.131.50
-200.159.137.111
  200.159.161.147
  200.159.224.122
  200.159.250.2
  200.159.91.130
+200.160.93.121
  200.161.143.194
  200.162.128.211
  200.162.171.247
@@ -81152,11 +82643,15 @@
  200.163.38.163
  200.164.85.245
  200.165.79.34
+200.166.77.130
  200.167.191.101
  200.169.218.172
+200.169.6.206
  200.17.13.3
  200.17.172.35
+200.17.173.1
  200.170.155.204
+200.170.162.153
  200.170.182.45
  200.170.248.190
  200.171.241.71
@@ -81166,9 +82661,11 @@
  200.175.166.98
  200.175.172.189
  200.175.180.116
+200.175.185.54
  200.175.239.226
  200.178.119.18
  200.178.251.146
+200.181.173.134
  200.182.18.82
  200.186.127.210
  200.187.127.8
@@ -81182,7 +82679,6 @@
  200.188.6.177
  200.19.254.179
  200.192.131.74
-200.192.212.131
  200.192.247.166
  200.193.101.106
  200.193.152.216
@@ -81190,10 +82686,10 @@
  200.194.35.136
  200.194.4.24
  200.194.42.162
-200.195.135.3
  200.195.136.12
  200.195.148.18
  200.195.156.242
+200.195.174.228
  200.195.55.186
  200.195.85.142
  200.196.249.170
@@ -81204,6 +82700,7 @@
  200.199.114.226
  200.199.227.195
  200.199.232.166
+200.199.250.170
  200.199.38.234
  200.199.8.113
  200.199.8.114
@@ -81218,7 +82715,6 @@
  200.20.186.254
  200.201.180.130
  200.201.200.52
-200.201.217.251
  200.203.104.18
  200.203.123.32
  200.203.123.34
@@ -81231,6 +82727,7 @@
  200.204.230.95
  200.205.134.107
  200.205.174.66
+200.206.50.66
  200.206.63.34
  200.206.81.154
  200.207.148.135
@@ -81247,9 +82744,11 @@
  200.212.2.94
  200.216.239.231
  200.216.30.196
+200.216.31.148
  200.216.77.154
  200.217.168.98
  200.217.191.130
+200.217.221.11
  200.219.207.42
  200.219.77.150
  200.220.202.1
@@ -81264,6 +82763,7 @@
  200.228.35.10
  200.228.86.78
  200.229.147.1
+200.229.194.158
  200.229.218.9
  200.229.227.201
  200.229.90.210
@@ -81274,7 +82774,9 @@
  200.233.163.65
  200.233.186.57
  200.233.186.58
+200.233.225.98
  200.233.248.46
+200.233.253.128
  200.236.221.242
  200.238.102.225
  200.238.216.228
@@ -81319,10 +82821,12 @@
  200.27.18.138
  200.27.18.242
  200.27.212.22
+200.27.38.106
  200.27.49.157
  200.27.71.123
  200.27.96.66
  200.29.10.15
+200.29.105.12
  200.29.109.112
  200.29.109.193
  200.29.115.162
@@ -81334,6 +82838,7 @@
  200.29.248.26
  200.29.248.57
  200.29.254.1
+200.29.66.133
  200.29.90.110
  200.3.252.242
  200.30.245.24
@@ -81348,6 +82853,7 @@
  200.33.152.207
  200.34.227.204
  200.35.145.133
+200.35.194.138
  200.35.43.57
  200.35.49.50
  200.35.49.89
@@ -81361,10 +82867,11 @@
  200.37.200.178
  200.37.202.19
  200.37.251.195
+200.37.35.178
+200.38.229.35
  200.38.232.248
  200.38.79.134
  200.39.241.64
-200.4.195.70
  200.40.42.54
  200.40.86.142
  200.41.121.69
@@ -81376,6 +82883,7 @@
  200.42.153.216
  200.42.174.109
  200.42.61.141
+200.43.245.50
  200.44.158.226
  200.44.50.155
  200.44.79.120
@@ -81396,6 +82904,7 @@
  200.5.251.5
  200.5.251.6
  200.5.32.217
+200.5.63.100
  200.51.94.251
  200.52.140.145
  200.52.140.148
@@ -81404,14 +82913,17 @@
  200.52.221.18
  200.52.67.82
  200.52.80.34
+200.53.20.238
  200.53.216.153
  200.53.217.25
  200.54.108.54
  200.54.167.253
  200.54.170.198
  200.54.183.234
+200.54.194.13
  200.54.218.188
  200.54.221.202
+200.54.242.46
  200.54.247.98
  200.54.51.124
  200.54.56.107
@@ -81423,7 +82935,6 @@
  200.55.140.181
  200.55.198.66
  200.55.208.196
-200.55.218.202
  200.55.243.138
  200.56.17.5
  200.56.60.157
@@ -81447,7 +82958,7 @@
  200.6.122.228
  200.6.136.235
  200.6.137.235
-200.6.140.49
+200.6.168.67
  200.6.168.70
  200.6.168.86
  200.6.169.122
@@ -81460,25 +82971,27 @@
  200.60.117.2
  200.60.132.74
  200.60.146.5
+200.60.60.84
+200.60.71.10
  200.60.78.174
  200.60.79.11
  200.60.91.42
  200.60.97.194
  200.60.97.196
+200.60.97.66
  200.61.181.65
  200.61.181.72
  200.61.185.200
+200.61.243.82
  200.62.99.4
  200.63.201.161
  200.63.201.163
  200.66.112.6
  200.66.112.9
-200.66.116.31
  200.66.117.93
  200.66.77.178
+200.66.82.250
  200.68.13.26
-200.68.138.41
-200.68.179.189
  200.68.2.10
  200.68.230.193
  200.68.230.197
@@ -81491,11 +83004,10 @@
  200.68.8.77
  200.68.87.164
  200.69.102.223
-200.69.141.210
+200.69.218.197
  200.69.224.73
  200.69.236.172
  200.69.39.6
-200.69.77.12
  200.69.81.10
  200.69.81.198
  200.69.83.54
@@ -81504,10 +83016,13 @@
  200.7.118.10
  200.7.120.212
  200.7.149.112
+200.7.193.229
  200.7.197.65
  200.7.197.69
  200.7.198.66
+200.7.219.137
  200.7.252.118
+200.7.8.3
  200.7.9.33
  200.7.98.102
  200.70.22.77
@@ -81515,6 +83030,7 @@
  200.71.122.54
  200.71.186.58
  200.71.190.205
+200.71.191.57
  200.71.237.250
  200.71.72.14
  200.71.72.201
@@ -81549,6 +83065,7 @@
  200.73.129.6
  200.73.130.156
  200.73.130.160
+200.73.130.62
  200.73.131.100
  200.73.131.156
  200.73.131.186
@@ -81560,9 +83077,9 @@
  200.74.89.85
  200.75.10.86
  200.75.104.206
+200.75.112.151
  200.75.133.60
  200.75.18.139
-200.75.241.206
  200.75.249.38
  200.75.45.67
  200.75.48.85
@@ -81578,6 +83095,7 @@
  200.77.186.182
  200.77.186.195
  200.77.186.198
+200.77.186.199
  200.77.186.205
  200.77.186.206
  200.77.186.208
@@ -81586,7 +83104,6 @@
  200.77.186.212
  200.77.186.218
  200.77.186.219
-200.79.176.177
  200.8.127.73
  200.8.178.50
  200.8.178.74
@@ -81606,6 +83123,7 @@
  200.81.190.13
  200.82.170.231
  200.83.133.77
+200.83.159.32
  200.83.166.136
  200.83.202.237
  200.83.3.52
@@ -81641,6 +83159,7 @@
  200.89.125.254
  200.89.125.94
  200.89.129.233
+200.89.154.99
  200.89.159.178
  200.89.159.190
  200.89.159.240
@@ -81655,6 +83174,7 @@
  200.89.178.79
  200.89.99.226
  200.9.132.245
+200.9.155.198
  200.91.131.48
  200.91.160.238
  200.91.167.146
@@ -81671,7 +83191,6 @@
  200.93.8.23
  200.94.140.50
  200.94.147.244
-200.95.170.92
  200.95.184.2
  200.95.197.70
  200.95.209.180
@@ -81698,21 +83217,22 @@
  2009941992.z13.web.core.windows.net
  2009sanchezsupplicate.com
  201.10.169.191
-201.102.218.101
  201.102.56.105
+201.102.59.240
  201.102.89.43
  201.103.171.252
  201.103.50.210
  201.103.74.18
  201.103.85.230
+201.105.155.35
  201.105.43.108
  201.105.90.168
  201.106.32.171
-201.106.52.125
  201.106.68.179
  201.106.95.131
  201.108.118.5
  201.108.2.179
+201.11.70.28
  201.110.189.228
  201.110.190.124
  201.110.196.203
@@ -81720,11 +83240,13 @@
  201.110.34.191
  201.110.49.42
  201.110.8.37
+201.111.133.76
  201.111.15.213
  201.111.27.86
  201.116.101.130
  201.116.184.243
  201.116.194.210
+201.116.202.181
  201.116.227.194
  201.116.52.104
  201.117.138.69
@@ -81733,8 +83255,7 @@
  201.123.134.168
  201.123.180.9
  201.123.35.234
-201.124.64.125
-201.124.71.45
+201.123.98.203
  201.128.132.254
  201.128.148.194
  201.128.204.26
@@ -81743,7 +83264,6 @@
  201.130.97.252
  201.131.126.17
  201.131.185.2
-201.131.203.90
  201.131.244.44
  201.131.32.25
  201.131.32.4
@@ -81774,18 +83294,17 @@
  201.140.176.114
  201.140.245.152
  201.141.53.87
+201.142.169.153
  201.142.182.168
  201.142.225.244
+201.142.233.199
  201.142.244.166
  201.142.246.237
  201.143.236.251
-201.144.107.146
  201.144.206.244
  201.144.234.22
  201.144.235.49
  201.144.48.73
-201.145.122.154
-201.145.124.116
  201.145.138.159
  201.145.169.101
  201.145.171.86
@@ -81796,12 +83315,14 @@
  201.148.126.38
  201.148.157.226
  201.148.216.131
-201.148.247.75
  201.148.252.22
+201.148.5.245
  201.148.71.65
  201.149.119.133
  201.149.12.242
+201.149.13.58
  201.149.20.161
+201.149.20.162
  201.149.21.180
  201.149.26.51
  201.149.3.102
@@ -81813,13 +83334,11 @@
  201.149.69.218
  201.149.83.179
  201.15.121.73
-201.15.76.160
  201.150.230.221
  201.150.252.218
  201.150.34.28
  201.150.37.178
  201.150.52.32
-201.150.52.33
  201.152.149.29
  201.155.182.49
  201.155.192.248
@@ -81831,7 +83350,6 @@
  201.159.112.70
  201.159.179.164
  201.159.18.139
-201.159.189.40
  201.159.95.101
  201.159.95.105
  201.159.95.113
@@ -81839,13 +83357,14 @@
  201.159.95.125
  201.159.95.193
  201.159.95.94
+201.16.144.197
  201.16.150.113
  201.16.155.138
  201.16.166.145
  201.16.179.121
+201.16.203.147
  201.16.206.100
  201.16.228.170
-201.160.130.89
  201.161.223.150
  201.161.37.93
  201.162.105.43
@@ -81853,6 +83372,7 @@
  201.163.162.179
  201.163.180.183
  201.163.239.132
+201.163.52.106
  201.163.74.202
  201.163.74.203
  201.163.98.162
@@ -81867,9 +83387,9 @@
  201.168.125.66
  201.168.152.106
  201.17.124.140
-201.17.130.156
  201.17.135.121
  201.17.78.79
+201.170.1.88
  201.170.146.158
  201.170.205.8
  201.170.243.149
@@ -81881,7 +83401,6 @@
  201.171.150.41
  201.171.244.130
  201.171.67.196
-201.171.85.139
  201.172.77.247
  201.172.89.164
  201.172.92.101
@@ -81899,7 +83418,9 @@
  201.174.127.62
  201.174.134.196
  201.174.134.197
+201.174.138.18
  201.174.182.158
+201.174.182.159
  201.174.185.26
  201.174.2.158
  201.174.28.235
@@ -81907,24 +83428,19 @@
  201.174.75.250
  201.175.113.237
  201.175.17.129
-201.175.202.31
-201.175.203.244
-201.175.203.245
-201.175.203.47
  201.175.73.218
-201.176.103.200
+201.176.209.15
  201.178.199.188
-201.179.153.54
  201.179.17.197
  201.179.52.230
  201.179.91.39
  201.179.96.207
  201.18.237.254
-201.18.86.78
  201.18.88.150
  201.182.120.230
  201.182.180.28
  201.182.214.190
+201.182.214.63
  201.182.33.124
  201.182.5.17
  201.182.88.10
@@ -81940,7 +83456,6 @@
  201.184.128.134
  201.184.130.194
  201.184.135.155
-201.184.145.59
  201.184.145.92
  201.184.151.58
  201.184.152.138
@@ -81954,6 +83469,7 @@
  201.184.43.99
  201.184.75.210
  201.186.13.184
+201.186.134.6
  201.186.202.146
  201.187.103.18
  201.187.106.222
@@ -81966,7 +83482,6 @@
  201.192.136.240
  201.192.138.219
  201.193.180.14
-201.193.60.210
  201.196.15.79
  201.196.89.111
  201.199.93.54
@@ -81975,6 +83490,7 @@
  201.20.106.186
  201.20.107.94
  201.20.113.210
+201.20.170.186
  201.20.186.33
  201.20.64.37
  201.20.65.221
@@ -82000,6 +83516,7 @@
  201.21.87.173
  201.21.87.86
  201.210.197.79
+201.211.156.106
  201.211.255.148
  201.211.31.45
  201.211.55.112
@@ -82018,7 +83535,6 @@
  201.213.231.77
  201.213.32.59
  201.213.52.131
-201.215.1.99
  201.215.208.78
  201.216.110.186
  201.216.110.67
@@ -82031,7 +83547,6 @@
  201.217.51.246
  201.217.51.9
  201.217.55.97
-201.217.64.18
  201.217.71.122
  201.218.125.150
  201.218.202.198
@@ -82040,7 +83555,6 @@
  201.218.228.226
  201.218.237.98
  201.218.238.101
-201.218.252.236
  201.219.10.210
  201.219.197.138
  201.219.197.50
@@ -82049,7 +83563,6 @@
  201.219.217.70
  201.219.220.205
  201.22.114.150
-201.22.166.54
  201.22.208.69
  201.22.229.5
  201.22.82.202
@@ -82081,10 +83594,13 @@
  201.230.244.16
  201.230.29.84
  201.231.111.53
+201.231.115.87
+201.231.175.63
  201.231.47.58
  201.231.84.107
  201.231.94.130
  201.232.54.48
+201.233.12.44
  201.234.119.228
  201.234.119.98
  201.234.185.147
@@ -82096,6 +83612,7 @@
  201.234.66.133
  201.234.81.181
  201.235.10.215
+201.235.169.59
  201.235.2.36
  201.236.1.51
  201.236.103.75
@@ -82105,7 +83622,6 @@
  201.236.143.243
  201.236.160.122
  201.236.160.142
-201.236.189.66
  201.236.200.242
  201.237.231.196
  201.238.181.231
@@ -82118,12 +83634,12 @@
  201.241.127.190
  201.241.41.68
  201.242.89.88
+201.243.65.147
  201.243.65.148
  201.243.65.150
  201.243.66.155
  201.244.0.47
  201.244.0.78
-201.244.110.150
  201.244.117.218
  201.244.121.146
  201.244.141.167
@@ -82132,7 +83648,7 @@
  201.244.163.205
  201.244.213.9
  201.244.214.162
-201.247.58.206
+201.247.72.102
  201.248.243.133
  201.249.146.101
  201.249.176.74
@@ -82145,7 +83661,9 @@
  201.250.47.180
  201.251.63.208
  201.252.85.48
+201.254.168.194
  201.255.0.137
+201.255.60.69
  201.26.143.133
  201.26.16.165
  201.26.174.39
@@ -82155,7 +83673,7 @@
  201.27.31.184
  201.27.37.224
  201.27.92.209
-201.28.135.246
+201.28.105.213
  201.28.61.250
  201.28.87.42
  201.28.87.43
@@ -82166,6 +83684,7 @@
  201.33.170.25
  201.33.228.154
  201.33.23.186
+201.34.192.148
  201.35.168.225
  201.35.168.227
  201.35.168.253
@@ -82180,6 +83699,7 @@
  201.42.114.190
  201.42.17.187
  201.42.2.205
+201.43.172.134
  201.43.83.50
  201.46.248.157
  201.46.28.100
@@ -82188,25 +83708,29 @@
  201.46.39.6
  201.46.65.125
  201.47.227.125
+201.47.46.38
  201.48.115.235
+201.48.115.236
  201.48.182.242
  201.48.184.157
  201.48.192.60
-201.48.220.89
  201.48.28.2
+201.48.34.195
  201.48.34.200
  201.48.40.153
  201.48.62.65
  201.48.80.49
+201.49.110.210
  201.49.115.117
  201.49.239.200
-201.49.58.234
  201.49.89.221
  201.50.38.189
+201.51.176.147
+201.54.106.17
  201.54.254.9
  201.55.103.34
+201.55.142.144
  201.55.159.102
-201.55.159.80
  201.55.201.246
  201.55.91.6
  201.59.201.92
@@ -82222,6 +83746,7 @@
  201.62.56.49
  201.62.73.92
  201.65.121.66
+201.66.102.117
  201.66.163.250
  201.66.199.247
  201.67.77.216
@@ -82242,14 +83767,17 @@
  201.71.155.55
  201.71.225.18
  201.71.228.86
+201.71.32.126
  201.72.190.98
  201.75.196.96
  201.75.2.185
  201.75.3.43
  201.75.52.210
+201.75.53.218
+201.76.120.220
  201.76.149.82
  201.76.9.56
-201.79.79.117
+201.77.130.3
  201.80.32.7
  201.80.45.116
  201.80.54.151
@@ -82276,6 +83804,7 @@
  201.92.54.139
  201.93.156.35
  201.93.159.234
+201.93.226.12
  201.93.243.200
  201.95.12.210
  201.95.72.139
@@ -82330,6 +83859,7 @@
  202.102.67.183
  202.102.67.184
  202.102.90.21
+202.103.176.67
  202.103.222.10
  202.103.238.138
  202.103.241.233
@@ -82344,6 +83874,7 @@
  202.105.238.100
  202.105.247.62
  202.105.247.84
+202.105.47.238
  202.105.98.210
  202.106.151.201
  202.106.151.223
@@ -82371,18 +83902,17 @@
  202.109.249.234
  202.110.253.130
  202.110.72.9
-202.110.77.28
-202.110.79.74
  202.110.83.126
  202.111.13.98
+202.111.130.152
  202.111.131.236
  202.111.162.2
-202.111.173.153
  202.111.173.59
  202.111.174.150
  202.111.185.3
  202.112.42.158
  202.112.51.45
+202.113.48.250
  202.113.65.13
  202.113.80.58
  202.114.176.199
@@ -82398,6 +83928,7 @@
  202.118.30.90
  202.118.8.30
  202.118.8.44
+202.118.8.50
  202.118.8.53
  202.118.8.54
  202.118.8.61
@@ -82410,6 +83941,7 @@
  202.120.184.75
  202.120.20.4
  202.120.234.134
+202.120.38.3
  202.121.138.74
  202.121.174.4
  202.121.174.96
@@ -82436,6 +83968,7 @@
  202.129.184.10
  202.129.189.58
  202.129.191.170
+202.129.196.242
  202.129.206.226
  202.129.207.197
  202.129.207.4
@@ -82454,16 +83987,19 @@
  202.131.233.122
  202.131.233.202
  202.131.234.142
+202.133.2.162
  202.133.4.49
  202.133.4.53
  202.133.4.57
  202.133.63.9
  202.134.0.9
+202.134.160.99
  202.134.180.50
  202.134.31.82
  202.134.4.211
  202.134.4.216
  202.134.61.41
+202.134.81.252
  202.136.120.62
  202.136.123.254
  202.136.124.38
@@ -82475,25 +84011,23 @@
  202.137.10.182
  202.137.116.125
  202.137.116.7
+202.137.124.210
  202.137.134.139
  202.137.134.190
  202.137.141.11
+202.137.141.98
+202.137.142.159
  202.137.142.28
  202.137.154.125
  202.137.154.138
  202.137.154.154
  202.137.154.62
-202.137.155.142
-202.137.155.148
+202.137.155.146
  202.137.155.161
-202.137.155.171
-202.137.155.181
  202.137.155.212
  202.137.155.22
  202.137.155.228
  202.137.155.234
-202.137.155.68
-202.137.155.78
  202.137.155.95
  202.137.159.132
  202.137.172.76
@@ -82503,7 +84037,6 @@
  202.137.26.4
  202.137.26.6
  202.137.26.8
-202.137.28.92
  202.137.5.98
  202.137.7.58
  202.138.233.162
@@ -82519,6 +84052,7 @@
  202.138.249.244
  202.138.254.154
  202.14.5.188
+202.140.208.24
  202.140.47.114
  202.141.225.174
  202.141.226.124
@@ -82542,11 +84076,11 @@
  202.142.162.186
  202.142.172.10
  202.142.178.114
-202.142.178.98
-202.142.189.138
  202.142.193.72
  202.142.215.25
+202.142.73.59
  202.143.111.42
+202.143.120.105
  202.143.120.57
  202.143.121.245
  202.143.127.163
@@ -82562,8 +84096,8 @@
  202.144.201.38
  202.146.217.195
  202.146.217.221
+202.146.221.81
  202.146.222.249
-202.146.235.79
  202.146.245.156
  202.147.192.134
  202.147.192.242
@@ -82584,14 +84118,13 @@
  202.150.155.222
  202.150.176.100
  202.150.177.105
-202.150.177.2
-202.150.180.188
  202.150.181.58
  202.150.182.28
  202.150.216.211
  202.151.163.10
  202.151.27.177
  202.152.1.89
+202.152.10.211
  202.152.149.26
  202.152.15.12
  202.152.21.213
@@ -82608,6 +84141,7 @@
  202.153.103.135
  202.153.37.194
  202.153.37.196
+202.153.37.205
  202.154.180.51
  202.154.180.53
  202.154.182.234
@@ -82615,12 +84149,11 @@
  202.154.189.149
  202.154.191.106
  202.154.191.58
-202.154.58.243
  202.155.208.243
  202.155.211.226
  202.155.228.207
  202.155.248.196
-202.157.176.154
+202.157.185.117
  202.158.11.92
  202.158.244.34
  202.158.247.170
@@ -82634,7 +84167,6 @@
  202.159.107.1
  202.159.107.137
  202.159.107.209
-202.159.107.97
  202.159.121.145
  202.159.121.209
  202.159.121.225
@@ -82670,7 +84202,6 @@
  202.159.37.14
  202.159.60.113
  202.159.60.137
-202.159.60.145
  202.159.60.17
  202.159.60.65
  202.160.132.115
@@ -82697,11 +84228,9 @@
  202.162.219.12
  202.162.79.202
  202.163.101.11
-202.163.101.69
  202.163.76.169
  202.164.131.74
  202.164.136.47
-202.164.137.103
  202.164.138.17
  202.164.138.212
  202.164.138.225
@@ -82720,18 +84249,19 @@
  202.164.49.210
  202.164.49.211
  202.165.22.108
+202.165.22.116
  202.165.22.135
  202.165.22.141
  202.165.22.158
  202.165.22.161
+202.165.22.221
  202.165.22.33
  202.165.22.5
  202.165.22.52
+202.165.22.75
  202.165.228.161
  202.165.228.225
  202.165.234.143
-202.165.234.185
-202.165.247.241
  202.166.14.60
  202.166.149.117
  202.166.163.222
@@ -82739,6 +84269,7 @@
  202.166.164.125
  202.166.164.126
  202.166.174.218
+202.166.183.215
  202.166.196.34
  202.166.196.6
  202.166.198.206
@@ -82774,9 +84305,11 @@
  202.168.159.54
  202.168.186.98
  202.168.189.90
+202.168.205.181
  202.168.225.141
  202.169.104.188
  202.169.240.54
+202.169.243.72
  202.169.244.178
  202.169.32.138
  202.169.35.210
@@ -82786,7 +84319,6 @@
  202.169.45.20
  202.169.46.52
  202.169.53.11
-202.169.56.11
  202.169.59.118
  202.170.121.201
  202.170.57.253
@@ -82794,6 +84326,7 @@
  202.171.253.105
  202.171.253.74
  202.172.32.247
+202.173.127.133
  202.174.46.174
  202.175.105.186
  202.175.187.74
@@ -82802,7 +84335,6 @@
  202.176.4.231
  202.177.233.128
  202.177.244.68
-202.178.113.220
  202.178.113.221
  202.178.113.222
  202.178.123.122
@@ -82822,7 +84354,6 @@
  202.182.109.112
  202.182.112.26
  202.182.117.2
-202.182.127.98
  202.182.48.86
  202.182.54.186
  202.182.59.188
@@ -82838,6 +84369,8 @@
  202.183.32.182
  202.183.32.185
  202.184.127.159
+202.184.167.7
+202.184.30.216
  202.184.49.189
  202.184.56.181
  202.185.35.248
@@ -82850,13 +84383,14 @@
  202.187.159.109
  202.187.163.54
  202.187.186.23
+202.187.195.37
  202.187.20.237
  202.187.244.23
  202.187.252.250
-202.187.31.20
  202.187.45.64
  202.187.83.182
  202.187.87.219
+202.188.101.106
  202.188.101.4
  202.188.20.123
  202.188.20.126
@@ -82865,7 +84399,6 @@
  202.191.120.12
  202.191.121.12
  202.191.122.62
-202.191.125.238
  202.191.126.100
  202.191.126.60
  202.191.127.121
@@ -82874,15 +84407,14 @@
  202.191.56.154
  202.192.34.106
  202.195.100.158
-202.195.237.213
  202.197.208.89
  202.200.144.150
  202.201.0.144
  202.201.12.119
  202.201.12.133
  202.201.13.134
-202.201.15.108
  202.204.179.181
+202.205.160.242
  202.207.15.211
  202.207.7.33
  202.208.223.251
@@ -82941,18 +84473,18 @@
  202.29.33.111
  202.29.39.234
  202.29.4.97
+202.29.51.61
  202.29.57.22
  202.29.80.133
  202.29.86.7
  202.29.95.12
-202.3.72.125
  202.3.72.17
  202.3.72.50
  202.30.130.199
  202.30.198.28
  202.32.40.50
+202.38.153.233
  202.38.181.171
-202.38.182.221
  202.38.224.23
  202.39.134.198
  202.39.151.229
@@ -82973,24 +84505,23 @@
  202.40.188.201
  202.40.188.90
  202.40.188.94
-202.40.190.62
  202.40.191.121
  202.43.112.34
  202.43.112.37
  202.43.112.78
+202.43.112.81
  202.43.113.173
  202.43.113.2
+202.43.113.69
  202.43.113.78
  202.43.117.134
  202.43.160.142
  202.43.183.158
-202.43.183.210
  202.43.183.98
  202.43.190.11
  202.43.191.10
  202.43.191.14
  202.43.34.50
-202.44.194.78
  202.44.213.159
  202.44.215.89
  202.44.240.6
@@ -83022,7 +84553,6 @@
  202.5.54.76
  202.5.56.33
  202.5.56.71
-202.5.59.25
  202.51.100.33
  202.51.102.17
  202.51.106.161
@@ -83039,25 +84569,24 @@
  202.51.118.42
  202.51.120.22
  202.51.178.126
-202.51.184.237
  202.51.188.170
  202.51.189.122
  202.51.189.134
-202.51.190.18
  202.51.190.36
+202.51.74.92
  202.51.87.227
-202.51.89.102
+202.51.87.64
  202.51.96.49
  202.52.146.71
  202.52.234.236
  202.52.244.150
-202.52.244.27
  202.52.248.254
  202.52.4.151
  202.52.58.37
  202.53.138.233
  202.53.160.50
  202.53.169.17
+202.53.171.18
  202.53.64.249
  202.53.8.82
  202.53.95.156
@@ -83102,7 +84631,6 @@
  202.58.108.81
  202.58.108.86
  202.58.204.150
-202.59.12.141
  202.59.166.146
  202.59.173.204
  202.59.78.182
@@ -83122,7 +84650,6 @@
  202.61.49.52
  202.61.87.57
  202.62.10.250
-202.62.102.196
  202.62.107.135
  202.62.11.106
  202.62.13.72
@@ -83142,9 +84669,8 @@
  202.62.45.53
  202.62.50.51
  202.62.50.81
-202.62.51.42
  202.62.59.113
-202.62.67.209
+202.62.65.58
  202.62.78.46
  202.62.84.210
  202.62.88.185
@@ -83166,20 +84692,21 @@
  202.66.135.111
  202.66.177.181
  202.67.153.114
-202.67.98.13
  202.67.98.72
  202.69.105.18
  202.69.171.51
  202.69.171.52
  202.69.38.115
  202.69.38.237
+202.69.45.22
  202.69.59.170
  202.69.59.69
-202.70.136.100
  202.70.136.160
  202.70.34.82
+202.70.37.2
  202.70.44.195
  202.70.65.229
+202.70.66.228
  202.70.72.217
  202.70.72.233
  202.70.80.73
@@ -83195,15 +84722,17 @@
  202.72.225.17
  202.72.233.18
  202.72.242.242
+202.72.243.198
  202.73.14.54
  202.73.14.58
+202.73.24.50
  202.73.50.242
  202.73.51.102
  202.73.58.54
  202.73.58.56
  202.74.243.112
  202.74.243.38
-202.75.111.73
+202.75.111.74
  202.75.211.206
  202.75.212.131
  202.75.217.236
@@ -83229,13 +84758,11 @@
  202.79.167.65
  202.79.169.57
  202.79.174.139
-202.79.23.163
-202.79.23.181
-202.79.23.226
  202.79.34.167
  202.79.34.178
  202.79.34.242
  202.79.35.30
+202.79.35.47
  202.79.37.14
  202.79.40.97
  202.79.56.90
@@ -83249,25 +84776,24 @@
  202.82.218.169
  202.82.59.237
  202.83.120.211
+202.83.122.108
+202.83.161.117
  202.83.168.97
  202.83.172.218
  202.83.172.245
  202.83.172.43
  202.83.174.34
  202.83.25.83
-202.83.36.114
  202.83.36.244
  202.83.36.32
  202.83.37.125
  202.83.37.13
  202.83.37.131
  202.83.38.13
-202.83.38.136
  202.83.39.66
  202.83.54.167
  202.83.55.19
  202.83.56.236
-202.83.57.65
  202.83.58.2
  202.83.58.46
  202.83.59.234
@@ -83275,17 +84801,17 @@
  202.84.42.69
  202.84.44.227
  202.85.208.217
+202.85.219.61
  202.85.222.103
  202.85.222.107
  202.85.223.185
  202.85.223.236
+202.85.223.248
  202.85.223.40
  202.85.223.74
  202.85.3.138
-202.86.127.113
  202.86.184.58
  202.86.217.90
-202.86.218.226
  202.86.218.27
  202.87.222.27
  202.87.222.28
@@ -83309,16 +84835,15 @@
  202.88.174.4
  202.88.216.242
  202.88.223.70
-202.88.233.136
  202.88.239.11
  202.88.241.118
  202.88.243.254
  202.88.251.98
  202.89.117.171
-202.89.138.225
  202.9.38.20
  202.9.39.139
  202.90.199.158
+202.90.199.206
  202.91.15.3
  202.91.232.39
  202.91.238.45
@@ -83341,7 +84866,6 @@
  202.92.128.181
  202.92.199.86
  202.92.4.129
-202.93.153.242
  202.93.153.253
  202.93.227.14
  202.93.229.99
@@ -83350,7 +84874,9 @@
  202.94.175.110
  202.94.175.118
  202.94.175.126
+202.94.175.212
  202.94.175.33
+202.94.175.35
  202.94.175.7
  202.94.175.87
  202.95.11.253
@@ -83375,6 +84901,7 @@
  202.98.252.213
  202.98.38.185
  202.98.38.187
+202.98.60.212
  202.98.80.187
  202.98.89.132
  202.99.167.133
@@ -83624,7 +85151,9 @@
  203.0.108.2
  203.10.58.4
  203.100.165.2
+203.100.77.229
  203.101.174.175
+203.101.178.13
  203.101.178.179
  203.101.178.68
  203.106.164.74
@@ -83639,12 +85168,14 @@
  203.11.71.1
  203.110.163.205
  203.110.164.139
+203.110.215.167
  203.110.86.24
  203.110.86.69
  203.110.86.71
  203.110.86.82
  203.110.86.94
  203.110.87.139
+203.110.94.131
  203.110.95.84
  203.110.95.92
  203.110.95.94
@@ -83656,6 +85187,7 @@
  203.112.218.83
  203.113.10.153
  203.113.135.199
+203.113.173.121
  203.113.174.47
  203.114.102.115
  203.114.102.157
@@ -83673,6 +85205,7 @@
  203.115.131.17
  203.115.99.189
  203.116.184.242
+203.116.190.98
  203.122.225.70
  203.122.226.250
  203.122.26.98
@@ -83683,7 +85216,6 @@
  203.124.32.202
  203.125.16.18
  203.125.73.70
-203.127.84.212
  203.127.92.151
  203.128.170.18
  203.128.172.89
@@ -83702,11 +85234,11 @@
  203.129.113.132
  203.129.113.142
  203.129.197.98
+203.129.218.76
  203.129.220.182
  203.129.225.66
  203.130.0.69
  203.130.1.162
-203.130.1.58
  203.130.130.40
  203.130.2.13
  203.130.215.147
@@ -83724,7 +85256,7 @@
  203.134.213.101
  203.135.20.36
  203.135.63.30
-203.137.78.136
+203.137.119.217
  203.141.155.139
  203.142.34.36
  203.142.38.26
@@ -83734,7 +85266,6 @@
  203.142.70.222
  203.142.76.171
  203.144.133.5
-203.144.233.115
  203.145.233.251
  203.146.100.227
  203.146.127.133
@@ -83743,7 +85274,6 @@
  203.146.21.244
  203.146.21.248
  203.147.62.92
-203.147.78.171
  203.147.90.25
  203.147.90.49
  203.148.20.162
@@ -83752,8 +85282,9 @@
  203.150.107.122
  203.150.107.167
  203.150.107.77
-203.150.113.104
+203.150.113.58
  203.150.137.94
+203.150.155.26
  203.150.157.74
  203.150.176.107
  203.150.225.2
@@ -83771,7 +85302,6 @@
  203.151.169.63
  203.151.169.64
  203.151.20.19
-203.151.214.33
  203.151.215.130
  203.151.81.77
  203.152.167.41
@@ -83781,9 +85311,11 @@
  203.153.109.150
  203.153.113.226
  203.153.119.242
+203.153.194.10
  203.153.20.64
  203.153.216.178
  203.153.216.189
+203.153.22.233
  203.153.25.126
  203.153.28.2
  203.153.99.169
@@ -83791,7 +85323,6 @@
  203.154.232.182
  203.154.78.176
  203.156.198.210
-203.156.203.35
  203.156.205.125
  203.156.205.55
  203.158.136.31
@@ -83800,11 +85331,11 @@
  203.158.177.71
  203.159.249.215
  203.160.1.76
-203.160.161.108
  203.160.165.18
  203.160.189.106
  203.160.189.202
  203.160.55.126
+203.160.55.200
  203.160.57.193
  203.160.57.39
  203.160.57.43
@@ -83856,7 +85387,6 @@
  203.170.112.16
  203.170.112.3
  203.170.121.115
-203.170.203.66
  203.170.58.241
  203.170.59.244
  203.170.65.155
@@ -83865,7 +85395,6 @@
  203.170.66.161
  203.170.66.173
  203.170.66.185
-203.170.66.186
  203.170.66.209
  203.170.66.217
  203.170.66.221
@@ -83875,6 +85404,7 @@
  203.170.66.49
  203.170.66.57
  203.170.67.109
+203.170.67.145
  203.170.67.157
  203.170.67.169
  203.170.67.17
@@ -83905,34 +85435,47 @@
  203.171.31.156
  203.172.162.163
  203.172.64.145
+203.172.66.216
+203.172.66.227
  203.172.76.4
+203.173.153.76
+203.173.92.102
  203.173.92.229
  203.173.92.250
  203.173.92.254
  203.173.94.2
+203.173.94.94
  203.174.13.158
  203.174.36.147
  203.174.56.230
  203.175.162.60
  203.175.79.46
+203.176.132.50
  203.176.135.102
  203.176.135.38
  203.176.135.98
  203.176.137.206
  203.176.138.222
+203.176.140.78
  203.176.176.130
  203.176.180.194
+203.176.74.228
  203.176.75.1
  203.176.78.120
  203.176.88.244
  203.177.135.133
  203.177.156.249
+203.177.159.170
  203.177.237.46
  203.177.71.203
  203.177.76.173
  203.177.83.179
+203.179.89.186
  203.180.218.175
+203.183.68.135
+203.184.132.153
  203.184.132.189
+203.184.132.190
  203.184.132.191
  203.184.55.57
  203.185.129.36
@@ -83943,14 +85486,15 @@
  203.188.246.194
  203.188.248.252
  203.188.255.179
+203.188.255.46
  203.188.255.74
-203.189.116.72
  203.189.135.7
  203.189.141.214
  203.189.141.56
  203.189.142.33
  203.189.143.204
  203.189.146.230
+203.189.151.143
  203.189.153.225
  203.189.154.243
  203.189.200.118
@@ -83961,7 +85505,6 @@
  203.19.88.51
  203.19.88.59
  203.19.92.3
-203.190.11.38
  203.190.116.140
  203.190.117.232
  203.190.12.187
@@ -83980,7 +85523,6 @@
  203.191.150.32
  203.192.199.74
  203.192.204.168
-203.192.208.194
  203.192.212.165
  203.192.219.7
  203.192.224.3
@@ -83989,7 +85531,7 @@
  203.192.25.1
  203.192.255.27
  203.192.81.220
-203.193.135.99
+203.193.156.126
  203.193.160.51
  203.193.184.35
  203.193.191.122
@@ -83998,21 +85540,26 @@
  203.195.130.233
  203.195.132.128
  203.195.134.30
+203.195.136.130
  203.195.138.190
  203.195.141.18
  203.195.144.114
+203.195.148.210
  203.195.150.131
  203.195.152.113
  203.195.154.146
+203.195.155.143
  203.195.157.137
  203.195.163.239
  203.195.164.81
  203.195.169.75
  203.195.174.122
  203.195.175.47
+203.195.202.128
  203.195.204.122
  203.195.204.47
  203.195.205.202
+203.195.211.173
  203.195.220.71
  203.195.224.229
  203.195.229.168
@@ -84023,12 +85570,16 @@
  203.198.142.142
  203.198.149.96
  203.198.162.142
+203.198.41.73
  203.198.94.228
  203.199.238.249
  203.2.112.100
+203.2.118.84
  203.2.162.41
  203.2.64.146
  203.200.95.142
+203.201.61.42
+203.202.240.243
  203.202.243.198
  203.202.243.199
  203.202.245.211
@@ -84036,7 +85587,7 @@
  203.202.253.186
  203.203.34.107
  203.203.8.154
-203.204.185.25
+203.204.188.11
  203.204.219.12
  203.204.241.15
  203.205.0.80
@@ -84050,7 +85601,6 @@
  203.205.35.201
  203.205.37.233
  203.205.41.172
-203.205.53.58
  203.205.97.42
  203.206.167.242
  203.206.205.179
@@ -84059,6 +85609,7 @@
  203.208.65.96
  203.209.190.154
  203.209.190.202
+203.209.207.2
  203.210.149.193
  203.210.84.83
  203.210.87.62
@@ -84068,7 +85619,6 @@
  203.212.98.24
  203.213.119.246
  203.213.120.164
-203.213.244.156
  203.213.249.66
  203.213.66.170
  203.214.39.130
@@ -84080,6 +85630,7 @@
  203.217.109.182
  203.217.110.201
  203.217.112.214
+203.217.118.61
  203.217.140.77
  203.217.145.4
  203.217.169.217
@@ -84090,6 +85641,7 @@
  203.217.176.60
  203.217.56.212
  203.217.56.33
+203.217.89.225
  203.218.127.193
  203.218.132.12
  203.218.14.244
@@ -84102,29 +85654,30 @@
  203.218.44.219
  203.218.51.29
  203.218.58.106
+203.218.61.40
  203.218.66.34
  203.218.85.159
  203.219.101.156
  203.219.151.169
  203.22.204.107
-203.220.146.45
  203.220.59.222
  203.221.14.215
  203.222.1.135
  203.222.1.52
  203.222.14.155
+203.222.14.23
  203.222.16.66
  203.222.26.26
  203.223.171.129
  203.223.171.161
  203.223.171.185
+203.223.171.189
  203.223.191.66
  203.223.41.34
  203.223.44.102
  203.227.115.112
  203.227.115.166
  203.227.115.61
-203.227.161.144
  203.227.203.31
  203.227.206.134
  203.227.217.104
@@ -84151,6 +85704,7 @@
  203.236.100.30
  203.236.190.2
  203.236.190.28
+203.236.51.35
  203.237.203.241
  203.237.238.234
  203.238.181.224
@@ -84174,7 +85728,6 @@
  203.243.10.249
  203.243.140.110
  203.243.142.11
-203.243.142.132
  203.243.142.149
  203.243.142.45
  203.243.142.70
@@ -84219,22 +85772,21 @@
  203.45.112.244
  203.45.155.160
  203.45.171.181
-203.45.25.21
  203.46.223.176
  203.51.27.108
  203.55.117.211
  203.56.191.129
+203.56.228.178
  203.56.24.180
  203.56.4.47
  203.56.40.159
-203.56.95.25
  203.57.200.58
  203.57.229.254
  203.58.26.70
  203.59.72.40
  203.6.149.115
-203.6.210.119
-203.6.230.96
+203.6.149.195
+203.6.211.26
  203.62.185.131
  203.64.20.2
  203.64.230.117
@@ -84258,7 +85810,6 @@
  203.74.190.196
  203.75.169.31
  203.75.169.6
-203.76.101.246
  203.76.109.178
  203.76.110.163
  203.76.110.164
@@ -84287,11 +85838,11 @@
  203.78.144.13
  203.78.144.231
  203.78.146.114
+203.80.137.49
  203.80.170.130
  203.80.170.68
  203.80.171.121
  203.80.171.147
-203.80.183.10
  203.80.190.162
  203.80.191.18
  203.80.34.178
@@ -84311,6 +85862,7 @@
  203.83.184.54
  203.83.189.126
  203.83.234.158
+203.86.193.48
  203.86.7.110
  203.88.202.26
  203.89.96.176
@@ -84358,6 +85910,7 @@
  204.101.4.42
  204.101.61.82
  204.107.27.43
+204.109.18.160
  204.109.18.254
  204.11.17.16
  204.11.20.57
@@ -84385,7 +85938,6 @@
  204.132.129.234
  204.137.151.14
  204.137.177.132
-204.14.213.164
  204.14.63.55
  204.145.94.123
  204.145.94.154
@@ -84419,8 +85971,6 @@
  204.16.247.19
  204.16.247.28
  204.17.56.42
-204.18.110.141
-204.18.62.134
  204.186.24.49
  204.188.213.73
  204.188.221.82
@@ -84444,6 +85994,7 @@
  204.42.253.132
  204.44.101.146
  204.44.112.135
+204.44.68.56
  204.44.71.186
  204.44.71.206
  204.44.75.20
@@ -84456,6 +86007,8 @@
  204.44.92.154
  204.44.95.42
  204.44.98.116
+204.44.98.243
+204.48.20.244
  204.48.21.36
  204.48.23.126
  204.48.23.96
@@ -84473,6 +86026,10 @@
  204.63.252.15
  204.63.40.34
  204.63.41.34
+204.69.154.41
+204.69.154.42
+204.69.154.45
+204.69.154.46
  204.74.223.154
  204.77.10.211
  204.8.130.10
@@ -84491,9 +86048,10 @@
  204.9.180.112
  204.9.243.81
  204.93.113.108
-204.93.154.195
+204.93.154.209
  204.93.160.85
  204.93.165.110
+204.93.180.12
  204.93.180.3
  204.93.197.85
  204.98.164.243
@@ -84507,12 +86065,12 @@
  205.134.182.106
  205.134.255.225
  205.157.156.10
-205.157.65.201
  205.164.3.143
  205.164.7.242
  205.170.93.249
  205.172.134.229
  205.173.105.205
+205.178.39.18
  205.178.9.104
  205.185.113.140
  205.185.113.151
@@ -84546,9 +86104,11 @@
  205.185.119.194
  205.185.119.220
  205.185.119.232
+205.185.121.152
  205.185.121.235
  205.185.121.236
  205.185.122.246
+205.185.123.151
  205.185.123.173
  205.185.123.78
  205.185.123.87
@@ -84569,10 +86129,14 @@
  205.185.127.217
  205.185.127.30
  205.185.127.69
-205.185.209.209
+205.185.209.221
  205.185.209.227
+205.185.209.234
  205.185.209.239
-205.185.214.130
+205.185.209.240
+205.185.209.88
+205.185.214.137
+205.185.214.138
  205.185.214.21
  205.185.214.22
  205.185.214.235
@@ -84580,12 +86144,18 @@
  205.185.214.99
  205.185.222.25
  205.185.222.26
-205.185.222.77
+205.185.222.67
+205.185.222.74
  205.185.223.147
  205.185.223.148
  205.185.223.171
+205.185.223.20
+205.185.223.36
  205.185.223.43
  205.185.223.49
+205.185.223.54
+205.185.223.67
+205.185.223.73
  205.185.223.91
  205.185.223.98
  205.186.131.199
@@ -84620,8 +86190,8 @@
  205.214.77.142
  205.215.7.23
  205.217.245.35
-205.217.253.207
  205.233.7.250
+205.234.152.106
  205.234.184.42
  205.234.198.191
  205.234.198.247
@@ -84659,15 +86229,16 @@
  206.126.81.49
  206.126.81.82
  206.126.81.92
-206.130.141.216
  206.132.54.112
  206.132.57.240
  206.166.251.181
  206.166.251.69
+206.167.33.33
  206.173.219.10
  206.174.214.90
  206.174.236.147
  206.174.236.57
+206.174.243.131
  206.176.159.208
  206.180.128.59
  206.180.160.119
@@ -84688,14 +86259,16 @@
  206.189.116.193
  206.189.117.249
  206.189.117.49
-206.189.117.9
  206.189.117.97
+206.189.118.107
  206.189.118.168
  206.189.119.183
  206.189.121.234
  206.189.121.29
  206.189.124.122
  206.189.124.254
+206.189.124.26
+206.189.124.27
  206.189.125.33
  206.189.125.59
  206.189.127.6
@@ -84705,6 +86278,7 @@
  206.189.130.218
  206.189.132.108
  206.189.132.123
+206.189.132.204
  206.189.132.47
  206.189.132.8
  206.189.132.98
@@ -84750,6 +86324,7 @@
  206.189.154.139
  206.189.154.19
  206.189.155.250
+206.189.156.35
  206.189.158.28
  206.189.159.30
  206.189.16.138
@@ -84819,7 +86394,6 @@
  206.189.188.218
  206.189.189.192
  206.189.190.18
-206.189.190.185
  206.189.190.204
  206.189.190.29
  206.189.191.112
@@ -84827,9 +86401,11 @@
  206.189.193.228
  206.189.194.249
  206.189.196.17
+206.189.197.183
  206.189.198.145
  206.189.198.237
  206.189.199.185
+206.189.199.227
  206.189.199.23
  206.189.199.250
  206.189.199.48
@@ -84872,6 +86448,7 @@
  206.189.218.119
  206.189.218.141
  206.189.22.132
+206.189.22.230
  206.189.220.174
  206.189.220.219
  206.189.221.52
@@ -84899,7 +86476,6 @@
  206.189.229.112
  206.189.23.189
  206.189.23.60
-206.189.231.196
  206.189.232.10
  206.189.232.30
  206.189.232.31
@@ -84910,6 +86486,7 @@
  206.189.239.242
  206.189.239.86
  206.189.24.200
+206.189.24.87
  206.189.26.189
  206.189.26.195
  206.189.26.219
@@ -84921,10 +86498,10 @@
  206.189.32.48
  206.189.32.77
  206.189.33.197
-206.189.33.44
  206.189.34.18
  206.189.35.67
  206.189.36.195
+206.189.38.105
  206.189.38.237
  206.189.39.125
  206.189.41.132
@@ -84933,6 +86510,7 @@
  206.189.43.92
  206.189.45.118
  206.189.45.137
+206.189.45.138
  206.189.45.96
  206.189.46.252
  206.189.46.50
@@ -84940,8 +86518,11 @@
  206.189.47.166
  206.189.47.179
  206.189.47.222
+206.189.49.141
+206.189.49.185
  206.189.50.101
  206.189.50.126
+206.189.51.209
  206.189.51.238
  206.189.51.250
  206.189.52.101
@@ -84956,6 +86537,7 @@
  206.189.53.61
  206.189.54.172
  206.189.54.181
+206.189.54.19
  206.189.54.247
  206.189.56.106
  206.189.57.130
@@ -84967,8 +86549,8 @@
  206.189.58.186
  206.189.58.188
  206.189.58.216
+206.189.58.63
  206.189.60.45
-206.189.60.51
  206.189.60.8
  206.189.61.248
  206.189.62.14
@@ -84979,7 +86561,6 @@
  206.189.63.45
  206.189.63.80
  206.189.64.158
-206.189.64.86
  206.189.65.170
  206.189.66.224
  206.189.67.236
@@ -85003,6 +86584,7 @@
  206.189.76.220
  206.189.77.109
  206.189.77.79
+206.189.79.71
  206.189.80.57
  206.189.80.7
  206.189.80.84
@@ -85011,7 +86593,6 @@
  206.189.83.111
  206.189.83.131
  206.189.83.155
-206.189.83.159
  206.189.83.36
  206.189.84.194
  206.189.84.63
@@ -85031,6 +86612,7 @@
  206.189.92.4
  206.189.92.74
  206.189.93.218
+206.189.93.61
  206.189.93.69
  206.189.95.193
  206.189.97.110
@@ -85043,16 +86625,16 @@
  206.214.143.126
  206.214.217.188
  206.214.244.218
-206.217.128.106
  206.217.128.130
  206.217.128.137
  206.217.129.244
  206.217.130.149
+206.217.132.195
+206.217.132.201
  206.217.135.166
  206.217.136.218
  206.217.137.205
  206.217.137.206
-206.217.137.208
  206.219.100.100
  206.219.100.104
  206.219.100.12
@@ -85063,18 +86645,19 @@
  206.219.100.50
  206.221.176.149
  206.221.176.87
+206.221.177.134
  206.221.191.106
  206.221.191.237
  206.223.153.52
  206.225.23.4
  206.225.95.33
-206.248.139.15
  206.248.172.162
  206.248.174.129
  206.248.184.127
  206.248.190.142
  206.248.97.116
  206.253.167.10
+206.253.167.195
  206.253.224.74
  206.253.226.7
  206.29.180.76
@@ -85083,7 +86666,10 @@
  206.41.172.111
  206.41.172.124
  206.41.172.191
+206.41.172.207
+206.41.172.244
  206.41.172.250
+206.41.172.76
  206.41.173.181
  206.41.174.145
  206.41.174.188
@@ -85096,6 +86682,7 @@
  206.41.178.94
  206.41.179.27
  206.41.184.140
+206.41.186.104
  206.41.186.46
  206.41.187.11
  206.41.187.111
@@ -85106,15 +86693,17 @@
  206.47.38.14
  206.47.83.27
  206.54.165.103
+206.54.196.36
  206.54.209.61
  206.71.228.129
  206.71.228.193
  206.72.195.16
  206.72.197.235
+206.72.198.59
  206.72.206.4
-206.72.66.209
  206.80.42.35
  206.81.1.137
+206.81.1.148
  206.81.1.200
  206.81.10.215
  206.81.11.129
@@ -85146,8 +86735,11 @@
  206.81.27.249
  206.81.28.167
  206.81.29.232
+206.81.29.242
  206.81.29.252
  206.81.29.88
+206.81.29.92
+206.81.3.76
  206.81.30.206
  206.81.31.131
  206.81.31.58
@@ -85159,6 +86751,7 @@
  207-365.net
  207.102.103.20
  207.102.21.5
+207.102.46.193
  207.106.93.174
  207.112.57.53
  207.115.102.98
@@ -85223,9 +86816,9 @@
  207.148.97.0
  207.148.98.111
  207.150.188.54
-207.153.17.155
  207.154.193.6
  207.154.194.180
+207.154.194.210
  207.154.195.134
  207.154.196.1
  207.154.198.107
@@ -85244,6 +86837,7 @@
  207.154.207.214
  207.154.207.73
  207.154.208.77
+207.154.209.242
  207.154.213.83
  207.154.215.142
  207.154.215.3
@@ -85254,9 +86848,12 @@
  207.154.220.193
  207.154.220.234
  207.154.221.96
+207.154.222.160
+207.154.223.140
  207.154.224.103
  207.154.224.26
  207.154.226.52
+207.154.226.6
  207.154.227.241
  207.154.227.3
  207.154.227.53
@@ -85271,20 +86868,25 @@
  207.154.235.230
  207.154.235.64
  207.154.236.130
+207.154.236.94
  207.154.237.194
  207.154.239.128
+207.154.240.127
  207.154.240.23
  207.154.241.101
  207.154.242.155
+207.154.242.25
  207.154.242.46
+207.154.242.82
+207.154.242.83
  207.154.243.194
  207.154.244.110
+207.154.245.195
  207.154.247.137
  207.154.247.141
  207.154.248.1
  207.154.248.160
  207.154.250.232
-207.154.251.2
  207.154.251.236
  207.154.252.0
  207.154.253.168
@@ -85306,14 +86908,13 @@
  207.180.195.166
  207.180.196.236
  207.180.202.89
+207.180.203.170
  207.180.205.88
  207.180.207.205
  207.180.208.112
  207.180.210.41
  207.180.215.196
  207.180.217.42
-207.180.221.187
-207.180.223.130
  207.180.223.239
  207.180.223.68
  207.180.224.17
@@ -85325,10 +86926,13 @@
  207.180.231.114
  207.180.232.43
  207.180.234.123
+207.180.234.157
  207.180.234.176
  207.180.234.31
  207.180.239.227
+207.180.241.142
  207.180.242.103
+207.180.243.235
  207.180.244.165
  207.180.245.214
  207.180.247.20
@@ -85339,17 +86943,16 @@
  207.182.154.178
  207.188.41.2
  207.188.69.59
-207.188.75.25
  207.189.196.12
+207.190.83.119
+207.191.161.104
  207.191.161.206
  207.191.163.249
-207.191.164.18
  207.191.165.8
  207.191.171.254
  207.191.171.255
  207.191.186.10
  207.191.240.214
-207.191.244.25
  207.191.249.43
  207.191.254.174
  207.191.26.202
@@ -85379,6 +86982,7 @@
  207.236.144.94
  207.237.108.28
  207.237.12.108
+207.237.127.163
  207.237.166.212
  207.237.36.184
  207.241.227.38
@@ -85399,6 +87003,7 @@
  207.244.117.55
  207.244.117.87
  207.244.118.126
+207.244.119.38
  207.244.149.106
  207.244.149.107
  207.244.149.108
@@ -85415,6 +87020,7 @@
  207.244.232.105
  207.244.233.209
  207.244.234.226
+207.244.240.135
  207.244.243.146
  207.244.243.147
  207.244.243.20
@@ -85452,12 +87058,13 @@
  207.246.95.196
  207.246.95.21
  207.246.95.32
+207.248.109.245
+207.248.113.236
  207.248.245.235
  207.249.133.182
  207.253.131.100
  207.253.170.156
  207.253.227.226
-207.254.245.18
  207.30.28.244
  207.30.28.246
  207.38.90.177
@@ -85572,6 +87179,7 @@
  207.7.108.203
  207.70.149.122
  207.70.150.246
+207.74.77.190
  207.74.82.103
  207.81.125.200
  207.81.239.127
@@ -85591,6 +87199,7 @@
  208.100.13.56
  208.100.170.91
  208.100.26.228
+208.100.26.229
  208.100.26.235
  208.100.26.241
  208.101.33.22
@@ -85599,20 +87208,19 @@
  208.102.40.193
  208.102.51.6
  208.103.228.79
-208.104.62.240
-208.104.64.237
  208.105.137.2
  208.106.250.221
  208.109.10.10
  208.109.100.40
+208.109.11.147
  208.109.11.34
  208.109.12.104
  208.109.12.211
  208.109.12.26
  208.109.13.144
+208.109.13.199
  208.109.13.208
  208.109.14.122
-208.109.14.224
  208.109.181.72
  208.109.184.46
  208.109.190.141
@@ -85638,9 +87246,7 @@
  208.113.133.131
  208.113.133.232
  208.113.133.35
-208.113.135.118
  208.113.135.145
-208.113.135.70
  208.113.153.203
  208.113.153.222
  208.113.162.98
@@ -85648,7 +87254,6 @@
  208.113.181.161
  208.113.182.208
  208.113.182.33
-208.113.200.245
  208.113.223.186
  208.113.249.139
  208.115.113.88
@@ -85671,16 +87276,18 @@
  208.117.222.82
  208.117.222.92
  208.117.85.152
+208.118.237.170
  208.118.237.211
  208.118.245.141
  208.123.119.107
  208.123.119.114
+208.124.74.1
  208.125.16.254
  208.125.188.74
+208.125.35.14
  208.126.16.110
  208.138.18.174
  208.157.164.46
-208.163.39.218
  208.167.242.170
  208.167.245.245
  208.167.254.247
@@ -85692,6 +87299,7 @@
  208.180.181.185
  208.180.202.147
  208.180.207.205
+208.180.217.164
  208.180.33.94
  208.180.71.177
  208.181.243.6
@@ -85715,7 +87323,7 @@
  208.52.161.177
  208.52.161.99
  208.53.34.202
-208.58.221.177
+208.54.231.151
  208.59.170.5
  208.59.50.23
  208.6.49.2
@@ -85771,12 +87379,12 @@
  208.83.204.215
  208.84.155.68
  208.84.155.69
-208.85.1.82
  208.85.3.130
  208.85.3.210
  208.85.50.152
  208.85.52.186
  208.86.10.183
+208.86.162.99
  208.86.184.38
  208.87.237.201
  208.87.241.91
@@ -85793,10 +87401,10 @@
  208.91.198.220
  208.91.198.30
  208.91.198.85
+208.91.199.159
  208.91.199.85
  208.91.57.65
  208.91.68.174
-208.92.111.192
  208.92.211.146
  208.92.211.82
  208.93.231.240
@@ -85814,6 +87422,8 @@
  209.103.178.1
  209.103.178.100
  209.103.178.104
+209.103.178.108
+209.103.178.111
  209.103.178.112
  209.103.178.120
  209.103.178.122
@@ -85821,10 +87431,10 @@
  209.103.178.128
  209.103.178.16
  209.103.178.160
-209.103.178.165
-209.103.178.166
-209.103.178.168
-209.103.178.176
+209.103.178.177
+209.103.178.178
+209.103.178.180
+209.103.178.182
  209.103.178.184
  209.103.178.189
  209.103.178.190
@@ -85844,36 +87454,38 @@
  209.103.178.254
  209.103.178.32
  209.103.178.4
+209.103.178.48
+209.103.178.56
+209.103.178.60
+209.103.178.63
  209.103.178.64
  209.103.178.66
  209.103.178.68
  209.103.178.72
  209.103.178.8
  209.103.178.80
-209.103.178.84
-209.103.178.87
-209.103.178.88
  209.103.178.97
  209.103.178.98
  209.105.136.57
  209.105.239.88
  209.105.243.145
  209.105.243.164
-209.107.196.153
  209.107.196.18
+209.107.196.189
+209.107.196.219
  209.107.196.225
+209.107.196.226
  209.107.196.231
  209.107.204.102
  209.107.204.103
  209.107.204.112
  209.107.204.47
-209.107.204.49
  209.107.204.55
+209.107.204.63
  209.107.204.71
-209.107.204.72
-209.107.204.81
-209.107.210.140
-209.107.210.146
+209.107.204.79
+209.107.210.104
+209.107.210.111
  209.107.210.155
  209.107.210.162
  209.107.210.186
@@ -85884,20 +87496,25 @@
  209.107.210.228
  209.107.210.49
  209.107.210.55
+209.107.210.71
  209.107.210.81
+209.107.210.87
+209.107.210.94
  209.107.214.195
  209.107.216.105
+209.107.216.120
  209.107.216.65
  209.107.216.86
+209.108.206.229
  209.11.246.11
  209.112.238.196
  209.118.108.196
  209.123.237.137
+209.123.88.37
  209.124.200.133
  209.124.55.40
  209.124.88.144
  209.124.90.241
-209.126.10.81
  209.126.101.179
  209.126.104.67
  209.126.11.4
@@ -85922,18 +87539,17 @@
  209.127.18.148
  209.127.20.10
  209.127.20.106
-209.127.43.99
+209.127.38.33
  209.128.84.141
  209.13.96.163
  209.13.96.164
  209.13.96.166
  209.13.96.171
  209.13.96.172
-209.133.222.122
  209.134.40.205
  209.136.26.162
  209.140.29.226
-209.141.124.190
+209.141.33.122
  209.141.33.215
  209.141.33.226
  209.141.33.40
@@ -85989,7 +87605,6 @@
  209.141.48.47
  209.141.48.68
  209.141.50.11
-209.141.50.157
  209.141.50.178
  209.141.50.238
  209.141.51.154
@@ -86005,7 +87620,9 @@
  209.141.53.217
  209.141.53.77
  209.141.54.106
+209.141.54.111
  209.141.54.122
+209.141.54.138
  209.141.54.153
  209.141.54.161
  209.141.54.195
@@ -86014,6 +87631,7 @@
  209.141.54.25
  209.141.54.36
  209.141.54.72
+209.141.55.107
  209.141.55.146
  209.141.55.174
  209.141.56.234
@@ -86029,13 +87647,13 @@
  209.141.59.157
  209.141.59.18
  209.141.59.208
-209.141.59.224
  209.141.59.245
  209.141.60.164
  209.141.61.111
  209.141.61.233
  209.141.61.52
  209.141.62.139
+209.141.62.54
  209.145.87.30bin.sh
  209.146.22.98
  209.15.140.66
@@ -86043,6 +87661,7 @@
  209.150.146.112
  209.150.150.66
  209.150.152.198
+209.150.241.64
  209.150.60.107
  209.151.135.13
  209.151.152.221
@@ -86054,15 +87673,14 @@
  209.159.158.234
  209.16.78.27
  209.160.113.213
-209.160.116.178
  209.160.40.13
  209.160.54.26
  209.160.64.61
-209.163.116.127
  209.163.160.253
  209.163.72.9
  209.164.189.107
  209.165.131.14
+209.165.163.187
  209.169.160.7
  209.169.161.146
  209.169.166.148
@@ -86147,14 +87765,14 @@
  209.193.44.73
  209.194.163.115
  209.194.236.25
-209.195.124.216
  209.197.16.155
-209.197.24.96
  209.197.26.104
+209.197.26.105
  209.197.26.87
  209.197.26.93
  209.197.26.99
  209.198.180.142
+209.198.80.8
  209.20.64.41
  209.200.15.168
  209.200.15.177
@@ -86207,7 +87825,6 @@
  209.222.117.37
  209.222.21.41
  209.222.97.105
-209.225.102.131
  209.23.122.132
  209.23.129.114
  209.232.198.8
@@ -86247,7 +87864,6 @@
  209.250.240.2
  209.250.241.254
  209.250.243.233
-209.250.246.129
  209.250.246.221
  209.250.247.176
  209.250.247.253
@@ -86262,7 +87878,7 @@
  209.44.101.82
  209.44.113.34
  209.44.99.194
-209.45.111.194
+209.45.111.195
  209.45.48.28
  209.45.53.53
  209.45.61.108
@@ -86273,19 +87889,19 @@
  209.50.48.175
  209.50.48.67
  209.51.162.3
+209.51.186.132
  209.51.188.190
-209.52.84.130
  209.54.34.231
  209.54.34.249
  209.54.60.159
  209.54.66.106
  209.58.129.98
+209.58.135.72
  209.58.135.79
  209.58.149.116
  209.58.151.147
  209.58.151.180
  209.58.151.246
-209.58.151.88
  209.58.152.105
  209.58.157.157
  209.58.157.198
@@ -86301,6 +87917,7 @@
  209.59.141.149
  209.59.154.141
  209.59.166.114
+209.59.182.84
  209.59.228.221
  209.59.229.28
  209.59.234.151
@@ -86314,6 +87931,7 @@
  209.62.56.194
  209.65.66.239
  209.65.67.201
+209.65.68.190
  209.65.71.28
  209.66.119.150
  209.66.128.10
@@ -86340,7 +87958,6 @@
  209.90.232.167
  209.90.77.24
  209.90.77.43
-209.91.140.182
  209.92.156.53
  209.92.176.24
  209.92.176.48
@@ -86354,6 +87971,7 @@
  209.97.132.186
  209.97.132.66
  209.97.133.56
+209.97.134.82
  209.97.137.55
  209.97.138.179
  209.97.138.189
@@ -86376,6 +87994,7 @@
  209.97.151.195
  209.97.158.250
  209.97.159.10
+209.97.161.129
  209.97.161.222
  209.97.162.178
  209.97.165.196
@@ -86404,27 +88023,26 @@
  209.97.186.179
  209.97.186.246
  209.97.186.48
-209.97.187.251
  209.97.188.25
  209.97.188.51
  209.97.189.249
  209.97.189.48
  209.97.189.98
-209.97.190.32
  209.97.191.190
  209.97.191.200
  209.97.199.149
  209.97.212.185
  209.99.129.100
  209.99.129.194
+209.99.129.222
  209.99.129.229
  209.99.129.234
+209.99.129.243
  209.99.129.37
  209.99.129.82
  209.99.129.83
  209.99.129.94
  209.99.131.105
-209.99.131.12
  209.99.131.189
  209.99.131.247
  209.99.131.32
@@ -86434,6 +88052,7 @@
  209.99.132.150
  209.99.132.248
  209.99.133.109
+209.99.133.134
  209.99.134.126
  209.99.134.127
  209.99.134.161
@@ -86441,9 +88060,7 @@
  209.99.134.235
  209.99.134.27
  209.99.134.33
-209.99.134.99
  209.99.135.117
-209.99.135.126
  209.99.135.149
  209.99.135.178
  209.99.135.183
@@ -86461,33 +88078,37 @@
  209.99.164.140
  209.99.164.56
  209.99.164.99
+209.99.165.179
  209.99.165.193
  209.99.165.3
-209.99.168.118
  209.99.168.146
-209.99.168.157
  209.99.168.18
+209.99.168.181
  209.99.168.185
  209.99.168.19
  209.99.168.196
  209.99.168.22
  209.99.168.234
  209.99.168.237
+209.99.168.3
  209.99.168.40
  209.99.168.41
  209.99.168.42
  209.99.168.45
  209.99.168.47
-209.99.168.50
+209.99.168.54
  209.99.168.91
-209.99.171.226
+209.99.172.105
+209.99.172.138
+209.99.172.209
  209.99.172.253
  209.99.173.163
  209.99.173.176
  209.99.173.88
-209.99.174.163
+209.99.175.167
  209.99.175.248
  209.99.175.72
+209.99.175.91
  209.99.175.95
  2091465280215.org
  2095169429.jclecardinal.com
@@ -86530,6 +88151,7 @@
  210.101.91.152
  210.103.116.186
  210.103.3.169
+210.103.85.111
  210.104.112.207
  210.105.101.222
  210.105.135.55
@@ -86545,8 +88167,10 @@
  210.112.121.225
  210.112.232.6
  210.113.121.41
+210.113.211.169
  210.113.51.146
  210.114.1.172
+210.114.17.171
  210.114.17.198
  210.114.17.205
  210.114.18.76
@@ -86568,16 +88192,13 @@
  210.12.27.226
  210.12.45.130
  210.12.52.26
-210.12.78.16
  210.120.120.43
  210.120.6.167
  210.121.10.236
  210.121.12.250
-210.121.123.236
  210.121.13.90
  210.121.173.6
  210.121.223.61
-210.121.236.121
  210.121.236.84
  210.121.5.40
  210.122.88.38
@@ -86599,10 +88220,10 @@
  210.13.210.59
  210.13.53.203
  210.13.93.59
+210.13.96.74
  210.131.183.195
  210.14.130.9
  210.14.132.24
-210.14.138.182
  210.14.142.85
  210.14.146.80
  210.14.17.241
@@ -86610,6 +88231,7 @@
  210.14.69.246
  210.14.69.69
  210.14.69.76
+210.14.77.102
  210.14.77.39
  210.140.10.24
  210.140.10.26
@@ -86632,10 +88254,11 @@
  210.157.255.130
  210.16.100.8
  210.16.101.36
+210.16.102.195
  210.16.102.68
-210.16.115.250
  210.16.187.206
  210.16.187.29
+210.16.188.59
  210.16.189.181
  210.16.189.4
  210.16.84.102
@@ -86647,13 +88270,10 @@
  210.165.109.217
  210.166.214.192
  210.166.230.64
-210.17.230.213
  210.171.150.205
-210.172.223.112
  210.172.87.226
  210.177.164.45
  210.177.96.193
-210.178.111.228
  210.178.122.172
  210.178.155.216
  210.178.36.10
@@ -86675,7 +88295,6 @@
  210.180.118.162
  210.182.101.144
  210.182.148.126
-210.182.148.85
  210.182.189.215
  210.183.102.85
  210.183.193.126
@@ -86683,6 +88302,7 @@
  210.183.22.225
  210.183.46.232
  210.183.94.137
+210.184.2.66
  210.186.105.71
  210.186.12.177
  210.186.143.23
@@ -86690,6 +88310,7 @@
  210.186.157.221
  210.186.226.28
  210.186.228.41
+210.186.99.96
  210.187.189.107
  210.187.51.226
  210.188.218.41
@@ -86727,6 +88348,7 @@
  210.201.118.103
  210.201.139.189
  210.201.2.54
+210.202.110.238
  210.204.127.20
  210.204.171.204
  210.205.6.107
@@ -86744,7 +88366,6 @@
  210.209.193.235
  210.209.200.122
  210.209.201.84
-210.209.201.94
  210.209.203.37
  210.209.204.147
  210.209.221.173
@@ -86756,8 +88377,6 @@
  210.21.221.156
  210.21.226.2
  210.210.110.124
-210.210.117.90
-210.210.117.95
  210.210.130.139
  210.210.136.147
  210.211.101.194
@@ -86767,10 +88386,14 @@
  210.211.116.29
  210.211.116.80
  210.211.117.135
+210.211.119.180
+210.211.124.15
  210.211.126.19
+210.211.17.82
  210.211.67.80
  210.211.68.196
  210.211.96.155
+210.211.96.181
  210.212.104.26
  210.212.172.114
  210.212.172.182
@@ -86779,10 +88402,6 @@
  210.212.253.150
  210.212.29.215
  210.212.68.213
-210.213.127.197
-210.213.127.204
-210.213.127.205
-210.213.127.206
  210.213.146.195
  210.213.244.54
  210.216.152.122
@@ -86792,9 +88411,9 @@
  210.216.21.99
  210.217.145.118
  210.219.173.21
-210.22.109.38
  210.22.5.117
  210.22.77.70
+210.220.150.170
  210.221.154.117
  210.221.96.33
  210.222.174.17
@@ -86803,6 +88422,7 @@
  210.222.200.72
  210.222.86.19
  210.223.141.74
+210.223.186.182
  210.223.216.102
  210.223.234.194
  210.223.239.240
@@ -86810,6 +88430,7 @@
  210.242.250.37
  210.242.28.15
  210.242.28.21
+210.242.52.28
  210.242.65.96
  210.243.27.42
  210.243.27.43
@@ -86841,6 +88462,9 @@
  210.245.92.136
  210.245.92.204
  210.245.92.228
+210.245.92.97
+210.245.95.166
+210.245.95.172
  210.246.240.254
  210.246.240.42
  210.246.243.70
@@ -86860,10 +88484,10 @@
  210.3.217.150
  210.4.114.122
  210.4.152.139
-210.4.66.139
  210.4.96.73
  210.4.97.107
  210.41.218.35
+210.42.37.150
  210.43.47.18
  210.44.14.43
  210.44.14.45
@@ -86886,17 +88510,17 @@
  210.5.100.84
  210.5.105.18
  210.5.110.122
-210.5.116.180
-210.5.116.181
  210.5.151.232
  210.5.155.130
  210.5.155.142
  210.5.172.6
  210.5.85.150
+210.50.201.46
  210.51.13.174
  210.51.174.189
  210.54.38.227
  210.55.186.173
+210.55.3.250
  210.56.1.240
  210.56.23.100
  210.56.232.56
@@ -86921,6 +88545,7 @@
  210.57.228.153
  210.57.234.146
  210.57.235.130
+210.57.235.233
  210.57.236.180
  210.57.237.181
  210.57.237.70
@@ -86929,7 +88554,6 @@
  210.59.180.158
  210.59.180.67
  210.59.180.68
-210.59.209.174
  210.59.98.106
  210.6.140.155
  210.6.150.39
@@ -86937,6 +88561,7 @@
  210.6.29.177
  210.6.48.13
  210.6.78.77
+210.60.51.251
  210.61.124.130
  210.61.156.128
  210.61.176.145
@@ -86955,6 +88580,7 @@
  210.7.16.14
  210.71.214.228
  210.71.232.236
+210.72.25.170
  210.72.25.225
  210.72.88.165
  210.72.88.87
@@ -86981,6 +88607,7 @@
  210.92.18.25
  210.94.133.243
  210.94.99.137
+210.95.214.130
  210.95.97.186
  210.96.119.128
  210.96.4.50
@@ -86994,8 +88621,6 @@
  210.99.220.214
  210.99.220.247
  210.99.230.48
-210.99.230.74
-210.99.231.177
  210.99.231.205
  210.99.231.220
  210.99.231.62
@@ -87031,7 +88656,6 @@
  211.104.242.52
  211.104.255.94
  211.104.66.157
-211.105.101.239
  211.105.187.10
  211.105.195.103
  211.105.214.127
@@ -87044,6 +88668,7 @@
  211.106.241.42
  211.107.138.212
  211.107.14.12
+211.107.147.58
  211.107.151.26
  211.107.175.215
  211.107.3.84
@@ -87063,7 +88688,6 @@
  211.112.18.37
  211.112.187.197
  211.112.205.57
-211.112.69.131
  211.112.70.94
  211.114.115.254
  211.114.178.168
@@ -87088,7 +88712,6 @@
  211.116.220.145
  211.116.220.205
  211.116.220.43
-211.116.220.77
  211.117.167.178
  211.117.60.11
  211.118.226.133
@@ -87122,18 +88745,19 @@
  211.137.52.159
  211.139.125.115
  211.139.241.211
+211.14.169.146
  211.14.254.213
  211.140.118.18
-211.140.196.90
+211.140.151.13
  211.140.204.254
  211.140.230.46
  211.140.252.139
  211.140.254.5
-211.140.94.11
  211.140.94.14
  211.140.94.17
  211.140.94.23
  211.140.94.26
+211.141.115.70
  211.141.200.137
  211.141.200.175
  211.141.234.16
@@ -87145,6 +88769,7 @@
  211.142.169.226
  211.142.215.250
  211.142.228.174
+211.142.26.106
  211.143.142.139
  211.143.16.164
  211.143.185.118
@@ -87163,15 +88788,17 @@
  211.144.68.30
  211.144.69.249
  211.144.96.41
-211.145.38.77
  211.145.47.192
+211.145.49.253
  211.147.133.66
  211.147.230.9
+211.147.234.67
  211.147.251.157
  211.147.74.231
  211.149.173.172
  211.149.191.118
  211.149.202.94
+211.149.221.30
  211.149.240.75
  211.151.130.24
  211.152.33.24
@@ -87186,6 +88813,7 @@
  211.157.101.163
  211.157.135.181
  211.157.149.131
+211.157.149.139
  211.157.151.53
  211.157.153.194
  211.157.159.106
@@ -87216,6 +88844,7 @@
  211.159.218.251
  211.160.244.77
  211.161.60.21
+211.161.90.99
  211.162.122.249
  211.162.122.250
  211.162.123.157
@@ -87225,7 +88854,6 @@
  211.167.111.44
  211.167.240.253
  211.167.96.88
-211.168.105.152
  211.168.108.124
  211.168.232.220
  211.170.165.107
@@ -87235,6 +88863,7 @@
  211.171.42.5
  211.172.100.207
  211.172.225.50
+211.173.58.253
  211.174.49.229
  211.174.59.120
  211.174.63.235
@@ -87248,7 +88877,6 @@
  211.184.178.64
  211.184.187.129
  211.184.2.252
-211.184.248.13
  211.184.49.248
  211.185.127.9
  211.185.13.14
@@ -87256,6 +88884,7 @@
  211.185.17.19
  211.185.20.173
  211.185.67.133
+211.186.228.188
  211.187.9.234
  211.189.132.230
  211.189.18.242
@@ -87268,6 +88897,7 @@
  211.192.64.222
  211.193.184.102
  211.193.31.52
+211.193.58.225
  211.193.60.137
  211.193.60.241
  211.193.90.51
@@ -87338,6 +88968,7 @@
  211.20.26.61
  211.20.90.138
  211.200.160.239
+211.200.178.178
  211.202.2.220
  211.202.225.83
  211.202.48.120
@@ -87368,8 +88999,6 @@
  211.210.161.162
  211.210.219.71
  211.210.3.214
-211.210.66.179
-211.212.128.53
  211.212.204.200
  211.212.237.221
  211.214.161.205
@@ -87385,11 +89014,13 @@
  211.218.204.209
  211.218.245.66
  211.218.254.25
+211.218.94.8
  211.219.18.186
  211.219.18.46
  211.219.233.94
  211.219.246.119
  211.219.253.89
+211.219.71.38
  211.22.107.150
  211.22.131.61
  211.22.135.32
@@ -87402,11 +89033,13 @@
  211.22.182.133
  211.22.209.93
  211.22.236.44
+211.22.244.205
  211.220.195.71
  211.220.27.191
  211.220.36.187
  211.220.53.68
  211.220.63.148
+211.220.75.28
  211.220.81.199
  211.220.88.10
  211.221.1.29
@@ -87415,6 +89048,7 @@
  211.221.39.182
  211.222.143.220
  211.222.144.208
+211.222.215.46
  211.222.216.220
  211.222.231.76
  211.222.236.101
@@ -87422,6 +89056,7 @@
  211.222.69.222
  211.222.75.51
  211.223.118.213
+211.223.174.53
  211.223.201.177
  211.223.205.250
  211.223.27.47
@@ -87474,7 +89109,6 @@
  211.229.236.149
  211.229.238.31
  211.229.30.62
-211.229.59.98
  211.23.142.13
  211.23.149.7
  211.23.156.28
@@ -87483,8 +89117,8 @@
  211.23.164.89
  211.23.248.23
  211.23.31.85
-211.23.45.44
-211.23.45.46
+211.23.45.29
+211.23.47.221
  211.23.57.32
  211.23.78.33
  211.23.89.32
@@ -87504,6 +89138,7 @@
  211.230.37.102
  211.230.55.213
  211.230.71.151
+211.230.86.62
  211.231.75.58
  211.232.235.250
  211.233.11.27
@@ -87527,7 +89162,6 @@
  211.237.165.174
  211.237.245.64
  211.237.246.125
-211.237.246.137
  211.237.246.214
  211.237.249.250
  211.237.249.27
@@ -87544,22 +89178,22 @@
  211.238.77.75
  211.238.83.238
  211.238.83.238bin.sh
-211.238.86.151
-211.238.95.26
  211.239.124.233
+211.239.124.237
+211.24.100.128
  211.24.105.19
  211.24.114.199
  211.24.114.56
+211.24.241.242
  211.24.28.202
-211.24.73.85
  211.24.8.49
  211.24.85.234
  211.24.95.49
  211.240.98.140
  211.241.177.69
-211.241.209.104
  211.242.110.197
  211.244.168.32
+211.244.73.44
  211.245.106.41
  211.245.120.122
  211.245.187.167
@@ -87583,7 +89217,6 @@
  211.250.233.150
  211.250.239.87
  211.250.25.55
-211.250.42.101
  211.250.72.142
  211.250.9.142
  211.251.235.65
@@ -87604,7 +89237,6 @@
  211.253.26.117
  211.253.27.146
  211.254.215.197
-211.255.23.1
  211.255.32.134
  211.255.32.19
  211.26.10.49
@@ -87617,7 +89249,6 @@
  211.27.147.67
  211.32.122.110
  211.32.122.124
-211.34.165.12
  211.34.165.209
  211.34.165.211
  211.34.165.229
@@ -87661,7 +89292,6 @@
  211.35.77.126
  211.35.77.62
  211.35.78.206
-211.36.144.197
  211.37.0.247
  211.38.132.36
  211.38.132.37
@@ -87693,7 +89323,6 @@
  211.46.172.48
  211.46.29.102
  211.46.77.77
-211.47.101.6
  211.47.102.51
  211.47.107.22
  211.47.118.102
@@ -87706,11 +89335,11 @@
  211.48.121.149
  211.48.138.182
  211.48.139.39
-211.48.140.245
  211.48.197.80
  211.48.20.244
  211.48.215.219
  211.48.49.135
+211.48.84.171
  211.48.90.28
  211.48.90.28bin.sh
  211.49.225.146
@@ -87735,7 +89364,6 @@
  211.55.111.25
  211.55.116.245
  211.55.116.245bin.sh
-211.55.123.178
  211.55.191.72
  211.55.251.81
  211.55.252.56
@@ -87755,7 +89383,6 @@
  211.63.71.72
  211.65.107.179
  211.67.55.116
-211.68.68.5
  211.70.159.30
  211.70.51.6
  211.72.111.91
@@ -87792,25 +89419,29 @@
  211.76.37.3
  211.76.72.123
  211.76.91.227
+211.80.102.182
+211.80.102.189
  211.84.226.2
  211.84.226.4
  211.84.226.5
  211.84.226.6
  211.84.226.9
  211.87.126.178
+211.87.178.161
  211.90.246.115
  211.90.37.212
+211.90.39.117
  211.90.93.204
  211.91.180.70
  211.91.56.176
  211.93.119.165
  211.93.68.203
-211.93.84.231
  211.93.91.46
  211.94.156.50
  211.95.47.166
  211.97.31.129
  211.99.227.4
+211.99.229.3
  21112.com
  211740640418593-dot-wetransfer-auth-file-341.appspot.com
  212.0.149.75
@@ -87840,6 +89471,7 @@
  212.103.61.157
  212.103.61.160
  212.103.61.50
+212.106.42.67
  212.107.144.216
  212.107.200.222
  212.107.237.28
@@ -87849,6 +89481,7 @@
  212.108.5.60
  212.109.185.6
  212.109.192.155
+212.109.192.178
  212.109.197.1
  212.109.198.126
  212.109.198.157
@@ -87857,14 +89490,12 @@
  212.109.221.73
  212.109.223.6
  212.109.39.180
+212.110.128.210
  212.110.20.141
  212.111.201.81
  212.111.40.56
  212.112.113.235
-212.112.122.27
  212.112.124.123
-212.112.154.183
-212.112.97.187
  212.112.97.27
  212.113.233.0
  212.113.35.162
@@ -87873,7 +89504,6 @@
  212.114.52.233
  212.114.98.66
  212.115.108.181
-212.115.112.196
  212.115.232.79
  212.115.49.229
  212.115.49.239
@@ -87881,6 +89511,7 @@
  212.115.51.210
  212.115.51.227
  212.115.51.26
+212.115.51.98
  212.115.53.143
  212.116.1.42
  212.116.65.244
@@ -87903,34 +89534,28 @@
  212.119.40.60
  212.119.40.62
  212.119.41.106
-212.119.41.126
  212.119.41.147
  212.119.41.150
  212.119.41.68
+212.119.44.207
  212.119.44.254
  212.119.44.46
-212.119.44.99
-212.119.45.157
+212.119.46.114
  212.119.46.224
  212.12.114.34
  212.12.114.81
  212.12.20.34
  212.12.52.231
  212.12.61.69
-212.12.69.43
  212.120.186.39
  212.122.187.209
  212.124.114.242
  212.124.160.4
  212.124.173.58
  212.124.182.144
-212.124.19.139
  212.124.21.41
  212.124.22.156
-212.124.6.130
  212.124.6.178
-212.124.6.184
-212.124.6.189
  212.124.6.253
  212.124.6.5
  212.124.6.92
@@ -87955,6 +89580,8 @@
  212.129.152.27
  212.129.16.22
  212.129.16.250
+212.129.16.53
+212.129.2.210
  212.129.21.59
  212.129.23.95
  212.129.24.79
@@ -87994,17 +89621,12 @@
  212.129.9.187
  212.129.9.233
  212.13.112.117
-212.13.155.111
-212.13.155.30
-212.13.175.25
-212.13.179.78
  212.13.49.186
  212.130.102.221
-212.133.224.114
-212.14.114.75
+212.139.38.137
  212.14.163.206
  212.142.104.138
-212.142.121.168
+212.142.204.71
  212.142.226.124
  212.142.226.93
  212.143.138.199
@@ -88066,23 +89688,21 @@
  212.16.104.33
  212.16.142.92
  212.16.70.196
-212.160.110.218
-212.160.230.70
-212.160.230.88
+212.160.230.76
+212.160.230.95
  212.160.90.34
  212.162.14.222
  212.162.151.144
  212.164.226.11
+212.164.35.85
  212.164.39.216
  212.166.151.47
-212.166.153.173
  212.166.68.146
  212.17.102.75
  212.170.18.65
  212.170.207.29
  212.170.50.203
  212.170.92.253
-212.171.111.103
  212.172.38.61
  212.172.74.14
  212.174.106.179
@@ -88091,7 +89711,7 @@
  212.174.253.6
  212.174.26.107
  212.174.26.43
-212.174.54.142
+212.174.62.230
  212.175.113.250
  212.175.167.137
  212.175.189.83
@@ -88101,6 +89721,7 @@
  212.175.87.9
  212.178.135.62
  212.178.154.174
+212.178.23.27
  212.179.245.104
  212.18.207.172
  212.18.22.236
@@ -88110,6 +89731,7 @@
  212.185.62.33
  212.186.170.226
  212.186.191.177
+212.187.48.150
  212.187.98.26
  212.188.192.20
  212.188.66.218
@@ -88118,23 +89740,23 @@
  212.19.20.87
  212.19.21.24
  212.19.23.204
+212.193.1.129
  212.193.1.131
  212.193.1.198
  212.199.182.20
  212.199.61.51
-212.2.229.12
  212.2.5.120
  212.20.56.138
  212.20.73.70
  212.200.118.98
  212.200.146.50
  212.200.165.18
+212.200.209.73
  212.200.212.50
  212.200.217.80
  212.200.236.42
  212.200.29.14
  212.200.89.254
-212.203.55.32
  212.204.75.161
  212.205.112.162
  212.205.154.76
@@ -88146,6 +89768,7 @@
  212.21.1.104
  212.21.136.181
  212.21.136.93
+212.21.143.7
  212.21.66.6
  212.217.113.11
  212.217.118.100
@@ -88153,7 +89776,6 @@
  212.22.70.65
  212.22.72.254
  212.22.85.104
-212.220.0.17
  212.220.0.176
  212.220.115.246
  212.220.204.238
@@ -88237,14 +89859,19 @@
  212.251.208.159
  212.251.232.254
  212.251.48.70
+212.252.106.196
+212.252.116.224
  212.252.134.107
+212.252.137.78
  212.252.63.247
  212.253.125.253
+212.253.77.208
  212.253.78.215
  212.253.84.102
  212.253.90.12
  212.253.94.222
  212.253.94.254
+212.254.245.173
  212.26.136.212
  212.26.236.129
  212.26.236.205
@@ -88260,7 +89887,6 @@
  212.3.109.7
  212.3.146.80
  212.3.188.171
-212.3.194.88
  212.3.205.85
  212.3.209.158
  212.30.203.42
@@ -88292,30 +89918,22 @@
  212.39.91.130
  212.4.57.179
  212.4.57.180
+212.40.72.114
+212.40.78.161
  212.40.94.18
  212.40.95.232
  212.42.104.101
  212.42.116.29
  212.42.117.207
-212.42.118.124
  212.42.193.125
  212.42.196.98
  212.42.99.22
-212.42.99.223
  212.42.99.32
-212.42.99.61
-212.43.99.2
-212.45.80.102
-212.45.80.107
+212.43.105.219
  212.45.80.108
  212.45.80.112
-212.45.80.15
-212.45.80.69
  212.46.18.158
  212.46.255.78
-212.47.136.147
-212.47.140.55
-212.47.141.36
  212.47.220.165
  212.47.227.72
  212.47.228.223
@@ -88330,6 +89948,7 @@
  212.47.236.238
  212.47.238.193
  212.47.238.207
+212.47.238.66
  212.47.240.251
  212.47.241.15
  212.47.247.226
@@ -88345,6 +89964,7 @@
  212.48.76.65
  212.48.84.127
  212.48.87.19
+212.49.115.70
  212.49.69.67
  212.49.70.12
  212.5.140.203
@@ -88358,6 +89978,7 @@
  212.51.142.238
  212.51.144.42
  212.51.146.9
+212.51.148.162
  212.51.156.185
  212.51.156.73
  212.51.159.132
@@ -88377,15 +89998,17 @@
  212.59.11.71
  212.59.30.110
  212.59.6.16
-212.6.187.100
  212.60.21.48
  212.60.5.220
  212.60.5.92
+212.60.64.220
  212.62.49.110
+212.63.111.222
  212.63.206.39
  212.64.1.170
  212.64.102.106
  212.64.111.18
+212.64.114.217
  212.64.12.236
  212.64.13.147
  212.64.14.101
@@ -88397,8 +90020,8 @@
  212.64.29.136
  212.64.3.40
  212.64.33.244
+212.64.35.193
  212.64.36.88
-212.64.39.90
  212.64.4.186
  212.64.4.3
  212.64.43.52
@@ -88411,6 +90034,8 @@
  212.64.60.50
  212.64.61.224
  212.64.61.70
+212.64.66.135
+212.64.66.168
  212.64.66.208
  212.64.66.218
  212.64.67.230
@@ -88444,30 +90069,32 @@
  212.69.166.122
  212.69.19.223
  212.69.218.47
-212.69.22.103
-212.69.22.120
-212.69.22.127
-212.69.22.16
+212.69.22.112
+212.69.22.126
+212.69.22.154
+212.69.22.156
  212.69.22.161
+212.69.22.166
+212.69.22.172
  212.69.22.173
-212.69.22.210
-212.69.22.234
-212.69.22.30
-212.69.22.37
+212.69.22.219
+212.69.22.232
+212.69.22.26
  212.69.22.43
+212.69.22.82
+212.69.22.83
+212.69.22.90
  212.69.22.92
-212.69.24.156
-212.69.24.158
+212.69.24.142
+212.69.24.174
  212.69.24.200
-212.69.24.225
  212.69.24.231
-212.69.24.55
+212.69.24.58
  212.69.24.61
  212.69.25.2
-212.69.27.96
+212.69.27.86
  212.7.20.104
  212.70.149.21
-212.70.149.37
  212.70.149.5
  212.70.149.53
  212.70.149.69
@@ -88513,11 +90140,14 @@
  212.8.249.103
  212.8.250.141
  212.8.253.16
+212.8.253.49
  212.80.219.11
  212.81.208.102
  212.83.129.11
  212.83.129.80
+212.83.130.62
  212.83.130.68
+212.83.130.88
  212.83.133.41
  212.83.133.63
  212.83.134.226
@@ -88526,6 +90156,7 @@
  212.83.137.54
  212.83.139.203
  212.83.141.237
+212.83.142.33
  212.83.144.11
  212.83.150.172
  212.83.152.183
@@ -88533,6 +90164,7 @@
  212.83.157.81
  212.83.158.105
  212.83.161.110
+212.83.162.123
  212.83.163.230
  212.83.166.62
  212.83.167.190
@@ -88541,21 +90173,28 @@
  212.83.168.97
  212.83.169.24
  212.83.169.71
+212.83.170.121
  212.83.170.57
  212.83.171.128
+212.83.174.222
  212.83.174.252
  212.83.176.116
  212.83.177.193
  212.83.177.36
+212.83.178.20
  212.83.178.35
  212.83.179.246
  212.83.181.11
  212.83.181.201
  212.83.182.10
  212.83.183.33
+212.83.183.57
  212.83.185.93
+212.83.186.26
  212.83.188.158
  212.83.188.161
+212.83.188.82
+212.83.189.92
  212.83.189.95
  212.83.191.184
  212.83.35.11
@@ -88568,6 +90207,9 @@
  212.83.58.216
  212.83.58.219
  212.83.58.231
+212.83.8.77
+212.83.8.79
+212.83.8.81
  212.85.247.170
  212.85.35.205
  212.85.69.14
@@ -88578,6 +90220,7 @@
  212.86.75.9
  212.87.169.49
  212.87.172.113
+212.87.172.76
  212.87.200.88
  212.89.173.216
  212.9.185.194
@@ -88593,6 +90236,7 @@
  212.92.106.116
  212.92.106.146
  212.92.108.44
+212.92.11.76
  212.92.115.97
  212.92.119.83
  212.92.123.55
@@ -88602,6 +90246,7 @@
  212.92.249.97
  212.94.0.186
  212.94.111.13
+212.94.8.41
  212.95.110.30
  212.95.121.26
  212.95.137.19
@@ -88614,23 +90259,21 @@
  212.95.175.226
  212.95.41.41
  212.96.34.143
-212.96.76.117
-212.96.76.9
-212.96.79.101
-212.96.95.151
  212.97.48.5
  212.98.122.91
  212.98.171.75
  212.98.171.91
-212.98.190.22
-212.98.97.152
  212.99.170.209
  212.99.226.35
  2122159.cloudcommercepro.com
+213.0.69.74
  213.0.86.62
  213.0.87.120
+213.10.100.182
  213.10.181.49
  213.100.180.51
+213.100.212.187
+213.100.216.150
  213.100.219.99
  213.101.151.4
  213.102.74.187
@@ -88646,14 +90289,13 @@
  213.108.134.182
  213.108.134.191
  213.108.161.39
-213.108.162.108
-213.108.162.209
  213.108.18.34
  213.108.196.20
  213.108.2.218
-213.108.2.30
+213.108.2.223
  213.108.200.11
  213.108.207.139
+213.108.242.163
  213.108.248.127
  213.108.249.127
  213.108.5.224
@@ -88684,11 +90326,13 @@
  213.124.126.26
  213.125.144.146
  213.125.67.108
+213.126.100.122
  213.126.15.210
  213.129.99.10
  213.130.206.240
  213.131.247.180
  213.131.45.75
+213.131.46.46
  213.131.78.113
  213.132.248.98
  213.133.100.200
@@ -88697,7 +90341,6 @@
  213.134.19.216
  213.134.192.13
  213.135.131.113
-213.135.154.63
  213.135.156.112
  213.135.158.148
  213.135.232.66
@@ -88719,11 +90362,12 @@
  213.136.79.123
  213.136.82.33
  213.136.83.223
+213.136.84.154
+213.136.85.17
  213.136.86.218
  213.136.87.165
  213.136.88.20
  213.136.89.190
-213.136.93.171
  213.136.94.142
  213.137.179.203
  213.137.61.38
@@ -88731,12 +90375,14 @@
  213.138.78.150
  213.139.206.50
  213.139.212.154
+213.139.45.102
  213.139.58.237
  213.14.112.92
  213.14.128.225
  213.14.136.71
  213.14.138.116
  213.14.151.42
+213.14.153.159
  213.14.158.73
  213.14.165.254
  213.14.31.122
@@ -88757,20 +90403,19 @@
  213.142.13.76
  213.142.148.79
  213.142.150.50
-213.142.159.149
+213.142.16.232
  213.142.185.1
  213.142.206.146
  213.142.218.226
-213.142.30.111
  213.142.30.57
  213.144.147.149
  213.144.147.16
-213.144.157.36
  213.144.66.249
  213.145.110.75
  213.145.137.102
  213.145.5.146
  213.147.107.58
+213.147.118.56
  213.147.97.225
  213.148.199.23
  213.149.103.132
@@ -88783,6 +90428,9 @@
  213.149.187.163
  213.149.190.193
  213.149.239.148
+213.149.51.68
+213.150.184.62
+213.150.206.88
  213.152.106.56
  213.152.161.101
  213.152.161.40
@@ -88798,13 +90446,13 @@
  213.154.3.102
  213.154.70.102
  213.155.3.216
-213.157.39.35
  213.157.50.82
  213.157.51.210
+213.158.10.101
  213.158.29.179
+213.159.34.121
  213.159.38.90
  213.159.60.64
-213.159.64.80
  213.16.205.207
  213.16.81.182
  213.16.99.180
@@ -88826,7 +90474,6 @@
  213.163.73.59
  213.163.73.78
  213.164.164.164
-213.164.254.241
  213.165.176.56
  213.165.178.214
  213.165.238.253
@@ -88835,11 +90482,11 @@
  213.166.69.147
  213.166.76.128
  213.166.76.136
+213.166.76.74
  213.166.77.106
  213.166.77.119
  213.166.77.156
  213.166.77.167
-213.166.77.253
  213.166.77.30
  213.166.77.52
  213.166.78.104
@@ -88851,16 +90498,18 @@
  213.166.79.229
  213.166.79.82
  213.166.79.98
+213.166.82.245
  213.167.205.186
  213.168.187.27
  213.168.190.59
  213.168.210.76
  213.168.250.126
  213.169.151.199
-213.170.92.46
+213.169.39.218
  213.171.196.14
  213.171.196.79
  213.171.225.234
+213.171.225.85
  213.171.37.206
  213.171.37.45
  213.171.46.182
@@ -88870,6 +90519,7 @@
  213.172.49.129
  213.172.91.53
  213.173.80.3
+213.173.93.228
  213.174.0.72
  213.174.10.58
  213.174.123.194
@@ -88878,10 +90528,13 @@
  213.175.197.156
  213.175.215.160
  213.175.221.110
+213.175.50.226
+213.176.35.212
  213.176.36.147
  213.176.36.42
  213.176.48.151
  213.176.61.56
+213.176.62.30
  213.177.101.151
  213.177.107.170
  213.178.155.74
@@ -88894,7 +90547,6 @@
  213.18.141.112
  213.18.150.131
  213.180.31.149
-213.180.67.140
  213.180.70.138
  213.180.89.75
  213.181.195.31
@@ -88909,6 +90561,7 @@
  213.184.100.132
  213.184.227.188
  213.184.248.225
+213.184.252.110
  213.184.254.128
  213.185.128.150
  213.185.128.152
@@ -88928,9 +90581,9 @@
  213.189.240.136
  213.189.4.139
  213.190.100.135
+213.190.30.117
  213.190.50.166
  213.191.105.236
-213.192.31.136
  213.193.0.225
  213.193.83.251
  213.194.133.14
@@ -88938,7 +90591,6 @@
  213.194.134.221
  213.194.141.150
  213.194.149.28
-213.194.151.16
  213.194.165.206
  213.194.166.165
  213.194.168.110
@@ -88949,16 +90601,16 @@
  213.195.127.45
  213.195.96.152
  213.195.96.54
-213.195.98.68
  213.196.154.68
  213.197.182.158
  213.198.192.161
  213.198.67.46
+213.199.128.219
  213.199.255.145
-213.200.15.29
  213.200.174.159
  213.200.221.94
  213.200.236.95
+213.202.101.114
  213.202.212.42
  213.202.212.78
  213.202.218.70
@@ -88968,8 +90620,9 @@
  213.202.53.203
  213.203.138.236
  213.204.125.240
-213.204.91.140
  213.205.32.10
+213.205.33.244
+213.205.33.61
  213.206.249.181
  213.206.91.61
  213.207.172.24
@@ -88980,8 +90633,7 @@
  213.21.15.22
  213.21.86.130
  213.210.67.186
-213.211.68.206
-213.211.93.209
+213.211.111.206
  213.212.63.61
  213.215.244.18
  213.216.48.21
@@ -88992,6 +90644,7 @@
  213.218.137.112
  213.218.154.210
  213.219.144.79
+213.219.146.15
  213.219.210.178
  213.219.210.180
  213.219.210.182
@@ -89017,97 +90670,26 @@
  213.227.39.38
  213.227.57.58
  213.227.93.117
-213.228.81.128
  213.229.125.87
  213.229.60.50
  213.229.86.240
  213.23.12.149
-213.230.107.127
-213.230.107.190
  213.230.107.202
-213.230.107.207
-213.230.107.223
-213.230.107.23
-213.230.107.9
-213.230.108.169
-213.230.108.229
-213.230.108.27
-213.230.108.6
-213.230.109.200
-213.230.109.207
-213.230.109.246
-213.230.110.117
  213.230.110.154
-213.230.110.58
-213.230.111.131
-213.230.111.177
-213.230.111.187
-213.230.111.250
-213.230.111.28
-213.230.121.21
-213.230.121.42
-213.230.124.132
-213.230.124.223
-213.230.124.93
-213.230.126.221
-213.230.126.49
-213.230.126.91
-213.230.126.93
-213.230.127.137
  213.230.127.139
-213.230.127.190
-213.230.127.56
-213.230.127.6
-213.230.127.7
  213.230.6.17
-213.230.67.189
-213.230.67.242
-213.230.67.245
  213.230.67.32
  213.230.67.33
-213.230.67.48
-213.230.67.71
-213.230.68.234
-213.230.69.152
-213.230.69.230
-213.230.69.247
  213.230.69.33
-213.230.69.94
  213.230.71.0
-213.230.71.233
-213.230.71.238
-213.230.71.29
-213.230.71.89
  213.230.77.13
-213.230.90.106
-213.230.90.190
-213.230.90.33
-213.230.91.128
-213.230.91.138
-213.230.91.150
-213.230.91.164
-213.230.91.216
-213.230.91.217
-213.230.91.231
-213.230.96.133
-213.230.96.141
+213.230.80.237
  213.230.96.200
  213.230.96.243
-213.230.96.92
-213.230.97.11
-213.230.97.115
-213.230.97.121
-213.230.97.123
-213.230.97.124
-213.230.97.125
-213.230.97.70
-213.230.99.138
-213.230.99.244
  213.231.21.109
+213.232.121.111
  213.232.211.253
-213.232.244.73
  213.232.247.142
-213.232.247.40
  213.233.177.149
  213.233.57.134
  213.234.0.242
@@ -89117,6 +90699,7 @@
  213.234.252.110
  213.234.31.22
  213.235.159.14
+213.235.98.219
  213.238.182.150
  213.238.182.163
  213.238.182.247
@@ -89145,33 +90728,14 @@
  213.239.218.54
  213.239.220.183
  213.239.232.113
-213.24.126.1
  213.24.126.143
  213.24.126.254
-213.24.126.67
-213.24.126.8
-213.24.127.148
-213.24.127.151
-213.24.127.164
-213.24.127.237
  213.24.127.252
-213.24.127.29
  213.24.127.62
  213.24.127.74
-213.24.132.140
-213.24.132.194
-213.24.132.82
-213.24.133.187
-213.24.133.41
-213.24.133.90
-213.24.134.159
-213.24.134.165
  213.24.134.54
-213.24.135.116
  213.24.135.188
  213.24.135.213
-213.24.135.26
-213.24.135.48
  213.24.167.78
  213.240.78.205
  213.244.115.130
@@ -89184,11 +90748,12 @@
  213.246.2.55
  213.246.28.178
  213.246.8.240
-213.248.172.126
+213.248.36.182
  213.248.39.163
+213.249.156.189
  213.249.157.37
  213.25.120.14
-213.25.135.59
+213.25.135.27
  213.25.46.110
  213.250.21.112
  213.250.247.146
@@ -89200,7 +90765,6 @@
  213.251.185.63
  213.251.189.204
  213.251.255.170
-213.251.40.3
  213.252.244.108
  213.252.244.119
  213.252.244.157
@@ -89216,7 +90780,6 @@
  213.254.157.3
  213.254.212.186
  213.27.152.15
-213.3.0.138
  213.3.24.104
  213.3.25.204
  213.3.26.176
@@ -89266,6 +90829,7 @@
  213.32.6.27
  213.32.63.123
  213.32.63.93
+213.32.70.208
  213.32.71.196
  213.32.77.242
  213.32.78.219
@@ -89274,6 +90838,7 @@
  213.32.91.37
  213.32.91.71
  213.32.92.57
+213.33.147.211
  213.33.147.215
  213.33.147.223
  213.33.157.204
@@ -89281,6 +90846,7 @@
  213.33.179.242
  213.33.179.244
  213.33.179.39
+213.33.216.246
  213.34.109.218
  213.34.163.254
  213.34.171.254
@@ -89288,6 +90854,7 @@
  213.35.152.198
  213.35.233.247
  213.37.100.199
+213.37.113.108
  213.37.205.33
  213.37.5.133
  213.39.25.37
@@ -89303,7 +90870,6 @@
  213.43.83.227
  213.45.200.17
  213.46.85.185
-213.46.89.14
  213.47.114.114
  213.47.148.252
  213.47.252.190
@@ -89319,19 +90885,17 @@
  213.5.67.223
  213.5.71.227
  213.50.195.125
-213.50.196.139
  213.52.129.250
-213.52.50.166
  213.52.74.198
  213.55.73.205
  213.55.77.131
  213.55.90.51
  213.57.220.199
+213.57.226.151
  213.58.196.146
  213.58.202.70
  213.59.135.87
  213.59.152.19
-213.59.156.202
  213.59.158.2
  213.59.249.19
  213.6.10.148
@@ -89342,8 +90906,6 @@
  213.6.122.225
  213.6.130.133
  213.6.134.188
-213.6.136.150
-213.6.138.122
  213.6.141.114
  213.6.141.146
  213.6.147.138
@@ -89352,6 +90914,7 @@
  213.6.162.6
  213.6.167.126
  213.6.199.94
+213.6.204.153
  213.6.210.50
  213.6.227.38
  213.6.244.178
@@ -89387,6 +90950,7 @@
  213.67.165.108
  213.7.203.66
  213.7.67.179
+213.7.78.110
  213.7.96.25
  213.74.30.13
  213.74.53.36
@@ -89395,6 +90959,7 @@
  213.77.77.197
  213.79.101.98
  213.79.122.233
+213.79.122.82
  213.8.119.40
  213.80.166.5
  213.80.185.252
@@ -89431,19 +90996,18 @@
  213.81.196.31
  213.81.196.32
  213.81.203.66
-213.81.209.89
  213.82.190.238
  213.82.217.163
  213.86.150.242
  213.86.23.219
  213.86.4.51
  213.87.101.176
-213.87.106.113
  213.87.202.193
  213.89.131.35
  213.89.131.53
  213.89.176.166
  213.89.20.59
+213.89.214.219
  213.89.48.30
  213.89.52.22
  213.91.124.110
@@ -89455,10 +91019,9 @@
  213.91.247.55
  213.92.109.101
  213.92.118.159
-213.92.150.90
  213.92.191.122
-213.92.204.136
  213.92.204.145
+213.92.204.4
  213.92.254.112
  213.92.254.28
  213.92.254.32
@@ -89487,6 +91050,9 @@
  216.10.250.57
  216.10.251.112
  216.104.15.130
+216.104.200.172
+216.104.200.2
+216.104.200.22
  216.104.37.122
  216.104.40.170
  216.105.168.216
@@ -89495,11 +91061,10 @@
  216.108.227.39
  216.108.229.37
  216.108.237.19
+216.108.237.50
  216.110.231.197
  216.113.108.248
  216.113.194.65
-216.114.103.118
-216.114.108.65
  216.115.152.109
  216.115.153.201
  216.115.225.91
@@ -89509,7 +91074,6 @@
  216.118.128.126
  216.118.153.243
  216.118.251.2
-216.119.164.156
  216.12.174.124
  216.120.237.30
  216.121.123.115
@@ -89520,7 +91084,6 @@
  216.126.41.115
  216.126.41.89
  216.126.74.66
-216.126.77.20
  216.126.81.9
  216.126.82.39
  216.127.161.83
@@ -89542,8 +91105,8 @@
  216.144.120.16
  216.144.243.34
  216.144.248.186
+216.144.251.78
  216.145.110.42
-216.145.133.113
  216.145.83.161
  216.145.87.218
  216.145.88.119
@@ -90318,30 +91881,34 @@
  216.151.138.98
  216.151.138.99
  216.151.163.114
-216.151.180.153
+216.151.180.183
  216.151.180.184
  216.151.180.196
+216.151.180.201
  216.151.180.208
  216.151.180.213
-216.151.180.46
+216.151.180.22
+216.151.180.3
+216.151.180.39
  216.151.180.63
  216.151.180.69
+216.151.180.76
  216.151.180.81
-216.151.180.87
  216.151.180.88
-216.151.183.105
+216.151.180.99
+216.151.183.10
+216.151.183.111
  216.151.183.112
-216.151.183.16
+216.151.183.22
  216.151.183.27
  216.151.183.40
+216.151.183.45
  216.151.183.57
  216.151.183.63
  216.151.183.70
  216.151.183.87
  216.151.183.88
  216.151.183.94
-216.151.184.185
-216.151.184.97
  216.152.249.0
  216.152.249.1
  216.152.249.10
@@ -90854,9 +92421,9 @@
  216.152.252.97
  216.152.252.98
  216.152.252.99
-216.154.0.188
  216.154.15.75
  216.154.201.132
+216.155.135.180
  216.155.151.198
  216.155.90.238
  216.155.93.77
@@ -90865,6 +92432,7 @@
  216.158.192.32
  216.158.217.2
  216.158.226.253
+216.158.230.196
  216.158.232.133
  216.158.240.216
  216.158.250.108
@@ -90872,6 +92440,7 @@
  216.158.93.106
  216.158.97.113
  216.160.204.10
+216.161.214.11
  216.161.57.182
  216.164.16.190
  216.164.192.25
@@ -90923,7 +92492,6 @@
  216.180.117.96
  216.182.106.179
  216.183.177.131
-216.183.222.135
  216.183.32.98
  216.183.40.209
  216.183.40.225
@@ -90934,7 +92502,6 @@
  216.185.114.222
  216.185.44.230
  216.186.133.172
-216.186.135.146
  216.186.155.137
  216.186.204.194
  216.186.250.53
@@ -90945,6 +92512,7 @@
  216.189.145.11
  216.189.146.52
  216.189.153.207
+216.189.153.64
  216.189.177.22
  216.189.190.95
  216.191.204.114
@@ -90953,6 +92521,7 @@
  216.193.128.54
  216.193.130.240
  216.194.165.98
+216.195.17.30
  216.195.32.7
  216.196.140.205
  216.196.223.82
@@ -90971,6 +92540,7 @@
  216.213.26.64
  216.213.27.218
  216.213.29.123
+216.213.29.76
  216.215.152.170
  216.218.134.12
  216.218.142.110
@@ -90986,7 +92556,6 @@
  216.218.240.46
  216.218.243.162
  216.218.245.10
-216.218.245.82
  216.218.245.9
  216.218.254.165
  216.218.254.181
@@ -90994,6 +92563,7 @@
  216.218.63.13
  216.221.152.148
  216.221.85.81
+216.222.194.40
  216.222.194.94
  216.223.26.101
  216.224.117.2
@@ -91024,9 +92594,8 @@
  216.232.223.30
  216.235.110.164
  216.235.244.68
-216.236.161.189
+216.236.164.82
  216.236.221.42
-216.238.224.136
  216.238.234.28
  216.238.241.63
  216.238.244.19
@@ -91037,8 +92606,8 @@
  216.239.190.201
  216.239.90.19
  216.24.177.73
-216.24.179.217
  216.24.193.163
+216.24.248.199
  216.24.249.75
  216.24.85.221
  216.24.85.65
@@ -91073,6 +92642,7 @@
  216.245.220.19
  216.245.221.230
  216.246.109.114
+216.246.109.132
  216.246.49.197
  216.246.49.199
  216.246.49.201
@@ -91081,7 +92651,6 @@
  216.248.197.237
  216.249.104.172
  216.250.115.132
-216.250.115.173
  216.250.236.10
  216.250.97.10
  216.250.97.150
@@ -91094,6 +92663,7 @@
  216.251.83.79
  216.252.209.8
  216.254.186.76
+216.255.123.98
  216.26.212.35
  216.27.60.2
  216.31.116.138
@@ -91114,8 +92684,8 @@
  216.47.196.104
  216.47.216.113
  216.47.235.66
-216.47.245.138
  216.47.42.18
+216.49.146.111
  216.49.37.157
  216.49.54.211
  216.53.254.86
@@ -91124,6 +92694,7 @@
  216.56.31.99
  216.56.48.245
  216.56.63.247
+216.58.27.11
  216.59.156.51
  216.59.172.47
  216.59.200.218
@@ -91135,6 +92706,7 @@
  216.61.218.163
  216.61.218.187
  216.65.1.208
+216.65.176.26
  216.66.0.103
  216.66.0.119
  216.66.27.194
@@ -91160,6 +92732,7 @@
  216.75.37.209
  216.8.128.20
  216.8.154.8
+216.80.102.155
  216.80.108.138
  216.81.118.118
  216.81.118.78
@@ -91182,6 +92755,7 @@
  216.83.57.7
  216.83.57.8
  216.83.57.9
+216.83.8.66
  216.85.161.204
  216.85.161.220
  216.85.161.222
@@ -91200,11 +92774,6 @@
  216.98.80.5
  216.98.84.2bin.sh
  216.98.85.200
-216.99.112.249
-216.99.112.250
-216.99.112.251
-216.99.112.252
-216.99.112.253
  216.99.158.179
  216.99.158.78
  21625.xc.iziyo.com
@@ -91213,10 +92782,12 @@
  217.10.103.170
  217.10.103.227
  217.10.144.19
+217.10.46.100
  217.100.113.174
  217.100.185.246
  217.100.196.10
  217.100.97.156
+217.101.245.64
  217.103.144.253
  217.103.94.158
  217.104.75.11
@@ -91224,38 +92795,25 @@
  217.107.106.204
  217.107.106.22
  217.107.106.234
-217.107.106.241
  217.107.106.54
  217.107.106.89
-217.107.106.93
-217.107.124.120
  217.107.124.161
-217.107.124.169
-217.107.124.9
-217.107.125.124
  217.107.125.13
  217.107.126.181
-217.107.126.198
-217.107.126.228
-217.107.126.82
-217.107.127.119
  217.107.127.213
  217.107.194.1
-217.107.194.26
  217.107.197.240
+217.107.34.210
  217.107.34.48
  217.107.71.14
-217.11.176.244
-217.11.183.113
-217.11.183.125
  217.11.225.189
  217.11.48.184
-217.11.76.250
  217.110.72.100
  217.111.146.157
  217.111.197.123
  217.111.239.37
  217.111.245.138
+217.112.130.58
  217.112.131.7
  217.112.92.251
  217.113.114.80
@@ -91269,10 +92827,10 @@
  217.114.212.26
  217.115.10.131
  217.115.11.163
+217.115.112.198
  217.115.116.250
  217.115.213.186
  217.115.51.53
-217.116.228.10
  217.117.216.105
  217.118.57.219
  217.119.121.123
@@ -91293,9 +92851,9 @@
  217.12.223.51
  217.12.57.89
  217.12.68.58
-217.12.85.234
  217.12.98.163
  217.120.103.59
+217.120.146.193
  217.122.250.142
  217.122.77.150
  217.123.170.239
@@ -91308,6 +92866,7 @@
  217.127.133.214
  217.128.2.177
  217.128.221.161
+217.128.47.29
  217.128.8.98
  217.129.216.122
  217.13.107.26
@@ -91322,6 +92881,7 @@
  217.130.52.42
  217.131.182.240
  217.131.2.232
+217.131.78.252
  217.133.12.80
  217.133.194.44
  217.133.40.144
@@ -91329,14 +92889,14 @@
  217.133.95.209
  217.136.113.229
  217.136.13.236
+217.136.90.158
  217.138.193.181
  217.138.193.184
  217.138.193.185
  217.138.193.188
-217.138.194.119
-217.138.194.124
  217.138.197.107
  217.138.202.211
+217.138.202.212
  217.138.202.213
  217.138.205.162
  217.138.209.151
@@ -91344,7 +92904,6 @@
  217.138.219.141
  217.138.222.86
  217.138.222.94
-217.138.252.164
  217.138.252.212
  217.14.7.228
  217.14.7.228bin.sh
@@ -91360,12 +92919,8 @@
  217.146.27.53
  217.146.76.212
  217.146.88.133
-217.147.0.152
  217.147.1.128
-217.147.1.169
  217.147.162.201
-217.147.165.2
-217.147.169.21
  217.147.169.244
  217.147.173.159
  217.147.28.102
@@ -91376,19 +92931,21 @@
  217.148.89.86
  217.149.188.102
  217.149.58.106
+217.149.7.124
  217.149.7.232
  217.15.117.26
  217.15.139.219
  217.15.178.7
  217.15.195.141
  217.150.220.15
-217.150.40.21
+217.150.41.29
  217.150.77.31
  217.150.80.59
  217.150.84.252
  217.150.87.244
  217.150.87.248
  217.150.87.250
+217.151.69.22
  217.153.241.204
  217.158.9.102
  217.16.18.219
@@ -91403,23 +92960,26 @@
  217.160.214.101
  217.160.239.186
  217.160.242.226
-217.160.244.7
  217.160.250.141
  217.160.254.33
  217.160.255.172
  217.160.59.241
  217.160.59.40
  217.160.59.64
+217.160.64.209
  217.160.65.177
+217.162.144.187
  217.163.11.111
  217.163.28.231
  217.164.255.35
  217.164.37.155
  217.165.115.121
  217.165.160.11
+217.165.23.53
  217.165.28.158
  217.165.28.164
  217.165.31.5
+217.168.153.65
  217.168.177.9
  217.168.76.230
  217.168.76.77
@@ -91435,18 +92995,17 @@
  217.170.206.146
  217.170.206.192
  217.171.147.164
-217.171.149.141
  217.171.39.143
  217.171.66.171
-217.172.122.10
+217.172.122.11
  217.172.122.12
  217.172.122.14
  217.172.122.16
+217.172.122.18
  217.172.122.4
  217.172.179.138
  217.172.179.75
  217.172.186.250
-217.172.190.248
  217.172.244.9
  217.173.202.227
  217.173.202.37
@@ -91465,14 +93024,15 @@
  217.182.16.12
  217.182.16.13
  217.182.16.9
+217.182.168.167
  217.182.169.183
  217.182.172.114
  217.182.172.117
  217.182.173.156
  217.182.174.139
  217.182.192.217
+217.182.193.49
  217.182.195.5
-217.182.196.227
  217.182.196.3
  217.182.197.93
  217.182.198.228
@@ -91487,6 +93047,8 @@
  217.182.217.24
  217.182.225.67
  217.182.23.55
+217.182.236.71
+217.182.242.31
  217.182.252.30
  217.182.253.249
  217.182.27.217
@@ -91514,7 +93076,6 @@
  217.19.209.253
  217.19.216.210
  217.194.6.58
-217.195.155.42
  217.195.164.4
  217.195.170.121
  217.195.202.34
@@ -91535,6 +93096,7 @@
  217.20.166.178
  217.20.183.149
  217.208.148.178
+217.208.47.120
  217.208.51.239
  217.208.80.36
  217.209.211.123
@@ -91544,9 +93106,9 @@
  217.21.125.179
  217.21.125.180
  217.21.147.112
-217.21.24.146
  217.21.54.173
  217.21.54.221
+217.21.6.18
  217.210.105.171
  217.210.11.200
  217.210.80.68
@@ -91557,27 +93119,27 @@
  217.217.179.17
  217.218.222.34
  217.218.233.164
+217.218.87.23
  217.219.116.116
  217.219.136.129
  217.219.137.203
  217.219.155.34
-217.219.172.13
-217.219.172.8
  217.219.173.200
-217.219.179.246
  217.219.217.81
+217.219.245.17
  217.219.31.210
  217.219.61.27
-217.219.61.6
  217.22.141.61
  217.22.60.25
+217.224.112.88
  217.225.100.74
+217.225.101.171
  217.225.126.227
-217.229.49.58
  217.23.12.100
  217.23.12.47
  217.23.140.103
  217.23.143.169
+217.23.188.2
  217.23.200.32
  217.23.3.251
  217.23.3.96
@@ -91590,17 +93152,16 @@
  217.23.69.146
  217.23.74.198
  217.23.8.80
-217.230.223.213
+217.230.218.166
  217.230.223.84
-217.233.34.20
  217.233.45.133
  217.233.46.138
+217.237.112.101
  217.24.119.11
  217.24.18.226
  217.24.240.68
  217.24.6.8
  217.24.72.52
-217.245.85.150
  217.248.124.114
  217.25.177.130
  217.25.198.133
@@ -91608,27 +93169,19 @@
  217.25.225.192
  217.25.25.246
  217.25.31.20
+217.251.141.68
  217.251.143.47
  217.26.163.82
  217.26.47.10
+217.27.117.136
  217.27.124.81
-217.27.131.208
-217.27.175.183
  217.27.175.249
  217.27.193.106
  217.27.219.14
  217.27.50.232
-217.29.122.112
-217.29.122.28
  217.29.126.136
  217.29.18.206
  217.29.30.18
-217.30.160.25
-217.30.169.248
-217.30.169.45
-217.30.170.29
-217.30.171.134
-217.30.171.41
  217.30.175.101
  217.30.194.246
  217.31.164.32
@@ -91644,11 +93197,9 @@
  217.40.96.250
  217.42.120.96
  217.42.78.24
-217.42.9.24
  217.56.71.58
  217.57.140.58
  217.57.74.118
-217.60.186.68
  217.60.50.197
  217.61.0.54
  217.61.107.36
@@ -91660,6 +93211,7 @@
  217.64.113.195
  217.64.133.220
  217.64.134.145
+217.64.142.242
  217.64.148.94
  217.64.17.54
  217.64.42.157
@@ -91669,7 +93221,6 @@
  217.65.126.116
  217.65.6.12
  217.66.106.216
-217.66.202.130
  217.67.182.170
  217.69.13.100
  217.69.13.110
@@ -91685,6 +93236,7 @@
  217.70.189.176
  217.70.191.85
  217.70.23.114
+217.70.58.217
  217.71.236.73
  217.72.1.254
  217.72.2.2
@@ -91696,7 +93248,6 @@
  217.73.143.76
  217.73.143.80
  217.73.183.53
-217.75.222.134
  217.76.40.57
  217.77.104.10
  217.77.219.21
@@ -91714,6 +93265,7 @@
  217.79.3.94
  217.79.34.202
  217.8.117.10
+217.8.117.101
  217.8.117.132
  217.8.117.17
  217.8.117.18
@@ -91737,16 +93289,16 @@
  217.88.124.173
  217.88.40.19
  217.89.145.130
-217.9.92.189
  217.92.55.246
  217.94.210.172
  217.94.242.128
  217.95.168.14
+217.96.214.38
  217538-dot-n-e-w-me-ss-age-po-rt-al.wl.r.appspot.com
  218.0.56.209
  218.0.88.48
-218.1.79.135
  218.10.13.98
+218.10.139.55
  218.10.239.96
  218.10.28.58
  218.10.70.190
@@ -91761,7 +93313,10 @@
  218.103.184.136
  218.103.188.208
  218.103.234.213
+218.103.242.226
  218.103.37.97
+218.104.175.28
+218.104.216.132
  218.104.225.140
  218.104.67.138
  218.106.120.122
@@ -91771,15 +93326,18 @@
  218.107.212.8
  218.107.38.70
  218.108.109.90
-218.108.152.218
+218.108.186.219
  218.108.188.226
  218.108.19.250
  218.108.31.28
+218.108.39.211
  218.108.52.58
  218.108.73.34
  218.109.145.152
  218.109.146.170
+218.11.107.127
  218.11.121.12
+218.111.88.185
  218.12.196.14
  218.12.33.155
  218.13.174.238
@@ -91813,7 +93371,6 @@
  218.146.227.203
  218.146.232.130
  218.146.249.90
-218.146.74.209
  218.147.109.163
  218.147.132.227
  218.147.179.218
@@ -91871,13 +93428,13 @@
  218.152.82.84
  218.153.157.39
  218.153.205.69
+218.153.212.73
  218.153.243.136
  218.154.126.47
  218.154.131.141
  218.154.134.246
  218.154.140.142
  218.154.181.253
-218.154.182.243
  218.154.202.67
  218.154.205.101
  218.154.21.22
@@ -91968,6 +93525,7 @@
  218.161.122.83
  218.161.122.88
  218.161.123.174
+218.161.123.96
  218.161.14.150
  218.161.14.23
  218.161.14.25
@@ -92011,6 +93569,7 @@
  218.161.42.179
  218.161.42.248
  218.161.47.230
+218.161.48.219
  218.161.48.73
  218.161.49.162
  218.161.49.69
@@ -92031,7 +93590,6 @@
  218.161.64.132
  218.161.64.147
  218.161.66.108
-218.161.66.150
  218.161.66.163
  218.161.66.234
  218.161.66.236
@@ -92039,7 +93597,6 @@
  218.161.68.132
  218.161.68.209
  218.161.68.79
-218.161.69.105
  218.161.70.161
  218.161.72.97
  218.161.73.109
@@ -92053,7 +93610,6 @@
  218.161.76.38
  218.161.78.162
  218.161.79.179
-218.161.80.102
  218.161.81.59
  218.161.82.228
  218.161.82.64
@@ -92086,6 +93642,7 @@
  218.164.13.7
  218.164.229.43
  218.166.11.26
+218.166.210.51
  218.166.32.200
  218.166.36.57
  218.166.88.152
@@ -92101,6 +93658,7 @@
  218.173.29.60
  218.18.101.84
  218.18.152.89
+218.18.161.186
  218.18.232.29
  218.18.239.149
  218.185.20.88
@@ -92119,7 +93677,6 @@
  218.189.125.134
  218.189.18.158
  218.189.19.30
-218.19.164.115
  218.193.192.193
  218.193.192.22
  218.195.112.98
@@ -92137,12 +93694,12 @@
  218.2.55.154
  218.20.254.247
  218.200.138.110
+218.200.235.178
  218.200.3.26
  218.200.5.178
  218.200.68.199
  218.201.100.66
  218.201.113.143
-218.201.160.34
  218.201.160.40
  218.201.250.233
  218.201.55.57
@@ -92150,9 +93707,9 @@
  218.201.78.103
  218.201.81.162
  218.202.140.167
+218.203.175.18
  218.203.175.70
  218.203.206.137
-218.204.104.234
  218.204.130.238
  218.204.132.211
  218.204.166.179
@@ -92164,9 +93721,9 @@
  218.206.168.34
  218.206.245.124
  218.206.25.11
+218.207.116.31
  218.207.126.155
  218.208.21.7
-218.209.47.222
  218.21.170.15
  218.21.170.20
  218.21.170.238
@@ -92188,6 +93745,7 @@
  218.21.171.55
  218.21.171.57
  218.21.196.234
+218.21.218.10
  218.21.240.200
  218.21.240.201
  218.21.240.24
@@ -92195,11 +93753,13 @@
  218.21.250.162
  218.21.250.60
  218.21.27.178
+218.21.32.98
  218.21.70.248
  218.21.78.35
  218.21.80.21
  218.21.97.106
  218.210.36.142
+218.210.46.57
  218.212.111.91
  218.212.114.209
  218.212.129.51
@@ -92230,12 +93790,13 @@
  218.218.0.219
  218.219.125.157
  218.219.209.202
+218.219.99.184
  218.22.127.176
  218.22.197.74
+218.22.234.147
  218.22.254.194
  218.22.27.3
  218.22.36.135
-218.22.47.130
  218.227.171.11
  218.23.227.52
  218.23.57.244
@@ -92248,9 +93809,11 @@
  218.234.19.79
  218.234.21.178
  218.234.32.79
+218.235.113.249
  218.236.113.49
  218.237.120.251
  218.237.120.252
+218.237.156.34
  218.237.173.117
  218.237.184.67
  218.237.219.12
@@ -92264,6 +93827,7 @@
  218.24.16.198
  218.24.173.120
  218.24.73.123
+218.240.137.68
  218.240.148.211
  218.241.134.34
  218.241.154.197
@@ -92286,6 +93850,7 @@
  218.246.71.117
  218.246.71.42
  218.246.93.97
+218.247.142.194
  218.248.116.142
  218.248.23.33
  218.248.232.24
@@ -92297,36 +93862,34 @@
  218.249.45.162
  218.249.59.12
  218.249.69.210
-218.249.73.54
  218.25.101.189
  218.25.130.220
  218.25.140.72
  218.25.161.226
  218.25.224.23
+218.25.93.6
  218.250.10.252
  218.250.137.45
  218.250.137.96
  218.250.145.132
  218.250.167.195
  218.250.187.133
+218.250.189.183
  218.250.205.172
  218.250.224.131
-218.250.228.157
  218.250.233.210
  218.250.70.22
-218.250.84.56
  218.251.49.116
  218.251.58.151
+218.252.44.54
  218.253.193.131
  218.253.240.16
  218.253.254.100
  218.253.69.134
  218.255.136.110
-218.255.162.53
  218.255.163.212
  218.255.242.114
  218.255.245.10
-218.255.70.126
  218.255.88.178
  218.26.101.226
  218.26.102.245
@@ -92359,12 +93922,13 @@
  218.28.199.236
  218.28.199.237
  218.28.20.18
+218.28.200.67
  218.28.238.162
  218.28.244.83
  218.28.253.146
  218.28.28.203
  218.28.39.147
-218.28.41.110
+218.28.57.230
  218.28.78.243
  218.28.83.106
  218.28.99.248
@@ -92381,6 +93945,7 @@
  218.29.219.36
  218.29.222.114
  218.29.231.4
+218.29.31.120
  218.29.35.62
  218.29.54.107
  218.29.54.108
@@ -92389,11 +93954,13 @@
  218.29.68.154
  218.29.7.11
  218.29.81.106
+218.29.81.110
+218.29.83.38
  218.29.85.98
-218.3.124.180
  218.3.194.126
  218.3.194.137
  218.3.223.134
+218.30.19.190
  218.30.21.112
  218.30.21.209
  218.30.21.46
@@ -92451,7 +94018,6 @@
  218.4.192.27
  218.4.201.122
  218.4.202.186
-218.4.214.115
  218.4.239.146
  218.4.240.194
  218.4.240.42
@@ -92467,12 +94033,14 @@
  218.5.250.131
  218.5.28.113
  218.5.28.19
+218.5.74.175
  218.5.74.92
  218.5.86.250
  218.50.155.245
  218.50.223.112
  218.50.52.241
  218.50.53.15
+218.50.6.16
  218.51.127.13
  218.51.205.132
  218.53.144.81
@@ -92480,6 +94048,7 @@
  218.54.149.67
  218.54.171.157
  218.55.114.91
+218.55.177.7
  218.55.227.145
  218.56.11.181
  218.56.11.236
@@ -92496,10 +94065,12 @@
  218.56.226.68
  218.56.41.228
  218.56.59.170
+218.56.65.232
  218.56.71.164
  218.56.82.23
  218.57.11.72
  218.57.118.56
+218.57.123.183
  218.57.123.247
  218.57.129.37
  218.57.204.114
@@ -92509,7 +94080,6 @@
  218.57.51.87bin.sh
  218.57.8.92
  218.57.81.236
-218.58.161.67
  218.58.162.126
  218.58.194.162
  218.58.198.154
@@ -92528,7 +94098,6 @@
  218.59.46.158
  218.59.98.138bin.sh
  218.59.98.44
-218.6.130.195
  218.6.192.238
  218.6.224.50
  218.6.95.146
@@ -92553,17 +94122,15 @@
  218.62.83.66
  218.62.91.252
  218.63.208.213
+218.63.56.198
  218.64.174.207
  218.64.218.43
  218.64.251.194
  218.64.53.20
  218.64.69.79
-218.64.77.62
  218.64.84.147
  218.65.131.26
  218.65.131.48
-218.65.219.119
-218.65.220.48
  218.65.221.156
  218.65.221.24
  218.66.16.241
@@ -92574,6 +94141,7 @@
  218.67.65.194
  218.67.88.169
  218.67.90.176
+218.68.152.113
  218.68.204.130
  218.69.1.90
  218.69.111.107
@@ -92587,13 +94155,13 @@
  218.69.98.170
  218.7.118.169
  218.7.141.51
-218.7.171.91
  218.7.19.244
  218.7.201.234
  218.7.208.250
  218.7.36.82
  218.7.56.182
  218.70.148.133
+218.70.17.50
  218.70.19.74
  218.70.218.228
  218.70.254.26
@@ -92605,6 +94173,7 @@
  218.71.141.62
  218.72.253.212
  218.73.111.41
+218.73.131.66
  218.73.33.94
  218.73.60.118
  218.74.130.63
@@ -92618,7 +94187,6 @@
  218.75.190.215
  218.75.210.46
  218.75.211.14
-218.75.216.21
  218.75.219.76
  218.75.230.12
  218.75.230.4
@@ -92626,31 +94194,36 @@
  218.75.33.180
  218.75.47.242
  218.75.60.55
+218.75.61.254
  218.75.62.90
  218.75.71.157
  218.75.72.82
  218.75.77.92
  218.75.78.214
-218.75.82.226
  218.75.98.230
  218.76.215.4
  218.76.221.72
+218.76.29.35
  218.76.35.178
  218.76.38.190
+218.76.38.75
  218.76.46.172
  218.76.49.100
  218.76.52.120
  218.76.60.162
+218.77.104.75
  218.77.116.166
  218.77.128.200
  218.77.129.81
  218.77.41.43
  218.77.50.45
+218.77.62.26
  218.77.8.142
  218.78.103.91
  218.78.209.1
  218.78.209.241
  218.78.21.74
+218.78.213.143
  218.78.26.250
  218.78.46.81
  218.78.50.164
@@ -92658,8 +94231,6 @@
  218.78.70.55
  218.78.73.117
  218.79.183.161
-218.79.93.185
-218.8.166.195
  218.8.215.32
  218.8.251.187
  218.8.64.20
@@ -92679,7 +94250,6 @@
  218.86.31.67
  218.86.87.171
  218.87.107.134
-218.87.143.128
  218.87.149.136
  218.87.193.78
  218.87.30.151
@@ -92688,15 +94258,22 @@
  218.87.30.159
  218.88.103.204
  218.88.124.76
+218.88.125.233
  218.88.215.252
  218.88.215.49
  218.88.23.141
  218.88.24.127
+218.88.24.3
  218.88.245.94
  218.88.25.113
+218.88.25.9
  218.88.250.6
+218.88.26.214
  218.88.27.119
  218.88.27.163
+218.88.29.188
+218.88.29.235
+218.88.29.236
  218.88.30.115
  218.88.30.191
  218.88.30.36
@@ -92711,7 +94288,6 @@
  218.89.50.90
  218.89.77.122
  218.89.77.123
-218.89.77.2
  218.89.77.21
  218.89.77.27
  218.89.77.28
@@ -92756,11 +94332,13 @@
  218.92.0.172
  218.92.0.173
  218.92.0.175
+218.92.0.176
  218.92.0.184
  218.92.0.185
-218.92.0.192
+218.92.0.191
  218.92.0.198
  218.92.0.199
+218.92.0.200
  218.92.0.201
  218.92.0.202
  218.92.0.203
@@ -92769,7 +94347,6 @@
  218.92.0.208
  218.92.0.211
  218.92.0.212
-218.92.0.213
  218.92.0.223
  218.92.0.246
  218.92.0.247
@@ -92802,7 +94379,7 @@
  218.93.172.59
  218.93.179.82
  218.93.198.230
-218.93.21.43
+218.93.21.194
  218.93.225.150
  218.93.4.10
  218.93.44.222
@@ -92830,7 +94407,6 @@
  218.94.57.147
  218.94.57.157
  218.94.59.55
-218.94.6.226
  218.94.60.99
  218.94.93.34
  218.95.136.168
@@ -92849,6 +94425,7 @@
  218betasus.com
  219.100.37.240
  219.101.192.141
+219.111.105.182
  219.111.2.38
  219.115.27.157
  219.117.196.250
@@ -92876,22 +94453,20 @@
  219.131.240.84
  219.131.241.106
  219.131.242.144
-219.131.243.148
  219.131.243.220
  219.131.60.195
  219.131.60.198
  219.133.167.225
  219.133.168.209
  219.133.37.8
-219.133.71.26
  219.134.137.234
  219.134.137.235
  219.134.161.166
  219.134.216.32
  219.135.139.130
  219.135.172.202
-219.135.174.177
  219.135.209.164
+219.135.214.58
  219.135.61.86
  219.136.207.78
  219.136.243.47
@@ -92912,12 +94487,10 @@
  219.139.207.33
  219.139.44.135
  219.139.67.166
-219.139.78.58
  219.139.78.67
  219.139.83.165
  219.140.124.119
  219.140.195.178
-219.140.55.174
  219.141.167.120
  219.141.231.161
  219.142.106.204
@@ -92925,7 +94498,6 @@
  219.142.143.118
  219.143.144.130
  219.143.154.4
-219.143.186.194
  219.143.3.146
  219.143.38.232
  219.144.196.98
@@ -92944,7 +94516,7 @@
  219.145.195.109
  219.145.2.4
  219.145.221.106
-219.145.43.52
+219.145.43.61
  219.146.122.194
  219.146.126.98
  219.146.127.6
@@ -92960,6 +94532,7 @@
  219.147.3.102
  219.147.74.48
  219.147.76.9
+219.147.99.190
  219.148.52.18
  219.148.83.88
  219.150.189.215
@@ -92975,7 +94548,6 @@
  219.151.151.35
  219.151.22.209
  219.151.22.56
-219.151.236.148
  219.151.248.79
  219.151.35.119
  219.151.41.253
@@ -92986,81 +94558,79 @@
  219.152.168.133
  219.152.170.58
  219.153.100.153
+219.153.115.251
  219.153.13.70
+219.153.20.213
+219.153.33.234
  219.153.6.161
  219.153.72.78
-219.153.72.87
  219.153.74.70
  219.154.0.124
  219.154.0.42
  219.154.102.109
-219.154.102.188
+219.154.103.190
+219.154.105.122
+219.154.109.152
  219.154.11.0
-219.154.112.150
  219.154.115.117
-219.154.118.183
+219.154.117.176
  219.154.119.243
-219.154.121.59
  219.154.122.28
-219.154.124.201
-219.154.125.219
-219.154.126.20
-219.154.126.207
-219.154.127.38
-219.154.127.85
-219.154.149.3
-219.154.152.151
+219.154.125.202
  219.154.154.104
  219.154.160.74
  219.154.182.157
  219.154.187.217
+219.154.187.3
  219.154.19.88
  219.154.2.27
  219.154.3.227
+219.154.32.82
  219.154.4.197
+219.154.4.79
  219.154.45.238
  219.154.6.231
  219.154.6.34
  219.154.7.30
  219.154.81.199
  219.154.97.148
-219.154.98.241
+219.154.97.48
  219.155.102.1
  219.155.102.140
  219.155.103.99
+219.155.107.120
  219.155.11.36
-219.155.114.11
+219.155.112.86
  219.155.115.133
  219.155.117.127
  219.155.12.13
+219.155.12.174
  219.155.13.2
-219.155.130.21
  219.155.14.130
-219.155.169.210
+219.155.184.71
+219.155.20.255
  219.155.21.25
  219.155.210.213
-219.155.211.254
  219.155.215.241
  219.155.215.80
-219.155.224.219
+219.155.216.252
  219.155.225.43
  219.155.23.198
  219.155.23.226
  219.155.238.65
-219.155.241.11
-219.155.247.15
-219.155.253.44
+219.155.249.176
+219.155.26.116
  219.155.27.242
  219.155.29.116
-219.155.31.122
-219.155.31.7
+219.155.31.247
  219.155.34.94
+219.155.4.190
+219.155.41.33
+219.155.66.32
  219.155.69.108
-219.155.69.112
  219.155.71.14
-219.155.73.83
-219.155.85.158
-219.155.87.130
+219.155.86.33
+219.155.93.230
  219.155.96.191
  219.155.96.239
  219.155.97.0
@@ -93072,25 +94642,27 @@
  219.155.99.240
  219.155.99.41
  219.156.11.203
+219.156.11.243
  219.156.11.83
+219.156.12.54
+219.156.12.6
  219.156.125.88
  219.156.126.5
-219.156.13.1
+219.156.13.167
  219.156.14.138
  219.156.146.13
  219.156.146.3
-219.156.15.89
  219.156.153.165
  219.156.153.214
-219.156.153.69
-219.156.154.248
  219.156.168.44
  219.156.18.10
  219.156.188.241
  219.156.188.77
  219.156.199.167
  219.156.20.153
+219.156.20.171
  219.156.20.210
+219.156.20.249
  219.156.20.54
  219.156.209.49
  219.156.210.6
@@ -93099,53 +94671,54 @@
  219.156.235.230
  219.156.242.51
  219.156.247.152
-219.156.56.232
+219.156.55.207
+219.156.57.130
+219.156.57.55
  219.156.61.116
  219.156.73.52
-219.156.75.66
-219.156.76.193
  219.156.77.236
-219.156.8.229
-219.156.95.153
+219.156.9.34
+219.156.96.40
+219.156.98.152
+219.157.116.209
+219.157.132.10
  219.157.132.23
-219.157.133.202
  219.157.134.107
  219.157.134.123
-219.157.134.138
  219.157.134.40
  219.157.134.67
  219.157.134.7
-219.157.135.8
-219.157.136.219
  219.157.139.165
-219.157.146.229
  219.157.146.91
  219.157.147.37
  219.157.150.79
-219.157.151.42
  219.157.151.5
  219.157.152.81
+219.157.162.90
+219.157.163.228
  219.157.168.233
-219.157.169.42
  219.157.171.215
-219.157.171.75
  219.157.171.92
  219.157.176.45
-219.157.178.245
+219.157.178.6
  219.157.179.101
+219.157.181.27
+219.157.181.74
  219.157.182.170
  219.157.183.229
  219.157.202.184
  219.157.202.21
+219.157.203.190
  219.157.203.69
  219.157.204.237
  219.157.204.49
+219.157.204.98
  219.157.206.123
  219.157.206.252
-219.157.207.214
  219.157.212.162
  219.157.212.205
  219.157.213.231
+219.157.214.187
  219.157.214.236
  219.157.214.40
  219.157.214.50
@@ -93156,79 +94729,85 @@
  219.157.215.222
  219.157.215.236
  219.157.215.240
-219.157.215.31
  219.157.215.64
  219.157.216.164
  219.157.216.98
  219.157.217.188
-219.157.218.118
+219.157.218.18
  219.157.219.159
  219.157.220.206
  219.157.221.183
  219.157.221.63
-219.157.223.109
+219.157.222.119
  219.157.223.170
-219.157.233.35
+219.157.223.23
+219.157.224.186
  219.157.235.234
  219.157.235.93
-219.157.237.112
  219.157.238.66
  219.157.24.196
  219.157.24.230
  219.157.241.142
-219.157.246.204
+219.157.246.196
+219.157.246.53
  219.157.247.206
-219.157.25.164
  219.157.250.121
-219.157.26.104
+219.157.253.210
+219.157.254.237
+219.157.254.74
  219.157.27.170
-219.157.29.195
+219.157.28.118
+219.157.29.30
  219.157.29.36
+219.157.31.135
+219.157.32.167
  219.157.32.53
-219.157.34.23
  219.157.34.37
  219.157.35.18
  219.157.36.105
  219.157.36.214
-219.157.40.16
+219.157.42.239
  219.157.43.152
-219.157.49.200
+219.157.48.6
+219.157.50.105
  219.157.51.45
  219.157.52.159
-219.157.53.32
+219.157.52.249
  219.157.54.231
  219.157.54.44
  219.157.55.224
  219.157.56.152
  219.157.57.2
-219.157.58.168
-219.157.59.236
+219.157.59.151
+219.157.59.186
  219.157.60.177
+219.157.61.119
+219.157.61.239
  219.157.61.38
+219.157.61.62
  219.157.64.8
-219.157.65.175
-219.157.66.118
-219.157.66.199
+219.157.66.64
+219.157.67.75
  219.157.75.62
  219.159.164.237
  219.159.170.38
  219.159.193.50
  219.159.201.76
-219.159.213.24
  219.159.244.58
  219.159.245.20
  219.159.245.35
  219.159.250.226
-219.159.38.197
  219.165.142.209
  219.165.253.2
  219.165.92.20
  219.166.33.209
  219.209.164.2
  219.216.120.119
-219.217.204.104
+219.228.100.200
  219.230.159.55
+219.232.115.95
  219.232.124.237
+219.232.48.202
  219.232.87.67
  219.233.217.123
  219.233.217.18
@@ -93253,6 +94832,7 @@
  219.241.6.180
  219.244.16.225
  219.244.16.227
+219.246.187.32
  219.246.67.82
  219.247.63.186
  219.249.113.183
@@ -93274,12 +94854,12 @@
  219.68.244.245
  219.68.5.83
  219.68.73.224
-219.68.74.37
  219.69.110.49
  219.69.77.114
  219.70.205.168
  219.70.63.211
  219.71.14.125
+219.71.191.215
  219.71.210.212
  219.73.0.52
  219.73.108.38
@@ -93289,13 +94869,12 @@
  219.73.5.227
  219.73.55.244
  219.73.61.85
+219.73.92.39
  219.73.94.65
-219.73.95.217
  219.74.121.62
  219.74.125.133
  219.74.129.43
  219.74.130.202
-219.74.140.102
  219.74.185.105
  219.74.40.227
  219.74.46.152
@@ -93315,6 +94894,7 @@
  219.77.27.183
  219.77.31.160
  219.77.42.29
+219.77.62.235
  219.77.67.174
  219.77.67.202
  219.77.97.133
@@ -93338,6 +94918,7 @@
  219.80.133.57
  219.80.144.143
  219.80.217.104
+219.80.217.209
  219.81.243.44
  219.83.125.35
  219.83.162.37
@@ -93379,13 +94960,11 @@
  219.85.68.50
  219.85.82.211
  219.85.9.40
-219.86.241.56
  219.87.82.112
  219.87.82.115
  219.87.82.116
  219.89.196.131
  219.90.112.44
-219.90.91.107
  219.91.110.131
  219.91.142.47
  219.91.153.165
@@ -93407,7 +94986,7 @@
  219.92.54.252
  219.92.59.93
  219.92.6.185
-219.93.110.60
+219.92.72.153
  219.93.111.93
  219.93.129.8
  219.94.128.174
@@ -93428,6 +95007,7 @@
  220.100.117.121
  220.100.56.142
  220.102.43.235
+220.104.105.204
  220.108.44.75
  220.110.145.21
  220.110.164.66
@@ -93475,7 +95055,6 @@
  220.122.194.200
  220.123.122.250bin.sh
  220.123.143.241
-220.123.169.70
  220.123.176.132
  220.123.177.160
  220.123.18.156
@@ -93493,10 +95072,9 @@
  220.124.186.246
  220.124.192.178
  220.124.22.93
-220.124.225.176
-220.124.240.66
  220.124.246.99
  220.124.94.111
+220.125.117.32
  220.125.223.105
  220.125.230.193
  220.125.230.194
@@ -93510,13 +95088,14 @@
  220.127.118.104
  220.127.118.116
  220.127.118.117
+220.127.134.59
  220.127.135.103
+220.127.148.8
  220.127.198.153
  220.127.201.5
  220.127.216.85
  220.127.221.123
  220.127.239.7
-220.127.3.59
  220.127.50.88
  220.127.53.223
  220.128.125.59
@@ -93544,6 +95123,7 @@
  220.130.156.189
  220.130.163.134
  220.130.174.113
+220.130.178.36
  220.130.184.5
  220.130.193.234
  220.130.213.221
@@ -93586,6 +95166,7 @@
  220.132.114.157
  220.132.114.161
  220.132.114.178
+220.132.114.252
  220.132.114.51
  220.132.115.7
  220.132.118.135
@@ -93674,7 +95255,6 @@
  220.132.191.143
  220.132.191.186
  220.132.191.38
-220.132.192.125
  220.132.192.169
  220.132.192.49
  220.132.193.147
@@ -93706,13 +95286,13 @@
  220.132.207.155
  220.132.208.13
  220.132.208.237
-220.132.209.150
  220.132.209.220
  220.132.210.223
  220.132.210.91
  220.132.213.2
  220.132.214.111
  220.132.214.120
+220.132.214.196
  220.132.214.43
  220.132.215.123
  220.132.217.1
@@ -93771,7 +95351,6 @@
  220.132.37.3
  220.132.38.17
  220.132.39.221
-220.132.41.14
  220.132.42.82
  220.132.43.1
  220.132.43.72
@@ -93780,6 +95359,7 @@
  220.132.46.251
  220.132.49.58
  220.132.50.145
+220.132.50.251
  220.132.50.75
  220.132.51.13
  220.132.51.165
@@ -93794,6 +95374,7 @@
  220.132.57.92
  220.132.6.138
  220.132.6.50
+220.132.68.51
  220.132.69.147
  220.132.69.238
  220.132.69.72
@@ -93822,7 +95403,6 @@
  220.132.84.78
  220.132.86.14
  220.132.86.21
-220.132.87.71
  220.132.88.135
  220.132.9.125
  220.132.90.134
@@ -93856,7 +95436,6 @@
  220.133.105.223
  220.133.105.92
  220.133.107.201
-220.133.108.173
  220.133.108.29
  220.133.108.64
  220.133.109.250
@@ -93880,7 +95459,6 @@
  220.133.12.47
  220.133.122.101
  220.133.122.21
-220.133.125.153
  220.133.125.21
  220.133.126.148
  220.133.126.30
@@ -94006,6 +95584,7 @@
  220.133.235.39
  220.133.236.166
  220.133.237.130
+220.133.237.166
  220.133.237.211
  220.133.237.4
  220.133.237.80
@@ -94045,7 +95624,6 @@
  220.133.4.97
  220.133.41.182
  220.133.43.151
-220.133.43.175
  220.133.45.64
  220.133.46.40
  220.133.48.242
@@ -94112,7 +95690,6 @@
  220.134.11.45
  220.134.110.191
  220.134.112.13
-220.134.112.137
  220.134.114.125
  220.134.116.161
  220.134.117.138
@@ -94173,6 +95750,7 @@
  220.134.152.142
  220.134.153.138
  220.134.153.75
+220.134.154.196
  220.134.154.205
  220.134.154.7
  220.134.155.26
@@ -94204,7 +95782,6 @@
  220.134.175.77
  220.134.178.99
  220.134.181.110
-220.134.181.243
  220.134.182.155
  220.134.182.158
  220.134.182.9
@@ -94283,7 +95860,6 @@
  220.134.249.134
  220.134.249.25
  220.134.25.204
-220.134.25.49
  220.134.250.230
  220.134.250.43
  220.134.250.74
@@ -94317,7 +95893,6 @@
  220.134.58.123
  220.134.58.141
  220.134.59.130
-220.134.59.182
  220.134.59.92
  220.134.6.162
  220.134.61.101
@@ -94456,6 +96031,7 @@
  220.135.192.214
  220.135.193.171
  220.135.193.217
+220.135.195.154
  220.135.195.2
  220.135.195.223
  220.135.197.157
@@ -94492,6 +96068,7 @@
  220.135.232.172
  220.135.232.193
  220.135.232.29
+220.135.236.29
  220.135.237.138
  220.135.237.252
  220.135.238.180
@@ -94516,7 +96093,6 @@
  220.135.252.250
  220.135.26.176
  220.135.26.181
-220.135.27.157
  220.135.27.194
  220.135.28.173
  220.135.28.21
@@ -94564,7 +96140,6 @@
  220.135.77.82
  220.135.78.136
  220.135.78.16
-220.135.79.198
  220.135.79.26
  220.135.79.82
  220.135.81.163
@@ -94581,6 +96156,7 @@
  220.135.93.60
  220.135.95.1
  220.135.95.98
+220.137.153.81
  220.137.16.207
  220.137.5.244
  220.141.103.214
@@ -94588,10 +96164,13 @@
  220.141.128.241
  220.141.172.114
  220.141.180.120
+220.141.200.152
  220.141.7.119
  220.142.173.136
  220.142.27.82
+220.142.43.164
  220.142.44.25
+220.142.45.180
  220.142.46.18
  220.142.48.69
  220.143.161.233
@@ -94602,7 +96181,11 @@
  220.144.221.114
  220.148.152.162
  220.149.227.105
+220.149.242.9
+220.152.104.221
+220.152.112.82
  220.156.236.162
+220.158.148.133
  220.158.216.101
  220.158.216.107
  220.158.216.121
@@ -94619,6 +96202,7 @@
  220.161.72.230
  220.161.77.42
  220.161.79.192
+220.161.81.131
  220.161.81.162
  220.162.164.101
  220.162.164.215
@@ -94638,10 +96222,12 @@
  220.164.192.112
  220.164.192.25
  220.164.192.6
+220.164.2.73
  220.164.226.211
  220.164.226.212
  220.164.36.38
  220.165.147.62
+220.165.149.168
  220.165.15.150
  220.165.15.228
  220.165.15.250
@@ -94651,7 +96237,6 @@
  220.166.42.139
  220.167.103.47
  220.167.105.122
-220.167.105.164
  220.167.109.127
  220.167.114.198
  220.167.147.11
@@ -94669,7 +96254,7 @@
  220.168.239.80
  220.168.240.227
  220.168.44.226
-220.168.52.245
+220.168.44.238
  220.169.101.4
  220.169.127.172
  220.169.252.147
@@ -94678,13 +96263,14 @@
  220.169.253.248
  220.169.254.109
  220.169.255.0
+220.169.255.16
  220.169.63.94
  220.171.45.37
  220.171.67.14
  220.171.93.62
  220.171.95.2
-220.172.193.180
  220.172.206.163
+220.172.52.115
  220.173.103.190
  220.173.122.211
  220.173.136.132
@@ -94705,16 +96291,17 @@
  220.175.204.97
  220.175.241.166
  220.175.51.180
+220.175.66.252
  220.176.172.64
  220.176.180.48
  220.176.183.42
  220.176.197.41
-220.176.197.49
  220.176.204.183
  220.177.92.227
  220.178.107.242
  220.178.164.13
  220.178.171.184
+220.178.221.74
  220.178.254.54
  220.178.62.230
  220.178.65.122
@@ -94722,12 +96309,13 @@
  220.178.67.247
  220.178.67.250
  220.178.71.156
+220.178.94.98
  220.179.231.165
  220.179.231.174
+220.179.231.202
  220.179.231.244
-220.179.231.250
  220.179.241.111
-220.179.28.27
+220.179.244.131
  220.179.28.85
  220.179.83.46
  220.180.112.208
@@ -94740,33 +96328,36 @@
  220.181.187.187
  220.181.87.80
  220.182.47.116
-220.184.0.88
  220.184.126.27
-220.184.235.82
+220.185.138.14
  220.185.195.156
  220.185.196.103
  220.185.198.208
  220.185.215.165
  220.185.217.239
+220.186.128.128
  220.186.128.13
  220.186.131.120
+220.186.131.133
  220.186.134.130
+220.186.134.14
  220.186.135.159
  220.186.138.60
+220.186.142.22
  220.186.142.67
  220.186.143.173
-220.186.144.210
-220.186.147.171
  220.186.147.78
  220.186.148.121
+220.186.149.139
+220.186.149.72
  220.186.149.78
+220.186.149.82
  220.186.152.90
-220.186.153.249
  220.186.154.220
+220.186.154.88
  220.186.155.203
  220.186.156.16
  220.186.156.49
-220.186.157.233
  220.186.158.15
  220.186.160.71
  220.186.161.35
@@ -94774,14 +96365,17 @@
  220.186.162.70
  220.186.163.247
  220.186.165.121
+220.186.166.199
  220.186.166.211
  220.186.166.59
-220.186.168.58
+220.186.167.66
+220.186.169.41
  220.186.169.96
  220.186.170.174
  220.186.171.80
  220.186.172.161
  220.186.173.167
+220.186.174.242
  220.186.182.87
  220.186.183.132
  220.186.188.31
@@ -94791,6 +96385,7 @@
  220.189.196.206
  220.189.209.182
  220.189.211.72
+220.189.211.75
  220.189.216.132
  220.189.68.209
  220.189.99.155
@@ -94800,6 +96395,7 @@
  220.191.217.3
  220.191.220.65
  220.192.156.12
+220.192.236.91
  220.192.249.43
  220.194.238.47
  220.194.238.49
@@ -94809,17 +96405,15 @@
  220.196.1.142
  220.196.74.51
  220.197.200.250
-220.200.161.254
+220.199.78.53
  220.201.110.38
  220.201.111.160
  220.201.160.200
  220.201.34.107
  220.201.59.4
  220.201.78.53
-220.201.81.142
  220.202.61.142
  220.202.72.237
-220.202.72.94
  220.202.73.105
  220.225.126.55
  220.225.133.2
@@ -94829,9 +96423,9 @@
  220.227.61.73
  220.230.121.57
  220.231.134.2
-220.231.195.75
  220.233.69.182
  220.235.116.185
+220.235.178.180
  220.238.111.25
  220.238.226.51
  220.239.24.89
@@ -94847,7 +96441,6 @@
  220.246.126.241
  220.246.126.37
  220.246.136.249
-220.246.154.111
  220.246.160.38
  220.246.166.128
  220.246.178.100
@@ -94875,7 +96468,6 @@
  220.248.18.146
  220.248.188.75
  220.248.238.130
-220.248.3.211
  220.248.36.50
  220.248.9.106
  220.248.95.178
@@ -94893,8 +96485,9 @@
  220.250.20.211
  220.250.25.125
  220.250.51.208
-220.253.30.140
  220.255.1.162
+220.255.107.236
+220.255.112.41
  220.255.158.168
  220.255.186.184
  220.255.197.17
@@ -94905,7 +96498,6 @@
  220.255.48.31
  220.255.54.237
  220.255.71.82
-220.66.155.2
  220.70.154.250
  220.70.199.14
  220.70.255.112
@@ -94920,7 +96512,6 @@
  220.71.162.72
  220.72.101.132
  220.72.157.216
-220.72.161.45
  220.72.173.197
  220.72.181.48
  220.72.26.33
@@ -94939,7 +96530,6 @@
  220.74.104.170
  220.74.104.184
  220.74.112.180
-220.74.113.57
  220.74.116.146
  220.74.120.147
  220.74.18.133
@@ -95017,6 +96607,7 @@
  220.81.57.60
  220.82.165.202
  220.82.173.68
+220.82.197.3
  220.83.207.33
  220.83.226.226
  220.84.126.136
@@ -95043,7 +96634,6 @@
  220.86.61.166
  220.86.67.9
  220.86.74.75
-220.87.154.188
  220.87.177.54
  220.87.50.221
  220.87.72.107
@@ -95090,6 +96680,7 @@
  220.93.204.226
  220.93.21.169
  220.93.216.119
+220.93.231.73
  220.93.239.104
  220.93.35.229
  220.93.35.95
@@ -95109,6 +96700,7 @@
  220market.net
  221-365.net
  221.0.107.78
+221.0.108.10
  221.0.119.180
  221.0.119.24
  221.0.122.105
@@ -95139,11 +96731,12 @@
  221.11.20.107
  221.11.245.180
  221.11.48.82
+221.112.123.137
  221.113.241.94
  221.114.210.133
+221.12.100.170
  221.12.101.123
  221.12.22.202
-221.12.26.242
  221.120.189.209
  221.120.192.26
  221.120.199.35
@@ -95153,9 +96746,9 @@
  221.120.98.49
  221.120.99.241
  221.121.12.238
-221.121.143.143
  221.121.145.137
  221.121.145.159
+221.121.153.179
  221.121.39.212
  221.122.100.25
  221.122.108.203
@@ -95198,7 +96791,6 @@
  221.125.255.55
  221.125.99.247
  221.126.242.254
-221.126.244.13
  221.127.125.34
  221.127.18.148
  221.127.24.156
@@ -95206,11 +96798,11 @@
  221.127.32.178
  221.127.41.194
  221.127.5.11
+221.13.163.150
  221.13.164.171
  221.13.177.150
  221.13.178.224
-221.13.220.139
-221.13.246.103
+221.13.235.153
  221.13.7.50
  221.13.74.246
  221.13.96.114
@@ -95237,20 +96829,19 @@
  221.139.3.168
  221.139.50.13
  221.139.50.136
-221.14.107.164
+221.14.105.217
+221.14.105.96
  221.14.107.41
  221.14.107.60
  221.14.122.2
  221.14.122.28
-221.14.123.175
-221.14.163.101
-221.14.165.109
-221.14.165.36
-221.14.167.5
+221.14.162.97
+221.14.164.16
+221.14.165.205
  221.14.167.85
  221.14.178.220
  221.14.182.21
-221.14.197.234
+221.14.197.62
  221.14.199.59
  221.14.243.168
  221.14.7.241
@@ -95274,6 +96865,7 @@
  221.144.253.133
  221.144.67.206
  221.144.73.100
+221.144.84.172
  221.145.101.71
  221.145.12.215
  221.145.205.60
@@ -95290,63 +96882,70 @@
  221.147.27.187
  221.148.107.154
  221.148.123.67
+221.148.172.241
  221.148.45.168
  221.149.122.41
  221.149.167.80
  221.149.224.87
-221.15.106.140
+221.149.95.230
  221.15.11.116
-221.15.115.67
-221.15.13.142
+221.15.124.186
+221.15.144.17
  221.15.145.124
  221.15.145.158
  221.15.145.208
  221.15.146.121
-221.15.146.4
-221.15.147.13
+221.15.146.212
  221.15.147.217
  221.15.147.242
  221.15.15.157
-221.15.15.50
  221.15.153.232
-221.15.161.70
+221.15.154.42
+221.15.158.116
+221.15.170.133
+221.15.170.160
  221.15.170.244
+221.15.171.56
  221.15.175.14
  221.15.176.5
  221.15.176.96
  221.15.177.110
-221.15.178.91
-221.15.185.224
-221.15.19.47
-221.15.19.48
+221.15.18.168
+221.15.18.25
+221.15.180.42
+221.15.191.81
  221.15.196.0
  221.15.196.210
-221.15.199.8
+221.15.198.186
+221.15.2.76
  221.15.20.65
-221.15.215.47
  221.15.217.142
  221.15.217.159
  221.15.217.21
+221.15.217.49
+221.15.218.139
  221.15.219.61
+221.15.219.9
  221.15.22.0
  221.15.22.137
  221.15.22.26
  221.15.224.124
  221.15.224.195
  221.15.224.251
-221.15.224.91
  221.15.226.0
  221.15.227.2
+221.15.23.122
  221.15.231.155
  221.15.232.152
  221.15.236.255
  221.15.237.193
+221.15.237.34
+221.15.237.92
  221.15.238.175
  221.15.238.18
  221.15.238.60
  221.15.238.85
  221.15.253.13
-221.15.253.155
  221.15.254.106
  221.15.254.38
  221.15.3.157
@@ -95354,10 +96953,9 @@
  221.15.4.174
  221.15.5.149
  221.15.54.162
-221.15.54.228
  221.15.6.110
  221.15.6.8
-221.15.84.164
+221.15.76.141
  221.150.112.229
  221.150.116.43
  221.150.178.198
@@ -95412,7 +97010,6 @@
  221.156.35.214
  221.157.12.198
  221.157.142.1
-221.157.164.194
  221.157.174.43
  221.157.191.178
  221.157.214.220
@@ -95431,7 +97028,6 @@
  221.159.237.189
  221.159.237.189bin.sh
  221.159.238.103
-221.159.244.41
  221.160.109.57
  221.160.115.22
  221.160.129.2
@@ -95454,6 +97050,7 @@
  221.161.248.187
  221.161.31.8
  221.161.34.219
+221.162.155.84
  221.162.177.145
  221.162.91.158
  221.163.205.160
@@ -95470,14 +97067,16 @@
  221.164.66.166
  221.165.13.155
  221.165.252.143
+221.166.167.73
  221.166.250.205
  221.166.250.205bin.sh
  221.167.127.178
-221.167.228.109
  221.167.242.146
+221.167.246.33
  221.167.26.29
  221.167.52.99
  221.167.61.157
+221.167.84.88
  221.167.97.84
  221.176.156.202
  221.176.156.203
@@ -95513,7 +97112,6 @@
  221.178.56.85
  221.178.56.90
  221.178.56.95
-221.179.119.58
  221.179.126.194
  221.179.173.90
  221.179.216.81
@@ -95533,6 +97131,7 @@
  221.192.199.35
  221.192.241.97
  221.192.244.242
+221.192.68.46
  221.193.140.65
  221.193.195.25
  221.193.195.51
@@ -95545,6 +97144,7 @@
  221.195.129.35
  221.195.189.144
  221.195.189.154
+221.195.226.53
  221.195.238.147
  221.195.242.248
  221.195.25.136
@@ -95562,7 +97162,6 @@
  221.198.96.42
  221.199.13.197
  221.199.171.114
-221.199.194.195
  221.199.56.98
  221.2.153.74
  221.2.155.199
@@ -95582,18 +97181,17 @@
  221.200.203.233
  221.200.21.86
  221.200.26.97
-221.200.8.74
  221.200.9.123
-221.201.122.214
  221.201.123.255
  221.201.124.26
-221.201.251.2
  221.202.11.145
  221.202.12.73
  221.202.15.192
  221.202.153.81
  221.202.168.254
+221.202.221.223
  221.202.221.242
+221.202.55.179
  221.202.72.128
  221.202.75.4
  221.202.8.8
@@ -95630,7 +97228,6 @@
  221.205.68.46
  221.205.70.63
  221.206.11.230
-221.206.135.249
  221.206.153.90
  221.206.249.172
  221.207.120.241
@@ -95672,14 +97269,12 @@
  221.210.211.50
  221.210.211.60
  221.210.211.8
+221.210.241.134
  221.210.36.71
  221.210.5.218
  221.210.97.243
  221.212.210.246
-221.212.49.138
-221.212.49.149
  221.212.74.130
-221.213.1.82
  221.213.115.48
  221.213.146.11
  221.213.150.107
@@ -95733,6 +97328,7 @@
  221.215.31.45
  221.215.48.75
  221.215.5.225
+221.215.53.18
  221.215.63.129
  221.215.65.146
  221.215.8.4
@@ -95743,21 +97339,19 @@
  221.216.156.52
  221.216.205.26
  221.216.38.119
-221.216.48.217
  221.216.95.120
  221.217.59.118
  221.217.59.42
  221.218.216.81
  221.218.97.205
  221.219.177.73
+221.219.180.205
  221.219.212.254
+221.219.99.106
  221.220.142.103
-221.220.152.73
  221.221.137.118
-221.221.145.113
-221.221.157.25
  221.221.157.31
-221.221.162.62
+221.221.159.77
  221.223.35.118
  221.224.122.162
  221.224.146.12
@@ -95775,7 +97369,6 @@
  221.224.9.154
  221.225.112.150
  221.225.137.174
-221.225.155.133
  221.225.226.79
  221.225.81.86
  221.225.82.74
@@ -95786,7 +97379,6 @@
  221.226.184.178
  221.226.28.34
  221.226.29.194
-221.226.30.34
  221.226.38.166
  221.226.39.202
  221.226.56.10
@@ -95809,7 +97401,7 @@
  221.229.190.64
  221.229.199.103
  221.229.204.196
-221.229.218.12
+221.229.218.40
  221.229.218.50
  221.229.220.210
  221.229.221.244
@@ -95822,14 +97414,12 @@
  221.231.115.2
  221.231.126.2
  221.231.31.227
-221.231.65.70
-221.231.72.202
  221.231.72.206
  221.231.72.66
-221.231.75.76
  221.232.1.133
  221.232.130.26
  221.232.130.88
+221.232.16.65
  221.232.181.4
  221.232.58.243
  221.232.69.100
@@ -95840,10 +97430,10 @@
  221.233.79.14
  221.233.94.147
  221.234.19.109
+221.234.216.12
  221.234.44.132
  221.234.9.207
  221.235.139.4
-221.235.184.101
  221.235.53.173
  221.235.72.170
  221.235.78.167
@@ -95860,6 +97450,7 @@
  221.238.47.98
  221.238.6.132
  221.239.103.146
+221.239.27.60
  221.239.62.155
  221.239.69.26
  221.247.249.32
@@ -95887,7 +97478,6 @@
  221.6.108.188
  221.6.109.5
  221.6.114.149
-221.6.197.130
  221.6.198.254
  221.6.206.14
  221.6.32.34
@@ -95901,7 +97491,6 @@
  221.8.12.152
  221.8.12.208
  221.8.140.37
-221.8.145.167
  221.8.185.177
  221.8.31.27
  221.8.37.226
@@ -95934,6 +97523,7 @@
  222.101.47.106
  222.101.97.162
  222.102.121.230
+222.102.16.22
  222.102.166.115
  222.102.166.170
  222.102.166.62
@@ -95949,7 +97539,6 @@
  222.103.233.233
  222.103.239.170
  222.104.137.106
-222.104.177.185
  222.104.206.112
  222.104.222.69
  222.104.226.205
@@ -96008,6 +97597,7 @@
  222.113.184.193
  222.113.252.68
  222.113.43.131
+222.114.137.214
  222.114.137.250
  222.114.144.209
  222.114.179.148
@@ -96024,6 +97614,7 @@
  222.114.43.115
  222.114.70.188
  222.114.70.246
+222.114.75.188
  222.114.85.2
  222.114.95.114
  222.114.98.62
@@ -96031,6 +97622,7 @@
  222.116.200.177
  222.116.58.223
  222.116.70.13
+222.116.84.127
  222.117.103.132
  222.117.124.136
  222.117.126.44
@@ -96045,7 +97637,6 @@
  222.117.85.164
  222.118.135.43
  222.118.140.188
-222.118.140.89
  222.118.162.243
  222.118.58.209
  222.118.84.75
@@ -96055,7 +97646,6 @@
  222.119.20.68
  222.119.218.5
  222.120.14.251
-222.120.168.43
  222.120.173.4
  222.120.173.52
  222.120.224.76
@@ -96109,6 +97699,8 @@
  222.128.126.51
  222.128.14.106
  222.128.15.208
+222.128.174.73
+222.128.176.118
  222.128.46.27
  222.128.51.106
  222.128.60.162
@@ -96121,10 +97713,10 @@
  222.132.156.2
  222.132.156.3
  222.132.161.77
-222.132.180.124
  222.132.189.4
  222.132.77.14
  222.132.82.62
+222.132.85.202
  222.133.102.125
  222.133.102.150
  222.133.218.22
@@ -96142,51 +97734,50 @@
  222.135.119.104
  222.135.142.117
  222.135.176.219
-222.135.218.231
  222.135.223.117
  222.135.24.18
  222.135.53.57
+222.135.55.79
+222.136.100.11
+222.136.101.203
+222.136.110.202
+222.136.112.242
+222.136.145.42
+222.136.154.39
  222.136.159.204
+222.136.168.123
  222.136.171.27
  222.136.212.112
  222.136.243.229
  222.136.243.243
  222.136.27.181
-222.136.28.175
  222.136.46.112
-222.136.49.252
-222.136.50.164
+222.136.51.47
  222.136.58.44
-222.136.62.8
+222.136.74.231
  222.136.81.43
  222.136.82.220
  222.137.0.44
  222.137.1.11
-222.137.1.141
+222.137.104.19
  222.137.104.198
-222.137.105.32
-222.137.107.164
+222.137.105.46
  222.137.120.106
  222.137.120.11
  222.137.120.141
  222.137.120.37
  222.137.120.96
-222.137.121.11
+222.137.122.13
  222.137.122.142
  222.137.122.227
  222.137.122.90
  222.137.123.118
  222.137.123.14
  222.137.123.188
-222.137.123.221
  222.137.128.226
-222.137.128.82
  222.137.129.26
  222.137.136.116
-222.137.136.146
  222.137.136.35
-222.137.136.5
-222.137.137.156
  222.137.137.169
  222.137.137.7
  222.137.138.152
@@ -96197,104 +97788,121 @@
  222.137.138.58
  222.137.139.109
  222.137.139.188
+222.137.139.223
  222.137.139.4
+222.137.139.91
  222.137.149.170
  222.137.152.108
-222.137.156.183
+222.137.153.106
+222.137.157.228
+222.137.158.119
  222.137.158.189
-222.137.160.88
-222.137.168.236
+222.137.164.129
+222.137.168.255
  222.137.169.136
  222.137.170.129
-222.137.173.255
-222.137.175.219
+222.137.170.158
+222.137.170.72
+222.137.175.51
  222.137.182.21
  222.137.2.47
  222.137.202.87
-222.137.203.174
  222.137.208.123
  222.137.209.91
-222.137.211.177
+222.137.210.26
  222.137.211.25
-222.137.212.1
-222.137.212.127
-222.137.212.62
-222.137.213.85
+222.137.214.202
  222.137.215.6
  222.137.215.83
+222.137.228.191
+222.137.233.244
+222.137.235.67
+222.137.238.134
  222.137.238.69
  222.137.239.144
  222.137.24.191
-222.137.3.226
+222.137.3.35
+222.137.33.145
  222.137.34.182
-222.137.35.37
  222.137.39.234
+222.137.4.190
  222.137.41.155
+222.137.41.78
+222.137.48.102
  222.137.5.102
  222.137.5.44
  222.137.5.69
-222.137.55.136
-222.137.60.57
-222.137.71.93
+222.137.51.250
+222.137.52.94
+222.137.53.57
  222.137.73.234
-222.137.75.44
+222.137.75.61
  222.137.76.194
+222.137.78.146
  222.137.78.22
  222.137.8.143
+222.137.8.213
  222.137.8.67
  222.137.82.71
+222.137.83.174
  222.137.87.46
  222.138.100.190
  222.138.100.227
  222.138.100.235
  222.138.101.2
-222.138.103.15
+222.138.102.192
+222.138.103.125
  222.138.109.162
+222.138.110.168
+222.138.110.33
  222.138.112.241
-222.138.113.146
-222.138.113.183
-222.138.116.249
+222.138.114.33
  222.138.116.255
-222.138.117.143
-222.138.117.8
  222.138.117.85
-222.138.118.204
-222.138.119.78
+222.138.119.89
+222.138.122.26
  222.138.122.73
  222.138.123.128
+222.138.167.181
  222.138.174.120
  222.138.174.182
  222.138.174.243
-222.138.174.81
  222.138.176.18
-222.138.177.149
-222.138.177.242
+222.138.177.80
  222.138.179.129
  222.138.180.34
  222.138.180.36
  222.138.181.119
+222.138.181.223
+222.138.182.76
  222.138.183.29
  222.138.184.55
  222.138.190.135
  222.138.20.244
+222.138.20.47
+222.138.200.238
  222.138.201.98
-222.138.205.130
-222.138.207.3
-222.138.207.89
+222.138.203.150
  222.138.21.80
+222.138.212.248
+222.138.214.0
+222.138.214.142
  222.138.225.53
-222.138.235.47
-222.138.236.7
+222.138.234.173
+222.138.237.161
+222.138.244.63
+222.138.246.188
+222.138.247.141
  222.138.54.62
  222.138.76.91
  222.138.76.96
-222.138.82.243
  222.138.91.240
  222.138.96.44
  222.138.96.69
  222.138.96.76
  222.138.98.192
  222.138.99.105
+222.139.103.239
  222.139.209.19
  222.139.21.222
  222.139.214.55
@@ -96302,80 +97910,88 @@
  222.139.245.70
  222.139.28.84
  222.139.60.31
-222.139.73.218
+222.139.76.188
+222.139.77.254
  222.139.78.41
  222.139.81.170
+222.139.87.242
  222.139.87.38
+222.139.92.21
+222.139.92.42
  222.14.38.105
+222.140.108.23
  222.140.112.168
  222.140.116.115
  222.140.125.169
  222.140.127.154
-222.140.158.197
+222.140.14.136
  222.140.16.238
-222.140.171.208
-222.140.176.111
-222.140.176.165
+222.140.160.49
+222.140.162.158
+222.140.166.4
+222.140.172.221
  222.140.177.223
-222.140.183.49
-222.140.189.4
+222.140.179.168
+222.140.188.84
  222.140.19.172
  222.140.213.49
  222.140.245.241
+222.140.248.59
  222.140.6.20
  222.140.72.174
  222.140.78.238
-222.141.103.179
  222.141.11.54
  222.141.12.245
  222.141.120.77
  222.141.124.42
-222.141.134.143
  222.141.14.132
-222.141.144.116
+222.141.15.137
  222.141.151.111
+222.141.161.114
  222.141.161.195
  222.141.167.216
-222.141.171.77
+222.141.175.207
  222.141.185.12
  222.141.185.182
  222.141.186.118
  222.141.188.93
-222.141.25.22
-222.141.251.62
+222.141.21.109
  222.141.26.18
-222.141.40.153
+222.141.26.82
  222.141.40.75
  222.141.42.164
  222.141.45.105
+222.141.45.11
  222.141.45.228
-222.141.46.220
+222.141.47.102
+222.141.60.66
  222.141.8.108
-222.141.83.15
-222.141.85.105
+222.141.86.234
  222.142.113.51
  222.142.141.208
  222.142.178.225
+222.142.196.194
  222.142.201.214
  222.142.202.158
  222.142.207.94
  222.142.208.173
+222.142.209.16
  222.142.209.191
-222.142.209.228
-222.142.210.98
  222.142.211.190
  222.142.211.30
  222.142.223.3
  222.142.234.169
  222.142.237.129
-222.142.252.226
+222.142.251.120
  222.142.252.77
+222.142.253.118
  222.142.44.156
  222.142.46.110
  222.142.47.237
  222.143.26.79
  222.148.98.230
  222.153.237.227
+222.153.58.115
  222.153.91.3
  222.160.194.64
  222.160.205.82
@@ -96391,24 +98007,23 @@
  222.161.17.58
  222.161.191.52
  222.161.209.66
-222.161.223.147
  222.161.223.54
  222.162.1.5
  222.162.12.107
  222.162.14.41
  222.162.249.204
  222.162.42.182
-222.162.42.59
  222.162.92.228
+222.163.131.97
  222.163.132.71
-222.163.149.29
-222.163.172.76
  222.163.183.47
  222.163.189.132
  222.163.189.15
  222.163.213.248
  222.163.231.129
+222.163.233.179
  222.163.235.33
+222.163.236.232
  222.163.37.174
  222.163.42.180
  222.164.102.195
@@ -96428,7 +98043,9 @@
  222.168.18.227
  222.168.30.18
  222.168.57.209
+222.168.85.227
  222.169.117.250
+222.169.185.242
  222.169.251.245
  222.170.149.123
  222.170.167.162
@@ -96439,7 +98056,6 @@
  222.171.105.242
  222.171.243.27
  222.171.248.19
-222.171.78.203
  222.172.149.36
  222.172.176.219
  222.172.221.238
@@ -96448,7 +98064,6 @@
  222.173.38.41
  222.173.54.222
  222.173.82.126
-222.173.98.230
  222.174.122.115
  222.174.148.178
  222.174.213.178
@@ -96464,6 +98079,7 @@
  222.177.17.107
  222.178.213.236
  222.178.216.126
+222.178.233.158
  222.179.205.14
  222.179.215.189
  222.179.89.46
@@ -96471,6 +98087,7 @@
  222.180.150.130
  222.180.151.86
  222.180.208.14
+222.182.58.213
  222.184.102.46
  222.184.134.42
  222.184.14.90
@@ -96478,6 +98095,7 @@
  222.184.254.170
  222.184.30.10
  222.184.35.115
+222.184.35.137
  222.184.35.139
  222.184.61.150
  222.184.7.26
@@ -96504,7 +98122,6 @@
  222.185.235.186
  222.185.241.130
  222.185.241.98
-222.185.243.130
  222.185.244.178
  222.185.252.106
  222.185.27.18
@@ -96513,12 +98130,14 @@
  222.185.42.110
  222.185.73.210
  222.185.77.105
+222.185.77.133
  222.185.77.134
  222.185.77.147
  222.185.77.42
  222.185.77.86
  222.185.85.228
  222.186.10.154
+222.186.102.18
  222.186.118.241
  222.186.13.91
  222.186.136.11
@@ -96583,7 +98202,6 @@
  222.188.136.85
  222.188.190.206
  222.188.204.153
-222.188.21.59
  222.188.211.234
  222.188.221.118
  222.188.231.30
@@ -96591,8 +98209,6 @@
  222.188.243.195
  222.188.243.225
  222.188.255.95
-222.188.38.103
-222.188.38.200
  222.188.81.114
  222.188.84.101
  222.188.96.71
@@ -96601,10 +98217,12 @@
  222.189.163.82
  222.189.186.44
  222.189.191.123
+222.189.217.172
  222.189.228.131
  222.189.238.236
  222.19.137.19
  222.19.137.26
+222.190.110.196
  222.190.122.163
  222.190.125.106
  222.190.125.8
@@ -96635,6 +98253,7 @@
  222.192.88.99
  222.195.93.164
  222.196.196.205
+222.205.12.183
  222.208.0.197
  222.208.119.107
  222.208.183.195
@@ -96642,7 +98261,6 @@
  222.208.233.76
  222.208.3.115
  222.208.42.11
-222.209.115.97
  222.209.120.13
  222.209.123.149
  222.209.216.163
@@ -96653,12 +98271,10 @@
  222.209.77.105
  222.209.85.197
  222.210.59.192
-222.211.115.202
  222.211.115.33
  222.211.148.83
  222.211.162.123
  222.212.141.178
-222.212.185.88
  222.212.82.166
  222.212.93.19
  222.213.136.78
@@ -96679,7 +98295,6 @@
  222.217.69.92
  222.218.103.76
  222.218.142.226
-222.218.17.187
  222.218.17.68
  222.218.176.73
  222.218.210.110
@@ -96693,14 +98308,12 @@
  222.219.29.205
  222.219.73.113
  222.219.80.74
-222.220.145.169
  222.220.157.35
  222.220.157.47
  222.220.162.172
  222.220.229.121
  222.220.234.113
  222.220.35.31
-222.221.238.90
  222.221.248.242
  222.221.36.63
  222.221.91.153
@@ -96708,7 +98321,6 @@
  222.222.140.168
  222.222.141.113
  222.222.158.23
-222.222.177.80
  222.222.178.22
  222.222.181.214
  222.222.209.147
@@ -96727,10 +98339,10 @@
  222.223.232.4
  222.223.254.125
  222.223.29.110
-222.223.56.116
  222.223.68.27
  222.223.93.194
  222.224.248.242
+222.229.109.174
  222.23.86.45
  222.230.133.216
  222.231.1.69
@@ -96752,7 +98364,6 @@
  222.236.47.188
  222.236.47.23
  222.236.85.220
-222.237.136.85
  222.237.181.210
  222.237.76.118
  222.237.78.213
@@ -96791,22 +98402,25 @@
  222.243.207.104
  222.243.6.86
  222.243.89.144
+222.244.131.225
  222.244.139.113
  222.244.146.232
  222.244.147.183
+222.245.37.196
  222.245.76.42
+222.246.111.24
+222.246.22.180
  222.246.64.105
  222.246.64.62
-222.246.66.106
+222.246.65.132
  222.249.173.26
  222.249.179.174
  222.249.228.37
  222.249.232.90
-222.249.235.234
  222.252.11.236
+222.252.112.13
  222.252.148.137
  222.252.148.208
-222.252.16.153
  222.252.17.34
  222.252.20.20
  222.252.20.219
@@ -96816,6 +98430,7 @@
  222.252.25.241
  222.252.28.31
  222.252.30.29
+222.252.57.111
  222.252.6.217
  222.252.63.252
  222.253.253.168
@@ -96823,7 +98438,6 @@
  222.254.51.82
  222.255.115.237
  222.255.135.243
-222.255.167.104
  222.255.175.217
  222.255.237.51
  222.255.46.58
@@ -96839,7 +98453,6 @@
  222.65.21.158
  222.65.241.58
  222.65.43.72
-222.65.45.188
  222.67.230.166
  222.67.231.1
  222.69.128.119
@@ -96878,12 +98491,10 @@
  222.74.23.247
  222.74.27.137
  222.74.4.70
-222.74.5.235
  222.74.73.202
  222.75.0.189
  222.75.1.197
  222.75.1.42
-222.75.16.70
  222.76.126.213
  222.76.42.211
  222.76.66.110
@@ -96891,12 +98502,12 @@
  222.77.187.118
  222.77.215.224
  222.78.185.234
+222.78.2.22
  222.78.248.133
  222.78.4.102
  222.78.57.31
  222.78.76.143
  222.79.16.150
-222.79.49.230
  222.80.110.191
  222.80.132.148
  222.80.148.4
@@ -96904,20 +98515,19 @@
  222.80.172.181
  222.80.240.242
  222.80.38.10
+222.80.39.18
  222.80.56.3
  222.80.61.181
  222.80.62.200
  222.80.87.12
  222.80.87.18
  222.81.119.245
-222.81.149.204
  222.81.149.25
  222.81.15.33
  222.81.153.248
  222.81.153.98
  222.81.154.52
  222.81.157.148
-222.81.28.184
  222.81.28.26
  222.81.31.104
  222.82.213.123
@@ -96950,21 +98560,17 @@
  222.86.192.246
  222.87.126.6
  222.87.177.3
-222.87.198.58
-222.87.198.6
  222.87.37.54
+222.87.54.164
  222.88.152.96
  222.88.236.236
  222.88.238.129
-222.88.253.34
-222.88.253.35
-222.88.253.36
-222.88.253.37
  222.88.253.38
  222.88.72.180
  222.89.166.120
  222.89.178.60
  222.89.34.114
+222.89.70.73
  222.90.111.62
  222.90.117.159
  222.90.117.45
@@ -96989,6 +98595,7 @@
  222.93.180.87
  222.93.252.202
  222.93.30.4
+222.94.100.190
  222.94.62.236
  222.94.90.215
  222.94.92.221
@@ -96999,7 +98606,6 @@
  222.95.234.6
  222.96.155.188
  222.96.156.84
-222.96.195.162
  222.96.237.2
  222.96.29.55
  222.96.50.40
@@ -97009,7 +98615,6 @@
  222.97.104.205
  222.97.126.167
  222.97.146.114
-222.97.172.100
  222.97.182.91
  222.97.194.211
  222.97.72.234
@@ -97078,10 +98683,8 @@
  223.113.12.55
  223.113.50.86
  223.115.229.191
-223.115.230.181
+223.115.230.207
  223.115.230.233
-223.117.38.144
-223.13.61.80
  223.13.69.156
  223.130.216.245
  223.130.217.234
@@ -97092,21 +98695,21 @@
  223.130.29.55
  223.131.83.54
  223.135.189.25
+223.144.136.139
  223.144.148.78
  223.145.144.8
  223.145.151.204
  223.145.197.66
  223.15.14.29
  223.15.163.144
-223.150.132.52
-223.150.215.17
+223.150.190.71
+223.150.220.177
+223.150.230.228
  223.150.231.114
  223.150.241.124
-223.150.77.38
-223.151.126.199
-223.151.183.34
+223.150.244.84
+223.150.246.146
  223.151.189.227
-223.154.4.159
  223.154.80.169
  223.154.80.173
  223.154.81.219
@@ -97119,7 +98722,6 @@
  223.157.9.86
  223.158.154.215
  223.159.18.2
-223.159.31.208
  223.16.103.123
  223.16.106.101
  223.16.112.126
@@ -97140,6 +98742,7 @@
  223.16.30.175
  223.16.47.5
  223.16.71.172
+223.16.76.39
  223.16.81.104
  223.16.97.141
  223.165.241.9
@@ -97178,12 +98781,10 @@
  223.171.34.44
  223.171.35.203
  223.171.37.224
-223.171.39.27
  223.171.41.124
  223.171.41.228
  223.171.46.146
  223.171.48.36
-223.171.56.222
  223.171.63.8
  223.18.128.210
  223.18.149.157
@@ -97196,19 +98797,17 @@
  223.18.64.147
  223.18.74.207
  223.18.79.247
-223.189.134.47
-223.189.178.170
  223.19.119.112
  223.19.119.152
  223.19.139.125
  223.19.141.177
  223.19.191.30
-223.19.29.46
  223.19.42.194
  223.19.73.184
  223.19.77.37
  223.191.34.173
  223.194.176.22
+223.194.27.68
  223.194.4.201
  223.197.136.59
  223.197.136.82
@@ -97229,11 +98828,12 @@
  223.198.249.170
  223.198.254.4
  223.198.255.32
-223.198.26.196
  223.199.0.78
  223.199.10.197
  223.199.12.181
+223.199.21.107
  223.199.21.89
+223.199.23.153
  223.199.8.50
  223.199.9.244
  223.205.180.31
@@ -97243,8 +98843,8 @@
  223.206.234.13
  223.206.243.39
  223.206.246.128
+223.206.247.208
  223.206.250.77
-223.212.153.64
  223.212.209.183
  223.212.226.218
  223.212.234.84
@@ -97257,10 +98857,10 @@
  223.215.160.131
  223.218.42.143
  223.22.233.27
+223.22.242.199
  223.22.243.179
  223.22.243.184
  223.22.252.208
-223.220.140.222
  223.220.168.22
  223.220.251.232
  223.223.142.16
@@ -97276,19 +98876,20 @@
  223.223.205.117
  223.223.205.194
  223.223.205.229
-223.226.164.29
  223.229.232.139
  223.229.234.152
+223.235.14.248
  223.235.201.33
-223.239.51.102
  223.240.103.61
  223.240.104.222
  223.240.65.72
+223.240.70.4
  223.240.71.236
  223.240.78.80
  223.240.93.176
  223.241.118.12
  223.241.247.214
+223.242.221.209
  223.242.246.40
  223.244.129.147
  223.244.129.166
@@ -97311,7 +98912,6 @@
  223.247.194.119
  223.247.194.43
  223.247.199.243
-223.247.201.32
  223.247.207.75
  223.247.218.112
  223.247.219.165
@@ -97319,12 +98919,11 @@
  223.247.219.87
  223.25.111.8
  223.25.14.66
-223.25.20.110
  223.25.247.233
+223.25.61.183
  223.25.64.225
  223.25.67.117
  223.25.68.202
-223.25.77.84
  223.25.99.163
  223.25.99.37
  223.252.75.173
@@ -97337,7 +98936,6 @@
  223.27.255.162
  223.27.255.190
  223.28.171.131
-223.28.249.56
  223.29.204.245
  223.29.204.246
  223.31.191.50
@@ -97394,7 +98992,6 @@
  223.75.167.161
  223.75.175.52
  223.75.218.60
-223.75.226.107
  223.75.50.73
  223.75.68.18
  223.75.69.249
@@ -97412,7 +99009,6 @@
  223.80.111.9
  223.80.12.88
  223.80.188.48
-223.80.91.119
  223.81.192.191
  223.82.0.48
  223.82.0.51
@@ -97426,10 +99022,10 @@
  223.82.99.148
  223.83.140.194
  223.83.177.185
-223.83.203.67
  223.83.210.197
  223.83.213.194
  223.83.216.125
+223.83.217.29
  223.84.247.233
  223.84.247.234
  223.84.61.232
@@ -97446,6 +99042,7 @@
  223.88.65.226
  223.9.149.141
  223.91.151.61
+223.91.171.32
  223.93.130.231
  223.93.140.130
  223.93.157.236
@@ -97502,8 +99099,9 @@
  23.100.25.26
  23.100.30.124
  23.100.34.224
-23.100.51.1
+23.100.56.213
  23.100.56.88
+23.100.62.143
  23.100.68.66
  23.101.112.231
  23.101.123.2
@@ -97519,7 +99117,9 @@
  23.102.137.83
  23.102.153.172
  23.102.155.128
-23.102.71.24
+23.102.36.181
+23.102.51.44
+23.102.58.101
  23.104.158.14
  23.104.158.15
  23.104.158.53
@@ -97539,7 +99139,6 @@
  23.105.159.123
  23.105.159.131
  23.105.159.146
-23.105.159.198
  23.105.159.23
  23.105.159.31
  23.105.196.142
@@ -97561,7 +99160,6 @@
  23.106.215.179
  23.106.223.127
  23.106.252.230
-23.106.27.121
  23.106.34.44
  23.106.47.68
  23.106.47.69
@@ -97583,7 +99181,9 @@
  23.108.254.180
  23.108.254.182
  23.108.254.4
+23.108.4.242
  23.108.4.77
+23.108.4.99
  23.108.44.67
  23.108.45.188
  23.108.45.251
@@ -97594,17 +99194,14 @@
  23.108.48.3
  23.108.50.17
  23.108.86.145
-23.108.86.184
-23.108.86.188
-23.108.93.102
-23.108.93.199
+23.108.93.139
+23.108.93.200
+23.108.93.227
  23.108.93.230
-23.108.93.30
-23.108.93.92
+23.108.93.85
  23.110.166.95
  23.111.114.196
  23.111.136.190
-23.111.168.178
  23.111.173.98
  23.112.250.126
  23.115.77.25
@@ -97669,6 +99266,7 @@
  23.136.64.8
  23.141.160.156
  23.141.240.206
+23.143.160.7
  23.146.144.156
  23.146.240.118
  23.146.240.230
@@ -97682,7 +99280,6 @@
  23.154.160.6
  23.16.116.171
  23.16.202.147
-23.16.206.110
  23.16.231.177
  23.16.24.244
  23.160.193.39
@@ -97741,6 +99338,7 @@
  23.226.229.252
  23.226.65.2
  23.226.90.172
+23.226.94.151
  23.227.179.2
  23.227.196.121
  23.227.196.126
@@ -97765,20 +99363,19 @@
  23.229.114.59
  23.229.13.213
  23.229.13.222
-23.229.13.76
  23.229.14.20
  23.229.14.25
  23.229.22.121
  23.229.25.76
  23.229.25.92
-23.229.25.97
  23.229.29.224
  23.229.34.237
  23.229.34.84
-23.229.35.32
-23.229.35.42
+23.229.45.163
+23.229.57.147
  23.229.57.151
-23.229.57.239
+23.229.57.159
+23.229.57.236
  23.229.57.248
  23.229.58.231
  23.229.58.235
@@ -97788,10 +99385,12 @@
  23.229.73.170
  23.229.73.68
  23.229.73.73
+23.229.73.75
  23.229.73.76
-23.229.73.85
-23.229.75.17
-23.229.75.27
+23.229.73.87
+23.229.73.95
+23.229.75.42
+23.229.75.56
  23.229.76.71
  23.229.88.199
  23.229.90.253
@@ -97813,9 +99412,7 @@
  23.231.15.64
  23.231.15.80
  23.231.32.142
-23.231.32.183
  23.231.32.200
-23.231.32.206
  23.231.32.235
  23.231.32.38
  23.231.32.52
@@ -97830,7 +99427,6 @@
  23.231.39.76
  23.233.107.21
  23.233.124.117
-23.233.246.75
  23.233.48.14
  23.235.199.28
  23.235.221.57
@@ -97839,41 +99435,42 @@
  23.236.126.45
  23.236.131.160
  23.236.148.13
+23.236.148.49
  23.236.148.5
  23.236.148.52
+23.236.148.6
  23.236.148.7
-23.236.166.13
+23.236.156.115
  23.236.181.34
-23.236.210.149
+23.236.210.155
  23.236.210.176
-23.236.221.177
-23.236.221.219
+23.236.210.181
  23.236.221.46
-23.236.221.78
  23.236.221.83
  23.236.223.167
-23.236.223.20
  23.236.223.22
+23.236.223.25
  23.236.223.28
  23.236.223.45
  23.236.228.14
  23.236.228.244
-23.236.228.53
  23.236.228.76
  23.236.228.95
  23.236.229.213
+23.236.229.243
  23.236.229.244
+23.236.229.250
  23.236.229.40
  23.236.229.54
  23.236.231.53
+23.236.232.196
  23.236.232.51
+23.236.232.81
  23.236.232.86
-23.236.232.90
  23.236.232.95
  23.236.242.206
  23.236.254.130
  23.236.49.71
-23.236.51.175
  23.236.53.163
  23.236.57.243
  23.236.57.37
@@ -97923,6 +99520,7 @@
  23.245.24.154
  23.246.247.42
  23.247.102.10
+23.247.102.106
  23.247.102.120
  23.247.102.125
  23.247.102.18
@@ -97932,6 +99530,7 @@
  23.247.5.46
  23.247.97.117
  23.248.152.227
+23.249.127.57
  23.249.161.109
  23.249.162.26
  23.249.163.7
@@ -97943,43 +99542,44 @@
  23.25.85.219
  23.25.85.221
  23.250.1.144
-23.250.1.147
  23.250.101.173
  23.250.105.98
  23.250.107.198
  23.250.107.93
  23.250.108.136
-23.250.108.139
  23.250.108.174
  23.250.108.204
  23.250.109.1
-23.250.11.251
+23.250.110.157
  23.250.16.111
  23.250.16.233
-23.250.16.68
  23.250.22.100
+23.250.24.59
  23.250.26.125
+23.250.26.198
+23.250.26.200
  23.250.26.35
  23.250.26.36
  23.250.42.221
  23.250.43.217
  23.250.44.216
+23.250.52.172
+23.250.52.220
  23.250.54.250
  23.250.55.162
  23.250.55.190
  23.250.56.224
-23.250.94.150
+23.250.94.173
  23.251.149.109
  23.251.157.221
+23.251.28.186
  23.251.32.80
  23.251.55.234
  23.251.86.72
-23.251.90.183
  23.251.93.42
  23.252.107.194
  23.252.170.124
  23.252.194.174
-23.252.34.227
  23.252.75.254
  23.253.119.33
  23.253.150.217
@@ -97993,11 +99593,9 @@
  23.253.88.213
  23.253.90.246
  23.253.94.80
-23.254.10.183
-23.254.10.198
+23.254.10.185
  23.254.10.218
  23.254.10.222
-23.254.10.223
  23.254.11.159
  23.254.11.169
  23.254.12.226
@@ -98017,7 +99615,6 @@
  23.254.167.112
  23.254.167.187
  23.254.17.73
-23.254.17.93
  23.254.20.170
  23.254.201.58
  23.254.202.154
@@ -98050,12 +99647,17 @@
  23.254.244.207
  23.254.250.11
  23.254.253.127
-23.254.36.34
+23.254.36.16
+23.254.36.239
  23.254.4.39
  23.254.46.79
+23.254.47.102
  23.254.47.107
+23.254.47.110
+23.254.47.82
  23.254.5.121
  23.254.5.46
+23.254.55.110
  23.254.55.187
  23.254.56.114
  23.254.56.53
@@ -98065,8 +99667,8 @@
  23.254.64.6
  23.254.8.246
  23.254.82.126
-23.254.82.86
  23.254.82.89
+23.254.82.91
  23.254.83.61
  23.254.83.68
  23.254.87.196
@@ -98076,7 +99678,6 @@
  23.27.194.44
  23.27.194.45
  23.27.194.46
-23.27.236.25
  23.27.65.146
  23.28.102.158
  23.28.50.172
@@ -98085,14 +99686,10 @@
  23.29.80.56
  23.30.0.186
  23.30.221.181
-23.31.215.172
+23.31.159.234
  23.4.43.27
  23.4buyuklergazete.com
  23.80.147.25
-23.80.149.10
-23.80.149.133
-23.80.149.193
-23.80.151.16
  23.81.140.15
  23.81.140.24
  23.81.140.41
@@ -98103,14 +99700,12 @@
  23.81.228.103
  23.81.228.145
  23.81.228.224
-23.81.228.243
  23.81.228.77
  23.81.229.127
  23.81.229.136
  23.81.229.167
  23.81.230.104
  23.81.230.111
-23.81.230.148
  23.81.230.173
  23.81.230.175
  23.81.230.187
@@ -98121,19 +99716,20 @@
  23.81.246.166
  23.81.246.83
  23.81.27.114
-23.82.110.174
-23.82.110.191
-23.82.110.244
+23.81.49.168
+23.81.50.59
+23.81.82.119
  23.82.16.207
  23.82.29.215
  23.82.29.240
  23.82.29.35
  23.82.29.51
-23.82.29.52
  23.82.44.69
+23.83.131.123
  23.83.133.250
  23.83.134.109
  23.83.179.27
+23.83.185.34
  23.83.225.179
  23.83.231.153
  23.83.240.209
@@ -98141,21 +99737,26 @@
  23.83.242.51
  23.83.247.171
  23.83.252.134
+23.83.87.102
+23.83.87.79
  23.83.89.197
  23.83.89.213
  23.83.89.37
  23.83.89.49
  23.83.92.101
+23.89.144.218
+23.89.176.253
  23.89.29.66
  23.90.145.34
  23.90.145.35
-23.90.145.37
  23.90.145.40
  23.90.145.58
+23.90.28.22
  23.90.28.51
  23.90.29.110
  23.90.29.149
  23.90.29.167
+23.90.29.195
  23.90.29.57
  23.90.29.80
  23.90.30.10
@@ -98175,7 +99776,6 @@
  23.90.31.47
  23.90.31.72
  23.90.40.111
-23.90.40.49
  23.90.43.13
  23.90.43.16
  23.91.240.148
@@ -98185,31 +99785,31 @@
  23.92.127.10
  23.92.127.34
  23.92.127.42
-23.92.127.44
  23.92.16.44
  23.92.17.46
  23.92.216.249
-23.92.218.173
+23.92.220.198
  23.92.221.88
  23.92.30.115
  23.92.30.164
-23.92.9.72
  23.92.9.90
  23.94.103.138
  23.94.103.43
  23.94.103.61
  23.94.104.126
  23.94.104.26
+23.94.108.115
  23.94.123.242
+23.94.133.215
  23.94.136.101
  23.94.139.74
+23.94.146.221
  23.94.151.211
-23.94.154.241
+23.94.151.43
  23.94.154.254
  23.94.156.8
  23.94.162.214
  23.94.175.52
-23.94.176.166
  23.94.176.177
  23.94.179.44
  23.94.182.197
@@ -98217,19 +99817,18 @@
  23.94.182.222
  23.94.183.113
  23.94.183.20
-23.94.185.202
  23.94.186.11
  23.94.186.181
-23.94.186.186
  23.94.187.130
  23.94.188.50
  23.94.190.119
  23.94.190.124
  23.94.191.234
  23.94.2.182
-23.94.20.242
+23.94.20.156
  23.94.204.101
  23.94.204.102
+23.94.204.119
  23.94.204.232
  23.94.206.177
  23.94.22.122
@@ -98253,18 +99852,15 @@
  23.94.43.186
  23.94.47.107
  23.94.47.114
-23.94.47.116
  23.94.47.125
  23.94.62.134
-23.94.66.124
  23.94.7.104
  23.94.7.144
  23.94.75.200
  23.94.75.214
-23.94.8.232
  23.94.8.6
-23.94.84.99
  23.94.87.249
+23.94.9.236
  23.94.93.171
  23.94.93.183
  23.94.93.208
@@ -98306,7 +99902,6 @@
  23.95.221.126
  23.95.221.156
  23.95.221.197
-23.95.225.112
  23.95.226.107
  23.95.226.153
  23.95.230.161
@@ -98320,8 +99915,10 @@
  23.95.25.106
  23.95.254.128
  23.95.254.160
-23.95.51.106
+23.95.5.20
+23.95.5.31
  23.95.55.211
+23.95.55.225
  23.95.81.204
  23.95.81.232
  23.95.85.74
@@ -98330,12 +99927,12 @@
  23.95.89.93
  23.95.9.10
  23.95.9.117
+23.95.9.128
  23.95.9.135
  23.95.9.144
  23.95.97.122
  23.95.97.124
  23.95.97.208
-23.96.202.234
  23.96.21.141
  23.96.24.82
  23.96.246.84
@@ -98348,10 +99945,12 @@
  23.97.180.45
  23.97.193.163
  23.98.134.62
+23.98.140.102
  23.98.144.214
  23.98.191.127
  23.98.216.241
  23.98.32.208
+23.98.66.136
  23.99.10.223
  23.99.110.151
  23.99.128.21
@@ -98417,7 +100016,9 @@
  24.104.173.201
  24.104.193.64
  24.105.202.216
+24.106.169.26
  24.106.226.216
+24.107.110.239
  24.107.212.83
  24.107.51.96
  24.108.220.229
@@ -98452,9 +100053,6 @@
  24.116.246.9
  24.118.165.35
  24.118.17.249
-24.118.69.61
-24.119.133.22
-24.119.43.211
  24.119.8.220
  24.12.184.19
  24.12.204.206
@@ -98471,10 +100069,8 @@
  24.128.212.117
  24.129.235.125
  24.13.121.112
-24.130.205.67
  24.132.126.238
  24.132.248.43
-24.132.31.29
  24.132.66.15
  24.134.98.137
  24.135.207.56
@@ -98484,9 +100080,9 @@
  24.139.143.210
  24.139.143.226
  24.139.244.238
+24.139.31.38
  24.14.211.163
  24.141.166.152
-24.141.34.166
  24.141.50.241
  24.142.165.126
  24.142.189.78
@@ -98502,25 +100098,21 @@
  24.148.117.35
  24.148.52.186
  24.148.98.177
-24.151.19.246
  24.152.102.226
  24.152.235.88
  24.152.240.209
-24.152.246.124
  24.152.30.57
  24.153.190.114
  24.153.205.22
  24.153.41.161
  24.154.144.221
  24.155.196.246
-24.155.66.210
  24.156.1.90
  24.157.130.222
  24.157.244.110
  24.158.132.157
  24.158.135.49
  24.159.15.203
-24.16.133.198
  24.160.144.208
  24.160.150.173
  24.161.8.110
@@ -98529,10 +100121,11 @@
  24.164.79.147
  24.165.208.33
  24.165.46.50
+24.165.48.169
+24.166.236.177
  24.167.210.124
  24.167.248.109
  24.167.96.213
-24.168.103.68
  24.17.132.34
  24.17.248.42
  24.170.241.241
@@ -98540,15 +100133,12 @@
  24.172.15.58
  24.172.34.114
  24.172.79.6
-24.172.82.94
  24.173.166.166
  24.173.72.38
  24.174.198.82
-24.176.195.250
  24.176.206.12
  24.176.239.113
  24.177.106.85
-24.177.185.132
  24.178.76.242
  24.178.90.49
  24.178.93.162
@@ -98556,6 +100146,7 @@
  24.179.13.119
  24.18.90.2
  24.180.155.84
+24.180.55.125
  24.181.205.130
  24.181.205.134
  24.181.67.58
@@ -98568,10 +100159,8 @@
  24.185.157.190
  24.185.159.118
  24.185.159.69
-24.185.62.76
  24.186.197.44
  24.186.221.111
-24.186.230.166
  24.186.87.106
  24.187.189.68
  24.187.199.142
@@ -98581,11 +100170,11 @@
  24.188.214.137
  24.188.228.243
  24.189.146.52
+24.189.159.134
  24.189.212.233
  24.19.9.253
  24.190.221.48
  24.190.60.242
-24.191.114.63
  24.192.185.142
  24.192.191.109
  24.192.223.69
@@ -98599,6 +100188,7 @@
  24.196.88.234
  24.2.154.151
  24.2.160.242
+24.2.29.46
  24.200.189.126
  24.200.190.39
  24.200.207.128
@@ -98621,7 +100211,6 @@
  24.207.205.152
  24.207.219.234
  24.207.86.99
-24.209.64.71
  24.21.176.186
  24.21.177.155
  24.21.229.157
@@ -98633,6 +100222,7 @@
  24.212.222.198
  24.212.249.164
  24.212.34.103
+24.212.45.252
  24.212.45.5
  24.212.51.61
  24.212.64.36
@@ -98643,6 +100233,7 @@
  24.215.104.39
  24.217.140.142
  24.217.33.233
+24.217.62.86
  24.218.231.49
  24.219.210.105
  24.22.117.29
@@ -98652,6 +100243,7 @@
  24.220.66.23
  24.220.85.125
  24.221.19.31
+24.221.19.57
  24.222.118.75
  24.222.131.233
  24.222.200.71
@@ -98689,27 +100281,29 @@
  24.234.75.185bin.sh
  24.235.35.241
  24.235.40.150
+24.235.50.168
  24.235.62.14
  24.236.111.248
  24.237.101.250
  24.237.70.53
  24.238.18.58
  24.238.80.114
-24.239.217.125
  24.239.232.136
+24.240.116.153
  24.240.96.140
+24.242.140.59
  24.243.87.27
  24.244.157.205
  24.244.157.21
+24.244.183.101
  24.245.100.212
  24.245.121.47
  24.245.126.32
  24.246.134.126
  24.246.23.168
+24.247.203.164
  24.247.213.209
  24.247.31.87
-24.247.73.160
-24.248.207.7
  24.248.44.90
  24.249.125.168
  24.249.136.254
@@ -98727,8 +100321,8 @@
  24.253.151.30
  24.254.38.127
  24.255.192.211
-24.255.96.250
  24.26.156.42
+24.26.31.226
  24.27.110.133
  24.30.124.181
  24.31.15.232
@@ -98739,7 +100333,6 @@
  24.35.195.174
  24.35.97.37
  24.36.11.130
-24.36.146.127
  24.36.161.180
  24.36.53.159
  24.37.113.22
@@ -98758,13 +100351,14 @@
  24.39.5.26
  24.4.68.254
  24.4.88.103
+24.42.136.118
  24.42.141.76
  24.42.167.242
  24.42.229.143
  24.42.28.39
  24.43.32.186
  24.43.99.75
-24.44.184.238
+24.45.69.240
  24.46.101.89
  24.46.183.117
  24.46.38.139
@@ -98774,6 +100368,7 @@
  24.48.175.29
  24.48.8.23
  24.4buyuklergazete.com
+24.5.124.12
  24.50.227.93
  24.50.247.40
  24.51.36.42
@@ -98792,7 +100387,6 @@
  24.55.19.82
  24.56.217.217
  24.56.242.244
-24.56.250.54
  24.57.192.80
  24.57.227.242
  24.57.243.108
@@ -98808,7 +100402,6 @@
  24.64.164.229
  24.64.86.246
  24.65.65.200
-24.65.73.68
  24.66.13.157
  24.66.130.44
  24.66.146.235
@@ -98817,14 +100410,11 @@
  24.67.21.40
  24.68.94.168
  24.69.65.8
-24.7.12.208
-24.7.125.43
  24.70.112.215
  24.70.200.144
  24.70.202.165
  24.70.96.78
  24.72.199.137
-24.72.80.84
  24.73.124.110
  24.74.120.196
  24.76.213.10
@@ -98844,11 +100434,11 @@
  24.86.185.80
  24.87.71.106
  24.88.169.93
-24.89.118.14
  24.89.162.12
  24.89.252.119
  24.89.71.20
  24.9.219.33
+24.90.103.144
  24.90.125.46
  24.90.164.18
  24.90.191.87
@@ -98859,7 +100449,7 @@
  24.92.157.192
  24.92.187.245
  24.93.234.75
-24.96.118.185
+24.94.94.219
  24.96.125.57
  24.96.173.47
  24.96.226.22
@@ -98977,14 +100567,14 @@
  26buofa26.bankofamericaslpemr.com
  26coder.net
  26v.cn
-27.0.15.37
  27.0.51.44
-27.0.54.136
  27.0.56.42
  27.1.245.16
  27.1.245.16bin.sh
  27.1.245.33
  27.1.253.142
+27.10.43.86
+27.10.48.132
  27.10.61.19
  27.10.62.106
  27.100.163.200
@@ -99011,10 +100601,11 @@
  27.102.70.210
  27.102.70.211
  27.104.157.167
-27.104.179.162
+27.104.175.70
  27.104.223.71
  27.104.235.24
  27.104.251.120
+27.104.252.37
  27.104.254.41
  27.104.255.19
  27.105.105.25
@@ -99029,7 +100620,6 @@
  27.105.71.117
  27.106.100.41
  27.106.12.218
-27.106.60.32
  27.106.84.162
  27.106.84.186
  27.109.115.130
@@ -99050,12 +100640,9 @@
  27.111.35.13
  27.111.44.196
  27.112.203.103
-27.113.112.66
  27.113.52.156
  27.113.52.46
-27.113.91.102
  27.114.134.46
-27.114.148.200
  27.114.151.187
  27.114.9.93
  27.115.117.6
@@ -99068,7 +100655,6 @@
  27.115.252.189
  27.115.50.114
  27.115.58.138
-27.116.16.118
  27.116.48.102
  27.116.51.119
  27.116.51.178
@@ -99086,7 +100672,6 @@
  27.119.62.167
  27.120.109.165
  27.121.109.247
-27.121.190.62
  27.122.56.147
  27.122.59.10
  27.122.59.100
@@ -99111,6 +100696,7 @@
  27.126.179.44
  27.126.179.46
  27.126.188.205
+27.126.35.7
  27.127.187.136
  27.128.165.131
  27.128.168.225
@@ -99121,7 +100707,6 @@
  27.128.183.162
  27.128.199.247
  27.128.201.88
-27.128.204.66
  27.128.233.104
  27.128.236.107
  27.128.236.189
@@ -99129,6 +100714,7 @@
  27.128.244.13
  27.13.163.209
  27.13.27.30
+27.13.96.227
  27.131.106.230
  27.131.178.119
  27.131.187.222
@@ -99144,6 +100730,7 @@
  27.14.84.103
  27.14.87.188
  27.142.132.247
+27.142.241.233
  27.145.130.154
  27.147.142.50
  27.147.142.53
@@ -99155,7 +100742,6 @@
  27.147.195.218
  27.147.209.215
  27.147.210.35
-27.147.214.124
  27.147.217.194
  27.147.217.86
  27.147.222.212
@@ -99168,7 +100754,6 @@
  27.148.211.136
  27.148.211.247
  27.15.24.183
-27.15.25.59
  27.15.25.91
  27.15.84.188
  27.150.175.150
@@ -99181,40 +100766,36 @@
  27.151.115.81
  27.151.30.189
  27.151.6.109
-27.153.140.94
  27.153.142.182
+27.153.183.38
  27.154.110.22
  27.154.225.186
-27.154.225.194
  27.154.233.226
  27.154.242.142
  27.154.32.202
  27.154.34.146
-27.154.59.202
  27.154.67.164
  27.154.67.65
  27.154.70.183
+27.154.70.212
  27.155.101.173
  27.155.101.197
  27.155.105.208
  27.155.54.174
  27.155.54.219
  27.155.54.34
-27.155.54.46
  27.155.54.60
  27.155.55.141
  27.155.83.174
  27.155.97.12
  27.156.139.221
-27.156.219.31
+27.156.222.26
  27.156.248.78
-27.156.4.11
  27.156.4.179
  27.156.6.147
-27.157.18.32
-27.157.18.46
  27.158.161.91
  27.158.214.239
+27.158.255.204
  27.158.48.201
  27.159.82.254
  27.17.11.78
@@ -99227,19 +100808,20 @@
  27.184.50.41
  27.185.15.56
  27.185.19.172
-27.187.248.145
  27.187.248.223
  27.187.248.63
  27.187.249.109
  27.187.249.163
  27.187.249.35
  27.187.250.42
+27.187.250.9
  27.187.251.85
  27.188.56.26
  27.188.61.75
  27.188.62.55
  27.188.77.75
  27.19.108.61
+27.19.55.180
  27.191.150.48
  27.191.210.15
  27.191.234.199
@@ -99265,7 +100847,6 @@
  27.193.233.48
  27.193.24.224
  27.193.249.83
-27.193.250.240
  27.193.250.240bin.sh
  27.193.253.146
  27.193.44.80
@@ -99289,6 +100870,7 @@
  27.194.157.226
  27.194.16.149
  27.194.164.63
+27.194.188.39
  27.194.192.227
  27.194.192.37
  27.194.193.236
@@ -99297,7 +100879,6 @@
  27.194.238.219
  27.194.238.250
  27.194.24.114
-27.194.25.138
  27.194.252.247
  27.194.26.98
  27.194.36.216
@@ -99324,6 +100905,7 @@
  27.198.153.92
  27.198.16.19
  27.198.33.255
+27.198.4.133
  27.198.51.21
  27.198.66.231
  27.199.106.203
@@ -99331,12 +100913,13 @@
  27.199.158.241
  27.199.198.206
  27.2.121.170
-27.2.166.34
+27.2.138.166
  27.2.166.35
  27.2.23.220
  27.2.68.251
  27.2.7.59
  27.2.70.230
+27.2.73.132
  27.2.82.97
  27.2.86.187
  27.200.1.139
@@ -99350,6 +100933,7 @@
  27.200.224.79
  27.200.224.98
  27.200.248.92
+27.200.25.208
  27.200.250.122
  27.200.78.102
  27.201.108.182
@@ -99373,6 +100957,7 @@
  27.202.142.222
  27.202.142.79
  27.202.161.111
+27.202.164.211
  27.202.171.91
  27.202.190.53
  27.202.2.207
@@ -99380,6 +100965,7 @@
  27.202.210.80
  27.202.210.80bin.sh
  27.202.212.123
+27.202.212.181
  27.202.226.121
  27.202.227.184
  27.202.243.37
@@ -99390,7 +100976,6 @@
  27.202.4.106
  27.202.44.3
  27.202.46.125
-27.202.48.62
  27.202.52.95
  27.202.76.83
  27.203.116.215
@@ -99415,7 +101000,6 @@
  27.203.5.143
  27.203.70.108
  27.203.87.75
-27.203.93.198
  27.203.97.11
  27.204.142.108
  27.204.143.131
@@ -99428,6 +101012,7 @@
  27.204.253.12
  27.204.254.155
  27.205.101.58
+27.205.121.150
  27.205.156.106
  27.205.171.132
  27.205.18.36
@@ -99435,6 +101020,7 @@
  27.205.248.30
  27.206.108.54
  27.206.137.253
+27.206.160.46
  27.206.175.85
  27.206.186.252
  27.206.187.235
@@ -99443,7 +101029,6 @@
  27.206.220.118
  27.206.240.52
  27.206.40.134
-27.206.41.55
  27.206.66.103
  27.206.85.151
  27.207.12.223
@@ -99455,7 +101040,7 @@
  27.207.197.49
  27.207.197.49bin.sh
  27.207.202.222
-27.207.239.141
+27.207.232.138
  27.207.24.78
  27.207.249.100
  27.207.251.64
@@ -99465,7 +101050,6 @@
  27.207.54.110
  27.207.8.238
  27.207.86.225
-27.207.95.140
  27.208.100.167
  27.208.103.44
  27.208.104.229
@@ -99478,16 +101062,14 @@
  27.208.200.128
  27.208.205.154
  27.208.21.167
-27.208.37.171
  27.208.37.210
  27.208.43.59
  27.208.45.77
  27.209.126.200
-27.209.148.107
-27.209.150.20
-27.209.200.197
+27.209.126.36
  27.209.217.208
  27.209.67.191
+27.21.169.138
  27.21.170.214
  27.210.10.133
  27.210.101.231
@@ -99502,13 +101084,11 @@
  27.210.147.237
  27.210.15.89
  27.210.155.54
-27.210.161.2
  27.210.17.222
  27.210.173.204
  27.210.194.159
  27.210.236.134
  27.210.246.189
-27.210.255.18
  27.210.255.236
  27.210.30.192
  27.210.35.107
@@ -99518,6 +101098,7 @@
  27.210.42.130
  27.210.43.136
  27.210.55.84
+27.210.67.199
  27.210.75.98
  27.210.82.136
  27.210.90.175
@@ -99539,12 +101120,10 @@
  27.213.175.242
  27.213.19.97
  27.213.208.35
-27.213.216.152
  27.213.244.125
  27.213.244.152
  27.213.252.208
  27.213.3.90
-27.213.33.92
  27.213.44.252
  27.213.6.148
  27.213.6.59
@@ -99571,11 +101150,10 @@
  27.215.168.29
  27.215.176.224
  27.215.177.142
-27.215.180.100
  27.215.191.88
  27.215.2.23
  27.215.202.93
-27.215.213.199
+27.215.224.196
  27.215.224.48
  27.215.228.253
  27.215.232.117
@@ -99594,6 +101172,7 @@
  27.215.76.18
  27.215.83.51
  27.215.83.51bin.sh
+27.215.88.243
  27.215.88.5
  27.215.96.1
  27.215.98.253
@@ -99616,14 +101195,11 @@
  27.216.227.58
  27.216.254.180
  27.216.4.13
-27.216.45.229
  27.216.46.101
-27.216.47.8
  27.216.48.72
  27.216.51.160
  27.216.54.67
  27.216.77.180
-27.216.79.193
  27.217.103.218
  27.217.103.59
  27.217.113.183
@@ -99643,16 +101219,15 @@
  27.217.213.201
  27.217.214.175
  27.217.242.231bin.sh
-27.217.244.143
  27.217.46.206
  27.217.49.27
-27.217.5.237
  27.217.54.35
  27.217.55.177
  27.217.66.91
  27.217.71.122
  27.217.88.78
  27.217.92.245
+27.218.178.146
  27.218.187.213
  27.218.194.92
  27.219.100.185
@@ -99682,6 +101257,7 @@
  27.219.31.65
  27.219.42.130
  27.219.57.145
+27.219.66.100
  27.219.67.178
  27.219.81.121
  27.219.82.177
@@ -99691,8 +101267,6 @@
  27.220.151.8
  27.220.158.71
  27.220.190.99
-27.220.253.123
-27.220.34.190
  27.220.89.168
  27.220.89.250
  27.220.94.247
@@ -99724,6 +101298,7 @@
  27.223.163.206
  27.223.174.233
  27.223.181.2
+27.223.189.174
  27.223.2.182
  27.223.203.99
  27.223.230.215
@@ -99757,14 +101332,15 @@
  27.247.190.189
  27.25.103.107
  27.25.169.15
+27.252.60.62
  27.254.130.67
  27.254.137.144
  27.254.172.190
-27.254.172.54
  27.254.206.238
  27.254.34.177
  27.254.34.181
  27.254.38.122
+27.254.46.67
  27.254.48.194
  27.254.60.60
  27.254.67.161
@@ -99776,7 +101352,6 @@
  27.255.75.3
  27.255.75.5
  27.255.75.7
-27.255.75.9
  27.255.77.10
  27.255.77.145
  27.255.77.182
@@ -99803,20 +101378,18 @@
  27.3.43.52
  27.3.44.31
  27.3.92.14
-27.30.4.108
  27.30.4.222
  27.32.181.37
  27.32.206.62
-27.32.230.133
  27.32.77.98
  27.33.129.234
  27.33.160.196
-27.34.12.65
  27.34.161.42
  27.34.20.87
  27.34.251.60
  27.34.4.41
  27.34.52.251
+27.34.7.186
  27.35.100.245
  27.35.100.31
  27.35.104.17
@@ -99827,16 +101400,20 @@
  27.35.108.153
  27.35.113.214
  27.35.120.167
+27.35.122.125
+27.35.122.176
  27.35.126.98
  27.35.127.129
  27.35.129.198
  27.35.144.79
+27.35.145.41
  27.35.145.43
+27.35.154.13
  27.35.154.42
-27.35.155.99
  27.35.156.47
  27.35.160.16
  27.35.171.58
+27.35.172.14
  27.35.172.208
  27.35.173.3
  27.35.173.95
@@ -99854,15 +101431,16 @@
  27.35.211.93
  27.35.212.124
  27.35.214.182
+27.35.214.186
  27.35.214.191
  27.35.214.207
  27.35.217.36
  27.35.217.44
  27.35.217.60
  27.35.217.64
+27.35.217.95
  27.35.218.8
  27.35.219.131
-27.35.219.61
  27.35.222.38
  27.35.228.116
  27.35.228.134
@@ -99879,7 +101457,6 @@
  27.35.254.60
  27.35.254.69
  27.35.34.141
-27.35.38.56
  27.35.38.71
  27.35.40.195
  27.35.50.143
@@ -99893,12 +101470,10 @@
  27.37.126.136
  27.37.9.181
  27.38.254.112
-27.41.142.194
+27.41.157.21
  27.41.157.5
-27.41.158.107
  27.41.158.204
-27.41.173.250
-27.41.174.52
+27.41.174.167
  27.41.179.202
  27.41.181.181
  27.41.182.169
@@ -99906,12 +101481,10 @@
  27.41.204.88
  27.41.206.175
  27.41.218.40
-27.41.221.255
-27.41.228.12
-27.41.228.77
+27.41.231.163
  27.41.91.192
-27.43.116.138
  27.43.122.184
+27.43.148.73
  27.44.194.248
  27.48.138.8
  27.49.160.7
@@ -99920,7 +101493,6 @@
  27.5.32.191
  27.50.162.159
  27.50.165.202
-27.50.169.198
  27.50.169.205
  27.50.169.209
  27.50.169.211
@@ -99937,7 +101509,6 @@
  27.54.123.2
  27.54.163.132
  27.54.166.212
-27.54.187.4
  27.54.217.69
  27.54.228.71
  27.54.248.35
@@ -99945,13 +101516,9 @@
  27.54.53.208
  27.54.94.226
  27.57.15.217
-27.57.199.66
  27.58.0.141
  27.6.104.60bin.sh
-27.6.132.212
-27.6.185.54
  27.6.207.11
-27.6.236.158
  27.6.30.211
  27.64.13.105
  27.64.13.187
@@ -99959,7 +101526,6 @@
  27.64.154.254
  27.64.16.204
  27.64.163.17
-27.64.175.147
  27.64.19.114
  27.64.192.73
  27.64.195.252
@@ -99970,31 +101536,30 @@
  27.64.9.139
  27.64.9.25
  27.65.230.179
+27.65.52.137
  27.65.58.89
  27.65.61.64
  27.66.118.132
  27.66.118.37
+27.66.252.96
  27.66.46.167
  27.66.72.48
  27.66.72.80
  27.66.73.58
  27.66.74.131
  27.66.75.109
-27.67.134.56
  27.68.0.150
-27.68.113.62
  27.68.23.106
  27.68.27.68
  27.68.76.48
  27.69.185.185
  27.69.224.204
-27.7.130.4
  27.7.143.136
  27.70.172.250
  27.70.174.61
  27.70.215.167
  27.70.227.42
-27.71.120.78
+27.71.122.205
  27.71.228.25
  27.71.231.175
  27.71.231.25
@@ -100009,6 +101574,7 @@
  27.72.19.127
  27.72.240.214
  27.72.29.159
+27.72.42.251
  27.72.46.130
  27.72.57.215
  27.72.61.48
@@ -100019,7 +101585,6 @@
  27.72.76.140
  27.72.80.126
  27.73.177.45
-27.73.213.180
  27.73.56.65
  27.73.59.187
  27.73.61.220
@@ -100029,7 +101594,6 @@
  27.74.247.135
  27.74.247.140
  27.74.251.18
-27.74.253.176
  27.74.53.82
  27.74.8.176
  27.74.8.99
@@ -100054,11 +101618,9 @@
  27.76.12.143
  27.76.126.10
  27.76.128.13
-27.76.15.142
  27.76.165.148
  27.76.165.212
  27.76.179.200
-27.76.2.34
  27.76.4.166
  27.76.5.134
  27.76.5.45
@@ -100092,13 +101654,15 @@
  27.8.103.35
  27.8.108.167
  27.8.112.103
+27.8.119.46
+27.8.119.88
  27.8.234.12
  27.8.235.240
  27.8.237.38
  27.8.239.181
  27.8.98.81
  27.8.99.155
-27.89.41.27
+27.82.13.10
  27.9.104.254
  27.9.125.57
  27.9.139.21
@@ -100306,7 +101870,6 @@
  2tbuofa2t.bankofamericaslpemr.com
  2tem5sb.merlontean.com
  2themoonwidget.info
-2thpubgm.com
  2tor.com.mx
  2tuo.xyz
  2vayxinhxinh.bio
@@ -100363,6 +101926,7 @@
  3-uk-portal.com
  3-uk-support.com
  3-uk-update.com
+3-verify.network
  3.0.126.199
  3.0.167.250
  3.0.172.253
@@ -100376,11 +101940,10 @@
  3.10.70.38
  3.101.125.70
  3.101.21.147
-3.101.38.51
  3.101.67.35
+3.104.224.80
  3.104.54.134
  3.11.152.239
-3.11.235.44
  3.112.107.63
  3.112.158.44
  3.112.174.195
@@ -100400,8 +101963,6 @@
  3.12.182.233
  3.12.25.240
  3.120.112.0
-3.120.129.159
-3.120.148.145
  3.120.151.83
  3.120.158.102
  3.120.172.249
@@ -100414,17 +101975,13 @@
  3.121.203.169
  3.121.203.211
  3.121.94.224
-3.122.114.14
  3.122.247.28
-3.122.248.153
  3.122.59.101
  3.123.19.130
-3.123.19.254
  3.123.222.19
  3.123.254.92
  3.123.26.194
  3.123.28.195
-3.124.204.255
  3.124.220.121
  3.124.38.47
  3.124.5.37
@@ -100433,13 +101990,10 @@
  3.125.6.62
  3.125.62.133
  3.126.184.249
-3.126.207.76
  3.126.209.33
  3.126.249.36
  3.127.151.210
-3.127.235.143
  3.127.236.227
-3.127.255.82
  3.127.45.228
  3.127.65.254
  3.128.106.107
@@ -100451,17 +102005,15 @@
  3.128.95.81
  3.129.10.250
  3.129.202.2
-3.129.38.238
  3.129.43.236
  3.130.237.238
  3.131.13.61
  3.131.202.18
-3.132.145.59
  3.132.39.66
+3.133.119.53
  3.133.154.216
  3.133.86.139
  3.134.245.141
-3.134.246.118
  3.134.246.127
  3.134.91.16
  3.135.154.33
@@ -100473,9 +102025,7 @@
  3.138.122.100
  3.138.169.159
  3.138.216.171
-3.139.70.55
  3.14.168.201
-3.14.182.203
  3.15.140.156
  3.15.158.119
  3.15.37.142
@@ -100500,9 +102050,7 @@
  3.17.61.84
  3.18.101.80
  3.18.107.11
-3.18.118.37
  3.18.213.211
-3.18.5.172
  3.19.227.221
  3.19.30.176
  3.19.56.156
@@ -100520,8 +102068,10 @@
  3.210.177.194
  3.211.51.136
  3.214.190.124
+3.219.41.205
  3.219.45.92
  3.219.58.63
+3.22.102.50
  3.22.198.63
  3.22.25.171
  3.220.203.233
@@ -100530,12 +102080,10 @@
  3.221.155.232
  3.222.213.197
  3.224.147.129
-3.226.240.85
  3.227.11.183
  3.227.15.164
  3.228.87.114
  3.23.227.175
-3.23.55.66
  3.23.85.64
  3.230.162.30
  3.231.220.144
@@ -100543,8 +102091,8 @@
  3.232.243.7
  3.233.220.90
  3.234.139.193
+3.234.251.85
  3.235.183.241
-3.235.183.74
  3.235.228.195
  3.235.254.62
  3.235.63.145
@@ -100557,8 +102105,6 @@
  3.237.39.87
  3.237.65.243
  3.238.110.171
-3.238.120.109
-3.238.23.103
  3.238.8.21
  3.248.223.135
  3.25.130.248
@@ -100567,7 +102113,6 @@
  3.250.188.245
  3.250.33.91
  3.250.35.22
-3.250.83.211
  3.26.49.147
  3.34.126.240
  3.34.133.144
@@ -100579,6 +102124,7 @@
  3.34.193.45
  3.34.196.221
  3.34.200.165
+3.34.213.108
  3.34.252.168
  3.34.42.230
  3.34.59.49
@@ -100596,8 +102142,10 @@
  3.35.40.175
  3.35.47.140
  3.35.48.144
+3.6.11.14
  3.6.206.209
  3.6.41.84
+3.6.56.117
  3.6.71.62
  3.6.87.154
  3.7.15.52
@@ -100622,7 +102170,6 @@
  3.81.9.188
  3.81.90.20
  3.81.94.209
-3.82.17.135
  3.82.58.104
  3.83.120.10
  3.83.190.102
@@ -100634,9 +102181,7 @@
  3.84.27.209
  3.84.95.119
  3.85.100.29
-3.85.159.124
  3.86.194.104
-3.86.216.225
  3.87.139.249
  3.87.158.26
  3.87.177.152
@@ -100646,19 +102191,24 @@
  3.89.143.143
  3.89.7.95
  3.90.112.217
-3.90.70.155
  3.90.83.73
  3.91.106.244
  3.91.236.72
  3.91.73.60
+3.92.228.144
  3.92.233.209
  3.93.2.251
  3.93.244.52
+3.93.38.220
  3.94.249.60
  3.94.96.136
  3.95.149.5
+3.95.221.61
+3.95.26.69
  3.96.170.113
  3.96.190.111
+3.96.7.44
+3.97.71.201
  3.empirecores.com
  3.gucac.com
  3.help.uk.secure-resolveproblem.com
@@ -100715,16 +102265,16 @@
  30ywc.codesandbox.io
  31-31-199-49.ovz.vps.regruhosting.ru
  31.0.1.151
-31.0.120.65
+31.0.165.184
  31.0.194.24
  31.0.210.36
  31.0.98.131
  31.0.99.6
  31.10.110.132
  31.10.15.182
+31.11.128.153
  31.11.130.88
  31.12.67.62
-31.124.173.141
  31.124.178.246
  31.127.118.68
  31.128.239.30
@@ -100735,15 +102285,13 @@
  31.129.173.162
  31.129.248.51
  31.129.253.30
-31.129.253.90
  31.129.82.101
  31.13.115.23
  31.13.137.65
  31.13.176.209
  31.13.180.33
  31.13.189.92
-31.130.159.2
-31.130.184.63
+31.13.34.14
  31.130.203.168
  31.131.111.67
  31.131.20.185
@@ -100759,8 +102307,6 @@
  31.132.211.144
  31.132.220.2
  31.132.69.165
-31.132.92.76
-31.132.93.149
  31.133.0.57
  31.133.49.74
  31.133.57.134
@@ -100770,26 +102316,27 @@
  31.134.125.209
  31.134.134.197
  31.134.16.13
+31.134.16.39
  31.134.81.36
  31.135.138.204
  31.135.139.19
  31.135.148.173
  31.135.161.174
+31.135.163.136
  31.135.177.195
+31.135.205.221
  31.135.65.140
  31.135.77.117
  31.135.91.9
  31.135.93.56
-31.14.126.51
  31.14.136.210
-31.14.159.11
  31.14.201.156
  31.14.40.154
  31.14.40.19
  31.14.57.239
  31.14.57.68
-31.14.85.12
-31.14.94.19
+31.14.73.63
+31.14.73.86
  31.140.193.73
  31.140.225.157
  31.145.138.145
@@ -100822,7 +102369,6 @@
  31.146.249.177
  31.146.249.198
  31.147.253.49
-31.148.124.77
  31.148.127.91
  31.148.219.131
  31.148.219.206
@@ -100836,7 +102382,6 @@
  31.15.88.72
  31.15.89.51
  31.150.171.109
-31.150.208.23
  31.151.28.39
  31.153.101.140
  31.154.174.126
@@ -100849,23 +102394,23 @@
  31.156.74.163
  31.156.78.210
  31.156.96.65
-31.16.126.238
  31.16.176.69
  31.16.185.139
  31.16.203.101
  31.16.217.18
  31.16.25.60
  31.16.250.8
+31.16.87.13
  31.16.91.237
  31.160.68.193
  31.162.152.3
  31.162.28.156
+31.162.28.191
  31.162.29.10
  31.162.48.115
  31.162.5.75
  31.162.51.231
  31.162.52.98
-31.163.129.111
  31.163.129.184
  31.163.130.208
  31.163.130.24
@@ -100873,14 +102418,13 @@
  31.163.130.57
  31.163.131.134
  31.163.131.19
-31.163.131.247
  31.163.131.76
  31.163.132.153
  31.163.132.158
-31.163.132.24
  31.163.132.250
  31.163.133.145
  31.163.133.193
+31.163.134.103
  31.163.134.106
  31.163.134.111
  31.163.134.121
@@ -100902,13 +102446,11 @@
  31.163.137.76
  31.163.139.18
  31.163.139.241
-31.163.140.144
  31.163.140.196
  31.163.140.31
  31.163.141.213
  31.163.141.30
  31.163.141.65
-31.163.142.170
  31.163.142.202
  31.163.142.222
  31.163.143.149
@@ -100971,8 +102513,8 @@
  31.163.168.42
  31.163.169.133
  31.163.169.213
-31.163.169.96
  31.163.170.231
+31.163.171.163
  31.163.171.17
  31.163.171.219
  31.163.172.1
@@ -100991,7 +102533,6 @@
  31.163.175.28
  31.163.176.158
  31.163.177.36
-31.163.178.194
  31.163.179.113
  31.163.179.117
  31.163.179.191
@@ -101002,7 +102543,6 @@
  31.163.182.119
  31.163.182.130
  31.163.182.180
-31.163.182.48
  31.163.182.80
  31.163.183.1
  31.163.183.189
@@ -101014,13 +102554,13 @@
  31.163.184.197
  31.163.185.43
  31.163.185.96
+31.163.186.151
  31.163.186.178
  31.163.186.26
  31.163.186.48
  31.163.186.55
  31.163.187.210
  31.163.188.6
-31.163.188.72
  31.163.189.101
  31.163.189.254
  31.163.189.76
@@ -101030,26 +102570,23 @@
  31.163.191.111
  31.163.198.162
  31.163.202.55
-31.163.204.171
  31.163.213.124
  31.163.215.12
  31.163.217.136
  31.163.223.161
  31.163.243.2
-31.163.249.105
  31.163.249.229
-31.166.248.51
  31.166.43.122
  31.167.11.121
  31.167.134.193
  31.167.134.252
  31.167.14.111
-31.167.142.137
  31.167.170.223
  31.167.18.162
  31.167.181.96
  31.167.186.69
  31.167.20.1
+31.167.33.166
  31.167.35.161
  31.168.120.3
  31.168.123.65
@@ -101067,32 +102604,27 @@
  31.168.247.24
  31.168.249.37
  31.168.28.180
-31.168.34.102
  31.168.63.146
  31.168.63.203
  31.168.69.220
-31.169.10.10
-31.169.25.130
-31.169.30.190
  31.17.207.18
+31.17.249.157
  31.17.70.80
  31.170.123.8
  31.170.160.90
  31.170.166.108
-31.170.166.121
  31.170.166.177
  31.170.166.18
  31.170.166.185
  31.170.173.73
-31.170.238.37
  31.170.49.26
  31.171.108.141
  31.171.192.247
+31.171.195.124
  31.171.197.12
  31.171.197.41
  31.171.197.46
  31.171.198.145
-31.171.198.22
  31.171.198.74
  31.171.251.35
  31.171.71.74
@@ -101106,7 +102638,6 @@
  31.172.30.4
  31.172.88.250
  31.173.0.249
-31.173.103.174
  31.173.13.190
  31.173.138.204
  31.173.162.191
@@ -101126,22 +102657,21 @@
  31.179.204.142
  31.179.224.42
  31.179.233.207
-31.179.233.212
  31.179.235.105
  31.179.247.161
  31.18.102.251
  31.18.122.117
  31.18.73.104
  31.180.142.26
-31.180.149.164
  31.180.152.227
-31.180.175.219
-31.180.187.48
  31.180.234.41
+31.181.169.128
  31.181.175.28
+31.181.81.166
  31.182.12.3
  31.182.13.17
  31.182.144.36
+31.182.253.222
  31.182.57.86
  31.184.177.6
  31.184.195.114
@@ -101162,7 +102692,6 @@
  31.186.27.203
  31.186.48.172
  31.186.53.122
-31.19.224.198
  31.192.105.16
  31.192.128.22
  31.192.131.132
@@ -101208,7 +102737,6 @@
  31.208.154.165
  31.208.16.80
  31.208.177.152
-31.208.196.206
  31.208.20.38
  31.208.225.175
  31.208.233.30
@@ -101234,6 +102762,7 @@
  31.210.188.108
  31.210.217.69
  31.210.225.249
+31.210.35.130
  31.210.43.228
  31.210.72.42
  31.211.187.230
@@ -101243,7 +102772,6 @@
  31.214.160.15
  31.215.144.96
  31.215.39.25
-31.217.11.151
  31.220.0.186
  31.220.0.202
  31.220.0.203
@@ -101262,7 +102790,6 @@
  31.220.2.222
  31.220.2.223
  31.220.3.105
-31.220.3.107
  31.220.3.185
  31.220.4.124
  31.220.4.17
@@ -101292,15 +102819,14 @@
  31.221.95.5
  31.222.127.72
  31.222.129.14
+31.222.6.8
  31.223.114.17
  31.223.16.149
  31.223.210.82
  31.223.33.10
-31.223.51.214
  31.223.60.177
  31.223.93.152
  31.23.128.171
-31.23.172.174
  31.23.34.185
  31.24.176.249
  31.24.186.216
@@ -101313,7 +102839,6 @@
  31.25.241.206
  31.25.241.224
  31.25.29.44
-31.25.31.6
  31.25.91.216
  31.27.105.102
  31.27.232.56
@@ -101330,6 +102855,7 @@
  31.28.99.25
  31.29.212.240
  31.29.44.80
+31.29.63.227
  31.29.99.227
  31.29.99.230
  31.3.135.181
@@ -101343,73 +102869,47 @@
  31.31.75.143
  31.31.76.95
  31.31.77.107
+31.32.16.198
  31.36.181.181
  31.40.1.60
  31.40.135.67
-31.40.208.109
-31.40.208.148
-31.40.208.156
+31.40.208.157
  31.40.208.166
-31.40.208.178
  31.40.208.186
  31.40.208.194
  31.40.208.205
-31.40.208.248
-31.40.208.49
-31.40.208.62
  31.40.208.85
  31.40.209.102
  31.40.209.109
  31.40.209.138
-31.40.209.161
  31.40.209.182
  31.40.209.191
  31.40.209.195
-31.40.209.203
-31.40.209.252
-31.40.209.26
  31.40.209.89
-31.40.252.102
-31.40.252.110
+31.40.209.93
+31.40.248.63
+31.40.249.106
  31.40.252.135
-31.40.252.14
-31.40.252.172
-31.40.252.179
  31.40.252.181
  31.40.252.214
  31.40.252.242
  31.40.252.49
  31.40.252.83
-31.40.252.91
  31.40.253.108
  31.40.253.14
-31.40.253.166
-31.40.253.168
-31.40.253.189
  31.40.253.196
  31.40.253.224
-31.40.253.23
-31.40.253.252
  31.40.253.50
-31.40.254.102
-31.40.254.133
-31.40.254.174
  31.40.254.208
  31.40.254.211
  31.40.254.216
  31.40.254.230
-31.40.254.51
-31.40.254.53
-31.40.254.56
  31.40.255.100
-31.40.255.155
  31.40.255.217
  31.40.255.229
  31.40.255.33
  31.40.255.50
  31.40.255.79
-31.40.26.13
-31.40.27.176
  31.40.48.112
  31.41.104.59
  31.41.11.10
@@ -101425,7 +102925,6 @@
  31.41.93.230
  31.42.11.180
  31.42.165.227
-31.42.178.2
  31.42.186.147
  31.42.254.24
  31.42.91.131
@@ -101457,8 +102956,6 @@
  31.46.85.48
  31.47.154.249
  31.47.189.14
-31.47.192.233
-31.47.202.132
  31.47.202.73
  31.47.240.130
  31.47.252.50
@@ -101473,11 +102970,9 @@
  31.49.121.10
  31.5.172.135
  31.5.235.168
-31.50.80.221
  31.50.81.226
  31.51.35.147
  31.53.18.65
-31.53.187.242
  31.53.222.46
  31.54.18.237
  31.54.210.21
@@ -101497,9 +102992,7 @@
  31.7.61.189
  31.7.61.190
  31.7.62.113
-31.8.112.166
  31.8.118.34
-31.8.70.171
  31.8.99.2
  310051-dot-n-e-w-me-ss-age-po-rt-al.wl.r.appspot.com
  31105.ldayl.com
@@ -101592,15 +103085,16 @@
  34.101.126.163
  34.101.129.24
  34.101.132.198
-34.101.171.179
  34.101.179.157
  34.101.186.228
  34.101.219.56
  34.101.229.34
  34.101.245.236
+34.101.245.93
  34.101.247.157
  34.101.70.182
  34.101.72.24
+34.101.85.110
  34.102.136.180
  34.105.102.230
  34.105.119.151
@@ -101620,6 +103114,7 @@
  34.106.151.6
  34.106.199.158
  34.106.217.38
+34.106.233.250
  34.106.240.178
  34.106.249.67
  34.106.53.204
@@ -101628,7 +103123,6 @@
  34.106.62.115
  34.106.78.170
  34.106.93.46
-34.107.101.26
  34.107.107.99
  34.107.118.237
  34.107.127.177
@@ -101637,18 +103131,18 @@
  34.107.41.9
  34.107.49.174
  34.107.54.119
-34.121.13.174
+34.121.114.203
  34.121.191.59
  34.121.220.45
  34.121.56.218
  34.122.121.152
  34.122.121.188
  34.122.136.24
+34.122.14.102
  34.122.143.82
  34.122.17.53
  34.122.32.203
  34.122.64.205
-34.122.90.156
  34.123.129.183
  34.123.157.13
  34.123.204.180
@@ -101666,6 +103160,7 @@
  34.125.218.167
  34.125.250.245
  34.125.45.103
+34.125.46.3
  34.125.47.186
  34.125.61.169
  34.125.67.59
@@ -101694,7 +103189,6 @@
  34.194.51.115
  34.195.157.48
  34.195.230.31
-34.195.55.159
  34.195.96.196
  34.196.116.222
  34.196.237.214
@@ -101736,7 +103230,6 @@
  34.205.32.116
  34.205.37.23
  34.205.92.115
-34.205.97.11
  34.206.155.80
  34.206.190.120
  34.206.33.115
@@ -101828,7 +103321,6 @@
  34.213.65.251
  34.213.80.109
  34.213.87.252
-34.213.88.137
  34.213.89.55
  34.214.100.194
  34.214.113.77
@@ -101862,7 +103354,6 @@
  34.216.202.234
  34.216.213.160
  34.216.77.71
-34.216.89.174
  34.216.96.76
  34.216.99.118
  34.217.128.86
@@ -102018,7 +103509,6 @@
  34.238.153.76
  34.238.174.178
  34.238.193.141
-34.238.193.68
  34.238.39.172
  34.238.58.137
  34.239.0.159
@@ -102133,6 +103623,7 @@
  34.64.137.48
  34.64.144.84
  34.64.145.134
+34.64.149.89
  34.64.150.100
  34.64.151.153
  34.64.208.196
@@ -102158,11 +103649,11 @@
  34.65.36.169
  34.65.53.140
  34.65.68.114
+34.65.71.81
  34.65.73.240
  34.66.208.65
  34.66.64.18
  34.66.68.160
-34.66.7.119
  34.66.92.210
  34.67.175.232
  34.67.224.244
@@ -102180,6 +103671,7 @@
  34.69.104.28
  34.69.205.232
  34.69.250.177
+34.69.253.72
  34.69.50.91
  34.69.69.205
  34.69.91.207
@@ -102201,8 +103693,6 @@
  34.71.206.168
  34.71.210.159
  34.71.41.157
-34.71.69.147
-34.72.10.216
  34.72.156.130
  34.72.157.28
  34.72.163.246
@@ -102214,14 +103704,11 @@
  34.73.10.30
  34.73.101.96
  34.73.136.216
-34.73.222.92
  34.73.237.110
-34.73.24.17
+34.73.68.227
  34.73.71.43
-34.73.81.215
  34.74.178.229
  34.74.178.245
-34.74.234.2
  34.74.252.206
  34.74.26.21
  34.74.46.5
@@ -102231,9 +103718,9 @@
  34.75.169.188
  34.75.201.170
  34.75.240.129
+34.75.54.59
  34.75.65.247
  34.76.203.45
-34.77.39.221
  34.77.55.50
  34.77.93.233
  34.78.103.223
@@ -102242,6 +103729,7 @@
  34.78.180.55
  34.78.38.251
  34.78.48.104
+34.78.97.138
  34.80.1.221
  34.80.125.230
  34.80.133.240
@@ -102261,6 +103749,7 @@
  34.80.90.118
  34.80.98.101
  34.82.103.75
+34.82.117.252
  34.82.128.79
  34.82.137.228
  34.82.170.246
@@ -102337,6 +103826,7 @@
  34.87.242.193
  34.87.251.211
  34.87.251.72
+34.87.252.166
  34.87.40.17
  34.87.47.113
  34.87.53.100
@@ -102350,11 +103840,12 @@
  34.89.113.184
  34.89.12.239
  34.89.120.156
+34.89.138.120
  34.89.151.167
-34.89.198.213
  34.89.199.188
  34.89.202.206
  34.89.228.34
+34.89.40.82
  34.89.57.152
  34.89.78.76
  34.89.86.67
@@ -102364,23 +103855,26 @@
  34.90.201.229
  34.90.25.58
  34.90.45.51
+34.90.70.223
  34.91.114.225
  34.91.117.125
  34.91.127.26
  34.91.140.191
  34.91.188.86
+34.91.190.158
  34.91.195.229
  34.91.215.174
  34.91.252.56
  34.91.41.138
  34.91.56.46
-34.91.70.150
  34.91.80.81
  34.92.112.22
+34.92.120.64
  34.92.136.198
  34.92.14.203
  34.92.147.105
  34.92.164.48
+34.92.165.218
  34.92.202.36
  34.92.208.17
  34.92.211.84
@@ -102388,13 +103882,15 @@
  34.92.219.178
  34.92.220.58
  34.92.222.132
+34.92.235.236
  34.92.247.201
  34.92.250.26
  34.92.29.1
  34.92.29.25
  34.92.33.114
+34.92.40.26
+34.92.44.231
  34.92.56.106
-34.92.58.73
  34.92.64.66
  34.92.87.60
  34.92.95.72
@@ -102423,6 +103919,7 @@
  34.94.30.169
  34.94.79.33
  34.94.90.131
+34.94.90.206
  34.94.93.161
  34.95.0.69
  34.95.136.147
@@ -102433,11 +103930,10 @@
  34.95.165.1
  34.95.167.94
  34.95.17.184
-34.95.183.86
  34.95.222.68
-34.95.224.146
-34.95.252.78
+34.95.223.61
  34.95.254.204
+34.95.29.216
  34.95.29.237
  34.95.32.196
  34.95.39.53
@@ -102446,7 +103942,6 @@
  34.95.50.131
  34.96.107.204
  34.96.134.60
-34.96.145.46
  34.96.160.228
  34.96.170.247
  34.96.182.63
@@ -102457,6 +103952,7 @@
  34.97.114.213
  34.97.123.203
  34.97.13.87
+34.97.134.215
  34.97.142.205
  34.97.148.44
  34.97.176.217
@@ -102504,13 +104000,12 @@
  35-23-4532-34.com
  35-40konkatsu.net
  35.0.127.52
-35.129.242.115
  35.130.112.58
  35.130.122.122
  35.131.161.166
-35.134.241.168
  35.136.181.118
  35.137.236.32
+35.141.183.100
  35.141.98.170
  35.142.170.32
  35.142.195.99
@@ -102523,6 +104018,7 @@
  35.153.182.233
  35.153.203.202
  35.153.54.53
+35.153.67.22
  35.153.87.161
  35.154.183.151
  35.154.188.207
@@ -102564,9 +104060,7 @@
  35.158.109.213
  35.158.169.39
  35.158.185.217
-35.158.214.255
  35.158.226.16
-35.158.227.216
  35.158.237.165
  35.158.249.148
  35.158.42.168
@@ -102617,6 +104111,7 @@
  35.163.36.246
  35.163.48.30
  35.163.8.39
+35.163.90.198
  35.164.128.161
  35.164.151.193
  35.164.16.145
@@ -102683,7 +104178,6 @@
  35.171.2.177
  35.171.84.56
  35.172.12.3
-35.172.136.68
  35.172.14.232
  35.172.15.43
  35.172.186.20
@@ -102826,6 +104320,7 @@
  35.182.91.192
  35.182.94.224
  35.182.99.109
+35.183.103.87
  35.183.104.1
  35.183.106.99
  35.183.110.122
@@ -102867,6 +104362,7 @@
  35.184.77.189
  35.184.83.249
  35.184.84.4
+35.184.88.36
  35.185.101.193
  35.185.11.70
  35.185.180.184
@@ -102896,7 +104392,6 @@
  35.187.237.57
  35.187.242.8
  35.187.243.26
-35.187.248.74
  35.187.254.230
  35.187.3.215
  35.187.46.198
@@ -103014,7 +104509,6 @@
  35.196.37.206
  35.196.70.139
  35.196.89.175
-35.196.96.221
  35.197.1.84
  35.197.124.137
  35.197.132.142
@@ -103035,15 +104529,14 @@
  35.198.155.181
  35.198.162.31
  35.198.174.203
+35.198.184.160
  35.198.195.26
  35.198.203.184
-35.198.204.244
  35.198.224.144
  35.198.228.240
  35.198.231.35
  35.198.245.58
  35.198.246.84
-35.198.255.208
  35.198.48.176
  35.198.49.11
  35.198.76.76
@@ -103085,7 +104578,6 @@
  35.200.77.30
  35.200.95.220
  35.200.97.57
-35.201.121.112
  35.201.13.82
  35.201.153.139
  35.201.177.100
@@ -103099,7 +104591,6 @@
  35.202.152.16
  35.202.163.161
  35.202.164.171
-35.202.166.52
  35.202.188.178
  35.202.198.13
  35.202.200.129
@@ -103137,6 +104628,8 @@
  35.204.2.48
  35.204.228.98
  35.204.31.217
+35.204.32.152
+35.204.32.209
  35.204.73.210
  35.204.91.115
  35.205.16.98
@@ -103144,35 +104637,18 @@
  35.205.83.203
  35.206.125.120
  35.207.1.8
-35.207.22.185
  35.207.65.42
  35.207.8.221
  35.207.9.24
  35.208.14.82
  35.208.164.242
-35.208.78.118
  35.209.158.181
-35.209.182.232
  35.209.209.15
  35.209.51.212
  35.209.9.189
-35.210.149.251
-35.211.156.249
  35.211.2.103
  35.211.51.221
-35.211.60.241
-35.211.77.207
-35.212.128.88
-35.212.163.36
-35.212.168.144
-35.212.233.154
-35.212.237.223
-35.212.237.228
  35.213.18.190
-35.214.200.218
-35.214.236.51
-35.214.253.143
-35.215.2.174
  35.215.234.224
  35.220.138.138
  35.220.144.111
@@ -103181,10 +104657,12 @@
  35.220.168.151
  35.220.179.119
  35.220.179.171
+35.220.182.45
  35.220.199.212
  35.220.209.206
  35.220.212.29
  35.220.221.203
+35.220.224.164
  35.220.253.166
  35.220.253.31
  35.221.114.222
@@ -103211,6 +104689,7 @@
  35.223.249.176
  35.223.255.227
  35.224.1.26
+35.224.1.87
  35.224.107.234
  35.224.132.48
  35.224.144.160
@@ -103218,7 +104697,6 @@
  35.224.161.45
  35.224.193.51
  35.224.196.254
-35.224.216.78
  35.224.221.202
  35.224.236.133
  35.224.248.68
@@ -103256,6 +104734,7 @@
  35.227.64.238
  35.227.77.27
  35.228.104.105
+35.228.132.48
  35.228.135.238
  35.228.171.144
  35.228.173.101
@@ -103266,7 +104745,6 @@
  35.228.210.96
  35.228.212.136
  35.228.236.15
-35.228.237.149
  35.228.238.236
  35.228.239.128
  35.228.24.69
@@ -103314,11 +104792,11 @@
  35.231.211.161
  35.231.217.24
  35.231.223.140
-35.231.62.74
  35.231.88.244
  35.231.89.204
  35.232.112.59
  35.232.138.65
+35.232.145.68
  35.232.205.107
  35.232.213.202
  35.232.22.47
@@ -103340,6 +104818,7 @@
  35.235.107.110
  35.235.115.241
  35.235.127.27
+35.235.78.175
  35.235.84.44
  35.235.89.230
  35.235.96.109
@@ -103427,8 +104906,10 @@
  35.244.25.124
  35.244.33.53
  35.244.67.121
+35.244.9.182
  35.244.92.76
  35.245.113.177
+35.245.143.50
  35.245.148.20
  35.245.173.118
  35.245.186.117
@@ -103456,7 +104937,6 @@
  35.246.98.61
  35.247.128.200
  35.247.147.161
-35.247.150.59
  35.247.153.74
  35.247.153.80
  35.247.154.79
@@ -103490,13 +104970,13 @@
  35tolaeaia7.visualizarfatura.me
  35y.2c8.myftpupload.com
  36.100.112.205
-36.102.208.154
  36.103.222.114
  36.103.222.42
  36.103.222.9
  36.103.223.21
  36.103.223.40
  36.103.226.156
+36.103.231.0
  36.103.241.148
  36.104.145.203
  36.105.15.120
@@ -103504,7 +104984,6 @@
  36.105.56.188
  36.105.57.50
  36.107.137.193
-36.107.211.112
  36.107.232.206
  36.107.233.232
  36.107.235.83
@@ -103524,13 +105003,12 @@
  36.110.182.30
  36.110.197.131
  36.110.197.202
+36.110.202.107
  36.110.217.140
-36.110.217.225
  36.110.218.194
  36.110.228.254
  36.110.231.213
  36.110.239.4
-36.110.26.43
  36.110.27.122
  36.110.29.74
  36.110.3.51
@@ -103593,31 +105071,25 @@
  36.133.131.165
  36.133.136.239
  36.133.138.125
-36.133.179.103
+36.133.139.183
  36.133.193.13
-36.133.195.176
  36.133.198.58
  36.133.2.177
  36.133.20.64
  36.133.28.151
  36.133.35.254
  36.133.38.134
-36.133.38.172
  36.133.39.73
  36.133.40.103
  36.133.40.2
  36.133.40.45
  36.133.45.95
+36.133.5.142
  36.133.5.157
  36.133.5.228
  36.133.54.123
  36.133.62.154
-36.133.74.141
-36.133.84.2
  36.133.97.79
-36.133.97.82
-36.134.27.32
-36.134.54.40
  36.134.69.10
  36.134.69.12
  36.134.69.253
@@ -103667,22 +105139,21 @@
  36.156.153.112
  36.156.154.154
  36.156.66.147
+36.157.142.30
  36.158.206.218
  36.158.206.230
  36.159.106.69
  36.170.52.254
  36.184.19.245
  36.189.253.226
-36.22.109.99
  36.22.178.114
  36.22.187.34
-36.22.196.55
-36.22.199.38
+36.22.221.165
  36.22.232.59
  36.224.85.173
+36.225.220.246
  36.225.42.85
  36.225.45.226
-36.226.118.200
  36.226.176.120
  36.226.249.210
  36.226.253.94
@@ -103700,7 +105171,6 @@
  36.228.56.237
  36.229.113.162
  36.229.113.242
-36.229.115.182
  36.229.162.230
  36.229.187.46
  36.229.197.25
@@ -103710,25 +105180,24 @@
  36.230.145.39
  36.230.149.140
  36.230.164.55
-36.230.247.206
  36.230.56.242
  36.230.84.133
  36.230.92.253
  36.231.151.47
  36.231.193.64
+36.231.198.221
  36.231.20.181
  36.231.201.150
  36.231.23.206
  36.231.69.25
  36.231.74.252
  36.231.95.42
-36.232.124.57
+36.232.172.66
  36.232.199.8
  36.232.203.238
  36.232.50.101
  36.232.97.172
  36.233.172.72
-36.233.214.173
  36.233.232.196
  36.233.62.198
  36.233.63.175
@@ -103741,6 +105210,7 @@
  36.235.208.141
  36.235.38.144
  36.235.40.196
+36.235.42.188
  36.235.57.74
  36.236.15.137
  36.236.156.204
@@ -103753,8 +105223,8 @@
  36.237.16.164
  36.237.6.228
  36.237.70.61
-36.237.81.191
  36.238.102.54
+36.238.117.75
  36.238.36.157
  36.238.39.219
  36.238.52.189
@@ -103772,7 +105242,6 @@
  36.239.75.105
  36.239.75.229
  36.239.76.12
-36.239.79.158
  36.239.80.123
  36.239.81.168
  36.239.84.246
@@ -103785,6 +105254,7 @@
  36.248.153.3
  36.248.162.91
  36.248.164.231
+36.248.169.137
  36.248.169.146
  36.248.169.181
  36.248.170.140
@@ -103795,21 +105265,15 @@
  36.248.182.87
  36.248.188.26
  36.248.244.67
-36.249.162.68
  36.249.162.89
-36.25.120.227
  36.25.212.144
  36.25.213.156
  36.25.214.153
  36.25.214.3
  36.25.228.115
-36.25.24.65
  36.25.243.251
  36.25.243.51
-36.25.25.216
-36.25.26.55
  36.25.27.170
-36.25.58.3
  36.250.174.98
  36.250.175.14
  36.250.175.148
@@ -103830,7 +105294,6 @@
  36.251.68.194
  36.251.88.191
  36.251.92.189
-36.251.94.36
  36.251.95.85
  36.251.98.186
  36.255.104.1
@@ -103841,7 +105304,6 @@
  36.255.156.78
  36.255.211.1
  36.255.220.2
-36.255.248.132
  36.255.248.218
  36.255.61.190
  36.255.61.26
@@ -103870,13 +105332,14 @@
  36.26.84.45
  36.26.87.107
  36.27.109.238
-36.27.143.164
+36.27.131.156
  36.27.208.157
  36.27.209.188
  36.27.33.168
  36.27.33.216
  36.32.110.7
  36.32.160.78
+36.32.173.14
  36.32.193.154
  36.32.193.213
  36.32.195.179
@@ -103886,15 +105349,13 @@
  36.32.71.33
  36.32.88.251
  36.32.90.247
-36.33.124.242
  36.33.132.206
  36.33.138.140
+36.33.139.113
  36.33.140.232
  36.33.140.248
-36.33.47.72
  36.34.15.70
  36.34.150.235
-36.34.22.117
  36.35.155.92
  36.35.160.188
  36.35.160.240
@@ -103903,7 +105364,6 @@
  36.35.161.156
  36.35.161.7
  36.35.164.52
-36.35.168.247
  36.35.240.233
  36.36.243.67
  36.37.104.98
@@ -103923,6 +105383,7 @@
  36.37.155.163
  36.37.157.250
  36.37.175.123
+36.37.177.186
  36.37.180.59
  36.37.183.214
  36.37.201.133
@@ -103936,14 +105397,15 @@
  36.39.161.23
  36.39.18.226
  36.39.68.34
-36.4.250.103
  36.42.38.129
  36.43.65.41
  36.44.16.122
+36.45.176.210
  36.45.177.213
  36.45.179.160
  36.45.183.24
  36.46.135.38
+36.46.172.75
  36.46.173.10
  36.46.173.199
  36.46.173.3
@@ -103955,8 +105417,8 @@
  36.55.230.146
  36.6.140.18
  36.6.158.226
-36.6.159.192
  36.62.238.137
+36.62.238.74
  36.62.239.105
  36.65.125.234
  36.65.127.156
@@ -103998,6 +105460,7 @@
  36.66.36.251
  36.66.36.252
  36.66.40.13
+36.66.43.65
  36.66.48.187
  36.66.53.191
  36.66.61.119
@@ -104009,12 +105472,13 @@
  36.66.98.236
  36.66.98.237
  36.66.98.6
-36.67.106.58
  36.67.109.165
  36.67.11.41
  36.67.112.11
  36.67.119.34
+36.67.123.239
  36.67.128.145
+36.67.142.133
  36.67.143.21
  36.67.153.58
  36.67.158.49
@@ -104050,7 +105514,6 @@
  36.67.27.189
  36.67.27.205
  36.67.27.211
-36.67.32.45
  36.67.38.135
  36.67.38.25
  36.67.51.186
@@ -104078,11 +105541,13 @@
  36.68.100.181
  36.68.123.208
  36.68.149.240
+36.68.20.213
  36.68.20.75
  36.68.40.53
  36.68.63.166
+36.68.9.211
  36.69.229.204
-36.69.86.26
+36.69.92.48
  36.7.107.157
  36.7.111.4
  36.7.111.8
@@ -104114,21 +105579,18 @@
  36.71.137.52
  36.71.140.15
  36.71.140.9
+36.71.141.139
  36.71.212.80
-36.71.233.190
  36.71.235.183
  36.71.56.112
-36.71.74.139
  36.72.105.232
  36.72.139.108
  36.72.14.69
  36.72.217.109
-36.72.218.19
  36.72.236.35
  36.72.36.80
  36.72.57.115
  36.72.85.127
-36.73.160.159
  36.73.22.199
  36.73.30.43
  36.73.32.212
@@ -104137,32 +105599,26 @@
  36.74.144.83
  36.74.148.66
  36.74.188.7
-36.74.201.72
  36.74.218.133
  36.74.27.23
-36.74.35.183
  36.74.54.226
  36.74.75.31
+36.74.98.72
  36.75.146.233
  36.75.185.209
  36.75.212.60
  36.75.238.53
-36.75.64.158
  36.75.64.211
  36.75.66.55
  36.76.89.130
  36.77.131.141
  36.77.235.101
-36.77.26.233
  36.77.45.165
+36.77.48.5
  36.78.140.51
-36.78.205.156
  36.78.210.176
  36.78.248.42
  36.79.20.187
-36.79.249.214
-36.79.249.61
-36.79.32.137
  36.79.70.247
  36.80.100.96
  36.80.109.12
@@ -104171,29 +105627,29 @@
  36.81.103.149
  36.81.15.243
  36.81.203.211
+36.81.227.77
  36.81.255.22
  36.82.106.238
+36.82.13.203
  36.82.142.193
  36.82.144.35
  36.82.17.39
  36.82.83.202
  36.82.91.160
-36.82.94.176
  36.83.237.106
  36.83.68.209
  36.83.87.24
  36.84.100.162
  36.84.100.165
  36.84.100.210
-36.84.135.207
  36.84.136.134
  36.84.237.175
  36.84.59.53
  36.84.80.31
  36.85.214.134
  36.85.222.129
-36.85.222.239
  36.85.222.34
+36.85.32.194
  36.85.36.133
  36.85.46.83
  36.85.91.95
@@ -104226,11 +105682,11 @@
  36.89.180.29
  36.89.181.103
  36.89.181.85
-36.89.182.193
  36.89.182.225
  36.89.182.3
  36.89.182.85
  36.89.183.209
+36.89.183.241
  36.89.183.253
  36.89.183.77
  36.89.187.193
@@ -104263,6 +105719,7 @@
  36.89.251.105
  36.89.27.235
  36.89.27.253
+36.89.29.75
  36.89.32.227
  36.89.41.113
  36.89.51.25
@@ -104284,6 +105741,7 @@
  36.90.122.146
  36.90.123.171
  36.90.123.173
+36.90.123.247
  36.90.13.52
  36.90.169.123
  36.90.17.218
@@ -104292,10 +105750,12 @@
  36.90.173.169
  36.90.173.7
  36.90.179.74
+36.90.184.173
  36.90.19.87
  36.90.237.251
  36.90.254.91
-36.90.41.242
+36.90.27.225
+36.90.38.105
  36.90.43.218
  36.90.43.227
  36.90.43.75
@@ -104306,16 +105766,13 @@
  36.90.51.96
  36.90.53.204
  36.90.53.226
-36.90.54.144
  36.90.54.48
  36.90.55.159
  36.90.58.66
  36.90.59.81
  36.90.61.127
  36.90.61.23
-36.90.61.238
  36.90.61.32
-36.90.62.212
  36.90.62.226
  36.90.62.52
  36.90.63.177
@@ -104373,7 +105830,6 @@
  36.92.9.75
  36.92.93.139
  36.92.93.61
-36.92.98.57
  36.94.119.139
  36.94.12.210
  36.94.130.176
@@ -104381,8 +105837,8 @@
  36.94.142.140
  36.94.145.21
  36.94.149.167
+36.94.161.163
  36.94.176.171
-36.94.20.190
  36.94.200.135
  36.94.23.91
  36.94.33.62
@@ -104403,9 +105859,7 @@
  36.97.143.123
  36.99.143.10
  36.99.160.161
-36.99.161.193
  36.99.175.246
-36.99.35.61
  36.99.40.139
  36.99.41.29
  36.99.44.70
@@ -104676,12 +106130,14 @@
  37-72-175-173.static.hvvc.us
  37.1.196.156
  37.1.200.82
+37.1.208.168
  37.1.216.172
  37.1.222.169
  37.10.127.82
  37.104.108.157
  37.104.112.176
  37.104.127.212
+37.104.217.16
  37.105.239.64
  37.106.122.158
  37.106.28.200
@@ -104691,14 +106147,13 @@
  37.11.46.126
  37.110.66.21
  37.111.42.210
+37.112.106.183
  37.112.227.224
  37.112.41.224
-37.112.47.170
  37.112.60.154
  37.113.131.22
  37.113.187.152
  37.113.47.145
-37.113.65.235
  37.114.149.20
  37.114.60.198
  37.114.61.73
@@ -104723,16 +106178,15 @@
  37.117.194.81
  37.117.194.95
  37.119.125.217
+37.119.168.43
  37.119.171.244
  37.119.250.113
  37.119.252.159
  37.119.55.0
  37.120.138.85
-37.120.138.86
  37.120.140.134
  37.120.142.77
  37.120.143.152
-37.120.145.163
  37.120.146.26
  37.120.148.78
  37.120.152.109
@@ -104742,7 +106196,6 @@
  37.120.192.154
  37.120.198.253
  37.120.202.53
-37.120.202.6
  37.120.203.131
  37.120.203.73
  37.120.205.186
@@ -104768,15 +106221,13 @@
  37.128.107.98
  37.128.174.35
  37.128.181.25
-37.129.170.65
-37.129.55.67
  37.130.176.186
  37.130.227.133
  37.130.38.21
  37.130.91.125
  37.131.164.102
-37.131.164.103
  37.131.164.124
+37.131.164.48
  37.131.164.93
  37.131.165.19
  37.131.166.251
@@ -104785,9 +106236,7 @@
  37.134.200.239
  37.134.238.244
  37.136.8.199
-37.138.182.74
  37.138.209.75
-37.138.213.129
  37.138.53.71
  37.139.0.44
  37.139.1.197
@@ -104830,7 +106279,7 @@
  37.139.85.66
  37.14.141.51
  37.142.120.186
-37.142.180.53
+37.142.125.247
  37.142.207.244
  37.142.41.226
  37.143.116.43
@@ -104844,54 +106293,21 @@
  37.145.74.29
  37.146.188.143
  37.146.72.75
+37.147.157.252
  37.147.167.101
  37.147.40.139
-37.148.109.162
  37.148.209.168
  37.148.211.78
+37.15.209.10
  37.15.209.163
-37.150.1.101
-37.150.1.11
-37.150.1.162
-37.150.1.215
-37.150.1.234
-37.150.10.46
-37.150.103.16
-37.150.108.164
-37.150.190.31
-37.150.202.10
-37.150.218.212
-37.150.218.216
-37.150.3.232
-37.150.5.184
-37.150.5.211
-37.150.53.68
-37.150.57.160
  37.150.58.77
-37.150.72.69
  37.150.75.124
-37.150.9.227
-37.151.121.77
-37.151.130.238
-37.151.137.22
-37.151.14.160
-37.151.155.221
-37.151.155.89
-37.151.16.58
  37.151.167.137
  37.151.177.79
-37.151.183.86
-37.151.208.133
-37.151.214.138
-37.151.23.74
-37.151.237.51
-37.151.249.32
-37.151.53.2
-37.151.61.148
-37.151.69.157
  37.152.163.35
  37.152.176.65
  37.152.176.9
+37.152.182.65
  37.152.185.214
  37.152.187.44
  37.153.138.206
@@ -104911,21 +106327,17 @@
  37.157.40.4
  37.157.75.3
  37.159.0.144
+37.159.10.150
  37.159.18.253
  37.159.208.218
-37.159.24.224
  37.159.78.37
  37.17.12.32
-37.17.12.33
  37.17.16.61
  37.17.168.163
  37.17.169.80
  37.17.172.122
  37.17.182.22
  37.17.182.24
-37.17.182.71
-37.17.183.190
-37.17.38.196
  37.17.56.44
  37.17.9.140
  37.17.9.28
@@ -104940,6 +106352,7 @@
  37.182.189.61
  37.182.29.152
  37.182.79.164
+37.183.148.102
  37.183.188.131
  37.183.194.157
  37.183.195.125
@@ -104976,6 +106389,7 @@
  37.187.119.17
  37.187.12.100
  37.187.12.126
+37.187.121.214
  37.187.121.67
  37.187.122.154
  37.187.122.82
@@ -105002,7 +106416,6 @@
  37.187.154.33
  37.187.159.92
  37.187.16.30
-37.187.161.206
  37.187.162.238
  37.187.167.55
  37.187.174.201
@@ -105066,11 +106479,9 @@
  37.191.189.43
  37.191.193.230
  37.191.197.157
-37.191.198.52
  37.191.234.177
  37.191.239.25
-37.191.240.62
-37.192.133.108
+37.191.243.119
  37.192.194.50
  37.192.20.22
  37.193.123.110
@@ -105088,6 +106499,7 @@
  37.194.29.155
  37.195.209.169
  37.196.26.48
+37.20.159.45
  37.200.77.123
  37.201.116.60
  37.201.139.174
@@ -105103,8 +106515,8 @@
  37.202.97.186
  37.202.99.207
  37.203.236.29
-37.204.108.240
  37.204.11.167
+37.204.63.103
  37.205.12.100
  37.205.14.137
  37.205.8.78
@@ -105117,7 +106529,7 @@
  37.208.44.172
  37.208.67.207
  37.209.12.197
-37.21.78.200
+37.21.98.28
  37.210.43.114
  37.210.89.144
  37.211.186.233
@@ -105126,32 +106538,22 @@
  37.211.7.90
  37.211.79.233
  37.212.138.205
-37.212.181.54
  37.212.182.90
-37.212.201.243
-37.212.220.199
  37.212.224.179
  37.212.252.97
  37.212.41.233
  37.212.8.236
  37.212.82.130
-37.212.82.88
-37.212.89.78
-37.212.92.103
  37.213.123.47
  37.213.229.124
  37.214.181.208
-37.214.48.183
  37.214.67.130
-37.215.167.228
  37.215.189.209
  37.215.254.39
  37.215.9.127
  37.218.191.190
-37.218.242.209
  37.218.245.25
  37.220.109.238
-37.220.195.14
  37.220.22.106
  37.220.22.131
  37.220.31.119
@@ -105167,80 +106569,71 @@
  37.220.35.36
  37.220.36.240
  37.221.163.218
-37.221.178.101
-37.221.178.155
+37.221.178.105
+37.221.178.107
+37.221.178.203
  37.221.178.206
  37.221.178.234
  37.221.178.237
-37.221.178.238
-37.221.178.47
+37.221.178.52
  37.221.178.79
-37.221.178.83
-37.221.178.92
  37.221.178.93
  37.221.178.95
-37.221.178.97
+37.221.179.101
  37.221.179.103
-37.221.179.104
  37.221.179.108
-37.221.179.132
+37.221.179.122
+37.221.179.15
  37.221.179.151
-37.221.179.154
+37.221.179.159
+37.221.179.16
+37.221.179.165
  37.221.179.173
+37.221.179.185
  37.221.179.21
  37.221.179.241
-37.221.179.245
-37.221.179.38
-37.221.179.52
  37.221.179.63
-37.221.181.50
-37.221.181.54
-37.221.181.69
-37.221.181.94
-37.221.182.10
+37.221.181.55
+37.221.182.182
  37.221.182.191
-37.221.182.229
-37.221.182.5
+37.221.182.210
+37.221.182.236
  37.221.183.10
  37.221.183.122
  37.221.183.14
-37.221.183.173
+37.221.183.145
  37.221.183.200
-37.221.183.33
-37.221.183.36
+37.221.183.26
+37.221.183.41
+37.221.183.46
  37.221.183.74
+37.221.183.77
  37.221.204.206
+37.221.209.159
  37.221.209.222
  37.221.214.24
-37.221.240.147
-37.221.249.202
-37.223.0.196
-37.223.157.190
+37.221.241.189
  37.224.115.7
  37.224.20.33
  37.224.51.251
+37.225.4.164
  37.228.129.2
  37.228.129.237
  37.228.129.5
  37.228.138.150
  37.228.139.68
-37.228.155.24
  37.228.241.125
  37.228.65.107
  37.228.68.27
-37.228.70.125
  37.228.70.151
  37.229.146.42
  37.229.236.134
  37.229.245.226
-37.23.186.97
  37.230.147.206
  37.230.169.69
  37.230.206.15
  37.230.99.119
  37.232.128.192
-37.232.137.166
-37.232.186.185
  37.232.34.201
  37.232.4.12
  37.232.98.103
@@ -105270,8 +106663,8 @@
  37.239.46.26
  37.24.128.100
  37.24.240.15
-37.242.2.36
  37.247.111.141
+37.247.111.29
  37.247.209.179
  37.25.65.132
  37.251.220.10
@@ -105299,7 +106692,6 @@
  37.252.8.185
  37.255.183.3
  37.255.209.94
-37.255.221.241
  37.255.229.136
  37.255.232.191
  37.255.239.168
@@ -105307,8 +106699,6 @@
  37.26.136.181
  37.26.136.224
  37.26.2.122
-37.26.30.178
-37.26.60.17
  37.26.63.195
  37.26.86.206
  37.26.87.11
@@ -105318,15 +106708,12 @@
  37.28.196.254
  37.28.233.167
  37.29.100.54
-37.29.106.202
+37.29.110.58
  37.29.116.46
-37.29.134.249
  37.29.35.190
  37.29.70.233
  37.29.81.19
  37.29.82.227
-37.30.49.10
-37.32.125.117
  37.32.125.145
  37.32.44.1
  37.33.0.63
@@ -105340,10 +106727,8 @@
  37.35.120.18
  37.36.220.154
  37.36.240.108
-37.37.131.14
  37.37.146.15
  37.4.227.227
-37.4.250.28
  37.44.137.205
  37.44.142.159
  37.44.252.16
@@ -105351,34 +106736,29 @@
  37.44.252.195
  37.44.252.86
  37.44.252.97
-37.44.253.13
+37.44.253.167
  37.44.254.103
-37.44.254.116
-37.44.254.173
-37.44.254.177
-37.44.254.187
-37.44.254.190
  37.44.254.223
-37.44.254.224
  37.44.254.23
  37.44.254.47
  37.44.254.64
  37.44.254.72
-37.44.255.116
+37.44.255.102
  37.44.255.121
-37.44.255.14
  37.44.255.155
-37.44.255.180
-37.44.255.21
-37.44.255.33
+37.44.255.250
  37.44.255.67
+37.44.47.2
  37.44.88.83
+37.45.114.86
  37.45.14.241
  37.45.29.27
  37.45.75.15
+37.45.80.212
  37.46.118.107
  37.46.129.215
  37.46.150.106
+37.46.150.115
  37.46.150.116
  37.46.150.136
  37.46.150.14
@@ -105388,20 +106768,22 @@
  37.46.150.17
  37.46.150.171
  37.46.150.177
-37.46.150.199
+37.46.150.203
  37.46.150.206
  37.46.150.207
  37.46.150.214
  37.46.150.235
  37.46.150.243
  37.46.150.30
+37.46.150.55
  37.46.150.75
  37.46.150.76
  37.46.150.86
  37.46.234.62
  37.46.242.114
  37.46.73.5
-37.47.175.149
+37.47.188.199
+37.47.56.55
  37.48.103.228
  37.48.105.203
  37.48.109.107
@@ -105413,6 +106795,7 @@
  37.48.84.223
  37.48.90.222
  37.48.94.6
+37.49.149.141
  37.49.217.229
  37.49.224.100
  37.49.224.101
@@ -105457,6 +106840,7 @@
  37.49.225.110
  37.49.225.115
  37.49.225.12
+37.49.225.123
  37.49.225.134
  37.49.225.140
  37.49.225.145
@@ -105464,21 +106848,20 @@
  37.49.225.152
  37.49.225.153
  37.49.225.154
-37.49.225.157
-37.49.225.159
  37.49.225.163
  37.49.225.164
  37.49.225.165
  37.49.225.166
-37.49.225.168
  37.49.225.170
+37.49.225.172
  37.49.225.183
  37.49.225.194
  37.49.225.196
+37.49.225.200
  37.49.225.201
+37.49.225.209
  37.49.225.223
  37.49.225.229
-37.49.225.23
  37.49.225.233
  37.49.225.245
  37.49.226.101
@@ -105533,6 +106916,7 @@
  37.49.226.99
  37.49.227.202
  37.49.229.140
+37.49.229.194
  37.49.229.52
  37.49.230.102
  37.49.230.103
@@ -105582,7 +106966,6 @@
  37.49.231.62
  37.49.98.229
  37.52.66.224
-37.53.42.252
  37.53.73.160
  37.53.8.255
  37.53.83.130
@@ -105593,8 +106976,10 @@
  37.55.141.180
  37.55.50.30
  37.57.0.198
+37.57.107.99
  37.57.119.90
  37.57.12.231
+37.57.130.244
  37.57.147.41
  37.57.15.43
  37.57.169.85
@@ -105657,11 +107042,9 @@
  37.59.50.81
  37.59.53.126
  37.59.53.135
-37.59.54.36
  37.59.55.128
  37.59.56.107
  37.59.56.124
-37.59.56.74
  37.59.57.96
  37.59.58.142
  37.59.58.8
@@ -105695,6 +107078,7 @@
  37.72.175.160
  37.72.175.206
  37.72.186.132
+37.72.186.35
  37.75.127.240
  37.75.81.120
  37.76.146.163
@@ -105710,10 +107094,13 @@
  37.79.131.229
  37.79.254.152
  37.79.4.242
+37.9.13.118
  37.9.13.119
  37.9.13.120
  37.9.13.83
  37.9.13.85
+37.9.13.92
+37.9.13.98
  37.9.134.133
  37.9.134.97
  37.9.168.167
@@ -105727,12 +107114,12 @@
  37.9.40.42
  37.9.41.122
  37.9.41.131
-37.9.41.188
  37.9.41.202
-37.9.44.250
+37.9.41.78
  37.9.44.253
  37.9.45.239
  37.9.46.181
+37.9.46.213
  37.9.46.29
  37.9.47.128
  37.9.53.123
@@ -105743,35 +107130,24 @@
  37.97.191.18
  37.97.249.17
  37.97.4.238
-37.98.154.50
  37.98.161.50
  37.98.196.42
  37.98.231.2
-37.99.109.14
-37.99.112.160
-37.99.115.218
-37.99.119.196
-37.99.119.206
-37.99.119.26
-37.99.120.180
  37.99.132.138
-37.99.16.73
  37.99.214.45
+37.99.250.217
  37.99.250.226
-37.99.250.235
  37.99.251.209
-37.99.251.226
-37.99.252.146
-37.99.252.237
-37.99.252.27
-37.99.252.67
+37.99.252.25
+37.99.253.180
  37.99.253.181
-37.99.253.219
+37.99.253.212
  37.99.253.84
+37.99.254.197
+37.99.255.108
  37.99.255.143
-37.99.255.42
-37.99.255.47
-37.99.255.82
+37.99.255.152
+37.99.255.255
  37.99.33.183
  37015.url.hen360.com
  370155612367591-dot-wetransfer-auth-file-341.appspot.com
@@ -105896,23 +107272,24 @@
  38.104.215.130
  38.105.198.51
  38.107.140.165
-38.108.81.53
  38.109.195.42
  38.111.114.148
  38.114.83.77
-38.121.85.37
+38.117.70.2
  38.122.16.146
  38.123.64.242
  38.124.1.228
  38.126.15.49
-38.126.254.114
  38.127.89.186
  38.130.220.61
  38.130.75.20
  38.130.75.38
  38.130.75.49
+38.131.27.32
+38.131.29.31
  38.131.31.156
  38.132.124.147
+38.132.132.182
  38.132.65.178
  38.132.99.145
  38.133.200.94
@@ -105941,6 +107318,9 @@
  38.68.47.61
  38.68.53.129
  38.69.48.2
+38.72.132.186
+38.72.132.194
+38.72.132.202
  38.73.238.138
  38.74.21.183
  38.75.38.144
@@ -105952,6 +107332,7 @@
  38.81.163.3
  38.83.103.66
  38.83.107.239
+38.86.94.12
  38.87.234.241
  38.87.234.242
  38.87.54.163
@@ -105962,6 +107343,7 @@
  38.89.136.200
  38.89.137.29
  38.89.142.148
+38.89.143.31
  38.89.150.26
  38.91.100.230
  38.91.100.28
@@ -105984,50 +107366,50 @@
  38963.xc.liaochuo.com
  38f1d44f1a954bd72362716c792b3cf7-dot-dbenitonline.ey.r.appspot.com
  38seventeen.com
-39.100.107.150
  39.100.112.86
-39.100.149.197
+39.100.142.87
  39.100.153.223
  39.100.216.1
  39.100.230.115
  39.100.28.147
-39.100.33.222
  39.100.36.150
-39.100.53.205
  39.100.65.211
  39.101.136.226
+39.101.192.128
  39.101.206.20
  39.101.207.41
+39.101.209.57
  39.102.38.27
  39.103.139.6
-39.104.107.206
+39.103.175.42
  39.104.118.116
  39.104.14.142
+39.104.14.232
+39.104.170.120
  39.104.66.185
  39.104.77.51
  39.104.82.5
  39.104.88.227
+39.104.98.130
  39.105.121.125
  39.105.125.122
  39.105.129.219
  39.105.136.217
  39.105.149.234
  39.105.166.115
-39.105.175.153
  39.105.187.245
-39.105.19.239
  39.105.45.201
  39.105.46.101
  39.105.64.68
  39.105.75.253
  39.105.80.23
  39.105.85.40
-39.105.97.108
  39.106.117.121
  39.106.118.147
  39.106.13.134
  39.106.14.65
  39.106.150.224
+39.106.160.255
  39.106.171.1
  39.106.19.133
  39.106.220.238
@@ -106048,13 +107430,12 @@
  39.107.236.42
  39.107.246.103
  39.107.69.172
-39.107.90.123
-39.107.95.197
  39.108.104.226
  39.108.123.4
  39.108.141.158
  39.108.165.16
  39.108.167.47
+39.108.224.94
  39.108.3.76
  39.108.64.20
  39.108.68.237
@@ -106065,6 +107446,7 @@
  39.109.122.156
  39.109.126.127
  39.109.126.162
+39.109.126.50
  39.109.127.81
  39.109.129.100
  39.109.13.130
@@ -106091,6 +107473,7 @@
  39.113.100.56
  39.113.245.254
  39.114.141.64
+39.114.174.151
  39.115.133.87
  39.118.131.43
  39.119.127.117
@@ -106110,19 +107493,19 @@
  39.137.107.98
  39.137.69.10
  39.137.69.7
+39.149.80.44
  39.149.83.155
  39.152.112.110
  39.152.129.237
  39.152.133.169
+39.152.133.197
  39.152.133.8
  39.152.16.22
  39.152.164.48
  39.152.192.73
  39.152.193.62
  39.152.20.153
-39.152.207.144
  39.152.207.145
-39.152.207.149
  39.152.207.86
  39.152.36.254
  39.152.37.88
@@ -106134,16 +107517,15 @@
  39.153.157.63
  39.153.246.234
  39.153.252.196
-39.155.134.147
  39.155.169.2
  39.155.195.1
  39.155.214.66
+39.155.214.74
  39.155.215.182
  39.155.215.69
  39.155.215.82
  39.155.215.86
  39.155.215.90
-39.155.215.94
  39.155.244.81
  39.155.255.94
  39.164.112.139
@@ -106155,41 +107537,25 @@
  39.164.99.60
  39.165.66.10
  39.170.27.26
-39.170.40.119
+39.170.41.102
  39.175.91.135
  39.175.92.86
+39.181.224.219
  39.183.132.49
  39.184.147.57
  39.184.152.56
  39.184.153.196
+39.184.156.105
  39.186.201.132
  39.186.201.147
  39.186.201.149
  39.187.69.92
-39.32.148.1
-39.32.149.209
-39.32.156.50
-39.33.16.215
-39.33.82.140
-39.33.91.249
+39.32.120.243
  39.34.243.222
  39.36.169.113
  39.36.195.178
-39.37.134.237
-39.37.157.89
-39.40.45.56
-39.40.55.235
-39.40.79.239
-39.40.97.135
-39.41.149.195
-39.43.35.63
-39.43.91.244
-39.44.105.20
-39.44.134.57
  39.44.183.128
  39.44.198.203
-39.44.20.97
-39.44.37.70
  39.44.41.104
  39.45.130.238
  39.45.140.189
@@ -106204,31 +107570,24 @@
  39.46.49.207
  39.46.72.200
  39.46.86.141
-39.46.90.2
-39.48.33.16
-39.49.15.147
-39.49.2.216
-39.50.16.22
-39.50.36.133
  39.50.97.132
-39.52.157.241
-39.52.173.9
-39.52.206.146
+39.53.202.219
  39.59.88.141
-39.60.57.45
  39.61.48.219
-39.61.53.67
  39.62.180.125
  39.64.149.48
  39.64.228.72
  39.64.34.208
  39.64.36.1
  39.65.102.212
+39.65.102.31
+39.65.133.66
  39.65.163.29
  39.65.165.65
  39.65.170.117
  39.65.172.250
  39.65.176.130
+39.65.186.5
  39.65.19.112
  39.65.204.248
  39.65.213.41
@@ -106244,7 +107603,6 @@
  39.65.67.164
  39.65.68.117
  39.65.77.204
-39.66.122.35
  39.66.131.134
  39.66.134.239
  39.66.178.41
@@ -106258,25 +107616,25 @@
  39.67.199.5
  39.67.226.250
  39.67.238.73
-39.67.31.134
+39.67.61.141
  39.67.80.26
  39.67.80.64
  39.67.85.64
  39.68.11.133
-39.68.145.219
  39.68.154.55
  39.68.175.148
  39.68.24.144
  39.68.241.196
  39.68.37.250
-39.68.81.15
  39.69.1.94
  39.69.115.100
  39.69.56.119
  39.69.56.252
  39.69.59.233
+39.69.63.90
  39.70.150.181
  39.70.202.131
+39.71.105.54
  39.71.122.50
  39.71.132.44
  39.71.133.236
@@ -106287,11 +107645,11 @@
  39.72.140.249
  39.72.188.83
  39.72.191.45
-39.72.197.148
  39.72.239.117
  39.72.243.56
  39.72.72.50
  39.73.1.187
+39.73.111.8
  39.73.122.199
  39.73.123.173
  39.73.123.45
@@ -106313,12 +107671,11 @@
  39.73.239.5
  39.73.242.182
  39.73.243.234
-39.73.243.96
  39.73.251.50
  39.73.28.254
+39.73.28.81
  39.73.29.216
  39.73.46.26
-39.73.46.70
  39.73.47.132
  39.73.47.134
  39.73.61.233
@@ -106332,9 +107689,9 @@
  39.74.135.235
  39.74.135.89
  39.74.139.172
-39.74.139.238
  39.74.144.152
  39.74.146.147
+39.74.15.99
  39.74.152.139bin.sh
  39.74.153.25
  39.74.175.57
@@ -106343,6 +107700,7 @@
  39.74.182.189
  39.74.189.152
  39.74.189.177
+39.74.190.238
  39.74.198.19
  39.74.198.239
  39.74.20.114
@@ -106357,8 +107715,8 @@
  39.74.52.178
  39.74.58.203
  39.75.176.7
-39.75.48.43
  39.75.53.80
+39.75.54.5
  39.76.218.216
  39.76.223.79
  39.76.43.191
@@ -106385,6 +107743,7 @@
  39.78.92.243
  39.79.113.189
  39.79.114.146
+39.79.118.149
  39.79.122.48
  39.79.124.102
  39.79.137.77
@@ -106395,7 +107754,6 @@
  39.79.146.116
  39.79.147.75
  39.79.148.190
-39.79.148.250
  39.79.149.166
  39.79.178.77
  39.79.185.120
@@ -106405,7 +107763,6 @@
  39.79.217.51
  39.79.218.123
  39.79.220.21
-39.79.242.177
  39.79.34.245
  39.79.5.156
  39.79.65.231
@@ -106414,6 +107771,7 @@
  39.79.95.113
  39.80.115.109
  39.80.159.212
+39.80.159.253
  39.80.164.198
  39.80.191.223
  39.80.191.49
@@ -106429,9 +107787,9 @@
  39.81.139.3
  39.81.189.207
  39.81.238.18
+39.81.25.105
  39.81.25.141
  39.81.31.185
-39.81.50.61
  39.82.228.63
  39.82.8.36
  39.83.112.87
@@ -106447,10 +107805,11 @@
  39.84.83.126
  39.84.91.64
  39.85.1.167
+39.85.104.76
+39.85.110.206
  39.85.12.205
  39.85.13.129
  39.85.197.204
-39.85.250.246
  39.85.3.104
  39.85.64.200
  39.85.77.107
@@ -106458,8 +107817,7 @@
  39.85.92.197
  39.86.1.81
  39.86.152.130
-39.86.156.43
-39.86.174.36
+39.86.153.163
  39.86.185.117
  39.86.186.145
  39.86.2.64
@@ -106467,6 +107825,7 @@
  39.86.239.185
  39.86.249.146
  39.86.39.219
+39.86.61.213
  39.86.62.244
  39.86.63.244
  39.86.65.119
@@ -106479,13 +107838,11 @@
  39.86.83.30
  39.86.83.51
  39.87.116.99
-39.87.147.49
  39.87.148.45
  39.87.237.182
  39.87.60.188
  39.88.109.128
  39.88.119.249
-39.88.13.126
  39.88.133.23
  39.88.144.114
  39.88.159.244
@@ -106500,12 +107857,10 @@
  39.88.228.48
  39.88.230.51
  39.88.249.239
-39.88.53.48
  39.88.6.75
  39.88.67.184
  39.88.67.92
  39.88.92.58
-39.89.0.140
  39.89.103.52
  39.89.105.155
  39.89.111.164
@@ -106524,6 +107879,7 @@
  39.89.174.67
  39.89.194.231
  39.89.204.42
+39.89.210.201
  39.89.211.37
  39.89.23.22
  39.89.237.220
@@ -106536,6 +107892,7 @@
  39.90.152.43
  39.90.154.220
  39.90.159.54bin.sh
+39.90.182.106
  39.90.189.214
  39.90.235.254
  39.90.55.2
@@ -106544,9 +107901,8 @@
  39.96.175.55
  39.96.176.165
  39.96.202.234
-39.96.56.35
+39.96.21.106
  39.96.71.218
-39.96.82.217
  39.96.84.38
  39.97.107.254
  39.97.120.186
@@ -106557,9 +107913,9 @@
  39.97.96.76
  39.98.172.174
  39.98.192.41
-39.98.212.165
  39.98.213.227
  39.98.228.208
+39.98.244.128
  39.99.232.25
  39.99.237.209
  39.99.34.197
@@ -106783,7 +108139,6 @@
  4.17.231.207
  4.17.231.208
  4.17.85.253
-4.34.52.202
  4.4buyuklergazete.com
  4.53.178.206
  4.7.94.244
@@ -106799,10 +108154,11 @@
  40.112.215.222
  40.112.248.209
  40.112.54.44
-40.112.73.36
  40.112.89.205
+40.113.11.6
  40.113.112.127
  40.113.138.133
+40.113.19.176
  40.113.19.193
  40.113.206.182
  40.113.238.202
@@ -106813,9 +108169,10 @@
  40.114.116.10
  40.114.40.133
  40.114.43.252
-40.114.48.118
  40.114.65.171
  40.114.66.171
+40.114.72.208
+40.115.104.153
  40.115.106.183
  40.115.106.252
  40.115.112.87
@@ -106831,7 +108188,6 @@
  40.117.252.39
  40.117.253.222
  40.117.46.166
-40.117.75.152
  40.117.83.119
  40.117.89.111
  40.118.133.199
@@ -106879,16 +108235,20 @@
  40.124.2.145
  40.124.27.223
  40.124.29.187
+40.124.30.229
+40.124.45.237
  40.124.54.157
  40.125.215.96
  40.125.65.33
  40.127.109.254
+40.127.128.58
+40.127.133.234
  40.127.133.63
  40.127.139.82
  40.127.160.75
+40.127.166.39
  40.127.177.193
  40.131.87.38
-40.132.209.159
  40.132.242.226
  40.132.85.149
  40.66.34.149
@@ -106897,6 +108257,8 @@
  40.68.103.75
  40.68.255.214
  40.69.155.91
+40.69.2.55
+40.69.22.7
  40.69.71.114
  40.69.91.131
  40.69.96.123
@@ -106911,7 +108273,6 @@
  40.71.251.58
  40.71.36.235
  40.71.41.208
-40.71.87.18
  40.71.92.214
  40.72.105.23
  40.73.0.147
@@ -106927,15 +108288,14 @@
  40.73.67.85
  40.73.77.193
  40.74.112.227
-40.74.226.113
  40.74.231.133
  40.74.235.156
  40.74.249.57
  40.74.78.199
  40.74.80.66
  40.74.92.77
+40.75.69.234
  40.75.83.91
-40.75.84.101
  40.76.0.90
  40.76.114.230
  40.76.160.40
@@ -106945,7 +108305,6 @@
  40.76.229.112
  40.76.24.2
  40.76.244.210
-40.76.42.74
  40.76.44.230
  40.76.48.188
  40.76.5.111
@@ -107029,13 +108388,11 @@
  40.78.126.29
  40.78.19.149
  40.78.44.26
-40.78.67.135
  40.78.70.107
  40.78.83.99
-40.78.85.82
  40.79.253.153
  40.79.26.139
-40.79.37.53
+40.80.146.253
  40.81.205.83
  40.82.196.210
  40.82.197.91
@@ -107047,40 +108404,42 @@
  40.83.190.122
  40.83.73.187
  40.83.89.19
-40.84.133.212
  40.84.133.224
  40.84.139.252
  40.84.148.116
-40.84.156.1
  40.84.158.212
  40.84.225.234
+40.85.118.93
+40.85.121.252
  40.85.159.164
  40.85.162.35
  40.85.165.200
  40.85.188.123
  40.85.202.11
  40.85.205.219
-40.85.217.120
  40.85.221.22
  40.85.252.223
+40.85.89.196
+40.86.217.73
  40.86.218.34
  40.86.219.220
  40.86.220.0
  40.86.223.44
  40.86.227.160
-40.86.227.89
  40.86.229.29
  40.86.87.161
  40.86.94.7
  40.86.99.195
-40.87.111.79
  40.87.121.96
+40.87.141.124
+40.87.144.130
  40.87.17.154
  40.87.24.123
  40.87.54.154
  40.87.87.198
  40.88.127.1
  40.88.148.192
+40.89.129.205
  40.89.134.4
  40.89.136.50
  40.89.137.145
@@ -107089,7 +108448,7 @@
  40.89.159.38
  40.90.211.189
  40.90.238.52
-40.91.103.83
+40.91.200.53
  4000095599.com
  400517034274668-dot-charming-sky-2700.appspot.com
  4006261166.com
@@ -107118,17 +108477,18 @@
  41.102.59.247
  41.102.97.25
  41.103.208.28
-41.105.34.89
  41.105.60.148
  41.107.69.41
  41.110.24.21
  41.110.24.9
  41.110.65.59
+41.110.9.61
  41.111.123.99
  41.111.131.149
  41.111.204.87
  41.128.168.39
  41.129.132.116
+41.129.20.12
  41.129.44.235
  41.129.45.92
  41.129.50.200
@@ -107136,16 +108496,19 @@
  41.138.241.106
  41.138.56.3
  41.138.89.236
-41.139.10.56
-41.139.131.177
+41.139.10.109
  41.139.223.242
-41.139.249.110
+41.139.239.2
+41.139.37.128
  41.139.9.47
+41.140.246.232
  41.140.253.4
  41.140.31.106
+41.140.5.154
  41.140.90.75
  41.141.220.3
  41.141.250.3
+41.141.53.253
  41.142.248.91
  41.142.252.63
  41.143.149.21
@@ -107159,14 +108522,12 @@
  41.155.239.203
  41.155.239.220
  41.155.241.27
-41.155.246.26
  41.157.220.199
  41.157.80.183
  41.160.100.202
  41.160.100.204
  41.160.114.37
  41.160.143.99
-41.160.182.50
  41.160.225.174
  41.160.252.116
  41.160.40.2
@@ -107206,16 +108567,15 @@
  41.180.82.158
  41.180.82.62
  41.180.98.70
-41.182.135.13
  41.182.145.171
-41.182.145.238
-41.182.145.4
-41.182.146.225
+41.182.145.64
+41.182.147.107
+41.182.148.159
  41.182.148.182
+41.182.149.218
  41.185.28.84
  41.185.29.128
  41.185.8.170
-41.188.107.5
  41.188.124.50
  41.188.46.17
  41.188.5.110
@@ -107245,9 +108605,9 @@
  41.193.37.153
  41.193.5.52
  41.193.55.190
-41.193.86.73
  41.194.37.106
-41.204.116.104
+41.203.190.126
+41.204.119.36
  41.204.53.81
  41.204.84.182
  41.204.87.90
@@ -107256,40 +108616,44 @@
  41.205.13.126
  41.205.23.22
  41.205.59.241
-41.205.62.146
  41.205.83.6
  41.206.11.44
  41.206.35.222
  41.206.48.90
  41.207.138.10
+41.207.2.128
+41.207.248.188
  41.207.251.194
  41.208.150.114
  41.208.161.203
  41.208.68.20
  41.208.70.39
  41.208.71.226
-41.209.118.171
  41.21.233.230
  41.210.12.251
-41.210.14.125
+41.210.13.3
  41.210.140.35
  41.210.161.114
+41.210.18.91
  41.210.20.74
+41.210.22.40
  41.210.23.191
  41.210.27.62
+41.210.27.76
  41.210.5.2
+41.210.7.113
  41.211.122.81
-41.212.103.35
+41.211.5.137
  41.212.121.138
-41.212.30.102
-41.212.71.232
+41.212.26.163
+41.212.41.162
+41.212.75.111
  41.213.13.146
  41.213.13.154
  41.213.138.16
  41.213.158.225
  41.214.185.29
  41.215.10.6
-41.215.118.218
  41.215.128.91
  41.215.241.146
  41.215.242.42
@@ -107306,9 +108670,9 @@
  41.215.77.54
  41.215.79.182
  41.215.81.26
+41.215.84.170
  41.215.95.113
  41.216.148.55
-41.216.167.201
  41.216.173.222
  41.216.177.120
  41.216.178.15
@@ -107324,11 +108688,13 @@
  41.217.219.53
  41.218.116.38
  41.218.117.46
-41.218.195.205
  41.218.197.184
-41.218.209.159
+41.218.197.97
+41.218.204.25
+41.218.204.57
+41.218.206.156
+41.218.207.102
  41.218.209.69
-41.218.218.176
  41.218.225.173
  41.218.253.127
  41.219.186.194
@@ -107337,7 +108703,6 @@
  41.220.119.246
  41.220.128.3
  41.220.162.71
-41.220.42.53
  41.221.158.186
  41.221.194.1
  41.221.236.62
@@ -107349,11 +108714,9 @@
  41.222.15.74
  41.222.172.57
  41.222.173.246
-41.222.179.174
  41.222.4.146
  41.222.57.63
  41.222.58.37
-41.222.94.194
  41.223.108.13
  41.223.136.40
  41.223.142.211
@@ -107363,6 +108726,7 @@
  41.224.57.98
  41.224.59.242
  41.225.186.80
+41.225.255.14
  41.225.99.33
  41.226.162.74
  41.226.176.221
@@ -107374,6 +108738,7 @@
  41.226.60.115
  41.226.60.138
  41.227.119.223
+41.227.151.97
  41.228.164.19
  41.229.253.214
  41.229.86.194
@@ -107387,6 +108752,7 @@
  41.230.5.48
  41.230.66.90
  41.230.8.226
+41.230.80.238
  41.231.122.92
  41.231.228.21
  41.231.5.206
@@ -107395,6 +108761,7 @@
  41.231.87.69
  41.233.129.125
  41.237.164.12
+41.237.176.252
  41.238.200.222
  41.238.47.117
  41.242.117.242
@@ -107402,7 +108769,6 @@
  41.242.136.2
  41.242.138.46
  41.242.141.134
-41.242.152.102
  41.242.57.34
  41.242.70.5
  41.242.80.29
@@ -107414,25 +108780,25 @@
  41.243.13.70
  41.248.133.186
  41.248.190.79
+41.248.208.9
  41.248.62.160
+41.249.146.223
  41.249.212.74
-41.249.250.209
  41.249.251.191
  41.250.160.92
  41.250.96.149
  41.251.106.8
-41.251.127.23
  41.251.195.2
  41.251.248.90
  41.251.252.222
  41.251.254.98
  41.252.240.117
+41.253.56.143
  41.254.41.230
  41.254.44.241
  41.254.44.62
  41.32.104.230
  41.32.112.34
-41.32.12.74
  41.32.133.153
  41.32.133.69
  41.32.137.176
@@ -107452,9 +108818,8 @@
  41.32.42.5
  41.32.49.187
  41.32.52.102
-41.32.52.109
  41.32.64.62
-41.33.113.81
+41.32.99.165
  41.33.126.5
  41.33.13.26
  41.33.146.1
@@ -107463,13 +108828,13 @@
  41.33.2.209
  41.33.210.78
  41.33.212.68
-41.33.229.210
  41.33.240.117
  41.33.45.180
  41.33.66.226
  41.33.66.228
  41.33.66.230
  41.33.66.254
+41.36.240.165
  41.38.128.22
  41.38.144.114
  41.38.152.63
@@ -107479,7 +108844,6 @@
  41.38.183.239
  41.38.19.147
  41.38.195.30
-41.38.245.192
  41.38.249.35
  41.38.250.18
  41.38.26.106
@@ -107489,9 +108853,11 @@
  41.38.86.234
  41.39.105.69
  41.39.119.209
+41.39.130.83
  41.39.157.150
  41.39.159.99
  41.39.171.206
+41.39.173.218
  41.39.181.152
  41.39.183.27
  41.39.183.34
@@ -107500,6 +108866,7 @@
  41.39.23.73
  41.39.27.85
  41.39.53.198
+41.39.65.104
  41.39.70.201
  41.39.71.179
  41.39.77.92
@@ -107522,31 +108889,29 @@
  41.44.179.186
  41.44.182.59
  41.45.118.215
+41.45.145.151
  41.45.27.63
  41.46.44.143
  41.46.48.193
  41.57.109.74
  41.57.42.174
-41.59.200.19
+41.58.129.216
+41.58.159.68
+41.59.199.124
  41.59.200.33
  41.59.202.12
-41.59.203.101
  41.59.203.31
-41.59.46.244
  41.59.82.183
  41.60.216.122
  41.60.216.148
  41.60.216.153
  41.60.218.10
  41.60.220.84
-41.60.233.252
  41.60.234.155
  41.60.234.20
  41.60.236.145
-41.60.236.245
  41.60.238.148
  41.60.84.134
-41.62.228.194
  41.63.0.41
  41.63.1.38
  41.63.1.40
@@ -107561,41 +108926,34 @@
  41.64.18.117
  41.65.111.226
  41.65.146.38
-41.65.174.66
-41.65.174.88
-41.65.174.91
-41.65.201.178
  41.65.218.72
  41.65.242.115
  41.65.68.70
  41.66.224.68
  41.66.226.175
+41.66.231.230
  41.66.232.101
  41.66.232.233
+41.66.236.153
  41.66.244.86
-41.66.246.130
+41.67.3.6
  41.67.48.101
  41.67.48.71
  41.68.103.14
+41.68.181.244
  41.68.41.246
  41.71.119.195
-41.71.24.139
-41.71.24.148
  41.71.24.154
  41.72.203.182
  41.72.203.66
-41.72.25.104
-41.72.26.34
  41.72.61.50
  41.72.61.67
-41.73.107.85
  41.73.132.4
  41.73.132.94
  41.73.15.130
  41.73.15.134
  41.73.15.246
  41.73.213.186
-41.73.4.54
  41.74.4.166
  41.75.110.37
  41.75.111.147
@@ -107622,16 +108980,16 @@
  41.76.248.17
  41.76.42.75
  41.76.8.12
+41.76.8.7
  41.77.100.129
  41.77.136.114
  41.77.137.114
-41.77.186.32
-41.77.209.79
  41.77.245.240
  41.78.103.8
  41.78.117.86
  41.78.118.2
  41.78.172.77
+41.78.223.121
  41.78.245.41
  41.78.247.252
  41.78.26.155
@@ -107641,12 +108999,10 @@
  41.79.16.154
  41.79.170.111
  41.79.170.125
-41.79.170.241
-41.79.170.73
+41.79.170.72
  41.79.170.88
  41.79.171.32
  41.79.217.116
-41.79.219.222
  41.79.236.164
  41.79.35.1
  41.79.49.23
@@ -107666,26 +109022,28 @@
  41.83.109.15
  41.83.109.89
  41.83.196.147
+41.83.217.17
  41.83.232.196
+41.83.93.172
  41.84.159.206
-41.85.185.234
+41.84.226.168
  41.85.189.66
  41.85.191.6
  41.86.153.187
  41.86.155.5
  41.86.18.10
+41.86.18.133
  41.86.18.150
  41.86.18.152
+41.86.18.153
  41.86.18.165
  41.86.18.174
-41.86.18.195
  41.86.18.20
  41.86.18.200
  41.86.18.202
  41.86.18.204
  41.86.18.207
  41.86.18.22
-41.86.18.89
  41.86.19.200
  41.86.19.205
  41.86.19.206
@@ -107693,10 +109051,12 @@
  41.86.21.59
  41.86.21.62
  41.86.21.9
+41.86.250.226
+41.86.254.190
  41.86.34.45
  41.86.5.103
-41.86.5.142
  41.86.5.197
+41.86.5.205
  41.86.56.224
  41.87.29.130
  41.87.7.22
@@ -107708,7 +109068,6 @@
  41.90.106.78
  41.90.126.158
  41.92.133.214
-41.92.20.157
  41.92.203.5
  41.92.9.175
  41.93.155.17
@@ -107719,7 +109078,7 @@
  41.94.22.6
  41.94.47.41
  41.97.179.102
-41.97.84.0
+41.97.182.219
  41.98.84.239
  4117570-dot-n-e-w-me-ss-age-po-rt-al.wl.r.appspot.com
  413bd12fe0.nxcli.net
@@ -107735,7 +109094,10 @@
  42.101.66.55
  42.101.89.15
  42.104.109.194
+42.106.40.172
  42.106.42.210
+42.106.42.236
+42.106.43.11
  42.112.106.22
  42.112.107.236
  42.112.126.205
@@ -107748,9 +109110,9 @@
  42.112.191.234
  42.112.209.164
  42.112.211.52
+42.112.215.200
  42.112.221.44
  42.112.234.99
-42.112.238.30
  42.112.26.24
  42.112.26.30
  42.112.36.20
@@ -107759,17 +109121,15 @@
  42.112.51.64
  42.112.54.30
  42.112.65.194
-42.112.95.40
  42.112.97.180
  42.113.101.21
  42.113.112.0
-42.113.112.81
  42.113.130.228
  42.113.150.106
  42.113.151.232
-42.113.151.40
  42.113.151.72
  42.113.172.208
+42.113.181.212
  42.113.181.88
  42.113.192.171
  42.113.2.107
@@ -107779,7 +109139,6 @@
  42.113.216.245
  42.113.218.154
  42.113.225.71
-42.113.229.182
  42.113.229.187
  42.113.229.188
  42.113.229.204
@@ -107788,11 +109147,8 @@
  42.113.229.209
  42.113.229.221
  42.113.229.230
-42.113.229.237
-42.113.229.254
  42.113.229.42
-42.113.229.5
-42.113.229.74
+42.113.229.91
  42.113.235.113
  42.113.236.193
  42.113.236.54
@@ -107806,7 +109162,6 @@
  42.113.99.172
  42.113.99.215
  42.114.100.163
-42.114.125.27
  42.114.153.181
  42.114.175.159
  42.114.177.224
@@ -107818,7 +109173,6 @@
  42.114.209.142
  42.114.210.134
  42.114.217.47
-42.114.37.218
  42.114.52.174
  42.114.56.33
  42.114.56.90
@@ -107842,6 +109196,7 @@
  42.115.91.82
  42.116.100.42
  42.116.102.83
+42.116.162.191
  42.116.175.59
  42.116.179.34
  42.116.18.180
@@ -107878,44 +109233,31 @@
  42.117.20.231
  42.117.20.232
  42.117.20.27
-42.117.20.30
  42.117.20.37
  42.117.20.45
  42.117.20.46
  42.117.20.47
-42.117.20.48
  42.117.20.5
-42.117.20.51
-42.117.20.52
  42.117.20.54
  42.117.20.60
  42.117.20.62
  42.117.20.64
-42.117.20.65
-42.117.20.68
  42.117.20.72
  42.117.20.79
  42.117.20.81
  42.117.20.82
-42.117.20.85
  42.117.20.88
  42.117.20.91
-42.117.20.93
  42.117.202.225
  42.117.213.0
  42.117.213.1
-42.117.213.107
  42.117.213.113
  42.117.213.114
  42.117.213.118
  42.117.213.121
  42.117.213.14
-42.117.213.43
-42.117.213.44
  42.117.213.47
  42.117.213.55
-42.117.213.7
-42.117.213.73
  42.117.213.94
  42.117.213.98
  42.117.220.96
@@ -107926,7 +109268,6 @@
  42.117.245.239
  42.117.251.167
  42.117.29.120
-42.117.31.136
  42.117.38.18
  42.117.38.30
  42.117.38.96
@@ -107945,14 +109286,12 @@
  42.118.104.4
  42.118.111.141
  42.118.117.188
-42.118.123.166
  42.118.123.236
  42.118.126.158
  42.118.129.12
  42.118.139.13
  42.118.139.238
  42.118.140.87
-42.118.141.251
  42.118.148.230
  42.118.153.45
  42.118.182.161
@@ -107965,7 +109304,6 @@
  42.118.238.189
  42.118.238.200
  42.118.242.189
-42.118.253.192
  42.118.29.33
  42.118.44.41
  42.118.62.185
@@ -107973,12 +109311,9 @@
  42.118.71.6
  42.118.78.113
  42.118.78.13
-42.118.98.56
  42.119.112.109
-42.119.148.54
  42.119.150.246
  42.119.152.30
-42.119.157.159
  42.119.157.38
  42.119.166.248
  42.119.181.135
@@ -107986,7 +109321,6 @@
  42.119.181.76
  42.119.199.179
  42.119.204.130
-42.119.204.161
  42.119.229.171
  42.119.229.228
  42.119.231.162
@@ -107996,8 +109330,10 @@
  42.119.25.250
  42.119.26.125
  42.119.27.156
+42.119.30.101
  42.119.36.137
  42.119.39.115
+42.119.46.59
  42.119.47.251
  42.119.63.26
  42.119.66.160
@@ -108010,18 +109346,16 @@
  42.119.98.171
  42.122.49.41
  42.122.50.61
-42.122.51.114
  42.123.99.67
  42.127.80.212
  42.148.150.79
  42.153.143.230
+42.153.153.238
  42.157.192.132
  42.157.195.226
  42.157.6.204
-42.157.6.208
  42.159.10.142
  42.159.142.14
-42.159.147.118
  42.159.155.8
  42.159.246.159
  42.159.247.101
@@ -108081,7 +109415,6 @@
  42.180.206.145
  42.180.254.49
  42.180.38.127
-42.180.39.223
  42.180.49.4
  42.187.121.88
  42.188.110.120
@@ -108100,6 +109433,7 @@
  42.192.0.10
  42.192.10.43
  42.192.12.208
+42.192.125.230
  42.192.131.231
  42.192.134.40
  42.192.138.52
@@ -108115,6 +109449,7 @@
  42.192.23.20
  42.192.23.217
  42.192.23.23
+42.192.37.236
  42.192.38.172
  42.192.41.68
  42.192.42.126
@@ -108124,7 +109459,6 @@
  42.192.49.46
  42.192.50.167
  42.192.50.18
-42.192.50.230
  42.192.51.168
  42.192.51.27
  42.192.51.93
@@ -108136,13 +109470,11 @@
  42.192.55.98
  42.192.60.154
  42.192.7.200
-42.192.72.107
  42.192.78.13
  42.192.85.120
  42.192.89.106
  42.192.95.184
  42.193.1.170
-42.193.10.176
  42.194.128.158
  42.194.135.105
  42.194.137.87
@@ -108199,9 +109531,9 @@
  42.2.225.73
  42.2.23.202
  42.2.233.226
-42.2.239.200
  42.2.38.77
  42.2.49.250
+42.2.59.92
  42.2.86.27
  42.200.109.74
  42.200.116.210
@@ -108217,10 +109549,8 @@
  42.200.173.48
  42.200.182.127
  42.200.196.30
-42.200.196.78
  42.200.198.230
  42.200.200.146
-42.200.201.37
  42.200.206.225
  42.200.211.79
  42.200.226.58
@@ -108236,145 +109566,152 @@
  42.200.95.12
  42.200.96.63
  42.201.228.210
+42.201.232.254
  42.201.253.195
  42.202.100.135
  42.202.101.228
-42.202.157.200
-42.224.0.125
  42.224.1.181
-42.224.112.217
+42.224.11.138
+42.224.11.85
+42.224.119.99
  42.224.122.152
  42.224.125.176
  42.224.125.179
-42.224.125.252
-42.224.126.38
-42.224.13.87
-42.224.135.33
+42.224.128.12
  42.224.136.181
-42.224.136.252
+42.224.138.79
  42.224.139.30
  42.224.141.148
  42.224.141.218
+42.224.142.183
  42.224.143.170
-42.224.147.93
-42.224.152.56
-42.224.155.101
+42.224.152.250
+42.224.16.35
+42.224.168.100
  42.224.169.215
+42.224.169.88
  42.224.17.202
  42.224.170.212
+42.224.170.217
  42.224.171.80
+42.224.172.120
+42.224.173.114
  42.224.173.39
  42.224.174.249
  42.224.176.186
  42.224.176.74
-42.224.177.199
  42.224.177.237
  42.224.177.243
  42.224.178.222
-42.224.179.10
-42.224.179.15
+42.224.179.248
  42.224.180.248
-42.224.180.32
-42.224.182.3
  42.224.183.126
-42.224.189.88
+42.224.188.115
  42.224.19.138
-42.224.208.214
-42.224.209.21
+42.224.209.146
+42.224.209.19
+42.224.209.48
+42.224.209.76
  42.224.210.141
-42.224.214.39
+42.224.210.21
+42.224.214.130
+42.224.214.242
+42.224.215.149
  42.224.215.69
  42.224.217.116
-42.224.217.201
+42.224.218.93
  42.224.22.236
-42.224.220.216
  42.224.221.134
  42.224.232.225
  42.224.233.141
-42.224.234.23
  42.224.236.68
-42.224.237.81
-42.224.239.32
-42.224.240.30
-42.224.241.73
  42.224.242.180
+42.224.243.255
+42.224.245.137
+42.224.245.54
+42.224.245.84
  42.224.248.17
-42.224.25.93
+42.224.251.82
  42.224.252.64
  42.224.26.5
  42.224.30.222
  42.224.36.186
+42.224.4.17
+42.224.4.51
  42.224.4.84
-42.224.46.199
-42.224.48.89
-42.224.5.78
-42.224.52.13
-42.224.53.130
-42.224.6.4
-42.224.60.139
-42.224.62.149
+42.224.40.167
+42.224.42.209
+42.224.44.216
+42.224.46.248
  42.224.65.211
  42.224.66.83
+42.224.68.152
  42.224.69.88
  42.224.70.21
-42.224.70.9
-42.224.71.84
-42.224.73.115
  42.224.73.14
  42.224.75.9
-42.224.76.129
  42.224.76.236
  42.224.77.242
-42.224.79.17
-42.224.9.19
+42.224.77.43
+42.224.77.74
+42.224.79.204
+42.224.88.98
  42.224.98.101
-42.224.98.169
-42.224.98.40
  42.225.154.17
-42.225.200.121
+42.225.19.137
+42.225.20.160
+42.225.200.227
  42.225.201.235
+42.225.202.154
+42.225.203.47
  42.225.203.5
  42.225.204.17
  42.225.205.12
-42.225.205.176
+42.225.207.82
+42.225.21.248
  42.225.211.236
  42.225.214.68
  42.225.215.149
-42.225.230.228
-42.225.238.1
+42.225.222.81
+42.225.235.192
+42.225.236.193
+42.225.244.70
  42.225.246.190
-42.225.252.244
  42.225.28.178
+42.225.31.231
  42.225.31.50
-42.225.34.18
-42.225.4.99
-42.225.51.147
+42.225.53.152
  42.226.65.94
-42.226.66.133
  42.226.67.235
-42.226.68.118
-42.226.71.203
-42.226.95.250
+42.226.71.227
+42.226.82.162
+42.226.91.216
+42.226.92.85
  42.227.116.20
  42.227.121.217
-42.227.138.121
  42.227.157.106
  42.227.166.244
  42.227.166.69
+42.227.167.87
  42.227.172.211
  42.227.184.249
  42.227.184.46
+42.227.185.183
+42.227.186.0
  42.227.196.128
  42.227.197.5
  42.227.197.8
-42.227.220.251
-42.227.240.4
-42.227.240.53
+42.227.207.47
+42.227.222.143
+42.227.24.181
+42.227.240.150
  42.227.243.7
  42.227.245.39
+42.227.247.223
  42.227.25.126
-42.227.251.239
-42.227.38.168
+42.227.25.96
+42.227.253.107
+42.227.28.220
  42.227.44.164
  42.227.57.194
  42.227.58.82
@@ -108384,43 +109721,45 @@
  42.228.127.28
  42.228.164.22
  42.228.164.23
+42.228.193.190
+42.228.194.177
  42.228.2.150
  42.228.200.157
-42.228.216.207
-42.228.234.144
  42.228.237.138
-42.228.245.44
+42.228.245.218
  42.228.34.139
  42.228.34.199
  42.228.34.89
+42.228.34.90
  42.228.36.182
  42.228.36.7
-42.228.38.179
  42.228.38.80
  42.228.39.189
  42.228.39.89
  42.228.4.35
  42.228.40.144
  42.228.40.199
+42.228.40.201
  42.228.40.225
  42.228.41.182
  42.228.43.26
-42.228.45.218
  42.228.45.86
  42.228.46.106
  42.228.46.129
  42.228.46.206
  42.228.47.169
  42.228.54.98
-42.228.59.226
-42.228.64.234
+42.228.64.36
+42.228.68.225
  42.228.68.74
-42.228.69.165
  42.228.7.2
-42.228.73.208
-42.228.75.122
-42.228.75.20
+42.228.71.114
+42.228.72.176
+42.228.75.209
  42.228.76.157
+42.228.76.162
+42.228.77.183
+42.228.79.244
  42.228.79.60
  42.228.80.137
  42.228.81.115
@@ -108430,111 +109769,109 @@
  42.228.94.145
  42.228.94.93
  42.229.160.145
-42.229.169.100
-42.229.182.12
-42.229.227.87
-42.229.229.43
-42.229.234.67
-42.229.235.20
+42.229.227.201
+42.229.231.129
  42.229.236.12
-42.230.121.197
-42.230.122.184
-42.230.122.193
-42.230.122.241
-42.230.123.116
+42.229.238.31
+42.229.239.162
+42.230.10.6
+42.230.100.165
+42.230.102.92
+42.230.120.116
  42.230.123.74
-42.230.124.112
-42.230.125.27
  42.230.126.238
+42.230.126.80
  42.230.13.211
-42.230.14.57
  42.230.152.90
+42.230.16.214
  42.230.170.56
  42.230.176.61
-42.230.186.13
-42.230.189.179
-42.230.194.81
-42.230.219.104
-42.230.224.93
-42.230.231.160
-42.230.246.178
+42.230.177.118
+42.230.178.84
+42.230.187.179
+42.230.214.104
+42.230.216.224
+42.230.217.41
  42.230.27.134
  42.230.37.194
  42.230.43.23
  42.230.50.192
-42.230.6.155
+42.230.50.238
  42.230.62.207
-42.230.68.216
  42.230.80.86
  42.230.81.191
-42.230.88.37
-42.230.89.174
-42.230.92.85
-42.230.95.219
-42.230.96.208
+42.230.86.76
+42.230.89.213
+42.230.93.220
  42.230.96.218
-42.230.98.115
-42.230.99.53
+42.230.97.38
+42.230.98.245
  42.231.108.75
+42.231.110.22
+42.231.111.115
  42.231.111.173
  42.231.120.138
  42.231.121.10
  42.231.123.117
+42.231.125.77
  42.231.135.146
-42.231.158.107
  42.231.161.220
  42.231.201.193
+42.231.217.24
  42.231.234.179
-42.231.237.177
-42.231.247.6
+42.231.247.133
  42.231.247.68
-42.231.249.40
  42.231.41.51
  42.231.42.217
  42.231.48.78
+42.231.49.68
  42.231.51.23
+42.231.67.234
  42.231.75.106
  42.232.100.48
  42.232.101.226
  42.232.114.186
-42.232.170.249
-42.232.171.203
-42.232.171.219
+42.232.115.111
+42.232.169.199
+42.232.170.1
  42.232.188.224
  42.232.188.62
  42.232.198.40
-42.232.200.185
  42.232.216.116
+42.232.216.239
  42.232.225.124
  42.232.229.25
  42.232.231.158
  42.232.231.49
  42.232.233.5
+42.232.234.76
  42.232.239.137
-42.232.39.124
  42.232.41.107
+42.232.45.106
  42.232.45.68
-42.232.75.95
-42.232.79.141
  42.232.80.133
-42.233.125.175
-42.233.125.243
+42.233.117.13
+42.233.120.202
  42.233.125.82
+42.233.146.150
+42.233.216.66
  42.233.220.180
  42.233.227.7
  42.233.232.93
  42.233.253.251
  42.233.254.41
  42.233.32.16
-42.233.66.151
-42.233.70.135
  42.233.73.146
  42.233.79.227
+42.233.91.128
+42.233.94.88
+42.234.107.186
+42.234.109.13
+42.234.109.90
+42.234.111.78
  42.234.116.244
-42.234.178.5
+42.234.136.79
  42.234.186.167
-42.234.186.222
-42.234.232.219
  42.234.236.206
  42.234.240.194
  42.234.240.23
@@ -108545,157 +109882,156 @@
  42.234.243.111
  42.234.243.234
  42.234.244.253
-42.234.246.200
-42.234.248.161
-42.234.248.179
-42.234.250.196
-42.234.250.42
-42.234.252.140
-42.234.252.141
-42.234.254.218
-42.234.254.243
-42.234.255.251
-42.234.85.70
-42.234.86.215
+42.234.248.133
+42.234.248.170
+42.234.249.170
+42.234.253.52
+42.234.254.185
+42.234.254.84
+42.234.255.54
  42.235.117.21
-42.235.122.170
  42.235.123.246
-42.235.126.120
  42.235.14.225
  42.235.143.145
-42.235.151.167
-42.235.152.174
-42.235.152.95
+42.235.152.247
+42.235.154.201
  42.235.156.137
+42.235.158.98
+42.235.160.123
+42.235.161.151
+42.235.163.149
  42.235.165.179
  42.235.169.202
+42.235.170.196
  42.235.171.48
-42.235.181.88
+42.235.174.125
+42.235.180.152
+42.235.180.243
  42.235.183.181
  42.235.184.88
-42.235.187.100
  42.235.187.29
  42.235.188.100
-42.235.191.233
+42.235.189.113
+42.235.189.152
  42.235.20.211
+42.235.51.240
  42.235.57.48
  42.235.59.66
  42.235.6.83
-42.235.64.178
-42.235.66.112
-42.235.66.159
-42.235.7.13
-42.235.7.136
-42.235.71.170
-42.235.83.89
-42.235.87.183
+42.235.64.7
+42.235.65.113
+42.235.67.72
+42.235.71.85
+42.235.80.117
+42.235.81.159
+42.235.81.187
+42.235.87.79
  42.235.88.178
  42.235.88.20
-42.235.89.157
-42.235.89.95
  42.235.91.93
  42.235.92.97
-42.235.94.230
+42.235.93.109
  42.235.95.249
+42.236.137.43
  42.236.141.182
+42.236.146.198
  42.236.148.237
-42.236.151.48
+42.236.148.240
+42.236.150.28
  42.236.151.93
  42.236.160.189
  42.236.161.183
  42.236.161.43
  42.236.163.178
-42.236.212.158
  42.236.212.45
  42.236.212.96
  42.236.213.172
  42.236.213.43
  42.236.214.103
-42.236.214.161
  42.236.215.190
  42.236.215.249
  42.236.221.189
-42.236.221.86
+42.236.221.21
  42.236.222.135
+42.236.222.139
  42.236.223.0
  42.236.223.2
  42.236.223.79
  42.236.223.90
-42.236.252.137
+42.236.237.166
  42.236.254.112
  42.236.254.70
  42.236.68.56
  42.236.74.70
  42.237.112.52
-42.237.114.252
-42.237.116.27
  42.237.18.141
  42.237.196.213
  42.237.197.58
-42.237.24.108
  42.237.27.28
  42.237.40.112
+42.237.46.253
+42.237.51.147
  42.237.82.124
-42.237.82.230
  42.237.90.156
  42.238.160.22
+42.238.160.80
  42.238.164.149
-42.238.173.49
-42.238.202.230
+42.238.171.231
+42.238.183.81
+42.238.191.50
+42.238.2.110
+42.238.208.30
  42.238.228.182
  42.238.231.157
+42.238.232.239
  42.238.235.73
  42.238.236.58
  42.238.241.114
-42.238.242.38
  42.238.244.116
-42.238.244.92
-42.238.245.7
  42.238.250.14
+42.238.250.35
  42.238.251.182
  42.238.5.149
-42.238.51.98
-42.238.64.101
-42.239.10.24
  42.239.100.254
+42.239.104.6
  42.239.121.193
+42.239.144.7
  42.239.145.30
  42.239.148.32
  42.239.15.82
+42.239.150.224
+42.239.16.133
  42.239.163.85
  42.239.181.224
  42.239.193.119
  42.239.206.35
-42.239.231.68
  42.239.233.77
-42.239.236.90
  42.239.237.164
  42.239.237.216
  42.239.237.83
-42.239.238.219
+42.239.238.68
  42.239.239.21
  42.239.239.71
  42.239.242.90
-42.239.244.148
  42.239.246.63
-42.239.249.140
  42.239.253.10
+42.239.253.102
  42.239.253.2
-42.239.253.224
  42.239.254.208
  42.239.77.134
-42.239.90.68
-42.239.93.134
+42.239.89.247
  42.240.129.58
  42.242.101.158
+42.242.104.211
+42.242.106.26
  42.242.231.12
  42.242.231.248
  42.242.243.114
  42.242.80.226
  42.242.92.49
  42.242.98.1
-42.243.101.66
  42.243.111.90
+42.243.218.197
  42.243.35.234
  42.244.62.229
  42.247.5.66
@@ -108733,9 +110069,10 @@
  42.249.21.12
  42.249.31.161
  42.249.39.220
-42.249.53.192
+42.3.104.210
  42.3.137.72
  42.3.18.20
+42.3.180.121
  42.3.193.229
  42.3.195.51
  42.3.202.229
@@ -108768,6 +110105,7 @@
  42.5.214.244
  42.5.215.42
  42.5.224.214
+42.5.225.156
  42.51.12.36
  42.51.129.156
  42.51.18.132
@@ -108786,7 +110124,7 @@
  42.52.18.18
  42.52.28.105
  42.52.30.102
-42.52.93.194
+42.52.41.8
  42.52.96.21
  42.53.119.173
  42.53.144.95
@@ -108805,6 +110143,7 @@
  42.55.134.167
  42.55.17.119
  42.55.179.159
+42.55.204.221
  42.55.206.99
  42.55.216.211
  42.55.252.234
@@ -108813,6 +110152,7 @@
  42.55.63.208
  42.55.71.51
  42.56.114.103
+42.56.12.255
  42.56.125.175
  42.56.193.166
  42.56.213.130
@@ -108833,12 +110173,11 @@
  42.58.178.55
  42.58.189.80
  42.58.210.57
-42.58.223.74
  42.58.238.169
  42.58.5.9
  42.58.54.159
  42.58.82.55
-42.59.105.138
+42.59.106.9
  42.59.111.4
  42.59.148.177
  42.59.174.156
@@ -108872,11 +110211,9 @@
  42.61.64.70
  42.61.99.155
  42.62.107.209
-42.62.114.231
  42.62.26.115
  42.62.31.51
  42.62.96.34
-42.63.14.194
  42.63.158.14
  42.63.199.141
  42.63.244.88
@@ -108884,7 +110221,6 @@
  42.7.121.84
  42.7.14.8
  42.7.149.251
-42.7.15.129
  42.7.15.201
  42.7.15.214
  42.7.15.93
@@ -108907,13 +110243,11 @@
  42.82.239.15
  42.84.162.196
  42.84.163.148
-42.84.194.61
  42.84.197.24
  42.84.198.14
  42.84.218.16
  42.85.145.231
  42.85.191.12
-42.85.228.28
  42.85.248.241
  42.85.52.140
  42.85.89.145
@@ -108921,9 +110255,9 @@
  42.86.147.160
  42.86.150.245
  42.86.17.90
+42.86.170.92
  42.86.37.195
  42.86.83.144
-42.87.111.250
  42.87.12.215
  42.87.248.11
  42.87.46.185
@@ -108940,6 +110274,7 @@
  42.98.71.10
  42.98.8.73
  42.99.116.139
+42.99.180.135
  420365365.com
  420extracts.ca
  420marijuanalist.com
@@ -108976,12 +110311,10 @@
  43.224.8.116
  43.224.8.124
  43.224.8.14
-43.225.112.152
  43.225.151.142
  43.225.151.198
  43.225.151.253
  43.225.157.152
-43.225.158.99
  43.225.161.91
  43.225.163.209
  43.225.186.2
@@ -108994,6 +110327,7 @@
  43.225.195.89
  43.225.195.90
  43.225.21.193
+43.225.213.184
  43.225.22.87
  43.225.38.82
  43.225.55.182
@@ -109007,6 +110341,7 @@
  43.226.144.80
  43.226.145.122
  43.226.146.180
+43.226.146.52
  43.226.146.76
  43.226.147.142
  43.226.147.215
@@ -109029,7 +110364,6 @@
  43.226.22.90
  43.226.236.222
  43.226.238.12
-43.226.239.126
  43.226.26.159
  43.226.49.211
  43.226.51.148
@@ -109052,10 +110386,11 @@
  43.228.222.114
  43.228.222.2
  43.228.38.174
-43.228.70.27
  43.228.70.36
  43.228.84.23
+43.229.11.11
  43.229.11.20
+43.229.11.35
  43.229.149.83
  43.229.151.135
  43.229.152.88
@@ -109074,16 +110409,22 @@
  43.229.62.95
  43.229.72.220
  43.229.73.174
+43.229.73.185
  43.229.73.197
  43.229.73.225
+43.229.73.229
  43.229.73.230
  43.229.73.233
  43.229.73.238
  43.229.73.239
+43.229.73.240
  43.229.73.242
  43.229.73.250
+43.229.73.254
+43.229.88.165
  43.229.88.86
  43.229.89.183
+43.230.106.71
  43.230.168.149
  43.230.195.160
  43.230.196.98
@@ -109095,14 +110436,16 @@
  43.231.114.180
  43.231.129.193
  43.231.150.78
+43.231.22.90
  43.231.52.183
  43.231.56.113
  43.231.62.100
+43.231.76.1
  43.231.76.105
  43.231.76.109
-43.231.76.113
  43.231.76.117
  43.231.76.121
+43.231.76.125
  43.231.76.129
  43.231.76.145
  43.231.76.149
@@ -109114,7 +110457,6 @@
  43.231.76.185
  43.231.76.193
  43.231.76.201
-43.231.76.209
  43.231.76.213
  43.231.76.221
  43.231.76.225
@@ -109136,7 +110478,6 @@
  43.231.77.1
  43.231.77.101
  43.231.77.117
-43.231.77.17
  43.231.77.21
  43.231.77.33
  43.231.77.37
@@ -109147,8 +110488,8 @@
  43.231.77.61
  43.231.77.65
  43.231.77.73
+43.231.77.77
  43.231.77.81
-43.231.77.89
  43.231.77.94
  43.231.78.1
  43.231.78.33
@@ -109157,6 +110498,7 @@
  43.231.78.5
  43.231.78.57
  43.231.78.61
+43.231.78.73
  43.231.78.85
  43.231.78.9
  43.231.79.1
@@ -109174,7 +110516,6 @@
  43.239.75.189
  43.239.75.81
  43.240.102.132
-43.240.103.173
  43.240.103.179
  43.240.112.146
  43.240.12.190
@@ -109184,7 +110525,6 @@
  43.240.226.28
  43.240.31.188
  43.240.31.52
-43.240.38.103
  43.240.66.46
  43.241.106.183
  43.241.106.220
@@ -109201,7 +110541,6 @@
  43.241.130.107
  43.241.196.78
  43.241.25.66
-43.241.57.18
  43.242.112.133
  43.242.112.254
  43.242.128.32
@@ -109210,9 +110549,7 @@
  43.242.210.142
  43.242.214.183
  43.242.242.197
-43.242.39.13
-43.243.127.174
-43.243.127.228
+43.243.132.86
  43.243.168.98
  43.243.171.24
  43.243.204.106
@@ -109234,7 +110571,6 @@
  43.246.139.33
  43.246.141.67
  43.246.141.69
-43.246.142.91
  43.246.240.135
  43.246.240.243
  43.246.241.147
@@ -109252,17 +110588,12 @@
  43.248.24.234
  43.248.25.6
  43.248.26.18
+43.248.70.132
  43.248.9.100
-43.249.113.219
-43.249.113.220
  43.249.113.235
-43.249.113.236
-43.249.113.243
-43.249.113.246
-43.249.114.36
  43.249.129.230
+43.249.195.62
  43.249.205.169
-43.249.217.83
  43.249.218.125
  43.249.249.20
  43.249.27.170
@@ -109287,12 +110618,10 @@
  43.251.159.144
  43.251.16.143
  43.251.17.39
-43.251.17.61
  43.251.172.13
  43.251.214.14
  43.251.255.83
  43.251.72.2
-43.251.94.73
  43.251.99.4
  43.252.106.58
  43.252.120.151
@@ -109321,7 +110650,6 @@
  43.254.158.178
  43.254.158.179
  43.254.158.183
-43.254.162.242
  43.254.205.22
  43.254.206.14
  43.254.206.143
@@ -109330,9 +110658,9 @@
  43.254.219.183
  43.254.219.3
  43.254.220.195
-43.254.240.150
  43.254.240.34
  43.254.241.20
+43.254.43.122
  43.254.43.76
  43.254.54.96
  43.254.59.210
@@ -109371,11 +110699,11 @@
  43e9b590ddd1d64b8ec8252e97214649ea9c160a.info
  43essentialsfood.com
  43sd.org
+44.135.217.150
  44.226.207.66
  44.229.164.142
  44.230.142.147
  44.234.25.204
-44.234.97.80
  44.235.31.168
  44.235.90.168
  44.241.40.115
@@ -109403,20 +110731,23 @@
  44realestates.com
  44unit.duckdns.org
  45-76-47-204.plesk.page
-45.10.165.120
-45.10.165.173
-45.10.165.20
+45.10.165.171
  45.10.165.209
  45.10.165.218
  45.10.165.237
-45.10.165.24
-45.10.165.59
  45.10.165.97
+45.10.166.110
+45.10.166.179
+45.10.175.20
  45.10.232.111
  45.10.232.117
  45.10.232.123
+45.10.232.135
  45.10.232.20
+45.10.232.33
+45.10.232.38
  45.10.232.51
+45.10.232.62
  45.10.232.69
  45.10.232.92
  45.10.237.201
@@ -109425,12 +110756,9 @@
  45.10.237.49
  45.10.237.9
  45.10.239.106
-45.10.239.145
-45.10.239.229
  45.10.239.51
  45.10.239.8
  45.10.24.137
-45.10.24.152
  45.10.24.197
  45.10.24.218
  45.10.55.142
@@ -109452,10 +110780,8 @@
  45.112.202.109
  45.112.203.124
  45.112.204.203
-45.112.240.225
-45.112.240.48
+45.112.242.39
  45.112.242.48
-45.112.242.71
  45.112.54.146
  45.112.56.142
  45.112.57.230
@@ -109492,23 +110818,19 @@
  45.114.117.63
  45.114.117.98
  45.114.130.4
-45.114.245.162
+45.114.144.152
  45.114.68.140
  45.114.68.174
  45.114.85.18
  45.114.85.202
-45.114.86.2
  45.115.112.214
  45.115.112.252
-45.115.115.90
  45.115.171.23
  45.115.171.30
-45.115.171.84
  45.115.173.205
  45.115.174.29
  45.115.176.193
  45.115.179.221
-45.115.26.9
  45.115.60.197
  45.115.61.205
  45.115.62.131
@@ -109544,13 +110866,16 @@
  45.117.102.201
  45.117.102.238
  45.117.112.116
+45.117.160.41
  45.117.160.82
  45.117.168.152
  45.117.207.26
  45.117.222.26
+45.117.228.65
  45.117.228.85
  45.117.228.89
  45.117.228.97
+45.117.244.13
  45.117.28.65
  45.117.29.7
  45.117.30.153
@@ -109576,16 +110901,16 @@
  45.118.145.223
  45.118.151.85
  45.118.217.57
-45.118.32.90
+45.118.32.154
  45.118.35.169
  45.118.35.182
  45.118.35.98
-45.119.125.102
  45.119.125.62
  45.119.125.86
  45.119.125.90
  45.119.126.114
  45.119.126.192
+45.119.126.247
  45.119.126.58
  45.119.203.170
  45.119.212.136
@@ -109616,34 +110941,26 @@
  45.119.85.234
  45.119.86.93
  45.12.148.123
-45.12.177.238
-45.12.177.24
  45.12.206.70
  45.12.215.167
  45.12.215.204
  45.12.215.243
  45.12.223.140
  45.120.119.55
-45.120.124.63
  45.120.162.120
  45.120.200.2
-45.120.49.129
-45.120.49.86
+45.120.3.56
  45.120.50.114
  45.120.50.85
-45.120.51.158
  45.120.51.228
  45.120.51.38
  45.120.51.70
  45.120.51.94
-45.120.53.50
  45.120.69.81
  45.120.76.21
  45.121.111.1
  45.121.144.114
  45.121.209.145
-45.121.209.153
-45.121.209.186
  45.121.209.190
  45.121.236.140
  45.121.237.147
@@ -109697,7 +111014,6 @@
  45.124.86.155
  45.125.117.100
  45.125.117.97
-45.125.118.26
  45.125.12.170
  45.125.239.34
  45.125.239.54
@@ -109706,7 +111022,6 @@
  45.125.245.178
  45.125.245.196
  45.125.245.21
-45.125.245.214
  45.125.45.64
  45.125.46.31
  45.125.63.46
@@ -109744,10 +111059,6 @@
  45.129.33.121
  45.129.33.122
  45.129.33.123
-45.129.33.124
-45.129.33.125
-45.129.33.126
-45.129.33.127
  45.129.33.129
  45.129.33.13
  45.129.33.14
@@ -109768,7 +111079,11 @@
  45.129.33.156
  45.129.33.160
  45.129.33.161
+45.129.33.163
  45.129.33.164
+45.129.33.165
+45.129.33.166
+45.129.33.168
  45.129.33.169
  45.129.33.171
  45.129.33.172
@@ -109792,7 +111107,6 @@
  45.129.33.19
  45.129.33.2
  45.129.33.20
-45.129.33.204
  45.129.33.21
  45.129.33.22
  45.129.33.24
@@ -109808,7 +111122,6 @@
  45.129.33.48
  45.129.33.49
  45.129.33.5
-45.129.33.50
  45.129.33.51
  45.129.33.52
  45.129.33.53
@@ -109829,25 +111142,24 @@
  45.129.96.49
  45.13.10.255
  45.13.161.115
+45.13.228.161
  45.13.228.179
+45.13.228.209
  45.13.231.144
-45.13.58.133
  45.13.58.149
  45.13.58.4
  45.130.147.27
-45.130.255.237
  45.130.60.97
+45.131.108.208
  45.131.108.227
-45.131.193.49
+45.131.192.76
  45.131.195.98
  45.131.231.90
  45.131.29.81
  45.131.34.201
-45.131.4.13
  45.131.4.15
  45.131.4.23
  45.131.4.9
-45.131.47.212
  45.132.105.43
  45.132.137.13
  45.132.137.16
@@ -109855,24 +111167,23 @@
  45.132.137.29
  45.132.138.15
  45.132.138.16
-45.132.185.12
+45.132.184.145
  45.132.185.139
  45.132.185.145
  45.132.185.174
  45.132.185.186
+45.132.185.194
  45.132.185.195
  45.132.185.210
  45.132.185.221
  45.132.185.44
-45.132.185.56
  45.132.185.67
  45.132.185.76
+45.132.186.24
+45.132.187.223
  45.132.194.15
-45.132.227.9
  45.132.242.49
  45.132.26.111
-45.132.51.155
-45.132.51.17
  45.133.106.148
  45.133.106.196
  45.133.107.130
@@ -109888,7 +111199,6 @@
  45.133.232.146
  45.133.232.148
  45.133.88.11
-45.133.88.12
  45.133.88.13
  45.133.88.16
  45.133.88.17
@@ -109899,49 +111209,33 @@
  45.133.88.9
  45.133.9.21
  45.133.9.60
-45.134.172.100
-45.134.172.110
  45.134.172.113
  45.134.172.143
-45.134.172.144
  45.134.172.16
-45.134.172.161
  45.134.172.162
-45.134.172.174
  45.134.172.178
  45.134.172.202
  45.134.172.205
  45.134.172.229
  45.134.172.238
-45.134.172.27
  45.134.172.28
  45.134.172.34
  45.134.172.55
-45.134.172.60
-45.134.172.63
  45.134.173.105
-45.134.173.110
  45.134.173.120
-45.134.173.201
-45.134.173.209
  45.134.173.217
  45.134.173.23
  45.134.173.240
  45.134.173.243
  45.134.173.46
  45.134.173.62
-45.134.173.78
-45.134.173.97
  45.134.174.113
  45.134.174.124
  45.134.174.188
  45.134.174.194
-45.134.174.197
  45.134.174.223
  45.134.174.225
  45.134.174.246
-45.134.174.30
-45.134.174.52
  45.134.175.147
  45.134.175.168
  45.134.175.170
@@ -109949,15 +111243,12 @@
  45.134.175.203
  45.134.175.214
  45.134.175.234
-45.134.175.244
  45.134.175.29
  45.134.175.36
  45.134.175.44
-45.134.175.46
  45.134.175.52
  45.134.175.55
-45.134.175.62
-45.134.175.67
+45.134.175.63
  45.134.180.59
  45.134.183.210
  45.134.187.104
@@ -109978,11 +111269,10 @@
  45.134.22.82
  45.134.252.237
  45.134.253.180
-45.134.26.46
+45.134.253.57
  45.135.118.144
  45.135.134.51
  45.135.135.169
-45.135.167.225
  45.135.187.98
  45.135.203.135
  45.135.232.21
@@ -109999,6 +111289,7 @@
  45.136.12.47
  45.136.131.179
  45.136.245.254
+45.136.69.155
  45.137.10.89
  45.137.150.131
  45.137.180.45
@@ -110014,18 +111305,13 @@
  45.138.101.12
  45.138.101.122
  45.138.101.133
-45.138.101.135
-45.138.101.137
  45.138.101.141
  45.138.101.149
  45.138.101.219
-45.138.101.221
  45.138.101.243
  45.138.101.251
  45.138.101.254
  45.138.101.36
-45.138.101.99
-45.138.4.91
  45.138.48.83
  45.138.72.100
  45.138.72.135
@@ -110034,13 +111320,20 @@
  45.139.176.170
  45.139.176.78
  45.139.186.123
-45.139.186.54
  45.139.186.55
  45.139.189.159
+45.139.213.154
+45.139.221.101
+45.139.221.123
+45.139.221.124
  45.139.221.13
+45.139.221.148
+45.139.221.155
+45.139.221.156
+45.139.221.157
+45.139.221.164
  45.139.221.28
  45.139.221.33
-45.139.222.19
  45.139.236.14
  45.139.236.5
  45.139.48.13
@@ -110058,7 +111351,6 @@
  45.14.150.133
  45.14.150.140
  45.14.150.19
-45.14.150.202
  45.14.150.250
  45.14.150.29
  45.14.150.51
@@ -110074,7 +111366,6 @@
  45.14.224.144
  45.14.224.148
  45.14.224.152
-45.14.224.153
  45.14.224.158
  45.14.224.164
  45.14.224.166
@@ -110085,7 +111376,6 @@
  45.14.224.204
  45.14.224.214
  45.14.224.22
-45.14.224.248
  45.14.224.250
  45.14.224.26
  45.14.224.28
@@ -110128,6 +111418,7 @@
  45.141.156.14
  45.141.156.17
  45.141.156.196
+45.141.156.20
  45.141.156.24
  45.141.156.26
  45.141.156.27
@@ -110142,7 +111433,6 @@
  45.141.58.53
  45.141.84.10
  45.141.84.126
-45.141.84.129
  45.141.84.173
  45.141.84.182
  45.141.84.184
@@ -110199,7 +111489,6 @@
  45.142.215.58
  45.142.252.88
  45.142.253.239
-45.143.108.77
  45.143.145.84
  45.143.147.38
  45.143.220.125
@@ -110249,51 +111538,32 @@
  45.144.177.224
  45.144.177.225
  45.144.207.43
-45.144.3.143
  45.144.30.4
  45.144.65.27
  45.144.65.49
  45.144.65.71
-45.145.116.24
  45.145.117.73
  45.145.121.145
-45.145.128.12
  45.145.128.142
  45.145.128.156
-45.145.128.182
  45.145.128.191
-45.145.128.24
-45.145.128.27
-45.145.128.40
  45.145.128.43
  45.145.128.74
-45.145.129.12
-45.145.129.14
  45.145.129.150
-45.145.129.158
  45.145.129.177
-45.145.129.188
  45.145.129.198
-45.145.129.21
-45.145.129.219
-45.145.129.220
  45.145.129.23
-45.145.129.43
-45.145.129.88
-45.145.131.135
-45.145.131.155
  45.145.131.158
-45.145.131.163
  45.145.131.180
  45.145.131.186
  45.145.131.19
-45.145.131.35
  45.145.131.44
  45.145.131.88
  45.145.131.90
  45.145.131.94
  45.145.161.187
  45.145.185.111
+45.145.185.119
  45.145.185.120
  45.145.185.187
  45.145.185.189
@@ -110327,6 +111597,7 @@
  45.146.164.166
  45.146.164.169
  45.146.164.171
+45.146.164.181
  45.146.164.199
  45.146.164.211
  45.146.164.212
@@ -110377,16 +111648,11 @@
  45.146.167.75
  45.146.168.71
  45.146.36.115
-45.147.160.45
-45.147.192.33
-45.147.192.52
  45.147.193.250
  45.147.198.233
  45.147.198.62
  45.147.228.245
  45.147.229.234
-45.147.253.10
-45.147.253.15
  45.148.10.12
  45.148.10.159
  45.148.10.160
@@ -110403,17 +111669,14 @@
  45.148.10.28
  45.148.10.38
  45.148.10.54
-45.148.10.60
  45.148.10.69
  45.148.10.72
  45.148.10.83
  45.148.10.86
-45.148.10.87
  45.148.10.89
  45.148.10.92
  45.148.10.94
  45.148.10.95
-45.148.10.98
  45.148.120.126
  45.148.120.155
  45.148.120.193
@@ -110424,20 +111687,18 @@
  45.148.122.113
  45.148.122.13
  45.148.122.184
-45.148.124.211
-45.148.124.29
+45.148.124.142
  45.148.125.116
  45.148.125.121
  45.148.125.127
  45.148.125.203
-45.148.125.209
-45.148.125.232
-45.148.125.237
  45.148.125.43
  45.148.125.88
-45.148.196.131
  45.148.232.235
+45.148.233.150
+45.148.233.44
  45.148.233.54
+45.148.234.154
  45.148.234.161
  45.148.235.123
  45.148.235.234
@@ -110446,6 +111707,7 @@
  45.148.75.252
  45.148.9.198
  45.148.9.20
+45.149.165.146
  45.149.165.27
  45.149.165.61
  45.149.78.128
@@ -110460,13 +111722,14 @@
  45.15.16.100
  45.15.16.72
  45.15.16.85
+45.15.237.137
  45.15.237.167
  45.15.237.65
  45.15.237.68
  45.15.24.48
-45.15.25.76
  45.15.61.233
  45.150.187.9
+45.150.206.103
  45.150.206.113
  45.150.206.114
  45.150.206.115
@@ -110474,12 +111737,14 @@
  45.150.206.117
  45.150.206.118
  45.150.206.119
+45.150.66.127
  45.150.66.158
  45.151.125.218
  45.151.125.33
  45.151.125.47
  45.151.145.47
  45.151.167.10
+45.151.169.96
  45.151.28.36
  45.151.88.170
  45.151.88.209
@@ -110492,6 +111757,7 @@
  45.151.88.44
  45.152.116.13
  45.152.182.135
+45.152.198.190
  45.152.198.194
  45.152.198.248
  45.152.198.37
@@ -110527,6 +111793,7 @@
  45.153.203.137
  45.153.203.140
  45.153.203.141
+45.153.203.153
  45.153.203.157
  45.153.203.17
  45.153.203.172
@@ -110538,14 +111805,13 @@
  45.153.203.216
  45.153.203.222
  45.153.203.226
-45.153.203.230
  45.153.203.235
  45.153.203.33
-45.153.203.34
  45.153.203.52
  45.153.217.195
  45.153.217.218
  45.153.217.240
+45.153.227.237
  45.153.240.17
  45.154.1.68
  45.154.1.71
@@ -110595,6 +111861,7 @@
  45.155.205.32
  45.155.205.33
  45.155.205.34
+45.155.207.98
  45.155.37.10
  45.155.42.128
  45.155.42.250
@@ -110622,7 +111889,6 @@
  45.156.30.239
  45.156.84.236
  45.157.138.108
-45.158.15.188
  45.158.187.159
  45.158.19.239
  45.158.199.10
@@ -110632,36 +111898,29 @@
  45.159.18.139
  45.159.18.242
  45.159.196.32
-45.159.23.104
-45.159.23.115
-45.159.23.143
-45.159.23.145
  45.159.23.147
-45.159.23.155
  45.159.23.195
  45.159.23.241
-45.159.23.32
  45.159.23.51
  45.159.23.64
  45.16.103.141
  45.16.226.117
  45.160.100.232
-45.160.131.18
-45.160.131.35
  45.160.131.58
  45.160.151.3
  45.160.191.6
  45.160.75.11
+45.161.112.142
  45.161.152.53
-45.161.184.50
  45.161.242.102
  45.161.255.21
  45.161.255.62
  45.162.123.9
-45.162.20.71
+45.162.20.186
  45.162.20.96
  45.162.203.138
  45.162.225.82
+45.162.231.250
  45.162.4.175
  45.162.4.83
  45.162.49.82
@@ -110680,8 +111939,10 @@
  45.163.207.5
  45.163.8.1
  45.163.8.120
+45.163.86.137
  45.164.140.130
  45.164.140.152
+45.164.153.227
  45.164.180.78
  45.164.198.6
  45.164.37.170
@@ -110690,14 +111951,18 @@
  45.165.152.26
  45.165.16.19
  45.165.168.220
+45.165.186.1
  45.165.213.188
+45.165.214.42
  45.165.59.211
  45.165.68.2
  45.165.68.5
  45.165.90.215
+45.166.119.74
  45.166.152.58
  45.166.186.222
  45.166.186.239
+45.166.21.165
  45.166.22.93
  45.166.246.3
  45.166.246.5
@@ -110705,7 +111970,6 @@
  45.166.33.141
  45.166.35.0
  45.166.35.17
-45.166.35.22
  45.166.35.4
  45.166.35.6
  45.166.35.8
@@ -110714,14 +111978,12 @@
  45.167.130.50
  45.167.144.11
  45.167.174.124
-45.167.174.168
-45.167.217.163
  45.167.220.135
+45.167.30.164
  45.167.36.35
+45.167.36.41
  45.167.36.43
  45.167.76.7
-45.168.15.209
-45.168.15.34
  45.168.15.53
  45.168.15.62
  45.168.160.50
@@ -110733,31 +111995,28 @@
  45.168.31.218
  45.168.31.253
  45.168.31.254
-45.168.34.83
  45.168.43.18
  45.168.43.20
  45.168.43.22
  45.168.56.33
-45.168.56.94
-45.168.57.154
+45.168.56.86
+45.168.57.102
+45.168.57.150
  45.168.57.166
  45.168.57.211
-45.168.57.236
  45.168.57.239
  45.168.57.240
-45.168.57.253
-45.168.57.80
+45.168.57.63
  45.168.57.86
  45.168.57.95
-45.168.57.97
  45.168.57.99
-45.168.58.33
-45.168.58.42
+45.168.58.96
  45.168.74.6
  45.168.96.1
  45.168.99.5
  45.169.136.185
  45.169.17.243
+45.169.17.254
  45.169.172.2
  45.169.196.17
  45.169.196.2
@@ -110775,31 +112034,34 @@
  45.17.72.227
  45.170.129.135
  45.170.129.193
+45.170.14.46
  45.170.14.56
  45.170.221.6
  45.171.124.30
  45.171.149.19
  45.171.237.86
  45.171.246.64
-45.171.59.157
  45.171.59.81
  45.172.133.0
  45.172.133.218
  45.172.172.119
+45.172.173.165
+45.172.173.39
+45.172.173.4
  45.173.12.196
  45.173.12.60
  45.173.130.97
  45.173.18.241
-45.173.18.83
  45.173.196.136
  45.173.198.249
-45.173.204.30
  45.173.28.1
  45.173.36.31
  45.173.72.2
  45.173.88.33
  45.174.149.4
  45.174.163.148
+45.174.166.10
+45.174.237.8
  45.175.108.148
  45.175.108.151
  45.175.12.36
@@ -110809,13 +112071,14 @@
  45.175.179.229
  45.175.179.230
  45.175.64.170
+45.176.108.123
  45.176.108.18
  45.176.108.189
  45.176.108.206
  45.176.108.208
+45.176.108.21
  45.176.108.222
  45.176.108.23
-45.176.108.31
  45.176.108.48
  45.176.108.95
  45.176.109.161
@@ -110826,17 +112089,16 @@
  45.176.109.239
  45.176.109.250
  45.176.109.28bin.sh
+45.176.109.57
  45.176.110.106
  45.176.110.118
  45.176.110.127
-45.176.110.130
  45.176.110.154
  45.176.110.16
  45.176.110.19
+45.176.110.204
  45.176.110.233
  45.176.110.254
-45.176.110.44
-45.176.110.88
  45.176.111.100
  45.176.111.119
  45.176.111.135
@@ -110844,18 +112106,16 @@
  45.176.111.193
  45.176.111.37
  45.176.111.44
-45.176.111.59
  45.176.111.69
-45.176.111.84
  45.176.133.46
  45.176.208.50
+45.176.213.72
  45.176.215.0
  45.176.244.48
  45.176.40.169
  45.177.109.244
  45.177.110.35
  45.177.110.36
-45.177.110.42
  45.177.196.201
  45.177.206.1
  45.177.207.1
@@ -110868,15 +112128,14 @@
  45.178.48.54
  45.178.96.13
  45.179.189.149
-45.179.191.82
  45.179.223.26
  45.179.24.234
+45.179.247.15
  45.179.54.4
  45.180.110.102
-45.180.117.17
-45.180.148.129
  45.180.159.235
  45.180.228.9
+45.181.19.64
  45.181.197.135
  45.181.228.209
  45.181.228.210
@@ -110885,14 +112144,15 @@
  45.181.228.216
  45.181.228.218
  45.181.228.220
+45.181.228.223
  45.181.229.209
  45.181.25.25
  45.181.31.118
+45.181.31.147
  45.181.48.2
-45.181.84.23
-45.181.84.24
+45.181.84.20
  45.181.84.28
-45.181.84.30
+45.181.84.29
  45.182.144.40
  45.182.156.13
  45.182.156.3
@@ -110919,9 +112179,9 @@
  45.185.134.163
  45.185.135.19
  45.185.135.66
-45.185.135.84
  45.185.181.31
  45.185.195.51
+45.185.40.33
  45.185.40.6
  45.185.41.65
  45.186.145.155
@@ -110942,11 +112202,11 @@
  45.188.198.212
  45.188.198.219
  45.188.198.229
-45.188.198.31
  45.188.198.42
  45.188.198.51
  45.188.198.52
  45.188.198.79
+45.188.198.92
  45.188.199.15
  45.188.199.194
  45.188.199.199
@@ -110959,6 +112219,7 @@
  45.189.187.1
  45.189.204.26
  45.189.21.91
+45.189.56.18
  45.190.151.250
  45.190.178.1
  45.190.178.13
@@ -110970,7 +112231,6 @@
  45.190.179.2
  45.190.179.5
  45.190.228.2
-45.190.231.171
  45.190.252.62
  45.191.101.252
  45.191.101.31
@@ -110984,14 +112244,13 @@
  45.192.176.181
  45.195.152.140
  45.195.177.32
+45.195.202.193
  45.199.13.17
-45.2.214.83
+45.20.210.161
  45.20.67.1
-45.201.132.110
  45.201.135.81
  45.201.145.61
  45.201.163.240
-45.201.163.248
  45.201.163.85
  45.201.164.42
  45.201.166.251
@@ -111001,12 +112260,14 @@
  45.201.188.95
  45.201.189.201
  45.201.194.215
-45.201.198.248
  45.201.200.44
  45.201.207.146
  45.201.209.44
  45.201.212.170
+45.202.9.160
+45.207.58.113
  45.219.21.67
+45.22.19.58
  45.221.11.24
  45.221.47.133
  45.221.56.41
@@ -111019,9 +112280,12 @@
  45.224.171.88
  45.224.173.254
  45.224.197.137
+45.224.22.26
  45.224.23.99
  45.224.43.68
  45.224.43.89
+45.224.98.163
+45.225.106.4
  45.225.110.193
  45.225.110.195
  45.225.110.221
@@ -111029,7 +112293,6 @@
  45.225.201.10
  45.225.49.202
  45.225.90.118
-45.225.92.58
  45.225.92.93
  45.226.163.205
  45.226.48.101
@@ -111038,7 +112301,6 @@
  45.226.48.54
  45.226.48.57
  45.226.48.61
-45.227.110.205
  45.227.156.179
  45.227.156.66
  45.227.159.7
@@ -111054,12 +112316,13 @@
  45.228.137.6
  45.228.16.1
  45.228.189.240
-45.228.205.150
+45.228.210.251
  45.228.217.11
  45.228.4.1
  45.228.4.18
  45.228.4.229
  45.228.4.249
+45.228.4.45
  45.228.4.50
  45.228.4.54
  45.228.4.61
@@ -111069,7 +112332,6 @@
  45.228.6.248
  45.228.96.34
  45.229.123.236
-45.229.126.12
  45.229.132.143
  45.229.138.6
  45.229.173.234
@@ -111094,15 +112356,14 @@
  45.230.191.24
  45.230.191.40
  45.230.240.107
-45.230.69.248
  45.230.8.20
+45.230.91.253
  45.231.12.37
  45.231.139.231
  45.231.145.103
  45.231.145.61
  45.231.213.110
  45.231.58.1
-45.231.61.227
  45.232.148.145
  45.232.177.242
  45.232.215.145
@@ -111114,15 +112375,18 @@
  45.232.249.62
  45.232.59.163
  45.232.64.17
+45.232.64.81
  45.232.65.214
  45.232.65.77
  45.232.66.66
+45.232.73.46
  45.232.73.46bin.sh
  45.232.73.83
  45.232.75.253
  45.232.95.124
  45.233.106.72
  45.233.116.59
+45.233.159.20
  45.233.169.14
  45.233.206.96
  45.233.23.100
@@ -111134,24 +112398,22 @@
  45.233.92.125
  45.233.95.120
  45.234.116.34
-45.234.116.40
+45.234.148.1
  45.234.28.140
  45.234.28.141
  45.234.28.143
  45.234.69.150
+45.234.69.178
  45.234.90.46
-45.235.110.66
  45.235.120.65
  45.235.131.2
  45.235.154.187
  45.235.16.88
  45.235.169.2
  45.235.22.243
-45.235.222.215
  45.235.37.37
  45.235.37.90
  45.235.37.98
-45.235.86.1
  45.235.87.138
  45.235.93.14
  45.236.117.25
@@ -111160,7 +112422,8 @@
  45.236.129.243
  45.236.130.158
  45.236.130.211
-45.236.149.87
+45.236.137.209
+45.236.149.4
  45.236.170.6
  45.236.170.9
  45.236.171.122
@@ -111168,20 +112431,15 @@
  45.236.94.8
  45.237.140.13
  45.237.182.98
-45.237.19.194
  45.237.7.216
  45.238.1.234
-45.238.121.129
-45.238.121.154
-45.238.121.206
-45.238.121.207
+45.238.121.198
+45.238.121.209
  45.238.121.232
  45.238.121.249
-45.238.122.107
  45.238.122.124
-45.238.122.174
-45.238.122.219
  45.238.122.88
+45.238.123.220
  45.238.123.223
  45.238.208.10
  45.238.208.6
@@ -111189,7 +112447,6 @@
  45.238.232.42
  45.238.252.74
  45.238.253.133
-45.238.3.216
  45.239.106.32
  45.239.106.5
  45.239.127.98
@@ -111197,15 +112454,16 @@
  45.239.180.6
  45.239.204.100
  45.239.232.182
+45.239.84.133
  45.240.103.44
  45.240.110.172
  45.240.165.228
  45.240.165.56
  45.240.169.32
+45.240.241.159
  45.240.242.19
  45.240.250.6
  45.240.255.138
-45.240.29.255
  45.240.88.16
  45.240.88.20
  45.240.88.25
@@ -111216,17 +112474,15 @@
  45.247.150.190
  45.248.138.210
  45.248.139.140
-45.248.193.24
-45.248.194.248
+45.248.192.185
+45.248.192.216
  45.248.195.108
  45.248.195.170
  45.248.195.94
  45.248.43.33
  45.248.57.126
-45.248.59.131
  45.248.64.58
  45.248.71.169
-45.248.78.244
  45.248.85.91
  45.248.86.69
  45.248.86.88
@@ -111234,7 +112490,6 @@
  45.248.94.195
  45.248.94.60
  45.248.95.28
-45.249.10.100
  45.249.100.40
  45.249.101.1
  45.249.122.6
@@ -111246,6 +112501,7 @@
  45.249.79.185
  45.249.79.190
  45.249.88.41
+45.249.91.179
  45.249.91.180
  45.249.91.246
  45.250.199.90
@@ -111254,6 +112510,7 @@
  45.250.226.56
  45.250.37.130
  45.250.37.136
+45.250.37.162
  45.250.37.174
  45.250.37.186
  45.250.37.187
@@ -111283,25 +112540,20 @@
  45.254.247.234
  45.254.254.130
  45.26.142.184
-45.27.11.176
-45.27.48.161
  45.29.158.89
  45.3.231.147
-45.31.116.252
  45.32.10.111
  45.32.103.230
  45.32.104.130
  45.32.104.138
  45.32.104.199
  45.32.104.30
-45.32.106.145
  45.32.109.115
  45.32.111.57
  45.32.114.82
  45.32.115.227
  45.32.115.39
  45.32.115.62
-45.32.116.115
  45.32.116.44
  45.32.117.192
  45.32.119.194
@@ -111415,7 +112667,6 @@
  45.33.22.66
  45.33.24.209
  45.33.3.16
-45.33.30.245
  45.33.31.176
  45.33.32.46
  45.33.38.249
@@ -111445,7 +112696,6 @@
  45.33.78.170
  45.33.81.202
  45.33.83.233
-45.33.84.24
  45.33.86.149
  45.33.91.252
  45.33.96.212
@@ -111457,11 +112707,12 @@
  45.35.38.114
  45.35.86.118
  45.36.184.6
-45.36.33.250
  45.39.54.51
  45.4.120.236
  45.4.158.22
+45.4.171.31
  45.4.183.30
+45.4.202.109
  45.4.216.52
  45.4.216.54
  45.4.216.71
@@ -111477,21 +112728,19 @@
  45.4.85.152
  45.4.85.76
  45.40.130.40
-45.40.164.164
  45.40.166.142
  45.40.166.144
-45.40.166.145
  45.40.192.155
  45.40.193.40
  45.40.194.129
  45.40.198.93
  45.40.199.82
-45.40.202.134
  45.40.203.112
  45.40.228.204
  45.40.234.156
  45.40.234.46
  45.40.253.179
+45.41.181.125
  45.41.181.88
  45.42.99.241
  45.43.105.89
@@ -111499,16 +112748,18 @@
  45.43.18.215
  45.43.21.31
  45.43.27.71
+45.43.45.250
  45.43.54.31
  45.43.63.41
+45.44.153.34
  45.44.208.10
  45.44.67.105
  45.46.162.85
  45.47.211.246
  45.48.168.16
+45.48.209.6
  45.49.227.60
  45.5.119.86
-45.5.131.247
  45.5.146.136
  45.5.152.78
  45.5.201.18
@@ -111517,6 +112768,7 @@
  45.5.208.25
  45.5.208.29
  45.5.208.6
+45.5.208.70
  45.5.208.72
  45.5.36.104
  45.50.112.141
@@ -111548,6 +112800,7 @@
  45.55.156.19
  45.55.157.1
  45.55.157.126
+45.55.157.158
  45.55.159.57
  45.55.16.175
  45.55.160.193
@@ -111653,6 +112906,7 @@
  45.55.61.114
  45.55.61.52
  45.55.63.118
+45.55.65.221
  45.55.65.92
  45.55.67.45
  45.55.70.15
@@ -111679,11 +112933,13 @@
  45.56.115.19
  45.56.119.204
  45.56.119.224
+45.56.120.180
  45.56.121.92
  45.56.122.128
  45.56.122.133
  45.56.122.75
  45.56.126.93
+45.56.137.66
  45.56.142.72
  45.56.162.8
  45.56.71.50
@@ -111707,18 +112963,15 @@
  45.57.163.219
  45.57.214.228
  45.57.218.203
-45.57.220.232
  45.57.220.236
  45.57.220.238
-45.57.230.153
  45.57.234.29
  45.57.247.164
  45.57.247.29
  45.57.247.35
  45.57.247.59
  45.57.252.135
-45.57.255.105
-45.58.52.13
+45.58.184.90
  45.58.52.17
  45.58.56.76
  45.59.245.93
@@ -111734,6 +112987,7 @@
  45.6.228.178
  45.6.229.224
  45.6.231.106
+45.6.27.151
  45.6.27.196
  45.6.36.70
  45.6.37.241
@@ -111743,6 +112997,8 @@
  45.61.136.136
  45.61.136.31
  45.61.139.48
+45.61.160.100
+45.61.160.154
  45.61.160.75
  45.61.161.13
  45.61.161.16
@@ -111751,14 +113007,18 @@
  45.61.162.119
  45.61.162.195
  45.61.162.95
-45.61.163.21
  45.61.163.49
-45.61.164.213
  45.61.165.20
  45.61.165.220
-45.61.165.61
+45.61.165.31
+45.61.165.41
  45.61.166.100
-45.61.167.106
+45.61.166.112
+45.61.166.81
+45.61.166.85
+45.61.166.97
+45.61.167.118
+45.61.167.179
  45.61.168.18
  45.61.168.30
  45.61.168.32
@@ -111772,6 +113032,7 @@
  45.61.169.66
  45.61.170.156
  45.61.170.181
+45.61.171.219
  45.61.171.232
  45.61.171.233
  45.61.171.30
@@ -111851,12 +113112,11 @@
  45.64.85.242
  45.64.9.126
  45.64.96.119
-45.64.96.62
  45.64.99.13
  45.65.128.216
  45.65.128.218
  45.65.129.38
-45.65.131.131
+45.65.131.130
  45.65.131.132
  45.65.131.138
  45.65.131.140
@@ -111864,9 +113124,11 @@
  45.65.198.104
  45.65.198.140
  45.65.233.73
+45.65.241.104
  45.65.251.186
  45.65.65.18
  45.66.10.41
+45.66.11.13
  45.66.150.249
  45.66.150.253
  45.66.156.103
@@ -111877,13 +113139,12 @@
  45.66.158.157
  45.66.158.158
  45.66.208.81
+45.66.209.103
  45.66.209.119
-45.66.209.121
  45.66.209.150
  45.66.209.167
-45.66.209.179
-45.66.209.203
  45.66.209.35
+45.66.210.134
  45.66.35.35
  45.66.45.115
  45.66.9.110
@@ -111894,36 +113155,21 @@
  45.67.113.71
  45.67.14.154
  45.67.14.61
-45.67.212.119
+45.67.153.21
  45.67.212.135
  45.67.212.183
  45.67.212.201
  45.67.212.249
-45.67.212.56
  45.67.212.72
-45.67.212.79
  45.67.212.81
-45.67.212.94
-45.67.213.12
-45.67.213.126
-45.67.213.136
  45.67.213.153
  45.67.213.177
-45.67.213.178
-45.67.213.191
-45.67.213.241
-45.67.213.32
-45.67.213.37
  45.67.213.50
  45.67.213.62
-45.67.213.72
  45.67.213.76
  45.67.213.89
-45.67.213.95
-45.67.214.105
  45.67.214.131
  45.67.214.177
-45.67.214.186
  45.67.214.205
  45.67.214.250
  45.67.214.98
@@ -111967,14 +113213,11 @@
  45.7.177.248
  45.7.178.106
  45.7.179.201
-45.7.182.15
  45.7.196.77
  45.7.205.103
  45.7.208.130
  45.7.208.144
-45.7.224.82
  45.7.231.15
-45.7.231.94
  45.7.238.90
  45.70.0.137
  45.70.0.17
@@ -111990,14 +113233,13 @@
  45.70.204.238
  45.70.204.245
  45.70.204.249
-45.70.204.254
  45.70.207.253
  45.70.208.42
  45.70.3.30
+45.70.5.210
  45.70.5.249
  45.70.59.254
  45.70.84.229
-45.70.94.133
  45.70.94.149
  45.71.108.18
  45.71.113.187
@@ -112017,24 +113259,26 @@
  45.71.80.9
  45.72.0.247
  45.72.109.125
-45.72.119.143
  45.72.129.231
  45.72.219.100
  45.72.219.86
-45.72.223.119
+45.72.234.166
+45.72.26.14
  45.72.3.143
  45.72.35.243
-45.72.61.149
  45.72.61.201
  45.72.61.209
  45.72.61.225
-45.72.67.60
+45.72.67.15
+45.72.67.61
+45.72.67.70
  45.72.67.79
-45.72.67.93
+45.72.67.92
  45.72.7.197
  45.72.71.180
  45.72.71.214
  45.72.71.220
+45.72.73.17
  45.73.13.205
  45.74.102.117
  45.74.150.145
@@ -112078,7 +113322,6 @@
  45.76.153.45
  45.76.153.90
  45.76.159.251
-45.76.159.82
  45.76.161.189
  45.76.164.246
  45.76.165.182
@@ -112093,8 +113336,8 @@
  45.76.179.26
  45.76.179.89
  45.76.18.117
+45.76.184.228
  45.76.186.19
-45.76.187.18
  45.76.187.236
  45.76.188.166
  45.76.19.208
@@ -112108,7 +113351,6 @@
  45.76.199.36
  45.76.20.147
  45.76.20.69
-45.76.202.121
  45.76.203.14
  45.76.203.62
  45.76.207.18
@@ -112214,13 +113456,13 @@
  45.77.237.44
  45.77.239.36
  45.77.24.175
-45.77.24.185
  45.77.24.247
  45.77.24.57
  45.77.243.33
  45.77.245.227
  45.77.247.65
  45.77.248.223
+45.77.251.151
  45.77.251.244
  45.77.26.160
  45.77.28.74
@@ -112286,7 +113528,6 @@
  45.79.125.42
  45.79.126.229
  45.79.126.240
-45.79.127.61
  45.79.133.137
  45.79.136.161
  45.79.136.228
@@ -112314,6 +113555,7 @@
  45.79.179.13
  45.79.179.161
  45.79.179.9
+45.79.180.166
  45.79.181.142
  45.79.181.179
  45.79.183.66
@@ -112340,6 +113582,7 @@
  45.79.217.155
  45.79.217.188
  45.79.218.133
+45.79.218.149
  45.79.219.179
  45.79.219.40
  45.79.221.101
@@ -112348,8 +113591,6 @@
  45.79.223.169
  45.79.225.171
  45.79.250.77
-45.79.26.223
-45.79.34.124
  45.79.37.121
  45.79.37.122
  45.79.4.230
@@ -112378,34 +113619,21 @@
  45.79.95.107
  45.79.95.154
  45.79.99.208
-45.8.116.127
-45.8.227.175
  45.8.99.201
-45.8.99.213
  45.8.99.225
-45.8.99.232
  45.8.99.248
-45.80.105.136
  45.80.105.189
-45.80.105.35
  45.80.106.101
-45.80.106.105
  45.80.106.116
-45.80.106.12
  45.80.106.152
  45.80.106.171
-45.80.106.211
  45.80.106.235
-45.80.106.240
-45.80.106.53
-45.80.106.55
  45.80.106.59
  45.80.107.127
  45.80.107.135
  45.80.107.150
-45.80.107.166
  45.80.107.174
-45.80.107.201
+45.80.107.202
  45.80.107.243
  45.80.107.250
  45.80.107.91
@@ -112429,7 +113657,6 @@
  45.81.7.40
  45.81.7.68
  45.81.7.72
-45.81.84.15
  45.82.120.55
  45.82.121.61
  45.82.138.80
@@ -112453,9 +113680,14 @@
  45.82.197.207
  45.82.197.3
  45.82.197.90
+45.82.198.45
+45.82.223.37
+45.82.223.51
+45.82.223.93
  45.82.72.92
  45.83.104.161
  45.83.118.66
+45.83.27.131
  45.83.27.152
  45.83.64.1
  45.83.64.107
@@ -112626,10 +113858,11 @@
  45.83.67.56
  45.83.67.9
  45.83.67.92
+45.83.90.180
  45.83.91.42
+45.83.91.90
  45.84.0.192
  45.84.0.193
-45.84.0.195
  45.84.172.14
  45.84.172.32
  45.84.172.59
@@ -112644,7 +113877,6 @@
  45.84.196.108
  45.84.196.110
  45.84.196.113
-45.84.196.120
  45.84.196.121
  45.84.196.124
  45.84.196.130
@@ -112696,16 +113928,15 @@
  45.85.0.98
  45.85.219.74
  45.85.85.8
-45.86.201.108
  45.86.201.173
  45.86.201.189
+45.86.201.52
  45.86.65.210
  45.86.68.29
  45.87.186.76
  45.87.213.162
  45.87.213.88
  45.87.228.50
-45.87.248.98
  45.87.252.125
  45.87.253.107
  45.87.253.71
@@ -112717,18 +113948,20 @@
  45.87.43.128
  45.87.89.89
  45.88.106.132
-45.88.106.36
  45.88.106.72
  45.88.106.90
+45.88.106.96
  45.88.110.171
  45.88.13.194
  45.88.209.181
+45.88.209.55
  45.88.3.145
  45.88.55.25
  45.89.124.41
  45.89.140.83
  45.89.16.45
  45.89.174.102
+45.89.174.104
  45.89.233.98
  45.89.67.171
  45.89.67.49
@@ -112739,8 +113972,6 @@
  45.9.188.239
  45.9.189.127
  45.9.189.172
-45.9.228.50
-45.9.230.146
  45.9.251.14
  45.9.46.139
  45.9.61.196
@@ -112772,6 +114003,7 @@
  45.93.201.121
  45.93.201.131
  45.93.201.62
+45.94.232.109
  45.94.232.124
  45.94.232.146
  45.94.232.151
@@ -112781,7 +114013,6 @@
  45.94.232.199
  45.94.232.214
  45.94.232.243
-45.94.233.172
  45.94.234.133
  45.94.234.17
  45.94.234.179
@@ -112922,6 +114153,7 @@
  45.95.169.7
  45.95.235.45
  45.95.235.86
+45.95.28.247
  45.95.39.101
  45.95.39.141
  45.95.39.142
@@ -112965,7 +114197,6 @@
  45tges3.icu
  45tuyr.site
  46.0.205.102
-46.0.228.207
  46.1.2.157
  46.1.53.21
  46.10.106.212
@@ -112973,7 +114204,6 @@
  46.10.199.90
  46.10.221.163
  46.10.253.4
-46.10.67.181
  46.100.249.100
  46.100.55.18
  46.100.55.79
@@ -113038,18 +114268,17 @@
  46.101.146.208
  46.101.146.6
  46.101.149.23
-46.101.15.161
  46.101.150.9
  46.101.151.167
  46.101.152.58
  46.101.152.77
  46.101.154.96
-46.101.156.213
  46.101.156.22
  46.101.158.114
  46.101.164.33
  46.101.164.46
  46.101.164.5
+46.101.165.120
  46.101.165.56
  46.101.165.62
  46.101.165.95
@@ -113097,7 +114326,6 @@
  46.101.197.228
  46.101.197.40
  46.101.2.135
-46.101.2.142
  46.101.201.158
  46.101.201.4
  46.101.202.115
@@ -113134,6 +114362,7 @@
  46.101.230.235
  46.101.233.75
  46.101.235.128
+46.101.235.215
  46.101.236.48
  46.101.236.77
  46.101.237.216
@@ -113184,7 +114413,6 @@
  46.101.55.40
  46.101.58.37
  46.101.6.43
-46.101.6.76
  46.101.61.207
  46.101.61.36
  46.101.66.194
@@ -113244,7 +114472,6 @@
  46.105.17.34
  46.105.171.109
  46.105.18.17
-46.105.183.36
  46.105.226.77
  46.105.227.206
  46.105.243.22
@@ -113269,22 +114496,18 @@
  46.107.228.254
  46.107.230.122
  46.107.230.156
-46.107.238.24
-46.107.238.30
  46.108.136.27
  46.109.53.63
  46.109.6.229
  46.11.240.1
+46.114.0.131
  46.114.104.216
-46.114.106.71
+46.114.106.54
  46.114.107.155
  46.114.108.32
-46.114.146.132
-46.114.148.118
-46.114.150.37
-46.114.150.40
-46.114.150.73
-46.114.7.182
+46.114.111.36
+46.114.2.221
+46.114.57.73
  46.114.7.91
  46.118.112.135
  46.118.113.15
@@ -113307,7 +114530,6 @@
  46.119.115.106
  46.119.121.84
  46.119.127.129
-46.119.150.38
  46.119.158.244
  46.119.160.162
  46.119.160.60
@@ -113337,7 +114559,6 @@
  46.125.67.230
  46.126.139.2
  46.126.208.238
-46.126.211.112
  46.126.211.168
  46.126.217.197
  46.126.236.2
@@ -113345,21 +114566,22 @@
  46.126.96.244
  46.127.38.231
  46.128.140.193
+46.128.194.213
+46.128.241.191
  46.128.241.64
  46.130.119.42
  46.130.127.172
-46.132.185.206
  46.136.51.234
  46.137.102.36
  46.137.138.142
-46.138.246.87
  46.139.105.181
+46.140.209.114
  46.140.88.243
  46.141.122.77
  46.141.13.239
  46.141.92.60
+46.142.1.34
  46.142.165.102
-46.142.25.141
  46.142.7.209
  46.143.184.209
  46.146.136.8
@@ -113374,16 +114596,12 @@
  46.146.239.105
  46.146.240.185
  46.146.240.199
-46.146.244.97
-46.146.36.104
+46.146.248.89
  46.146.48.171
  46.146.54.164
-46.146.63.0
  46.147.117.100
-46.147.123.166
  46.147.132.50
  46.148.18.122
-46.148.189.74
  46.148.190.223
  46.148.20.25
  46.148.206.226
@@ -113391,7 +114609,7 @@
  46.148.26.78
  46.148.35.49
  46.148.36.236
-46.148.44.68
+46.148.44.128
  46.149.113.2
  46.149.176.223
  46.149.177.111
@@ -113407,6 +114625,7 @@
  46.149.190.234
  46.149.190.243
  46.149.191.56
+46.149.233.190
  46.149.86.51
  46.150.164.64
  46.150.170.10
@@ -113415,25 +114634,21 @@
  46.150.252.11
  46.150.7.15
  46.150.75.100
-46.150.76.25
  46.151.150.11
  46.151.157.115
  46.151.215.107
  46.151.241.85
  46.151.52.196
  46.151.60.99
+46.151.72.95
  46.152.110.9
  46.152.147.228
  46.152.211.224
  46.152.78.103
  46.153.134.232
-46.154.118.195
-46.158.169.212
-46.158.7.189
  46.158.81.33
  46.158.92.169
  46.159.20.147
-46.159.76.177
  46.16.10.155
  46.16.226.6
  46.16.228.6
@@ -113460,7 +114675,6 @@
  46.161.60.230
  46.161.60.242
  46.161.60.37
-46.161.60.63
  46.161.60.81
  46.161.61.194
  46.161.61.211
@@ -113491,14 +114705,10 @@
  46.161.62.240
  46.161.62.243
  46.161.62.246
-46.161.62.248
  46.161.62.254
  46.161.62.33
-46.161.62.38
-46.161.62.51
  46.161.62.62
  46.161.62.69
-46.161.62.73
  46.161.62.74
  46.161.62.86
  46.161.62.87
@@ -113554,6 +114764,7 @@
  46.161.63.20
  46.161.63.200
  46.161.63.201
+46.161.63.204
  46.161.63.206
  46.161.63.209
  46.161.63.214
@@ -113573,7 +114784,6 @@
  46.161.63.24
  46.161.63.240
  46.161.63.242
-46.161.63.244
  46.161.63.245
  46.161.63.251
  46.161.63.253
@@ -113592,7 +114802,6 @@
  46.161.63.61
  46.161.63.67
  46.161.63.68
-46.161.63.69
  46.161.63.70
  46.161.63.72
  46.161.63.73
@@ -113613,7 +114822,6 @@
  46.161.9.6
  46.161.9.8
  46.162.192.165
-46.162.72.223
  46.163.144.228
  46.163.72.236
  46.164.143.82
@@ -113621,34 +114829,40 @@
  46.164.246.184
  46.164.248.220
  46.164.251.129
-46.165.129.143
+46.165.129.163
+46.165.130.240
+46.165.130.79
  46.165.131.66
-46.165.132.43
+46.165.132.188
  46.165.133.91
  46.165.134.123
+46.165.135.234
  46.165.135.245
-46.165.137.198
+46.165.135.53
+46.165.136.84
+46.165.138.77
  46.165.138.80
  46.165.138.90
-46.165.140.186
+46.165.142.0
  46.165.144.125
  46.165.147.137
+46.165.147.150
  46.165.147.217
+46.165.148.167
  46.165.150.198
  46.165.151.155
  46.165.160.110
-46.165.176.42
-46.165.178.41
+46.165.178.12
+46.165.178.252
  46.165.178.83
+46.165.179.169
  46.165.180.37
  46.165.181.47
-46.165.182.30
-46.165.183.238
-46.165.185.49
-46.165.186.106
+46.165.186.213
+46.165.186.25
  46.165.187.227
  46.165.187.43
-46.165.189.174
+46.165.188.242
  46.165.197.141
  46.165.210.17
  46.165.220.212
@@ -113689,7 +114903,6 @@
  46.166.163.246
  46.166.165.178
  46.166.170.42
-46.166.171.50
  46.166.173.109
  46.166.173.186
  46.166.173.33
@@ -113707,7 +114920,6 @@
  46.166.187.193
  46.166.187.223
  46.166.188.208
-46.166.188.75
  46.166.190.182
  46.166.190.192
  46.166.190.200
@@ -113718,12 +114930,13 @@
  46.167.244.251
  46.167.244.56
  46.167.244.59
-46.167.68.8
  46.17.100.14
  46.17.106.109
  46.17.106.61
  46.17.121.109
  46.17.121.19
+46.17.175.19
+46.17.46.251
  46.17.46.55
  46.17.47.195
  46.17.99.143
@@ -113738,15 +114951,12 @@
  46.172.223.250
  46.172.4.111
  46.172.56.2
-46.172.6.30
  46.172.63.49
  46.172.69.163
  46.172.69.76
-46.172.78.247
  46.172.79.58
  46.172.84.203
  46.172.90.198
-46.173.105.151
  46.173.11.110
  46.173.165.208
  46.173.165.236
@@ -113788,20 +114998,18 @@
  46.176.244.203
  46.176.48.237
  46.18.202.159
-46.18.67.66
  46.18.76.4
  46.180.141.150
  46.180.156.230
  46.181.102.77
  46.182.106.190
  46.182.111.80
+46.182.173.245
  46.182.19.219
  46.182.19.49
  46.182.21.248
  46.182.240.27
  46.182.5.30
-46.182.5.40
-46.182.86.174
  46.183.117.188
  46.183.216.142
  46.183.217.69
@@ -113839,6 +115047,7 @@
  46.185.213.62
  46.185.240.125
  46.185.246.193
+46.186.250.202
  46.187.56.214
  46.188.10.187
  46.188.109.21
@@ -113881,7 +115090,6 @@
  46.195.178.84
  46.195.181.23
  46.197.213.251
-46.198.141.82
  46.199.195.95
  46.2.242.2
  46.20.152.56
@@ -113892,9 +115100,11 @@
  46.20.59.11
  46.20.93.83
  46.200.137.238
+46.200.157.213
  46.200.40.235
  46.200.74.213
  46.200.9.204
+46.201.199.138
  46.201.227.148
  46.201.23.66
  46.201.243.216
@@ -113906,6 +115116,7 @@
  46.209.141.242
  46.209.209.74
  46.209.210.230
+46.209.251.130
  46.209.36.82
  46.209.47.193
  46.209.47.3
@@ -113919,23 +115130,24 @@
  46.21.171.85
  46.21.250.205
  46.21.252.100
+46.21.55.3
  46.21.60.215
-46.21.80.108
  46.21.97.90
+46.210.124.130
  46.212.177.70
  46.214.12.169
  46.214.120.147
  46.214.123.55
  46.214.125.132
+46.214.183.35
  46.214.201.152
  46.214.241.156
-46.214.37.242
  46.214.70.50
  46.216.11.214
  46.216.25.182
  46.216.54.244
  46.216.59.142
-46.217.196.7
+46.217.74.116
  46.217.75.120
  46.217.75.65
  46.218.155.194
@@ -113952,7 +115164,6 @@
  46.22.120.82
  46.22.166.103
  46.22.173.131
-46.22.220.37
  46.22.254.254
  46.22.48.26
  46.22.49.41
@@ -113969,7 +115180,6 @@
  46.224.2.69
  46.225.119.60
  46.225.126.139
-46.225.152.179
  46.225.233.149
  46.225.240.122
  46.225.241.19
@@ -113979,7 +115189,6 @@
  46.226.109.100
  46.226.111.23
  46.226.18.135
-46.227.122.26
  46.227.152.110
  46.227.162.98
  46.227.36.147
@@ -114027,10 +115236,10 @@
  46.229.224.194
  46.229.238.187
  46.229.67.198
-46.23.184.111
  46.23.42.113
  46.23.74.181
  46.23.87.218
+46.231.170.1
  46.231.66.202
  46.232.132.249
  46.232.176.45
@@ -114038,21 +115247,18 @@
  46.232.251.191
  46.232.251.222
  46.233.20.96
+46.233.28.137
  46.233.40.185
  46.233.9.28
  46.234.155.92
  46.235.141.221
  46.235.219.130
  46.235.53.26
-46.235.75.61
-46.235.85.101
-46.235.86.227
  46.235.91.97
  46.236.116.143
  46.236.194.34
  46.236.79.13
  46.237.253.139
-46.237.49.3
  46.238.122.54
  46.238.41.201
  46.24.130.254
@@ -114069,7 +115275,6 @@
  46.242.145.104
  46.242.38.14
  46.242.66.240
-46.242.9.87
  46.243.12.99
  46.243.145.131
  46.243.145.132
@@ -114077,23 +115282,26 @@
  46.243.147.131
  46.243.149.130
  46.243.150.35
+46.243.156.128
  46.243.160.253
  46.243.179.115
  46.243.189.99
  46.243.220.226
  46.243.220.232
-46.243.220.52
  46.243.221.20
  46.243.221.39
  46.243.221.81
+46.243.221.9
  46.243.68.16
  46.244.230.44
+46.244.29.36
  46.244.57.184
  46.245.222.203
  46.246.106.20
  46.246.122.34
  46.246.123.133
  46.246.123.151
+46.246.26.8
  46.246.3.254
  46.246.35.203
  46.246.35.94
@@ -114110,8 +115318,9 @@
  46.246.62.206
  46.246.77.55
  46.246.94.204
+46.248.164.217
  46.248.167.156
-46.248.48.95
+46.248.173.39
  46.249.114.178
  46.249.199.7
  46.249.204.180
@@ -114135,23 +115344,20 @@
  46.251.98.68
  46.252.100.42
  46.252.107.81
+46.252.21.137
+46.252.21.236
+46.252.24.150
  46.252.25.129
-46.252.35.80
  46.252.63.68
  46.253.1.246
  46.253.234.231
-46.253.39.142
  46.254.11.194
  46.254.217.169
-46.254.217.54
  46.254.217.67
  46.254.240.106
  46.254.247.53
  46.254.247.60
  46.255.211.20
-46.255.66.202
-46.255.70.75
-46.255.71.191
  46.26.133.184
  46.26.134.157
  46.26.157.54
@@ -114171,10 +115377,9 @@
  46.28.227.78
  46.28.67.124
  46.28.75.214
-46.29.11.254
+46.28.76.194
  46.29.116.3
  46.29.116.6
-46.29.160.113
  46.29.160.116
  46.29.161.214
  46.29.164.140
@@ -114183,12 +115388,12 @@
  46.29.165.170
  46.29.165.49
  46.29.166.105
+46.29.167.195
  46.29.167.235
  46.29.211.7
  46.29.248.238
  46.29.250.186
  46.29.250.203
-46.29.250.217
  46.29.251.108
  46.29.251.124
  46.29.251.236
@@ -114196,9 +115401,7 @@
  46.29.251.45
  46.29.252.108
  46.29.254.246
-46.29.255.140
  46.29.79.57
-46.29.9.46
  46.31.177.209
  46.31.33.36
  46.32.100.55
@@ -114206,7 +115409,6 @@
  46.32.2.158
  46.32.234.8
  46.32.239.84
-46.32.252.84
  46.32.254.123
  46.32.50.98
  46.32.53.120
@@ -114227,22 +115429,20 @@
  46.33.54.202
  46.34.153.66
  46.34.161.9
-46.34.198.217
-46.34.200.29
+46.34.189.247
  46.35.184.187
  46.35.19.18
  46.35.249.189
  46.35.254.156
  46.35.7.43
  46.36.132.68
-46.36.146.241
  46.36.220.44
  46.36.27.120
  46.36.70.144
  46.37.188.139
  46.37.31.195
+46.37.31.201
  46.38.142.142
-46.38.233.161
  46.38.235.14
  46.38.235.236
  46.38.237.108
@@ -114309,6 +115509,7 @@
  46.4.91.109
  46.4.92.21
  46.4.94.175
+46.40.2.195
  46.40.229.31
  46.40.92.231
  46.41.134.9
@@ -114317,7 +115518,7 @@
  46.41.196.77
  46.42.16.160
  46.42.18.28
-46.42.232.208
+46.42.37.38
  46.43.1.22
  46.43.2.95
  46.43.204.88
@@ -114327,7 +115528,6 @@
  46.44.166.125
  46.45.15.200
  46.45.187.49
-46.45.19.138
  46.45.229.159
  46.46.85.97
  46.47.135.114
@@ -114347,18 +115547,16 @@
  46.52.214.216
  46.52.233.84
  46.52.255.69
-46.53.180.227
  46.53.183.136
  46.53.195.177
  46.55.168.50
  46.55.218.95
  46.55.25.191
  46.55.34.223
-46.59.102.230
  46.59.12.86
  46.59.124.166
  46.59.17.98
-46.59.222.43
+46.59.218.32
  46.59.243.225
  46.59.25.81
  46.59.30.133
@@ -114373,12 +115571,9 @@
  46.6.15.18
  46.6.7.61
  46.61.112.108
-46.61.171.105
  46.61.247.131
  46.61.9.99
  46.62.144.80
-46.62.152.38
-46.62.170.19
  46.63.0.17
  46.63.22.16
  46.63.57.50
@@ -114387,7 +115582,6 @@
  46.63.81.195
  46.64.253.236
  46.64.62.196
-46.72.154.144
  46.72.192.232
  46.72.196.159
  46.72.238.126
@@ -114406,15 +115600,12 @@
  46.8.155.111
  46.8.155.227
  46.8.156.173
-46.8.156.177
  46.8.157.138
  46.8.159.147
  46.8.16.53
  46.8.178.103
-46.8.178.105
  46.8.178.107
  46.8.178.109
-46.8.178.110
  46.8.178.111
  46.8.178.112
  46.8.178.115
@@ -114443,7 +115634,6 @@
  46.8.223.92
  46.8.243.235
  46.8.247.3
-46.8.253.163
  46.8.33.101
  46.8.33.121
  46.8.33.190
@@ -114469,9 +115659,14 @@
  46.83.72.164
  46.83.73.54
  46.83.77.136
+46.83.92.147
+46.83.94.159
+46.85.208.40
  46.86.67.167
  46.87.215.110
-46.90.84.74
+46.90.83.194
+46.92.112.227
+46.92.28.202
  46.93.99.39
  46.95.139.161
  46.97.241.238
@@ -114480,6 +115675,7 @@
  46.97.76.154
  46.98.127.20
  46.98.212.103
+46.98.212.202
  46.99.131.27
  46.99.133.169
  46.99.134.170
@@ -114493,6 +115689,7 @@
  46.99.251.246
  46.99.252.42
  46.99.255.235
+46.99.58.163
  460365365.com
  4624.31cf4fdae.com
  4632.3190cfdae.com
@@ -114517,6 +115714,7 @@
  46buortfa46.bankofamericaslpemr.com
  46w46.com
  47.100.106.114
+47.100.119.112
  47.100.120.52
  47.100.137.252
  47.100.16.144
@@ -114524,46 +115722,45 @@
  47.100.162.210
  47.100.171.38
  47.100.192.146
-47.100.209.18
  47.100.244.87
  47.100.251.240
  47.100.27.114
-47.100.32.114
-47.100.43.246
  47.101.138.183
  47.101.151.15
  47.101.190.190
  47.101.36.129
  47.102.102.47
  47.102.122.175
-47.102.139.58
  47.102.193.203
  47.102.216.176
  47.102.44.188
  47.103.1.49
+47.103.107.225
+47.103.132.67
  47.103.14.96
  47.103.148.115
+47.103.159.227
+47.103.93.33
  47.103.97.150
-47.104.110.129
  47.104.150.67
  47.104.153.246
-47.104.156.239
  47.104.174.198
  47.104.182.97
  47.104.189.181
  47.104.191.32
  47.104.232.19
  47.104.238.8
+47.104.252.203
  47.104.68.172
  47.104.79.149
  47.104.93.176
  47.105.100.191
-47.105.132.8
+47.105.127.151
  47.105.137.74
  47.105.160.127
  47.105.161.162
  47.105.25.175
-47.105.44.134
+47.105.91.160
  47.106.113.245
  47.106.124.179
  47.106.161.182
@@ -114577,15 +115774,19 @@
  47.106.82.115
  47.106.84.72
  47.106.86.211
+47.106.91.124
  47.107.133.109
  47.107.134.197
  47.107.144.13
  47.107.147.168
+47.107.164.148
  47.107.175.190
+47.107.228.241
  47.107.242.71
  47.107.244.98
-47.107.56.120
  47.107.61.8
+47.107.70.252
+47.107.92.175
  47.108.140.54
  47.108.156.129
  47.108.165.147
@@ -114598,6 +115799,7 @@
  47.108.50.199
  47.108.51.141
  47.108.56.153
+47.108.56.230
  47.108.56.231
  47.108.63.50
  47.108.65.144
@@ -114606,31 +115808,34 @@
  47.11.252.44
  47.110.126.60
  47.110.150.226
+47.110.238.171
  47.110.49.177
-47.110.68.112
  47.110.92.146
+47.111.113.87
  47.111.14.20
+47.111.153.111
+47.111.160.38
  47.111.161.245
  47.111.242.160
+47.111.246.143
  47.111.30.74
  47.111.73.94
  47.111.89.46
  47.111.93.83
-47.112.116.126
  47.112.122.216
  47.112.127.188
  47.112.144.63
+47.112.164.200
  47.112.203.31
-47.112.231.143
  47.113.108.107
  47.113.201.83
  47.113.95.224
-47.114.103.210
  47.114.156.131
  47.114.47.245
  47.114.57.226
  47.114.59.102
  47.114.72.158
+47.115.137.45
  47.115.146.83
  47.115.149.127
  47.115.166.149
@@ -114638,8 +115843,9 @@
  47.115.172.191
  47.115.52.118
  47.115.53.163
-47.12.163.132
+47.12.210.8
  47.12.228.237
+47.12.48.178
  47.134.135.148
  47.136.103.249
  47.14.17.107
@@ -114662,8 +115868,8 @@
  47.152.199.79
  47.152.200.65
  47.153.183.211
-47.154.86.123
  47.156.113.192
+47.156.132.123
  47.156.153.122
  47.156.70.145
  47.157.190.232
@@ -114684,29 +115890,27 @@
  47.180.88.49
  47.180.9.168
  47.184.212.187
-47.184.215.21
  47.184.48.254
  47.185.140.164
  47.185.21.126
  47.185.89.82
-47.186.113.67
  47.186.74.173
  47.186.82.182
  47.187.116.17
  47.187.16.50
  47.187.241.113
  47.187.249.197
-47.187.26.135
  47.187.29.151
-47.187.4.95
  47.187.7.210
  47.188.230.19
  47.188.43.153
  47.189.240.211
  47.19.54.70
+47.19.86.253
  47.190.132.213
  47.190.19.75
  47.190.63.28
+47.190.81.92
  47.192.118.43
  47.195.242.148
  47.196.131.158
@@ -114715,7 +115919,6 @@
  47.198.209.213
  47.198.231.85
  47.198.67.59
-47.20.150.144
  47.20.185.84
  47.200.15.123
  47.201.29.254
@@ -114728,14 +115931,12 @@
  47.21.19.222
  47.21.202.98
  47.21.41.254
-47.212.87.33
  47.216.50.174
  47.217.122.253
  47.217.23.156
  47.218.194.38
+47.22.43.40
  47.221.237.222
-47.221.44.74
-47.221.67.74
  47.221.97.81
  47.222.103.234
  47.223.138.176
@@ -114746,29 +115947,31 @@
  47.227.68.203
  47.23.4.36
  47.23.70.10
-47.232.210.24
  47.233.102.157
  47.234.210.235
  47.234.241.121
  47.24.129.216
  47.240.230.87
-47.240.41.43
-47.240.71.224
-47.241.10.91
+47.241.10.157
+47.241.109.98
  47.241.128.140
  47.241.13.24
  47.241.15.209
  47.241.15.42
+47.241.17.34
+47.241.21.95
  47.241.26.71
-47.241.28.63
-47.241.29.56
  47.241.33.14
  47.241.34.42
+47.241.61.131
  47.241.62.238
  47.241.63.146
  47.241.63.196
  47.241.7.56
+47.241.70.0
  47.241.75.62
+47.241.76.21
+47.242.10.58
  47.242.128.121
  47.242.128.133
  47.242.128.243
@@ -114778,7 +115981,7 @@
  47.242.223.170
  47.242.28.74
  47.242.30.91
-47.242.52.179
+47.242.76.143
  47.242.90.25
  47.244.1.172
  47.244.107.89
@@ -114786,7 +115989,7 @@
  47.244.131.233
  47.244.137.178
  47.244.149.14
-47.244.165.29
+47.244.151.211
  47.244.166.23
  47.244.170.243
  47.244.183.210
@@ -114802,7 +116005,8 @@
  47.244.221.47
  47.244.229.23
  47.244.23.238
-47.244.233.233
+47.244.233.214
+47.244.244.202
  47.244.26.70
  47.244.27.17
  47.244.27.29
@@ -114815,6 +116019,7 @@
  47.244.7.115
  47.244.9.128
  47.245.128.237
+47.245.26.5
  47.245.3.203
  47.245.32.64
  47.245.33.17
@@ -114835,7 +116040,6 @@
  47.254.134.244
  47.254.145.104
  47.254.151.148
-47.254.151.241
  47.254.170.214
  47.254.172.154
  47.254.172.215
@@ -114846,30 +116050,27 @@
  47.254.177.13
  47.254.178.15
  47.254.197.130
+47.254.20.78
  47.254.20.82
-47.254.203.229
  47.254.214.208
  47.254.215.132
  47.254.216.89
-47.254.234.70
  47.254.237.199
-47.254.238.50
  47.254.240.55
  47.254.29.128
+47.254.29.135
  47.254.64.216
  47.254.67.22
  47.254.73.32
-47.254.74.196
  47.254.76.32
  47.254.77.228
-47.254.84.107
  47.254.93.177
+47.254.94.183
  47.254.95.196
  47.26.196.22
-47.26.94.181
-47.27.224.128
  47.32.155.207
  47.32.255.120
+47.33.54.44
  47.33.69.112
  47.34.128.25
  47.34.159.85
@@ -114877,19 +116078,18 @@
  47.34.164.211
  47.34.208.115
  47.36.140.164
-47.37.100.67
  47.37.171.72
-47.37.93.91
+47.39.207.183
  47.40.27.24
  47.42.205.221
  47.44.26.10
  47.46.215.66
  47.46.34.39
  47.49.12.165
-47.49.12.168
  47.49.12.169
  47.49.147.253
  47.49.171.19
+47.5.170.67
  47.50.246.114
  47.51.161.235
  47.51.217.75
@@ -114900,6 +116100,7 @@
  47.52.131.159
  47.52.134.197
  47.52.152.69
+47.52.173.66
  47.52.193.158
  47.52.201.10
  47.52.204.241
@@ -114912,7 +116113,6 @@
  47.52.239.42
  47.52.28.179
  47.52.38.232
-47.52.39.76
  47.52.59.139
  47.52.61.250
  47.52.62.174
@@ -114927,7 +116127,7 @@
  47.54.211.232
  47.55.50.229
  47.56.106.198
-47.56.126.247
+47.56.128.56
  47.56.132.105
  47.56.141.204
  47.56.159.53
@@ -114936,10 +116136,8 @@
  47.56.232.61
  47.56.239.36
  47.56.251.168
-47.56.251.207
  47.56.253.59
  47.56.255.20
-47.56.255.231
  47.57.124.34
  47.57.125.18
  47.57.144.77
@@ -114949,20 +116147,22 @@
  47.57.19.95
  47.57.74.239
  47.57.88.124
+47.6.104.214
  47.6.15.79
+47.6.155.189
  47.6.85.252
  47.61.184.131
-47.62.148.70
  47.63.239.154
  47.63.239.20
  47.63.46.83
  47.7.114.234
+47.72.128.205
+47.72.93.55
  47.74.148.237
  47.74.16.114
  47.74.175.100
  47.74.178.80
  47.74.185.172
-47.74.20.131
  47.74.216.206
  47.74.220.148
  47.74.221.216
@@ -114971,9 +116171,11 @@
  47.74.228.168
  47.74.231.192
  47.74.234.121
+47.74.239.82
  47.74.240.108
  47.74.241.65
  47.74.242.64
+47.74.27.41
  47.74.3.113
  47.74.32.13
  47.74.35.128
@@ -115000,22 +116202,18 @@
  47.75.154.176
  47.75.167.17
  47.75.168.219
-47.75.175.59
  47.75.176.144
-47.75.178.149
  47.75.184.180
  47.75.185.189
  47.75.187.146
  47.75.199.52
  47.75.2.225
  47.75.202.172
-47.75.204.149
  47.75.204.212
  47.75.205.246
  47.75.216.136
  47.75.242.21
  47.75.253.127
-47.75.35.229
  47.75.37.35
  47.75.42.179
  47.75.42.203
@@ -115024,12 +116222,13 @@
  47.75.55.181
  47.75.7.170
  47.75.90.57
-47.75.92.24
  47.75.96.85
  47.88.100.201
+47.88.148.177
  47.88.153.61
  47.88.154.236
  47.88.157.51
+47.88.159.100
  47.88.168.99
  47.88.17.253
  47.88.220.246
@@ -115054,7 +116253,6 @@
  47.89.21.168
  47.89.242.60
  47.89.34.5
-47.89.46.67
  47.89.49.161
  47.89.8.91
  47.90.0.38
@@ -115068,22 +116266,15 @@
  47.90.96.169
  47.91.106.208
  47.91.124.172
-47.91.132.18
-47.91.156.40
  47.91.17.45
  47.91.178.158
-47.91.19.156
  47.91.196.15
-47.91.196.238
  47.91.206.207
-47.91.211.169
-47.91.215.113
  47.91.228.50
  47.91.239.118
  47.91.246.186
  47.91.253.239
  47.91.28.226
-47.91.29.241
  47.91.29.30
  47.91.79.240
  47.91.86.181
@@ -115099,12 +116290,14 @@
  47.92.212.252
  47.92.228.155
  47.92.245.97
-47.92.69.155
  47.92.78.176
  47.92.79.85
+47.92.84.235
+47.92.90.12
  47.92.94.125
  47.93.100.59
  47.93.129.209
+47.93.150.168
  47.93.173.17
  47.93.198.131
  47.93.228.217
@@ -115126,8 +116319,8 @@
  47.94.40.1
  47.94.6.21
  47.94.89.87
+47.95.0.135
  47.95.11.154
-47.95.145.199
  47.95.2.17
  47.95.211.197
  47.95.211.213
@@ -115135,33 +116328,28 @@
  47.95.213.15
  47.95.214.106
  47.95.215.4
-47.95.240.20
  47.95.32.92
  47.95.6.212
  47.96.119.168
  47.96.123.190
  47.96.224.198
-47.96.234.249
-47.96.41.44
  47.96.5.37
-47.96.80.168
-47.97.109.82
-47.97.190.222
+47.97.119.237
  47.97.90.220
  47.98.102.8
  47.98.114.56
-47.98.132.161
  47.98.138.84
-47.98.166.108
  47.98.166.130
+47.98.174.176
  47.98.190.243
  47.98.192.141
+47.98.236.241
  47.98.45.31
-47.98.53.165
+47.98.50.251
  47.99.134.42
  47.99.149.110
  47.99.158.238
-47.99.186.124
+47.99.202.38
  47.99.65.77
  47.99.82.168
  470365365.com
@@ -115216,30 +116404,32 @@
  49.0.82.190
  49.1.244.139
  49.112.138.211
+49.112.139.159
  49.112.196.49
  49.112.197.0
  49.112.198.186
  49.112.95.249
+49.114.149.68
  49.114.185.61
  49.114.72.218
  49.114.75.70
-49.114.76.209
  49.115.100.143
-49.115.128.227
  49.115.128.63
-49.115.135.41
+49.115.193.85
  49.115.195.47
  49.115.198.166
  49.115.203.30
-49.115.222.240
  49.115.97.206
  49.115.98.124
  49.116.182.64
  49.116.183.36
  49.116.197.233
  49.116.205.198
+49.116.210.231
  49.116.212.39
+49.116.214.170
  49.116.214.38
+49.116.215.156
  49.116.32.150
  49.116.32.165
  49.116.71.58
@@ -115276,12 +116466,9 @@
  49.128.181.229
  49.128.184.131
  49.128.184.139
+49.128.186.165
  49.128.186.51
  49.128.60.248
-49.130.10.101
-49.130.27.179
-49.130.75.80
-49.130.9.19
  49.135.45.84
  49.142.102.191
  49.142.184.126
@@ -115334,12 +116521,10 @@
  49.146.85.76
  49.149.133.99
  49.149.137.144
-49.149.174.109
  49.149.45.236
  49.149.95.47
  49.150.228.59
  49.151.49.196
-49.156.111.213
  49.156.149.190
  49.156.149.218
  49.156.151.242
@@ -115356,6 +116541,7 @@
  49.158.0.99
  49.158.1.165
  49.158.112.149
+49.158.142.221
  49.158.142.6
  49.158.202.10
  49.158.202.214
@@ -115370,7 +116556,6 @@
  49.158.44.231
  49.158.44.4
  49.158.52.148
-49.158.54.2
  49.158.97.22
  49.159.106.235
  49.159.109.148
@@ -115378,7 +116563,6 @@
  49.159.173.26
  49.159.199.58
  49.159.20.121
-49.159.20.138
  49.159.20.77
  49.159.21.3
  49.159.27.182
@@ -115401,6 +116585,7 @@
  49.172.35.112
  49.173.53.167
  49.174.182.99
+49.174.212.110
  49.174.26.34
  49.174.68.246
  49.174.8.152
@@ -115414,10 +116599,12 @@
  49.206.193.67
  49.206.200.245
  49.206.228.138
+49.206.24.16
  49.206.244.236
  49.206.26.9
  49.207.140.81
  49.207.199.193
+49.207.200.59
  49.207.203.206
  49.207.214.138
  49.207.215.212
@@ -115436,6 +116623,7 @@
  49.213.168.99
  49.213.169.186
  49.213.170.163
+49.213.170.251
  49.213.170.49
  49.213.171.161
  49.213.172.161
@@ -115483,7 +116671,6 @@
  49.213.226.13
  49.213.232.97
  49.228.21.174
-49.228.41.221
  49.228.78.114
  49.229.69.4
  49.229.73.214
@@ -115491,7 +116678,7 @@
  49.231.146.68
  49.231.166.197
  49.231.182.30
-49.231.241.11
+49.231.238.162
  49.231.66.20
  49.232.100.132
  49.232.100.177
@@ -115519,9 +116706,9 @@
  49.232.150.106
  49.232.152.23
  49.232.152.94
+49.232.154.122
  49.232.155.196
  49.232.157.17
-49.232.157.35
  49.232.158.164
  49.232.16.241
  49.232.16.47
@@ -115534,6 +116721,7 @@
  49.232.165.50
  49.232.166.136
  49.232.166.221
+49.232.169.224
  49.232.169.27
  49.232.17.254
  49.232.171.31
@@ -115562,6 +116750,7 @@
  49.232.202.58
  49.232.204.241
  49.232.205.249
+49.232.208.133
  49.232.208.26
  49.232.208.9
  49.232.209.9
@@ -115576,6 +116765,7 @@
  49.232.247.107
  49.232.26.148
  49.232.28.38
+49.232.28.79
  49.232.29.120
  49.232.29.152
  49.232.3.125
@@ -115632,6 +116822,7 @@
  49.233.160.103
  49.233.160.217
  49.233.162.222
+49.233.165.151
  49.233.166.113
  49.233.166.251
  49.233.168.100
@@ -115661,6 +116852,7 @@
  49.233.201.186
  49.233.202.149
  49.233.202.231
+49.233.203.30
  49.233.204.226
  49.233.204.30
  49.233.204.37
@@ -115758,7 +116950,6 @@
  49.234.182.55
  49.234.182.99
  49.234.183.237
-49.234.189.22
  49.234.190.140
  49.234.195.122
  49.234.201.237
@@ -115782,7 +116973,6 @@
  49.234.225.74
  49.234.226.196
  49.234.227.17
-49.234.228.143
  49.234.23.205
  49.234.23.243
  49.234.230.31
@@ -115790,7 +116980,6 @@
  49.234.232.164
  49.234.235.127
  49.234.236.123
-49.234.236.161
  49.234.239.248
  49.234.239.91
  49.234.24.193
@@ -115831,7 +117020,6 @@
  49.234.72.59
  49.234.73.105
  49.234.76.124
-49.234.76.44
  49.234.77.13
  49.234.78.135
  49.234.78.175
@@ -115915,7 +117103,6 @@
  49.235.206.24
  49.235.207.127
  49.235.213.170
-49.235.221.172
  49.235.221.66
  49.235.226.192
  49.235.226.50
@@ -115933,7 +117120,6 @@
  49.235.24.207
  49.235.240.251
  49.235.241.211
-49.235.247.198
  49.235.25.117
  49.235.250.113
  49.235.250.156
@@ -115949,7 +117135,6 @@
  49.235.26.37
  49.235.28.55
  49.235.28.96
-49.235.29.59
  49.235.31.168
  49.235.34.147
  49.235.35.65
@@ -115962,6 +117147,7 @@
  49.235.69.119
  49.235.69.80
  49.235.7.60
+49.235.70.249
  49.235.70.92
  49.235.73.19
  49.235.73.82
@@ -115977,7 +117163,6 @@
  49.235.84.101
  49.235.86.34
  49.235.87.70
-49.235.89.99
  49.235.9.47
  49.235.90.166
  49.235.90.244
@@ -115987,19 +117172,23 @@
  49.235.93.87
  49.235.94.136
  49.235.94.164
-49.235.95.38
  49.235.96.146
+49.235.96.34
  49.235.98.68
  49.236.192.13
  49.236.192.136
  49.236.193.70
  49.236.214.166
  49.238.142.12
+49.244.78.195
+49.245.111.148
  49.245.120.242
  49.245.121.144
  49.245.17.152
  49.245.30.212
  49.245.42.168
+49.245.44.222
+49.245.47.37
  49.245.51.223
  49.245.9.231
  49.245.93.188
@@ -116020,13 +117209,14 @@
  49.248.148.165
  49.248.32.110
  49.248.84.138
+49.249.237.226
  49.249.239.198
  49.255.35.114
  49.255.93.10
  49.3.20.161
  49.3.224.99
  49.3.44.137
-49.36.39.217
+49.36.1.82
  49.36.6.64
  49.37.150.15
  49.37.171.211
@@ -116034,11 +117224,10 @@
  49.4.31.138
  49.4.4.72
  49.48.33.168
-49.48.65.94
  49.48.68.63
  49.48.86.25
-49.48.90.121
  49.49.1.171
+49.49.191.4
  49.49.192.71
  49.49.28.194
  49.5.14.242
@@ -116146,6 +117335,7 @@
  49.64.127.123
  49.64.15.14
  49.64.158.5
+49.64.176.209
  49.64.176.51
  49.65.187.1
  49.65.234.216
@@ -116168,12 +117358,10 @@
  49.68.131.194
  49.68.131.71
  49.68.135.125
-49.68.145.117
-49.68.147.144
-49.68.147.158
  49.68.147.219
  49.68.147.235
  49.68.147.54
+49.68.147.6
  49.68.151.194
  49.68.154.105
  49.68.154.84
@@ -116195,6 +117383,7 @@
  49.68.226.132
  49.68.226.134
  49.68.228.218
+49.68.228.250
  49.68.230.73
  49.68.233.157
  49.68.233.212
@@ -116214,7 +117403,6 @@
  49.68.251.197
  49.68.251.202
  49.68.251.98
-49.68.255.184
  49.68.41.233
  49.68.43.154
  49.68.43.8
@@ -116231,17 +117419,9 @@
  49.68.98.223
  49.69.159.95
  49.69.175.200
-49.69.201.36
-49.69.201.98
  49.69.202.84
-49.69.205.208
  49.69.211.18
-49.69.213.104
-49.69.213.154
-49.69.213.249
-49.69.215.231
-49.69.215.32
-49.69.61.29
+49.69.72.139
  49.7.11.37
  49.7.14.184
  49.7.234.50
@@ -116262,6 +117442,7 @@
  49.70.225.99
  49.70.234.20
  49.70.235.234
+49.70.253.199
  49.70.33.78
  49.70.34.196
  49.70.34.61
@@ -116270,32 +117451,30 @@
  49.70.89.243
  49.70.95.248
  49.71.124.210
-49.71.140.233
  49.71.68.101
  49.72.110.183
  49.72.124.85
-49.72.156.118
  49.72.207.3
  49.72.212.22
  49.72.53.130
+49.72.98.215
  49.73.235.149
-49.73.57.82
  49.73.84.175
  49.74.105.153
  49.74.105.175
  49.74.219.26
+49.75.121.97
  49.75.129.214
  49.76.11.253
  49.76.163.53
-49.76.55.60
  49.76.57.192
+49.77.155.170
  49.77.58.10
  49.77.58.72
  49.77.58.97
  49.77.59.206
  49.80.105.209
  49.80.122.175
-49.80.146.158
  49.80.99.107
  49.80.99.109
  49.80.99.149
@@ -116304,6 +117483,7 @@
  49.80.99.48
  49.81.100.163
  49.81.101.237
+49.81.101.79
  49.81.102.69
  49.81.103.42
  49.81.103.62
@@ -116323,10 +117503,8 @@
  49.81.172.12
  49.81.178.95
  49.81.212.50
-49.81.218.29
  49.81.220.98
  49.81.227.84
-49.81.229.31
  49.81.237.96
  49.81.239.65
  49.81.250.6
@@ -116361,16 +117539,9 @@
  49.82.248.14
  49.82.249.71
  49.82.252.63
-49.82.253.209
  49.83.108.143
-49.83.171.189
-49.83.192.208
-49.83.192.74
  49.83.195.13
  49.83.195.33
-49.83.195.68
-49.83.85.14
-49.83.85.219
  49.84.113.238
  49.84.124.225
  49.84.125.254
@@ -116381,7 +117552,7 @@
  49.85.226.163
  49.85.54.87
  49.86.199.195
-49.86.199.249
+49.86.222.160
  49.86.77.124
  49.87.123.82
  49.87.171.116
@@ -116395,7 +117566,7 @@
  49.88.112.112
  49.88.112.113
  49.88.112.115
-49.88.112.116
+49.88.112.117
  49.88.112.60
  49.88.112.65
  49.88.112.68
@@ -116407,10 +117578,11 @@
  49.88.112.75
  49.88.112.76
  49.88.121.163
-49.88.154.140
+49.88.160.172
+49.88.226.165
  49.88.234.66
+49.88.64.130
  49.88.64.233
-49.88.67.98
  49.89.103.106
  49.89.115.124
  49.89.137.129
@@ -116607,12 +117779,13 @@
  5.10.68.248
  5.10.76.30
  5.10.8.44
-5.100.128.171
+5.100.136.110
  5.100.136.135
+5.100.136.139
  5.100.136.46
-5.100.141.230
-5.100.142.199
-5.100.143.104
+5.100.138.54
+5.100.141.148
+5.100.142.155
  5.100.228.206
  5.100.231.237
  5.101.107.190
@@ -116621,12 +117794,11 @@
  5.101.15.173
  5.101.151.106
  5.101.151.41
+5.101.156.167
  5.101.174.40
  5.101.197.143
  5.101.213.229
  5.101.221.238
-5.101.23.117
-5.101.56.213
  5.101.77.153
  5.101.8.34
  5.101.98.71
@@ -116642,7 +117814,6 @@
  5.102.225.145
  5.102.242.91
  5.102.246.190
-5.102.250.54
  5.102.58.41
  5.103.118.110
  5.103.137.146
@@ -116665,21 +117836,8 @@
  5.11.219.241
  5.11.36.57
  5.11.86.59
-5.112.30.135
-5.113.134.142
-5.115.35.212
-5.117.191.182
-5.117.215.50
  5.12.183.152
  5.12.206.214
-5.121.201.190
-5.121.89.186
-5.122.28.56
-5.123.133.143
-5.123.56.38
-5.124.187.224
-5.125.16.118
-5.127.254.173
  5.128.100.109
  5.128.121.2
  5.128.224.61
@@ -116689,19 +117847,17 @@
  5.13.120.117
  5.13.123.138
  5.130.168.9
-5.130.40.224
  5.133.11.116
  5.133.11.118
  5.133.11.119
  5.133.168.15
  5.133.179.243
-5.133.20.182
  5.133.24.117
  5.133.251.82
  5.133.65.82
-5.134.181.238
  5.134.61.34
  5.134.70.109
+5.135.0.33
  5.135.120.247
  5.135.123.36
  5.135.123.38
@@ -116714,7 +117870,6 @@
  5.135.161.7
  5.135.166.43
  5.135.174.215
-5.135.176.163
  5.135.176.208
  5.135.177.202
  5.135.177.5
@@ -116736,21 +117891,20 @@
  5.135.23.3
  5.135.237.216
  5.135.34.152
+5.135.35.160
  5.135.65.145
  5.135.72.184
  5.135.74.187
  5.135.94.191
  5.136.231.106
  5.136.244.170
-5.137.128.143
  5.137.211.147
-5.137.212.232
+5.137.227.146
  5.137.246.33
  5.137.51.138
-5.138.172.248
-5.138.190.60
+5.137.78.122
+5.138.132.17
  5.138.3.194
-5.139.22.106
  5.14.114.35
  5.14.122.192
  5.14.15.232
@@ -116769,7 +117923,9 @@
  5.140.66.252
  5.140.71.226
  5.141.131.164
+5.141.188.20
  5.141.223.136
+5.141.223.140
  5.141.244.52
  5.141.244.97
  5.141.29.137
@@ -116777,9 +117933,10 @@
  5.141.81.106
  5.141.81.133
  5.141.86.107
-5.142.224.198
-5.143.2.161
-5.143.65.235
+5.142.4.201
+5.143.48.180
+5.143.73.244
+5.144.12.15
  5.144.130.12
  5.144.176.130
  5.144.176.194
@@ -116791,18 +117948,16 @@
  5.144.91.21
  5.145.10.122
  5.145.175.80
-5.146.192.123
-5.146.192.124
  5.146.192.140
  5.146.192.147
-5.146.192.160
+5.146.192.151
  5.146.192.162
  5.146.192.168
+5.146.192.169
  5.147.153.51
  5.147.156.59
  5.147.97.159
  5.148.122.130
-5.148.188.179
  5.148.32.227
  5.148.32.240
  5.149.144.102
@@ -116814,12 +117969,13 @@
  5.149.64.194
  5.15.147.94
  5.15.150.212
+5.15.168.80
+5.15.175.144
  5.15.58.64
  5.150.210.235
  5.150.213.70
  5.150.216.244
  5.150.230.8
-5.150.236.83
  5.150.239.205
  5.150.240.82
  5.150.249.254
@@ -116828,11 +117984,12 @@
  5.151.118.159
  5.151.118.213
  5.151.118.234
+5.152.0.128
  5.152.0.200
  5.152.0.210
  5.152.148.141
+5.152.148.185
  5.152.158.4
-5.152.171.152
  5.152.203.117
  5.152.203.118
  5.152.206.196
@@ -116853,26 +118010,22 @@
  5.154.5.165
  5.154.5.201
  5.154.5.88
-5.157.0.108
  5.157.104.252
  5.157.105.89
  5.157.123.232
-5.157.14.109
-5.157.14.159
  5.157.14.253
  5.157.16.74
  5.157.17.61
  5.157.19.136
  5.157.19.147
-5.157.19.165
  5.157.19.183
  5.157.19.237
+5.157.19.251
  5.157.19.254
  5.157.19.38
  5.157.19.69
  5.157.26.235
  5.157.26.248
-5.157.26.29
  5.157.27.127
  5.157.27.60
  5.157.27.82
@@ -116882,14 +118035,12 @@
  5.157.43.172
  5.157.43.30
  5.157.5.114
-5.157.5.135
  5.157.5.155
  5.157.5.203
  5.157.52.133
  5.157.56.55
  5.157.56.62
  5.157.7.35
-5.157.8.20
  5.158.123.153
  5.158.187.169
  5.158.236.116
@@ -116897,7 +118048,6 @@
  5.159.111.200
  5.159.118.65
  5.159.50.62
-5.16.12.213
  5.16.13.38
  5.160.103.202
  5.160.110.116
@@ -116925,7 +118075,7 @@
  5.160.72.150
  5.160.82.66
  5.160.82.72
-5.160.82.77
+5.160.82.76
  5.160.82.78
  5.160.85.188
  5.160.86.54
@@ -116940,6 +118090,7 @@
  5.164.250.121
  5.165.116.240
  5.165.179.77
+5.165.252.198
  5.165.252.70
  5.165.6.215
  5.165.66.212
@@ -119003,44 +120154,49 @@
  5.17.94.86
  5.172.17.90
  5.172.204.194
+5.172.235.83
  5.175.225.107
  5.175.40.57
  5.178.135.226
+5.178.188.78
  5.178.193.43
  5.178.217.227
  5.178.61.121
  5.178.68.215
  5.178.68.221
  5.18.252.15
-5.180.150.121
  5.180.150.140
  5.180.150.165
  5.180.150.238
-5.180.150.55
  5.180.211.73
  5.180.220.11
  5.180.220.112
-5.180.220.137
-5.180.220.155
+5.180.220.16
+5.180.220.172
  5.180.220.23
-5.180.220.41
+5.180.220.28
  5.180.220.47
  5.180.220.65
  5.180.221.108
  5.180.221.36
+5.180.244.189
+5.180.244.241
+5.180.244.78
  5.180.246.122
  5.180.246.126
  5.180.78.156
  5.181.135.190
  5.181.156.106
+5.181.168.24
  5.181.170.31
  5.181.209.190
  5.181.211.254
  5.181.238.5
  5.181.4.201
  5.181.4.247
+5.181.46.125
  5.181.93.140
-5.182.141.61
+5.182.184.178
  5.182.209.115
  5.182.209.18
  5.182.209.21
@@ -119064,9 +120220,11 @@
  5.182.245.36
  5.182.26.126
  5.182.26.129
+5.182.50.131
+5.182.50.64
+5.182.50.85
  5.183.130.143
-5.183.200.70
-5.183.253.102
+5.183.253.112
  5.183.253.115
  5.183.253.136
  5.183.253.155
@@ -119074,24 +120232,22 @@
  5.183.253.164
  5.183.253.173
  5.183.253.182
-5.183.253.212
  5.183.253.248
-5.183.253.250
  5.183.253.50
  5.183.253.78
-5.183.253.85
+5.183.255.118
+5.183.255.184
  5.183.80.79
  5.183.92.116
  5.183.92.121
-5.183.92.128
  5.183.92.139
  5.183.92.151
  5.183.92.158
  5.183.92.164
-5.183.92.19
-5.183.92.193
+5.183.92.175
+5.183.92.181
+5.183.92.188
  5.183.92.20
-5.183.92.200
  5.183.92.235
  5.183.92.25
  5.183.92.26
@@ -119099,23 +120255,19 @@
  5.183.92.37
  5.183.92.38
  5.183.92.44
-5.183.92.49
  5.183.92.67
  5.183.92.74
  5.183.92.86
  5.183.93.14
-5.183.93.33
  5.183.94.27
-5.183.94.99
+5.184.244.152
  5.185.66.236
-5.186.249.206
  5.186.57.163
  5.186.60.13
  5.187.55.242
  5.187.69.208
  5.187.70.110
  5.187.71.182
-5.187.75.183
  5.188.102.188
  5.188.105.9
  5.188.11.114
@@ -119126,11 +120278,9 @@
  5.188.156.77
  5.188.159.48
  5.188.168.127
-5.188.206.18
  5.188.206.201
  5.188.206.211
  5.188.206.38
-5.188.210.10
  5.188.210.109
  5.188.210.139
  5.188.210.158
@@ -119141,7 +120291,6 @@
  5.188.210.245
  5.188.210.46
  5.188.210.59
-5.188.210.63
  5.188.210.84
  5.188.211.46
  5.188.216.100
@@ -119157,19 +120306,14 @@
  5.188.216.63
  5.188.217.223
  5.188.217.230
-5.188.217.247
-5.188.217.250
-5.188.217.66
  5.188.218.24
  5.188.219.150
-5.188.219.175
  5.188.219.196
  5.188.219.224
  5.188.219.46
  5.188.219.68
  5.188.231.10
  5.188.231.44
-5.188.245.252
  5.188.33.194
  5.188.48.5
  5.188.48.7
@@ -119180,7 +120324,6 @@
  5.188.62.140
  5.188.62.174
  5.188.62.179
-5.188.62.214
  5.188.62.24
  5.188.62.33
  5.188.84.115
@@ -119206,7 +120349,6 @@
  5.188.84.7
  5.188.84.70
  5.188.84.92
-5.188.84.95
  5.188.86.25
  5.188.9.25
  5.188.9.76
@@ -119259,17 +120401,15 @@
  5.189.239.249
  5.189.62.46
  5.19.173.178
-5.19.236.169
-5.19.249.126
  5.19.253.43
+5.190.123.173
+5.190.141.107
+5.190.168.150
  5.190.209.3
+5.190.215.177
  5.190.39.31
-5.190.81.122
-5.190.81.42
  5.190.96.58
-5.191.32.75
  5.194.187.106
-5.195.137.10
  5.195.224.127
  5.196.100.210
  5.196.101.213
@@ -119287,9 +120427,9 @@
  5.196.217.176
  5.196.218.24
  5.196.222.51
-5.196.23.219
  5.196.239.210
  5.196.255.171
+5.196.27.163
  5.196.27.37
  5.196.29.108
  5.196.33.177
@@ -119300,7 +120440,6 @@
  5.196.59.57
  5.196.65.141
  5.196.68.118
-5.196.68.145
  5.196.69.107
  5.196.69.227
  5.196.70.107
@@ -119316,10 +120455,8 @@
  5.196.75.95
  5.196.76.111
  5.196.8.72
-5.196.82.44
  5.196.82.5
  5.196.82.7
-5.196.83.54
  5.196.83.78
  5.196.83.88
  5.196.88.177
@@ -119331,6 +120468,7 @@
  5.196.95.80
  5.197.112.42
  5.199.130.127
+5.199.130.149
  5.199.130.188
  5.199.130.24
  5.199.130.43
@@ -119347,7 +120485,6 @@
  5.2.155.101
  5.2.164.75
  5.2.180.254
-5.2.182.7
  5.2.188.23
  5.2.202.95
  5.2.203.194
@@ -119357,6 +120494,7 @@
  5.2.249.195
  5.2.67.174
  5.2.67.51
+5.2.68.74
  5.2.70.145
  5.2.70.147
  5.2.72.101
@@ -119374,11 +120512,9 @@
  5.2.79.179
  5.2.79.82
  5.20.0.60
-5.20.13.80
  5.200.55.159
  5.200.64.54
  5.200.85.197
-5.200.89.104
  5.200.92.10
  5.200.92.116
  5.201.164.104
@@ -119390,7 +120526,6 @@
  5.202.114.191
  5.202.150.209
  5.202.157.159
-5.202.157.221
  5.202.181.241
  5.202.193.74
  5.202.206.133
@@ -119399,7 +120534,6 @@
  5.202.40.236
  5.202.45.25
  5.202.46.134
-5.202.46.150
  5.202.46.153
  5.202.46.154
  5.202.46.166
@@ -119414,11 +120548,7 @@
  5.202.47.199
  5.202.47.249
  5.202.47.50
-5.202.53.213
  5.202.76.109
-5.202.76.167
-5.202.77.133
-5.204.135.156
  5.206.224.138
  5.206.224.171
  5.206.224.216
@@ -119436,17 +120566,13 @@
  5.206.236.45
  5.206.65.112
  5.206.88.106
-5.209.156.78
  5.21.61.143
  5.21.65.197
-5.210.79.5
-5.218.96.168
  5.22.154.50
  5.22.198.38
  5.225.220.76
  5.226.168.31
  5.226.70.68
-5.227.12.19
  5.228.190.65
  5.228.232.101
  5.23.102.194
@@ -119454,25 +120580,12 @@
  5.230.22.248
  5.230.69.18
  5.231.53.84
-5.232.169.253
  5.232.174.127
-5.232.187.102
-5.232.9.40
-5.234.173.117
-5.234.234.178
-5.234.242.52
-5.234.97.168
-5.235.173.66
-5.235.178.221
-5.235.185.254
  5.235.186.38
  5.235.187.108
-5.235.253.144
  5.236.93.8
-5.236.96.170
  5.238.209.34
  5.238.217.173
-5.239.145.109
  5.240.109.222
  5.240.146.167
  5.240.27.151
@@ -119489,27 +120602,11 @@
  5.249.154.119
  5.249.70.232
  5.25.255.46
-5.251.102.198
  5.251.118.18
-5.251.128.103
-5.251.148.100
  5.251.149.23
-5.251.157.43
-5.251.194.66
-5.251.21.120
-5.251.22.227
-5.251.22.6
-5.251.221.226
-5.251.248.59
-5.251.255.71
-5.251.3.242
-5.251.40.207
  5.251.46.144
-5.251.5.232
+5.251.46.91
  5.251.59.195
-5.251.61.167
-5.251.70.134
-5.251.77.210
  5.252.176.20
  5.252.193.211
  5.252.194.137
@@ -119558,7 +120655,6 @@
  5.26.90.208
  5.27.225.27
  5.27.226.176
-5.27.242.217
  5.28.62.85
  5.29.165.21
  5.31.5.95
@@ -119572,22 +120668,19 @@
  5.32.25.94
  5.32.68.226
  5.32.71.134
-5.34.126.36
+5.34.108.241
  5.34.158.102
  5.34.178.126
  5.34.180.125
  5.34.180.177
+5.34.180.192
  5.34.181.13
  5.34.181.17
  5.34.183.97
  5.34.221.226
  5.34.244.239
-5.34.89.226
-5.35.220.185
  5.36.102.122
-5.36.117.250
  5.36.123.12
-5.36.235.252
  5.36.59.122
  5.37.169.118
  5.38.176.31
@@ -119608,8 +120701,6 @@
  5.39.31.208
  5.39.5.14
  5.39.5.5
-5.39.64.29
-5.39.64.46
  5.39.66.58
  5.39.70.222
  5.39.74.106
@@ -119632,7 +120723,6 @@
  5.39.94.46
  5.39.95.38
  5.39.97.155
-5.40.80.162
  5.42.15.37
  5.42.246.46
  5.43.138.240
@@ -119641,6 +120731,7 @@
  5.44.169.215
  5.44.203.155
  5.44.25.146
+5.44.40.77
  5.44.5.170
  5.45.108.241
  5.45.110.20
@@ -119656,8 +120747,7 @@
  5.51.60.216
  5.53.138.156
  5.53.142.228
-5.54.38.143
-5.55.157.144
+5.54.95.24
  5.55.253.99
  5.55.92.24
  5.55.95.60
@@ -119677,7 +120767,6 @@
  5.56.27.145
  5.56.61.183
  5.56.92.52
-5.57.14.218
  5.57.33.71
  5.57.34.34
  5.58.18.104
@@ -119694,32 +120783,31 @@
  5.59.143.43
  5.59.145.129
  5.59.35.26
-5.59.41.142
  5.61.50.213
  5.61.51.32
  5.62.1.79
  5.62.18.132
  5.62.18.65
+5.62.18.90
  5.62.19.37
  5.62.19.41
  5.62.19.46
  5.62.19.49
-5.62.19.54
  5.62.19.61
-5.62.19.62
  5.62.37.16
  5.62.39.232
  5.62.39.37
  5.62.39.53
  5.62.43.60
  5.62.43.61
+5.62.56.49
  5.62.56.50
  5.62.56.51
-5.62.57.106
-5.62.57.46
  5.62.58.49
  5.62.58.50
  5.62.58.51
+5.62.59.27
+5.62.59.87
  5.62.60.110
  5.62.60.111
  5.62.60.53
@@ -119729,17 +120817,13 @@
  5.62.62.54
  5.62.62.55
  5.63.10.198
-5.63.127.170
  5.63.146.172
  5.63.158.232
  5.63.165.178
  5.63.166.140
  5.63.187.116
  5.63.188.194
-5.63.65.245
-5.63.66.130
  5.63.88.202
-5.63.96.28
  5.64.86.165
  5.65.28.81
  5.66.138.88
@@ -119753,33 +120837,12 @@
  5.70.221.67
  5.70.254.236
  5.70.88.113
-5.71.143.0
  5.71.155.237
  5.71.186.2
  5.71.50.175
  5.71.54.23
  5.71.93.248
-5.74.41.202
-5.75.1.161
-5.75.29.30
-5.75.96.247
-5.76.101.29
-5.76.126.240
-5.76.132.229
-5.76.141.214
-5.76.141.29
-5.76.141.76
-5.76.152.140
-5.76.153.134
-5.76.153.75
-5.76.164.228
  5.76.171.247
-5.76.178.113
-5.76.214.128
-5.76.221.45
-5.76.54.228
-5.76.75.157
-5.76.96.20
  5.77.185.98
  5.77.254.236
  5.77.35.249
@@ -119815,18 +120878,20 @@
  5.8.16.72
  5.8.16.73
  5.8.16.75
-5.8.16.76
  5.8.16.77
  5.8.16.78
  5.8.16.83
  5.8.16.85
+5.8.16.87
  5.8.16.88
+5.8.16.90
  5.8.16.92
  5.8.18.31
  5.8.201.110
  5.8.41.36
  5.8.47.251
  5.8.51.104
+5.8.71.45
  5.8.88.75
  5.80.210.170
  5.83.160.77
@@ -119838,7 +120903,6 @@
  5.88.124.228
  5.88.124.86
  5.88.130.165
-5.88.141.168
  5.88.141.217
  5.88.184.182
  5.88.185.249
@@ -119859,6 +120923,7 @@
  5.9.105.53
  5.9.106.213
  5.9.107.14
+5.9.108.254
  5.9.110.254
  5.9.110.50
  5.9.111.70
@@ -119925,7 +120990,6 @@
  5.9.59.178
  5.9.6.170
  5.9.6.51
-5.9.61.101
  5.9.62.130
  5.9.63.149
  5.9.66.111
@@ -119960,17 +121024,14 @@
  5.9.97.173
  5.9.98.178
  5.9.99.120
-5.90.192.147
  5.90.201.63
  5.90.201.95
-5.90.203.31
-5.90.205.189
  5.90.213.138
-5.90.31.73
-5.90.57.106
-5.90.7.121
  5.90.71.67
-5.91.6.250
+5.90.74.236
+5.91.13.114
+5.91.15.63
+5.91.7.100
  5.94.20.9
  5.94.216.52
  5.94.219.19
@@ -119983,7 +121044,6 @@
  5.zxczj.top
  50-87-224-50.unifiedlayer.com
  50.0.51.253
-50.101.20.178
  50.106.51.98
  50.107.49.234
  50.112.39.196
@@ -119994,7 +121054,6 @@
  50.115.170.88
  50.115.171.79
  50.115.172.155
-50.115.173.102
  50.115.173.126
  50.115.173.131
  50.115.174.240
@@ -120035,6 +121094,7 @@
  50.116.72.164
  50.116.78.109
  50.116.86.205
+50.117.249.202
  50.117.96.182
  50.118.172.64
  50.121.220.50
@@ -120078,12 +121138,10 @@
  50.192.37.170
  50.192.49.195
  50.192.49.5
-50.192.59.93
  50.193.202.81
  50.194.102.27
  50.194.145.45
  50.195.129.121
-50.195.197.105
  50.195.7.180
  50.196.105.87
  50.196.126.233
@@ -120094,7 +121152,6 @@
  50.197.162.169
  50.197.210.138
  50.197.38.230
-50.197.5.36
  50.198.160.225
  50.199.46.20
  50.199.81.66
@@ -120112,7 +121169,6 @@
  50.202.139.150
  50.202.44.35
  50.203.146.253
-50.204.163.226
  50.204.219.101
  50.205.119.150
  50.205.151.218
@@ -120125,7 +121181,6 @@
  50.207.163.12
  50.207.57.246
  50.208.56.148
-50.208.66.182
  50.209.208.17
  50.21.237.141
  50.211.203.180
@@ -120140,15 +121195,12 @@
  50.224.119.194
  50.226.180.214
  50.227.175.124
-50.227.195.3
  50.227.46.1
-50.227.77.194
+50.228.81.138
  50.23.43.242
  50.23.69.44
  50.23.76.241
-50.230.160.35
  50.232.204.114
-50.232.217.130
  50.232.60.196
  50.233.148.74
  50.233.228.147
@@ -120159,7 +121211,6 @@
  50.235.67.4
  50.235.92.14
  50.235.92.65
-50.236.0.129
  50.236.133.10
  50.236.148.246
  50.236.148.254
@@ -120169,6 +121220,7 @@
  50.237.128.182
  50.237.206.138
  50.237.206.174
+50.238.192.162
  50.240.188.72
  50.240.190.22
  50.240.254.245
@@ -120201,7 +121253,6 @@
  50.250.34.229
  50.250.56.129
  50.250.75.153
-50.251.216.225
  50.251.216.228
  50.251.29.57
  50.251.31.229
@@ -120227,15 +121278,14 @@
  50.3.177.106
  50.3.177.72
  50.3.177.76
-50.3.192.35
-50.3.194.213
+50.3.193.201
+50.3.194.55
  50.3.197.20
-50.3.197.236
  50.3.197.240
  50.3.197.90
  50.3.74.72
  50.3.83.2
-50.3.91.103
+50.30.24.217
  50.30.37.150
  50.30.93.94
  50.31.10.228
@@ -120244,7 +121294,6 @@
  50.31.147.175
  50.31.26.152
  50.31.30.22
-50.31.60.226
  50.31.96.11
  50.33.148.138
  50.34.39.72
@@ -120277,6 +121326,7 @@
  50.57.108.76
  50.57.190.90
  50.57.191.85
+50.57.65.102
  50.57.72.4
  50.58.161.85
  50.59.162.79
@@ -120287,46 +121337,35 @@
  50.62.160.157
  50.62.161.140
  50.62.161.211
-50.62.161.52
  50.62.176.104
-50.62.176.125
-50.62.176.140
  50.62.176.151
  50.62.176.220
  50.62.176.236
  50.62.176.75
  50.62.176.95
-50.62.177.122
-50.62.177.163
  50.62.177.223
-50.62.177.231
  50.62.177.55
  50.62.177.91
+50.62.208.106
  50.62.208.155
  50.62.208.166
-50.62.208.200
  50.62.208.36
-50.62.208.52
  50.62.208.86
  50.62.30.5
  50.62.35.16
  50.63.12.201
  50.63.167.184
-50.63.194.171
-50.63.194.48
-50.63.196.106
-50.63.196.150
+50.63.194.54
+50.63.196.103
  50.63.196.173
  50.63.196.177
  50.63.196.76
-50.63.197.105
-50.63.197.21
-50.63.197.31
-50.63.197.68
-50.63.197.88
+50.63.196.85
+50.63.197.154
+50.63.197.20
+50.63.197.36
  50.63.52.157
  50.63.58.84
-50.64.22.203
  50.65.109.231
  50.65.136.121
  50.65.66.137
@@ -120335,12 +121374,14 @@
  50.66.45.43
  50.66.82.129
  50.67.14.107
+50.67.17.27
  50.67.234.213
  50.67.40.214
  50.67.49.110
  50.68.104.92
  50.68.113.194
  50.68.200.101
+50.7.124.143
  50.7.138.133
  50.7.177.59
  50.7.184.58
@@ -120351,6 +121392,7 @@
  50.70.141.143
  50.70.203.159
  50.70.232.99
+50.71.150.181
  50.71.215.45
  50.71.8.83
  50.72.45.183
@@ -120360,8 +121402,8 @@
  50.76.148.93
  50.77.133.114
  50.77.8.169
-50.80.188.100
  50.80.224.218
+50.81.111.72
  50.82.157.158
  50.83.157.117
  50.84.11.150
@@ -120369,18 +121411,18 @@
  50.84.120.122
  50.84.210.194
  50.84.40.98
-50.86.5.199
  50.87.144.115
  50.87.144.158
  50.87.144.23
+50.87.144.54
  50.87.179.106
  50.87.248.100
  50.87.248.76
  50.87.37.232
  50.87.38.190
  50.88.129.220
-50.88.177.32
  50.88.20.178
+50.88.217.109
  50.88.97.117
  50.90.3.116
  50.91.114.38
@@ -120399,10 +121441,8 @@
  50.98.235.238
  50.98.242.171
  50.99.143.119
-50.99.218.122
  50.99.237.5
  50.99.243.135
-50.99.33.15
  500-365.net
  500-plus.you24.eu
  5000-aruba.com
@@ -120432,13 +121472,13 @@
  51.103.130.57
  51.103.138.56
  51.103.139.79
+51.103.141.202
  51.103.142.75
  51.103.19.12
  51.103.28.223
  51.103.31.232
  51.103.36.201
  51.103.36.90
-51.103.44.123
  51.103.72.31
  51.104.208.250
  51.104.242.17
@@ -120447,7 +121487,6 @@
  51.105.53.53
  51.107.76.178
  51.107.89.12
-51.11.187.150
  51.11.240.55
  51.11.242.196
  51.11.243.14
@@ -120462,11 +121501,11 @@
  51.116.235.117
  51.120.94.14
  51.124.142.198
+51.124.86.45
  51.13.65.199
  51.132.132.126
  51.132.21.44
  51.132.244.53
-51.132.245.28
  51.132.52.203
  51.136.33.31
  51.136.50.73
@@ -120476,14 +121515,13 @@
  51.140.179.45
  51.140.48.231
  51.140.67.211
-51.140.79.37
  51.141.0.227
  51.141.111.44
-51.141.15.79
  51.141.161.253
  51.141.167.27
  51.141.76.176
  51.141.79.141
+51.143.1.182
  51.143.103.117
  51.144.106.161
  51.144.140.130
@@ -120492,6 +121530,7 @@
  51.145.184.156
  51.145.208.244
  51.148.153.60
+51.148.160.195
  51.15.1.221
  51.15.10.158
  51.15.100.145
@@ -120531,16 +121570,16 @@
  51.15.144.211
  51.15.145.112
  51.15.145.148
+51.15.145.62
  51.15.147.154
  51.15.147.166
  51.15.148.90
-51.15.149.176
  51.15.153.164
  51.15.153.180
-51.15.154.171
  51.15.154.83
  51.15.157.182
  51.15.157.211
+51.15.158.125
  51.15.158.253
  51.15.159.90
  51.15.162.102
@@ -120596,7 +121635,9 @@
  51.15.242.181
  51.15.243.117
  51.15.243.63
+51.15.248.110
  51.15.254.110
+51.15.254.2
  51.15.34.228
  51.15.34.41
  51.15.35.252
@@ -120608,8 +121649,8 @@
  51.15.43.205
  51.15.43.210
  51.15.43.85
+51.15.45.18
  51.15.45.241
-51.15.45.6
  51.15.45.7
  51.15.46.11
  51.15.46.174
@@ -120703,7 +121744,6 @@
  51.154.136.60
  51.154.14.19
  51.154.25.79
-51.154.35.253
  51.154.46.234
  51.154.53.96
  51.154.60.34
@@ -120733,7 +121773,6 @@
  51.158.151.75
  51.158.153.179
  51.158.153.18
-51.158.153.222
  51.158.160.2
  51.158.161.10
  51.158.161.106
@@ -120794,6 +121833,8 @@
  51.158.98.121
  51.158.99.51
  51.159.0.145
+51.159.1.7
+51.159.1.8
  51.159.130.139
  51.159.130.16
  51.159.133.230
@@ -120838,6 +121879,8 @@
  51.159.2.240
  51.159.20.44
  51.159.22.177
+51.159.22.187
+51.159.22.188
  51.159.22.221
  51.159.22.222
  51.159.22.238
@@ -120845,10 +121888,12 @@
  51.159.28.62
  51.159.3.222
  51.159.30.99
-51.159.4.237
+51.159.53.182
+51.159.53.183
  51.159.56.35
-51.159.67.165
+51.159.78.172
  51.159.93.108
+51.159.93.240
  51.159.94.110
  51.159.94.210
  51.159.95.8
@@ -120866,7 +121911,6 @@
  51.161.45.238
  51.161.52.46
  51.161.52.56
-51.161.57.15
  51.161.57.155
  51.161.62.153
  51.161.68.186
@@ -120951,6 +121995,7 @@
  51.178.53.84
  51.178.56.57
  51.178.63.225
+51.178.7.149
  51.178.80.229
  51.178.81.75
  51.178.83.124
@@ -120959,7 +122004,6 @@
  51.178.86.97
  51.178.87.42
  51.178.9.100
-51.179.104.166
  51.182.101.43
  51.182.82.148
  51.183.87.86
@@ -120968,10 +122012,8 @@
  51.195.10.26
  51.195.103.56
  51.195.111.108
-51.195.130.161
-51.195.130.170
-51.195.130.176
-51.195.133.181
+51.195.130.164
+51.195.130.166
  51.195.136.190
  51.195.136.233
  51.195.147.192
@@ -121002,7 +122044,6 @@
  51.195.150.252
  51.195.150.68
  51.195.151.208
-51.195.154.121
  51.195.163.255
  51.195.166.160
  51.195.166.161
@@ -121018,9 +122059,11 @@
  51.195.45.196
  51.195.47.153
  51.195.47.79
+51.195.5.167
  51.195.53.50
  51.195.53.6
  51.195.55.6
+51.195.57.28
  51.195.6.99
  51.195.62.87
  51.195.88.130
@@ -121140,18 +122183,22 @@
  51.211.183.85
  51.222.0.40
  51.222.13.24
+51.222.14.22
  51.222.14.28
  51.222.14.70
  51.222.14.78
  51.222.19.123
+51.222.22.213
  51.222.25.185
  51.222.25.197
  51.222.26.189
  51.222.29.39
+51.222.29.73
  51.222.56.152
  51.222.8.122
  51.222.9.153
  51.223.25.228
+51.223.44.125
  51.235.56.203
  51.235.70.91
  51.235.82.71
@@ -121316,7 +122363,6 @@
  51.255.64.196
  51.255.64.58
  51.255.69.109
-51.255.7.221
  51.255.75.16
  51.255.76.71
  51.255.85.180
@@ -121324,9 +122370,8 @@
  51.255.85.26
  51.255.87.121
  51.255.95.26
-51.37.107.174
-51.37.235.127
  51.37.35.59
+51.37.54.30
  51.38.101.119
  51.38.103.163
  51.38.105.215
@@ -121340,6 +122385,7 @@
  51.38.129.120
  51.38.129.49
  51.38.130.242
+51.38.131.234
  51.38.134.203
  51.38.135.250
  51.38.140.11
@@ -121371,7 +122417,6 @@
  51.38.238.165
  51.38.238.205
  51.38.244.38
-51.38.244.42
  51.38.32.230
  51.38.35.139
  51.38.35.229
@@ -121429,19 +122474,23 @@
  51.68.123.192
  51.68.123.65
  51.68.139.151
-51.68.140.104
  51.68.140.243
  51.68.141.101
  51.68.141.240
  51.68.143.201
  51.68.143.212
+51.68.149.147
  51.68.149.149
+51.68.149.150
+51.68.149.151
+51.68.149.152
  51.68.149.155
-51.68.149.159
  51.68.149.161
  51.68.149.163
+51.68.149.168
+51.68.149.171
+51.68.149.174
  51.68.149.175
-51.68.149.180
  51.68.152.18
  51.68.172.217
  51.68.172.59
@@ -121478,7 +122527,6 @@
  51.68.251.200
  51.68.253.19
  51.68.33.31
-51.68.36.210
  51.68.36.57
  51.68.44.13
  51.68.44.143
@@ -121489,12 +122537,12 @@
  51.68.85.93
  51.68.86.247
  51.68.88.26
+51.68.89.42
  51.68.90.171
  51.68.90.24
  51.68.90.244
  51.68.91.191
  51.68.94.206
-51.68.97.209
  51.7.245.8
  51.75.120.36
  51.75.122.213
@@ -121510,7 +122558,6 @@
  51.75.147.33
  51.75.147.35
  51.75.147.40
-51.75.147.41
  51.75.147.43
  51.75.147.44
  51.75.149.207
@@ -121524,10 +122571,12 @@
  51.75.169.151
  51.75.17.122
  51.75.170.50
+51.75.171.48
  51.75.173.232
  51.75.173.236
  51.75.18.212
  51.75.18.215
+51.75.188.112
  51.75.19.175
  51.75.191.176
  51.75.196.154
@@ -121562,6 +122611,7 @@
  51.75.53.167
  51.75.55.212
  51.75.55.53
+51.75.57.166
  51.75.64.187
  51.75.64.21
  51.75.64.23
@@ -121654,10 +122704,10 @@
  51.77.73.39
  51.77.75.127
  51.77.9.78
-51.77.92.102
  51.77.94.244
  51.77.95.120
  51.79.100.13
+51.79.11.49
  51.79.111.220
  51.79.123.249
  51.79.130.84
@@ -121672,7 +122722,6 @@
  51.79.153.194
  51.79.153.197
  51.79.157.254
-51.79.159.172
  51.79.160.138
  51.79.160.193
  51.79.171.203
@@ -121715,7 +122764,7 @@
  51.81.103.223
  51.81.112.135
  51.81.118.2
-51.81.152.38
+51.81.139.26
  51.81.155.35
  51.81.18.91
  51.81.226.60
@@ -121725,11 +122774,9 @@
  51.81.29.60
  51.81.31.167
  51.81.31.168
-51.81.31.170
  51.81.31.172
  51.81.31.61
  51.81.31.62
-51.81.31.66
  51.81.34.189
  51.81.34.79
  51.81.43.50
@@ -121761,8 +122808,11 @@
  51.83.134.17
  51.83.134.233
  51.83.136.109
+51.83.138.242
  51.83.138.247
+51.83.139.29
  51.83.139.31
+51.83.139.32
  51.83.139.33
  51.83.139.5
  51.83.139.55
@@ -121774,12 +122824,14 @@
  51.83.171.14
  51.83.171.25
  51.83.180.147
+51.83.180.241
  51.83.185.192
  51.83.185.209
  51.83.186.98
  51.83.187.201
  51.83.189.0
  51.83.200.164
+51.83.200.175
  51.83.200.176
  51.83.200.179
  51.83.200.213
@@ -121790,7 +122842,7 @@
  51.83.210.220
  51.83.216.234
  51.83.216.235
-51.83.217.86
+51.83.31.218
  51.83.33.156
  51.83.33.202
  51.83.33.88
@@ -121811,7 +122863,7 @@
  51.83.97.44
  51.83.98.104
  51.83.99.227
-51.89.10.253
+51.89.1.38
  51.89.100.108
  51.89.103.32
  51.89.119.120
@@ -121819,7 +122871,6 @@
  51.89.13.174
  51.89.136.104
  51.89.139.219
-51.89.142.53
  51.89.148.169
  51.89.148.30
  51.89.148.69
@@ -121837,7 +122888,6 @@
  51.89.165.90
  51.89.166.108
  51.89.173.199
-51.89.179.215
  51.89.179.224
  51.89.187.170
  51.89.195.116
@@ -121847,6 +122897,7 @@
  51.89.204.170
  51.89.205.182
  51.89.207.238
+51.89.208.88
  51.89.21.1
  51.89.21.78
  51.89.213.95
@@ -121864,8 +122915,8 @@
  51.89.32.83
  51.89.36.180
  51.89.40.32
+51.89.40.99
  51.89.50.146
-51.89.57.105
  51.89.6.79
  51.89.62.241
  51.89.76.220
@@ -121912,7 +122963,6 @@
  51.91.197.151
  51.91.204.85
  51.91.212.159
-51.91.214.66
  51.91.229.147
  51.91.229.20
  51.91.248.152
@@ -121990,11 +123040,9 @@
  52-flash-player-install.ml
  52.0.160.131
  52.0.6.165
-52.0.69.235
  52.0.87.8
  52.1.254.215
  52.1.46.14
-52.10.170.186
  52.10.173.113
  52.10.231.149
  52.10.238.175
@@ -122022,6 +123070,7 @@
  52.119.117.46
  52.119.117.50
  52.12.94.219
+52.125.140.0
  52.128.240.42
  52.129.47.88
  52.13.22.56
@@ -122050,7 +123099,6 @@
  52.14.149.21
  52.14.159.97
  52.14.171.234
-52.14.18.129
  52.14.180.106
  52.14.181.46
  52.14.182.231
@@ -122071,6 +123119,7 @@
  52.141.61.232
  52.142.15.195
  52.142.25.231
+52.142.253.144
  52.142.48.53
  52.142.51.155
  52.142.7.8
@@ -122084,6 +123133,7 @@
  52.146.12.224
  52.146.13.131
  52.146.13.69
+52.146.35.37
  52.146.45.8
  52.146.46.244
  52.147.178.124
@@ -122093,6 +123143,7 @@
  52.147.32.241
  52.148.136.67
  52.148.152.19
+52.148.152.228
  52.148.155.190
  52.148.155.70
  52.148.95.111
@@ -122100,11 +123151,13 @@
  52.149.152.236
  52.149.157.60
  52.149.180.228
+52.149.217.136
  52.149.217.64
  52.149.225.8
  52.15.103.61
  52.15.105.249
  52.15.105.94
+52.15.111.162
  52.15.115.119
  52.15.138.15
  52.15.140.203
@@ -122117,14 +123170,12 @@
  52.15.215.225
  52.15.229.145
  52.15.51.23
-52.15.53.94
  52.15.65.174
  52.15.65.61
  52.15.69.67
  52.15.87.18
  52.15.98.118
  52.151.1.24
-52.151.114.205
  52.151.117.83
  52.152.130.63
  52.152.140.14
@@ -122135,6 +123186,7 @@
  52.156.78.167
  52.156.8.150
  52.157.102.33
+52.157.151.24
  52.157.154.150
  52.158.237.191
  52.16.130.54
@@ -122147,16 +123199,17 @@
  52.160.126.89
  52.160.70.41
  52.160.81.85
-52.160.86.229
  52.161.12.190
  52.161.13.30
  52.161.20.135
  52.161.29.204
  52.161.92.66
+52.162.177.6
  52.162.179.16
  52.162.242.4
  52.162.252.164
  52.162.254.120
+52.162.34.184
  52.162.48.32
  52.162.88.107
  52.163.121.255
@@ -122168,11 +123221,9 @@
  52.164.124.121
  52.164.209.35
  52.165.152.75
-52.165.28.223
  52.165.32.203
  52.165.33.244
  52.165.33.245
-52.165.91.103
  52.166.232.140
  52.166.253.112
  52.166.62.239
@@ -122181,10 +123232,10 @@
  52.167.130.164
  52.167.156.52
  52.167.163.88
-52.167.166.38
  52.167.167.174
  52.167.173.198
  52.168.11.129
+52.168.122.218
  52.168.138.134
  52.168.148.166
  52.168.168.50
@@ -122194,8 +123245,10 @@
  52.168.87.215
  52.168.87.27
  52.168.90.133
+52.169.113.52
  52.169.122.231
  52.169.137.135
+52.169.141.211
  52.169.159.90
  52.169.184.206
  52.169.224.12
@@ -122258,6 +123311,7 @@
  52.176.45.66
  52.176.5.136
  52.176.90.129
+52.176.93.77
  52.176.94.86
  52.177.121.220
  52.177.16.224
@@ -122307,11 +123361,9 @@
  52.186.11.118
  52.186.13.110
  52.186.139.119
-52.186.139.193
-52.186.140.58
  52.186.161.95
+52.186.66.227
  52.186.84.111
-52.187.107.50
  52.187.117.17
  52.187.121.163
  52.187.130.77
@@ -122324,7 +123376,6 @@
  52.188.13.142
  52.188.144.67
  52.188.147.170
-52.188.15.144
  52.188.153.135
  52.188.17.49
  52.188.172.62
@@ -122335,7 +123386,7 @@
  52.188.68.29
  52.188.69.174
  52.188.9.234
-52.189.224.153
+52.189.222.229
  52.19.127.128
  52.19.136.130
  52.19.142.157
@@ -122352,7 +123403,6 @@
  52.191.137.182
  52.191.138.141
  52.191.163.162
-52.191.165.108
  52.191.166.171
  52.191.173.54
  52.191.184.80
@@ -122445,7 +123495,6 @@
  52.209.220.93
  52.209.69.212
  52.209.89.214
-52.21.248.28
  52.210.144.79
  52.210.168.132
  52.210.174.49
@@ -122529,6 +123578,7 @@
  52.224.164.31
  52.224.176.178
  52.224.240.150
+52.224.28.255
  52.224.66.246
  52.228.64.198
  52.228.64.71
@@ -122556,13 +123606,13 @@
  52.231.192.132
  52.231.202.10
  52.231.33.90
-52.231.53.25
  52.231.92.23
  52.232.246.85
  52.233.45.15
  52.234.179.85
  52.234.224.154
  52.235.28.13
+52.236.131.152
  52.237.118.225
  52.237.165.184
  52.237.174.185
@@ -122584,6 +123634,7 @@
  52.247.113.177
  52.247.194.12
  52.247.203.36
+52.247.235.106
  52.247.32.160
  52.247.62.50
  52.249.251.173
@@ -122597,7 +123648,7 @@
  52.25.237.167
  52.25.41.202
  52.25.81.249
-52.250.11.223
+52.250.1.219
  52.250.110.193
  52.250.19.179
  52.251.41.13
@@ -122612,7 +123663,6 @@
  52.254.81.180
  52.254.84.141
  52.255.143.183
-52.255.145.245
  52.255.147.248
  52.255.149.161
  52.255.159.205
@@ -122665,7 +123715,6 @@
  52.3.177.50
  52.3.186.199
  52.3.231.255
-52.3.245.39
  52.30.100.41
  52.30.154.84
  52.30.16.188
@@ -122739,8 +123788,10 @@
  52.35.220.104
  52.35.47.93
  52.35.89.64
+52.35.90.208
  52.36.100.97
  52.36.105.184
+52.36.125.174
  52.36.16.60
  52.36.18.181
  52.36.194.134
@@ -122880,7 +123931,6 @@
  52.52.214.182
  52.52.247.240
  52.52.26.74
-52.52.35.70
  52.53.117.56
  52.53.163.129
  52.53.165.23
@@ -122933,24 +123983,20 @@
  52.57.53.177
  52.57.76.51
  52.57.99.132
-52.58.152.18
  52.58.20.231
  52.59.116.14
  52.59.119.163
  52.59.155.250
  52.59.164.19
  52.59.165.248
-52.59.198.199
  52.59.207.46
  52.59.207.50
  52.59.215.202
  52.59.217.154
  52.59.218.170
  52.59.219.87
-52.59.227.69
  52.59.237.182
  52.59.249.130
-52.59.33.60
  52.59.37.183
  52.59.38.179
  52.59.42.182
@@ -123021,7 +124067,6 @@
  52.70.119.124
  52.70.129.232
  52.70.144.244
-52.70.219.150
  52.70.236.157
  52.71.151.231
  52.71.155.178
@@ -123086,10 +124131,10 @@
  52.81.56.33
  52.82.16.15
  52.86.11.253
+52.86.117.121
  52.86.176.3
  52.87.117.72
  52.87.127.10
-52.87.155.218
  52.87.160.37
  52.87.167.173
  52.87.167.216
@@ -123269,7 +124314,6 @@
  54.149.85.173
  54.150.6.97
  54.151.175.199
-54.151.3.183
  54.152.103.104
  54.152.118.146
  54.152.153.114
@@ -123277,6 +124321,7 @@
  54.152.253.182
  54.152.37.6
  54.152.52.43
+54.152.61.6
  54.152.80.39
  54.153.10.226
  54.153.104.98
@@ -123302,6 +124347,7 @@
  54.158.135.177
  54.158.145.45
  54.158.153.252
+54.158.190.145
  54.158.222.214
  54.158.228.57
  54.158.248.31
@@ -123320,7 +124366,6 @@
  54.159.221.201
  54.159.237.129
  54.159.24.235
-54.159.77.226
  54.160.137.46
  54.160.181.152
  54.160.91.239
@@ -123476,7 +124521,6 @@
  54.183.142.219
  54.183.155.178
  54.183.161.206
-54.183.164.65
  54.183.169.192
  54.183.169.241
  54.183.187.60
@@ -123540,6 +124584,7 @@
  54.193.102.124
  54.193.177.134
  54.193.21.31
+54.193.21.65
  54.193.216.255
  54.193.6.240
  54.193.67.130
@@ -123766,7 +124811,6 @@
  54.221.84.53
  54.222.161.1
  54.222.231.104
-54.223.200.138
  54.223.61.142
  54.224.128.129
  54.224.130.89
@@ -123775,7 +124819,6 @@
  54.224.95.8
  54.225.107.110
  54.225.113.207
-54.226.113.193
  54.226.178.241
  54.226.19.210
  54.226.203.78
@@ -123813,7 +124856,6 @@
  54.234.255.239
  54.234.38.217
  54.234.63.235
-54.235.163.229
  54.235.20.153
  54.235.232.110
  54.235.237.165
@@ -123909,6 +124951,7 @@
  54.252.194.142
  54.252.45.131
  54.253.15.33
+54.253.200.105
  54.254.144.51
  54.254.155.189
  54.254.163.190
@@ -123934,12 +124977,8 @@
  54.36.117.1
  54.36.120.120
  54.36.123.206
-54.36.127.96
-54.36.148.148
-54.36.148.249
-54.36.149.24
-54.36.149.44
-54.36.164.135
+54.36.148.0
+54.36.148.193
  54.36.165.239
  54.36.165.34
  54.36.166.196
@@ -123949,7 +124988,6 @@
  54.36.181.100
  54.36.183.14
  54.36.185.139
-54.36.185.237
  54.36.19.138
  54.36.190.245
  54.36.205.105
@@ -123963,7 +125001,9 @@
  54.36.49.125
  54.36.61.64
  54.36.62.114
+54.36.81.31
  54.37.11.58
+54.37.121.239
  54.37.131.204
  54.37.141.106
  54.37.143.192
@@ -123988,6 +125028,7 @@
  54.37.197.67
  54.37.199.249
  54.37.204.183
+54.37.204.99
  54.37.205.241
  54.37.209.37
  54.37.21.211
@@ -124044,7 +125085,7 @@
  54.38.202.180
  54.38.204.53
  54.38.208.13
-54.38.214.106
+54.38.214.237
  54.38.215.250
  54.38.215.29
  54.38.22.61
@@ -124081,18 +125122,19 @@
  54.39.131.45
  54.39.133.203
  54.39.133.91
+54.39.134.199
  54.39.145.123
  54.39.147.2
  54.39.156.171
  54.39.16.153
  54.39.16.73
+54.39.161.171
  54.39.172.214
  54.39.193.0
  54.39.197.109
  54.39.215.23
  54.39.215.32
  54.39.215.38
-54.39.22.116
  54.39.22.135
  54.39.22.191
  54.39.226.219
@@ -124235,11 +125277,9 @@
  54.89.131.64
  54.89.138.184
  54.89.185.159
-54.89.224.115
  54.89.225.128
  54.89.248.173
  54.89.252.81
-54.89.31.13
  54.89.43.19
  54.89.46.30
  54.89.49.59
@@ -124271,10 +125311,10 @@
  54.93.52.240
  54.93.53.196
  54.93.64.79
-54.93.83.49
  54.93.87.122
  54.93.91.251
  54.93.96.87
+54.94.158.137
  54.94.250.84
  54.95.0.160
  54.95.190.219
@@ -124352,17 +125392,16 @@
  57bofa75.bofa0serivceb.com
  57d3e30e.duckdns.org
  57vd9.app.link
+58.106.192.11
  58.106.192.116
-58.106.192.165
-58.106.192.223
-58.106.192.74
-58.106.192.99
+58.106.192.155
+58.106.192.191
  58.108.233.121
  58.108.236.249
  58.108.249.145
  58.11.242.228
  58.11.57.98
-58.11.7.238
+58.114.246.150
  58.114.246.240
  58.115.163.19
  58.115.59.62
@@ -124380,6 +125419,7 @@
  58.119.67.1
  58.120.227.139
  58.120.27.153
+58.120.80.234
  58.121.108.44
  58.122.119.36
  58.124.169.148
@@ -124389,7 +125429,6 @@
  58.126.223.166
  58.126.42.93
  58.127.186.231
-58.127.98.156
  58.130.120.224
  58.131.104.7
  58.137.160.183
@@ -124410,11 +125449,10 @@
  58.142.243.112
  58.142.60.80
  58.143.142.142
-58.143.163.69
  58.143.198.47
  58.143.198.47bin.sh
  58.145.1.198
-58.145.188.235
+58.145.184.229
  58.146.211.140
  58.146.230.24
  58.147.170.114
@@ -124429,8 +125467,8 @@
  58.147.173.47
  58.147.176.235
  58.147.180.126
+58.147.183.23
  58.148.102.96
-58.148.250.34
  58.149.49.186
  58.149.52.124
  58.149.89.229
@@ -124438,6 +125476,7 @@
  58.150.99.144
  58.151.154.220
  58.152.111.131
+58.152.115.170
  58.152.139.19
  58.152.168.217
  58.152.172.249
@@ -124445,7 +125484,6 @@
  58.152.189.120
  58.152.190.140
  58.152.194.200
-58.152.202.207
  58.152.206.190
  58.152.222.59
  58.152.27.236
@@ -124455,17 +125493,14 @@
  58.152.69.150
  58.152.89.3
  58.153.107.115
-58.153.112.138
  58.153.112.168
  58.153.121.112
  58.153.135.214
  58.153.221.41
  58.153.30.180
  58.153.41.214
-58.153.44.156
  58.153.51.2
  58.153.57.224
-58.153.62.86
  58.153.63.208
  58.158.0.86
  58.16.172.147
@@ -124499,6 +125534,7 @@
  58.177.139.102
  58.177.46.171
  58.177.5.220
+58.177.6.190
  58.177.86.10
  58.177.91.169
  58.179.129.102
@@ -124524,11 +125560,13 @@
  58.182.1.187
  58.182.11.253
  58.182.110.51
+58.182.14.102
  58.182.163.181
  58.182.165.40
  58.182.173.200
  58.182.20.251
  58.182.23.169
+58.182.24.168
  58.182.25.225
  58.182.30.170
  58.182.39.210
@@ -124547,13 +125585,11 @@
  58.186.50.107
  58.186.68.14
  58.187.115.178
-58.187.115.69
  58.187.16.56
  58.187.209.67
  58.187.209.75
  58.187.209.93
  58.187.22.51
-58.187.22.53
  58.187.230.37
  58.187.30.99
  58.187.57.100
@@ -124576,28 +125612,27 @@
  58.20.91.67
  58.208.214.167
  58.208.84.93
-58.209.108.35
  58.209.119.46
  58.209.130.205
  58.209.211.56
  58.209.23.73
  58.209.239.23
+58.21.101.8
  58.21.177.44
  58.21.187.149
  58.21.199.126
-58.21.234.93
  58.21.247.227
-58.21.249.47
  58.21.83.240
  58.21.9.241
  58.210.128.130
+58.210.154.44
  58.210.163.242
  58.210.172.118
  58.210.173.182
+58.210.180.180
  58.210.200.82
  58.210.207.141
  58.210.239.86
-58.210.243.26
  58.210.252.53
  58.210.38.210
  58.210.49.222
@@ -124624,7 +125659,6 @@
  58.212.63.146
  58.212.63.63
  58.213.104.138
-58.213.116.170
  58.213.149.106
  58.213.155.227
  58.213.189.227
@@ -124649,6 +125683,7 @@
  58.213.91.7
  58.213.91.8
  58.213.91.9
+58.214.10.242
  58.214.11.123
  58.214.254.57
  58.214.27.130
@@ -124693,7 +125728,6 @@
  58.216.176.211
  58.216.176.212
  58.216.176.214
-58.216.195.206
  58.216.199.243
  58.216.199.246
  58.216.207.110
@@ -124717,7 +125751,7 @@
  58.218.17.129
  58.218.185.20
  58.218.199.80
-58.218.200.199
+58.218.200.145
  58.218.200.95
  58.218.204.51
  58.218.210.162
@@ -124738,6 +125772,7 @@
  58.220.10.164
  58.220.10.171
  58.220.109.222
+58.220.194.82
  58.220.204.246
  58.220.232.9
  58.220.248.189
@@ -124755,11 +125790,11 @@
  58.220.56.3
  58.220.56.64
  58.220.87.226
-58.220.95.78
+58.220.95.82
+58.220.95.92
  58.221.101.182
  58.221.11.42
  58.221.114.18
-58.221.12.190
  58.221.128.74
  58.221.137.36
  58.221.14.14
@@ -124787,11 +125822,8 @@
  58.221.60.131
  58.221.60.232
  58.221.62.191
-58.221.62.199
  58.221.62.204
  58.221.62.214
-58.221.62.221
-58.221.62.228
  58.221.64.51
  58.221.67.10
  58.221.72.119
@@ -124817,9 +125849,9 @@
  58.227.193.198
  58.227.252.120
  58.228.159.253
+58.228.206.71
  58.229.114.170
  58.229.157.178
-58.229.184.242
  58.229.187.72
  58.229.194.122bfac0332.moe
  58.229.208.158
@@ -124832,7 +125864,6 @@
  58.230.118.81
  58.230.123.88
  58.230.147.230
-58.230.195.149
  58.232.55.7
  58.232.55.8
  58.233.240.94
@@ -124854,7 +125885,6 @@
  58.240.231.114
  58.240.9.11
  58.240.96.50
-58.241.124.154
  58.241.135.9
  58.241.150.125
  58.241.230.77
@@ -124897,6 +125927,7 @@
  58.245.169.185
  58.245.217.14
  58.245.221.27
+58.245.227.22
  58.245.246.4
  58.245.68.200
  58.246.134.186
@@ -124905,6 +125936,7 @@
  58.246.180.114
  58.246.231.6
  58.246.4.50
+58.246.5.122
  58.246.60.162
  58.246.64.11
  58.246.68.6
@@ -124914,36 +125946,33 @@
  58.246.91.155
  58.247.10.90
  58.247.120.118
-58.247.149.224
  58.247.69.39
  58.247.83.230
  58.248.104.122
+58.248.113.174
  58.248.117.15
-58.248.141.20
-58.248.141.68
-58.248.143.42
-58.248.144.88
-58.248.148.107
+58.248.141.66
  58.248.17.84
  58.248.173.230
  58.248.208.148
  58.248.208.150
  58.248.225.28
-58.248.73.136
-58.248.73.144
  58.248.73.71
+58.248.73.91
+58.248.78.202
  58.248.83.223
  58.248.85.43
+58.248.85.44
  58.248.99.230
-58.249.11.44
-58.249.12.133
-58.249.12.30
-58.249.13.40
-58.249.14.27
+58.249.10.119
+58.249.13.110
  58.249.19.224
+58.249.22.145
  58.249.55.68
-58.249.82.45
-58.249.87.247
+58.249.79.175
+58.249.82.92
+58.249.88.43
+58.249.91.245
  58.250.176.94
  58.250.250.161
  58.250.27.18
@@ -124956,6 +125985,7 @@
  58.252.135.50
  58.252.4.137
  58.252.68.5
+58.253.17.140
  58.254.220.116
  58.254.35.146
  58.254.35.178
@@ -124967,7 +125997,6 @@
  58.27.207.42
  58.27.247.70
  58.27.95.2
-58.29.20.121
  58.29.26.73
  58.29.84.41
  58.3.155.8
@@ -124990,7 +126019,6 @@
  58.33.240.114
  58.33.35.82
  58.33.49.196
-58.33.52.126
  58.33.84.251
  58.33.85.113
  58.33.88.179
@@ -125002,16 +126030,15 @@
  58.37.11.109
  58.37.183.99
  58.37.204.241
-58.37.21.252
  58.37.3.198
  58.37.36.163
+58.37.5.38
  58.37.56.83
  58.37.58.49
  58.39.143.22
  58.39.177.96
  58.40.118.114
  58.40.124.174
-58.40.44.119
  58.40.66.114
  58.40.66.150
  58.42.193.33
@@ -125036,7 +126063,7 @@
  58.48.160.162
  58.48.168.166
  58.48.226.103
-58.48.84.6
+58.48.84.78
  58.49.116.78
  58.49.147.37
  58.49.210.174
@@ -125060,9 +126087,12 @@
  58.53.128.136
  58.53.128.61
  58.53.146.36
+58.54.36.109
  58.55.2.141
  58.55.48.181
  58.55.50.141
+58.56.112.167
+58.56.140.242
  58.56.140.62
  58.56.164.66
  58.56.166.66
@@ -125073,8 +126103,8 @@
  58.56.51.208
  58.56.56.174
  58.56.66.199
+58.56.96.27
  58.57.100.34
-58.57.111.247
  58.57.15.29
  58.57.182.202
  58.57.182.242
@@ -125128,9 +126158,9 @@
  58.65.172.252
  58.65.218.108
  58.65.218.138
-58.65.223.227
  58.65.74.28
  58.69.136.192
+58.69.161.161
  58.69.161.45
  58.69.165.197
  58.69.215.238
@@ -125144,9 +126174,9 @@
  58.71.29.162
  58.71.56.2
  58.71.87.58
+58.74.76.18
  58.74.76.19
  58.75.126.235
-58.76.151.189
  58.76.151.51
  58.76.162.134
  58.76.165.110
@@ -125159,9 +126189,7 @@
  58.8.143.108
  58.8.143.230
  58.8.2.250
-58.8.212.155
  58.8.232.197
-58.8.78.89
  58.80.109.59
  58.82.155.11
  58.82.170.50
@@ -125177,6 +126205,7 @@
  58.84.31.133
  58.84.31.149
  58.84.31.169
+58.84.31.17
  58.84.31.173
  58.84.31.209
  58.84.31.21
@@ -125184,12 +126213,12 @@
  58.84.31.33
  58.84.31.41
  58.84.31.45
-58.84.31.57
  58.84.31.65
  58.84.31.77
  58.84.31.81
  58.84.31.9
  58.84.31.97
+58.84.6.58
  58.87.108.16
  58.87.110.244
  58.87.113.103
@@ -125228,7 +126257,7 @@
  58.9.182.62
  58.9.45.27
  58.9.99.67
-58.96.153.140
+58.96.148.138
  58.96.175.218
  58.96.211.50
  58.96.237.121
@@ -125236,6 +126265,7 @@
  58.97.195.80
  58.97.201.228
  58.97.201.45
+58.97.205.164
  58.97.206.33
  58.97.214.5
  58.97.214.7
@@ -125284,17 +126314,14 @@
  59.1.28.42
  59.1.28.70
  59.1.86.1
-59.10.157.106
  59.10.99.194
  59.100.12.173
  59.102.110.19
  59.102.148.151
  59.102.168.189
  59.102.177.157
-59.102.250.170
-59.103.121.38
+59.102.248.141
  59.103.138.87
-59.103.139.131
  59.103.164.174
  59.103.254.36
  59.106.141.147
@@ -125349,6 +126376,7 @@
  59.120.20.152
  59.120.212.241
  59.120.221.107
+59.120.231.151
  59.120.239.204
  59.120.5.154
  59.120.51.157
@@ -125400,7 +126428,6 @@
  59.125.189.76
  59.125.189.77
  59.125.196.15
-59.125.2.63
  59.125.204.199
  59.125.213.86
  59.125.214.115
@@ -125408,15 +126435,13 @@
  59.125.243.2
  59.125.248.139
  59.125.250.70
-59.125.252.49
-59.125.28.51
-59.125.3.241
  59.125.3.249
  59.125.52.155
  59.125.65.160
  59.125.67.198
  59.125.70.206
  59.125.70.209
+59.125.8.186
  59.125.89.226
  59.125.9.109
  59.125.96.140
@@ -125424,7 +126449,6 @@
  59.126.0.117
  59.126.0.227
  59.126.0.8
-59.126.1.160
  59.126.1.251
  59.126.1.71
  59.126.10.235
@@ -125456,8 +126480,10 @@
  59.126.124.201
  59.126.125.198
  59.126.125.219
+59.126.125.66
  59.126.126.194
  59.126.126.240
+59.126.127.50
  59.126.129.175
  59.126.129.67
  59.126.13.126
@@ -125512,6 +126538,7 @@
  59.126.177.25
  59.126.177.66
  59.126.178.22
+59.126.178.78
  59.126.179.108
  59.126.179.191
  59.126.179.204
@@ -125527,7 +126554,6 @@
  59.126.191.95
  59.126.192.181
  59.126.193.24
-59.126.193.247
  59.126.194.205
  59.126.194.21
  59.126.195.116
@@ -125565,6 +126591,7 @@
  59.126.217.61
  59.126.218.24
  59.126.218.99
+59.126.219.227
  59.126.22.118
  59.126.22.127
  59.126.22.160
@@ -125604,6 +126631,7 @@
  59.126.243.232
  59.126.244.150
  59.126.244.95
+59.126.247.104
  59.126.247.67
  59.126.249.103
  59.126.25.224
@@ -125622,7 +126650,6 @@
  59.126.29.238
  59.126.3.201
  59.126.31.137
-59.126.31.233
  59.126.31.99
  59.126.32.152
  59.126.32.227
@@ -125692,10 +126719,10 @@
  59.126.89.160
  59.126.89.168
  59.126.89.170
-59.126.9.103
  59.126.9.41
  59.126.90.148
  59.126.90.23
+59.126.91.234
  59.126.92.65
  59.126.94.172
  59.126.95.119
@@ -125753,6 +126780,7 @@
  59.127.142.124
  59.127.144.140
  59.127.145.30
+59.127.146.107
  59.127.146.175
  59.127.147.73
  59.127.149.232
@@ -125791,6 +126819,7 @@
  59.127.178.8
  59.127.179.46
  59.127.18.188
+59.127.18.235
  59.127.180.145
  59.127.181.118
  59.127.181.163
@@ -125900,7 +126929,6 @@
  59.127.57.125
  59.127.57.203
  59.127.59.111
-59.127.59.197
  59.127.60.3
  59.127.61.150
  59.127.61.232
@@ -125938,7 +126966,6 @@
  59.127.88.189
  59.127.90.31
  59.127.92.227
-59.127.92.35
  59.127.93.103
  59.127.94.85
  59.127.95.245
@@ -125959,6 +126986,7 @@
  59.144.139.18
  59.144.48.34
  59.145.111.67
+59.145.146.166
  59.145.221.103
  59.147.165.20
  59.148.18.126
@@ -125974,6 +127002,7 @@
  59.149.115.177
  59.149.135.248
  59.149.145.94
+59.149.194.222
  59.149.202.190
  59.149.205.222
  59.149.60.131
@@ -125996,6 +127025,8 @@
  59.151.224.169
  59.151.224.38
  59.151.231.113
+59.151.236.4
+59.151.236.62
  59.151.239.36
  59.151.244.11
  59.151.245.158
@@ -126006,12 +127037,12 @@
  59.151.43.20
  59.151.47.42
  59.152.104.54
-59.152.11.134
  59.152.111.241
  59.152.130.112
  59.152.212.72
  59.152.212.82
  59.152.237.118
+59.152.245.126
  59.152.246.226
  59.152.251.30
  59.152.254.50
@@ -126025,10 +127056,8 @@
  59.153.121.184
  59.153.121.188
  59.153.121.190
-59.153.16.156
  59.153.17.186
  59.153.18.90
-59.153.254.215
  59.153.84.253
  59.153.96.138
  59.153.97.156
@@ -126038,6 +127067,7 @@
  59.16.133.69
  59.16.28.45
  59.16.36.147
+59.160.209.30
  59.162.86.8
  59.167.120.116
  59.167.126.2
@@ -126045,12 +127075,10 @@
  59.167.155.59
  59.169.181.125
  59.17.121.71
-59.17.53.198
  59.17.56.114
  59.173.115.51
  59.173.12.166
  59.173.12.193
-59.173.12.194
  59.173.134.123
  59.173.195.149
  59.174.151.114
@@ -126064,6 +127092,7 @@
  59.175.153.34
  59.175.228.60
  59.177.104.112
+59.177.104.170
  59.177.105.44
  59.177.36.227
  59.177.36.77
@@ -126075,16 +127104,18 @@
  59.177.76.57
  59.177.77.32
  59.177.78.212
-59.177.78.23
  59.177.79.168
  59.177.79.213
  59.177.79.79
  59.178.72.124
+59.178.77.198
  59.178.85.61
  59.178.87.82
  59.18.144.188
  59.18.193.139
  59.18.194.137
+59.180.144.113
+59.180.145.56
  59.180.154.236
  59.181.106.18
  59.181.122.64bin.sh
@@ -126141,6 +127172,7 @@
  59.22.144.211
  59.22.196.109
  59.22.233.81
+59.22.26.131
  59.22.55.86
  59.23.108.205
  59.23.13.47
@@ -126187,14 +127219,11 @@
  59.28.24.197
  59.28.42.77
  59.28.44.229
-59.28.64.54
-59.28.74.176
  59.28.94.51
  59.29.129.36
  59.29.130.171
  59.29.135.151
  59.29.170.57
-59.29.216.209
  59.29.66.218
  59.29.80.231
  59.3.110.118
@@ -126213,7 +127242,6 @@
  59.3.210.31
  59.3.241.252
  59.3.28.131
-59.3.4.233
  59.3.94.190
  59.3.95.108
  59.30.109.93
@@ -126242,13 +127270,13 @@
  59.35.232.8
  59.35.232.82
  59.35.233.171
-59.35.233.21
  59.35.233.76
  59.35.234.210
  59.35.234.69
  59.35.234.93
  59.35.234.99
  59.35.235.122
+59.35.235.245
  59.35.235.67
  59.36.148.69
  59.36.161.241
@@ -126290,17 +127318,17 @@
  59.39.205.253
  59.39.205.95
  59.4.151.52
+59.4.9.69
  59.4.98.61
  59.40.79.114
-59.40.81.227
  59.41.125.163
  59.41.65.43
  59.42.10.71
  59.42.192.90
  59.42.206.228
  59.42.207.212
-59.42.39.10
  59.42.88.53
+59.42.89.198
  59.42.91.140
  59.44.150.165
  59.44.175.19
@@ -126308,7 +127336,6 @@
  59.44.37.156
  59.45.142.240
  59.45.142.253
-59.45.202.11
  59.45.27.187
  59.45.40.120
  59.45.40.52
@@ -126320,11 +127347,10 @@
  59.46.13.128
  59.46.13.129
  59.46.13.130
+59.46.13.136
  59.46.13.252
  59.46.13.71
  59.46.13.79
-59.46.136.138
-59.46.136.140
  59.46.15.117
  59.46.15.118
  59.46.169.194
@@ -126351,7 +127377,6 @@
  59.47.37.141
  59.48.117.70
  59.48.129.142
-59.48.142.30
  59.48.149.251
  59.48.150.2
  59.48.172.222
@@ -126382,10 +127407,11 @@
  59.52.78.185
  59.52.8.217
  59.53.216.136
-59.53.45.141
  59.54.54.226
  59.55.128.147
  59.55.128.170
+59.55.38.119
+59.55.38.153
  59.55.38.86
  59.55.39.200
  59.55.74.250
@@ -126405,8 +127431,6 @@
  59.56.71.215
  59.56.73.201
  59.56.74.16
-59.56.78.38
-59.56.78.47
  59.56.99.130
  59.57.13.188
  59.57.13.92
@@ -126430,12 +127454,14 @@
  59.61.10.134
  59.61.13.184
  59.61.160.125
+59.61.160.222
  59.61.241.46
  59.61.9.191
  59.63.163.165
  59.63.199.198
  59.63.200.69
  59.63.203.138
+59.63.204.76
  59.63.206.201
  59.63.206.206
  59.63.207.6
@@ -126446,7 +127472,13 @@
  59.63.225.114
  59.63.228.14
  59.64.129.148
+59.64.129.38
+59.64.129.41
+59.64.129.43
+59.64.129.74
+59.64.129.84
  59.67.149.249
+59.7.108.233
  59.7.124.148
  59.7.137.10
  59.7.163.186
@@ -126475,11 +127507,10 @@
  59.88.200.64
  59.88.203.124
  59.88.206.41
-59.88.228.146
-59.88.228.17
-59.88.228.83
  59.88.229.91
-59.88.231.71
+59.88.230.213
+59.88.230.67
+59.88.231.69
  59.88.57.0
  59.88.59.82
  59.89.118.170
@@ -126487,7 +127518,6 @@
  59.9.106.52
  59.9.157.71
  59.9.16.131
-59.9.170.189
  59.9.243.192
  59.9.77.181
  59.9.87.225
@@ -126528,137 +127558,129 @@
  59.91.204.5
  59.91.204.52
  59.91.205.123
+59.92.180.180
+59.92.180.227
+59.92.180.245
  59.92.180.55
-59.92.181.247
-59.92.181.38
-59.92.182.127
-59.92.182.179
-59.92.183.186
+59.92.180.61
+59.92.181.230
+59.92.181.8
+59.92.182.229
+59.92.182.96
+59.92.183.104
+59.92.183.134
+59.92.216.222
+59.92.216.253
  59.92.216.254
-59.92.217.220
-59.92.217.234
-59.92.218.14
-59.92.219.243
+59.92.5.201
  59.92.69.22
  59.92.74.46
+59.93.100.94
+59.93.105.126
  59.93.108.103
-59.93.16.166
-59.93.16.207
  59.93.17.15
-59.93.18.129
-59.93.18.134
-59.93.18.153
-59.93.18.222
-59.93.19.103
-59.93.19.110
-59.93.236.60
-59.93.237.138
-59.93.237.16
-59.93.237.206
+59.93.17.71
+59.93.18.112
+59.93.18.179
+59.93.18.77
+59.93.236.205
+59.93.236.223
+59.93.237.139
+59.93.238.18
  59.93.238.57
-59.93.238.77
-59.93.239.213
-59.93.239.219
-59.93.239.78
+59.93.239.58
  59.94.176.237
  59.94.176.30
-59.94.180.211
+59.94.180.125
+59.94.180.196
+59.94.182.142
  59.94.182.158
-59.94.182.54
-59.94.182.61
-59.94.183.101
-59.94.183.119
+59.94.182.216
+59.94.183.13
  59.94.183.146
  59.94.183.173
-59.94.183.222
-59.94.183.34
+59.94.183.211
  59.95.103.13
-59.95.172.216
-59.95.172.26
+59.95.172.12
+59.95.172.22
+59.95.172.38
+59.95.172.80
+59.95.172.88
+59.95.173.115
  59.95.173.165
-59.95.173.41
-59.95.174.247
-59.95.175.196
+59.95.173.202
+59.95.173.207
+59.95.173.32
+59.95.174.71
+59.95.175.190
+59.95.175.253
  59.95.96.42
-59.96.36.20
-59.96.36.232
-59.96.36.38
-59.96.37.163
-59.96.37.180
-59.96.37.64
-59.96.38.140
-59.96.38.148
-59.96.38.158
+59.96.37.237
  59.96.38.234
+59.96.38.236
+59.96.39.108
+59.96.39.44
+59.96.39.55
  59.97.130.179
  59.97.141.18
  59.97.168.179
-59.97.168.233
-59.97.168.252
-59.97.168.4
  59.97.168.72
-59.97.168.86
-59.97.169.1
  59.97.169.135
  59.97.169.147
-59.97.169.19
-59.97.169.224
-59.97.169.238
-59.97.169.29
  59.97.169.64
  59.97.169.69
  59.97.169.86
  59.97.170.15
-59.97.170.160
+59.97.170.193
  59.97.170.28
-59.97.171.133
-59.97.171.222
-59.97.172.102
-59.97.172.179
-59.97.172.246
-59.97.172.255
-59.97.173.112
-59.97.174.112
-59.97.175.209
-59.97.175.218
+59.97.171.67
+59.97.172.159
+59.97.172.161
+59.97.172.200
+59.97.173.111
+59.97.173.146
+59.97.173.173
+59.97.174.189
+59.97.175.151
+59.97.175.19
+59.97.175.204
  59.97.238.208
  59.98.16.203
  59.98.16.49
+59.98.188.119
  59.98.7.7
  59.99.136.150
-59.99.136.243
-59.99.138.162
-59.99.140.232
-59.99.143.70
+59.99.139.78
+59.99.141.69
+59.99.141.98
  59.99.149.135
+59.99.151.19
+59.99.151.224
  59.99.151.226
-59.99.162.51
-59.99.40.106
+59.99.40.168
  59.99.40.216
  59.99.40.226
+59.99.40.63
  59.99.40.68
-59.99.41.116
  59.99.41.151
  59.99.41.172
-59.99.41.249
-59.99.41.41
+59.99.41.192
  59.99.41.83
  59.99.42.0
-59.99.42.168
-59.99.43.221
-59.99.43.245
-59.99.43.73
-59.99.44.116
+59.99.43.165
  59.99.44.229
-59.99.46.166
-59.99.46.39
-59.99.47.178
-59.99.47.64
+59.99.44.43
+59.99.45.154
+59.99.46.176
+59.99.47.139
+59.99.47.157
+59.99.47.237
+59.99.47.88
  59.99.7.159
-59.99.93.177
-59.99.93.253
-59.99.95.113
-59.99.95.73
+59.99.94.165
+59.99.94.166
+59.99.94.187
+59.99.95.139
  590466-dot-n-e-w-me-ss-age-po-rt-al.wl.r.appspot.com
  5918062d-fb42-4707-b098-e2c266e14d95.htmlpasta.com
  591860.playcode.io
@@ -126794,13 +127816,13 @@
  60.10.72.82
  60.108.128.186
  60.11.112.11
+60.11.114.36
  60.11.222.33
  60.11.46.194
  60.11.51.92
  60.11.9.112
  60.113.117.109
  60.113.215.60
-60.114.10.36
  60.12.105.13
  60.12.109.78
  60.12.124.70
@@ -126810,6 +127832,7 @@
  60.12.218.186
  60.12.33.9
  60.12.5.27
+60.12.77.171
  60.13.126.151
  60.13.146.20
  60.13.194.103
@@ -126821,6 +127844,7 @@
  60.13.230.199
  60.13.240.104
  60.13.251.214
+60.132.121.224
  60.14.102.82
  60.14.118.152
  60.14.120.24
@@ -126830,25 +127854,20 @@
  60.144.22.38
  60.148.120.11
  60.15.117.151
-60.15.140.107
  60.15.140.167
  60.15.170.110
  60.15.194.186
-60.15.251.149
-60.16.102.136
  60.16.109.31
  60.16.195.247
  60.16.197.67
  60.16.209.190
  60.16.51.42
-60.16.84.139
  60.16.86.190
  60.16.89.28
  60.16.89.67
  60.16.92.122
  60.16.94.203
  60.160.11.46
-60.160.21.37
  60.160.21.8
  60.161.13.29
  60.161.13.44
@@ -126876,9 +127895,8 @@
  60.166.39.106
  60.166.73.0
  60.166.78.28
-60.167.133.233
  60.167.176.189
-60.167.176.209
+60.167.176.194
  60.167.176.247
  60.167.176.250
  60.167.176.251
@@ -126897,16 +127915,17 @@
  60.167.178.23
  60.167.178.4
  60.167.178.45
+60.167.178.50
+60.167.178.69
  60.167.178.95
  60.167.180.193
  60.167.182.147
  60.167.182.169
+60.167.182.170
  60.167.182.184
-60.167.182.209
  60.167.188.207
  60.167.189.120
  60.167.189.172
-60.167.189.37
  60.167.189.73
  60.167.191.86
  60.167.239.99
@@ -126918,13 +127937,13 @@
  60.168.132.4
  60.168.150.207
  60.169.245.234
+60.17.13.236
  60.17.148.145
  60.17.173.140
  60.17.248.255
  60.17.58.124
  60.170.101.25
  60.170.110.43
-60.170.111.51
  60.170.119.252
  60.170.166.177
  60.170.166.72
@@ -126935,12 +127954,14 @@
  60.170.255.63
  60.170.27.76
  60.171.117.206
+60.171.122.145
  60.171.124.70
  60.171.124.72
  60.171.163.216
  60.171.203.85
  60.171.206.244
  60.171.208.199
+60.171.3.42
  60.171.94.91
  60.172.160.43
  60.172.31.231
@@ -126953,12 +127974,13 @@
  60.173.162.235
  60.173.226.146
  60.173.241.134
+60.173.243.229
  60.173.255.176
  60.173.65.6
  60.173.9.178
+60.174.118.80
  60.174.130.19
  60.174.21.13
-60.174.21.251
  60.174.217.87
  60.174.225.253
  60.174.234.44
@@ -126968,11 +127990,9 @@
  60.174.242.172
  60.174.248.244
  60.174.55.78
-60.174.66.254
  60.174.72.198
  60.174.95.143
  60.175.1.242
-60.175.12.255
  60.175.124.27
  60.175.153.105
  60.175.198.48
@@ -126982,6 +128002,7 @@
  60.177.125.171
  60.177.27.77
  60.178.118.14
+60.178.220.210
  60.178.24.168
  60.178.27.215
  60.178.27.76
@@ -126990,15 +128011,14 @@
  60.18.128.4
  60.18.184.72
  60.181.185.65
-60.182.230.45
+60.182.195.11
  60.182.238.212
-60.183.156.213
+60.182.96.198
  60.183.3.161
  60.184.197.173
  60.184.54.204
  60.184.95.135
  60.185.159.249
-60.186.118.84
  60.187.229.19
  60.187.238.63
  60.189.149.202
@@ -127038,7 +128058,6 @@
  60.190.23.22
  60.190.239.210
  60.190.24.225
-60.190.248.12
  60.190.249.119
  60.190.249.121
  60.190.249.66
@@ -127050,6 +128069,7 @@
  60.191.100.164
  60.191.107.132
  60.191.11.241
+60.191.11.248
  60.191.119.124
  60.191.119.99
  60.191.125.35
@@ -127068,6 +128088,7 @@
  60.191.227.227
  60.191.227.228
  60.191.23.21
+60.191.230.14
  60.191.244.45
  60.191.250.30
  60.191.26.184
@@ -127081,7 +128102,6 @@
  60.191.94.120
  60.194.241.132
  60.194.65.243
-60.195.134.92
  60.195.216.149
  60.196.69.234
  60.199.10.222
@@ -127108,7 +128128,6 @@
  60.20.110.43
  60.20.128.152
  60.20.238.251
-60.205.140.63
  60.205.161.200
  60.205.181.62
  60.205.188.24
@@ -127118,6 +128137,7 @@
  60.206.112.119
  60.206.193.1
  60.208.105.196
+60.208.111.194
  60.208.128.251
  60.208.131.178
  60.208.160.4
@@ -127131,7 +128151,7 @@
  60.209.129.217
  60.209.132.86
  60.209.136.34
-60.209.160.144
+60.209.163.54
  60.209.165.19
  60.209.181.202
  60.209.198.71
@@ -127143,7 +128163,6 @@
  60.209.255.142
  60.209.26.70
  60.209.57.205
-60.209.62.224
  60.209.64.209
  60.209.72.126
  60.209.75.27
@@ -127152,6 +128171,7 @@
  60.21.162.14
  60.21.237.26
  60.21.65.118
+60.21.80.144
  60.21.83.195
  60.210.104.22
  60.210.147.126
@@ -127178,14 +128198,12 @@
  60.211.94.184
  60.211.94.68
  60.211.94.68bin.sh
-60.212.106.214
  60.212.107.162
  60.212.107.162bin.sh
-60.212.107.220
-60.212.117.206
  60.212.124.131
  60.212.143.63
  60.212.153.164
+60.212.157.163
  60.212.166.205
  60.212.175.113
  60.212.180.197
@@ -127210,7 +128228,6 @@
  60.213.177.63
  60.213.184.26
  60.213.191.74
-60.213.191.78
  60.213.46.22
  60.213.88.124
  60.214.102.23
@@ -127221,15 +128238,15 @@
  60.214.127.114
  60.214.132.222
  60.214.143.78
-60.214.144.94
  60.214.147.82
+60.214.193.155
  60.214.211.202
  60.214.216.192
  60.214.216.34
  60.214.225.11
  60.214.227.206
  60.214.239.108
-60.214.246.10
+60.214.244.248
  60.214.33.185
  60.214.34.129
  60.214.35.154
@@ -127238,16 +128255,16 @@
  60.215.161.69
  60.215.162.234
  60.215.163.198
-60.215.171.23
  60.215.190.176
  60.215.195.37
  60.215.202.140
  60.215.203.48
  60.215.204.152
  60.215.205.208
-60.215.212.206
  60.215.212.60
  60.215.219.107
+60.215.220.191
+60.215.3.73
  60.215.35.217
  60.215.83.254
  60.216.101.46
@@ -127264,6 +128281,7 @@
  60.217.138.161
  60.217.64.137
  60.217.64.237
+60.217.85.127
  60.218.184.100
  60.218.191.222
  60.218.206.187
@@ -127275,6 +128293,7 @@
  60.219.253.118
  60.219.36.9
  60.22.126.140
+60.22.184.171
  60.22.205.62
  60.22.243.10
  60.22.72.185
@@ -127283,7 +128302,6 @@
  60.22.89.105
  60.22.91.164
  60.220.104.240
-60.220.104.36
  60.220.145.122
  60.220.147.196
  60.220.185.149
@@ -127301,6 +128319,7 @@
  60.220.29.0
  60.220.38.208
  60.220.94.170
+60.221.225.136
  60.221.49.97
  60.222.233.208
  60.223.232.94
@@ -127318,7 +128337,6 @@
  60.235.24.222
  60.237.58.71
  60.24.124.52
-60.24.60.82
  60.24.72.131
  60.24.73.183
  60.24.77.243
@@ -127326,7 +128344,6 @@
  60.241.146.218
  60.241.231.114
  60.241.53.60
-60.241.77.93
  60.242.148.12
  60.243.114.66
  60.243.149.14
@@ -127373,8 +128390,6 @@
  60.249.114.145
  60.249.133.137
  60.249.134.102
-60.249.143.230
-60.249.143.61
  60.249.145.25
  60.249.178.193
  60.249.178.194
@@ -127382,12 +128397,10 @@
  60.249.183.169
  60.249.197.246
  60.249.206.148
-60.249.212.131
  60.249.220.97
  60.249.220.99
  60.249.229.232
  60.249.24.88
-60.249.245.247
  60.249.246.89
  60.249.25.127
  60.249.29.205
@@ -127397,7 +128410,6 @@
  60.249.82.172
  60.249.90.30
  60.249.91.223
-60.25.11.42
  60.25.222.222
  60.25.235.106
  60.250.103.77
@@ -127408,6 +128420,7 @@
  60.250.159.236
  60.250.164.169
  60.250.189.46
+60.250.189.56
  60.250.198.27
  60.250.203.77
  60.250.213.157
@@ -127417,6 +128430,7 @@
  60.250.23.233
  60.250.235.138
  60.250.246.221
+60.250.29.230
  60.250.58.142
  60.250.75.139
  60.250.77.209
@@ -127438,15 +128452,13 @@
  60.251.58.88
  60.251.60.100
  60.251.60.96
-60.251.80.75
-60.251.80.77
  60.251.80.78
  60.253.12.90
  60.253.14.166
  60.253.15.104
  60.253.32.68
-60.253.34.48
  60.253.39.56
+60.253.42.72
  60.253.42.95
  60.253.43.137
  60.253.43.41
@@ -127458,7 +128470,6 @@
  60.253.47.20
  60.253.49.27
  60.253.50.5
-60.253.50.8
  60.253.51.127
  60.253.51.57
  60.253.60.26
@@ -127486,12 +128497,13 @@
  60.26.104.57
  60.26.121.56
  60.26.230.19
+60.26.242.110
  60.26.7.44
  60.27.115.26
  60.27.118.124
  60.27.126.250
+60.27.238.191
  60.27.56.76
-60.27.79.149
  60.29.123.202
  60.29.126.50
  60.29.169.151
@@ -127515,10 +128527,12 @@
  60.49.0.221
  60.49.104.110
  60.49.106.113
+60.49.125.97
  60.5.100.77
  60.5.139.234
  60.5.174.236
  60.5.45.85
+60.5.68.188
  60.50.28.188
  60.50.30.158
  60.50.30.177
@@ -127536,7 +128550,6 @@
  60.51.4.203
  60.52.0.144
  60.52.249.62
-60.52.32.114
  60.52.55.44
  60.52.84.101
  60.53.126.184
@@ -127545,7 +128558,6 @@
  60.53.229.147
  60.53.36.56
  60.53.81.7
-60.54.32.157
  60.6.132.170
  60.6.140.127
  60.6.146.92
@@ -127555,6 +128567,7 @@
  60.6.168.146
  60.6.182.160
  60.6.202.12
+60.6.203.73
  60.6.206.52
  60.6.210.131
  60.6.221.122
@@ -127565,6 +128578,7 @@
  60.69.252.31
  60.7.102.46
  60.7.198.3
+60.7.222.2
  60.7.94.111
  60.73.33.73
  60.8.118.82
@@ -127583,6 +128597,7 @@
  60.9.70.60
  60.9.86.113
  60.9.91.169
+60.9.98.32
  60.93.23.51
  60.93.62.64
  60112501-dot-sydneyma.appspot.com
@@ -127611,7 +128626,6 @@
  61.0.29.14
  61.0.29.186
  61.0.29.99
-61.0.99.35
  61.1.236.251
  61.1.34.158
  61.10.182.126
@@ -127621,7 +128635,6 @@
  61.100.186.87
  61.100.3.100
  61.100.5.136
-61.101.130.209
  61.102.209.45
  61.102.209.52
  61.105.225.163
@@ -127657,6 +128670,7 @@
  61.131.223.33
  61.131.228.76
  61.131.45.105
+61.131.45.22
  61.132.110.126
  61.132.138.82
  61.132.138.83
@@ -127672,6 +128686,7 @@
  61.132.52.45
  61.133.118.6
  61.133.122.19
+61.133.215.6
  61.133.232.248
  61.133.232.249
  61.133.232.250
@@ -127691,7 +128706,6 @@
  61.135.215.237
  61.135.223.109
  61.136.101.103
-61.136.101.166
  61.136.101.178
  61.136.101.248
  61.136.144.163
@@ -127705,7 +128719,6 @@
  61.136.79.32
  61.137.152.233
  61.137.159.194
-61.137.174.249
  61.138.106.9
  61.138.117.21
  61.138.28.45
@@ -127727,22 +128740,18 @@
  61.140.178.126
  61.140.73.133
  61.140.73.155
-61.141.125.22
+61.141.124.74
  61.141.139.226
  61.141.21.34
  61.141.222.94
  61.141.235.210
  61.141.236.46
  61.141.64.20
-61.142.20.11
  61.142.20.19
-61.142.20.22
  61.142.20.25
  61.142.20.26
-61.142.20.28
  61.142.20.29
  61.142.20.31
-61.142.20.32
  61.142.20.33
  61.142.20.35
  61.142.20.36
@@ -127783,11 +128792,11 @@
  61.144.211.235
  61.144.53.34
  61.145.177.158
-61.145.178.134
  61.145.182.27
  61.145.185.121
  61.145.216.2
  61.145.83.149
+61.146.108.149
  61.146.118.104
  61.146.199.186
  61.147.103.107
@@ -127799,8 +128808,6 @@
  61.147.204.122
  61.147.48.164
  61.147.48.95
-61.147.51.141
-61.147.51.195
  61.147.67.206
  61.147.70.66
  61.148.149.130
@@ -127815,11 +128822,13 @@
  61.149.254.214
  61.15.151.91
  61.15.70.53
+61.15.98.7
  61.150.104.98
  61.150.106.246
  61.150.114.203
  61.150.115.117
  61.150.43.105
+61.150.43.67
  61.150.44.50
  61.150.76.240
  61.150.88.32
@@ -127835,6 +128844,7 @@
  61.153.111.234
  61.153.111.235
  61.153.111.236
+61.153.111.237
  61.153.126.1
  61.153.145.58
  61.153.168.232
@@ -127844,13 +128854,13 @@
  61.153.26.54
  61.153.6.226
  61.154.164.241
-61.154.197.122
  61.154.64.31
  61.155.0.253
  61.155.106.14
  61.155.137.205
  61.155.137.21
  61.155.138.100
+61.155.138.2
  61.155.142.67
  61.155.142.68
  61.155.142.70
@@ -127905,7 +128915,6 @@
  61.161.86.194
  61.162.164.228
  61.162.168.8bin.sh
-61.162.220.97
  61.162.55.42
  61.162.57.22
  61.162.66.193
@@ -127913,18 +128922,14 @@
  61.163.123.82
  61.163.136.104bin.sh
  61.163.138.253
+61.163.138.254
  61.163.139.202
  61.163.140.237
-61.163.144.61
-61.163.148.143
-61.163.149.255
+61.163.144.85
+61.163.148.22
  61.163.151.46
-61.163.153.67
  61.163.156.160
-61.163.156.172
-61.163.179.56
  61.163.192.28
-61.163.192.88
  61.163.216.136
  61.163.218.33
  61.163.36.4
@@ -127957,7 +128962,9 @@
  61.167.119.228
  61.167.119.234
  61.167.149.97
+61.167.36.206
  61.167.98.130
+61.168.136.94
  61.168.137.183
  61.168.139.52
  61.168.222.143
@@ -127966,13 +128973,13 @@
  61.171.17.64
  61.171.31.11
  61.172.115.43
-61.172.209.164
  61.172.242.187
  61.172.244.198
  61.173.103.189
  61.173.28.251
  61.174.16.174
  61.174.212.58
+61.174.243.62
  61.174.50.171
  61.174.50.5
  61.174.50.57
@@ -128044,6 +129051,7 @@
  61.180.113.8
  61.180.184.214
  61.180.65.236
+61.180.65.25
  61.180.78.228
  61.181.128.242
  61.181.131.18
@@ -128058,7 +129066,6 @@
  61.183.137.210
  61.183.144.188
  61.183.15.9
-61.183.158.70
  61.183.35.124
  61.183.37.9
  61.183.52.106
@@ -128078,6 +129085,7 @@
  61.184.249.125
  61.184.25.246
  61.184.33.43
+61.184.37.86
  61.184.44.52
  61.184.77.70
  61.184.80.4
@@ -128085,6 +129093,7 @@
  61.185.114.130
  61.185.114.227
  61.185.131.172
+61.185.140.39
  61.185.18.34
  61.185.18.37
  61.185.198.130
@@ -128094,8 +129103,9 @@
  61.185.9.93
  61.186.130.102
  61.186.32.187
+61.186.39.188
  61.186.39.193
-61.187.10.130
+61.187.10.133
  61.188.199.10
  61.188.210.229
  61.188.220.206
@@ -128105,7 +129115,6 @@
  61.189.20.45
  61.189.238.80
  61.189.38.56
-61.189.38.59
  61.189.43.58
  61.19.114.51
  61.19.127.228
@@ -128142,18 +129151,18 @@
  61.191.55.33
  61.194.24.197
  61.196.43.176
+61.197.137.241
+61.2.129.0
  61.2.140.193
  61.2.148.230
  61.2.17.110
  61.2.17.135
-61.2.23.34
+61.2.17.56
  61.2.243.4
  61.2.253.156
-61.2.44.65
-61.2.44.68
+61.20.90.56
  61.200.18.66
  61.213.118.28
-61.216.1.21
  61.216.102.1
  61.216.103.142
  61.216.104.177
@@ -128178,7 +129187,6 @@
  61.216.36.106
  61.216.4.39
  61.216.40.209
-61.216.43.72
  61.216.44.125
  61.216.51.177
  61.216.57.229
@@ -128210,7 +129218,6 @@
  61.220.128.67
  61.220.142.90
  61.220.150.137
-61.220.172.121
  61.220.196.1
  61.220.243.202
  61.220.35.110
@@ -128226,24 +129233,27 @@
  61.221.64.176
  61.221.64.4
  61.221.64.5
+61.221.64.6
  61.221.64.90
  61.221.80.157
  61.222.146.129
  61.222.155.229
+61.222.202.201
  61.222.59.232
  61.223.1.89
  61.223.126.28
  61.223.15.203
  61.223.15.216
  61.223.27.157
-61.223.44.48
  61.223.49.87
-61.223.81.40
+61.224.104.10
+61.224.195.22
  61.224.68.208
  61.224.82.134
  61.224.83.54
  61.224.86.241
  61.227.128.7
+61.227.152.173
  61.227.180.80
  61.227.200.210
  61.227.235.200
@@ -128257,7 +129267,6 @@
  61.230.163.73
  61.230.170.34
  61.230.200.211
-61.231.18.204
  61.232.206.226
  61.237.147.33
  61.238.1.229
@@ -128305,6 +129314,7 @@
  61.244.80.223
  61.245.177.13
  61.246.32.180
+61.246.38.175
  61.246.39.159
  61.246.7.145
  61.247.178.158
@@ -128327,7 +129337,6 @@
  61.28.112.218
  61.28.116.83
  61.29.96.146
-61.31.171.230
  61.32.154.211
  61.33.119.226
  61.35.11.199
@@ -128365,22 +129374,19 @@
  61.51.18.235
  61.51.81.90
  61.52.0.64
-61.52.1.233
  61.52.10.243
  61.52.100.125
  61.52.100.150
  61.52.100.185
-61.52.100.186
+61.52.100.190
  61.52.100.73
-61.52.100.93
  61.52.101.115
-61.52.101.143
  61.52.101.202
  61.52.101.233
+61.52.101.72
  61.52.102.130
  61.52.102.132
  61.52.102.245
-61.52.102.4
  61.52.11.40
  61.52.11.87
  61.52.128.79
@@ -128388,94 +129394,89 @@
  61.52.131.104
  61.52.131.12
  61.52.131.176
-61.52.131.33
-61.52.132.81
  61.52.133.51
-61.52.135.235
-61.52.15.243
+61.52.135.93
  61.52.156.121
  61.52.156.236
  61.52.156.70
  61.52.157.252
+61.52.158.105
  61.52.158.222
  61.52.158.68
  61.52.159.163
  61.52.159.87
  61.52.162.105
+61.52.165.197
  61.52.167.249
-61.52.168.253
  61.52.173.234
  61.52.173.3
-61.52.174.1
  61.52.177.101
  61.52.179.41
  61.52.180.133
-61.52.185.53
  61.52.186.168
-61.52.192.5
+61.52.186.240
  61.52.193.144
  61.52.193.179
  61.52.193.198
  61.52.194.12
  61.52.195.136
-61.52.197.160
+61.52.196.120
  61.52.197.203
-61.52.197.21
  61.52.197.60
  61.52.197.85
-61.52.198.39
  61.52.199.108
  61.52.199.196
  61.52.199.216
  61.52.2.139
  61.52.204.140
  61.52.208.198
+61.52.211.59
  61.52.212.132
  61.52.212.172
  61.52.212.36
-61.52.212.76
  61.52.213.195
  61.52.213.99
+61.52.214.251
  61.52.214.83
  61.52.215.10
  61.52.215.165
  61.52.232.179
  61.52.233.93
-61.52.243.192
+61.52.234.222
+61.52.245.219
  61.52.247.130
  61.52.27.34
  61.52.28.126
  61.52.28.79
-61.52.31.211
-61.52.33.209
+61.52.31.243
  61.52.33.42
-61.52.36.21
-61.52.37.1
+61.52.38.210
  61.52.39.229
-61.52.42.44
+61.52.40.74
+61.52.41.251
  61.52.43.138
  61.52.44.105
+61.52.45.100
+61.52.48.101
+61.52.48.233
  61.52.51.132
-61.52.53.183
-61.52.55.84
+61.52.53.241
  61.52.56.216
-61.52.56.246
-61.52.59.69
+61.52.58.177
  61.52.6.11
-61.52.61.157
+61.52.63.127
  61.52.7.77
  61.52.73.35
  61.52.78.106
-61.52.79.142
+61.52.78.131
  61.52.79.18
-61.52.81.173
  61.52.87.29
  61.52.9.250
  61.52.9.67
  61.52.96.134
-61.52.96.137
  61.52.96.149
  61.52.96.169
+61.52.96.26
  61.52.96.46
  61.52.96.74
  61.52.96.88
@@ -128487,82 +129488,72 @@
  61.52.98.151
  61.52.98.32bin.sh
  61.52.98.45
-61.52.99.136
  61.52.99.181
  61.52.99.216
  61.52.99.51
+61.53.1.72
  61.53.10.102
  61.53.11.91
  61.53.116.130
-61.53.116.44
  61.53.117.0
-61.53.117.85
  61.53.117.98
+61.53.118.216
  61.53.119.67
  61.53.119.82
  61.53.12.31
+61.53.121.174
  61.53.121.45
  61.53.121.53
  61.53.123.24
  61.53.124.62
  61.53.125.48
  61.53.126.46
-61.53.127.168
  61.53.138.31
-61.53.145.121
-61.53.145.19
-61.53.150.202
+61.53.150.134
  61.53.151.235
-61.53.152.54
-61.53.174.46
-61.53.237.230
+61.53.220.96
  61.53.241.13
  61.53.249.50
  61.53.251.230
-61.53.27.97
-61.53.30.219
-61.53.31.223
+61.53.26.14
+61.53.30.87
+61.53.50.21
  61.53.52.35
-61.53.54.18
  61.53.54.65
+61.53.59.239
  61.53.60.160
-61.53.62.43
  61.53.65.251
  61.53.72.40
-61.53.73.199
-61.53.75.155
  61.53.75.57
-61.53.75.75
+61.53.80.98
  61.53.81.185
+61.53.81.227
  61.53.81.36
+61.53.82.230
  61.53.83.164
-61.53.83.228
  61.53.84.76
  61.53.86.248
-61.53.86.34
  61.53.87.4
  61.53.96.12
-61.54.10.129
  61.54.167.84
-61.54.169.162
+61.54.181.222
+61.54.194.88
  61.54.2.103
-61.54.205.189
  61.54.231.129
+61.54.233.174
  61.54.248.217
  61.54.249.180
  61.54.40.143
-61.54.40.148
-61.54.42.74
+61.54.41.247
+61.54.42.253
+61.54.42.69
  61.54.43.28
-61.54.58.130
+61.54.5.60
+61.54.57.26
+61.54.61.199
  61.54.62.222
-61.54.68.123
-61.54.68.160
  61.54.71.42
-61.54.71.46
-61.54.77.190
  61.54.78.161
-61.54.79.6
  61.54.96.167
  61.55.105.220
  61.55.141.11
@@ -128613,7 +129604,6 @@
  61.61.88.216
  61.61.90.100
  61.62.157.233
-61.62.190.67
  61.62.212.201
  61.62.24.129
  61.62.24.204
@@ -128633,19 +129623,15 @@
  61.67.240.189
  61.68.52.88
  61.69.167.204
-61.69.233.23
-61.69.243.114
  61.7.129.174
  61.7.138.58
  61.7.141.34
  61.7.142.39
+61.7.146.96
  61.7.147.29
  61.7.167.53
-61.7.175.108
  61.7.175.113
-61.7.177.196
  61.7.183.101
-61.7.183.147
  61.7.184.140
  61.7.184.211
  61.7.186.43
@@ -128723,12 +129709,14 @@
  61.79.229.112bin.sh
  61.79.44.92
  61.79.45.100
+61.79.62.126
  61.79.81.214
  61.8.3.157
  61.8.68.238
  61.8.75.186
  61.8.79.68
  61.80.114.203
+61.80.117.152
  61.80.117.155
  61.80.232.217
  61.80.236.225
@@ -128767,6 +129755,7 @@
  61.84.208.45
  61.84.250.133
  61.84.250.7
+61.84.250.71
  61.85.149.34
  61.85.171.104
  61.85.19.99
@@ -128774,20 +129763,17 @@
  61.85.224.42
  61.85.229.238
  61.85.230.41
-61.90.110.195
-61.91.110.222
-61.91.168.130
+61.91.163.2
  61.91.168.158
  61.91.168.162
-61.91.169.206
  61.91.183.86
  61.91.235.226
  61.91.79.40
  61.91.80.107
  61.92.121.91
+61.92.155.246
  61.92.186.222
  61.92.238.22
-61.92.44.157
  61.92.70.18
  61.92.99.157
  61.93.107.87
@@ -128810,7 +129796,6 @@
  61.97.168.249
  61.97.175.233
  61.97.208.198
-61.97.218.31
  61.97.243.109
  61.97.248.72
  61.97.249.174
@@ -128858,22 +129843,22 @@
  62.109.0.2
  62.109.10.150
  62.109.14.133
-62.109.16.3
  62.109.171.39
  62.109.18.23
  62.109.19.103
  62.109.2.52
  62.109.20.253
-62.11.236.14
+62.11.178.98
+62.11.182.229
  62.11.49.184
  62.11.75.70
-62.11.77.143
  62.112.11.188
  62.112.194.132
  62.112.9.142
  62.112.9.222
  62.113.18.61
  62.113.196.48
+62.113.2.2
  62.113.238.135
  62.113.238.136
  62.113.238.148
@@ -128892,18 +129877,14 @@
  62.118.147.22
  62.119.24.133
  62.12.113.126
+62.12.5.178
  62.12.64.91
-62.12.67.247
  62.12.79.13
  62.12.81.239
  62.12.83.197
  62.12.87.93
  62.12.91.246
  62.122.103.110
-62.122.136.240
-62.122.136.241
-62.122.136.242
-62.122.136.243
  62.122.156.74
  62.122.195.162
  62.122.201.170
@@ -128916,6 +129897,7 @@
  62.129.7.85
  62.13.193.206
  62.133.130.122
+62.133.130.126
  62.133.172.221
  62.133.174.247
  62.133.194.156
@@ -128925,10 +129907,12 @@
  62.138.14.253
  62.138.145.62
  62.138.16.231
+62.138.18.158
  62.138.2.243
  62.138.206.160
  62.139.58.76
  62.14.231.138
+62.140.0.108
  62.140.23.192
  62.140.247.10
  62.140.250.122
@@ -128939,23 +129923,12 @@
  62.141.66.110
  62.141.73.58
  62.143.168.255
-62.143.188.176
  62.148.157.111
-62.148.157.115
  62.148.157.133
-62.148.157.135
  62.148.157.137
  62.148.157.138
-62.148.157.147
-62.148.157.182
-62.148.157.2
-62.148.157.219
-62.148.157.236
  62.148.157.3
  62.148.157.48
-62.148.157.56
-62.148.157.68
-62.148.157.70
  62.149.118.150
  62.149.12.172
  62.149.143.141
@@ -128963,20 +129936,19 @@
  62.149.20.10
  62.149.20.30
  62.149.202.3
+62.149.29.38
  62.149.29.48
  62.149.29.58
  62.149.5.18
  62.149.99.113
  62.150.126.58
  62.150.131.191
-62.150.135.41
  62.150.170.140
  62.150.178.61
  62.150.191.66
  62.150.192.1
  62.150.8.199
  62.151.0.21
-62.151.177.85
  62.151.181.92
  62.152.2.154
  62.152.31.192
@@ -128989,13 +129961,13 @@
  62.16.41.210
  62.162.111.153
  62.162.147.181
-62.162.187.51
  62.162.228.66
  62.163.191.99
  62.163.24.180
  62.165.204.143
  62.165.210.76
  62.165.222.230
+62.165.252.211
  62.168.143.51
  62.168.159.42
  62.168.57.109
@@ -129025,7 +129997,9 @@
  62.171.157.235
  62.171.157.83
  62.171.160.189
+62.171.161.105
  62.171.161.47
+62.171.163.253
  62.171.164.69
  62.171.165.100
  62.171.173.13
@@ -129033,7 +130007,6 @@
  62.171.174.192
  62.171.175.89
  62.171.176.133
-62.171.177.178
  62.171.177.203
  62.171.177.80
  62.171.178.134
@@ -129050,7 +130023,6 @@
  62.173.140.118
  62.173.145.48
  62.173.149.24
-62.173.152.69
  62.173.154.183
  62.176.1.194
  62.176.116.146
@@ -129073,6 +130045,8 @@
  62.183.98.181
  62.189.71.12
  62.192.240.250
+62.193.138.129
+62.193.150.255
  62.193.227.12
  62.193.230.2
  62.194.125.15
@@ -129090,7 +130064,6 @@
  62.201.118.139
  62.201.210.134
  62.201.220.50
-62.201.222.243
  62.201.226.226
  62.201.233.59
  62.201.70.40
@@ -129100,13 +130073,14 @@
  62.203.3.235
  62.203.94.225
  62.205.132.245
-62.205.248.22
+62.205.169.74
  62.209.54.80
  62.210.101.43
  62.210.103.45
  62.210.105.112
  62.210.105.116
  62.210.107.189
+62.210.107.196
  62.210.107.201
  62.210.107.31
  62.210.107.45
@@ -129124,10 +130098,13 @@
  62.210.115.133
  62.210.116.249
  62.210.12.220
+62.210.122.241
+62.210.123.21
  62.210.124.248
  62.210.125.157
  62.210.125.53
  62.210.127.120
+62.210.129.156
  62.210.129.246
  62.210.131.148
  62.210.132.30
@@ -129147,10 +130124,13 @@
  62.210.143.245
  62.210.146.148
  62.210.146.7
+62.210.147.54
  62.210.148.246
  62.210.148.247
  62.210.148.87
  62.210.149.68
+62.210.15.212
+62.210.15.86
  62.210.151.81
  62.210.152.87
  62.210.152.90
@@ -129190,23 +130170,21 @@
  62.210.202.81
  62.210.203.108
  62.210.203.127
-62.210.204.15
  62.210.204.182
  62.210.205.141
  62.210.205.66
  62.210.206.78
  62.210.207.209
-62.210.207.241
  62.210.207.52
  62.210.207.63
  62.210.207.8
+62.210.208.225
  62.210.209.245
  62.210.209.94
  62.210.211.19
  62.210.211.209
  62.210.215.71
  62.210.217.35
-62.210.24.240
  62.210.243.247
  62.210.244.100
  62.210.244.229
@@ -129262,6 +130240,7 @@
  62.210.94.159
  62.210.97.48
  62.210.99.100
+62.210.99.150
  62.210.99.221
  62.211.205.221
  62.212.10.250
@@ -129274,6 +130253,7 @@
  62.213.82.18
  62.213.97.6
  62.215.100.217
+62.215.122.244
  62.215.194.209
  62.215.29.18
  62.216.80.252
@@ -129301,7 +130281,6 @@
  62.23.15.92
  62.231.163.161
  62.231.245.5
-62.232.198.194
  62.232.8.82
  62.232.8.98
  62.233.37.237
@@ -129381,18 +130360,18 @@
  62.240.192.42
  62.240.192.43
  62.240.2.41
+62.240.25.144
  62.240.4.4
-62.241.230.229
  62.244.140.37
  62.245.152.33
  62.250.77.255
-62.250.91.213
  62.251.109.216
  62.251.109.38
-62.251.54.163
+62.251.28.124
  62.251.56.96
  62.251.78.171
  62.253.169.206
+62.253.96.36
  62.254.14.227
  62.254.157.105
  62.254.31.211
@@ -129403,6 +130382,7 @@
  62.28.137.41
  62.28.162.34
  62.28.183.14
+62.28.193.218
  62.28.217.62
  62.28.222.221
  62.28.253.197
@@ -129421,14 +130401,16 @@
  62.32.66.252
  62.33.103.24
  62.33.105.49
+62.33.168.50
  62.33.207.196
  62.33.207.201
  62.33.207.202
  62.33.207.98
-62.33.211.129
  62.33.241.37
  62.33.36.218
+62.34.241.167
  62.34.67.100
+62.38.139.152
  62.38.153.112
  62.38.222.98
  62.38.75.208
@@ -129439,6 +130421,7 @@
  62.4.14.122
  62.4.14.183
  62.4.14.200
+62.4.14.255
  62.4.15.205
  62.4.15.225
  62.4.16.123
@@ -129449,12 +130432,11 @@
  62.4.22.236
  62.4.23.127
  62.4.29.73
+62.4.52.12
  62.4.60.50
  62.43.207.148
-62.44.134.115
  62.44.70.253
  62.44.82.61
-62.45.170.58
  62.45.213.182
  62.45.4.139
  62.46.175.44
@@ -129463,6 +130445,7 @@
  62.48.152.238
  62.48.212.197
  62.48.251.58
+62.48.254.33
  62.50.179.243
  62.57.227.12
  62.59.252.145
@@ -129476,7 +130459,7 @@
  62.60.178.229
  62.63.254.189
  62.64.6.177
-62.67.212.33
+62.67.203.104
  62.67.212.34
  62.67.212.38
  62.67.212.41
@@ -129487,6 +130470,7 @@
  62.67.51.8
  62.68.246.27
  62.68.50.134
+62.69.8.13
  62.73.105.183
  62.73.126.72
  62.73.127.10
@@ -129500,16 +130484,17 @@
  62.75.187.192
  62.75.191.106
  62.75.191.166
+62.75.201.28
  62.75.202.55
+62.75.203.118
+62.75.203.120
  62.75.204.249
  62.75.222.59
  62.76.235.126
-62.76.235.138
  62.76.235.151
  62.76.235.51
  62.76.235.84
  62.76.235.89
-62.76.235.94
  62.76.96.6
  62.77.152.150
  62.77.173.240
@@ -129523,9 +130508,11 @@
  62.80.235.224
  62.81.76.18
  62.82.161.68
+62.83.0.103
  62.83.78.94
  62.84.59.21
  62.84.75.50
+62.84.80.46
  62.85.77.116
  62.85.92.153
  62.87.116.90
@@ -129549,10 +130536,11 @@
  62.96.251.229
  62.97.116.82
  62.97.41.107
+62.97.49.121
  62.97.49.122
  62.98.20.66
+62.98.82.208
  62.99.178.46
-62.99.78.120
  62.99.90.10
  620021.com
  6200294-dot-oaao-274308.uc.r.appspot.com
@@ -129617,10 +130605,11 @@
  63.141.239.26
  63.141.239.66
  63.141.244.250
+63.141.245.34
  63.141.252.106
  63.142.161.4
-63.142.221.30
  63.142.252.72
+63.142.54.90
  63.142.58.154
  63.143.110.211
  63.143.32.126
@@ -129628,6 +130617,7 @@
  63.143.38.226
  63.143.45.19
  63.143.86.253
+63.143.96.181
  63.143.96.50
  63.143.98.57
  63.143.98.72
@@ -129650,7 +130640,6 @@
  63.168.21.195
  63.170.254.21
  63.199.35.6
-63.209.0.101
  63.220.1.43
  63.223.106.188
  63.223.85.28
@@ -129660,7 +130649,6 @@
  63.225.175.1
  63.226.22.18
  63.227.116.162
-63.228.98.57
  63.235.160.54
  63.238.56.225
  63.240.155.81
@@ -129713,26 +130701,24 @@
  63.32.211.52
  63.32.35.79
  63.32.41.63
+63.32.43.101
  63.32.57.156
  63.32.65.43
  63.33.204.91
  63.41.225.61
  63.41.36.219
-63.41.9.210
+63.41.36.220
  63.80.184.72
+63.80.191.132
+63.80.191.133
+63.80.191.134
+63.80.191.135
+63.80.191.136
+63.80.191.137
+63.80.191.138
+63.80.191.141
  63.80.191.142
-63.80.191.159
-63.80.191.160
-63.80.191.163
-63.80.191.164
-63.80.191.165
-63.80.191.167
-63.80.191.168
-63.80.191.169
-63.80.191.170
-63.80.191.171
-63.80.191.172
-63.80.191.173
+63.80.191.143
  63.80.191.175
  63.80.191.176
  63.80.191.177
@@ -129746,21 +130732,15 @@
  63.80.191.185
  63.80.191.186
  63.80.191.187
-63.80.191.98
-63.81.82.100
-63.81.82.102
-63.81.82.103
-63.81.82.105
-63.81.82.106
-63.81.82.108
-63.81.82.109
-63.81.82.110
-63.81.82.111
-63.81.82.112
-63.81.82.114
+63.80.191.192
+63.80.191.193
+63.80.191.194
+63.80.191.195
+63.81.82.11
  63.81.82.115
  63.81.82.116
  63.81.82.117
+63.81.82.12
  63.81.82.120
  63.81.82.121
  63.81.82.122
@@ -129770,7 +130750,8 @@
  63.81.82.126
  63.81.82.127
  63.81.82.128
-63.81.82.129
+63.81.82.130
+63.81.82.131
  63.81.82.132
  63.81.82.133
  63.81.82.134
@@ -129779,63 +130760,66 @@
  63.81.82.137
  63.81.82.138
  63.81.82.139
-63.81.82.14
-63.81.82.140
-63.81.82.15
-63.81.82.17
-63.81.82.173
-63.81.82.174
-63.81.82.175
-63.81.82.176
-63.81.82.178
-63.81.82.180
-63.81.82.181
-63.81.82.182
-63.81.82.183
-63.81.82.184
-63.81.82.185
-63.81.82.186
-63.81.82.187
+63.81.82.141
+63.81.82.142
+63.81.82.144
+63.81.82.145
+63.81.82.146
+63.81.82.148
+63.81.82.150
+63.81.82.151
+63.81.82.152
+63.81.82.154
+63.81.82.155
+63.81.82.172
  63.81.82.189
-63.81.82.19
  63.81.82.190
  63.81.82.191
  63.81.82.192
  63.81.82.193
  63.81.82.194
  63.81.82.195
-63.81.82.20
  63.81.82.24
  63.81.82.27
+63.81.82.31
  63.81.82.36
-63.81.82.41
  63.81.82.43
-63.81.82.50
-63.81.82.51
-63.81.82.52
-63.81.82.55
+63.81.82.47
  63.81.82.60
  63.81.82.62
+63.81.82.67
+63.81.82.68
+63.81.82.69
  63.81.82.7
+63.81.82.70
+63.81.82.71
+63.81.82.72
+63.81.82.73
+63.81.82.74
+63.81.82.75
+63.81.82.76
+63.81.82.77
+63.81.82.78
+63.81.82.80
  63.81.82.81
-63.81.82.98
-63.81.82.99
+63.81.82.97
  63.81.90.136
-63.81.90.144
-63.81.90.145
-63.81.90.147
-63.81.90.149
+63.81.90.140
+63.81.90.143
  63.81.90.150
  63.81.90.153
  63.81.90.156
  63.81.90.157
-63.81.90.165
-63.81.90.167
-63.81.90.168
-63.81.90.169
+63.81.90.158
+63.81.90.159
+63.81.90.164
  63.81.90.172
-63.81.90.180
+63.81.90.175
+63.81.90.177
+63.81.90.178
  63.81.90.188
+63.81.90.195
+63.83.74.194
  630068-dot-n-e-w-me-ss-age-po-rt-al.wl.r.appspot.com
  630124578416503-dot-wah-cgo-lsb.appspot.com
  6306481-0.alojamiento-web.es
@@ -129877,6 +130861,7 @@
  64.118.86.44
  64.119.195.128
  64.119.197.105
+64.119.197.139
  64.119.81.233
  64.120.239.130
  64.120.51.146
@@ -129884,10 +130869,7 @@
  64.121.237.50
  64.121.26.99
  64.121.30.123
-64.121.39.60
  64.124.100.52
-64.126.33.184
-64.127.84.44
  64.128.143.65
  64.128.143.70
  64.13.225.150
@@ -129926,15 +130908,15 @@
  64.139.79.35
  64.140.150.169
  64.140.169.42
+64.141.112.137
  64.141.19.180
  64.145.76.122
-64.145.76.129
-64.145.76.141
+64.145.76.128
  64.145.76.147
-64.145.76.153
  64.145.76.158
+64.145.76.182
  64.145.76.183
-64.145.76.32
+64.145.76.20
  64.145.76.38
  64.145.76.56
  64.145.76.63
@@ -129944,20 +130926,12 @@
  64.145.79.10
  64.145.93.244
  64.145.93.245
-64.145.94.39
-64.145.94.51
  64.145.94.58
+64.145.94.9
  64.147.114.20
  64.147.6.186
  64.147.96.154
  64.15.109.235
-64.15.129.102
-64.15.129.106
-64.15.129.116
-64.15.129.117
-64.15.129.118
-64.15.129.119
-64.15.129.124
  64.15.147.111
  64.15.147.71
  64.15.155.177
@@ -129983,22 +130957,25 @@
  64.180.181.171
  64.180.196.13
  64.180.6.192
+64.180.80.127
  64.180.81.97
  64.182.235.13
  64.182.69.130
  64.182.69.233
+64.183.100.166
  64.183.185.42
  64.183.252.250
  64.183.73.122
+64.183.78.70
  64.185.115.4
  64.185.14.18
  64.187.175.226
  64.187.217.234
  64.187.99.130
  64.188.19.107
+64.188.30.226
  64.188.44.114
  64.189.249.37
-64.19.218.10
  64.190.203.117
  64.191.88.242
  64.20.156.51
@@ -130015,13 +130992,11 @@
  64.202.187.246
  64.202.188.205
  64.202.189.14
-64.203.121.36
  64.207.144.30
  64.207.152.81
  64.207.182.168
  64.207.184.67
  64.207.187.164
-64.210.41.241
  64.210.64.114
  64.213.148.44
  64.213.148.88
@@ -130033,6 +131008,8 @@
  64.225.106.12
  64.225.106.89
  64.225.109.187
+64.225.11.24
+64.225.11.59
  64.225.112.216
  64.225.115.33
  64.225.116.243
@@ -130177,8 +131154,6 @@
  64.227.74.255
  64.227.75.111
  64.227.75.56
-64.227.76.190
-64.227.76.234
  64.227.77.123
  64.227.77.253
  64.227.77.84
@@ -130191,7 +131166,6 @@
  64.227.84.153
  64.227.84.155
  64.227.84.163
-64.227.88.175
  64.227.89.96
  64.227.90.107
  64.227.91.117
@@ -130226,7 +131200,6 @@
  64.235.211.78
  64.235.243.55
  64.235.34.69
-64.235.35.160
  64.235.37.69
  64.235.38.189
  64.235.41.131
@@ -130244,13 +131217,12 @@
  64.29.146.185
  64.30.37.40
  64.31.10.194
-64.31.14.194
  64.31.24.174
  64.31.6.122
  64.31.8.10
  64.32.104.210
-64.32.122.161
  64.32.137.180
+64.33.193.67
  64.33.68.176
  64.34.111.74
  64.34.161.16
@@ -130275,15 +131247,10 @@
  64.4.90.225
  64.4.98.235
  64.4.99.106
-64.40.144.19
-64.40.231.54
  64.40.250.5
  64.42.183.66
-64.43.30.230
  64.44.133.131
  64.44.40.66
-64.44.48.172
-64.44.48.81
  64.46.4.160
  64.46.6.37
  64.46.83.194
@@ -130293,6 +131260,7 @@
  64.52.85.67
  64.53.14.211
  64.53.206.136
+64.53.207.60
  64.57.124.244
  64.57.124.245
  64.57.124.246
@@ -130422,6 +131390,7 @@
  64.69.57.76
  64.69.57.98
  64.71.131.100
+64.71.178.100
  64.71.178.84
  64.71.187.74
  64.71.73.142
@@ -130448,17 +131417,21 @@
  64.9.216.172
  64.90.191.82
  64.90.194.108
+64.90.40.253
  64.90.48.197
  64.90.48.204
+64.90.49.109
  64.90.49.117
  64.90.49.118
+64.90.49.12
  64.90.49.120
  64.90.49.122
  64.90.49.126
  64.90.49.164
  64.90.49.166
-64.90.49.169
+64.90.49.168
  64.90.49.170
+64.90.49.176
  64.90.49.179
  64.90.49.241
  64.90.49.250
@@ -130480,8 +131453,10 @@
  64.90.50.44
  64.90.50.70
  64.90.50.79
+64.90.50.81
  64.90.50.87
  64.90.51.1
+64.90.51.122
  64.90.51.156
  64.90.51.175
  64.90.51.18
@@ -130490,9 +131465,11 @@
  64.90.51.184
  64.90.51.186
  64.90.51.188
+64.90.51.214
  64.90.51.226
  64.90.51.244
  64.90.51.246
+64.90.51.28
  64.90.51.36
  64.90.51.6
  64.90.51.69
@@ -130501,6 +131478,7 @@
  64.90.51.95
  64.90.52.0
  64.90.52.108
+64.90.52.119
  64.90.52.12
  64.90.52.133
  64.90.52.142
@@ -130508,12 +131486,15 @@
  64.90.52.167
  64.90.52.171
  64.90.52.177
+64.90.52.199
  64.90.52.202
+64.90.52.231
  64.90.52.242
  64.90.52.252
  64.90.52.50
  64.90.52.57
  64.90.52.91
+64.90.52.92
  64.90.52.97
  64.90.53.114
  64.90.53.127
@@ -130521,7 +131502,9 @@
  64.90.53.150
  64.90.53.153
  64.90.53.179
+64.90.53.182
  64.90.53.193
+64.90.53.195
  64.90.53.198
  64.90.53.200
  64.90.53.202
@@ -130532,6 +131515,7 @@
  64.90.53.78
  64.90.53.84
  64.90.54.10
+64.90.54.110
  64.90.54.115
  64.90.54.120
  64.90.54.124
@@ -130539,8 +131523,8 @@
  64.90.54.136
  64.90.54.155
  64.90.54.200
+64.90.54.204
  64.91.224.243
-64.91.246.167
  64.91.246.36
  64.91.247.113
  64.91.248.243
@@ -130551,8 +131535,8 @@
  64.91.60.164
  64.91.60.84
  64.92.112.118
+64.92.41.20
  64.94.208.243
-64.94.210.174
  64.94.210.58
  64.95.102.36
  64.95.96.212
@@ -130560,6 +131544,7 @@
  64.95.98.11
  64.95.98.210
  64.95.98.214
+64.98.117.198
  64.98.48.179
  64055604-dot-sydneyma.appspot.com
  64346730.weebly.com
@@ -130581,8 +131566,8 @@
  64afe3595b5d8be9d60b91dae8c8bac4c1d83d72.info
  64bcf0cbd205160fc348d46e26baa31239b47dfa.info
  65.0.146.31
-65.0.180.195
  65.0.2.188
+65.0.28.34
  65.0.3.156
  65.0.31.205
  65.0.45.31
@@ -130593,7 +131578,6 @@
  65.0.82.149
  65.101.247.82
  65.101.247.83
-65.102.49.62
  65.107.59.68
  65.111.119.55
  65.111.165.14
@@ -130610,21 +131594,19 @@
  65.130.33.85
  65.130.39.119
  65.130.39.18
-65.131.65.197
  65.140.253.162
  65.155.32.128
  65.155.32.130
+65.155.32.134
  65.155.32.152
  65.155.32.174
-65.155.32.189
-65.155.32.73
+65.155.32.245
  65.158.126.62
  65.158.81.132
  65.17.190.193
  65.171.1.175
  65.172.242.149
  65.172.242.149bin.sh
-65.172.242.172
  65.172.242.225
  65.172.242.249
  65.172.242.82
@@ -130634,6 +131616,7 @@
  65.18.192.91
  65.181.112.128
  65.181.123.254
+65.181.123.34
  65.181.123.41
  65.181.124.100
  65.181.124.112
@@ -130652,6 +131635,7 @@
  65.19.167.131
  65.19.167.132
  65.19.174.248
+65.190.160.149
  65.191.76.227
  65.196.87.161
  65.207.23.201
@@ -130660,7 +131644,6 @@
  65.222.143.112
  65.23.154.17
  65.23.166.31
-65.23.182.49
  65.24.227.50
  65.24.235.86
  65.24.37.71
@@ -130673,13 +131656,14 @@
  65.255.209.18
  65.255.42.40
  65.255.60.157
-65.255.72.198
+65.255.70.150
  65.26.155.131
  65.26.224.48
  65.26.233.203
  65.27.134.105
  65.27.179.78
  65.30.124.236
+65.30.147.103
  65.31.127.80
  65.32.136.67
  65.32.157.145
@@ -130697,7 +131681,6 @@
  65.49.108.248
  65.49.109.93
  65.49.14.72
-65.49.19.100
  65.49.19.102
  65.49.194.252
  65.49.196.138
@@ -130854,19 +131837,23 @@
  65.52.39.6
  65.52.67.14
  65.60.11.122
+65.60.11.210
  65.60.11.211
  65.60.11.212
  65.60.11.213
  65.60.11.214
  65.60.144.25
  65.60.44.2
+65.60.44.3
+65.60.44.4
+65.60.44.5
+65.60.44.6
  65.60.53.122
  65.61.221.151
  65.64.8.59
  65.75.121.141
  65.75.128.151
  65.75.85.212
-65.78.164.198
  65.78.4.234
  65.78.98.124
  65.79.201.78
@@ -130892,7 +131879,6 @@
  652.3190cfdae.com
  653635dda973c896905dc7b87958b1ca0ae257b9.info
  6537712314-itm.ltd
-653879-112112.pampapicadas.com.ar
  654.31cf4fdae.com
  654298776.weebly.com
  65435621.weebly.com
@@ -130945,7 +131931,7 @@
  66.112.212.51
  66.112.218.245
  66.112.218.78
-66.113.160.231
+66.113.195.77
  66.114.33.90
  66.115.111.205
  66.115.173.18
@@ -130960,9 +131946,8 @@
  66.118.164.146
  66.119.160.235
  66.119.169.237
-66.128.244.88
+66.128.241.179
  66.128.34.136
-66.128.49.110
  66.129.151.99
  66.129.207.43
  66.130.123.42
@@ -131008,9 +131993,9 @@
  66.153.174.148
  66.154.105.122
  66.154.105.123
+66.154.107.39
  66.154.112.136
  66.154.125.164
-66.158.196.23
  66.160.134.3
  66.160.136.2
  66.160.144.159
@@ -131028,6 +132013,8 @@
  66.165.95.169
  66.168.204.54
  66.168.40.18
+66.168.88.194
+66.169.173.155
  66.169.226.99
  66.171.177.230
  66.171.58.17
@@ -131056,6 +132043,7 @@
  66.180.16.10
  66.181.188.62
  66.181.94.150
+66.182.125.217
  66.183.112.211
  66.183.182.22
  66.183.20.254
@@ -131122,19 +132110,16 @@
  66.220.12.90
  66.220.123.13
  66.220.247.9
-66.220.30.32
  66.220.31.111
+66.220.78.91
  66.222.149.143
  66.222.174.217
  66.222.218.19
  66.222.249.2
-66.222.252.124
  66.223.209.18
-66.223.220.211
  66.226.77.13
  66.227.142.13
  66.227.46.10
-66.227.46.183
  66.228.132.9
  66.228.135.203
  66.228.36.170
@@ -131189,7 +132174,6 @@
  66.25.132.43
  66.251.139.83
  66.251.139.92
-66.254.196.158
  66.254.49.172
  66.255.209.34
  66.27.104.255
@@ -131199,6 +132183,7 @@
  66.29.176.14
  66.30.252.128
  66.31.211.242
+66.31.211.79
  66.33.212.122
  66.33.219.12
  66.34.13.70
@@ -131242,7 +132227,6 @@
  66.45.255.91
  66.46.188.158
  66.49.148.15
-66.54.123.98
  66.54.249.38
  66.54.98.231
  66.54.98.235
@@ -131261,7 +132245,6 @@
  66.67.50.163
  66.68.187.140
  66.68.85.16
-66.69.180.5
  66.69.20.214
  66.69.200.130
  66.69.51.198
@@ -131287,7 +132270,6 @@
  66.70.204.64
  66.70.204.76
  66.70.207.201
-66.70.212.77
  66.70.217.179
  66.70.218.228
  66.70.218.233
@@ -131304,27 +132286,29 @@
  66.71.247.94
  66.75.72.175
  66.75.73.50
-66.75.81.143
  66.76.12.94
  66.76.196.108
  66.76.248.44
  66.76.27.71
  66.76.58.60
  66.79.163.22
-66.79.97.175
  66.8.170.104
  66.8.203.16
  66.82.22.79
  66.83.166.14
  66.84.18.202
+66.84.38.19
  66.84.9.244
  66.85.147.16
  66.85.149.114
  66.85.157.104
  66.85.157.66
  66.85.157.73
+66.85.236.175
  66.85.236.37
  66.85.46.4
+66.85.47.153
+66.85.47.5
  66.85.47.62
  66.90.118.42
  66.90.255.99
@@ -131332,12 +132316,13 @@
  66.91.3.176
  66.96.10.225
  66.96.193.206
+66.96.195.213
  66.96.220.5
  66.96.228.119
  66.96.232.138
-66.96.235.17
  66.97.120.123
  66.97.120.70
+66.97.181.196
  66.97.39.23
  66.98.114.221
  66.98.115.108
@@ -131378,7 +132363,7 @@
  67.11.150.52
  67.111.47.168
  67.140.204.16
-67.143.208.15
+67.149.1.23
  67.149.129.13
  67.149.208.37
  67.149.215.13
@@ -131387,17 +132372,16 @@
  67.149.32.99
  67.15.177.55
  67.154.191.164
-67.154.191.166
  67.159.128.203
  67.159.139.36
  67.159.16.2
  67.159.26.127
  67.159.3.18
  67.160.132.187
+67.160.206.106
  67.160.212.194
  67.161.14.41
  67.161.255.106
-67.162.172.116
  67.162.85.73
  67.163.129.15
  67.163.135.106
@@ -131406,9 +132390,9 @@
  67.166.23.54
  67.167.104.190
  67.167.81.100
-67.168.119.246
  67.168.223.110
  67.168.56.253
+67.169.76.213
  67.170.122.121
  67.170.192.229
  67.170.193.219
@@ -131417,17 +132401,15 @@
  67.173.127.128
  67.173.174.117
  67.173.174.83
+67.173.229.230
  67.173.5.122
  67.174.205.218
-67.175.140.113
  67.175.194.37
  67.176.57.29
  67.180.251.161
  67.180.88.196
-67.181.132.191
  67.183.251.230
  67.184.114.214
-67.185.243.144
  67.186.197.78
  67.187.165.231
  67.189.112.138
@@ -131467,7 +132449,6 @@
  67.198.205.62
  67.198.205.7
  67.198.237.210
-67.198.237.212
  67.198.237.229
  67.199.132.198
  67.199.132.25
@@ -131499,7 +132480,6 @@
  67.205.137.177
  67.205.138.145
  67.205.138.198
-67.205.138.247
  67.205.139.170
  67.205.140.101
  67.205.140.87
@@ -131520,7 +132500,6 @@
  67.205.150.14
  67.205.150.155
  67.205.150.64
-67.205.151.173
  67.205.152.40
  67.205.153.12
  67.205.153.4
@@ -131530,6 +132509,7 @@
  67.205.158.248
  67.205.159.121
  67.205.160.105
+67.205.160.209
  67.205.161.59
  67.205.161.8
  67.205.162.26
@@ -131591,14 +132571,13 @@
  67.207.93.228
  67.207.94.180
  67.207.95.230
-67.209.133.61
  67.209.176.31
  67.209.185.210
  67.209.185.218
  67.209.185.37
  67.209.189.242
  67.209.190.12
-67.21.80.134
+67.209.248.34
  67.210.145.161
  67.210.146.61
  67.210.155.1
@@ -131606,11 +132585,11 @@
  67.210.227.162
  67.210.228.203
  67.210.68.201
-67.210.79.255
  67.211.129.161
  67.211.129.161bin.sh
  67.211.141.118
  67.211.155.95
+67.211.157.178
  67.211.208.194
  67.211.208.83
  67.211.218.74
@@ -131621,9 +132600,8 @@
  67.212.218.242
  67.213.129.59
  67.213.212.11
-67.213.212.12
-67.213.212.16
-67.213.82.137
+67.213.212.13
+67.213.212.14
  67.213.87.21
  67.213.88.27
  67.214.167.194
@@ -131637,6 +132615,7 @@
  67.215.9.236
  67.216.200.240
  67.216.204.183
+67.216.209.28
  67.216.216.103
  67.216.216.223
  67.216.220.27
@@ -131666,7 +132645,6 @@
  67.222.131.151
  67.222.138.46
  67.222.16.112
-67.222.237.232
  67.225.130.109
  67.225.139.208
  67.225.147.71
@@ -131769,9 +132747,9 @@
  67.237.24.46
  67.238.132.251
  67.240.254.142
-67.241.15.46
  67.241.150.89
  67.242.106.156
+67.243.233.2
  67.244.13.13
  67.244.29.52
  67.245.120.145
@@ -131780,7 +132758,6 @@
  67.247.22.17
  67.247.43.147
  67.248.38.146
-67.248.8.102
  67.249.107.195
  67.251.1.69
  67.251.64.168
@@ -131791,6 +132768,7 @@
  67.253.90.179
  67.254.116.89
  67.254.198.110
+67.254.221.227
  67.254.233.136
  67.255.114.169
  67.255.253.25
@@ -131801,7 +132779,6 @@
  67.40.148.193
  67.41.72.45
  67.42.197.20
-67.43.7.162
  67.48.147.31
  67.48.50.126
  67.48.63.123
@@ -131812,14 +132789,12 @@
  67.53.72.130
  67.55.101.68
  67.55.115.100
-67.55.249.224
  67.55.90.132
  67.58.209.121
  67.58.215.149
  67.58.222.7
  67.59.151.227
  67.59.156.163
-67.6.172.103
  67.60.137.219
  67.61.108.237
  67.61.119.3
@@ -131827,7 +132802,7 @@
  67.63.115.125
  67.68.88.78
  67.69.76.1
-67.69.76.204
+67.69.76.40
  67.7.5.17
  67.70.146.48
  67.70.18.29
@@ -131842,6 +132817,7 @@
  67.79.44.82
  67.79.75.242
  67.80.164.152
+67.80.221.194
  67.81.110.191
  67.81.135.204
  67.81.98.111
@@ -131886,7 +132862,7 @@
  68.1.64.48
  68.10.137.56
  68.10.18.22
-68.100.216.111
+68.100.123.171
  68.101.62.26
  68.102.243.52
  68.102.85.136
@@ -131895,13 +132871,16 @@
  68.104.65.149
  68.105.210.206
  68.105.215.189
+68.105.80.207
  68.106.161.122
  68.106.25.44
  68.107.135.126
  68.108.234.217
+68.109.122.42
  68.109.233.150
  68.109.71.148
-68.110.167.212
+68.11.106.47
+68.11.134.148
  68.111.3.250
  68.114.229.171
  68.114.95.61
@@ -131909,7 +132888,9 @@
  68.116.4.158
  68.116.41.6
  68.116.72.158
+68.116.93.54
  68.118.35.140
+68.119.100.163
  68.119.137.39
  68.119.215.85
  68.119.52.128
@@ -131919,7 +132900,6 @@
  68.129.67.139
  68.132.136.198
  68.132.64.146
-68.134.118.57
  68.134.33.199
  68.135.5.60
  68.14.211.66
@@ -131928,11 +132908,12 @@
  68.145.134.63
  68.145.170.102
  68.146.105.4
+68.148.103.103
  68.148.133.128
  68.148.9.87
  68.148.96.128
+68.149.172.24
  68.149.80.28
-68.15.133.189
  68.15.151.20
  68.15.224.140
  68.15.4.29
@@ -131942,7 +132923,6 @@
  68.150.248.120
  68.150.88.99
  68.151.210.44
-68.161.204.60
  68.162.121.232
  68.162.255.153
  68.166.0.184
@@ -131950,6 +132930,7 @@
  68.168.115.243
  68.168.142.29
  68.168.142.91
+68.168.180.195
  68.168.213.251
  68.168.213.252
  68.169.145.23
@@ -131959,6 +132940,7 @@
  68.169.51.212
  68.170.36.100
  68.170.75.117
+68.170.75.163
  68.171.103.75
  68.171.131.137
  68.171.179.72
@@ -131971,14 +132953,13 @@
  68.173.243.56
  68.173.245.139
  68.173.30.80
+68.174.119.206
  68.174.15.223
  68.174.182.226
-68.174.190.157
  68.174.233.93
  68.174.74.55
  68.175.107.153
  68.175.12.190
-68.175.50.173
  68.175.89.61
  68.178.103.180
  68.178.128.89
@@ -132083,6 +133064,7 @@
  68.183.16.53
  68.183.169.251
  68.183.170.114
+68.183.178.155
  68.183.178.162
  68.183.178.26
  68.183.179.184
@@ -132096,6 +133078,7 @@
  68.183.182.100
  68.183.182.103
  68.183.182.99
+68.183.184.7
  68.183.186.142
  68.183.186.231
  68.183.186.232
@@ -132108,6 +133091,7 @@
  68.183.188.80
  68.183.188.82
  68.183.188.89
+68.183.189.30
  68.183.19.26
  68.183.190.164
  68.183.190.199
@@ -132143,6 +133127,7 @@
  68.183.207.62
  68.183.207.70
  68.183.208.248
+68.183.208.60
  68.183.210.111
  68.183.210.163
  68.183.215.125
@@ -132153,6 +133138,7 @@
  68.183.22.30
  68.183.22.85
  68.183.221.115
+68.183.221.156
  68.183.224.75
  68.183.225.160
  68.183.226.4
@@ -132181,6 +133167,8 @@
  68.183.240.19
  68.183.27.89
  68.183.28.137
+68.183.28.215
+68.183.28.35
  68.183.29.78
  68.183.30.178
  68.183.30.66
@@ -132208,6 +133196,7 @@
  68.183.62.145
  68.183.63.109
  68.183.64.176
+68.183.64.24
  68.183.66.107
  68.183.66.233
  68.183.68.148
@@ -132217,6 +133206,7 @@
  68.183.72.81
  68.183.73.179
  68.183.75.207
+68.183.75.251
  68.183.75.56
  68.183.77.114
  68.183.78.119
@@ -132235,6 +133225,7 @@
  68.183.89.147
  68.183.90.61
  68.183.90.64
+68.183.91.237
  68.183.92.227
  68.183.92.52
  68.183.93.193
@@ -132250,20 +133241,17 @@
  68.186.178.240
  68.186.33.98
  68.186.85.14
+68.187.66.180
  68.188.11.189
  68.188.112.97
  68.188.172.210
  68.188.63.149
-68.189.109.139
  68.189.184.40
  68.190.212.219
  68.190.221.67
-68.191.108.124
  68.192.21.94
-68.192.81.18
  68.193.247.240
  68.193.34.13
-68.194.119.78
  68.194.85.201
  68.195.60.198
  68.196.183.69
@@ -132274,7 +133262,7 @@
  68.2.104.20
  68.200.175.178
  68.201.129.219
-68.202.20.97
+68.202.138.246
  68.203.9.66
  68.206.159.58
  68.206.21.41
@@ -132303,6 +133291,7 @@
  68.32.248.98
  68.34.20.123
  68.35.122.196
+68.36.29.41
  68.37.147.146
  68.37.69.206
  68.37.92.238
@@ -132313,8 +133302,8 @@
  68.4.215.225
  68.41.134.30
  68.41.31.115
+68.42.204.116
  68.43.185.239
-68.43.96.194
  68.44.137.144
  68.44.190.44
  68.44.243.74
@@ -132325,9 +133314,7 @@
  68.48.131.251
  68.48.240.245
  68.48.242.227
-68.5.173.208
  68.5.37.81
-68.5.44.226
  68.50.156.55
  68.50.171.202
  68.50.46.131
@@ -132369,10 +133356,10 @@
  68.70.11.176
  68.70.49.253
  68.71.133.101
+68.71.165.204
  68.71.37.13
  68.73.117.66
  68.74.158.192
-68.79.25.234
  68.80.60.182
  68.82.238.247
  68.83.24.202
@@ -132459,6 +133446,7 @@
  69.112.106.211
  69.112.37.174
  69.113.205.91
+69.113.44.83
  69.115.23.90
  69.116.18.32
  69.116.209.199
@@ -132467,6 +133455,7 @@
  69.118.182.115
  69.118.184.208
  69.119.193.9
+69.119.30.86
  69.119.63.199
  69.119.85.43
  69.12.127.194
@@ -132494,9 +133483,9 @@
  69.120.151.146
  69.120.246.181
  69.121.59.0
-69.123.218.229
  69.124.231.110
  69.127.214.47
+69.127.24.52
  69.13.196.47
  69.13.39.34
  69.13.39.39
@@ -132509,7 +133498,6 @@
  69.138.132.251
  69.138.189.201
  69.139.44.61
-69.139.82.55
  69.14.145.75
  69.14.157.165
  69.14.158.98
@@ -132520,16 +133508,17 @@
  69.146.134.2
  69.146.228.143
  69.146.96.117
-69.147.219.199
-69.147.219.223
+69.147.220.111
  69.147.220.142
  69.147.220.178
-69.147.220.99
-69.147.221.140
+69.147.220.197
+69.147.220.242
+69.147.221.199
  69.147.221.214
+69.147.221.246
+69.147.221.90
  69.147.222.34
  69.147.222.4
-69.147.222.70
  69.148.175.185
  69.149.41.29
  69.15.68.38
@@ -132567,41 +133556,62 @@
  69.163.160.191
  69.163.160.195
  69.163.160.200
+69.163.160.208
  69.163.160.21
+69.163.160.253
+69.163.160.3
  69.163.160.40
  69.163.160.44
  69.163.160.6
  69.163.160.64
  69.163.160.66
+69.163.160.85
  69.163.160.89
+69.163.161.105
  69.163.161.111
+69.163.161.115
  69.163.161.118
  69.163.161.162
+69.163.161.172
  69.163.161.176
  69.163.161.178
  69.163.161.203
+69.163.161.206
+69.163.161.214
  69.163.161.223
  69.163.161.226
  69.163.161.23
  69.163.161.240
+69.163.161.242
+69.163.161.245
+69.163.161.249
  69.163.161.30
  69.163.161.45
+69.163.161.47
  69.163.161.53
  69.163.161.54
  69.163.161.58
+69.163.161.65
  69.163.161.68
  69.163.161.76
  69.163.161.87
  69.163.162.100
+69.163.162.108
+69.163.162.13
  69.163.162.132
  69.163.162.153
  69.163.162.161
  69.163.162.172
+69.163.162.187
+69.163.162.191
+69.163.162.192
  69.163.162.202
+69.163.162.222
  69.163.162.240
  69.163.162.245
  69.163.162.253
  69.163.162.44
+69.163.162.47
  69.163.163.117
  69.163.163.120
  69.163.163.159
@@ -132611,19 +133621,26 @@
  69.163.163.17
  69.163.163.171
  69.163.163.174
+69.163.163.176
  69.163.163.193
  69.163.163.217
+69.163.163.32
  69.163.163.53
  69.163.163.54
  69.163.163.56
  69.163.163.6
  69.163.163.62
-69.163.163.93
+69.163.163.88
+69.163.163.92
  69.163.163.95
  69.163.163.97
+69.163.164.0
  69.163.164.100
  69.163.164.255
  69.163.164.29
+69.163.164.34
+69.163.164.37
+69.163.164.51
  69.163.164.52
  69.163.164.55
  69.163.164.61
@@ -132632,15 +133649,19 @@
  69.163.165.132
  69.163.165.172
  69.163.165.180
+69.163.165.196
  69.163.165.204
  69.163.165.22
  69.163.165.243
  69.163.165.89
+69.163.166.113
  69.163.166.12
  69.163.166.143
  69.163.166.169
  69.163.166.173
+69.163.166.247
  69.163.166.25
+69.163.166.61
  69.163.166.74
  69.163.166.97
  69.163.167.133
@@ -132671,7 +133692,6 @@
  69.167.13.148
  69.167.151.209
  69.167.152.53
-69.167.22.139
  69.167.23.48
  69.167.23.61
  69.167.27.41
@@ -132697,7 +133717,6 @@
  69.171.209.43
  69.171.209.48
  69.171.209.60
-69.171.232.235
  69.171.66.223
  69.171.71.21
  69.171.72.101
@@ -132706,7 +133725,10 @@
  69.171.78.120
  69.171.78.223
  69.171.78.225
+69.171.80.47
+69.172.161.147
  69.172.165.196
+69.172.74.46
  69.172.87.212
  69.174.245.163
  69.175.109.74
@@ -132726,34 +133748,29 @@
  69.175.97.172
  69.175.97.173
  69.175.97.174
+69.176.133.35
  69.176.53.122
-69.178.30.220
  69.178.49.209
  69.179.23.79
  69.179.38.78
  69.179.39.184
  69.179.4.41
  69.181.162.176
+69.181.189.110
  69.181.47.221
  69.181.88.180
  69.183.32.121
-69.193.61.158
  69.194.11.249
  69.194.15.75
  69.194.8.237
-69.195.124.131
-69.195.124.220
  69.195.129.71
  69.195.152.114
-69.195.221.171
-69.196.140.134
  69.196.158.227
  69.197.131.114
  69.197.139.130
  69.197.143.253
  69.197.148.26
  69.197.148.87
-69.197.149.50
  69.197.151.90
  69.197.163.195
  69.197.169.202
@@ -132770,6 +133787,7 @@
  69.197.32.119
  69.199.44.59
  69.2.244.202
+69.20.164.217
  69.20.66.228
  69.20.66.236
  69.20.94.68
@@ -132778,7 +133796,6 @@
  69.20.94.76
  69.203.201.235
  69.204.236.142
-69.206.138.154
  69.206.61.11
  69.209.23.72
  69.21.245.58
@@ -132787,16 +133804,15 @@
  69.216.103.57
  69.218.221.5
  69.22.184.249
-69.226.207.86
  69.23.123.146
  69.23.134.102
  69.232.101.123
  69.237.103.232
  69.237.82.158
  69.238.202.251
-69.243.150.123
  69.245.71.26
  69.246.26.72
+69.247.36.145
  69.247.82.140
  69.247.89.58
  69.248.146.7
@@ -132807,12 +133823,10 @@
  69.25.27.246
  69.250.156.161
  69.251.82.109
-69.254.146.8
  69.255.141.238
  69.26.142.174
  69.26.142.227
  69.26.159.51
-69.28.62.166
  69.30.198.178
  69.30.198.186
  69.30.198.202
@@ -132881,7 +133895,6 @@
  69.55.54.65
  69.55.62.9
  69.57.164.32
-69.57.237.96
  69.57.239.254
  69.58.178.56
  69.58.178.57
@@ -132901,7 +133914,6 @@
  69.62.176.156
  69.62.187.248
  69.62.190.121
-69.63.134.83
  69.63.16.6
  69.63.68.194
  69.63.73.171
@@ -132912,6 +133924,7 @@
  69.64.38.156
  69.64.46.27
  69.64.46.86
+69.64.48.102
  69.64.51.154
  69.64.51.162
  69.64.51.250
@@ -132921,11 +133934,9 @@
  69.64.67.68
  69.65.244.26
  69.65.3.168
-69.65.65.178
  69.65.70.79
  69.69.213.3
  69.70.68.42
-69.71.225.228
  69.72.169.233
  69.72.194.58
  69.72.202.238
@@ -132935,13 +133946,13 @@
  69.73.28.41
  69.75.105.124
  69.75.115.194
+69.75.175.229
  69.75.212.190
  69.76.240.206
  69.76.49.0
  69.8.34.165
  69.80.29.102
  69.81.146.13
-69.84.107.237
  69.84.12.8
  69.84.240.11
  69.84.5.144
@@ -133047,12 +134058,11 @@
  70.104.137.16
  70.106.150.91
  70.106.193.69
-70.108.242.178
  70.109.53.128
  70.110.160.224
  70.112.139.159
  70.112.162.144
-70.113.239.98
+70.112.177.13
  70.113.86.177
  70.114.22.142
  70.114.239.85
@@ -133071,20 +134081,17 @@
  70.121.172.89
  70.121.219.224
  70.121.54.87
-70.123.116.221
  70.123.125.237
-70.124.232.70
  70.124.8.67
  70.126.152.216
  70.126.196.23
  70.126.246.151
  70.126.28.214
  70.127.155.33
-70.127.209.1
  70.131.38.109
  70.15.221.17
+70.15.242.21
  70.16.157.162
-70.162.143.252
  70.164.0.233
  70.165.65.233
  70.166.204.38
@@ -133139,6 +134146,7 @@
  70.24.39.114
  70.25.91.58
  70.28.47.239
+70.28.92.124
  70.30.44.94
  70.31.72.252
  70.32.0.110
@@ -133167,8 +134175,6 @@
  70.37.50.171
  70.37.67.55
  70.37.75.157
-70.38.27.248
-70.38.27.252
  70.39.150.82
  70.40.210.173
  70.40.213.248
@@ -133177,6 +134183,7 @@
  70.44.5.62
  70.44.73.213
  70.44.89.180
+70.45.113.17
  70.45.116.71
  70.45.133.188
  70.45.224.195
@@ -133191,14 +134198,15 @@
  70.53.183.217
  70.53.185.165
  70.54.172.241
+70.55.158.66
  70.58.126.211
-70.59.239.37
  70.60.132.34
  70.60.238.62
  70.61.166.78
  70.63.170.86
  70.64.104.89
  70.64.122.204
+70.64.40.210
  70.64.48.41
  70.65.105.34
  70.65.107.59
@@ -133279,7 +134287,6 @@
  70efbf02d17896982d2d1d0d249d51e2-dot-oo0-987.appspot.com
  71.0.190.224
  71.1.107.235
-71.10.1.165
  71.100.48.61
  71.100.73.66
  71.100.77.227
@@ -133289,7 +134296,8 @@
  71.105.155.204
  71.105.44.45
  71.105.48.7
-71.112.210.65
+71.11.166.33
+71.11.249.31
  71.112.212.196
  71.114.46.209
  71.117.145.210
@@ -133298,9 +134306,9 @@
  71.125.57.64
  71.126.181.208
  71.127.149.226
-71.127.156.63
  71.127.221.147
  71.13.105.122
+71.13.28.200
  71.13.29.182
  71.13.87.122
  71.13.92.62
@@ -133314,10 +134322,10 @@
  71.15.138.7
  71.15.245.148
  71.15.45.96
-71.15.8.206
  71.161.90.231
  71.162.172.166
  71.163.171.154
+71.163.243.192
  71.163.29.121
  71.168.149.14
  71.168.214.49
@@ -133342,6 +134350,7 @@
  71.187.208.102
  71.189.180.111
  71.189.24.112
+71.189.46.188
  71.189.47.10
  71.19.144.106
  71.19.144.148
@@ -133356,9 +134365,9 @@
  71.193.164.3
  71.193.36.31
  71.194.108.170
+71.196.250.233
  71.196.93.8
  71.197.220.117
-71.197.91.77
  71.198.191.17
  71.198.208.72
  71.199.148.184
@@ -133366,6 +134375,7 @@
  71.200.70.202
  71.200.89.21
  71.204.162.179
+71.204.165.1
  71.204.34.191
  71.205.126.232
  71.208.12.25
@@ -133379,16 +134389,13 @@
  71.208.57.55
  71.208.63.90
  71.208.76.221
-71.209.0.103
  71.209.190.79
  71.209.226.194
-71.209.33.111
  71.210.174.117
  71.211.146.65
-71.211.25.111
+71.211.54.130
  71.212.144.220
  71.212.23.170
-71.212.51.43
  71.213.117.120
  71.213.141.244
  71.213.146.149
@@ -133409,25 +134416,24 @@
  71.213.58.206
  71.213.58.81
  71.213.86.3
-71.213.86.54
  71.213.88.192
  71.213.90.208
  71.215.100.233
-71.218.106.193
+71.215.38.124
  71.218.136.61
  71.218.145.149
  71.218.21.12
  71.218.245.116
  71.220.148.25
+71.220.194.112
  71.221.0.72
  71.222.26.182
-71.222.30.120
  71.222.8.178
  71.225.121.125
+71.226.40.140
  71.227.242.72
  71.228.126.91
  71.228.134.158
-71.228.149.87
  71.229.103.166
  71.229.141.129
  71.231.145.228
@@ -133437,12 +134443,14 @@
  71.233.156.100
  71.233.192.189
  71.233.52.47
-71.234.93.198
  71.235.124.243
  71.236.68.25
+71.237.115.5
  71.237.150.172
+71.237.160.28
  71.237.161.118
  71.237.97.77
+71.239.119.167
  71.242.127.196
  71.244.185.101
  71.244.226.161
@@ -133460,8 +134468,8 @@
  71.28.168.11
  71.29.210.119
  71.33.135.151
+71.33.136.246
  71.33.232.126
-71.34.18.232
  71.37.238.85
  71.38.117.8
  71.38.90.235
@@ -133487,7 +134495,6 @@
  71.47.186.82
  71.48.57.98
  71.49.116.179
-71.49.136.197
  71.49.180.36
  71.49.186.245
  71.50.131.49
@@ -133502,7 +134509,6 @@
  71.57.148.139
  71.57.180.213
  71.57.241.246
-71.58.90.64
  71.59.91.188
  71.6.146.185
  71.6.146.186
@@ -133524,10 +134530,10 @@
  71.6.232.5
  71.6.232.6
  71.6.232.8
+71.60.113.9
  71.60.175.80
  71.60.192.20
  71.60.74.147
-71.61.166.87
  71.62.115.105
  71.62.13.183
  71.62.173.58
@@ -133540,6 +134546,7 @@
  71.72.135.3
  71.72.140.136
  71.72.196.159
+71.72.234.20
  71.73.5.169
  71.74.113.236
  71.74.184.137
@@ -133554,24 +134561,20 @@
  71.80.74.41
  71.81.152.192
  71.81.191.103
-71.81.39.136
  71.82.135.102
-71.84.104.140
  71.84.157.201
  71.85.115.26
  71.85.117.51
  71.85.218.231
  71.85.5.68
  71.86.202.160
+71.86.212.20
  71.86.81.122
-71.87.161.184
  71.87.44.109
  71.88.207.47
  71.89.209.212
-71.91.114.180
  71.91.79.43
  71.92.0.15
-71.92.201.42
  71.92.202.13
  71.93.148.59
  71.93.180.247
@@ -133598,6 +134601,7 @@
  72.10.28.190
  72.10.32.139
  72.10.75.10
+72.11.135.0
  72.11.135.222
  72.11.140.74
  72.11.145.8
@@ -133607,16 +134611,13 @@
  72.128.6.3
  72.13.171.216
  72.131.69.125
-72.132.102.88
  72.132.219.48
  72.132.27.158
  72.133.177.119
-72.134.205.184
  72.134.245.7
  72.134.81.111
  72.135.224.85
  72.135.232.168
-72.136.98.208
  72.137.82.73
  72.138.45.190
  72.139.123.212
@@ -133631,7 +134632,6 @@
  72.140.179.221
  72.141.204.207
  72.141.51.198
-72.142.122.53
  72.143.100.14
  72.143.15.82
  72.15.247.113
@@ -133643,15 +134643,11 @@
  72.161.2.246
  72.167.113.216
  72.167.131.155
-72.167.159.101
-72.167.159.15
  72.167.161.46
  72.167.164.44
  72.167.164.72
-72.167.190.203
  72.167.190.213
  72.167.190.231
-72.167.190.31
  72.167.190.6
  72.167.224.135
  72.167.227.34
@@ -133669,11 +134665,11 @@
  72.18.130.41
  72.180.13.251
  72.180.80.67
-72.182.43.135
  72.183.63.214
  72.185.27.131
  72.186.136.247
  72.186.137.156
+72.186.139.38
  72.187.238.18
  72.187.53.140
  72.188.122.156
@@ -133685,8 +134681,6 @@
  72.19.61.122
  72.191.113.27
  72.191.230.57
-72.192.103.130
-72.192.153.158
  72.192.92.103
  72.194.159.49
  72.194.223.207
@@ -133699,19 +134693,15 @@
  72.195.34.59
  72.196.126.147
  72.197.219.254
+72.197.68.161
  72.198.122.235
  72.198.29.30
-72.198.8.3
-72.199.27.26
-72.199.49.30
  72.2.148.5
  72.2.20.39
  72.20.137.133
  72.20.176.209
  72.20.91.172
-72.200.55.50
  72.202.236.62
-72.203.187.202
  72.203.86.47
  72.207.151.196
  72.208.206.234
@@ -133733,17 +134723,14 @@
  72.223.19.37
  72.224.193.17
  72.225.198.139
-72.225.59.76
  72.225.7.80
  72.226.15.212
  72.227.149.82
-72.227.229.129
  72.229.211.51
  72.229.230.118
  72.230.237.11
  72.231.10.31
  72.231.188.167
-72.231.243.181
  72.232.167.73
  72.232.202.66
  72.233.127.179
@@ -133760,10 +134747,9 @@
  72.237.117.71
  72.237.117.81
  72.237.117.86
-72.238.158.71
  72.238.18.57
  72.239.229.208
-72.24.136.222
+72.239.45.223
  72.24.91.196
  72.240.123.84
  72.240.126.32
@@ -133793,9 +134779,7 @@
  72.252.4.194
  72.252.4.57
  72.253.108.147
-72.253.208.230
  72.255.1.235
-72.255.61.147
  72.255.61.161
  72.255.61.52
  72.255.62.117
@@ -133821,6 +134805,8 @@
  72.34.42.146
  72.34.42.196
  72.34.43.74
+72.37.135.201
+72.37.142.41
  72.37.199.41
  72.37.212.230
  72.38.0.172
@@ -133838,7 +134824,6 @@
  72.46.157.102
  72.46.205.70
  72.46.207.50
-72.47.186.48
  72.47.248.48
  72.48.234.137
  72.49.128.94
@@ -133847,13 +134832,11 @@
  72.50.240.124
  72.51.34.249
  72.51.6.183
-72.52.104.90
  72.52.111.58
  72.52.112.209
  72.52.112.25
  72.52.125.34
  72.52.125.83
-72.52.131.41
  72.52.138.110
  72.52.150.147
  72.52.150.93
@@ -133867,8 +134850,6 @@
  72.52.94.130
  72.53.134.182
  72.53.141.107
-72.55.136.156
-72.55.136.199
  72.65.246.83
  72.65.246.84
  72.65.62.50
@@ -133890,8 +134871,8 @@
  72.80.116.10
  72.80.198.241
  72.80.233.20
-72.83.137.48
  72.83.216.67
+72.83.232.54
  72.84.247.5
  72.84.73.68
  72.88.219.161
@@ -133957,7 +134938,9 @@
  73.100.185.180
  73.100.19.104
  73.100.40.178
+73.103.78.86
  73.104.0.50
+73.104.189.151
  73.105.29.208
  73.107.102.72
  73.109.183.238
@@ -133967,7 +134950,9 @@
  73.110.170.108
  73.110.222.253
  73.111.216.115
+73.111.52.132
  73.112.84.96
+73.114.54.239
  73.114.91.101
  73.115.82.44
  73.116.193.136
@@ -133984,12 +134969,14 @@
  73.13.104.201
  73.130.21.96
  73.131.78.250
+73.133.209.158
  73.135.41.55
  73.136.129.35
  73.138.248.232
  73.138.249.174
  73.138.75.151
  73.139.190.176
+73.139.215.133
  73.14.19.214
  73.14.213.38
  73.14.89.87
@@ -134001,10 +134988,10 @@
  73.148.23.198
  73.15.247.118
  73.150.47.81
-73.150.57.19
  73.151.61.69
  73.152.157.213
  73.152.233.100
+73.154.179.79
  73.154.78.184
  73.156.166.223
  73.156.172.155
@@ -134012,7 +134999,6 @@
  73.158.127.66
  73.158.138.247
  73.158.147.140
-73.159.33.183
  73.16.207.94
  73.160.77.80
  73.161.13.19
@@ -134022,13 +135008,13 @@
  73.162.55.16
  73.163.180.189
  73.164.52.11
-73.165.155.245
  73.166.245.77
  73.168.170.206
  73.169.135.137
  73.169.136.149
  73.170.128.14
  73.170.66.172
+73.170.78.64
  73.171.139.42
  73.171.28.104
  73.171.96.175
@@ -134038,9 +135024,10 @@
  73.178.168.31
  73.179.171.207
  73.179.223.7
+73.180.42.114
+73.181.116.81
  73.181.193.36
  73.181.212.48
-73.181.227.249
  73.182.190.68
  73.182.55.23
  73.184.146.247
@@ -134049,25 +135036,25 @@
  73.185.5.86
  73.188.27.180
  73.189.164.139
+73.189.22.167
  73.189.248.47
  73.19.95.114
-73.190.128.101
  73.191.105.147
  73.194.185.196
  73.194.254.8
  73.195.116.145
  73.196.167.45
  73.196.205.64
+73.199.65.2
  73.2.1.73
+73.2.11.155
  73.200.123.136
  73.201.99.74
  73.202.219.27
  73.202.246.138
-73.202.82.22
  73.202.94.242
  73.203.169.195
  73.203.79.200
-73.204.216.103
  73.205.101.200
  73.205.112.214
  73.205.205.213
@@ -134079,20 +135066,21 @@
  73.209.24.166
  73.209.24.30
  73.209.30.60
+73.21.65.208
  73.211.134.215
  73.212.147.92
-73.212.148.202
  73.213.160.205
  73.213.26.179
+73.215.97.122
  73.216.78.94
  73.217.114.206
  73.217.79.105
  73.22.153.25
-73.220.214.60
  73.221.221.48
  73.221.249.191
  73.222.179.128
  73.222.94.184
+73.223.184.49
  73.224.88.169
  73.225.145.238
  73.225.155.207
@@ -134106,14 +135094,18 @@
  73.23.241.110
  73.23.82.133
  73.230.25.82
-73.230.82.58
  73.231.231.83
  73.231.235.10
+73.231.235.175
  73.231.95.101
+73.232.102.183
  73.232.46.104
  73.235.129.91
  73.235.226.74
+73.238.19.246
+73.239.107.185
  73.239.11.159
+73.239.122.196
  73.239.197.175
  73.240.171.67
  73.240.190.65
@@ -134124,18 +135116,18 @@
  73.244.81.190
  73.245.214.234
  73.245.31.179
-73.246.103.38
  73.246.233.197
  73.248.190.241
  73.248.234.184
  73.25.123.164
-73.251.244.10
  73.251.84.166
  73.253.104.185
  73.254.207.2
  73.255.2.67
  73.26.102.201
+73.26.113.248
  73.26.98.45
+73.28.159.8
  73.28.200.103
  73.29.139.28
  73.29.37.188
@@ -134144,6 +135136,7 @@
  73.32.108.199
  73.35.52.167
  73.35.60.4
+73.36.232.192
  73.37.123.160
  73.38.213.196
  73.39.27.247
@@ -134156,8 +135149,10 @@
  73.43.26.125
  73.45.212.48
  73.45.37.120
+73.46.119.40
  73.46.15.133
  73.46.218.63
+73.46.231.94
  73.47.229.191
  73.47.63.196
  73.48.143.14
@@ -134181,19 +135176,15 @@
  73.59.4.102
  73.6.184.64
  73.60.227.128
-73.61.51.13
  73.61.6.1
  73.62.12.214
  73.62.147.174
-73.63.232.155
+73.63.136.108
  73.65.229.77
-73.65.243.237
-73.66.164.134
  73.66.228.172
  73.66.93.2
  73.67.133.25
  73.7.135.222
-73.72.220.62
  73.73.230.131
  73.73.90.68
  73.74.145.41
@@ -134202,7 +135193,6 @@
  73.76.41.52
  73.77.14.20
  73.78.37.96
-73.78.77.201
  73.8.77.18
  73.82.57.252
  73.82.76.68
@@ -134223,16 +135213,17 @@
  73.92.26.33
  73.93.184.25
  73.93.252.130
-73.95.139.25
  73.95.40.47
+73.96.104.152
+73.96.105.100
  73.96.105.70
  73.96.30.69
  73.97.12.152
  73.97.164.59
  73.97.177.193
+73.97.88.48
  73.98.227.247
  73.98.237.75
-73.99.185.114
  7302321canadainc.com
  730857112247343118.weebly.com
  732930-dot-n-e-w-me-ss-age-po-rt-al.wl.r.appspot.com
@@ -134252,7 +135243,6 @@
  74.101.225.121
  74.102.39.43
  74.103.153.52
-74.103.217.182
  74.103.37.117
  74.104.100.57
  74.104.160.135
@@ -134295,10 +135285,10 @@
  74.120.14.29
  74.120.14.30
  74.120.14.31
+74.120.14.37
  74.120.14.38
  74.120.14.39
  74.120.14.40
-74.120.14.53
  74.120.14.54
  74.120.14.55
  74.120.14.56
@@ -134369,11 +135359,11 @@
  74.138.26.36
  74.138.28.69
  74.14.62.39
+74.140.147.248
  74.140.187.123
  74.140.220.0
  74.141.0.75
  74.141.132.233
-74.143.65.18
  74.15.221.214
  74.15.64.117
  74.192.146.131
@@ -134381,13 +135371,12 @@
  74.194.247.205
  74.195.115.176
  74.195.171.150
-74.197.12.144
-74.199.74.88
  74.199.84.77
  74.2.185.132
  74.200.208.146
  74.201.173.132
  74.201.173.134
+74.201.249.114
  74.202.10.85
  74.202.142.53
  74.202.182.46
@@ -134400,6 +135389,7 @@
  74.204.163.90
  74.204.66.105
  74.205.120.232
+74.205.150.206
  74.205.223.153
  74.207.152.2
  74.207.187.129
@@ -134411,6 +135401,7 @@
  74.207.231.80
  74.207.237.96
  74.207.241.29
+74.207.245.232
  74.207.249.55
  74.207.253.197
  74.208.10.47
@@ -134420,6 +135411,7 @@
  74.208.123.225
  74.208.124.169
  74.208.13.22
+74.208.154.22
  74.208.168.176
  74.208.173.53
  74.208.173.91
@@ -134489,6 +135481,8 @@
  74.50.85.15
  74.50.85.59
  74.51.154.210
+74.51.2.240
+74.51.8.61
  74.52.164.18
  74.52.17.34
  74.53.121.130
@@ -134517,7 +135511,6 @@
  74.63.216.218
  74.63.220.148
  74.63.221.49
-74.63.229.198
  74.63.253.10
  74.65.216.49
  74.65.243.244
@@ -134526,20 +135519,21 @@
  74.67.193.192
  74.67.241.156
  74.68.157.90
+74.69.121.121
  74.7.84.106
  74.70.21.65
  74.71.124.74
  74.71.15.170
  74.71.152.200
  74.72.123.96
-74.72.4.203
  74.73.114.82
  74.73.249.7
  74.75.104.224
+74.75.117.254
  74.75.165.81
+74.75.205.66
  74.76.61.139
  74.77.90.160
-74.78.188.72
  74.78.203.230
  74.78.31.240
  74.79.124.131
@@ -134550,6 +135544,7 @@
  74.81.68.114
  74.82.1.152
  74.82.1.8
+74.82.193.216
  74.82.209.133
  74.82.250.119
  74.82.27.57
@@ -134620,7 +135615,6 @@
  74.82.47.7
  74.82.47.8
  74.82.47.9
-74.82.52.100
  74.83.173.67
  74.83.192.123
  74.83.221.29
@@ -134629,6 +135623,7 @@
  74.84.144.229
  74.84.144.234
  74.84.144.68
+74.84.248.252
  74.85.156.94
  74.85.157.198
  74.85.45.254
@@ -134672,24 +135667,21 @@
  75.100.167.202
  75.101.111.132
  75.101.224.25
+75.102.27.90
  75.102.39.180
-75.103.66.9
-75.104.11.91
-75.108.134.225
-75.108.59.148
  75.109.102.8
-75.109.194.152
-75.109.210.102
  75.109.221.206
  75.109.226.104
  75.109.23.22
  75.109.249.165
+75.110.236.31
  75.111.125.131
  75.111.126.62
  75.111.168.21
  75.112.160.49
  75.112.68.166
  75.112.74.197
+75.113.150.10
  75.113.162.153
  75.113.223.38
  75.114.100.166
@@ -134698,11 +135690,14 @@
  75.119.200.131
  75.119.200.97
  75.119.201.101
+75.119.201.105
  75.119.201.50
+75.119.201.82
  75.119.201.9
  75.119.202.15
  75.119.202.26
  75.119.203.171
+75.119.203.196
  75.119.203.201
  75.119.203.203
  75.119.203.204
@@ -134712,10 +135707,15 @@
  75.119.204.75
  75.119.204.99
  75.119.205.12
+75.119.205.133
  75.119.205.14
  75.119.205.219
+75.119.206.119
  75.119.206.94
+75.119.207.10
  75.119.207.115
+75.119.207.168
+75.119.207.17
  75.119.215.210
  75.121.69.141
  75.125.130.122
@@ -134739,32 +135739,32 @@
  75.127.6.62
  75.127.68.106
  75.127.7.137
+75.127.7.153
  75.127.7.167
  75.127.7.198
+75.128.106.207
  75.128.159.46
  75.128.50.87
+75.129.26.63
  75.129.64.107
  75.13.245.193
  75.13.64.99
  75.130.124.90
  75.130.218.151
-75.130.227.27
  75.132.171.144
-75.134.17.127
+75.135.100.115
+75.135.101.218
  75.136.121.230
-75.137.230.154
  75.137.241.100
  75.139.38.211
  75.140.162.212
  75.140.35.198
  75.140.86.113
-75.141.173.128
  75.142.211.18
  75.142.215.48
-75.142.252.56
  75.143.100.75
-75.143.128.12
  75.143.172.32
+75.143.218.62
  75.143.247.51
  75.144.132.165
  75.144.45.17
@@ -134781,7 +135781,6 @@
  75.150.192.33
  75.150.28.166
  75.150.62.125
-75.150.9.174
  75.151.213.85
  75.152.17.219
  75.152.64.24
@@ -134810,7 +135809,6 @@
  75.162.68.254
  75.164.153.130
  75.165.135.243
-75.165.14.36
  75.166.120.178
  75.166.186.56
  75.167.254.17
@@ -134822,24 +135820,23 @@
  75.172.114.142
  75.172.9.14
  75.173.5.69
+75.175.132.116
  75.175.2.246
-75.175.203.4
  75.175.97.248
-75.176.108.223
  75.176.21.144
  75.177.178.218
  75.181.139.49
  75.182.93.101
  75.183.15.12
-75.185.55.230
+75.185.243.179
  75.188.38.166
  75.189.232.247
  75.190.114.202
  75.2.88.115
  75.24.62.81
  75.250.130.109
+75.250.169.93
  75.3.206.157
-75.3.74.88
  75.31.93.181
  75.32.236.142
  75.4.98.105
@@ -134853,6 +135850,7 @@
  75.51.221.20
  75.51.222.43
  75.51.34.205
+75.51.96.100
  75.55.97.119
  75.56.8.205
  75.57.26.201
@@ -134869,11 +135867,13 @@
  75.71.161.216
  75.71.41.239
  75.73.90.226
+75.74.193.43
  75.74.41.21
  75.74.7.227
  75.75.232.111
  75.75.232.133
  75.75.232.154
+75.75.232.18
  75.75.232.38
  75.75.232.70
  75.76.185.211
@@ -134883,6 +135883,7 @@
  75.81.226.4
  75.82.34.4
  75.82.49.143
+75.82.85.161
  75.83.121.147
  75.83.176.131
  75.83.186.62
@@ -134896,11 +135897,12 @@
  75.85.47.95
  75.86.10.139
  75.86.142.122
+75.97.13.194
  75.97.242.94
  75.97.38.113
+75.97.40.50
  75.98.226.29
  75.98.36.146
-75.98.46.212
  75.99.123.26
  75.99.13.123
  75.99.159.189
@@ -134960,6 +135962,7 @@
  76.103.7.22
  76.104.80.47
  76.105.163.246
+76.106.249.251
  76.106.27.129
  76.106.3.21
  76.108.129.211
@@ -134978,8 +135981,7 @@
  76.120.75.139
  76.121.142.176
  76.126.246.139
-76.126.43.89
-76.127.117.8
+76.126.90.15
  76.127.99.120
  76.14.109.203
  76.14.11.121
@@ -135002,11 +136004,12 @@
  76.164.197.92
  76.164.201.201
  76.164.202.3
+76.167.148.205
  76.167.150.16
  76.167.150.74
-76.168.17.185
  76.168.54.203
  76.170.11.82
+76.170.32.158
  76.171.66.198
  76.172.60.3
  76.173.113.199
@@ -135014,30 +136017,33 @@
  76.173.179.89
  76.173.238.49
  76.173.250.27
+76.174.129.203
  76.175.100.75
  76.175.137.5
  76.175.161.123
  76.175.162.101
  76.176.13.51
  76.176.17.13
+76.176.24.51
  76.176.81.246
  76.178.135.121
  76.178.199.119
  76.178.73.223
  76.18.1.104
  76.180.99.249
+76.181.148.89
  76.181.44.116
  76.182.177.11
  76.183.201.70
  76.183.211.188
  76.184.115.29
  76.184.235.124
+76.185.195.20
  76.185.28.113
  76.186.123.165
  76.186.73.35
  76.187.167.11
  76.187.49.44
-76.188.167.244
  76.188.24.162
  76.19.33.60
  76.196.88.249
@@ -135050,6 +136056,7 @@
  76.20.63.24
  76.201.6.148
  76.204.247.110
+76.210.184.124
  76.210.186.38
  76.213.142.127
  76.214.245.110
@@ -135065,20 +136072,17 @@
  76.233.80.93
  76.24.175.218
  76.240.162.156
-76.246.9.83
-76.25.13.1
-76.251.85.6
+76.243.201.126
  76.252.198.41
  76.253.0.85
-76.254.128.137
  76.254.145.213
  76.254.145.225
  76.254.156.163
  76.26.52.132
  76.27.179.47
+76.27.59.190
  76.28.124.152
  76.28.178.62
-76.29.182.210
  76.29.80.211
  76.3.10.64
  76.3.11.225
@@ -135102,16 +136106,16 @@
  76.66.194.124
  76.69.29.42
  76.7.128.243
-76.71.32.133
  76.71.35.185
  76.72.18.79
+76.72.180.190
+76.72.22.145
  76.72.254.222
-76.72.41.185
+76.72.41.75
  76.73.249.146
  76.74.170.209
  76.74.219.143
  76.76.105.218
-76.76.236.111
  76.76.238.13
  76.76.252.217
  76.76.83.23
@@ -135130,7 +136134,6 @@
  76.84.224.46
  76.85.128.198
  76.85.153.103
-76.86.245.17
  76.87.194.213
  76.87.58.38
  76.87.85.100
@@ -135139,7 +136142,6 @@
  76.88.48.104
  76.88.51.61
  76.88.59.75
-76.89.123.68
  76.89.176.203
  76.89.241.31
  76.89.71.58
@@ -135176,10 +136178,8 @@
  76internet-yapkredi.com
  76srv.com
  76wzxjp.com
-77.0.164.75
-77.0.18.79
-77.1.191.188
-77.10.185.8
+77.1.146.189
+77.10.169.81
  77.10.235.159
  77.101.132.253
  77.104.102.230
@@ -135191,17 +136191,15 @@
  77.105.101.207
  77.105.101.233
  77.105.101.80
-77.105.199.233
  77.105.252.193
  77.105.44.25
  77.105.87.97
  77.107.17.52
-77.107.185.209
  77.107.19.61
  77.107.35.147
  77.107.41.175
  77.107.41.58
-77.107.43.217
+77.107.42.45
  77.107.51.33
  77.107.87.51
  77.108.52.128
@@ -135215,6 +136213,7 @@
  77.109.177.12
  77.109.191.140
  77.109.191.149
+77.11.158.81
  77.110.25.253
  77.110.27.226
  77.110.63.57
@@ -135222,8 +136221,9 @@
  77.119.128.158
  77.119.229.106
  77.12.69.249
-77.12.79.230
+77.12.75.247
  77.12.92.149
+77.120.103.130
  77.120.113.64
  77.120.113.69
  77.120.116.85
@@ -135231,7 +136231,6 @@
  77.120.122.114
  77.120.122.15
  77.120.122.22
-77.120.137.143
  77.120.163.103
  77.120.173.27
  77.120.33.175
@@ -135257,14 +136256,15 @@
  77.127.60.239
  77.127.71.241
  77.128.68.141
-77.13.120.217
+77.13.254.202
  77.130.135.14
  77.131.118.34
  77.134.172.81
-77.137.87.99
+77.137.144.108
  77.138.133.86
  77.138.170.206
  77.138.236.236
+77.139.39.37
  77.140.201.98
  77.140.237.201
  77.141.8.209
@@ -135274,10 +136274,11 @@
  77.159.198.186
  77.160.194.161
  77.161.42.100
+77.162.216.226
  77.163.105.152
  77.163.136.136
+77.163.184.129
  77.163.24.180
-77.164.157.171
  77.164.213.131
  77.164.241.157
  77.165.133.73
@@ -135294,18 +136295,18 @@
  77.172.59.122
  77.174.237.229
  77.175.30.187
-77.180.56.23
-77.181.103.59
+77.179.112.29
+77.179.26.56
+77.180.83.56
  77.181.90.142
+77.182.183.251
  77.182.59.79
  77.183.186.184
  77.185.12.214
-77.185.16.65
-77.189.111.15
-77.189.112.185
-77.189.171.251
+77.189.111.98
  77.189.55.178
  77.189.73.10
+77.189.95.217
  77.190.19.204
  77.190.55.239
  77.191.24.183
@@ -135314,6 +136315,7 @@
  77.198.48.5
  77.199.87.64
  77.2.62.205
+77.20.215.213
  77.20.245.213
  77.20.64.207
  77.20.64.82
@@ -135324,13 +136326,12 @@
  77.205.65.61
  77.206.120.228
  77.206.233.180
-77.21.162.104
+77.21.162.95
  77.21.166.111
  77.21.166.75
-77.21.184.104
+77.21.167.125
  77.21.186.16
  77.21.186.28
-77.21.186.81
  77.211.170.149
  77.211.170.214
  77.216.117.168
@@ -135342,6 +136343,7 @@
  77.22.22.165
  77.22.238.8
  77.220.185.190
+77.220.194.27
  77.220.214.225
  77.221.130.11
  77.221.130.15
@@ -135353,7 +136355,6 @@
  77.221.154.202
  77.221.220.133
  77.221.52.77
-77.222.104.49
  77.222.109.211
  77.222.112.127
  77.222.115.97
@@ -135371,8 +136372,8 @@
  77.222.61.212
  77.223.204.190
  77.223.205.15
-77.223.98.53
-77.223.99.80
+77.224.69.168
+77.226.83.119
  77.228.73.18
  77.229.159.32
  77.229.57.33
@@ -135397,8 +136398,6 @@
  77.234.40.136
  77.234.41.22
  77.234.89.132
-77.235.107.64
-77.235.148.74
  77.235.58.242
  77.236.189.18
  77.236.192.200
@@ -135406,7 +136405,6 @@
  77.236.64.250
  77.236.76.74
  77.236.78.158
-77.236.86.28
  77.236.97.247
  77.237.87.207
  77.238.120.20
@@ -135414,7 +136412,6 @@
  77.238.212.227
  77.238.79.111
  77.239.148.134
-77.239.200.22
  77.239.48.142
  77.239.65.206
  77.240.101.94
@@ -135429,6 +136426,7 @@
  77.242.17.114
  77.242.17.68
  77.242.20.190
+77.242.21.246
  77.242.219.206
  77.242.23.146
  77.242.234.95
@@ -135448,26 +136446,26 @@
  77.243.191.44
  77.243.191.45
  77.243.218.63
-77.243.24.243
  77.243.51.53
  77.243.95.18
+77.244.180.205
  77.244.210.246
  77.244.211.39
+77.244.236.157
  77.244.26.125
  77.244.30.184
  77.244.42.178
  77.244.46.48
  77.244.72.57
  77.245.101.254
-77.245.108.226
  77.245.110.212
  77.245.112.48
  77.245.13.198
  77.245.149.38
  77.245.15.162
+77.245.6.164
  77.245.76.93
  77.246.191.192
-77.247.108.153
  77.247.108.77
  77.247.111.98
  77.247.127.150
@@ -135482,8 +136480,8 @@
  77.247.250.70
  77.247.251.17
  77.247.92.178
+77.247.94.131
  77.247.94.176
-77.247.94.207
  77.248.178.74
  77.248.202.212
  77.248.247.204
@@ -135494,41 +136492,45 @@
  77.250.24.18
  77.250.60.51
  77.250.67.102
+77.254.237.105
  77.254.44.22
  77.27.168.117
  77.27.176.109
  77.27.26.85
  77.28.103.97
  77.28.255.80
+77.28.4.146
  77.28.96.196
  77.28.96.206
  77.29.6.65
  77.3.207.8
-77.3.216.137
+77.3.41.192
+77.3.42.49
+77.3.44.237
+77.3.81.193
  77.3.98.110
+77.30.110.196
  77.30.202.167
-77.30.226.220
  77.30.55.192
  77.30.64.52
  77.31.161.222
  77.31.35.184
  77.31.84.205
-77.32.180.154
  77.34.183.148
  77.35.39.160
  77.37.130.123
  77.37.155.85
  77.37.156.166
  77.37.164.74
-77.37.174.71
+77.37.203.230
  77.37.208.119
  77.37.212.122
  77.37.236.10
  77.37.240.23
  77.37.246.150
  77.38.21.239
-77.38.217.100
  77.38.42.145
+77.38.91.77
  77.39.117.115
  77.39.15.43
  77.39.8.184
@@ -135570,14 +136572,13 @@
  77.40.62.179
  77.41.123.213
  77.41.134.93
-77.42.225.169
  77.42.229.79
  77.42.232.4
  77.42.234.183
  77.44.58.58
+77.45.148.77
  77.45.157.18
  77.45.163.206
-77.45.246.44
  77.45.248.145
  77.46.137.17
  77.46.137.21
@@ -135586,7 +136587,6 @@
  77.46.146.6
  77.46.248.177
  77.47.114.199
-77.47.67.26
  77.48.10.206
  77.48.137.3
  77.48.137.65
@@ -135606,17 +136606,20 @@
  77.53.152.116
  77.53.206.56
  77.53.231.208
+77.53.237.204
  77.53.241.81
  77.53.242.193
  77.53.244.143
  77.53.48.218
  77.53.53.196
  77.53.7.229
+77.54.128.91
  77.54.144.158
  77.54.207.17
  77.54.232.131
  77.55.211.77
-77.56.214.160
+77.55.223.92
+77.56.232.77
  77.56.6.24
  77.57.105.152
  77.57.114.22
@@ -135625,12 +136628,13 @@
  77.57.53.115
  77.57.59.199
  77.58.100.111
+77.58.124.104
  77.58.17.83
  77.58.220.34
  77.58.58.11
-77.6.144.119
+77.6.31.247
  77.6.39.39
-77.61.187.18
+77.6.91.54
  77.64.162.103
  77.64.234.44
  77.65.129.162
@@ -135645,17 +136649,17 @@
  77.68.115.33
  77.68.115.58
  77.68.25.145
-77.68.28.173
  77.68.62.77
  77.68.79.44
  77.68.82.58
  77.68.87.99
+77.68.9.125
  77.68.9.178
  77.68.94.102
  77.69.189.71
  77.69.23.183
  77.69.9.110
-77.7.168.4
+77.7.15.202
  77.70.16.245
  77.70.29.86
  77.70.35.87
@@ -135663,7 +136667,6 @@
  77.71.30.84
  77.71.82.6
  77.72.138.108
-77.72.50.236
  77.72.71.66
  77.72.83.192
  77.73.27.69
@@ -135676,7 +136679,6 @@
  77.73.69.79
  77.73.70.2
  77.73.70.28
-77.74.168.53
  77.74.196.3
  77.74.78.80
  77.75.0.158
@@ -135736,9 +136738,7 @@
  77.76.151.206
  77.76.228.4
  77.76.41.205
-77.77.215.6
  77.78.11.235
-77.78.157.236
  77.78.17.106
  77.78.196.173
  77.78.204.44
@@ -135752,8 +136752,6 @@
  77.79.93.3
  77.8.109.186
  77.8.18.244
-77.8.185.126
-77.8.27.97
  77.81.100.88
  77.81.139.36
  77.81.139.37
@@ -135764,34 +136762,32 @@
  77.81.139.46
  77.81.23.74
  77.81.247.72
+77.81.29.62
  77.81.30.221
  77.81.7.90
  77.81.87.207
  77.82.202.81
  77.82.90.234
  77.82.96.186
+77.83.1.109
+77.83.1.157
  77.83.117.240
  77.83.149.232
-77.83.149.91
  77.83.175.161
  77.83.84.57
  77.83.84.94
  77.83.85.120
  77.83.85.129
-77.83.85.147
  77.83.85.148
  77.83.85.181
-77.83.85.196
  77.83.85.224
  77.83.85.46
  77.83.86.160
  77.83.86.170
  77.83.86.40
-77.83.87.16
  77.83.87.237
  77.83.87.242
  77.83.87.59
-77.83.87.65
  77.85.169.149
  77.85.169.19
  77.85.176.67
@@ -135816,8 +136812,8 @@
  77.89.246.62
  77.89.248.157
  77.89.251.138
+77.9.178.14
  77.91.201.31
-77.91.53.65
  77.91.60.90
  77.91.82.105
  77.92.132.179
@@ -135827,7 +136823,6 @@
  77.92.83.100
  77.93.126.12
  77.93.208.64
-77.93.211.211
  77.93.223.9
  77.93.235.34
  77.93.248.67
@@ -135843,16 +136838,12 @@
  77.95.167.41
  77.95.225.77
  77.95.60.155
-77.95.65.167
-77.95.65.168
  77.95.8.11
-77.95.93.132
  77.96.217.16
-77.96.59.247
+77.96.3.159
  77.97.150.249
  77.98.107.167
  77.super-me.online
-77005.info
  77009.net
  77011.net
  77022.org
@@ -135886,23 +136877,20 @@
  77rv.net
  77st.net
  78.1.225.180
+78.1.227.67
  78.1.228.179
  78.1.8.98
  78.10.218.176
-78.100.218.34
+78.100.216.187
  78.100.246.60
-78.101.165.58
  78.101.169.80
  78.101.178.5
-78.101.231.250
  78.101.26.131
  78.102.136.61
-78.102.239.38
  78.105.161.245
  78.106.209.103
  78.106.220.129
  78.107.220.30
-78.107.255.6
  78.107.58.130
  78.108.102.8
  78.108.108.162
@@ -135919,7 +136907,7 @@
  78.109.53.7
  78.11.32.28
  78.11.32.3
-78.11.39.85
+78.11.45.175
  78.11.69.3
  78.110.154.177
  78.110.158.168
@@ -135941,7 +136929,6 @@
  78.111.249.108
  78.111.250.174
  78.111.250.49
-78.111.97.180
  78.111.97.182
  78.111.99.178
  78.112.103.154
@@ -135950,6 +136937,7 @@
  78.113.231.245
  78.115.20.117
  78.116.69.186
+78.117.21.233
  78.118.109.147
  78.118.61.162
  78.118.96.201
@@ -135958,10 +136946,7 @@
  78.122.132.63
  78.125.47.94
  78.128.112.30
-78.128.113.118
  78.128.113.119
-78.128.113.120
-78.128.113.121
  78.128.113.162
  78.128.113.222
  78.128.113.238
@@ -135983,9 +136968,9 @@
  78.129.250.17
  78.13.52.238
  78.130.128.106
+78.130.130.3
+78.130.195.89
  78.130.254.162
-78.131.100.190
-78.131.49.8
  78.131.52.120
  78.131.56.112
  78.131.58.83
@@ -135993,7 +136978,6 @@
  78.132.140.85
  78.132.171.34
  78.132.211.254
-78.132.33.193
  78.132.63.230
  78.133.12.20
  78.133.126.100
@@ -136002,7 +136986,7 @@
  78.133.50.31
  78.133.85.100
  78.133.94.243
-78.134.119.63
+78.134.109.13
  78.134.124.92
  78.134.126.85
  78.134.17.143
@@ -136015,7 +136999,6 @@
  78.134.90.115
  78.134.93.134
  78.135.53.21
-78.136.228.101
  78.136.30.118
  78.137.122.20
  78.137.168.192
@@ -136044,9 +137027,10 @@
  78.141.223.107
  78.141.240.146
  78.141.31.43
+78.141.35.10
+78.142.109.84
  78.142.114.69
  78.142.18.20
-78.142.18.52
  78.142.194.29
  78.142.194.34
  78.142.194.6
@@ -136055,25 +137039,27 @@
  78.142.6.117
  78.142.60.102
  78.143.96.35
+78.146.186.99
  78.146.202.184
-78.146.72.130
  78.148.88.96
+78.15.151.124
  78.151.161.24
  78.152.161.133
  78.152.169.207
  78.152.169.8
  78.153.4.122
  78.153.50.88
+78.154.167.68
  78.154.176.154
  78.154.180.12
  78.154.189.190
  78.154.218.233
-78.154.222.177
-78.154.225.243
+78.154.223.168
  78.155.118.15
  78.155.205.102
  78.156.1.88
  78.156.140.5
+78.156.32.204
  78.156.9.173
  78.157.165.90
  78.157.193.67
@@ -136085,12 +137071,10 @@
  78.157.91.120
  78.158.11.226
  78.158.151.65
-78.158.153.27
  78.158.160.72
  78.158.164.98
  78.158.176.225
  78.158.191.141
-78.158.191.162
  78.158.218.39
  78.159.103.141
  78.159.103.159
@@ -136104,9 +137088,10 @@
  78.160.0.161
  78.160.20.80
  78.160.215.204
-78.160.89.203
+78.161.174.5
  78.161.180.207
  78.162.67.57
+78.163.102.213
  78.163.94.99
  78.164.103.241
  78.164.158.133
@@ -136150,6 +137135,7 @@
  78.175.25.127
  78.176.77.217
  78.177.70.144
+78.179.11.62
  78.179.151.188
  78.179.27.3
  78.18.84.174
@@ -136160,6 +137146,7 @@
  78.180.155.1
  78.180.157.169
  78.180.183.87
+78.180.95.133
  78.181.103.113
  78.184.5.87
  78.185.13.145
@@ -136172,6 +137159,7 @@
  78.186.125.177
  78.186.133.97
  78.186.14.162
+78.186.141.76
  78.186.143.223
  78.186.146.79
  78.186.15.235
@@ -136181,7 +137169,6 @@
  78.186.160.14
  78.186.169.202
  78.186.169.219
-78.186.184.198
  78.186.188.12
  78.186.191.10
  78.186.198.122
@@ -136245,6 +137232,7 @@
  78.188.16.177
  78.188.164.93
  78.188.168.64
+78.188.174.100
  78.188.177.246
  78.188.181.106
  78.188.198.225
@@ -136273,7 +137261,7 @@
  78.189.10.14
  78.189.107.139
  78.189.109.149
-78.189.111.192
+78.189.117.40
  78.189.160.100
  78.189.161.31
  78.189.175.72
@@ -136284,6 +137272,7 @@
  78.189.188.62
  78.189.189.85
  78.189.190.196
+78.189.191.195
  78.189.192.69
  78.189.202.253
  78.189.207.248
@@ -136299,14 +137288,14 @@
  78.189.72.118
  78.189.76.127
  78.189.94.228
-78.190.176.92
-78.190.179.159
  78.191.217.199
  78.191.246.237
  78.192.18.48
+78.192.61.77
  78.193.74.165
  78.194.135.43
  78.195.86.1
+78.198.47.213
  78.198.97.205
  78.20.135.129
  78.20.94.222
@@ -136325,6 +137314,7 @@
  78.217.177.232
  78.217.36.106
  78.219.167.75
+78.220.102.122
  78.220.111.71
  78.221.154.29
  78.221.223.169
@@ -136332,12 +137322,12 @@
  78.225.200.204
  78.227.38.86
  78.228.142.126
-78.23.204.168
  78.23.46.93
  78.230.146.74
  78.232.152.36
  78.232.91.228
  78.234.104.179
+78.237.216.72
  78.239.49.141
  78.24.101.86
  78.24.111.198
@@ -136350,6 +137340,7 @@
  78.246.107.6
  78.246.12.111
  78.247.112.21
+78.247.170.48
  78.248.250.213
  78.249.30.153
  78.25.112.42
@@ -136362,6 +137353,7 @@
  78.26.146.69
  78.26.151.247
  78.26.164.218
+78.26.169.163
  78.26.179.12
  78.26.180.80
  78.27.139.13
@@ -136370,33 +137362,32 @@
  78.29.35.3
  78.29.42.10
  78.29.42.94
-78.29.46.205
  78.29.67.207
+78.29.68.143
  78.29.72.195
  78.30.227.222
  78.30.34.171
  78.30.40.241
  78.30.51.35
  78.30.52.227
-78.31.143.96
  78.31.64.229
  78.31.74.10
+78.31.93.164
+78.31.93.225
  78.32.159.52
  78.35.120.245
  78.35.250.110
  78.35.251.85
  78.35.70.153
+78.36.10.97
  78.36.152.186
  78.36.16.214
-78.36.160.5
  78.36.163.253
  78.36.197.146
  78.36.200.4
-78.36.21.12
  78.36.6.246
  78.37.27.139
  78.37.48.179
-78.37.63.171
  78.37.69.21
  78.38.122.249
  78.38.123.110
@@ -136407,7 +137398,6 @@
  78.38.67.212
  78.39.193.36
  78.39.205.171
-78.39.231.209
  78.40.104.118
  78.40.107.3
  78.40.139.80
@@ -136419,7 +137409,6 @@
  78.41.174.196
  78.41.174.198
  78.41.40.16
-78.42.170.25
  78.44.250.93
  78.46.107.152
  78.46.128.195
@@ -136427,6 +137416,7 @@
  78.46.151.58
  78.46.17.17
  78.46.173.117
+78.46.173.189
  78.46.188.239
  78.46.189.199
  78.46.191.14
@@ -136434,7 +137424,6 @@
  78.46.200.216
  78.46.208.107
  78.46.212.51
-78.46.213.142
  78.46.218.20
  78.46.22.102
  78.46.226.85
@@ -136453,7 +137442,6 @@
  78.46.98.13
  78.46.99.198
  78.47.110.223
-78.47.130.42
  78.47.146.79
  78.47.147.223
  78.47.16.54
@@ -136466,14 +137454,14 @@
  78.47.50.83
  78.47.61.83
  78.47.87.196
+78.49.40.201
  78.54.162.49
-78.54.171.217
-78.54.175.40
+78.54.182.182
+78.55.177.16
  78.56.201.4
  78.56.35.205
  78.57.227.227
  78.58.137.207
-78.58.223.100
  78.6.228.32
  78.60.130.181
  78.60.203.75
@@ -136493,6 +137481,7 @@
  78.69.194.105
  78.70.160.141
  78.71.102.80
+78.71.181.170
  78.71.2.168
  78.71.212.230
  78.71.234.246
@@ -136502,9 +137491,11 @@
  78.72.222.170
  78.72.233.238
  78.72.43.150
+78.73.141.174
  78.73.54.32
  78.77.200.243
  78.77.201.246
+78.77.202.128
  78.78.182.154
  78.78.216.78
  78.79.194.229
@@ -136513,38 +137504,41 @@
  78.8.111.87
  78.8.120.10
  78.8.126.198
+78.8.160.87
  78.8.188.1
  78.8.188.100
  78.8.188.136
  78.8.188.200
  78.8.188.250
+78.8.188.59
  78.8.188.97
  78.8.189.1
  78.8.189.115
+78.8.189.121
  78.8.189.147
  78.8.189.156
  78.8.189.242
+78.8.189.52
  78.8.189.88
  78.80.179.178
  78.80.2.186
  78.81.245.153
-78.82.164.29
  78.82.203.247
  78.82.237.9
+78.82.238.69
  78.83.103.4
  78.83.129.61
  78.83.129.85
  78.83.199.235
  78.83.242.229
  78.83.53.171
-78.83.98.20
  78.84.137.101
  78.84.137.60
  78.84.137.90
  78.84.16.236
  78.84.169.212
  78.84.22.156
-78.85.13.192
+78.84.75.231
  78.85.17.176
  78.85.17.6
  78.85.172.10
@@ -136572,6 +137566,7 @@
  78.92.174.1
  78.92.254.169
  78.92.254.9
+78.93.123.139
  78.93.123.59
  78.94.180.85
  78.94.255.174
@@ -136580,13 +137575,13 @@
  78.94.92.13
  78.96.129.15
  78.96.142.24
+78.96.149.58
  78.96.17.76
  78.96.32.107
  78.97.123.232
  78.97.206.136
  78.97.206.149
  78.98.175.251
-78.99.213.173
  78.99.68.237
  7803000.com
  78111.com
@@ -136629,11 +137624,11 @@
  79.100.49.79
  79.101.1.25
  79.101.106.74
+79.101.23.34
  79.101.37.252
  79.101.45.94
  79.101.55.161
  79.101.55.162
-79.101.98.2
  79.102.128.245
  79.102.129.165
  79.102.174.66
@@ -136664,6 +137659,7 @@
  79.106.34.9
  79.106.35.130
  79.106.35.138
+79.106.35.139
  79.106.35.142
  79.106.35.20
  79.106.35.58
@@ -136692,11 +137688,13 @@
  79.110.17.76
  79.110.17.99
  79.110.201.117
+79.110.31.105
  79.110.31.59
  79.110.31.65
  79.111.12.111
  79.111.13.155
  79.111.13.182
+79.111.7.208
  79.113.191.249
  79.113.203.187
  79.113.211.212
@@ -136708,6 +137706,7 @@
  79.115.172.4
  79.115.186.76
  79.115.193.3
+79.115.197.155
  79.115.243.21
  79.115.245.227
  79.115.246.20
@@ -136732,9 +137731,7 @@
  79.120.54.174
  79.120.70.47
  79.121.103.71
-79.121.113.69
  79.121.52.62
-79.123.136.96
  79.124.27.59
  79.124.3.100
  79.124.49.227
@@ -136763,10 +137760,8 @@
  79.124.78.43
  79.124.8.24
  79.124.8.8
-79.125.160.18
  79.125.183.146
  79.125.4.162
-79.126.115.89
  79.127.113.235
  79.127.115.97
  79.127.124.131
@@ -136787,34 +137782,23 @@
  79.130.102.195
  79.130.119.31
  79.130.63.14
-79.131.152.172
-79.131.154.80
  79.131.173.224
-79.131.52.39
  79.132.118.133
  79.132.18.159
-79.132.200.180
  79.132.200.3
-79.132.201.136
  79.132.201.154
  79.132.203.236
  79.132.204.5
  79.132.205.34
  79.133.160.199
-79.133.186.22
-79.133.187.19
  79.133.200.146
  79.133.228.55
-79.133.43.119
  79.133.6.236
-79.134.152.26
  79.134.173.69
  79.134.195.74
  79.134.4.6
  79.134.7.134
-79.135.45.215
  79.135.73.141
-79.135.88.180
  79.136.1.41
  79.136.11.91
  79.136.11.93
@@ -136835,6 +137819,7 @@
  79.137.20.253
  79.137.222.49
  79.137.24.250
+79.137.254.51
  79.137.28.159
  79.137.33.20
  79.137.34.248
@@ -136884,7 +137869,6 @@
  79.143.188.130
  79.143.188.18
  79.143.188.7
-79.143.21.104
  79.143.225.152
  79.143.24.190
  79.143.37.84
@@ -136895,6 +137879,7 @@
  79.143.87.240
  79.143.87.241
  79.146.121.90
+79.146.173.226
  79.146.21.163
  79.146.37.169
  79.147.176.99
@@ -136916,7 +137901,6 @@
  79.157.224.79
  79.159.28.8
  79.16.11.33
-79.16.125.100
  79.16.46.244
  79.160.172.212
  79.160.69.186
@@ -136926,7 +137910,6 @@
  79.164.238.134
  79.164.59.221
  79.165.121.108
-79.165.19.4
  79.165.225.234
  79.165.250.129
  79.166.181.64
@@ -136938,11 +137921,6 @@
  79.169.184.113
  79.17.227.196
  79.170.185.187
-79.170.40.168
-79.170.44.116
-79.170.44.150
-79.170.44.155
-79.170.44.209
  79.171.13.166
  79.171.13.182
  79.171.60.11
@@ -136955,6 +137933,7 @@
  79.173.212.181
  79.173.251.117
  79.173.252.104
+79.173.84.28
  79.173.88.244
  79.173.90.153
  79.174.13.5
@@ -136963,6 +137942,7 @@
  79.174.70.46
  79.174.72.78
  79.175.125.210
+79.175.176.52
  79.175.223.24
  79.175.57.77
  79.175.85.24
@@ -136981,6 +137961,7 @@
  79.181.20.138
  79.181.82.231
  79.181.83.16
+79.183.121.203
  79.183.91.113
  79.184.174.202
  79.184.70.116
@@ -136992,37 +137973,36 @@
  79.188.246.2
  79.188.40.187
  79.188.44.86
-79.188.57.19
-79.188.68.89
  79.188.9.30
  79.189.62.218
  79.19.201.211
  79.190.143.250
  79.190.144.158
  79.190.213.51
-79.193.123.138
+79.193.120.110
+79.194.140.197
  79.194.173.13
-79.194.173.70
+79.195.72.103
  79.197.191.45
  79.198.229.246
  79.2.137.18
  79.2.142.166
  79.20.247.221
  79.201.171.34
-79.201.174.28
+79.201.174.215
  79.205.143.113
-79.207.22.112
  79.207.244.96
  79.208.186.109
  79.208.245.166
+79.209.65.93
  79.209.72.210
-79.209.73.148
  79.21.157.106
-79.21.224.141
+79.21.186.116
  79.21.45.9
  79.211.169.189
  79.211.231.50
  79.213.70.17
+79.214.51.254
  79.217.207.233
  79.217.21.51
  79.218.117.76
@@ -137031,21 +138011,23 @@
  79.219.236.195
  79.224.56.206
  79.23.192.95
+79.23.214.30
  79.23.24.6
-79.23.28.215
  79.23.74.251
  79.230.124.217
  79.232.162.209
-79.233.172.66
+79.233.161.195
  79.235.157.75
  79.235.175.228
-79.236.182.205
  79.236.189.170
+79.238.22.30
+79.24.154.170
  79.24.209.121
+79.24.215.163
  79.242.174.69
  79.244.122.142
+79.246.114.46
  79.248.101.153
-79.248.107.159
  79.25.112.10
  79.25.59.168
  79.25.95.13
@@ -137057,11 +138039,13 @@
  79.27.58.121
  79.3.186.211
  79.3.197.186
+79.3.3.81
  79.3.89.246
  79.31.111.241
  79.31.224.198
  79.31.255.74
  79.31.6.201
+79.32.151.16
  79.32.158.232
  79.32.67.61
  79.32.80.147
@@ -137078,6 +138062,7 @@
  79.41.123.117
  79.41.165.227
  79.41.192.133
+79.41.83.219
  79.41.87.108
  79.42.111.22
  79.42.190.239
@@ -137096,7 +138081,7 @@
  79.49.5.41
  79.5.1.73
  79.50.218.80
-79.51.88.20
+79.51.115.222
  79.52.42.135
  79.53.115.234
  79.53.117.169
@@ -137105,9 +138090,6 @@
  79.54.115.243
  79.55.130.202
  79.55.158.98
-79.55.22.77
-79.55.6.99
-79.56.35.65
  79.58.55.43
  79.59.251.230
  79.60.143.222
@@ -137118,11 +138100,13 @@
  79.62.235.37
  79.62.34.228
  79.63.131.98
+79.66.247.203
  79.67.137.168
  79.68.32.168
  79.7.0.87
  79.7.114.1
  79.7.157.91
+79.7.158.202
  79.7.158.208
  79.7.177.70
  79.7.182.180
@@ -137137,6 +138121,7 @@
  79.79.57.54
  79.79.58.94
  79.8.112.131
+79.8.151.176
  79.8.155.177
  79.8.178.21
  79.8.192.152
@@ -137161,6 +138146,7 @@
  79.98.1.32
  79.98.107.90
  79.98.159.7
+79.98.223.16
  79.98.223.69
  79.98.23.9
  79.98.30.37
@@ -137286,8 +138272,6 @@
  8.12.16.78
  8.12.161.82
  8.12.22.118
-8.129.12.161
-8.129.172.40
  8.129.209.71
  8.129.47.187
  8.134.18.217
@@ -137296,12 +138280,11 @@
  8.15.224.120
  8.19.61.42
  8.208.15.220
-8.208.27.171
+8.208.26.152
  8.208.76.187
  8.208.76.238
  8.208.76.28
  8.208.90.81
-8.209.215.172
  8.209.71.217
  8.209.72.208
  8.209.73.223
@@ -137310,8 +138293,6 @@
  8.209.82.155
  8.209.91.61
  8.209.95.59
-8.210.1.51
-8.210.107.224
  8.210.128.108
  8.210.141.107
  8.210.141.183
@@ -137327,24 +138308,26 @@
  8.210.212.28
  8.210.214.87
  8.210.217.170
+8.210.224.66
  8.210.229.68
+8.210.32.160
  8.210.34.2
  8.210.45.143
  8.210.77.199
  8.210.79.220
  8.210.85.146
-8.210.88.234
+8.210.86.251
  8.210.92.32
  8.211.170.221
  8.22.68.28
  8.242.211.86
-8.242.232.14
  8.26.191.44
  8.27.118.34
  8.28.16.254
  8.29.103.50
  8.29.65.74
  8.30.177.205
+8.30.181.51
  8.30.188.41
  8.30.196.204
  8.33.32.203
@@ -137392,7 +138375,6 @@
  8.9.8.68
  8.dojnh.com
  80-87-45.ga
-80.0.141.86
  80.10.11.137
  80.10.74.236
  80.10.75.218
@@ -137406,11 +138388,13 @@
  80.102.22.14
  80.102.50.2
  80.103.116.164
+80.104.130.178
  80.104.167.129
  80.104.200.223
  80.104.8.71
  80.106.107.4
  80.106.228.1
+80.106.241.112
  80.106.247.145
  80.107.117.210
  80.107.17.212
@@ -137420,7 +138404,6 @@
  80.108.210.64
  80.108.82.95
  80.109.153.122
-80.109.220.251
  80.109.75.19
  80.11.29.177
  80.110.188.114
@@ -137435,35 +138418,37 @@
  80.117.125.101
  80.117.232.62
  80.117.254.73
-80.117.48.125
  80.117.48.141
  80.118.240.244
  80.120.248.141
  80.120.248.142
  80.120.248.151
+80.122.229.106
  80.122.92.78
  80.123.143.202
  80.127.116.96
  80.127.252.150
-80.128.156.114
+80.128.145.39
  80.13.252.251
  80.13.7.156
-80.132.121.230
+80.131.69.69
  80.132.126.251
-80.132.193.221
-80.135.114.168
+80.132.127.220
+80.132.205.95
+80.132.207.28
+80.134.160.208
  80.135.118.204
  80.135.247.145
-80.136.55.29
-80.136.59.249
  80.137.123.245
  80.137.175.16
  80.139.83.10
  80.139.95.235
-80.139.95.237
  80.14.172.55
  80.14.187.157
  80.14.89.146
+80.141.179.101
+80.143.58.226
+80.144.90.120
  80.147.194.242
  80.147.200.76
  80.147.37.219
@@ -137474,7 +138459,6 @@
  80.15.223.135
  80.15.36.32
  80.151.202.50
-80.151.29.142
  80.151.40.92
  80.153.141.224
  80.153.22.20
@@ -137501,14 +138485,15 @@
  80.179.157.4
  80.179.42.40
  80.179.42.44
+80.180.139.171
  80.180.171.136
+80.180.201.221
  80.180.222.151
  80.180.57.25
  80.181.120.195
  80.181.187.247
  80.181.227.243
  80.182.120.119
-80.182.149.45
  80.182.249.219
  80.183.230.132
  80.183.67.6
@@ -137516,6 +138501,7 @@
  80.184.108.152
  80.184.26.109
  80.184.3.203
+80.187.108.194
  80.188.204.250
  80.188.239.106
  80.189.197.11
@@ -137529,17 +138515,16 @@
  80.191.169.81
  80.191.223.242
  80.191.230.82
-80.191.234.161
  80.191.237.169
  80.191.255.94
  80.191.46.59
  80.192.171.95
+80.193.248.50
  80.193.251.66
  80.194.62.218
  80.197.125.83
  80.2.201.66
  80.2.208.221
-80.20.133.206
  80.200.58.215
  80.201.147.91
  80.201.72.10
@@ -137549,11 +138534,7 @@
  80.209.230.160
  80.209.231.126
  80.21.126.234
-80.21.190.42
-80.21.251.28
  80.210.109.88
-80.210.152.123
-80.210.165.79
  80.210.18.218
  80.210.18.85
  80.210.26.203
@@ -137606,14 +138587,12 @@
  80.211.67.216
  80.211.70.92
  80.211.71.44
-80.211.73.125
  80.211.75.205
  80.211.83.105
  80.211.87.47
  80.211.89.87
  80.211.99.98
  80.212.172.107
-80.212.26.92
  80.212.63.139
  80.213.12.220
  80.213.2.72
@@ -137626,11 +138605,10 @@
  80.216.75.119
  80.217.110.221
  80.217.160.243
-80.217.163.48
  80.217.17.129
  80.217.191.235
-80.217.9.74
  80.218.56.244
+80.219.113.82
  80.219.243.75
  80.221.159.67
  80.224.77.239
@@ -137642,6 +138620,7 @@
  80.229.147.76
  80.229.157.225
  80.229.168.1
+80.229.173.57
  80.229.234.93
  80.229.28.60
  80.229.37.136
@@ -137652,13 +138631,11 @@
  80.232.248.17
  80.233.134.119
  80.234.33.156
-80.234.43.26
  80.234.81.182
  80.235.214.123
  80.235.221.42
  80.235.87.104
  80.237.159.104
-80.237.194.90
  80.237.2.74
  80.237.79.29
  80.238.124.88
@@ -137676,7 +138653,9 @@
  80.240.25.13
  80.240.250.222
  80.240.51.48
+80.240.51.99
  80.240.62.26
+80.241.113.140
  80.241.209.102
  80.241.210.218
  80.241.211.57
@@ -137690,9 +138669,9 @@
  80.241.221.135
  80.241.222.137
  80.241.222.138
+80.241.222.37
  80.241.243.238
  80.241.255.218
-80.241.33.114
  80.241.44.238
  80.241.46.6
  80.241.60.207
@@ -137721,12 +138700,9 @@
  80.246.31.57
  80.247.164.121
  80.247.76.181
-80.248.14.211
  80.248.225.150
  80.248.233.10
  80.249.1.140
-80.249.149.29
-80.249.151.139
  80.249.176.206
  80.25.41.189
  80.25.87.49
@@ -137751,6 +138727,7 @@
  80.253.94.252
  80.254.102.78
  80.254.12.218
+80.254.123.36
  80.254.165.132
  80.254.215.27
  80.254.48.93
@@ -137768,6 +138745,7 @@
  80.255.3.87
  80.26.152.204
  80.26.176.21
+80.26.192.202
  80.28.102.26
  80.28.211.131
  80.28.255.69
@@ -137777,7 +138755,6 @@
  80.3.41.245
  80.30.200.121
  80.30.30.47
-80.31.129.10
  80.31.238.123
  80.31.31.231
  80.32.195.155
@@ -137787,9 +138764,7 @@
  80.38.139.178
  80.4.23.192
  80.44.201.158
-80.44.45.140
  80.44.90.212
-80.47.117.154
  80.48.174.105
  80.48.183.166
  80.48.211.70
@@ -137799,6 +138774,7 @@
  80.48.99.204
  80.49.154.148
  80.49.207.229
+80.49.71.106
  80.5.132.247
  80.5.140.25
  80.50.141.118
@@ -137809,7 +138785,6 @@
  80.53.57.146
  80.55.101.146
  80.55.175.172
-80.56.150.193
  80.56.150.53
  80.59.233.178
  80.60.120.119
@@ -137835,6 +138810,7 @@
  80.68.2.100
  80.68.2.74
  80.68.226.42
+80.69.52.150
  80.70.146.18
  80.70.17.209
  80.70.17.225
@@ -137883,14 +138859,10 @@
  80.71.117.38
  80.71.121.68
  80.71.121.70
-80.71.13.138
  80.71.136.204
  80.71.180.89
  80.71.39.213
  80.72.121.179
-80.72.176.11
-80.72.179.2
-80.72.34.10
  80.72.66.207
  80.73.13.219
  80.73.91.130
@@ -137930,9 +138902,6 @@
  80.80.167.249
  80.80.171.100
  80.80.172.3
-80.80.212.36
-80.80.212.48
-80.80.212.5
  80.80.234.140
  80.81.145.54
  80.81.145.97
@@ -137943,7 +138912,6 @@
  80.82.55.71
  80.82.64.114
  80.82.64.116
-80.82.64.124
  80.82.64.127
  80.82.64.129
  80.82.64.140
@@ -137965,12 +138933,10 @@
  80.82.65.82
  80.82.65.90
  80.82.66.176
-80.82.67.45
  80.82.68.134
  80.82.68.202
  80.82.68.218
  80.82.68.223
-80.82.68.225
  80.82.68.28
  80.82.68.29
  80.82.69.122
@@ -137980,7 +138946,6 @@
  80.82.70.118
  80.82.70.140
  80.82.70.178
-80.82.70.189
  80.82.70.206
  80.82.70.227
  80.82.70.231
@@ -137988,7 +138953,6 @@
  80.82.70.249
  80.82.70.25
  80.82.70.33
-80.82.77.132
  80.82.77.138
  80.82.77.139
  80.82.77.146
@@ -137996,7 +138960,9 @@
  80.82.77.212
  80.82.77.227
  80.82.77.235
+80.82.77.237
  80.82.77.245
+80.82.77.250
  80.82.77.33
  80.82.77.5
  80.82.77.66
@@ -138038,7 +139004,6 @@
  80.89.137.210
  80.89.137.214
  80.89.137.54
-80.89.156.216
  80.89.203.172
  80.89.231.21
  80.89.234.190
@@ -138057,9 +139022,9 @@
  80.92.189.70
  80.92.239.180
  80.92.84.168
+80.93.119.90
  80.93.124.148
  80.93.210.82
-80.93.212.44
  80.93.213.246
  80.93.217.42
  80.93.220.21
@@ -138079,6 +139044,7 @@
  80.94.93.22
  80.94.93.23
  80.94.93.24
+80.94.93.25
  80.94.93.27
  80.94.93.29
  80.94.93.3
@@ -138089,13 +139055,9 @@
  80.94.93.40
  80.94.93.41
  80.94.93.42
-80.94.93.45
  80.94.93.47
  80.94.93.48
  80.94.93.49
-80.94.93.6
-80.94.93.7
-80.94.93.8
  80.94.93.9
  80.94.99.244
  80.95.109.6
@@ -138150,7 +139112,6 @@
  81.104.104.196
  81.105.178.194
  81.105.223.91
-81.106.44.248
  81.107.36.31
  81.11.188.233
  81.110.14.23
@@ -138174,20 +139135,16 @@
  81.12.169.126
  81.12.169.254
  81.12.224.61
-81.12.28.203
  81.12.43.131
  81.12.52.130
  81.12.93.144
  81.12.94.122
-81.129.151.108
  81.129.239.167
  81.129.239.169
-81.13.192.194
  81.130.146.18
  81.130.171.102
  81.130.188.5
  81.130.234.235
-81.130.237.169
  81.130.70.67
  81.131.136.194
  81.133.171.139
@@ -138207,11 +139164,13 @@
  81.147.137.213
  81.148.254.0
  81.148.254.206
+81.149.38.69
  81.15.239.53
  81.150.18.92
  81.151.114.101
+81.151.80.7
+81.152.170.26
  81.153.11.10
-81.153.171.89
  81.153.251.131
  81.156.142.195
  81.156.238.169
@@ -138222,7 +139181,6 @@
  81.16.122.128
  81.16.123.123
  81.16.124.74
-81.16.15.170
  81.16.250.105
  81.16.33.31
  81.16.33.33
@@ -138240,7 +139198,6 @@
  81.161.63.251
  81.161.63.252
  81.161.63.253
-81.161.67.64
  81.162.231.6
  81.162.237.120
  81.162.243.249
@@ -138250,8 +139207,8 @@
  81.163.36.139
  81.163.36.210
  81.163.57.147
-81.163.62.136
  81.163.62.221
+81.163.8.195
  81.164.47.161
  81.164.70.26
  81.165.180.252
@@ -138259,6 +139216,7 @@
  81.166.131.227
  81.167.109.247
  81.167.175.244
+81.167.186.96
  81.167.205.200
  81.167.244.222
  81.167.249.169
@@ -138281,6 +139239,7 @@
  81.169.251.124
  81.17.131.251
  81.17.131.61
+81.17.144.242
  81.17.16.122
  81.17.16.122zeros6x.sh
  81.17.16.146
@@ -138297,11 +139256,9 @@
  81.17.30.40
  81.17.81.34
  81.17.86.112
-81.17.91.117
  81.17.92.4
  81.17.94.50
  81.170.133.7
-81.170.143.54
  81.170.143.75
  81.170.147.24
  81.170.147.244
@@ -138317,6 +139274,7 @@
  81.170.226.120
  81.170.243.170
  81.170.252.231
+81.170.253.234
  81.170.81.165
  81.171.12.44
  81.171.22.143
@@ -138328,36 +139286,29 @@
  81.174.11.10
  81.174.11.159
  81.174.11.227
+81.174.137.35
  81.174.154.124
  81.174.205.233
-81.174.246.185
  81.174.34.1
  81.174.47.50
  81.174.65.27
-81.175.152.253
  81.175.28.110
  81.175.71.121
  81.176.229.202
  81.176.229.7
-81.177.126.253
  81.177.126.74
  81.177.126.99
-81.177.127.125
-81.177.127.138
-81.177.127.163
-81.177.127.31
  81.177.135.25
  81.177.157.81
  81.177.170.217
  81.177.170.218
  81.177.170.90
-81.177.174.59
  81.177.73.10
  81.177.73.17
  81.177.73.29
  81.177.73.7
+81.18.33.26
  81.18.34.98
-81.18.36.230
  81.18.90.43
  81.180.117.140
  81.180.124.186
@@ -138368,6 +139319,7 @@
  81.182.246.50
  81.182.248.193
  81.182.254.124
+81.182.3.46
  81.182.6.245
  81.183.208.244
  81.183.213.36
@@ -138389,6 +139341,7 @@
  81.19.129.165
  81.19.211.34
  81.19.215.118
+81.19.215.8
  81.19.3.16
  81.190.32.21
  81.191.233.134
@@ -138408,7 +139361,6 @@
  81.196.142.73
  81.196.208.227
  81.196.216.222
-81.196.254.46
  81.196.66.238
  81.196.69.79
  81.197.114.223
@@ -138437,6 +139389,7 @@
  81.200.63.108
  81.201.50.131
  81.202.67.69
+81.206.43.83
  81.208.34.38
  81.208.39.28
  81.209.177.136
@@ -138478,18 +139431,17 @@
  81.214.254.203
  81.214.39.214
  81.214.57.144
-81.214.63.228
  81.214.70.85
  81.215.151.220
-81.215.16.158
  81.215.193.185
-81.215.195.83
  81.215.198.238
  81.215.199.141
  81.215.199.29
  81.215.200.142
  81.215.204.75
  81.215.230.173
+81.215.9.195
+81.217.175.104
  81.218.110.46
  81.218.139.106
  81.218.148.98
@@ -138507,20 +139459,15 @@
  81.218.199.121
  81.218.25.210
  81.219.174.10
-81.219.253.193
  81.22.176.154
  81.22.46.170
-81.22.46.209
-81.22.46.22
  81.22.46.23
  81.22.46.40
-81.22.46.97
  81.22.47.154
  81.22.47.189
  81.22.47.199
  81.22.47.49
  81.22.51.231
-81.22.57.143
  81.22.98.49
  81.223.149.104
  81.224.111.93
@@ -138536,13 +139483,13 @@
  81.226.169.192
  81.226.191.14
  81.227.171.215
-81.227.218.113
  81.228.135.177
  81.229.187.44
  81.229.218.27
  81.229.89.161
  81.23.32.47
  81.230.136.6
+81.230.154.84
  81.231.128.105
  81.231.50.55
  81.232.140.246
@@ -138572,28 +139519,27 @@
  81.243.152.143
  81.244.103.97
  81.245.60.108
+81.245.67.150
  81.245.86.35
  81.246.225.203
  81.246.233.248
-81.247.173.162
  81.248.1.143
  81.248.238.182
  81.248.4.6
  81.248.45.215
  81.248.63.63
  81.249.150.96
-81.249.173.125
  81.25.120.224
  81.25.170.9
  81.25.229.123
  81.25.53.204
  81.25.58.50
+81.250.114.138
  81.250.147.230
  81.250.161.242
  81.253.100.224
  81.253.108.78
  81.253.114.127
-81.253.251.53
  81.255.105.165
  81.255.214.18
  81.26.241.240
@@ -138601,7 +139547,6 @@
  81.27.79.18
  81.28.164.55
  81.28.248.139
-81.29.143.174
  81.29.206.43
  81.29.211.35
  81.29.245.164
@@ -138631,7 +139576,6 @@
  81.32.62.104
  81.33.4.214
  81.34.18.81
-81.35.160.55
  81.35.67.42
  81.36.111.181
  81.36.14.52
@@ -138647,7 +139591,6 @@
  81.4.110.153
  81.4.127.34
  81.4.178.90
-81.4.205.90
  81.40.135.63
  81.42.205.178
  81.43.65.253
@@ -138664,15 +139607,12 @@
  81.47.161.135
  81.47.167.231
  81.5.103.14
-81.5.253.134
  81.53.136.98
-81.53.30.41
  81.56.94.102
  81.57.217.41
  81.6.39.241
  81.6.43.167
  81.61.163.100
-81.61.203.250
  81.68.100.106
  81.68.100.138
  81.68.102.238
@@ -138692,7 +139632,6 @@
  81.68.120.181
  81.68.120.99
  81.68.121.160
-81.68.121.82
  81.68.123.185
  81.68.123.65
  81.68.125.236
@@ -138716,7 +139655,6 @@
  81.68.142.128
  81.68.143.165
  81.68.144.156
-81.68.145.162
  81.68.145.65
  81.68.147.247
  81.68.147.53
@@ -138752,12 +139690,15 @@
  81.68.203.111
  81.68.203.116
  81.68.205.105
+81.68.206.57
  81.68.207.135
  81.68.209.225
  81.68.209.73
  81.68.214.232
  81.68.215.10
+81.68.215.181
  81.68.217.130
+81.68.217.58
  81.68.218.94
  81.68.223.9
  81.68.224.66
@@ -138783,7 +139724,6 @@
  81.68.244.183
  81.68.244.19
  81.68.244.249
-81.68.244.66
  81.68.244.79
  81.68.246.68
  81.68.248.78
@@ -138827,7 +139767,9 @@
  81.69.13.127
  81.69.15.117
  81.69.15.129
+81.69.15.140
  81.69.15.76
+81.69.16.28
  81.69.17.26
  81.69.170.127
  81.69.171.202
@@ -138844,7 +139786,6 @@
  81.69.194.23
  81.69.197.13
  81.69.20.62
-81.69.21.116
  81.69.21.163
  81.69.218.22
  81.69.218.33
@@ -138853,7 +139794,6 @@
  81.69.224.242
  81.69.225.138
  81.69.225.84
-81.69.228.153
  81.69.230.2
  81.69.230.208
  81.69.232.30
@@ -138867,9 +139807,9 @@
  81.69.242.220
  81.69.242.72
  81.69.243.134
-81.69.243.46
  81.69.244.32
  81.69.244.42
+81.69.245.138
  81.69.245.16
  81.69.245.202
  81.69.245.83
@@ -138882,7 +139822,6 @@
  81.69.255.247
  81.69.255.86
  81.69.26.68
-81.69.27.157
  81.69.28.239
  81.69.3.109
  81.69.3.201
@@ -138896,6 +139835,7 @@
  81.69.59.111
  81.69.7.163
  81.69.8.165
+81.69.8.34
  81.69.9.125
  81.69.9.170
  81.69.9.42
@@ -138921,6 +139861,7 @@
  81.70.154.128
  81.70.154.223
  81.70.155.118
+81.70.155.138
  81.70.155.18
  81.70.156.2
  81.70.157.5
@@ -138939,6 +139880,7 @@
  81.70.22.3
  81.70.23.138
  81.70.27.79
+81.70.34.143
  81.70.36.166
  81.70.36.8
  81.70.38.175
@@ -138981,7 +139923,6 @@
  81.71.135.79
  81.71.136.41
  81.71.138.119
-81.71.138.240
  81.71.138.3
  81.71.139.210
  81.71.14.95
@@ -138992,7 +139933,6 @@
  81.71.147.245
  81.71.147.40
  81.71.19.202
-81.71.2.14
  81.71.22.142
  81.71.24.200
  81.71.25.135
@@ -139002,9 +139942,11 @@
  81.71.36.176
  81.71.36.35
  81.71.4.235
+81.71.45.162
  81.71.68.119
  81.71.68.204
  81.71.68.248
+81.71.7.68
  81.71.70.182
  81.71.71.95
  81.71.72.138
@@ -139016,11 +139958,9 @@
  81.71.83.237
  81.71.85.116
  81.71.85.80
-81.71.87.8
  81.8.176.236
  81.8.187.107
  81.8.195.211
-81.8.37.98
  81.8.9.98
  81.82.132.105
  81.82.201.5
@@ -139030,6 +139970,8 @@
  81.82.251.244
  81.82.82.45
  81.86.25.161
+81.86.82.68
+81.88.197.204
  81.88.198.162
  81.88.221.190
  81.88.222.222
@@ -139055,14 +139997,12 @@
  81.89.215.146
  81.89.48.239
  81.89.79.232
+81.9.129.238
  81.90.188.81
  81.90.3.226
-81.91.137.43
  81.91.137.45
  81.91.154.195
  81.91.157.134
-81.91.186.225
-81.91.187.85
  81.91.208.8
  81.91.219.98
  81.92.202.202
@@ -139082,11 +140022,8 @@
  81.95.13.51
  81.95.131.10
  81.95.226.138
-81.95.227.153
-81.95.230.166
  81.95.230.211
  81.95.231.149
-81.95.233.122
  81.95.45.234
  81.95.5.146
  81.95.7.22
@@ -139124,7 +140061,6 @@
  82.10.188.54
  82.10.24.188
  82.100.63.181
-82.102.100.94
  82.102.115.131
  82.102.118.46
  82.102.121.77
@@ -139137,13 +140073,14 @@
  82.102.22.242
  82.102.27.10
  82.102.27.118
+82.102.30.115
  82.103.116.126
  82.103.118.42
  82.103.70.227
  82.103.73.164
  82.103.90.198
  82.103.95.134
-82.103.95.86
+82.11.39.237
  82.11.71.131
  82.11.73.137
  82.112.146.204
@@ -139162,9 +140099,7 @@
  82.114.90.90
  82.114.94.68
  82.114.94.69
-82.115.215.101
  82.115.215.156
-82.116.120.3
  82.116.32.13
  82.116.38.167
  82.116.79.5
@@ -139193,12 +140128,12 @@
  82.124.137.199
  82.124.19.33
  82.127.160.25
+82.127.232.222
  82.127.237.205
  82.127.67.202
  82.128.141.82
  82.128.141.82bin.sh
  82.128.247.149
-82.129.185.66
  82.129.8.4
  82.130.201.15
  82.131.191.34
@@ -139227,6 +140162,7 @@
  82.14.235.11
  82.141.147.75
  82.141.147.80
+82.141.160.139
  82.142.101.32
  82.142.135.10
  82.142.147.174
@@ -139261,10 +140197,8 @@
  82.147.93.63
  82.148.179.37
  82.148.19.120
-82.148.19.132
  82.148.25.100
  82.148.25.99
-82.148.29.149
  82.150.140.40
  82.151.113.56
  82.151.114.197
@@ -139288,7 +140222,6 @@
  82.161.246.42
  82.163.79.61
  82.164.156.121
-82.164.196.84
  82.164.20.213
  82.164.50.175
  82.165.100.150
@@ -139300,7 +140233,6 @@
  82.165.140.117
  82.165.159.130
  82.165.159.131
-82.165.163.80
  82.165.18.207
  82.165.184.192
  82.165.186.165
@@ -139321,7 +140253,6 @@
  82.166.86.104
  82.169.227.38
  82.176.164.40
-82.177.154.152
  82.177.176.1
  82.177.176.24
  82.177.87.98
@@ -139330,19 +140261,16 @@
  82.186.120.234
  82.186.233.89
  82.186.251.25
-82.192.235.212
  82.192.81.160
  82.192.88.11
-82.193.100.83
  82.193.103.110
  82.193.110.177
-82.193.113.114
  82.193.115.159
  82.193.145.123
  82.193.15.3
+82.193.150.21
  82.194.17.45
  82.194.182.54
-82.194.51.174
  82.194.57.186
  82.194.66.135
  82.194.85.198
@@ -139377,36 +140305,25 @@
  82.197.203.78
  82.197.204.14
  82.197.207.140
+82.197.212.118
  82.197.215.125
  82.197.231.216
-82.198.187.79
  82.199.102.10
  82.199.50.221
  82.199.55.93
  82.2.193.244
  82.20.11.17
-82.20.251.200
  82.200.105.254
  82.200.142.22
  82.200.160.178
  82.200.164.134
  82.200.168.92
-82.200.171.86
  82.200.174.6
  82.200.197.100
  82.200.202.66
  82.200.205.30
-82.200.217.122
-82.200.217.246
-82.200.217.58
-82.200.217.86
-82.200.218.70
-82.200.219.18
-82.200.222.3
  82.200.226.226
-82.200.231.82
  82.200.233.4
-82.200.255.130
  82.200.40.61
  82.200.55.38
  82.200.65.218
@@ -139421,7 +140338,6 @@
  82.202.167.56
  82.202.197.224
  82.202.197.233
-82.202.247.228
  82.202.68.231
  82.202.99.217
  82.204.141.94
@@ -139429,15 +140345,15 @@
  82.205.42.92
  82.206.222.21
  82.207.126.147
-82.207.199.108
  82.207.209.36
+82.207.210.190
  82.207.27.206
+82.207.36.144
  82.207.44.156
  82.207.56.202
  82.207.57.10
  82.207.59.154
  82.207.60.26
-82.208.101.13
  82.208.149.161
  82.208.173.16
  82.208.173.230
@@ -139450,9 +140366,11 @@
  82.209.132.156
  82.209.132.81
  82.209.135.85
+82.209.166.126
  82.209.204.235
  82.209.206.126
  82.209.216.156
+82.209.216.162
  82.209.219.244
  82.209.222.146
  82.209.222.197
@@ -139471,8 +140389,11 @@
  82.211.24.144
  82.211.24.156
  82.211.24.160
+82.211.24.180
  82.211.24.184
  82.211.24.186
+82.211.24.19
+82.211.24.66
  82.211.24.97
  82.211.31.210
  82.211.55.22
@@ -139482,7 +140403,6 @@
  82.211.57.174
  82.211.57.180
  82.211.57.187
-82.211.57.203
  82.211.57.214
  82.211.57.250
  82.211.58.104
@@ -139495,19 +140415,19 @@
  82.211.9.113
  82.211.9.134
  82.211.9.146
+82.211.9.163
  82.211.9.211
  82.211.9.235
-82.211.9.46
+82.211.9.68
  82.211.9.84
  82.211.9.99
  82.212.103.10
-82.212.82.222
  82.213.200.69
  82.213.225.62
  82.213.231.102
  82.213.231.238
  82.213.233.104
-82.213.236.22
+82.213.247.245
  82.213.78.2
  82.214.224.30
  82.216.110.29
@@ -139519,7 +140439,6 @@
  82.22.150.96
  82.22.74.93
  82.220.0.85
-82.220.34.231
  82.221.100.229
  82.221.102.177
  82.221.102.181
@@ -139567,8 +140486,6 @@
  82.223.73.138
  82.223.78.168
  82.223.83.118
-82.224.202.20
-82.225.20.155
  82.228.108.208
  82.228.113.26
  82.228.6.131
@@ -139588,10 +140505,13 @@
  82.251.198.4
  82.252.131.1
  82.252.137.137
+82.252.140.80
  82.252.141.19
+82.252.143.139
  82.252.145.109
  82.252.150.183
  82.252.150.198
+82.252.153.17
  82.252.153.26
  82.252.155.153
  82.252.157.95
@@ -139599,27 +140519,24 @@
  82.253.131.63
  82.253.28.46
  82.254.243.42
-82.255.149.22
  82.255.154.111
  82.255.20.214
  82.255.203.175
  82.255.38.238
  82.26.57.81
-82.27.185.248
  82.29.104.21
  82.3.220.15
  82.30.113.174
+82.30.4.30
  82.31.209.133
  82.32.8.246
  82.33.148.31
  82.33.4.255
  82.36.136.144
-82.37.149.147
  82.37.31.3
  82.39.166.139
  82.39.82.18
  82.4.203.246
-82.40.228.91
  82.41.118.158
  82.46.110.203
  82.46.189.53
@@ -139662,14 +140579,12 @@
  82.62.48.206
  82.62.67.150
  82.62.67.4
-82.62.95.24
-82.64.100.154
+82.63.69.156
  82.64.104.190
  82.64.124.108
  82.64.131.215
  82.64.132.50
  82.64.15.100
-82.64.15.106
  82.64.165.77
  82.64.167.80
  82.64.170.170
@@ -139680,7 +140595,6 @@
  82.64.20.76
  82.64.201.47
  82.64.206.205
-82.64.212.80
  82.64.222.78
  82.64.229.111
  82.64.231.55
@@ -139694,6 +140608,7 @@
  82.64.46.144
  82.64.49.27
  82.64.57.228
+82.64.60.174
  82.64.71.54
  82.64.77.30
  82.64.80.181
@@ -139710,16 +140625,20 @@
  82.65.154.62
  82.65.165.177
  82.65.166.65
+82.65.172.245
  82.65.173.65
+82.65.178.130
  82.65.190.68
  82.65.23.62
  82.65.3.217
  82.65.3.231
+82.65.32.221
  82.65.42.106
  82.65.7.31
  82.65.86.43
  82.66.234.57
  82.66.81.44
+82.67.168.126
  82.67.234.103
  82.67.235.179
  82.67.247.11
@@ -139727,6 +140646,7 @@
  82.67.68.28
  82.68.49.227
  82.69.119.77
+82.7.108.18
  82.71.0.201
  82.71.23.33
  82.71.47.216
@@ -139775,6 +140695,8 @@
  82.81.197.254
  82.81.199.8
  82.81.214.153
+82.81.214.237
+82.81.216.189
  82.81.23.171
  82.81.232.68
  82.81.241.25
@@ -139787,6 +140709,8 @@
  82.81.69.65
  82.81.73.245
  82.82.248.215
+82.82.254.86
+82.83.175.26
  82.9.216.218
  82.9.246.11
  82.94.216.148
@@ -139796,12 +140720,14 @@
  82.95.232.41
  82.96.36.115
  82.96.37.228
+82.97.23.50
  82.98.104.217
  82.98.140.12
  82.98.141.7
  82.98.160.105
  82.98.194.16
  82.99.104.36
+82.99.129.181
  82.99.203.76
  82.99.203.78
  82.99.206.18
@@ -139857,6 +140783,7 @@
  83.11.174.242
  83.11.3.156
  83.110.102.129
+83.110.198.160
  83.110.199.102
  83.110.213.149
  83.110.214.138
@@ -139864,6 +140791,7 @@
  83.110.225.215
  83.110.240.127
  83.110.241.177
+83.110.250.222
  83.110.251.195
  83.110.5.234
  83.110.80.172
@@ -139877,20 +140805,18 @@
  83.12.179.10
  83.12.198.38
  83.12.244.50
-83.122.194.116
+83.128.167.115
  83.128.173.97
  83.128.190.219
  83.128.21.250
-83.128.49.155
  83.13.118.130
  83.13.19.85
  83.13.191.186
  83.13.92.109
+83.132.59.167
  83.133.121.137
  83.133.127.251
  83.134.20.16
-83.135.130.159
-83.135.145.98
  83.135.150.251
  83.135.194.233
  83.135.195.216
@@ -139902,6 +140828,7 @@
  83.135.199.229
  83.135.199.255
  83.135.200.106
+83.135.201.185
  83.135.203.184
  83.135.203.226
  83.135.205.3
@@ -139910,7 +140837,7 @@
  83.135.207.60
  83.135.207.99
  83.135.83.94
-83.135.92.89
+83.135.92.125
  83.136.106.190
  83.136.114.154
  83.136.123.228
@@ -139923,6 +140850,7 @@
  83.137.204.195
  83.137.205.81
  83.137.41.10
+83.137.6.228
  83.138.216.235
  83.138.48.14
  83.139.138.11
@@ -139935,9 +140863,9 @@
  83.142.193.145
  83.142.197.99
  83.142.52.116
+83.142.52.22
  83.142.52.39
-83.142.52.76
-83.142.53.61
+83.142.53.167
  83.142.54.166
  83.142.83.21
  83.143.134.34
@@ -139956,25 +140884,25 @@
  83.148.146.68
  83.148.241.222
  83.149.126.98
+83.149.37.192
+83.149.44.31
  83.15.108.140
  83.15.198.33
  83.150.16.14
  83.150.214.235
  83.150.214.238
+83.150.215.186
  83.150.218.106
  83.150.218.111
  83.150.218.114
  83.150.218.163
  83.150.218.166
  83.150.218.231
-83.150.218.237
  83.150.218.241
-83.150.218.52
  83.150.54.50
  83.151.229.140
  83.151.230.201
  83.152.229.26
-83.159.240.104
  83.16.100.218
  83.16.62.106
  83.161.157.200
@@ -139985,16 +140913,14 @@
  83.162.240.14
  83.162.251.163
  83.163.153.74
-83.163.211.75
  83.164.146.86
  83.164.150.238
-83.165.229.57
  83.165.44.142
-83.165.46.251
+83.165.50.235
  83.165.62.214
-83.165.79.110
  83.166.101.237
  83.166.241.216
+83.167.1.125
  83.167.203.174
  83.167.247.177
  83.167.27.4
@@ -140017,7 +140943,6 @@
  83.169.20.144
  83.169.208.218
  83.169.21.32
-83.169.212.9
  83.169.238.190
  83.169.245.34
  83.169.28.96
@@ -140039,11 +140964,11 @@
  83.171.253.20
  83.171.253.217
  83.171.253.226
+83.171.253.83
  83.171.253.90
  83.171.254.103
  83.171.254.130
  83.171.254.169
-83.171.254.33
  83.171.255.115
  83.171.255.117
  83.171.255.124
@@ -140078,11 +141003,9 @@
  83.179.86.100
  83.18.0.141
  83.18.149.38
-83.18.207.66
  83.18.36.146
  83.180.60.69
  83.180.62.214
-83.180.69.31
  83.180.72.52
  83.183.106.222
  83.184.95.121
@@ -140102,6 +141025,7 @@
  83.198.82.100
  83.199.8.45
  83.199.90.103
+83.2.189.6
  83.2.189.66
  83.20.207.43
  83.202.231.25
@@ -140113,6 +141037,7 @@
  83.209.139.50
  83.209.162.235
  83.209.219.235
+83.209.236.79
  83.209.237.224
  83.209.252.83
  83.209.51.230
@@ -140138,15 +141063,11 @@
  83.219.205.131
  83.22.178.191
  83.22.248.73
-83.22.71.208
  83.220.144.22
  83.220.162.174
  83.220.173.158
  83.220.173.21
-83.221.160.91
-83.221.166.222
  83.221.175.184
-83.221.175.202
  83.221.207.234
  83.221.210.21
  83.221.210.233
@@ -140189,7 +141110,6 @@
  83.233.138.242
  83.233.181.209
  83.233.192.20
-83.233.192.250
  83.233.195.161
  83.233.196.54
  83.233.201.201
@@ -140224,7 +141144,7 @@
  83.240.15.151
  83.240.242.218
  83.240.72.79
-83.242.251.36
+83.242.251.37
  83.242.96.21
  83.242.96.22
  83.243.191.199
@@ -140237,13 +141157,13 @@
  83.248.153.170
  83.248.180.19
  83.248.180.9
+83.248.190.57
  83.248.66.194
  83.249.73.216
  83.25.14.196
  83.250.1.13
  83.250.140.254
  83.250.17.202
-83.250.220.41
  83.250.40.3
  83.250.58.75
  83.250.8.110
@@ -140268,7 +141188,7 @@
  83.26.50.159
  83.26.54.64
  83.26.76.38
-83.27.185.67
+83.27.26.170
  83.27.55.23
  83.28.162.225
  83.28.4.29
@@ -140282,14 +141202,11 @@
  83.30.252.90
  83.31.183.51
  83.32.181.76
-83.34.164.71
-83.34.33.65
  83.36.104.129
  83.37.158.47
+83.38.12.181
  83.38.39.93
  83.4.100.251
-83.4.39.184
-83.4.56.165
  83.40.147.111
  83.40.148.43
  83.41.172.111
@@ -140307,16 +141224,17 @@
  83.55.101.248
  83.56.24.88
  83.58.135.21
+83.6.123.252
  83.6.146.196
  83.6.159.151
  83.6.3.135
  83.60.154.199
  83.61.23.152
+83.63.137.76
  83.64.132.254
  83.64.78.154
  83.66.103.52
  83.66.120.38
-83.66.146.139
  83.66.175.34
  83.68.237.104
  83.68.251.177
@@ -140324,6 +141242,7 @@
  83.69.215.130
  83.69.222.102
  83.69.237.89
+83.69.90.191
  83.69.93.64
  83.7.114.8
  83.7.179.177
@@ -140363,6 +141282,7 @@
  83.97.20.117
  83.97.20.118
  83.97.20.153
+83.97.20.155
  83.97.20.159
  83.97.20.161
  83.97.20.170
@@ -140395,7 +141315,6 @@
  83.99.8.161
  83.99.83.184
  83.99.83.185
-83.99.83.188
  83010624-96-20190711114544.webstarterz.com
  8304153-89850-dot-bles05.wn.r.appspot.com
  8322344-dot-n-e-w-me-ss-age-po-rt-al.wl.r.appspot.com
@@ -140430,6 +141349,7 @@
  84.106.165.105
  84.106.37.98
  84.107.72.15
+84.108.77.68
  84.110.106.22
  84.110.47.54
  84.110.53.130
@@ -140440,63 +141360,64 @@
  84.113.144.10
  84.113.25.238
  84.114.111.75
-84.114.247.11
+84.114.190.61
+84.115.129.40
  84.115.136.210
  84.115.136.45
  84.115.141.72
  84.117.113.152
  84.117.139.69
-84.117.39.107
  84.118.107.8
  84.118.161.63
  84.118.239.130
  84.120.107.50
  84.120.243.235
+84.121.196.149
  84.121.4.248
  84.122.1.218
  84.126.137.181
  84.126.177.81
-84.126.242.230
  84.126.71.50
  84.127.137.202
  84.127.40.16
-84.132.151.59
+84.129.207.90
  84.134.24.100
  84.135.138.231
+84.137.15.180
+84.137.21.5
+84.137.8.100
  84.137.88.41
  84.140.144.150
  84.140.148.139
-84.141.238.148
  84.141.40.241
  84.145.117.151
  84.145.76.125
-84.148.209.122
  84.15.143.111
  84.15.156.185
  84.15.160.174
  84.15.209.197
-84.151.181.174
-84.154.244.149
+84.151.104.254
+84.154.240.119
  84.154.248.91
-84.154.29.130
  84.16.126.83
  84.16.234.202
  84.16.234.247
-84.16.242.193
  84.16.248.172
  84.16.38.218
  84.16.46.130
-84.160.183.213
  84.160.183.89
  84.160.52.80
-84.160.53.132
+84.162.166.9
  84.164.162.221
+84.167.155.159
  84.168.116.156
  84.168.252.185
  84.17.15.2
  84.17.23.34
  84.17.34.25
+84.17.35.11
  84.17.36.59
+84.17.43.186
  84.17.46.179
  84.17.48.108
  84.17.48.109
@@ -140506,11 +141427,14 @@
  84.17.49.110
  84.17.49.202
  84.17.49.245
+84.17.49.32
+84.17.49.40
  84.17.51.125
  84.17.51.37
  84.17.51.54
  84.17.51.82
  84.17.54.71
+84.17.55.102
  84.17.55.103
  84.17.55.105
  84.17.55.106
@@ -140524,35 +141448,34 @@
  84.17.55.125
  84.17.55.21
  84.17.55.22
+84.17.55.23
  84.17.55.5
  84.17.55.8
  84.17.60.210
  84.17.60.214
+84.17.60.236
  84.17.61.225
  84.17.62.208
-84.171.145.155
+84.170.235.51
  84.174.216.84
  84.174.96.222
  84.178.71.231
  84.180.250.158
-84.181.89.53
  84.183.149.231
  84.184.234.47
-84.185.212.251
  84.185.244.169
+84.186.209.237
+84.189.86.242
  84.19.178.210
  84.19.89.38
-84.190.139.120
  84.190.142.186
  84.192.16.234
  84.193.201.197
  84.194.158.124
-84.195.163.186
+84.195.243.66
  84.196.119.31
  84.197.0.45
  84.197.122.50
-84.197.138.232
-84.197.198.167
  84.199.237.190
  84.2.188.27
  84.2.191.178
@@ -140577,10 +141500,12 @@
  84.204.144.174
  84.204.40.154
  84.205.15.25
+84.205.24.161
  84.205.47.232
  84.208.137.213
  84.208.207.98
  84.209.1.53
+84.209.113.59
  84.209.133.126
  84.209.139.0
  84.209.15.55
@@ -140589,21 +141514,12 @@
  84.21.170.43
  84.21.170.47
  84.21.170.61
-84.21.188.123
-84.21.188.168
-84.21.188.174
-84.21.188.198
-84.21.188.232
-84.21.188.241
-84.21.188.252
-84.21.188.58
  84.21.191.1
  84.21.191.10
  84.21.191.101
  84.21.191.102
  84.21.191.106
  84.21.191.107
-84.21.191.111
  84.21.191.112
  84.21.191.115
  84.21.191.118
@@ -140628,19 +141544,16 @@
  84.21.191.18
  84.21.191.184
  84.21.191.187
-84.21.191.188
  84.21.191.194
  84.21.191.195
  84.21.191.196
  84.21.191.206
  84.21.191.207
  84.21.191.213
-84.21.191.215
  84.21.191.221
  84.21.191.222
  84.21.191.225
  84.21.191.226
-84.21.191.228
  84.21.191.230
  84.21.191.233
  84.21.191.235
@@ -140665,12 +141578,9 @@
  84.21.191.54
  84.21.191.60
  84.21.191.64
-84.21.191.67
  84.21.191.73
  84.21.191.81
  84.21.191.87
-84.21.191.89
-84.21.191.92
  84.21.191.93
  84.21.191.95
  84.21.191.96
@@ -140697,16 +141607,13 @@
  84.216.181.94
  84.216.51.36
  84.217.118.226
-84.217.240.49
  84.217.7.105
  84.217.82.227
  84.22.116.140
-84.22.137.229
  84.22.138.150
  84.22.141.87
  84.22.143.118
  84.22.144.202
-84.22.195.194
  84.22.198.26
  84.22.25.10
  84.22.35.142
@@ -140715,9 +141622,7 @@
  84.22.41.102
  84.22.42.213
  84.22.52.222
-84.22.59.202
  84.22.59.74
-84.22.63.122
  84.226.245.96
  84.226.56.42
  84.228.117.172
@@ -140735,7 +141640,6 @@
  84.229.233.3
  84.23.138.151
  84.23.141.177
-84.23.145.70
  84.23.153.91
  84.231.161.178
  84.232.113.247
@@ -140763,6 +141667,7 @@
  84.236.30.236
  84.236.38.244
  84.236.6.226
+84.236.90.99
  84.237.231.191
  84.238.105.42
  84.238.107.237
@@ -140774,10 +141679,7 @@
  84.238.96.208
  84.239.39.142
  84.239.39.89
-84.24.178.77
-84.240.200.170
-84.240.203.49
-84.240.208.134
+84.24.190.84
  84.240.26.123
  84.240.28.49
  84.240.66.131
@@ -140809,16 +141711,16 @@
  84.246.200.122
  84.246.21.243
  84.246.229.182
+84.247.10.232
  84.247.48.11
  84.247.48.12
-84.247.48.13
-84.247.48.14
  84.247.48.20
  84.247.48.25
  84.247.48.27
  84.247.48.28
  84.247.48.3
  84.247.48.30
+84.247.48.4
  84.247.48.51
  84.247.48.53
  84.247.48.54
@@ -140827,16 +141729,18 @@
  84.247.48.59
  84.247.48.6
  84.247.48.61
-84.247.48.62
  84.247.48.7
  84.247.48.8
+84.247.50.245
+84.247.50.246
+84.247.50.251
  84.25.47.230
  84.250.5.191
  84.251.91.165
+84.252.12.48
  84.252.121.124
  84.254.38.12
  84.254.39.129
-84.254.8.101
  84.254.89.159
  84.254.90.125
  84.255.194.237
@@ -140867,11 +141771,9 @@
  84.35.130.19
  84.38.110.18
  84.38.129.217
-84.38.130.146
  84.38.134.198
  84.38.180.25
  84.38.180.76
-84.38.181.8
  84.38.184.216
  84.38.184.53
  84.38.184.67
@@ -140887,6 +141789,7 @@
  84.38.66.11
  84.38.95.147
  84.39.181.96
+84.39.183.96
  84.39.185.189
  84.39.186.168
  84.39.241.53
@@ -140894,44 +141797,36 @@
  84.40.94.170
  84.40.96.129
  84.41.15.231
-84.42.204.37
  84.42.218.14
  84.42.224.146
  84.42.253.252
  84.42.33.178
  84.42.62.141
  84.42.62.187
-84.42.72.137
  84.42.72.183
-84.42.72.254
  84.42.72.59
  84.42.73.108
-84.42.73.226
  84.42.73.29
-84.42.73.3
  84.42.74.175
  84.42.74.184
-84.42.74.19
  84.42.74.207
-84.42.74.66
  84.42.75.65
  84.42.76.0
-84.42.76.160
  84.42.76.162
  84.42.76.179
  84.42.76.215
  84.42.76.52
+84.43.153.200
  84.43.181.174
  84.43.90.54
  84.45.121.135
  84.45.38.216
  84.46.1.149
-84.46.12.72
  84.46.16.173
  84.46.4.112
  84.46.4.114
-84.46.4.122
  84.46.44.154
+84.47.105.202
  84.47.226.66
  84.47.226.68
  84.47.4.50
@@ -140957,174 +141852,102 @@
  84.52.53.11
  84.52.85.238
  84.53.192.243
-84.53.198.1
  84.53.198.10
-84.53.198.100
-84.53.198.101
  84.53.198.102
  84.53.198.105
  84.53.198.106
-84.53.198.107
  84.53.198.108
-84.53.198.109
-84.53.198.11
  84.53.198.110
-84.53.198.111
-84.53.198.112
  84.53.198.114
  84.53.198.117
-84.53.198.118
-84.53.198.12
  84.53.198.120
-84.53.198.122
  84.53.198.123
  84.53.198.124
-84.53.198.125
  84.53.198.126
  84.53.198.128
  84.53.198.129
-84.53.198.130
  84.53.198.131
  84.53.198.133
  84.53.198.134
  84.53.198.135
-84.53.198.136
  84.53.198.137
  84.53.198.138
-84.53.198.139
-84.53.198.14
  84.53.198.140
  84.53.198.141
-84.53.198.142
  84.53.198.146
-84.53.198.148
  84.53.198.149
-84.53.198.15
-84.53.198.150
-84.53.198.151
  84.53.198.153
  84.53.198.154
  84.53.198.155
  84.53.198.156
-84.53.198.157
  84.53.198.158
-84.53.198.159
  84.53.198.160
-84.53.198.161
  84.53.198.162
  84.53.198.163
-84.53.198.165
  84.53.198.166
  84.53.198.167
-84.53.198.168
  84.53.198.169
  84.53.198.17
  84.53.198.171
  84.53.198.172
-84.53.198.173
  84.53.198.174
-84.53.198.176
-84.53.198.177
-84.53.198.178
-84.53.198.179
-84.53.198.18
-84.53.198.180
-84.53.198.181
-84.53.198.182
  84.53.198.183
  84.53.198.185
  84.53.198.189
  84.53.198.190
  84.53.198.192
  84.53.198.193
-84.53.198.195
  84.53.198.197
  84.53.198.198
  84.53.198.2
  84.53.198.201
-84.53.198.202
  84.53.198.203
  84.53.198.204
  84.53.198.207
  84.53.198.208
  84.53.198.209
  84.53.198.21
-84.53.198.210
-84.53.198.212
  84.53.198.213
  84.53.198.214
-84.53.198.215
-84.53.198.217
  84.53.198.218
-84.53.198.219
  84.53.198.22
  84.53.198.220
-84.53.198.222
  84.53.198.223
  84.53.198.225
-84.53.198.226
-84.53.198.227
-84.53.198.228
  84.53.198.229
  84.53.198.23
  84.53.198.230
-84.53.198.232
  84.53.198.233
  84.53.198.234
  84.53.198.235
-84.53.198.236
-84.53.198.237
  84.53.198.238
-84.53.198.239
-84.53.198.24
  84.53.198.240
  84.53.198.241
  84.53.198.242
-84.53.198.243
  84.53.198.244
  84.53.198.245
-84.53.198.246
-84.53.198.247
  84.53.198.248
-84.53.198.249
  84.53.198.25
-84.53.198.251
-84.53.198.252
  84.53.198.254
  84.53.198.255
  84.53.198.26
  84.53.198.27
-84.53.198.29
-84.53.198.3
  84.53.198.30
  84.53.198.31
-84.53.198.32
  84.53.198.33
-84.53.198.34
-84.53.198.35
  84.53.198.36
-84.53.198.37
  84.53.198.38
  84.53.198.39
  84.53.198.40
  84.53.198.41
-84.53.198.42
-84.53.198.43
  84.53.198.44
-84.53.198.45
-84.53.198.46
  84.53.198.47
  84.53.198.48
  84.53.198.49
-84.53.198.5
-84.53.198.50
-84.53.198.51
  84.53.198.52
  84.53.198.53
  84.53.198.54
  84.53.198.55
-84.53.198.56
-84.53.198.58
  84.53.198.59
  84.53.198.60
  84.53.198.61
@@ -141132,33 +141955,20 @@
  84.53.198.64
  84.53.198.65
  84.53.198.66
-84.53.198.67
-84.53.198.68
-84.53.198.7
  84.53.198.70
-84.53.198.71
-84.53.198.72
-84.53.198.73
  84.53.198.74
-84.53.198.75
  84.53.198.78
  84.53.198.79
  84.53.198.8
  84.53.198.80
  84.53.198.81
-84.53.198.82
-84.53.198.83
  84.53.198.84
-84.53.198.85
-84.53.198.86
  84.53.198.87
  84.53.198.88
-84.53.198.89
  84.53.198.9
  84.53.198.95
  84.53.198.96
  84.53.198.98
-84.53.198.99
  84.53.222.70
  84.53.225.118
  84.53.236.55
@@ -141167,6 +141977,7 @@
  84.53.239.248
  84.53.239.95
  84.53.243.90
+84.53.244.98
  84.53.247.204
  84.53.247.253
  84.54.132.0
@@ -141181,26 +141992,26 @@
  84.54.53.94
  84.54.58.105
  84.54.58.128
+84.54.58.184
+84.54.58.210
  84.54.58.48
-84.54.69.66
-84.55.211.137
  84.55.70.80
  84.57.168.131
  84.58.161.111
+84.58.163.81
  84.58.186.83
  84.58.247.239
-84.60.34.136
+84.58.27.31
+84.58.27.4
  84.60.34.238
-84.61.151.157
-84.61.151.36
  84.61.40.68
  84.63.136.83
  84.63.171.4
  84.63.219.33
-84.63.47.142
  84.63.47.89
  84.66.181.20
  84.68.29.209
+84.68.9.143
  84.7.153.192
  84.7.217.94
  84.7.96.195
@@ -141209,6 +142020,7 @@
  84.72.111.202
  84.73.124.186
  84.73.156.202
+84.73.17.41
  84.73.218.55
  84.74.119.202
  84.74.240.47
@@ -141223,7 +142035,6 @@
  84.84.200.130
  84.85.102.113
  84.85.15.179
-84.85.159.9
  84.85.228.191
  84.85.251.208
  84.87.77.211
@@ -141233,7 +142044,7 @@
  84.92.24.249
  84.92.49.136
  84.92.92.247
-84.95.2.159
+84.99.196.158
  840215.servicesbpd.club
  840e4d67.ngrok.io
  841365365.com
@@ -141261,6 +142072,7 @@
  85.0.156.157
  85.0.164.246
  85.0.223.190
+85.0.49.239
  85.0.5.251
  85.1.145.38
  85.1.18.231
@@ -141277,13 +142089,14 @@
  85.10.206.179
  85.10.24.40
  85.10.248.121
-85.10.51.35
+85.10.50.186
+85.10.51.17
+85.10.51.36
  85.10.53.90
  85.10.56.134
  85.10.56.138
  85.100.122.211
  85.100.126.177
-85.100.126.91
  85.100.43.171
  85.101.118.60
  85.101.119.249
@@ -141313,7 +142126,6 @@
  85.105.131.247
  85.105.135.70
  85.105.154.118
-85.105.155.218
  85.105.156.8
  85.105.16.154
  85.105.162.155
@@ -141341,6 +142153,7 @@
  85.105.244.183
  85.105.247.98
  85.105.255.37
+85.105.27.192
  85.105.29.239
  85.105.31.183
  85.105.32.224
@@ -141355,6 +142168,7 @@
  85.106.4.183
  85.106.4.40
  85.106.8.102
+85.107.164.83
  85.108.99.41
  85.109.127.48
  85.109.43.176
@@ -141368,7 +142182,6 @@
  85.11.61.162
  85.110.125.42
  85.111.12.199
-85.111.17.64
  85.111.32.197
  85.111.55.19
  85.111.74.140
@@ -141379,20 +142192,9 @@
  85.112.78.34
  85.113.0.202
  85.113.136.32
-85.113.14.18
  85.113.140.196
-85.113.15.110
-85.113.15.66
  85.113.18.130
-85.113.18.186
-85.113.21.226
-85.113.213.130
-85.113.213.176
  85.113.213.81
-85.113.213.99
-85.113.214.150
-85.113.217.176
-85.113.31.2
  85.113.38.197
  85.113.51.151
  85.113.91.205
@@ -141414,10 +142216,6 @@
  85.115.173.73
  85.116.120.106
  85.116.125.149
-85.117.100.162
-85.117.114.180
-85.117.118.31
-85.117.120.189
  85.117.56.103
  85.117.56.73
  85.117.56.74
@@ -141438,13 +142236,11 @@
  85.12.33.30
  85.121.205.185
  85.128.142.109
-85.128.142.137
  85.128.60.158
  85.13.134.81
  85.13.229.138
  85.13.237.23
  85.132.37.196
-85.132.47.102
  85.132.57.227
  85.132.79.170
  85.132.9.180
@@ -141453,7 +142249,7 @@
  85.133.143.35
  85.133.190.156
  85.135.95.218
-85.136.47.215
+85.137.209.64
  85.138.213.57
  85.138.240.40
  85.138.36.170
@@ -141463,14 +142259,13 @@
  85.14.243.31
  85.14.79.26
  85.14.8.232
-85.140.3.106
-85.140.4.116
  85.142.45.77
  85.143.156.158
  85.143.210.193
  85.143.213.2
  85.143.214.43
  85.143.222.245
+85.143.228.150
  85.143.228.207
  85.143.254.20
  85.145.142.46
@@ -141490,6 +142285,8 @@
  85.152.162.105
  85.152.174.56
  85.152.69.155
+85.153.238.155
+85.154.110.206
  85.158.181.41
  85.159.178.172
  85.159.212.90
@@ -141498,9 +142295,7 @@
  85.159.237.210
  85.159.237.71
  85.159.237.76
-85.159.26.13
  85.159.27.40
-85.159.27.84
  85.159.35.138
  85.159.4.113
  85.159.64.163
@@ -141508,7 +142303,6 @@
  85.163.113.35
  85.163.113.58
  85.163.224.168
-85.163.46.102
  85.163.5.148
  85.163.53.75
  85.164.185.172
@@ -141538,6 +142332,7 @@
  85.17.25.69
  85.17.75.108
  85.17.90.143
+85.170.178.143
  85.170.233.95
  85.171.188.35
  85.171.52.251
@@ -141545,7 +142340,6 @@
  85.172.107.1
  85.172.11.101
  85.172.12.245
-85.172.122.134
  85.172.170.146
  85.172.174.46
  85.172.189.189
@@ -141553,20 +142347,16 @@
  85.172.229.121
  85.172.31.108
  85.172.38.232
-85.172.39.174
  85.172.98.94
  85.173.112.54
-85.173.126.126
  85.173.165.36
-85.174.107.69
-85.174.200.51
-85.174.75.176
  85.175.100.254
  85.175.171.169
  85.175.194.35
  85.175.227.3
  85.175.4.251
  85.175.5.6
+85.175.97.196
  85.175.97.57
  85.175.98.232
  85.175.99.105
@@ -141574,6 +142364,7 @@
  85.175.99.136
  85.18.117.101
  85.18.205.196
+85.18.236.229
  85.184.138.108
  85.184.168.215
  85.184.191.57
@@ -141587,7 +142378,6 @@
  85.185.248.17
  85.185.250.27
  85.185.75.243
-85.185.98.109
  85.186.127.60
  85.186.38.228
  85.186.97.181
@@ -141607,13 +142397,9 @@
  85.191.200.51
  85.191.219.13
  85.191.243.82
-85.192.172.13
  85.192.173.32
  85.192.191.6
-85.192.20.149
  85.192.59.10
-85.193.102.216
-85.193.119.127
  85.194.102.234
  85.194.157.148
  85.194.238.131
@@ -141631,11 +142417,11 @@
  85.196.136.17
  85.196.136.9
  85.196.173.25
-85.196.179.34
  85.196.183.162
  85.196.211.100
  85.196.25.2
  85.196.80.134
+85.197.160.44
  85.197.161.143
  85.197.177.204
  85.198.115.122
@@ -141662,8 +142448,10 @@
  85.202.195.87
  85.202.229.205
  85.203.44.154
+85.203.46.157
  85.204.116.111
  85.204.116.139
+85.204.116.155
  85.204.116.179
  85.204.116.197
  85.204.116.202
@@ -141675,6 +142463,7 @@
  85.204.116.25
  85.204.116.32
  85.204.116.48
+85.204.116.59
  85.204.116.66
  85.204.116.71
  85.204.116.72
@@ -141691,13 +142480,13 @@
  85.204.53.52
  85.204.65.163
  85.206.2.35
-85.206.57.125
  85.206.57.202
  85.207.128.82
  85.207.155.39
  85.208.109.193
  85.208.109.221
-85.208.140.163
+85.208.115.112
+85.208.115.201
  85.208.185.212
  85.208.187.5
  85.208.203.4
@@ -141724,7 +142513,6 @@
  85.208.86.50
  85.208.86.81
  85.208.87.12
-85.208.87.153
  85.208.87.162
  85.208.87.164
  85.208.87.187
@@ -141758,7 +142546,6 @@
  85.209.0.156
  85.209.0.162
  85.209.0.164
-85.209.0.166
  85.209.0.168
  85.209.0.171
  85.209.0.172
@@ -141797,10 +142584,8 @@
  85.209.0.41
  85.209.0.42
  85.209.0.44
-85.209.0.48
  85.209.0.5
  85.209.0.54
-85.209.0.57
  85.209.0.63
  85.209.0.67
  85.209.0.68
@@ -141816,14 +142601,12 @@
  85.209.0.99
  85.209.149.137
  85.209.149.144
-85.209.149.145
  85.209.149.188
  85.209.149.20
  85.209.149.200
  85.209.149.22
  85.209.149.52
  85.209.149.87
-85.209.150.135
  85.209.150.137
  85.209.150.144
  85.209.150.165
@@ -141832,7 +142615,6 @@
  85.209.150.82
  85.209.151.103
  85.209.151.137
-85.209.151.148
  85.209.151.243
  85.209.151.39
  85.209.151.84
@@ -141852,9 +142634,10 @@
  85.211.126.190
  85.212.178.113
  85.212.195.72
-85.212.216.196
+85.212.35.128
+85.212.62.198
  85.212.64.216
-85.212.95.250
+85.212.73.232
  85.214.103.48
  85.214.108.223
  85.214.127.109
@@ -141904,15 +142687,15 @@
  85.216.66.241
  85.217.137.77
  85.217.170.105
+85.217.170.239
  85.217.192.39
-85.222.124.62
  85.222.17.110
  85.222.206.142
  85.222.69.218
+85.223.181.214
  85.223.214.130
  85.224.108.43
  85.224.125.220
-85.224.186.218
  85.224.217.159
  85.224.71.160
  85.225.101.161
@@ -141938,7 +142721,6 @@
  85.230.42.151
  85.230.7.58
  85.230.79.233
-85.232.10.48
  85.232.244.35
  85.232.25.226
  85.234.116.99
@@ -141962,12 +142744,10 @@
  85.238.101.59
  85.238.104.235
  85.238.167.170
-85.238.184.237
  85.238.194.251
  85.238.96.130
  85.238.99.14
  85.239.121.168
-85.239.212.117
  85.239.35.123
  85.239.35.124
  85.239.35.130
@@ -142018,8 +142798,10 @@
  85.248.227.165
  85.248.6.41
  85.249.107.197
-85.249.33.0
  85.25.119.252
+85.25.15.202
+85.25.15.211
+85.25.15.217
  85.25.194.12
  85.25.194.74
  85.25.195.33
@@ -142036,18 +142818,12 @@
  85.252.123.110
  85.253.98.252
  85.254.72.27
+85.254.75.246
  85.255.169.148
  85.255.170.46
  85.255.203.42
-85.26.234.41
-85.27.109.212
  85.27.199.198
-85.29.130.210
-85.29.132.202
-85.29.133.154
  85.29.136.63
-85.29.150.200
-85.29.178.133
  85.3.173.102
  85.3.203.149
  85.3.206.174
@@ -142060,7 +142836,11 @@
  85.30.248.210
  85.30.61.54
  85.31.176.203
-85.33.102.18
+85.31.53.248
+85.31.53.249
+85.31.53.250
+85.31.53.251
+85.31.53.254
  85.33.122.226
  85.35.244.164
  85.38.164.51
@@ -142103,34 +142883,34 @@
  85.70.97.59
  85.72.110.235
  85.72.191.132
-85.72.201.221
  85.72.220.109
  85.72.240.89
  85.72.32.44
  85.72.38.209
  85.72.51.33
  85.73.128.172
+85.73.138.12
  85.73.154.86
  85.73.224.128
  85.73.57.218
-85.74.130.25
  85.74.174.199
  85.74.21.48
  85.74.225.141
  85.74.23.37
  85.74.97.40
-85.75.119.145
  85.75.219.238
  85.75.74.16
  85.8.44.247
  85.8.51.143
+85.8.91.41
+85.84.99.163
  85.85.12.67
  85.89.170.201
  85.89.170.99
  85.89.183.27
  85.89.187.195
  85.89.188.37
-85.9.131.165
+85.9.125.82
  85.9.134.15
  85.9.20.134
  85.9.20.135
@@ -142142,13 +142922,11 @@
  85.90.100.62
  85.90.105.201
  85.90.163.235
-85.90.194.206
  85.90.194.74
  85.90.244.52
  85.90.247.9
  85.92.108.211
  85.92.108.246
-85.92.121.189
  85.92.144.88
  85.92.164.179
  85.92.165.225
@@ -142176,8 +142954,6 @@
  85.93.20.91
  85.93.20.92
  85.93.218.204
-85.94.0.118
-85.94.0.149
  85.94.201.138
  85.94.33.242
  85.95.167.186
@@ -142202,6 +142978,7 @@
  85.97.184.130
  85.97.195.129
  85.97.204.234
+85.98.243.215
  85.98.33.161
  85.98.52.88
  85.98.59.91
@@ -142248,17 +143025,21 @@
  86.101.153.203
  86.101.155.96
  86.101.224.233
+86.101.85.216
  86.104.15.20
  86.104.18.51
  86.104.194.116
  86.104.194.140
  86.104.194.156
+86.104.194.171
  86.104.194.176
  86.104.194.178
  86.104.194.179
  86.104.194.180
  86.104.194.181
  86.104.194.182
+86.104.194.183
+86.104.194.184
  86.104.194.185
  86.104.194.188
  86.104.194.191
@@ -142270,6 +143051,7 @@
  86.104.194.213
  86.104.194.214
  86.104.194.215
+86.104.194.216
  86.104.194.220
  86.104.194.221
  86.104.194.222
@@ -142288,6 +143070,7 @@
  86.105.18.253
  86.105.18.5
  86.105.183.112
+86.105.183.238
  86.105.183.84
  86.105.187.122
  86.105.212.94
@@ -142295,14 +143078,12 @@
  86.105.227.165
  86.105.25.77
  86.106.102.166
-86.106.121.115
  86.106.121.75
  86.106.131.150
  86.106.131.207
  86.106.74.125
  86.106.92.23
  86.107.146.161
-86.108.0.139
  86.108.106.212
  86.108.108.246
  86.108.109.91
@@ -142311,16 +143092,13 @@
  86.108.116.3
  86.108.127.106
  86.108.29.162
-86.108.40.101
  86.108.5.102
  86.108.5.105
  86.108.5.74
  86.108.51.246
-86.108.53.172
  86.108.6.31
  86.108.6.32
  86.108.69.155
-86.108.71.191
  86.108.74.42
  86.108.75.114
  86.108.86.153
@@ -142375,6 +143153,7 @@
  86.123.187.169
  86.123.188.209
  86.123.31.44
+86.123.38.245
  86.123.55.43
  86.123.65.220
  86.124.129.151
@@ -142413,6 +143192,7 @@
  86.141.235.71
  86.142.241.133
  86.143.124.247
+86.143.146.94
  86.143.148.128
  86.144.134.215
  86.144.181.162
@@ -142427,6 +143207,7 @@
  86.149.8.23
  86.15.86.116
  86.152.238.234
+86.153.58.161
  86.157.225.33
  86.159.105.46
  86.159.154.192
@@ -142435,13 +143216,14 @@
  86.161.241.247
  86.162.119.95
  86.162.80.19
+86.163.105.5
+86.164.108.24
  86.165.30.176
  86.166.240.151
  86.167.22.40
  86.169.196.8
  86.169.196.96
  86.170.46.4
-86.172.3.218
  86.173.62.115
  86.173.77.98
  86.175.72.240
@@ -142468,36 +143250,32 @@
  86.202.151.196
  86.202.64.224
  86.207.138.18
-86.207.192.225
  86.213.63.181
  86.216.169.148
-86.218.107.235
  86.218.8.146
  86.22.221.170
  86.222.65.138
-86.222.78.135
  86.225.212.132
  86.23.172.205
  86.23.18.29
  86.23.4.8
+86.233.196.67
  86.234.149.82
  86.234.56.72
  86.234.62.28
  86.234.64.241
  86.235.226.160
-86.24.104.62
+86.236.249.159
  86.24.173.237
-86.242.215.226
-86.249.255.117
  86.250.184.199
  86.253.219.39
  86.253.40.82
  86.254.122.150
+86.26.149.239
  86.27.243.5
  86.28.108.118
  86.28.76.169
  86.28.76.189
-86.29.183.224
  86.29.85.90
  86.30.18.186
  86.30.41.181
@@ -142509,7 +143287,6 @@
  86.34.205.27
  86.34.40.215
  86.34.49.153
-86.35.166.217
  86.35.181.9
  86.35.182.166
  86.35.202.193
@@ -142517,11 +143294,11 @@
  86.35.35.99
  86.35.43.220
  86.38.10.57
-86.38.130.136
  86.38.171.149
  86.40.163.93
  86.40.82.233
  86.42.166.147
+86.42.9.230
  86.43.151.5
  86.45.145.20
  86.45.186.126
@@ -142532,7 +143309,7 @@
  86.52.44.102
  86.56.238.247
  86.57.131.182
-86.57.133.254
+86.57.132.71
  86.57.134.184
  86.57.167.132
  86.57.181.122
@@ -142543,8 +143320,9 @@
  86.57.216.191
  86.57.216.23
  86.57.235.240
+86.57.243.168
  86.59.147.155
-86.60.155.217
+86.6.113.248
  86.60.179.136
  86.60.36.169
  86.60.36.170
@@ -142559,6 +143337,7 @@
  86.63.66.230
  86.64.5.3
  86.73.116.53
+86.75.201.236
  86.76.7.132
  86.8.203.86
  86.8.77.187
@@ -142575,14 +143354,15 @@
  86.94.204.81
  86.95.8.249
  86.96.249.162
-86.97.32.103
  86.97.38.116
  86.98.157.222
  86.98.215.67
+86.98.220.155
  86.98.32.155
  86.98.67.140
  86.98.72.177
  86.98.75.96
+86.98.80.152
  86.98.82.253
  86.98.89.189
  86.98.9.52
@@ -142615,7 +143395,7 @@
  86g8ur.000webhostapp.com
  86mld.com
  87.0.2.121
-87.0.246.154
+87.1.105.241
  87.1.203.37
  87.1.83.3
  87.1.89.131
@@ -142646,6 +143426,7 @@
  87.106.140.114
  87.106.142.141
  87.106.16.155
+87.106.168.119
  87.106.168.85
  87.106.169.191
  87.106.170.144
@@ -142673,7 +143454,6 @@
  87.110.188.59
  87.110.60.124
  87.113.182.83
-87.116.144.146
  87.116.148.251
  87.116.148.5
  87.117.1.169
@@ -142689,7 +143469,7 @@
  87.117.234.195
  87.117.39.96
  87.117.45.19
-87.117.51.182
+87.117.56.81
  87.118.108.204
  87.118.116.103
  87.118.116.12
@@ -142735,15 +143515,15 @@
  87.122.117.43
  87.122.121.88
  87.122.185.98
-87.122.196.169
  87.122.214.178
  87.122.215.210
  87.122.219.2
  87.122.223.210
+87.122.227.210
  87.123.101.117
-87.123.105.86
-87.123.157.207
+87.123.165.137
  87.123.171.12
+87.123.175.79
  87.123.32.69
  87.123.33.127
  87.123.33.214
@@ -142772,6 +143552,7 @@
  87.123.66.154
  87.123.66.191
  87.123.67.1
+87.123.67.161
  87.123.68.172
  87.123.69.193
  87.123.69.82
@@ -142803,46 +143584,48 @@
  87.138.108.161
  87.139.127.162
  87.139.46.114
+87.14.189.207
  87.14.191.42
  87.140.92.161
+87.142.193.96
  87.142.196.87
+87.143.148.240
  87.144.252.219
  87.146.254.112
  87.15.194.35
  87.150.253.190
-87.150.62.45
  87.154.62.89
  87.154.82.47
  87.154.91.25
-87.156.135.246
-87.156.51.139
+87.156.141.217
  87.157.179.156
  87.157.182.127
+87.16.146.183
+87.16.153.210
  87.16.72.110
  87.160.149.147
  87.160.195.64
  87.163.35.148
-87.164.84.184
-87.166.37.150
+87.166.45.45
+87.166.46.196
  87.168.141.251
  87.169.126.200
+87.17.139.109
  87.17.214.235
  87.17.218.205
-87.17.36.102
-87.17.5.22
  87.17.90.169
  87.170.179.202
-87.172.224.56
+87.170.41.14
  87.172.226.230
+87.172.228.64
  87.173.210.249
-87.175.80.125
  87.175.82.220
-87.177.233.239
+87.177.234.99
  87.177.239.209
  87.178.251.121
-87.185.157.143
  87.185.159.33
  87.185.31.200
+87.187.105.109
  87.187.144.72
  87.187.155.63
  87.187.159.136
@@ -142862,7 +143645,6 @@
  87.2.31.173
  87.20.106.128
  87.20.137.4
-87.20.252.66
  87.20.39.152
  87.20.64.92
  87.200.238.18
@@ -142879,7 +143661,6 @@
  87.21.245.127
  87.210.254.220
  87.212.231.68
-87.213.228.114
  87.214.199.95
  87.214.96.147
  87.216.176.56
@@ -142887,10 +143668,9 @@
  87.217.91.78
  87.218.156.4
  87.218.217.24
-87.219.62.28
  87.219.83.218
-87.220.151.125
  87.221.188.229
+87.221.188.40
  87.222.2.105
  87.225.0.174
  87.225.106.80
@@ -142920,17 +143700,7 @@
  87.236.233.189
  87.236.88.222
  87.237.120.219
-87.237.233.222
-87.237.234.181
-87.237.235.6
-87.237.236.17
-87.237.236.4
-87.237.237.170
-87.237.237.96
  87.237.238.185
-87.237.238.36
-87.237.239.30
-87.237.239.38
  87.238.133.106
  87.238.133.168
  87.238.175.54
@@ -142945,7 +143715,6 @@
  87.241.143.6
  87.241.160.125
  87.241.160.80
-87.241.174.203
  87.241.44.41
  87.241.56.181
  87.241.91.181
@@ -142955,12 +143724,10 @@
  87.242.234.181
  87.242.78.186
  87.243.134.220
-87.243.27.78
  87.244.181.136
  87.244.182.241
  87.244.4.178
  87.244.4.93
-87.245.140.151
  87.245.163.250
  87.245.163.252
  87.245.170.253
@@ -142982,11 +143749,11 @@
  87.246.7.141
  87.246.7.142
  87.246.7.143
+87.246.7.144
  87.246.7.145
  87.246.7.146
  87.246.7.147
  87.246.7.148
-87.246.7.156
  87.246.7.35
  87.246.7.36
  87.246.7.37
@@ -143007,12 +143774,10 @@
  87.246.7.56
  87.247.102.142
  87.247.111.222
-87.247.143.129
  87.247.143.209
  87.247.143.225
  87.247.19.126
  87.247.3.234
-87.247.40.250
  87.247.97.189
  87.248.171.235
  87.248.182.115
@@ -143020,21 +143785,21 @@
  87.248.31.60
  87.248.7.125
  87.249.142.66
+87.249.217.57
  87.249.22.114
  87.250.219.94
  87.250.222.22
  87.251.112.117
  87.251.122.178
  87.251.214.153
-87.251.214.234
  87.251.216.2
  87.251.228.114
  87.251.245.80
  87.251.247.238
+87.251.250.84
  87.251.66.126
  87.251.67.184
  87.251.67.205
-87.251.70.160
  87.251.70.200
  87.251.70.202
  87.251.70.211
@@ -143065,7 +143830,6 @@
  87.251.74.30
  87.251.74.31
  87.251.74.35
-87.251.74.36
  87.251.74.4
  87.251.74.48
  87.251.74.58
@@ -143084,9 +143848,7 @@
  87.251.80.10
  87.251.99.153
  87.252.183.184
-87.252.99.89
  87.253.135.238
-87.253.3.138
  87.253.42.244
  87.253.70.139
  87.253.71.25
@@ -143096,18 +143858,13 @@
  87.255.13.217
  87.255.193.50
  87.255.198.166
-87.255.207.250
-87.255.211.194
-87.255.213.2
  87.255.217.154
-87.255.221.90
  87.255.51.230
  87.255.64.214
  87.255.77.51
  87.255.8.74
  87.26.121.231
  87.26.128.168
-87.26.15.211
  87.26.36.198
  87.26.40.62
  87.26.48.139
@@ -143124,6 +143881,7 @@
  87.3.46.64
  87.3.76.140
  87.5.26.155
+87.5.85.102
  87.5.98.36
  87.61.232.211
  87.61.90.230
@@ -143133,13 +143891,14 @@
  87.65.190.115
  87.65.195.214
  87.65.251.29
+87.65.70.130
+87.70.15.68
  87.71.119.132
  87.74.111.125
  87.75.105.186
  87.76.11.57
  87.76.12.118
  87.76.32.22
-87.76.33.134
  87.76.33.208
  87.76.33.39
  87.76.34.189
@@ -143158,9 +143917,8 @@
  87.9.132.50
  87.9.198.194
  87.9.201.90
-87.9.65.145
-87.92.157.181
-87.92.246.107
+87.9.62.69
+87.92.138.133
  87.93.33.20
  87.93.41.139
  87.93.8.13
@@ -143239,9 +143997,10 @@
  87ms.com
  87n3t-m3m45.net
  87n3t-m3m50.com
+88.1.118.79
+88.1.171.2
  88.1.222.254
  88.10.126.6
-88.10.29.255
  88.100.162.153
  88.100.55.137
  88.101.23.66
@@ -143273,7 +144032,6 @@
  88.119.220.136
  88.119.254.139
  88.119.49.66
-88.119.96.134
  88.12.19.206
  88.12.37.13
  88.12.47.65
@@ -143283,9 +144041,9 @@
  88.121.123.242
  88.121.130.169
  88.121.22.235
-88.123.130.243
  88.123.169.208
-88.127.73.42
+88.125.245.163
+88.129.162.63
  88.129.208.35
  88.129.208.44
  88.129.208.46
@@ -143297,24 +144055,19 @@
  88.129.44.15
  88.129.82.123
  88.13.9.239
-88.130.134.80
  88.130.156.196
-88.130.157.229
  88.130.158.159
  88.130.218.145
+88.130.218.220
  88.130.221.157
-88.130.69.227
-88.130.88.61
-88.130.90.121
+88.130.49.77
  88.130.90.153
-88.130.90.97
  88.131.253.74
  88.132.194.239
  88.132.194.239bin.sh
  88.132.217.184
  88.132.66.26
  88.134.121.93
-88.134.144.33
  88.135.117.232
  88.135.210.179
  88.135.38.250
@@ -143322,20 +144075,20 @@
  88.135.39.143
  88.135.39.162
  88.135.40.126
+88.135.40.179
  88.135.40.212
  88.135.40.241
  88.135.42.143
-88.135.42.6
  88.135.43.104
-88.135.43.233
+88.135.43.186
  88.135.43.241
  88.135.44.108
  88.135.44.202
  88.135.44.219
  88.135.44.232
+88.135.44.241
  88.135.45.185
  88.135.45.27
-88.135.45.37
  88.135.47.207
  88.135.62.117
  88.135.63.176
@@ -143345,6 +144098,7 @@
  88.14.237.251
  88.145.179.233
  88.146.204.49
+88.146.243.222
  88.147.107.228
  88.147.121.119
  88.147.142.103
@@ -143356,12 +144110,14 @@
  88.147.198.227
  88.147.22.77
  88.147.244.250
+88.147.253.215
  88.147.254.66
-88.147.27.55
  88.147.7.66
  88.147.88.95
  88.147.90.15
  88.147.99.13
+88.148.113.194
+88.148.113.237
  88.148.113.249
  88.149.142.129
  88.149.143.25
@@ -143392,23 +144148,21 @@
  88.151.140.190
  88.151.243.106
  88.151.75.131
-88.152.185.223
-88.152.185.232
  88.152.204.13
  88.152.233.143
-88.152.27.0
  88.153.216.102
+88.153.27.252
  88.153.35.32
  88.156.176.224
  88.156.97.210
  88.157.229.58
  88.159.128.67
  88.159.132.102
+88.161.72.68
  88.162.1.136
  88.162.25.1
  88.162.54.93
  88.165.81.34
-88.17.137.39
  88.17.240.63
  88.19.38.191
  88.190.155.48
@@ -143437,6 +144191,7 @@
  88.198.10.239
  88.198.109.4
  88.198.11.136
+88.198.145.31
  88.198.146.116
  88.198.151.153
  88.198.16.153
@@ -143458,6 +144213,7 @@
  88.198.43.231
  88.198.44.44
  88.198.46.36
+88.198.49.217
  88.198.52.78
  88.198.54.11
  88.198.54.67
@@ -143465,7 +144221,6 @@
  88.198.55.175
  88.198.57.103
  88.198.59.60
-88.198.86.71
  88.198.91.74
  88.198.92.47
  88.199.127.16
@@ -143496,30 +144251,18 @@
  88.202.224.162
  88.202.230.221
  88.203.203.150
-88.203.231.125
-88.204.142.82
-88.204.161.206
  88.204.164.234
-88.204.197.6
  88.204.198.84
-88.204.200.10
-88.204.200.166
-88.204.204.50
  88.204.210.194
-88.204.212.14
-88.204.216.142
-88.204.232.206
-88.204.232.234
-88.204.242.202
+88.204.227.218
  88.204.242.54
  88.204.245.146
-88.204.248.178
  88.206.119.124
  88.206.140.64
  88.206.163.29
  88.206.173.43
-88.206.183.105
  88.206.188.199
+88.207.110.190
  88.207.126.226
  88.208.205.79
  88.208.220.105
@@ -143552,7 +144295,7 @@
  88.215.2.29
  88.216.6.222
  88.217.113.112
-88.217.118.10
+88.217.118.8
  88.217.126.191
  88.217.172.165
  88.217.181.215
@@ -143585,20 +144328,15 @@
  88.218.17.48
  88.218.17.64
  88.218.17.72
-88.218.17.95
  88.218.193.65
  88.218.227.162
  88.218.227.241
  88.218.46.127
  88.218.46.165
  88.218.46.173
-88.218.46.179
  88.218.46.20
-88.218.46.214
  88.218.46.31
  88.218.46.71
-88.218.46.73
-88.218.46.74
  88.218.65.189
  88.218.65.200
  88.218.65.244
@@ -143618,7 +144356,7 @@
  88.218.67.122
  88.218.67.133
  88.218.67.235
-88.218.67.248
+88.218.67.249
  88.218.67.88
  88.218.92.124
  88.219.65.245
@@ -143635,9 +144373,10 @@
  88.226.96.242
  88.227.171.93
  88.227.251.162
+88.227.255.195
+88.228.189.179
  88.228.207.85
  88.229.4.26
-88.23.255.213
  88.231.121.95
  88.231.239.180
  88.231.239.253
@@ -143647,9 +144386,8 @@
  88.234.65.86
  88.236.163.250
  88.236.187.82
-88.24.182.251
  88.240.242.7
-88.242.134.164
+88.240.81.114
  88.242.5.57
  88.243.182.144
  88.243.206.81
@@ -143678,6 +144416,7 @@
  88.247.200.220
  88.247.209.164
  88.247.211.187
+88.247.212.19
  88.247.212.56
  88.247.22.226
  88.247.237.206
@@ -143685,7 +144424,6 @@
  88.247.35.28
  88.247.48.101
  88.247.49.109
-88.247.54.67
  88.247.61.250
  88.247.64.53
  88.247.88.184
@@ -143700,7 +144438,6 @@
  88.248.249.43
  88.248.49.26
  88.248.55.136
-88.248.6.230
  88.249.0.65
  88.249.1.196
  88.249.107.103
@@ -143708,6 +144445,7 @@
  88.249.120.205
  88.249.148.36
  88.249.164.251
+88.249.174.250
  88.249.181.198
  88.249.182.227
  88.249.194.134
@@ -143734,9 +144472,9 @@
  88.250.236.251
  88.250.240.245
  88.250.242.69
-88.252.146.81
  88.252.22.252
  88.252.242.152
+88.253.82.90
  88.255.102.110
  88.255.102.19
  88.255.102.38
@@ -143756,26 +144494,26 @@
  88.26.184.227
  88.26.255.75
  88.26.34.89
+88.31.60.31
  88.38.118.83
  88.43.93.227
  88.43.93.228
  88.44.100.106
  88.5.20.123
-88.5.20.30
+88.64.192.151
+88.64.230.103
  88.65.160.213
  88.65.233.150
-88.68.171.193
+88.68.171.175
+88.68.171.55
  88.7.137.57
-88.7.250.225
-88.7.48.157
-88.70.146.220
  88.71.186.154
+88.71.186.172
  88.73.13.238
-88.73.175.0
-88.73.175.49
  88.73.180.26
-88.74.200.115
+88.73.185.238
  88.76.252.15
+88.77.243.140
  88.78.137.199
  88.78.147.139
  88.79.208.11
@@ -143798,12 +144536,12 @@
  88.83.54.237
  88.84.131.90
  88.84.212.14
-88.84.222.252
  88.84.223.251
  88.85.174.199
  88.85.97.150
  88.86.125.50
  88.87.13.175
+88.87.164.26
  88.87.207.27
  88.87.6.154
  88.87.69.242
@@ -143841,10 +144579,9 @@
  88.99.115.156
  88.99.123.146
  88.99.125.6
-88.99.134.187
  88.99.134.46
-88.99.134.61
  88.99.139.98
+88.99.14.70
  88.99.149.100
  88.99.150.13
  88.99.167.175
@@ -143855,6 +144592,7 @@
  88.99.209.230
  88.99.209.94
  88.99.213.166
+88.99.231.246
  88.99.33.103
  88.99.35.171
  88.99.38.113
@@ -143880,7 +144618,6 @@
  8857954-dot-n-e-w-me-ss-age-po-rt-al.wl.r.appspot.com
  88632.tk
  887-365.net
-887445508153b9a44339d0e6fb09739c472-887445508153b9a44339d0.tk
  887sconline.com
  888238.com
  8883448.com
@@ -143920,14 +144657,10 @@
  89.106.101.247bin.sh
  89.106.199.150
  89.106.199.38
-89.106.233.206
  89.106.42.205
-89.107.197.118
-89.107.197.173
  89.108.111.39
  89.108.118.7
  89.108.119.5
-89.108.120.202
  89.108.126.228
  89.108.137.237
  89.108.154.123
@@ -144013,19 +144746,20 @@
  89.137.123.11
  89.137.246.181
  89.137.249.74
+89.14.155.166
+89.14.221.14
+89.14.26.204
  89.14.29.210
-89.141.126.47
  89.141.249.184
  89.141.45.88
  89.141.67.231
  89.142.132.223
-89.142.141.101
  89.142.193.82
  89.142.65.243
  89.142.8.166
  89.143.198.104
-89.143.72.1
  89.143.72.200
+89.143.74.107
  89.144.12.17
  89.144.14.54
  89.144.19.90
@@ -144046,14 +144780,11 @@
  89.144.25.97
  89.144.47.244
  89.144.47.246
-89.144.47.251
  89.144.47.28
  89.144.47.8
  89.146.86.236
  89.148.167.73
  89.148.167.94
-89.148.214.92
-89.148.242.86
  89.149.12.188
  89.149.235.45
  89.150.212.201
@@ -144089,7 +144820,6 @@
  89.163.211.40
  89.163.224.143
  89.163.224.187
-89.163.224.79
  89.163.225.112
  89.163.225.119
  89.163.227.159
@@ -144118,7 +144848,7 @@
  89.174.71.111
  89.175.138.78
  89.176.134.133
-89.178.193.135
+89.176.203.67
  89.178.211.144
  89.178.23.231
  89.179.125.71
@@ -144131,25 +144861,32 @@
  89.18.27.192
  89.181.208.61
  89.182.125.237
+89.183.118.111
  89.184.152.198
  89.184.74.45
+89.185.228.60
  89.185.231.103
  89.185.93.190
  89.186.0.158
  89.186.13.110
  89.186.13.84
+89.186.7.38
  89.186.81.169
  89.187.142.208
  89.187.143.31
  89.187.143.81
  89.187.168.132
  89.187.168.137
+89.187.168.139
  89.187.168.140
  89.187.168.145
  89.187.168.147
  89.187.168.163
  89.187.168.172
+89.187.168.173
+89.187.168.179
  89.187.168.84
+89.187.171.228
  89.187.174.198
  89.187.181.71
  89.187.195.18
@@ -144167,9 +144904,11 @@
  89.19.199.152
  89.19.20.202
  89.19.241.94
+89.19.50.107
  89.19.7.152
  89.190.120.116
  89.190.165.4
+89.190.19.162
  89.190.242.190
  89.191.228.127
  89.191.228.149
@@ -144181,20 +144920,19 @@
  89.191.229.244
  89.191.229.34
  89.191.229.40
-89.196.167.65
-89.197.152.53
  89.20.102.136
  89.20.102.139
  89.20.135.204
  89.20.47.191
  89.200.137.67
  89.200.182.10
+89.201.163.242
  89.201.192.124
  89.201.192.199
  89.201.194.36
  89.202.127.4
  89.203.13.6
-89.203.249.239
+89.203.143.235
  89.203.8.62
  89.204.223.205
  89.205.35.133
@@ -144202,20 +144940,22 @@
  89.205.83.49
  89.205.87.153
  89.206.46.164
+89.207.90.202
  89.207.92.107
  89.207.93.238
  89.208.122.114
  89.208.146.99
  89.208.255.98
-89.208.32.234
  89.208.35.79
  89.21.194.36
  89.21.209.174
  89.21.73.221
  89.21.77.158
  89.21.77.162
+89.21.77.72
  89.210.144.252
  89.210.185.78
+89.211.106.120
  89.211.223.6
  89.211.224.90
  89.211.225.142
@@ -144226,7 +144966,6 @@
  89.212.9.96
  89.215.166.127
  89.215.189.74
-89.215.33.252
  89.216.102.123
  89.216.104.9
  89.216.118.80
@@ -144234,30 +144973,17 @@
  89.216.29.79
  89.216.47.154
  89.216.59.110
-89.216.99.102
  89.216.99.251
  89.218.11.2
  89.218.118.22
-89.218.122.114
  89.218.133.170
-89.218.147.146
-89.218.167.226
  89.218.170.54
-89.218.174.126
  89.218.218.202
-89.218.240.106
-89.218.240.178
-89.218.243.78
-89.218.248.54
-89.218.32.187
  89.218.5.106
  89.218.5.108
  89.218.5.110
  89.218.72.51
-89.218.74.46
  89.218.75.211
-89.218.78.226
-89.218.79.173
  89.219.26.226
  89.22.103.213
  89.22.152.244
@@ -144286,7 +145012,6 @@
  89.229.151.58
  89.23.194.174
  89.23.196.60
-89.23.198.165
  89.23.230.189
  89.230.96.42
  89.231.248.86
@@ -144294,6 +145019,7 @@
  89.232.192.40
  89.232.195.16
  89.232.207.210
+89.232.220.82
  89.232.37.103
  89.233.183.64
  89.233.219.172
@@ -144301,7 +145027,8 @@
  89.233.219.46
  89.233.219.93
  89.234.148.50
-89.234.148.59
+89.234.148.54
+89.234.148.69
  89.234.157.254
  89.234.17.115
  89.234.17.116
@@ -144314,23 +145041,10 @@
  89.236.101.52
  89.236.112.100
  89.236.17.108
-89.236.199.143
-89.236.200.32
-89.236.204.82
-89.236.217.70
-89.236.219.102
  89.236.239.25
-89.236.241.223
-89.236.241.7
-89.236.250.135
+89.236.36.222
  89.237.113.144
  89.237.14.14
-89.237.192.183
-89.237.192.51
-89.237.193.0
-89.237.194.242
-89.237.194.64
-89.237.195.70
  89.237.32.129
  89.237.32.177
  89.237.32.193
@@ -144380,8 +145094,8 @@
  89.24.76.185
  89.240.0.182
  89.240.0.63
-89.244.123.209
-89.245.128.77
+89.244.125.34
+89.245.125.153
  89.245.80.165
  89.245.80.30
  89.245.83.181
@@ -144403,8 +145117,6 @@
  89.245.95.76
  89.246.116.113
  89.246.116.115
-89.246.125.214
-89.247.12.150
  89.248.111.164
  89.248.112.202
  89.248.160.132
@@ -144415,6 +145127,7 @@
  89.248.160.192
  89.248.160.215
  89.248.160.217
+89.248.160.221
  89.248.162.137
  89.248.162.146
  89.248.162.161
@@ -144485,6 +145198,7 @@
  89.248.171.165
  89.248.171.167
  89.248.171.176
+89.248.171.181
  89.248.171.2
  89.248.171.253
  89.248.171.32
@@ -144516,6 +145230,7 @@
  89.248.174.46
  89.248.243.200
  89.248.244.182
+89.249.203.13
  89.249.247.209
  89.249.247.216
  89.249.255.152
@@ -144526,7 +145241,6 @@
  89.250.149.114
  89.250.167.189
  89.250.19.173
-89.250.221.106
  89.250.5.58
  89.251.144.37
  89.251.147.97
@@ -144562,11 +145276,9 @@
  89.31.140.28
  89.31.46.208
  89.31.57.5
-89.32.100.136
  89.32.150.160
  89.32.153.221
  89.32.227.230
-89.32.249.21
  89.32.40.34
  89.32.41.180
  89.32.41.201
@@ -144626,19 +145338,17 @@
  89.35.178.104
  89.35.178.108
  89.35.210.205
-89.35.253.45
-89.35.253.5
  89.35.30.101
  89.35.30.114
-89.35.30.117
  89.35.30.124
  89.35.30.139
  89.35.30.158
  89.35.30.164
+89.35.30.2
  89.35.30.202
  89.35.30.242
  89.35.30.46
-89.35.31.46
+89.35.31.8
  89.35.39.115
  89.35.39.204
  89.35.39.60
@@ -144646,10 +145356,7 @@
  89.36.133.62
  89.36.160.112
  89.36.175.10
-89.36.184.51
-89.36.200.101
-89.36.200.119
-89.36.202.191
+89.36.195.238
  89.36.208.231
  89.36.212.129
  89.36.212.17
@@ -144664,9 +145371,7 @@
  89.37.122.216
  89.37.192.194
  89.37.193.44
-89.37.64.139
  89.37.64.220
-89.37.64.68
  89.38.11.16
  89.38.145.14
  89.38.150.129
@@ -144688,12 +145393,12 @@
  89.38.98.5
  89.39.105.103
  89.39.106.94
+89.39.107.191
  89.39.107.195
  89.39.108.202
  89.39.114.41
  89.39.126.228
  89.39.174.13
-89.40.110.146
  89.40.113.141
  89.40.113.161
  89.40.114.11
@@ -144701,15 +145406,11 @@
  89.40.115.180
  89.40.142.176
  89.40.150.239
-89.40.153.118
  89.40.217.40
  89.40.247.173
  89.40.48.186
  89.40.59.234
-89.40.61.82
-89.40.73.225
-89.40.73.231
-89.40.73.247
+89.40.73.234
  89.40.73.249
  89.40.82.236
  89.40.88.242
@@ -144726,7 +145427,6 @@
  89.42.212.219
  89.42.217.11
  89.42.31.48
-89.42.61.12
  89.43.202.10
  89.43.202.168
  89.43.202.44
@@ -144736,9 +145436,6 @@
  89.43.5.134
  89.43.60.117
  89.44.103.58
-89.44.205.112
-89.44.205.188
-89.44.205.239
  89.44.247.141
  89.44.247.232
  89.44.247.30
@@ -144752,7 +145449,6 @@
  89.45.67.99
  89.46.100.105
  89.46.100.144
-89.46.104.203
  89.46.105.182
  89.46.105.196
  89.46.105.197
@@ -144761,6 +145457,7 @@
  89.46.108.108
  89.46.108.165
  89.46.108.211
+89.46.109.193
  89.46.204.81
  89.46.235.111
  89.46.235.242
@@ -144771,26 +145468,25 @@
  89.47.160.115
  89.47.161.219
  89.47.28.165
-89.47.53.47
  89.56.148.84
-89.64.76.225
  89.65.244.169
  89.65.44.144
  89.66.173.101
+89.67.0.87
  89.68.130.136
  89.69.179.180
  89.7.152.241
+89.72.147.92
  89.72.176.33
  89.72.212.205
  89.73.123.32
  89.74.146.15
-89.76.142.70
-89.76.234.43
+89.76.26.95
  89.76.75.175
  89.77.225.154
+89.78.5.56
  89.79.48.213
  89.80.42.48
-89.89.5.129
  89.9.92.243
  89.92.88.237
  89.95.83.154
@@ -144900,23 +145596,26 @@
  9-29.com
  9-35.xyz
  90.0.0.247
+90.1.41.107
  90.103.251.143
  90.104.116.167
  90.104.241.224
-90.105.105.201
+90.109.157.142
  90.109.197.166
+90.109.200.158
  90.109.27.115
+90.112.16.217
  90.112.66.69
+90.113.129.30
  90.113.165.82
-90.118.177.139
  90.120.235.42
  90.125.101.211
  90.125.50.235
  90.126.42.245
  90.133.84.135
+90.134.210.113
  90.139.132.39
  90.139.167.215
-90.139.198.144
  90.139.228.25
  90.139.61.85
  90.139.92.15
@@ -144930,7 +145629,6 @@
  90.146.107.82
  90.146.153.21
  90.146.16.34
-90.146.183.140
  90.146.219.186
  90.15.234.16
  90.15.29.43
@@ -144942,12 +145640,13 @@
  90.150.198.22
  90.150.199.136
  90.150.199.149
-90.150.200.118
+90.150.199.52
  90.150.200.16
  90.150.200.172
  90.150.200.204
  90.150.200.219
  90.150.200.239
+90.150.201.1
  90.150.201.35
  90.150.202.201
  90.150.202.215
@@ -144982,6 +145681,7 @@
  90.168.34.174
  90.168.34.229
  90.170.20.2
+90.170.59.154
  90.171.35.83
  90.173.241.88
  90.173.248.78
@@ -145001,6 +145701,7 @@
  90.182.165.18
  90.182.36.30
  90.183.101.238
+90.183.152.12
  90.183.152.178
  90.183.158.50
  90.185.249.111
@@ -145011,12 +145712,10 @@
  90.188.184.43
  90.188.21.217
  90.188.236.43
-90.188.251.88
  90.188.253.58
  90.188.255.142
  90.188.35.190
  90.188.35.23
-90.188.39.102
  90.188.41.236
  90.188.91.30
  90.189.110.170
@@ -145025,8 +145724,8 @@
  90.189.172.54
  90.189.209.144
  90.190.63.236
-90.191.220.38
  90.192.134.205
+90.192.148.248
  90.193.160.62
  90.194.138.41
  90.196.138.176
@@ -145041,7 +145740,6 @@
  90.215.188.26
  90.216.16.184
  90.219.60.177
-90.220.202.133
  90.222.100.40
  90.222.3.118
  90.222.80.64
@@ -145061,12 +145759,12 @@
  90.227.130.6
  90.227.184.2
  90.229.170.191
+90.230.129.125
  90.230.21.243
  90.231.155.253
  90.231.156.76
  90.232.12.186
  90.232.125.167
-90.232.132.125
  90.232.162.129
  90.232.174.156
  90.232.184.41
@@ -145103,12 +145801,15 @@
  90.65.111.230
  90.65.96.67
  90.66.148.239
+90.69.228.55
  90.71.169.95
  90.71.38.63
+90.73.38.79
  90.73.53.33
  90.74.52.246
  90.75.209.16
  90.76.107.69
+90.8.253.128
  90.84.226.16
  90.84.233.193
  90.84.233.84
@@ -145151,14 +145852,11 @@
  91.102.224.50
  91.102.81.121
  91.102.82.239
-91.103.104.143
  91.103.110.54
  91.103.196.170
  91.103.248.23
  91.103.248.92
  91.103.25.74
-91.103.252.44
-91.103.252.45
  91.103.31.45
  91.105.13.35
  91.105.135.113
@@ -145176,21 +145874,17 @@
  91.106.188.229
  91.106.193.72
  91.106.199.101
-91.107.10.69
-91.107.5.216
  91.108.141.94
-91.108.145.180
  91.108.151.10
-91.108.151.203
  91.108.156.158
  91.108.178.222
  91.108.183.170
  91.109.13.108
-91.109.136.83
  91.109.15.52
  91.109.26.72
  91.109.3.188
  91.109.5.170
+91.11.84.35
  91.114.240.126
  91.115.214.39
  91.117.218.56
@@ -145220,6 +145914,7 @@
  91.121.133.13
  91.121.133.211
  91.121.134.201
+91.121.135.79
  91.121.14.107
  91.121.141.219
  91.121.142.210
@@ -145235,7 +145930,6 @@
  91.121.156.27
  91.121.159.201
  91.121.16.117
-91.121.161.108
  91.121.161.171
  91.121.162.189
  91.121.162.198
@@ -145337,9 +146031,11 @@
  91.122.61.161
  91.123.166.111
  91.123.166.87
+91.124.115.19
  91.124.160.226
  91.124.163.232
  91.124.214.44
+91.125.123.125
  91.125.212.60
  91.126.18.130
  91.126.200.53
@@ -145357,16 +146053,17 @@
  91.131.196.192
  91.131.197.155
  91.131.197.48
+91.132.138.242
  91.132.138.44
  91.132.138.54
  91.132.138.62
  91.132.147.168
  91.132.197.21
  91.132.197.43
-91.132.23.240
  91.134.13.250
  91.134.133.251
  91.134.135.95
+91.134.136.45
  91.134.138.46
  91.134.140.84
  91.134.142.57
@@ -145413,15 +146110,15 @@
  91.135.101.228
  91.135.193.146
  91.135.194.22
-91.135.196.31
  91.135.201.122
+91.135.242.186
  91.135.242.203
-91.135.251.150
  91.135.63.95
  91.136.48.27
  91.136.48.84
  91.137.127.123
  91.137.140.89
+91.137.189.62
  91.137.247.230
  91.137.251.31
  91.138.215.5
@@ -145467,6 +146164,7 @@
  91.15.77.108
  91.15.77.182
  91.15.79.196
+91.150.189.122
  91.150.77.57
  91.150.77.58
  91.151.104.212
@@ -145474,14 +146172,13 @@
  91.151.95.19
  91.152.120.228
  91.152.8.173
-91.153.149.104
  91.153.157.113
  91.153.59.49
  91.153.85.226
  91.155.2.97
  91.155.25.9
-91.158.173.210
  91.158.60.120
+91.159.184.223
  91.159.194.212
  91.16.29.240
  91.160.186.31
@@ -145495,10 +146192,8 @@
  91.169.100.84
  91.170.12.3
  91.170.40.64
-91.170.71.173
  91.172.62.9
  91.173.165.153
-91.174.162.196
  91.174.213.39
  91.174.80.149
  91.175.129.61
@@ -145506,17 +146201,22 @@
  91.175.141.132
  91.175.165.19
  91.175.181.196
+91.175.85.145
+91.176.197.19
  91.177.69.185
  91.18.245.176
  91.180.73.174
  91.181.235.31
+91.182.237.75
  91.183.215.121
  91.183.237.172
+91.183.34.205
  91.183.53.241
  91.184.52.3
  91.185.19.189
  91.185.190.207
  91.185.198.234
+91.185.2.53
  91.185.206.66
  91.185.209.150
  91.185.212.7
@@ -145545,9 +146245,7 @@
  91.188.117.157
  91.188.124.225
  91.188.124.232
-91.188.129.63
  91.188.229.129
-91.188.231.56
  91.188.244.204
  91.188.246.120
  91.188.246.134
@@ -145556,8 +146254,6 @@
  91.188.246.191
  91.188.246.214
  91.188.246.26
-91.188.246.51
-91.188.246.56
  91.188.246.85
  91.188.246.97
  91.188.247.110
@@ -145593,6 +146289,8 @@
  91.192.103.26
  91.192.103.33
  91.192.103.34
+91.192.103.42
+91.192.103.43
  91.192.103.6
  91.192.103.7
  91.192.103.8
@@ -145608,7 +146306,6 @@
  91.192.219.39
  91.192.24.202
  91.192.25.149
-91.193.100.150
  91.193.117.45
  91.193.125.3
  91.193.130.8
@@ -145617,6 +146314,7 @@
  91.193.252.112
  91.193.252.250
  91.193.253.129
+91.193.253.188
  91.193.253.248
  91.193.4.136
  91.194.190.135
@@ -145626,6 +146324,7 @@
  91.194.84.106
  91.194.84.124
  91.194.84.78
+91.194.90.203
  91.195.124.11
  91.195.124.9
  91.195.130.2
@@ -145634,12 +146333,12 @@
  91.195.157.4
  91.195.192.38
  91.195.254.46
+91.195.255.228
  91.196.100.35
  91.196.100.93
  91.196.132.166
  91.196.149.179
  91.196.150.45
-91.196.36.7
  91.196.50.33
  91.196.61.115
  91.196.70.11
@@ -145654,11 +146353,12 @@
  91.197.224.139
  91.197.44.133
  91.198.108.220
-91.198.164.24
  91.198.220.225
  91.199.118.137
+91.199.118.76
  91.199.3.100
  91.2.173.53
+91.200.101.47
  91.200.114.243
  91.200.12.58
  91.200.12.76
@@ -145668,7 +146368,6 @@
  91.200.13.64
  91.200.57.218
  91.201.168.130
-91.201.174.76
  91.201.177.210
  91.201.188.240
  91.201.240.101
@@ -145680,18 +146379,14 @@
  91.202.144.153
  91.202.145.97
  91.202.16.63
-91.202.18.2
-91.202.92.19
  91.203.114.112
  91.203.114.71
  91.203.136.162
  91.203.145.116
  91.203.146.126
  91.203.167.39
-91.203.173.211
-91.203.173.72
  91.203.174.191
-91.203.175.18
+91.203.176.204
  91.203.192.72
  91.203.208.174
  91.203.224.177
@@ -145713,8 +146408,9 @@
  91.204.149.5
  91.204.15.108
  91.204.15.135
+91.204.15.164
+91.204.15.213
  91.204.15.34
-91.204.15.82
  91.204.163.19
  91.204.199.73
  91.204.205.84
@@ -145733,6 +146429,7 @@
  91.205.168.44
  91.205.168.46
  91.205.168.62
+91.205.173.138
  91.205.173.54
  91.205.173.71
  91.205.173.83
@@ -145764,6 +146461,7 @@
  91.207.244.212
  91.207.5.102
  91.207.52.104
+91.207.61.175
  91.207.7.124
  91.208.184.110
  91.208.184.117
@@ -145782,7 +146480,6 @@
  91.209.84.237
  91.209.89.33
  91.21.187.55
-91.21.89.182
  91.210.102.199
  91.210.11.219
  91.210.136.202
@@ -145792,27 +146489,29 @@
  91.210.146.237
  91.210.147.131
  91.210.147.47
+91.210.159.30
+91.210.163.84
  91.210.170.162
  91.210.178.161
  91.210.224.123
  91.210.224.154
-91.210.224.21
+91.210.224.211
  91.210.237.71
  91.210.24.30
+91.210.249.111
  91.210.47.85
  91.211.105.92
  91.211.124.217
  91.211.146.202
  91.211.172.104
  91.211.195.27
+91.211.237.85
  91.211.248.35
  91.211.250.195
  91.211.250.208
  91.211.251.127
  91.211.251.22
-91.211.251.226
  91.211.251.42
-91.211.251.75
  91.211.251.76
  91.211.3.110
  91.211.3.111
@@ -145825,10 +146524,10 @@
  91.212.124.160
  91.212.127.100
  91.212.150.241
-91.213.100.68
  91.213.119.246
  91.213.197.15
  91.213.46.214
+91.213.50.119
  91.213.50.85
  91.214.114.7
  91.214.115.100
@@ -145869,6 +146568,7 @@
  91.217.109.246
  91.217.109.81
  91.217.112.251
+91.217.197.227
  91.217.202.174
  91.217.42.3
  91.217.61.14
@@ -145880,10 +146580,8 @@
  91.218.127.210
  91.218.160.153
  91.218.163.74
-91.218.170.252
  91.218.19.106
  91.218.195.187
-91.218.202.22
  91.218.47.161
  91.218.65.37
  91.218.86.194
@@ -145901,10 +146599,9 @@
  91.219.238.226
  91.219.238.234
  91.219.239.188
+91.219.248.16
  91.219.25.232
  91.219.253.115
-91.219.253.42
-91.219.4.151
  91.219.58.160
  91.219.88.121
  91.219.90.198
@@ -145922,13 +146619,13 @@
  91.222.128.59
  91.222.171.246
  91.222.196.82
-91.222.205.166
  91.222.223.240
  91.222.236.111
  91.222.236.19
  91.222.236.249
  91.222.239.144
  91.222.239.186
+91.222.239.237
  91.222.239.254
  91.223.136.228
  91.223.136.49
@@ -145936,7 +146633,6 @@
  91.223.212.208
  91.223.242.23
  91.223.68.29
-91.224.179.39
  91.224.205.62
  91.224.206.27
  91.224.97.119
@@ -145950,16 +146646,15 @@
  91.225.208.85
  91.225.208.87
  91.225.22.45
-91.225.226.39
-91.225.77.52
  91.226.116.217
  91.226.137.9
-91.226.141.253
+91.226.140.54
  91.226.192.8
  91.226.212.131
  91.226.212.218
  91.226.213.133
  91.226.253.160
+91.226.35.93
  91.226.45.66
  91.226.5.245
  91.226.72.252
@@ -145969,7 +146664,6 @@
  91.227.220.154
  91.227.28.154
  91.228.151.52
-91.228.34.36
  91.228.56.38
  91.228.8.162
  91.228.84.250
@@ -145977,7 +146671,6 @@
  91.228.85.197
  91.228.85.45
  91.228.86.166
-91.228.86.64
  91.228.87.159
  91.228.87.161
  91.228.87.180
@@ -145987,7 +146680,6 @@
  91.229.77.64
  91.229.78.76
  91.229.79.152
-91.23.158.154
  91.230.138.11
  91.230.146.73
  91.230.154.221
@@ -146003,13 +146695,12 @@
  91.231.179.65
  91.231.196.170
  91.231.213.51
-91.231.252.12
-91.231.59.236
  91.231.70.61
  91.231.97.115
  91.232.105.116
  91.232.105.180
  91.232.134.143
+91.232.157.29
  91.232.162.31
  91.232.162.77
  91.232.165.112
@@ -146027,7 +146718,6 @@
  91.233.43.33
  91.233.48.110
  91.234.104.98
-91.234.194.126
  91.234.195.199
  91.234.218.1
  91.234.255.20
@@ -146052,6 +146742,7 @@
  91.234.62.230
  91.234.62.233
  91.234.62.235
+91.234.62.236
  91.234.62.237
  91.234.62.238
  91.234.62.239
@@ -146072,9 +146763,7 @@
  91.235.143.183
  91.235.143.184
  91.235.143.197
-91.235.177.128
  91.235.178.161
-91.235.178.244
  91.235.186.212
  91.235.187.132
  91.235.189.247
@@ -146082,13 +146771,13 @@
  91.235.244.205
  91.235.247.154
  91.235.255.7
+91.235.69.191
  91.235.71.58
  91.236.114.83
  91.236.116.121
  91.236.116.89
  91.236.122.186
  91.236.122.202
-91.236.122.204
  91.236.122.62
  91.236.141.12
  91.236.142.69
@@ -146109,8 +146798,10 @@
  91.237.200.208
  91.237.201.237
  91.237.201.243
+91.237.202.196
  91.237.202.74
  91.237.203.133
+91.237.203.148
  91.237.203.181
  91.237.248.40
  91.237.61.15
@@ -146123,9 +146814,7 @@
  91.238.199.1
  91.238.223.41
  91.238.255.71
-91.238.29.6
  91.239.112.101
-91.239.136.166
  91.239.142.37
  91.239.158.22
  91.239.18.172
@@ -146137,13 +146826,14 @@
  91.240.125.80
  91.240.193.56
  91.240.209.105
-91.240.236.137
-91.240.41.244
+91.240.243.236
+91.240.243.242
+91.240.243.48
+91.240.243.93
  91.240.54.254
  91.240.63.129
  91.240.77.145
  91.240.77.172
-91.240.8.235
  91.240.84.192
  91.240.87.144
  91.240.97.69
@@ -146153,17 +146843,16 @@
  91.241.182.93
  91.241.19.223
  91.241.19.42
-91.241.19.60
-91.241.19.67
  91.241.194.245
  91.241.20.246
  91.242.136.103
  91.243.100.112
  91.243.101.25
  91.243.162.166
-91.243.167.173
  91.243.168.119
  91.243.175.249
+91.243.190.191
+91.243.190.61
  91.243.203.3
  91.243.80.144
  91.243.80.38
@@ -146175,8 +146864,8 @@
  91.243.90.162
  91.243.90.217
  91.243.90.252
-91.243.90.96
  91.243.91.130
+91.243.91.181
  91.243.91.213
  91.243.91.66
  91.243.91.67
@@ -146184,7 +146873,6 @@
  91.243.92.240
  91.243.92.242
  91.243.92.69
-91.243.92.81
  91.243.93.113
  91.243.93.197
  91.243.93.199
@@ -146205,10 +146893,9 @@
  91.244.78.50
  91.245.109.75
  91.245.114.33
-91.245.30.153
+91.245.30.100
  91.245.30.79
  91.245.85.130
-91.246.210.43
  91.246.213.100
  91.246.213.104
  91.246.74.202
@@ -146224,22 +146911,22 @@
  91.250.83.53
  91.3.126.183
  91.3.69.168
-91.3.75.230
-91.3.75.252
+91.3.77.111
  91.37.223.62
-91.42.117.235
  91.42.209.248
  91.44.225.23
  91.46.47.216
-91.5.122.131
  91.50.246.75
-91.51.236.188
+91.51.162.33
  91.63.17.107
  91.64.110.166
  91.64.117.92
  91.64.76.127
+91.65.164.134
+91.65.190.45
  91.65.70.241
-91.67.11.99
+91.67.148.206
+91.67.169.38
  91.67.240.32
  91.69.231.155
  91.72.171.138
@@ -146259,14 +146946,16 @@
  91.80.137.202
  91.80.140.9
  91.80.153.150
+91.80.31.132
  91.82.182.167
  91.82.40.118
  91.82.41.200
  91.82.42.2
  91.82.46.25
+91.82.47.132
+91.83.161.145
  91.83.163.95
  91.83.227.150
-91.83.227.76
  91.83.88.201
  91.83.88.53
  91.83.92.27
@@ -146277,25 +146966,22 @@
  91.86.83.129
  91.87.123.173
  91.87.153.218
+91.87.73.6
  91.9.194.40
  91.90.114.186
-91.90.121.102
  91.90.121.107
  91.90.122.133
  91.90.122.138
  91.90.123.20
-91.90.167.101
  91.90.190.194
  91.90.36.174
  91.90.39.182
  91.92.109.43
  91.92.115.210
-91.92.121.26
  91.92.144.166
  91.92.16.244
  91.92.186.2
  91.92.191.134
-91.92.205.96
  91.92.209.250
  91.92.213.148
  91.92.214.59
@@ -146312,12 +146998,12 @@
  91.93.170.220
  91.93.44.162
  91.93.48.9
+91.93.63.187
  91.93.64.64
  91.93.69.211
  91.93.73.148
  91.93.97.106
  91.98.108.189
-91.98.247.4
  91.98.26.62
  91.98.28.188
  91.98.32.223
@@ -146330,7 +147016,6 @@
  91.98.6.127
  91.98.64.222
  91.98.68.49
-91.98.88.193
  910-365.com
  91131994de4.xyz
  911718.net
@@ -146362,20 +147047,18 @@
  91ruitue.com
  92-help.com
  92.1.195.95
-92.10.217.28
  92.10.226.197
  92.100.102.252
-92.100.207.215
+92.101.146.182
+92.101.148.118
  92.101.61.80
  92.101.92.69
-92.101.94.81
  92.103.168.50
  92.104.111.206
-92.104.231.182
+92.104.40.51
  92.105.149.59
  92.105.167.160
  92.105.208.127
-92.105.22.126
  92.105.61.210
  92.106.102.227
  92.106.143.52
@@ -146384,13 +147067,11 @@
  92.107.154.228
  92.107.202.205
  92.107.206.243
-92.108.10.97
  92.108.241.58
  92.109.224.63
  92.110.58.125
  92.111.126.154
  92.111.156.14
-92.112.119.86
  92.112.18.209
  92.112.245.7
  92.113.199.114
@@ -146402,15 +147083,15 @@
  92.115.102.133
  92.115.134.57
  92.116.12.141
-92.116.137.213
  92.116.142.103
+92.116.171.229
  92.116.34.27
-92.116.6.249
+92.116.36.103
  92.117.121.24
  92.117.132.147
+92.117.134.72
  92.117.144.50
-92.117.156.196
-92.117.242.81
+92.117.158.99
  92.118.149.91
  92.118.160.1
  92.118.160.13
@@ -146450,15 +147131,17 @@
  92.118.208.196
  92.118.208.218
  92.118.208.63
-92.118.209.170
-92.118.209.44
  92.118.211.109
+92.118.211.115
  92.118.211.161
  92.118.211.192
+92.118.211.20
  92.118.211.220
  92.118.211.241
+92.118.211.246
  92.118.211.25
  92.118.211.44
+92.118.211.72
  92.118.27.122
  92.118.27.173
  92.118.52.58
@@ -146478,77 +147161,62 @@
  92.124.162.48
  92.124.198.170
  92.127.195.74
+92.127.237.101
  92.130.196.17
  92.131.208.136
+92.131.94.31
  92.133.135.24
  92.139.239.207
+92.142.151.227
  92.15.224.201
  92.150.9.141
  92.151.79.102
+92.152.106.155
  92.154.54.87
  92.154.95.236
  92.157.66.51
  92.158.58.140
-92.16.41.115
  92.169.84.253
  92.170.221.168
  92.18.60.183
-92.184.102.102
-92.184.102.123
  92.184.102.125
-92.184.102.132
  92.184.102.178
+92.184.102.179
  92.184.102.189
-92.184.102.20
+92.184.102.223
  92.184.102.23
+92.184.102.31
  92.184.102.33
  92.184.102.94
+92.184.104.117
  92.184.104.168
-92.184.104.188
  92.184.104.225
-92.184.104.241
-92.184.104.66
+92.184.104.74
  92.184.105.117
  92.184.105.162
  92.184.107.70
-92.184.108.159
  92.184.108.202
-92.184.108.207
-92.184.108.60
-92.184.108.64
-92.184.108.70
  92.184.108.82
-92.184.108.87
-92.184.110.1
+92.184.110.247
  92.184.112.103
  92.184.112.11
  92.184.112.110
-92.184.112.114
-92.184.112.121
-92.184.112.124
  92.184.112.131
  92.184.112.136
  92.184.112.146
  92.184.112.149
  92.184.112.164
  92.184.112.174
-92.184.112.177
  92.184.112.182
-92.184.112.193
  92.184.112.2
  92.184.112.207
  92.184.112.208
  92.184.112.214
  92.184.112.218
-92.184.112.22
-92.184.112.221
-92.184.112.222
  92.184.112.235
-92.184.112.239
  92.184.112.247
  92.184.112.249
  92.184.112.252
-92.184.112.30
  92.184.112.37
  92.184.112.41
  92.184.112.47
@@ -146556,37 +147224,42 @@
  92.184.112.54
  92.184.112.61
  92.184.112.80
-92.184.112.88
-92.184.112.94
+92.184.112.96
  92.184.116.155
+92.184.116.205
  92.184.116.237
-92.184.117.112
+92.184.117.123
+92.184.124.105
  92.184.124.109
-92.184.124.139
+92.184.124.115
  92.184.124.172
  92.184.124.178
  92.184.124.202
  92.184.124.212
-92.184.124.232
-92.184.124.242
+92.184.124.225
+92.184.124.240
  92.184.124.253
-92.184.97.105
+92.184.124.75
+92.184.98.145
  92.184.98.168
+92.185.96.97
+92.186.241.141
  92.187.228.47
  92.189.247.153
  92.19.2.42
  92.19.213.191
  92.19.225.29
+92.19.243.84
  92.190.153.246
  92.190.177.39
  92.190.182.62
+92.192.79.82
  92.192.89.114
-92.192.91.213
  92.193.180.138
-92.194.106.22
  92.194.40.50
-92.195.14.220
-92.196.173.201
+92.194.96.226
+92.195.32.138
+92.195.85.167
  92.2.81.153
  92.20.12.134
  92.20.224.214
@@ -146594,6 +147267,7 @@
  92.20.74.204
  92.20.8.10
  92.20.86.49
+92.200.104.171
  92.204.128.148
  92.204.160.150
  92.204.163.231
@@ -146602,7 +147276,6 @@
  92.204.164.90
  92.204.173.137
  92.207.253.226
-92.207.253.238
  92.208.113.163
  92.208.118.105
  92.208.118.13
@@ -146616,18 +147289,17 @@
  92.208.204.145
  92.208.207.192
  92.209.102.107
-92.209.103.124
  92.211.91.16
  92.215.120.152
-92.217.57.13
+92.217.73.104
  92.217.85.135
  92.219.151.94
  92.219.48.156
+92.219.94.75
  92.22.81.200
+92.220.10.100
  92.220.112.251
-92.220.142.145
  92.220.163.15
-92.220.203.40
  92.221.166.189
  92.221.40.80
  92.221.47.171
@@ -146649,6 +147321,7 @@
  92.222.208.174
  92.222.209.223
  92.222.211.47
+92.222.217.167
  92.222.221.49
  92.222.28.243
  92.222.41.125
@@ -146681,10 +147354,10 @@
  92.231.44.2
  92.232.198.59
  92.232.57.107
+92.233.111.233
  92.233.171.64
  92.236.71.145
  92.237.16.142
-92.237.198.149
  92.237.20.100
  92.237.218.114
  92.237.242.79
@@ -146693,6 +147366,7 @@
  92.238.234.158
  92.24.114.144
  92.24.51.238
+92.240.137.14
  92.240.238.35
  92.240.45.245
  92.240.48.85
@@ -146715,9 +147389,7 @@
  92.242.100.131
  92.242.126.154
  92.242.207.18
-92.242.220.91
  92.242.220.93
-92.242.234.19
  92.242.235.132
  92.242.240.34
  92.242.243.164
@@ -146731,16 +147403,11 @@
  92.243.15.162
  92.243.21.182
  92.243.84.187
-92.244.246.184
-92.244.246.190
  92.244.36.73
  92.244.99.229
  92.245.170.180
  92.245.175.165
-92.245.6.160
-92.246.140.238
  92.246.187.253
-92.246.20.200
  92.246.22.214
  92.246.76.243
  92.246.84.133
@@ -146751,7 +147418,6 @@
  92.247.125.161
  92.247.125.169
  92.247.125.177
-92.247.125.185
  92.247.125.186
  92.247.125.205
  92.247.125.213
@@ -146793,6 +147459,7 @@
  92.248.45.242
  92.249.122.108
  92.249.128.115
+92.249.135.165
  92.249.138.39
  92.249.143.44
  92.249.149.189
@@ -146800,6 +147467,7 @@
  92.249.216.113
  92.249.219.47
  92.25.148.33
+92.25.194.96
  92.251.11.134
  92.251.115.56
  92.251.32.25
@@ -146820,6 +147488,7 @@
  92.253.239.112
  92.253.250.71
  92.253.37.70
+92.253.60.166
  92.253.62.30
  92.253.69.221
  92.253.73.241
@@ -146829,6 +147498,7 @@
  92.254.236.240
  92.255.128.229
  92.255.164.166
+92.255.166.11
  92.255.170.159
  92.255.170.66
  92.255.174.56
@@ -146850,6 +147520,7 @@
  92.255.92.178
  92.27.142.29
  92.27.196.33
+92.27.205.3
  92.27.215.166
  92.27.221.109
  92.27.5.169
@@ -146867,19 +147538,16 @@
  92.34.167.214
  92.34.184.225
  92.34.201.242
-92.34.253.71
  92.35.108.183
  92.35.235.164
  92.35.4.23
  92.35.71.42
-92.38.136.69
  92.38.163.44
  92.38.225.177
  92.38.226.16
  92.38.45.250
  92.38.45.253
  92.38.45.68
-92.38.77.144
  92.39.111.230
  92.39.130.130
  92.39.247.20
@@ -146904,54 +147572,16 @@
  92.45.19.5
  92.45.195.90
  92.45.196.143
-92.46.100.39
+92.45.41.123
  92.46.121.26
  92.46.127.238
-92.46.178.164
-92.46.178.64
-92.46.185.82
-92.46.185.86
-92.46.193.50
-92.46.2.131
  92.46.215.82
-92.46.228.134
-92.46.248.6
-92.46.25.240
-92.46.255.106
-92.46.255.86
-92.46.27.73
-92.46.66.83
-92.46.71.82
  92.46.80.94
-92.46.83.31
  92.46.86.48
-92.46.90.254
-92.47.112.196
-92.47.119.107
-92.47.141.238
-92.47.147.182
-92.47.149.66
-92.47.164.251
-92.47.167.84
-92.47.174.115
-92.47.210.121
-92.47.218.12
-92.47.223.128
-92.47.240.5
-92.47.241.164
-92.47.242.38
-92.47.248.235
-92.47.32.250
-92.47.32.38
-92.47.37.223
  92.47.62.134
  92.47.68.103
-92.47.78.136
-92.47.91.43
-92.47.92.44
  92.47.92.46
  92.48.124.21
-92.49.142.216
  92.49.143.65
  92.49.214.237
  92.50.133.238
@@ -146970,7 +147600,7 @@
  92.52.149.100
  92.52.186.123
  92.52.204.23
-92.52.23.232
+92.52.216.210
  92.53.103.158
  92.53.111.240
  92.53.119.193
@@ -146985,10 +147615,6 @@
  92.54.237.74
  92.55.103.182
  92.55.121.197
-92.55.160.245
-92.55.175.242
-92.55.188.20
-92.55.188.231
  92.55.22.162
  92.55.66.133
  92.55.66.94
@@ -147003,15 +147629,12 @@
  92.61.102.252
  92.61.114.103
  92.61.191.119
-92.62.112.130
  92.62.131.106
  92.62.139.103
  92.62.196.66
  92.62.73.73
-92.63.103.123
  92.63.104.84
  92.63.111.201
-92.63.141.180
  92.63.192.231
  92.63.192.96
  92.63.196.13
@@ -147048,6 +147671,7 @@
  92.68.176.97
  92.70.192.85
  92.70.243.58
+92.72.168.72
  92.74.195.155
  92.76.167.124
  92.79.100.106
@@ -147057,6 +147681,7 @@
  92.8.85.159
  92.80.110.47
  92.80.217.82
+92.80.251.245
  92.81.117.206
  92.81.119.26
  92.81.19.48
@@ -147099,7 +147724,6 @@
  92.96.171.112
  92.96.172.185
  92.96.31.150
-92.97.104.137
  92.98.243.43
  92.98.7.153
  92.98.80.121
@@ -147132,7 +147756,6 @@
  92ld0-fund.online
  93.0.93.222
  93.100.132.97
-93.100.151.99
  93.103.110.6
  93.103.12.167
  93.103.12.195
@@ -147145,6 +147768,7 @@
  93.104.210.119
  93.104.210.230
  93.104.210.29
+93.104.211.31
  93.104.213.162
  93.104.213.231
  93.105.155.169
@@ -147153,8 +147777,6 @@
  93.107.43.251
  93.108.242.140
  93.11.126.83
-93.110.152.96
-93.110.162.138
  93.113.110.87
  93.113.111.100
  93.113.111.193
@@ -147192,9 +147814,11 @@
  93.115.26.186
  93.115.27.70
  93.115.27.73
+93.115.28.13
  93.115.28.92
  93.115.29.28
  93.115.29.78
+93.115.41.17
  93.115.86.246
  93.115.86.9
  93.115.92.169
@@ -147206,7 +147830,6 @@
  93.116.234.240
  93.116.247.221
  93.116.57.4
-93.117.112.124
  93.117.174.151
  93.117.72.27
  93.118.102.208
@@ -147218,6 +147841,7 @@
  93.118.98.56
  93.119.106.179
  93.119.123.233
+93.119.139.135
  93.119.161.92
  93.119.164.33
  93.119.181.146
@@ -147234,7 +147858,6 @@
  93.122.233.221
  93.122.239.141
  93.123.125.83
-93.123.16.172
  93.123.180.164
  93.123.225.151
  93.123.41.29
@@ -147267,9 +147890,8 @@
  93.126.98.242
  93.127.145.162
  93.127.145.40
-93.132.98.46
  93.133.155.19
-93.136.123.101
+93.136.12.251
  93.139.128.141
  93.139.171.171
  93.139.173.80
@@ -147280,12 +147902,10 @@
  93.142.201.222
  93.142.206.154
  93.142.212.0
-93.142.228.31
  93.142.24.64
  93.142.240.146
  93.142.245.124
  93.142.246.165
-93.143.53.167
  93.144.114.249
  93.144.122.236
  93.144.160.252
@@ -147315,8 +147935,8 @@
  93.149.158.158
  93.149.208.70
  93.149.227.16
-93.149.228.30
  93.149.233.109
+93.149.237.169
  93.15.13.198
  93.15.159.159
  93.15.41.61
@@ -147328,7 +147948,6 @@
  93.151.171.129
  93.151.220.213
  93.152.139.99
-93.152.140.51
  93.152.158.132
  93.153.38.250
  93.153.95.186
@@ -147339,7 +147958,6 @@
  93.156.71.240
  93.157.153.134
  93.157.163.66
-93.157.176.159
  93.157.193.18
  93.157.62.102
  93.157.62.58
@@ -147353,18 +147971,15 @@
  93.158.85.35
  93.159.141.166
  93.159.158.85
-93.159.184.226
  93.159.190.107
-93.159.215.240
  93.159.221.58
-93.160.187.106
-93.163.176.183
+93.159.80.181
+93.16.99.97
  93.163.52.152
  93.168.110.75
  93.170.103.109
  93.170.113.159
  93.170.119.71
-93.170.124.251
  93.170.129.150
  93.170.13.7
  93.170.138.139
@@ -147386,6 +148001,7 @@
  93.173.220.138
  93.174.0.17
  93.174.0.38
+93.174.123.235
  93.174.163.252
  93.174.88.123
  93.174.88.31
@@ -147395,6 +148011,7 @@
  93.174.89.52
  93.174.89.55
  93.174.89.56
+93.174.91.187
  93.174.93.119
  93.174.93.12
  93.174.93.123
@@ -147435,6 +148052,7 @@
  93.174.95.81
  93.175.203.124
  93.175.214.107
+93.175.234.1
  93.176.146.185
  93.176.152.43
  93.176.180.144
@@ -147450,8 +148068,7 @@
  93.177.117.194
  93.177.117.251
  93.177.117.76
-93.177.119.151
-93.177.119.28
+93.177.118.144
  93.177.119.97
  93.177.82.226
  93.178.15.63
@@ -147488,8 +148105,8 @@
  93.185.254.8
  93.185.4.90
  93.185.65.183
-93.185.65.187
-93.185.79.90
+93.185.96.61
+93.185.96.62
  93.186.104.20
  93.186.148.33
  93.186.152.94
@@ -147504,6 +148121,8 @@
  93.188.166.222
  93.188.224.253
  93.188.36.60
+93.188.36.81
+93.189.145.169
  93.189.221.253
  93.189.29.75
  93.189.30.194
@@ -147525,29 +148144,27 @@
  93.190.206.3
  93.190.21.90
  93.190.41.97
-93.190.46.26
  93.190.58.4
  93.191.114.183
  93.191.156.102
-93.191.156.20
  93.192.85.39
  93.194.51.143
  93.196.103.122
  93.197.32.105
  93.2.210.101
-93.201.124.93
  93.201.236.52
+93.202.136.80
  93.203.35.140
-93.209.182.113
  93.209.185.17
  93.21.101.4
  93.21.224.154
  93.210.12.166
  93.210.21.171
-93.210.26.55
+93.210.6.237
  93.214.122.25
  93.219.113.201
  93.22.37.164
+93.221.47.106
  93.222.192.185
  93.222.201.124
  93.222.218.113
@@ -147562,22 +148179,21 @@
  93.237.36.171
  93.241.228.102
  93.242.218.76
+93.243.173.82
  93.245.136.220
-93.245.233.164
  93.25.118.228
+93.254.95.42
  93.27.205.105
  93.27.52.58
  93.29.43.226
  93.31.12.115
  93.33.192.204
-93.34.12.15
  93.35.186.155
  93.35.225.23
  93.36.189.210
  93.36.241.59
  93.37.242.10
  93.37.244.82
-93.37.80.90
  93.38.127.179
  93.39.184.17
  93.39.195.174
@@ -147605,13 +148221,11 @@
  93.42.79.64
  93.43.193.42
  93.43.22.148
-93.43.223.61
  93.43.231.1
  93.43.35.161
  93.44.88.255
  93.46.101.20
  93.46.167.60
-93.46.193.98
  93.46.218.89
  93.46.34.242
  93.46.54.4
@@ -147622,7 +148236,6 @@
  93.47.192.170
  93.47.195.161
  93.48.254.226
-93.48.255.233
  93.48.88.51
  93.49.164.197
  93.49.247.215
@@ -147639,22 +148252,18 @@
  93.51.29.92
  93.51.49.210
  93.54.121.112
-93.55.137.209
  93.55.210.172
  93.55.211.209
  93.55.241.214
  93.55.242.131
  93.56.109.163
-93.56.206.214
  93.56.220.4
  93.56.87.123
  93.57.249.8
  93.57.30.14
  93.57.37.230
-93.57.71.66
  93.57.81.162
  93.6.25.187
-93.61.108.20
  93.61.137.226
  93.61.76.73
  93.63.167.100
@@ -147680,7 +148289,6 @@
  93.71.33.192
  93.71.9.21
  93.72.114.171
-93.72.149.200
  93.72.159.251
  93.72.245.221
  93.74.111.222
@@ -147706,7 +148314,6 @@
  93.78.207.116
  93.78.26.163
  93.79.102.19
-93.79.132.245
  93.79.240.150
  93.8.151.167
  93.8.87.97
@@ -147733,6 +148340,8 @@
  93.87.125.221
  93.87.17.1
  93.87.28.158
+93.87.48.159
+93.87.48.200
  93.87.75.118
  93.87.92.126
  93.88.107.125
@@ -147765,10 +148374,10 @@
  93.92.131.194
  93.92.205.180
  93.93.110.250
+93.93.35.100
  93.93.46.180
  93.93.71.228
  93.94.217.167
-93.94.241.205
  93.94.89.46
  93.94.91.107
  93.95.100.163
@@ -147778,13 +148387,12 @@
  93.95.217.45
  93.95.226.147
  93.95.240.245
-93.95.246.186
  93.95.88.13
  93.96.91.67
  93.97.219.82
-93.99.134.116
-93.99.146.122
+93.99.133.33
  93.99.176.84
+93.99.192.163
  93.99.53.201
  93.99.6.158
  93020300-dot-sydneyma.appspot.com
@@ -147857,8 +148465,10 @@
  94.102.5.32
  94.102.50.137
  94.102.50.138
+94.102.50.139
  94.102.50.155
  94.102.50.163
+94.102.50.169
  94.102.50.178
  94.102.50.182
  94.102.50.56
@@ -147908,6 +148518,7 @@
  94.102.63.245
  94.102.63.50
  94.102.63.52
+94.102.63.63
  94.102.63.71
  94.102.63.74
  94.102.63.94
@@ -147915,6 +148526,8 @@
  94.103.120.173
  94.103.122.210
  94.103.175.86
+94.103.80.42
+94.106.214.115
  94.112.121.49
  94.112.132.191
  94.112.224.11
@@ -147924,7 +148537,6 @@
  94.114.70.23
  94.12.31.76
  94.121.14.175
-94.123.67.161
  94.124.193.242
  94.124.193.245
  94.124.6.181
@@ -147939,6 +148551,7 @@
  94.127.223.181
  94.127.68.158
  94.129.83.178
+94.130.1.12
  94.130.10.158
  94.130.10.251
  94.130.105.174
@@ -147946,9 +148559,9 @@
  94.130.109.210
  94.130.11.6
  94.130.111.22
+94.130.124.14
  94.130.131.239
  94.130.142.54
-94.130.143.151
  94.130.149.49
  94.130.149.97
  94.130.162.107
@@ -147960,11 +148573,13 @@
  94.130.180.55
  94.130.20.181
  94.130.220.87
+94.130.34.225
  94.130.35.227
  94.130.64.182
  94.130.69.46
  94.130.71.31
  94.130.72.201
+94.130.73.18
  94.130.73.22
  94.130.75.8
  94.130.84.44
@@ -147974,7 +148589,9 @@
  94.131.14.19
  94.131.219.88
  94.132.33.140
-94.134.172.46
+94.133.29.154
+94.134.2.13
+94.134.250.165
  94.134.40.141
  94.136.138.142
  94.136.154.49
@@ -148042,21 +148659,7 @@
  94.141.142.143
  94.141.20.80
  94.141.233.66
-94.141.235.3
-94.141.236.238
-94.141.237.38
-94.141.241.138
-94.141.249.234
-94.141.250.86
  94.141.61.96
-94.141.71.52
-94.141.77.182
-94.141.81.193
-94.141.83.253
-94.141.84.12
-94.141.88.221
-94.141.91.24
-94.141.91.71
  94.142.130.61
  94.142.235.140
  94.142.241.194
@@ -148065,22 +148668,17 @@
  94.142.245.123
  94.142.245.124
  94.143.197.129
-94.143.197.153
-94.143.197.156
  94.143.198.130
  94.143.198.19
-94.143.198.84
  94.143.43.230
  94.143.65.234
  94.143.83.203
  94.153.144.58
  94.153.157.18
  94.153.169.22
-94.153.198.62
  94.153.224.194
  94.153.224.202
  94.153.227.14
-94.154.106.27
  94.154.152.238
  94.154.159.157
  94.154.159.96
@@ -148091,11 +148689,8 @@
  94.154.84.150
  94.154.96.130
  94.155.115.161
-94.155.252.45
  94.155.33.133
  94.155.33.139
-94.155.33.146
-94.155.33.148
  94.155.33.184
  94.155.33.190
  94.155.33.191
@@ -148114,17 +148709,16 @@
  94.155.33.75
  94.155.33.76
  94.155.33.77
-94.155.33.79
  94.155.33.80
  94.155.33.81
  94.155.33.82
  94.155.33.83
  94.155.33.84
  94.155.33.85
+94.155.33.86
  94.155.33.87
  94.155.79.172
  94.155.81.11
-94.156.119.230
  94.156.128.114
  94.156.128.69
  94.156.128.72
@@ -148144,8 +148738,9 @@
  94.157.141.238
  94.158.152.248
  94.158.152.54
-94.158.165.19
+94.158.190.69
  94.158.245.114
+94.158.245.143
  94.158.245.15
  94.158.246.234
  94.158.36.183
@@ -148157,6 +148752,7 @@
  94.16.120.18
  94.16.121.91
  94.16.159.144
+94.16.35.100
  94.162.117.161
  94.168.53.50
  94.174.64.12
@@ -148172,6 +148768,7 @@
  94.177.170.102
  94.177.171.51
  94.177.171.73
+94.177.176.116
  94.177.183.28
  94.177.185.117
  94.177.189.119
@@ -148195,11 +148792,11 @@
  94.178.175.201
  94.179.250.196
  94.18.231.202
+94.180.106.94
  94.180.223.10
  94.180.24.11
  94.180.24.123
  94.180.24.133
-94.180.24.154
  94.180.24.161
  94.180.24.162
  94.180.24.174
@@ -148207,22 +148804,18 @@
  94.180.24.36
  94.180.24.4
  94.180.24.43
-94.180.24.46
  94.180.24.5
  94.180.24.55
  94.180.24.59
  94.180.24.62
  94.180.24.71
  94.180.24.91
-94.180.245.19
  94.180.245.221
  94.180.246.38
-94.180.247.20
  94.180.249.187
  94.180.25.105
  94.180.25.117
  94.180.25.128
-94.180.25.146
  94.180.25.163
  94.180.25.165
  94.180.25.170
@@ -148235,9 +148828,8 @@
  94.180.25.236
  94.180.25.242
  94.180.25.255
-94.180.25.31
+94.180.25.29
  94.180.25.33
-94.180.25.39
  94.180.25.45
  94.180.25.53
  94.180.25.56
@@ -148245,10 +148837,8 @@
  94.180.25.67
  94.180.25.69
  94.180.25.70
-94.180.25.79
  94.180.25.86
  94.180.253.213
-94.180.28.0
  94.180.28.10
  94.180.28.102
  94.180.28.103
@@ -148303,7 +148893,6 @@
  94.180.28.89
  94.180.28.95
  94.180.57.15
-94.181.168.150
  94.181.174.45
  94.181.33.149
  94.182.196.110
@@ -148313,14 +148902,11 @@
  94.182.227.191
  94.182.25.74
  94.183.131.154
-94.183.149.101
  94.183.154.240
-94.183.161.231
  94.183.187.127
  94.183.225.101
  94.183.231.81
  94.183.242.169
-94.183.33.254
  94.183.40.126
  94.183.71.214
  94.183.87.121
@@ -148328,6 +148914,7 @@
  94.185.83.100
  94.185.85.45
  94.187.148.21
+94.187.3.105
  94.188.28.106
  94.188.39.158
  94.189.132.47
@@ -148340,11 +148927,9 @@
  94.19.7.55
  94.19.73.106
  94.190.177.213
-94.190.187.9
  94.190.35.174
  94.190.55.103
  94.190.76.239
-94.190.79.45
  94.191.100.11
  94.191.107.157
  94.191.107.25
@@ -148366,6 +148951,7 @@
  94.192.225.46
  94.192.31.180
  94.193.114.99
+94.193.221.38
  94.194.234.179
  94.195.103.151
  94.195.75.209
@@ -148388,18 +148974,13 @@
  94.199.178.17
  94.199.178.233
  94.199.181.248
-94.199.19.159
  94.199.198.137
  94.199.96.5
  94.2.133.202
  94.20.200.122
  94.20.21.251
  94.20.21.37
-94.20.233.140
-94.20.233.190
  94.20.64.42
-94.20.66.213
-94.20.97.66
  94.200.114.161
  94.200.114.162
  94.200.126.42
@@ -148416,10 +148997,11 @@
  94.205.247.10
  94.208.111.187
  94.208.223.141
+94.208.246.103
  94.208.56.204
  94.209.17.157
  94.21.118.140
-94.21.153.248
+94.21.139.151
  94.21.155.191
  94.21.155.91
  94.21.177.228
@@ -148429,13 +149011,14 @@
  94.212.219.138
  94.212.31.69
  94.213.107.137
-94.216.79.239
+94.216.90.48
  94.217.126.231
  94.217.218.84
+94.218.207.136
  94.218.22.216
  94.22.47.242
+94.222.139.222
  94.224.100.185
-94.224.94.14
  94.227.227.186
  94.227.40.54
  94.227.78.248
@@ -148445,14 +149028,13 @@
  94.228.180.218
  94.228.198.44
  94.228.2.33
-94.228.203.179
  94.228.203.84
  94.228.214.5
  94.228.215.83
+94.228.224.144
  94.228.4.249
  94.228.57.80
  94.228.57.82
-94.228.85.166
  94.229.100.202
  94.229.161.60
  94.23.1.8
@@ -148460,14 +149042,11 @@
  94.23.12.182
  94.23.12.38
  94.23.13.27
-94.23.154.171
  94.23.16.30
  94.23.160.207
  94.23.164.255
-94.23.176.17
  94.23.179.193
  94.23.179.199
-94.23.183.161
  94.23.19.147
  94.23.195.186
  94.23.196.68
@@ -148496,6 +149075,7 @@
  94.23.4.47
  94.23.44.120
  94.23.5.135
+94.23.51.183
  94.23.62.116
  94.23.69.61
  94.23.70.195
@@ -148524,10 +149104,9 @@
  94.231.184.47
  94.231.191.188
  94.231.216.134
-94.231.216.166
+94.231.216.195
  94.231.216.207
  94.231.216.235
-94.231.216.27
  94.231.216.46
  94.231.80.100
  94.232.11.178
@@ -148536,7 +149115,6 @@
  94.232.200.144
  94.232.40.112
  94.232.40.35
-94.232.42.169
  94.232.42.179
  94.232.44.38
  94.232.44.52
@@ -148545,12 +149123,10 @@
  94.232.46.20
  94.232.46.50
  94.233.41.190
-94.233.72.208
  94.236.131.14
  94.236.138.169
  94.236.143.239
  94.236.182.92
-94.236.200.175
  94.236.210.132
  94.236.226.209
  94.236.23.242
@@ -148567,22 +149143,8 @@
  94.240.38.170
  94.241.162.229
  94.241.170.207
-94.242.171.129
-94.242.171.145
  94.242.171.154
  94.242.171.161
-94.242.171.172
-94.242.171.20
-94.242.171.206
-94.242.171.217
-94.242.171.220
-94.242.171.230
-94.242.171.29
-94.242.171.44
-94.242.171.46
-94.242.171.7
-94.242.171.8
-94.242.171.84
  94.242.206.227
  94.242.206.75
  94.242.213.9
@@ -148597,7 +149159,6 @@
  94.242.57.57
  94.242.62.18
  94.242.62.38
-94.242.62.50
  94.243.140.162
  94.243.219.122
  94.243.239.74
@@ -148606,7 +149167,6 @@
  94.243.26.245
  94.243.26.60
  94.244.107.41
-94.244.134.107
  94.244.157.176
  94.244.97.244
  94.245.131.55
@@ -148625,7 +149185,6 @@
  94.249.7.167
  94.249.93.186
  94.25.104.250
-94.25.166.75
  94.25.228.74
  94.25.229.114
  94.25.63.138
@@ -148633,17 +149192,15 @@
  94.250.248.75
  94.250.249.120
  94.250.249.16
-94.250.249.211
  94.250.254.147
  94.250.82.185
-94.251.27.179
+94.251.55.17
  94.253.101.192
  94.253.15.25
  94.253.237.25
  94.253.3.208
  94.253.98.86
  94.254.0.172
-94.254.19.97
  94.254.2.71
  94.254.20.55
  94.254.60.101
@@ -148655,7 +149212,6 @@
  94.255.197.33
  94.255.198.144
  94.255.199.62
-94.255.206.196
  94.255.207.167
  94.255.207.174
  94.255.244.80
@@ -148667,26 +149223,24 @@
  94.255.247.223
  94.255.247.4
  94.26.142.10
-94.26.192.38
  94.26.197.155
-94.26.203.27
-94.26.204.42
+94.26.223.163
  94.26.90.14
-94.26.90.240
  94.26.90.87
  94.27.232.62
  94.27.254.165
  94.28.123.145
  94.28.31.99
  94.29.72.109
-94.30.115.21
  94.30.152.164
  94.30.242.237
+94.30.97.245
  94.31.101.43
  94.31.53.203
  94.32.66.15
  94.32.66.48
  94.34.176.227
+94.34.204.114
  94.34.205.225
  94.34.224.165
  94.40.127.166
@@ -148713,7 +149267,6 @@
  94.46.3.139
  94.49.68.138
  94.49.70.12
-94.50.161.49
  94.50.162.191
  94.50.179.67
  94.50.180.75
@@ -148730,19 +149283,20 @@
  94.53.213.121
  94.53.71.214
  94.53.83.30
-94.55.160.237
+94.54.1.3
  94.57.252.147
  94.6.196.227
  94.60.136.242
  94.60.231.90
  94.60.98.142
  94.62.201.87
-94.63.206.217
+94.63.214.96
  94.64.126.144
  94.64.142.237
  94.64.76.114
  94.64.82.153
  94.65.115.79
+94.65.181.131
  94.65.181.60
  94.65.34.134
  94.65.53.41
@@ -148750,13 +149304,14 @@
  94.65.58.206
  94.65.63.250
  94.66.104.190
+94.66.193.211
  94.66.23.132
-94.66.59.207
  94.66.80.57
  94.66.86.78
  94.67.106.234
  94.67.2.87
  94.67.207.203
+94.67.238.145
  94.67.249.70
  94.67.89.197
  94.67.92.138
@@ -148777,24 +149332,29 @@
  94.73.193.106
  94.73.199.57
  94.73.204.9
+94.73.239.124
  94.73.247.4
  94.73.250.66
  94.73.252.193
  94.74.124.248
  94.74.130.188
  94.74.131.42
-94.74.134.16
  94.74.135.246
+94.74.138.185
  94.74.144.138
+94.74.144.51
  94.74.148.153
  94.74.148.90
  94.74.151.155
+94.74.157.96
  94.74.160.187
  94.74.162.197
-94.74.174.35
-94.74.177.235
+94.74.177.9
  94.74.179.8
+94.74.181.119
+94.74.185.186
  94.74.188.166
+94.74.188.22
  94.75.228.26
  94.75.243.135
  94.75.245.36
@@ -148849,27 +149409,24 @@
  95.0.206.62
  95.0.219.241
  95.0.219.245
-95.0.219.250
  95.0.219.251
  95.0.37.74
  95.0.66.76
  95.0.66.97
  95.0.66.98
+95.10.176.158
  95.104.114.50
-95.104.194.16
  95.104.54.227
-95.105.184.58
  95.105.212.113
  95.105.234.196
  95.105.253.100
  95.105.89.221
  95.106.106.220
-95.106.244.246
-95.106.59.30
  95.107.101.178
  95.107.103.207
  95.107.163.114
  95.107.199.90
+95.107.2.143
  95.107.39.208
  95.107.53.155
  95.107.6.3
@@ -148881,7 +149438,6 @@
  95.110.149.183
  95.110.153.164
  95.110.160.27
-95.110.173.251
  95.110.186.48
  95.110.190.163
  95.110.194.245
@@ -148891,7 +149447,7 @@
  95.110.232.124
  95.110.234.93
  95.111.128.185
-95.111.128.43
+95.111.196.109
  95.111.226.19
  95.111.227.79
  95.111.228.21
@@ -148906,19 +149462,19 @@
  95.111.252.182
  95.111.253.158
  95.111.254.160
+95.112.228.145
  95.114.26.221
  95.114.52.224
-95.115.44.45
  95.116.124.228
-95.116.177.56
+95.116.193.14
  95.116.235.231
-95.12.143.143
+95.116.91.63
+95.118.54.228
  95.12.143.42
  95.12.203.45
  95.120.59.36
  95.122.154.149
  95.122.97.103
-95.125.161.156
  95.128.118.182
  95.128.142.76
  95.128.144.1
@@ -148953,12 +149509,12 @@
  95.13.93.7
  95.13.95.115
  95.13.95.24
-95.130.168.234
  95.130.9.90
  95.131.10.118
  95.131.102.39
  95.131.70.76
  95.132.186.186
+95.132.228.177
  95.132.235.191
  95.133.163.58
  95.133.163.98
@@ -148977,22 +149533,17 @@
  95.135.190.15
  95.135.200.130
  95.136.47.170
-95.136.91.67
  95.137.156.236
  95.137.240.3
  95.137.240.30
  95.138.228.28
  95.138.33.28
-95.139.172.127
  95.14.128.16
  95.14.144.57
  95.140.116.18
  95.140.194.98
-95.140.195.36
  95.140.27.135
-95.141.135.162
  95.141.135.171
-95.141.135.206
  95.141.142.46
  95.141.17.0
  95.141.17.1
@@ -149256,6 +149807,8 @@
  95.141.44.100
  95.142.118.20
  95.142.118.26
+95.142.160.52
+95.142.160.91
  95.142.161.63
  95.142.161.87
  95.142.164.239
@@ -149270,7 +149823,6 @@
  95.142.44.203
  95.142.84.234
  95.142.88.117
-95.142.91.231
  95.143.133.180
  95.143.134.60
  95.143.135.226
@@ -149279,11 +149831,13 @@
  95.143.192.159
  95.143.193.125
  95.143.200.95
+95.143.21.14
+95.143.21.25
  95.143.218.179
-95.143.22.51
+95.143.22.136
+95.143.22.41
  95.143.22.56
  95.143.220.18
-95.143.220.5
  95.143.8.182
  95.143.82.202
  95.144.0.30
@@ -149292,13 +149846,14 @@
  95.15.113.237
  95.15.140.230
  95.15.162.191
+95.15.95.59
  95.15.98.251
+95.150.216.26
  95.150.39.145
  95.152.22.2
  95.153.167.63
  95.153.31.84
  95.153.31.94
-95.153.86.117
  95.154.104.147
  95.154.118.97
  95.154.145.139
@@ -149312,7 +149867,6 @@
  95.155.198.93
  95.155.199.202
  95.155.204.63
-95.155.205.100
  95.155.36.152
  95.155.63.186
  95.156.125.190
@@ -149337,6 +149891,7 @@
  95.158.63.46
  95.158.63.61
  95.158.7.234
+95.160.140.253
  95.160.181.237
  95.161.12.45
  95.161.169.170
@@ -149346,6 +149901,7 @@
  95.161.218.230
  95.161.22.147
  95.161.232.194
+95.161.239.89
  95.161.4.19
  95.163.107.14
  95.163.107.15
@@ -149372,6 +149928,8 @@
  95.165.164.170
  95.165.167.37
  95.165.172.171
+95.165.187.202
+95.165.196.6
  95.165.201.178
  95.165.252.94
  95.165.26.27
@@ -149394,8 +149952,8 @@
  95.169.213.76
  95.169.214.217
  95.169.214.220
-95.169.22.100
  95.169.22.174
+95.169.226.171
  95.169.28.142
  95.169.5.166
  95.169.6.123
@@ -149406,6 +149964,7 @@
  95.170.115.154
  95.170.118.79
  95.170.156.42
+95.170.166.237
  95.170.166.238
  95.170.192.216
  95.170.70.25
@@ -149436,23 +149995,11 @@
  95.176.152.208
  95.176.228.103
  95.177.175.231
-95.179.127.124
-95.179.127.143
-95.179.127.204
-95.179.127.231
-95.179.127.250
-95.179.127.254
  95.179.127.36
-95.179.127.41
-95.179.127.42
-95.179.127.5
-95.179.127.89
  95.179.131.110
  95.179.132.92
-95.179.137.90
  95.179.138.23
  95.179.141.19
-95.179.143.201
  95.179.150.209
  95.179.153.7
  95.179.159.170
@@ -149463,6 +150010,7 @@
  95.179.188.215
  95.179.191.229
  95.179.210.17
+95.179.210.228
  95.179.212.50
  95.179.214.152
  95.179.234.5
@@ -149476,7 +150024,6 @@
  95.181.148.125
  95.181.148.218
  95.181.148.64
-95.181.148.74
  95.181.148.86
  95.181.149.213
  95.181.149.48
@@ -149492,7 +150039,6 @@
  95.181.188.200
  95.181.214.105
  95.181.230.146
-95.181.253.109
  95.181.37.114
  95.181.45.234
  95.181.86.74
@@ -149500,8 +150046,6 @@
  95.182.122.199
  95.182.126.243
  95.182.126.251
-95.182.15.12
-95.182.18.153
  95.182.213.55
  95.182.235.44
  95.182.66.2
@@ -149511,16 +150055,15 @@
  95.183.52.148
  95.183.55.40
  95.183.88.22
-95.184.192.49
  95.188.234.244
  95.188.71.19
  95.189.101.81
  95.189.78.2
-95.189.96.77
  95.19.50.106
  95.19.50.227
  95.19.50.73
  95.190.120.42
+95.192.155.68
  95.192.27.178
  95.192.3.189
  95.192.60.127
@@ -149548,6 +150091,7 @@
  95.195.75.183
  95.195.94.75
  95.196.132.222
+95.196.148.199
  95.196.163.226
  95.196.204.24
  95.197.108.133
@@ -149563,7 +150107,7 @@
  95.198.34.204
  95.198.35.154
  95.198.40.84
-95.198.69.180
+95.198.52.237
  95.198.69.218
  95.198.71.158
  95.20.162.171
@@ -149572,8 +150116,8 @@
  95.204.158.175
  95.204.205.216
  95.204.219.192
+95.204.6.182
  95.204.85.149
-95.208.236.113
  95.208.253.143
  95.209.154.19
  95.209.155.91
@@ -149633,6 +150177,9 @@
  95.214.40.17
  95.214.53.156
  95.214.8.86
+95.215.108.123
+95.215.108.134
+95.215.108.90
  95.215.19.22
  95.215.205.176
  95.215.205.248
@@ -149668,6 +150215,7 @@
  95.216.165.43
  95.216.169.53
  95.216.181.107
+95.216.181.234
  95.216.187.94
  95.216.191.61
  95.216.192.143
@@ -149702,7 +150250,6 @@
  95.216.5.31
  95.216.53.163
  95.216.56.15
-95.216.59.23
  95.216.59.92
  95.216.6.156
  95.216.6.174
@@ -149718,6 +150265,7 @@
  95.216.8.166
  95.216.9.240
  95.216.96.167
+95.216.96.172
  95.216.96.93
  95.216.97.16
  95.216.99.213
@@ -149731,13 +150279,11 @@
  95.217.125.203
  95.217.129.110
  95.217.145.249
-95.217.156.23
  95.217.16.46
  95.217.162.125
  95.217.163.234
  95.217.165.80
  95.217.179.118
-95.217.18.83
  95.217.180.216
  95.217.183.155
  95.217.184.215
@@ -149746,15 +150292,19 @@
  95.217.187.75
  95.217.190.53
  95.217.194.209
-95.217.195.228
  95.217.195.91
  95.217.197.206
  95.217.205.27
  95.217.213.50
-95.217.223.58
  95.217.227.99
  95.217.23.149
  95.217.230.126
+95.217.26.178
+95.217.26.44
+95.217.26.45
+95.217.26.47
+95.217.26.48
+95.217.26.58
  95.217.3.191
  95.217.32.101
  95.217.32.177
@@ -149775,7 +150325,6 @@
  95.217.78.80
  95.217.9.180
  95.217.93.21
-95.217.94.198
  95.217.94.234
  95.217.94.235
  95.217.94.236
@@ -149792,42 +150341,45 @@
  95.227.234.14
  95.229.138.72
  95.231.87.112
+95.232.125.85
  95.232.200.250
  95.232.235.194
  95.232.25.19
  95.232.252.151
-95.232.252.246
  95.233.68.206
-95.234.120.164
  95.234.249.253
  95.235.174.145
-95.235.36.227
  95.235.60.135
  95.236.144.2
  95.237.233.217
+95.237.40.238
  95.237.7.242
+95.238.244.100
  95.24.120.22
  95.24.24.160
+95.24.24.45
  95.24.81.43
  95.240.56.129
  95.243.136.198
  95.243.65.80
  95.244.86.94
  95.246.104.219
-95.246.25.52
  95.247.171.181
  95.247.172.182
  95.247.233.159
  95.247.48.48
  95.248.188.176
  95.248.72.68
+95.25.254.158
  95.25.75.112
  95.25.92.91
  95.250.44.125
  95.251.213.197
+95.251.67.60
  95.251.89.9
  95.251.9.69
  95.252.171.8
+95.252.37.39
  95.252.89.31
  95.253.100.189
  95.253.238.77
@@ -149837,44 +150389,36 @@
  95.255.60.110
  95.26.73.47
  95.27.142.114
+95.27.154.138
+95.27.84.87
  95.28.244.228
  95.29.156.192
  95.29.42.110
  95.30.183.124
  95.30.20.137
-95.30.218.154
  95.31.119.210
  95.31.165.210
  95.31.172.45
  95.31.186.116
  95.31.209.113
  95.31.22.193
-95.31.23.157
  95.31.231.228
  95.31.241.178
-95.31.35.252
  95.31.5.29
-95.31.73.96
  95.32.131.83
  95.32.135.28
-95.32.142.171
-95.32.16.46
  95.32.162.226
  95.32.193.2
  95.32.196.57
  95.32.20.21
  95.32.201.38
-95.32.214.4
-95.32.216.113
-95.32.31.166
+95.32.6.151
  95.32.69.121
  95.32.91.123
  95.34.169.12
-95.38.17.92
-95.38.211.50
+95.38.18.30
  95.38.212.102
  95.38.252.214
-95.38.30.187
  95.38.40.180
  95.38.67.175
  95.39.12.16
@@ -149885,8 +150429,8 @@
  95.43.220.254
  95.43.42.100
  95.46.157.238
+95.46.167.219
  95.46.44.198
-95.46.47.86
  95.46.74.61
  95.47.140.172
  95.47.140.42
@@ -149899,102 +150443,35 @@
  95.51.180.226
  95.51.186.245
  95.51.210.81
-95.53.156.41
+95.52.255.232
  95.54.196.135
  95.54.73.214
  95.55.81.236
  95.55.82.208
-95.56.102.193
-95.56.115.142
-95.56.133.193
-95.56.166.14
-95.56.166.242
-95.56.170.21
  95.56.189.16
-95.56.190.249
  95.56.201.39
-95.56.203.102
  95.56.205.100
  95.56.224.203
  95.56.243.207
  95.56.44.125
-95.56.47.205
-95.56.65.212
-95.56.86.239
-95.57.143.47
-95.57.145.18
-95.57.162.132
-95.57.164.137
  95.57.164.55
-95.57.2.80
  95.57.207.188
  95.57.218.103
-95.57.223.163
-95.57.234.92
-95.57.242.46
  95.57.39.1
-95.57.48.202
-95.57.49.114
-95.57.69.40
  95.57.71.240
-95.57.78.15
-95.57.79.149
  95.57.79.213
  95.57.8.80
-95.57.84.39
-95.58.126.246
-95.58.13.227
-95.58.135.185
  95.58.141.168
-95.58.145.106
-95.58.145.154
-95.58.145.2
-95.58.151.253
  95.58.164.130
-95.58.165.162
-95.58.165.250
-95.58.168.74
-95.58.18.202
  95.58.18.90
  95.58.180.169
-95.58.211.115
-95.58.216.158
-95.58.223.124
  95.58.228.75
-95.58.229.133
-95.58.229.183
-95.58.237.84
-95.58.239.59
-95.58.28.25
-95.58.30.166
-95.58.31.2
-95.58.31.66
-95.58.37.168
-95.58.38.19
-95.58.4.114
-95.58.4.6
-95.58.4.74
-95.58.50.161
-95.58.54.127
-95.58.56.247
-95.58.68.107
-95.58.73.20
-95.58.78.36
-95.59.103.93
  95.59.105.179
-95.59.117.111
  95.59.132.44
-95.59.148.57
-95.59.220.96
-95.59.254.18
+95.59.161.202
  95.59.26.160
  95.59.26.9
-95.59.3.134
-95.59.40.71
  95.59.7.26
-95.59.76.109
-95.59.9.225
-95.59.9.240
  95.6.40.120
  95.6.5.233
  95.6.64.145
@@ -150003,6 +150480,7 @@
  95.6.77.61
  95.6.8.14
  95.60.146.134
+95.62.206.220
  95.63.245.167
  95.65.124.252
  95.65.30.156
@@ -150011,12 +150489,14 @@
  95.65.89.96
  95.65.98.184
  95.66.142.18
+95.66.145.254
  95.66.182.136
  95.67.101.94
  95.67.110.109
  95.67.38.55
  95.67.46.86
  95.67.63.106
+95.67.65.18
  95.67.87.176
  95.68.115.202
  95.68.116.41
@@ -150033,7 +150513,7 @@
  95.70.136.197
  95.70.172.105
  95.70.174.200
-95.70.242.225
+95.70.194.206
  95.71.124.178
  95.71.124.203
  95.71.124.31
@@ -150043,13 +150523,12 @@
  95.71.135.163
  95.71.185.110
  95.71.196.63
-95.71.32.29
+95.71.242.98
  95.72.144.201
  95.72.144.215
  95.72.166.146
  95.72.74.100
  95.73.0.35
-95.73.106.213
  95.73.137.172
  95.73.251.250
  95.73.40.214
@@ -150064,14 +150543,12 @@
  95.78.162.117
  95.78.169.4
  95.78.203.32
-95.78.205.132
  95.78.251.116
  95.79.112.74
  95.79.121.115
  95.79.25.247
  95.79.34.35
  95.79.35.133
-95.79.36.55
  95.79.55.196
  95.79.57.206
  95.80.10.185
@@ -150084,11 +150561,6 @@
  95.80.79.106
  95.81.17.95
  95.81.2.110
-95.82.113.143
-95.82.116.58
-95.82.117.96
-95.82.121.195
-95.82.121.70
  95.82.146.70
  95.83.73.31
  95.84.128.25
@@ -150156,7 +150628,6 @@
  95.87.66.75
  95.87.9.254
  95.89.179.10
-95.89.7.91
  95.9.118.147
  95.9.120.40
  95.9.139.170
@@ -150169,7 +150640,6 @@
  95.9.225.107
  95.9.237.183
  95.9.243.32
-95.9.244.57
  95.9.245.56
  95.9.249.63
  95.9.36.25
@@ -150181,19 +150651,20 @@
  95.9.83.180
  95.9.96.110
  95.90.181.37
-95.90.181.58
-95.90.198.207
  95.90.254.108
+95.90.32.165
  95.91.194.6
  95.91.231.108
  95.91.45.50
  95.91.65.94
  95.92.74.9
+95.92.88.14
  95.93.216.34
  95.93.29.85
  95.94.219.81
-95.94.25.115
+95.95.129.239
  95.97.10.18
+95.97.105.42
  95.97.209.10
  95.97.27.33
  950-365.com
@@ -150218,6 +150689,8 @@
  96.114.71.146
  96.114.71.147
  96.125.164.243
+96.125.194.250
+96.125.228.110
  96.126.100.115
  96.126.101.158
  96.126.102.27
@@ -150260,8 +150733,10 @@
  96.20.178.115
  96.20.87.164
  96.21.177.8
+96.22.233.43
  96.22.82.34
  96.224.227.210
+96.224.254.44
  96.224.32.210
  96.225.175.194
  96.225.97.17
@@ -150284,10 +150759,10 @@
  96.238.89.4
  96.239.17.242
  96.240.109.89
+96.240.200.107
  96.240.201.104
  96.240.202.168
  96.241.75.151
-96.241.84.252
  96.242.147.73
  96.242.174.18
  96.242.5.35
@@ -150300,12 +150775,12 @@
  96.250.213.40
  96.250.3.36
  96.250.9.187
+96.252.37.32
  96.253.28.186
  96.253.78.75
  96.254.171.10
  96.255.110.243
  96.255.219.187
-96.255.46.146
  96.255.84.96
  96.255.96.11
  96.27.143.106
@@ -150322,18 +150797,17 @@
  96.30.234.239
  96.30.236.195
  96.30.51.176
-96.30.69.157
  96.30.84.21
  96.31.77.62
  96.33.141.140
  96.35.44.209
  96.37.63.182
  96.37.73.96
+96.38.126.30
  96.38.148.12
-96.38.159.96
  96.39.152.89
  96.39.76.211
-96.40.54.217
+96.40.230.244
  96.41.157.101
  96.42.74.229
  96.43.111.15
@@ -150367,7 +150841,6 @@
  96.49.236.9
  96.50.229.48
  96.50.41.57
-96.50.71.94
  96.51.101.23
  96.51.33.17
  96.51.9.189
@@ -150380,21 +150853,19 @@
  96.55.18.58
  96.55.57.139
  96.55.58.16
-96.56.110.234
  96.56.150.24
-96.56.5.2
  96.56.55.147
  96.56.58.202
  96.57.103.138
  96.57.24.186
  96.57.248.252
  96.57.5.210
+96.57.7.106
  96.57.99.138
  96.59.11.140
  96.59.111.169
  96.59.172.84
  96.59.195.227
-96.60.140.48
  96.61.113.203
  96.65.60.181
  96.66.15.147
@@ -150425,6 +150896,7 @@
  96.73.47.18
  96.73.56.75
  96.75.134.85
+96.75.184.97
  96.77.19.190
  96.77.231.29
  96.77.43.233
@@ -150434,16 +150906,15 @@
  96.78.178.158
  96.79.124.153
  96.79.7.210
-96.8.113.205
  96.8.114.178
  96.8.115.26
  96.8.116.232
  96.8.120.113
  96.8.122.171
-96.8.122.178
  96.8.122.180
  96.8.122.185
  96.80.107.217
+96.80.20.180
  96.80.251.85
  96.80.72.94
  96.82.74.129
@@ -150487,6 +150958,7 @@
  96.9.77.71
  96.9.79.20
  96.9.79.233
+96.9.80.101
  96.9.84.245
  96.9.86.70
  96.9.88.139
@@ -150497,7 +150969,6 @@
  96.91.100.41
  96.91.14.37
  96.91.204.122
-96.92.10.154
  96.92.157.164
  96.92.208.34
  96.93.196.89
@@ -150523,11 +150994,16 @@
  96c8714c-d919-44cf-a1a1-dd300c4b3a06.htmlcomponentservice.com
  96e2cf79e31193f971e8489181b1b4939a832cff.info
  96mxu.weblium.site
+97.102.128.251
  97.103.238.219
  97.103.245.132
+97.104.1.70
+97.104.231.84
  97.105.129.229
  97.105.15.251
  97.105.156.2
+97.105.40.180
+97.105.6.100
  97.107.127.214
  97.107.129.70
  97.107.131.216
@@ -150538,6 +151014,7 @@
  97.107.139.167
  97.107.141.166
  97.112.106.144
+97.112.228.92
  97.112.86.181
  97.113.206.137
  97.115.157.201
@@ -150582,18 +151059,13 @@
  97.74.236.154
  97.74.237.196
  97.74.24.101
-97.74.24.113
-97.74.24.133
-97.74.24.174
-97.74.24.189
+97.74.24.169
  97.74.24.193
-97.74.24.194
  97.74.24.197
-97.74.24.201
+97.74.24.215
  97.74.24.216
-97.74.24.222
  97.74.24.227
-97.74.24.46
+97.74.4.42
  97.74.6.64
  97.75.144.178
  97.75.148.152
@@ -150603,21 +151075,23 @@
  97.79.1.218
  97.79.203.242
  97.79.239.42
-97.81.177.196
+97.79.29.36
  97.81.187.225
  97.81.244.191
  97.82.41.156
  97.82.79.83
  97.83.108.94
-97.83.16.92
  97.83.173.243
  97.83.248.117
+97.84.104.4
  97.84.232.105
+97.84.246.39
  97.85.36.15
  97.88.101.87
  97.88.8.34
  97.90.115.171
  97.90.49.141
+97.90.80.18
  97.91.167.168
  97.92.0.182
  97.92.133.43
@@ -150625,7 +151099,6 @@
  97.93.49.220
  97.95.161.255
  97.95.223.36
-97.97.68.0
  97.98.26.185
  97.99.177.36
  97.99.205.241
@@ -150647,7 +151120,6 @@
  97pogonszczecininfo.pogon.max.pl
  97sm.org
  98.0.210.218
-98.100.191.51
  98.100.202.106
  98.102.222.30
  98.102.56.66
@@ -150662,6 +151134,7 @@
  98.113.143.106
  98.113.162.148
  98.113.239.207
+98.113.78.18
  98.114.181.134
  98.114.51.235
  98.115.11.45
@@ -150671,6 +151144,7 @@
  98.116.105.49
  98.116.107.56
  98.116.145.45
+98.116.175.251
  98.116.234.182
  98.119.219.27
  98.124.243.32
@@ -150716,8 +151190,6 @@
  98.128.159.54
  98.128.159.98
  98.128.166.190
-98.128.180.245
-98.128.180.99
  98.128.181.235
  98.128.181.244
  98.128.198.243
@@ -150734,7 +151206,6 @@
  98.128.250.214
  98.128.250.44
  98.128.250.54
-98.129.229.166
  98.129.77.98
  98.13.75.196
  98.130.2.58
@@ -150753,11 +151224,14 @@
  98.146.212.146
  98.146.216.209
  98.15.140.226
+98.15.9.64
  98.150.169.135
+98.151.151.104
  98.151.19.47
  98.151.250.238
  98.151.39.75
  98.151.88.104
+98.152.177.43
  98.152.199.155
  98.153.109.186
  98.153.147.98
@@ -150781,7 +151255,7 @@
  98.159.110.228
  98.159.110.231
  98.159.110.232
-98.159.83.114
+98.159.82.112
  98.159.90.158
  98.159.90.92
  98.159.99.102
@@ -150809,7 +151283,9 @@
  98.164.197.138
  98.164.197.227
  98.164.199.153
+98.164.31.113
  98.165.125.14
+98.165.196.253
  98.168.253.24
  98.171.21.129
  98.172.110.130
@@ -150819,8 +151295,8 @@
  98.172.69.141
  98.174.204.209
  98.175.197.111
-98.175.252.149
  98.176.124.166
+98.177.60.181
  98.178.240.9
  98.179.182.136
  98.182.212.15
@@ -150839,7 +151315,6 @@
  98.191.240.152
  98.191.6.172
  98.191.71.139
-98.192.200.99
  98.192.202.192
  98.192.74.164
  98.193.226.113
@@ -150856,7 +151331,6 @@
  98.199.252.13
  98.199.86.219
  98.2.233.131
-98.200.213.136
  98.201.192.205
  98.202.232.200
  98.203.162.230
@@ -150864,9 +151338,8 @@
  98.206.130.4
  98.206.254.200
  98.206.84.64
-98.208.143.176
-98.208.33.36
  98.21.251.169
+98.210.165.225
  98.211.33.202
  98.211.69.104
  98.213.183.28
@@ -150874,13 +151347,13 @@
  98.217.124.239
  98.219.121.217
  98.219.172.82
-98.219.212.12
  98.22.26.221
  98.220.181.15
  98.224.139.209
  98.224.62.239
  98.224.72.168
  98.225.157.78
+98.225.248.37
  98.226.186.214
  98.226.204.55
  98.227.2.202
@@ -150900,7 +151373,6 @@
  98.238.161.194
  98.239.128.154
  98.239.36.155
-98.242.225.185
  98.244.145.49
  98.247.106.211
  98.247.52.166
@@ -150909,6 +151381,7 @@
  98.249.253.174
  98.25.193.114
  98.251.9.73
+98.253.121.197
  98.253.160.30
  98.253.193.165
  98.253.34.137
@@ -150920,13 +151393,13 @@
  98.28.92.55
  98.29.18.119
  98.29.195.204
+98.29.39.171
  98.32.243.104
  98.33.76.100
  98.34.138.143
  98.35.16.77
  98.36.134.183
  98.36.149.4
-98.36.89.139
  98.39.37.127
  98.4.96.81
  98.5.123.187
@@ -150988,18 +151461,20 @@
  99.137.20.45
  99.14.28.119
  99.14.51.66
+99.140.40.82
  99.144.117.165
+99.145.100.61
  99.148.135.55
  99.148.197.14
  99.152.32.222
  99.155.232.76
  99.157.104.219
  99.164.139.172
+99.168.100.238
  99.176.24.64
  99.176.27.13
  99.185.76.161
  99.188.36.50
-99.192.170.250
  99.192.218.142
  99.192.223.18
  99.194.106.207
@@ -151023,6 +151498,7 @@
  99.194.25.162
  99.194.3.167
  99.194.7.13
+99.195.124.78
  99.198.118.186
  99.199.136.77
  99.2.136.115
@@ -151077,6 +151553,7 @@
  99.245.64.69
  99.246.165.190
  99.246.222.163
+99.246.4.201
  99.248.135.241
  99.248.154.155
  99.248.37.236
@@ -151114,9 +151591,11 @@
  99.58.163.117
  99.61.135.143
  99.67.57.104
+99.68.9.36
  99.71.113.187
  99.73.215.70
  99.74.255.250
+99.75.152.102
  99.76.133.167
  99.78.113.71
  99.78.113.72
@@ -151129,7 +151608,7 @@
  99.88.47.34
  99.89.34.3
  99.90.34.142
-99.96.122.99
+99.91.12.209
  99.97.218.164
  99.98.219.253
  990244728374797421.weebly.com
@@ -151379,7 +151858,6 @@ a0476921.xsph.ru
  a0480318.xsph.ru
  a0480747.xsph.ru
  a0481263.xsph.ru
-a0484506.xsph.ru
  a0484555.xsph.ru
  a0484562.xsph.ru
  a0485469.xsph.ru
@@ -151387,12 +151865,12 @@ a0485664.xsph.ru
  a0487298.xsph.ru
  a0487600.xsph.ru
  a0487780.xsph.ru
-a0488463.xsph.ru
  a0488859.xsph.ru
  a0488888.xsph.ru
  a0489209.xsph.ru
  a0489224.xsph.ru
  a0489257.xsph.ru
+a0489475.xsph.ru
  a06kz.mentriqq.com
  a098327634868288934.web.app
  a0991d3c6bd14af994610478701f22cf39296297.info
@@ -153198,7 +153676,6 @@ accountprivate.000webhostapp.com
  accountprosec.000webhostapp.com
  accountprotection-halifax.com
  accountprotection-payee.com
-accountprotection-review.com
  accountprotection-uk.com
  accountprotectionlloyds.com
  accountqueries-halifax.com
@@ -153773,6 +154250,7 @@ activatemeberuseraccount.weebly.com
  activateyourattyahoomailtothelatestversionwebpage.weebly.com
  activation-center-social-media-us2020.my.id
  activation-center-social-us2020.my.id
+activation-email-upgrades.glitch.me
  activation-pages-invitation-site-100011245174772015.tk
  activation-pages-invitation-sites-10267531174772015.tk
  activation-pages-invitation-sites-1027531174772015.tk
@@ -153805,8 +154283,6 @@ activemail-activation-upgrade.glitch.me
  activemedia.com
  activeorganizelevel.tk
  activeserviceprovider.com
-activesucuenta.webcindario.com
-activesucuentabg.webcindario.com
  activesusdatos.webcindario.com
  activesusproductosaqui.com
  activethreatconsulting.com
@@ -153924,6 +154400,7 @@ ad-store.online
  ad-www.com
  ad-x.svcoding.com
  ad.iinsure.xyz
+ad.jandigitalstudios.com
  ad.toadsense.com
  ad.words-google.com
  ad0bep0.atwebpages.com
@@ -154024,6 +154501,7 @@ addbillingapple.servecounterstrike.com
  addbjowiqphotzsz-dot-owaonk399399393.uk.r.appspot.com
  addedpayee-authentication.com
  addergytech.com
+addertyg.xyz
  addevin.xyz
  addflux.com
  addhun.ml
@@ -154276,7 +154754,6 @@ adminsl.ru
  adminsrc.serveirc.com
  adminsrtorsverifications.weebly.com
  adminsrvr.org
-adminsupportatt.weebly.com
  adminsupports-amazon.com
  adminsupportsbc.weebly.com
  adminsupportyahoo.weebly.com
@@ -154450,6 +154927,7 @@ adsbusinesscouponscampaigns.com
  adsbusinesscouponscreditaccount.com.denemexyz.xyz
  adsbusinesscreditcampaing.com
  adsbusinesscreditcouponsaccount.com
+adsbusinesscreditsaccount.com.denemexyz.xyz
  adscampaignaccountcoupon.com
  adscampaignaccountscoupon.com
  adscampaignaccountscoupons.com
@@ -154468,6 +154946,7 @@ adscouponscreditcampaignaccount.com
  adscreditaccountcoupons.com
  adscreditaccountscampaigncoupons.com
  adscreditbusinessaccount.com
+adscreditbusinesscouponaccount.com
  adscreditcoupons.com
  adscreditcouponsaccount.com
  adscreditsbusinesscouponaccount.com
@@ -154988,7 +155467,6 @@ aforauditor.com
  aforech.com
  aforevoz.ga
  aforevoz.tk
-afpcg.com.mailsibar.com
  afpltbdsevrnrumm-dot-millinium.ey.r.appspot.com
  afpn.jaysbrand.com
  afptooekjethdhpu-dot-millinium.ey.r.appspot.com
@@ -155414,6 +155892,7 @@ agt7150.work
  agtelephone.com
  agtikuwait.com
  agtrade.hu
+agtroma.it
  aguacateonline.co
  aguacatesvalencia.es
  aguadocepiscinas.com.br
@@ -156404,7 +156883,6 @@ aleandroreis.adv.br
  aleangelpet.com
  aleatemadeg.com
  alecicousk.com
-alecrimagency.com
  aledostawa.org
  aleena-onlineshop24.my.id
  aleenaenterprises.in
@@ -156475,6 +156953,7 @@ alert-securityrisk.cc
  alert-support-wells-fargo.com
  alert-text.me
  alert-three-account.link
+alert-unknownlogin.cc
  alert-wells-blocked.site
  alert-wellsfargosupportdepartment.tk
  alert.bank.wf.reference-id4284.work
@@ -156829,6 +157308,7 @@ alisoba.ru
  alison-sportandfitness.com
  alison-sportandfitnesss.com
  alison53867389.xyz
+alison6532018.xyz
  alisonnailspartnership.business
  alisonparkercrs.net
  alisonsport-fitness.com
@@ -157052,7 +157532,6 @@ allooalel.club
  allotasse.kissr.com
  allowanceteft.ga
  allowmefirstbuildcon.com
-allowpayee-hs-bc.com
  allows48-paypal.com
  alloy-71.ga
  alloymammary.com
@@ -157548,6 +158027,7 @@ amannz.xyz
  amanoz.xyz
  amanoza.info
  amanvedanth.com
+amanzonp.xyz
  amaone.co.ja.ruqrieujenfapleokxnuqisoxj.top
  amaonnoa.com
  amaonz-mail.xyz
@@ -157797,29 +158277,22 @@ amazon-check-co-jp.cfoyo.top
  amazon-check-co-jp.e1b.top
  amazon-check-co-jp.e1y.top
  amazon-check-co-jp.e1z.top
-amazon-check-co-jp.f1x.top
  amazon-check-co-jp.fdsfsd.buzz
  amazon-check-co-jp.fuogc.top
-amazon-check-co-jp.g1v.top
+amazon-check-co-jp.g1w.top
  amazon-check-co-jp.h1p.top
  amazon-check-co-jp.h1s.top
  amazon-check-co-jp.ifnd.top
  amazon-check-co-jp.j1g.top
-amazon-check-co-jp.j1i.top
  amazon-check-co-jp.j1s.top
  amazon-check-co-jp.l1u.top
-amazon-check-co-jp.mrpgf.top
-amazon-check-co-jp.myvmg.top
-amazon-check-co-jp.n1c.top
  amazon-check-co-jp.p9i.xyz
  amazon-check-co-jp.q1z.top
-amazon-check-co-jp.r1r.top
  amazon-check-co-jp.r1u.top
  amazon-check-co-jp.rz1.top
  amazon-check-co-jp.u1i.top
  amazon-check-co-jp.w1l.top
  amazon-check-co-jp.w1r.top
-amazon-check-co-jp.z1w.top
  amazon-checkinfo-verifyuser.xyz
  amazon-co-jp-6z1f61awfwaf1ezsfseaz135f1szdaf313reae5f1sz31f3.ga
  amazon-co-jp-account-help-centors.xyz
@@ -158124,6 +158597,7 @@ amazon-x.top
  amazon-xg.top
  amazon-xi.top
  amazon-xi.xyz
+amazon-xl.top
  amazon-xwebidrscf.serveirc.com
  amazon-z.top
  amazon.111f7k.top
@@ -158171,7 +158645,6 @@ amazon.c0.jp-c163358b6b1a5093f8b9e1c7574af32f22708d71.ph
  amazon.c0.jp-c1ece12fdefe84f6552c8bcb2863694028ad2852.ph
  amazon.c0.jp-d54c37e7c3c55d6a547b0bc7567a9fd585dcd4dd.ph
  amazon.c0.jp-fca0ca029f9f6e6ee4da108babb11847ded43710.ph
-amazon.c0.jp3.4efa7aed6eaefc9b1ac19e.xyz
  amazon.ca.accountpreferredpayments.nz-classic.tk
  amazon.ca.token-0xff2d.phone-icloud.com
  amazon.check-mybillinfo.com
@@ -158318,7 +158791,6 @@ amazon.co.jp.amazonjpsd.xyz
  amazon.co.jp.amazonsignin.top
  amazon.co.jp.amazoumne-longio.top
  amazon.co.jp.amazznjp.top
-amazon.co.jp.amazzon-co-jp.tk
  amazon.co.jp.amirkenneddd1.monster
  amazon.co.jp.amx42ca362xcanbvxzsa.net
  amazon.co.jp.amzcoffee.com
@@ -159092,6 +159564,7 @@ amazonssacxe.xyz
  amazonssales.xyz
  amazonssm.buzz
  amazonsss.buzz
+amazonssuu.xyz
  amazonstore-loginpage.xyz
  amazonsupportservicellc.tk
  amazonsuuo.buzz
@@ -159153,6 +159626,7 @@ amazonzxx.xyz
  amazonzxxc.xyz
  amazoom.cloud
  amazoon.co.jp.faddish.xyz
+amazoon.hotlote.icu
  amazoon.pw
  amazoong.buzz
  amazoonl.xyz
@@ -159208,7 +159682,6 @@ ambil-pulsa-gratis-bosku.000webhostapp.com
  ambildiaomond-terbaru.gameburigdm.cf
  ambilgrtis.000webhostapp.com
  ambilhadiahgiveway.000webhostapp.com
-ambiluang500juta.toh.info
  ambiseg.servsites.com.br
  ambitionconcepts.com
  ambitiousopponent.co.za
@@ -159665,7 +160138,6 @@ ammedieval.org
  ammetoday.com
  ammfkuei.top
  ammonhair.nl
-ammops.acicatech.es
  ammrgcajkgmhktpo-dot-millinium.ey.r.appspot.com
  ammrswpxqxfuahau-dot-millinium.ey.r.appspot.com
  ammssnbrxezqacjk-dot-millinium.ey.r.appspot.com
@@ -159848,7 +160320,6 @@ amz-europe-sellercentral.eu-services-dk0.online
  amz-limited.000webhostapp.com
  amz-managedisapointedmajo999985547scampage.gleeze.com
  amz-partner.com
-amz-prime.com
  amz-request-0tp.balreg.com
  amz-scure-verify.for-our.info
  amz-scure106.session-reg.com
@@ -159896,6 +160367,7 @@ amzonad.bgwrzt.cn
  amzonallouttheactivityseptembre2020.giize.com
  amzoncustverify.3utilities.com
  amzoneid54620-jp.com
+amzonjp.hsu3jp6kx7fb8ovankovtfyx0nryh3ps.info
  amzons.000webhostapp.com
  amzonwy.co.uk
  amzordrbilling.com
@@ -160406,9 +160878,8 @@ annazaraernest.com
  annazoe-co-jp.oiio.vg
  annazom.buzz
  annazom.space
-annazon-checks-co-jp.yusl-oops.top
  annazon-chicks-co-jp.kjhfhcn.top
-annazon-chikes-co-jp.in-actiche.top
+annazon-loginto.jp.busoi.buzz
  annazon.club
  annazon.co.uk
  annazonjp.co
@@ -160464,7 +160935,6 @@ annual-recompense-coupon.ca
  annual-repayment.com
  annual-update.com
  annual-win-prices.000webhostapp.com
-annualcrimsonapplicationstack.xtraloaded662.repl.co
  annualexpress.ml
  annualtaxrepayment.com
  annulation-commande-paypal-informations.he9sh.org
@@ -160668,7 +161138,6 @@ anuonkoooredammn.com
  anuopypanhsrsuqzlhdgztiqqrzvsqruepzf-dot-glegen303939423233.ue.r.appspot.com
  anussyshbsiopiaj.com
  anuuyoxvhvisytzhxkvnnvcbbjnisplsttem-dot-offgl8876899977678.uk.r.appspot.com
-anuuyoxvhvisytzhxkvnnvcbbjnisplsttem.offgl8876899977678.uk.r.appspot.com
  anvexo.com
  anvietlong.com
  anvietpro.com
@@ -160714,6 +161183,7 @@ anzcancel.com
  anzcsaembltinecrvepljyqyet-dot-gleowayel400503.uc.r.appspot.com
  anzerbrokers.com
  anzo.capital
+ao.jandigitalstudios.com
  aoaonline.org
  aobyvmfuxxealtqj-dot-millinium.ey.r.appspot.com
  aoc-connect.weebly.com
@@ -161135,28 +161605,9 @@ app-1537966966.000webhostapp.com
  app-1538948274.000webhostapp.com
  app-1539937238.000webhostapp.com
  app-1541815294.000webhostapp.com
-app-236454667.petlove.nu
  app-24-7.myshopify.com
-app-246663525.petlove.nu
-app-247647266.petlove.nu
-app-267342373.petlove.nu
  app-33544045.sinilind.ee
-app-336763773.petlove.nu
-app-353353464.petlove.nu
-app-356347243.petlove.nu
-app-356773365.petlove.nu
  app-36horas.com
-app-375235662.petlove.nu
-app-376237657.petlove.nu
-app-376527542.petlove.nu
-app-427223436.petlove.nu
-app-537536356.petlove.nu
-app-626226566.petlove.nu
-app-626376337.petlove.nu
-app-655727725.petlove.nu
-app-746245675.petlove.nu
-app-757525442.petlove.nu
-app-776745723.petlove.nu
  app-acesso-gestao.com
  app-acessobanking.epizy.com
  app-acessodigital.com
@@ -161338,7 +161789,6 @@ app.datamailapps.com
  app.descargas1.xyz
  app.descargas2.xyz
  app.descargas3.xyz
-app.dropbox.bussiness.portsmouthmots.co.uk
  app.easysignpro.com
  app.emaillineapps.com
  app.emailnewchils.com
@@ -161612,6 +162062,7 @@ appie.icord.cn
  appie.ioioc.cn
  appie.ld-security.com
  appie.lock87.cn
+appie.orgnk.cn
  appied-signin.apple-ca.music-appstore-monthly.info
  appied-supportcs.ddnsking.com
  appieid-appie.ca-user-signin.jp-ios-user.com
@@ -161676,6 +162127,7 @@ apple-findmyphone.com
  apple-findre.com
  apple-frozen-update.com
  apple-frozens-update.com
+apple-gps-id-iphone.net
  apple-gps-id.net
  apple-ibusca.com
  apple-icloud-a4.cn
@@ -162875,10 +163327,12 @@ applnch-121876603.sangekasra.ir
  applnch-123391077.sangekasra.ir
  applnch-123893186.sangekasra.ir
  applnch-125448593.sangekasra.ir
+applnch-129107149.sangekasra.ir
  applnch-129744461.sangekasra.ir
  applnch-134623626.sangekasra.ir
  applnch-139731522.sangekasra.ir
  applnch-142014671.sangekasra.ir
+applnch-143183260.sangekasra.ir
  applnch-145959631.sangekasra.ir
  applnch-147517777.sangekasra.ir
  applnch-157464449.sangekasra.ir
@@ -162891,6 +163345,7 @@ applnch-186071633.sangekasra.ir
  applnch-190585499.sangekasra.ir
  applnch-194847445.sangekasra.ir
  applnch-206089226.sangekasra.ir
+applnch-209222113.sangekasra.ir
  applnch-215996977.sangekasra.ir
  applnch-218574645.sangekasra.ir
  applnch-219017251.sangekasra.ir
@@ -162916,6 +163371,7 @@ applnch-392171825.sangekasra.ir
  applnch-394077665.sangekasra.ir
  applnch-396192847.sangekasra.ir
  applnch-411219597.sangekasra.ir
+applnch-414922044.sangekasra.ir
  applnch-419082389.sangekasra.ir
  applnch-433956797.sangekasra.ir
  applnch-437822710.sangekasra.ir
@@ -162925,6 +163381,8 @@ applnch-443252791.sangekasra.ir
  applnch-443350731.sangekasra.ir
  applnch-445591060.sangekasra.ir
  applnch-445900928.sangekasra.ir
+applnch-453508383.sangekasra.ir
+applnch-462199144.sangekasra.ir
  applnch-471561169.sangekasra.ir
  applnch-477716809.sangekasra.ir
  applnch-482026220.sangekasra.ir
@@ -162946,6 +163404,7 @@ applnch-567303648.sangekasra.ir
  applnch-570866708.sangekasra.ir
  applnch-573506778.sangekasra.ir
  applnch-575866062.sangekasra.ir
+applnch-577193494.sangekasra.ir
  applnch-581006838.sangekasra.ir
  applnch-589694389.sangekasra.ir
  applnch-599563048.sangekasra.ir
@@ -162953,6 +163412,7 @@ applnch-600740509.sangekasra.ir
  applnch-603981102.sangekasra.ir
  applnch-606644132.sangekasra.ir
  applnch-609437193.sangekasra.ir
+applnch-615449943.sangekasra.ir
  applnch-622312567.sangekasra.ir
  applnch-629152848.sangekasra.ir
  applnch-638430605.sangekasra.ir
@@ -162960,14 +163420,17 @@ applnch-650378075.sangekasra.ir
  applnch-652561052.sangekasra.ir
  applnch-655068601.sangekasra.ir
  applnch-656759625.sangekasra.ir
+applnch-659467255.sangekasra.ir
  applnch-673358907.sangekasra.ir
  applnch-677254692.sangekasra.ir
  applnch-677800386.sangekasra.ir
  applnch-679042391.sangekasra.ir
+applnch-687517185.sangekasra.ir
  applnch-693790946.sangekasra.ir
  applnch-697962384.sangekasra.ir
  applnch-698934376.sangekasra.ir
  applnch-718929681.sangekasra.ir
+applnch-720581847.sangekasra.ir
  applnch-726213025.sangekasra.ir
  applnch-733908744.sangekasra.ir
  applnch-735504802.sangekasra.ir
@@ -162983,6 +163446,9 @@ applnch-790700818.sangekasra.ir
  applnch-792817815.sangekasra.ir
  applnch-793511062.sangekasra.ir
  applnch-809562049.sangekasra.ir
+applnch-814838902.sangekasra.ir
+applnch-849046471.sangekasra.ir
+applnch-855212479.sangekasra.ir
  applnch-860723456.sangekasra.ir
  applnch-862816945.sangekasra.ir
  applnch-864899987.sangekasra.ir
@@ -162991,6 +163457,7 @@ applnch-894102924.sangekasra.ir
  applnch-900073994.sangekasra.ir
  applnch-900392897.sangekasra.ir
  applnch-911788560.sangekasra.ir
+applnch-916493500.sangekasra.ir
  applnch-920721062.sangekasra.ir
  applnch-923124451.sangekasra.ir
  applnch-926616049.sangekasra.ir
@@ -163000,6 +163467,7 @@ applnch-956567686.sangekasra.ir
  applnch-960845615.sangekasra.ir
  applnch-965437223.sangekasra.ir
  applnch-979756242.sangekasra.ir
+applnch-992066137.sangekasra.ir
  applnch-996881894.sangekasra.ir
  applnch-998580449.sangekasra.ir
  applnpost.app
@@ -163064,6 +163532,7 @@ appreviewwme.ru
  apprioinccom-dot-of-fi-ce-365.rj.r.appspot.com
  appriver3651012784-my.sharepoint.com
  apprls.com
+apprml.000webhostapp.com
  approachable-transf.000webhostapp.com
  appropriatelyselfish.com
  approvallearningallianzcom.shuiacast.top
@@ -163462,6 +163931,7 @@ arababakimi.com
  arabaresmi.com
  arabaudiology.com
  arabbrothers-trad.com
+arabca.net
  arabcoegypt.com
  arabearabe.mypi.co
  arabfannews.com
@@ -163820,7 +164290,6 @@ arinalytova.lopedevega.es
  arinfosolutions.com
  arinidentalcare.com
  arinlays.com
-arirtfiobicrgvuv-dot-owaonk399399393.uk.r.appspot.com
  arisegems.com
  ariseint.org
  arisen.com.my
@@ -164741,6 +165210,7 @@ assessment-self-taxrebate.uk
  assessment-uk1.com
  assessor-quitaonline.com
  assessoria-finan.webnode.pt
+assessoria.quitarbv.com
  assessoriaaymore.online
  assessoriajuridicasantander.godaddysites.com
  assessorialegalnm.com.br
@@ -164772,6 +165242,7 @@ assist-amazon.servecounterstrike.com
  assist-att.net
  assist-paypal.com
  assist-protect.tk
+assist-secure.banyak-rezeky.xyz
  assist-secure.ga
  assist-secure.tk
  assist8971crfbh.com
@@ -164796,7 +165267,6 @@ assistenza-gruppoisp.com
  assistenza-postmobile.com
  assistenza-webank-urgente.com
  assistenza-webinfo.000webhostapp.com
-assistenzacertificata-web.com
  assistenzaclienti-it-clienti.com
  assistenzaclienti-it.com
  assistenzainternetnew.net
@@ -165394,7 +165864,6 @@ att1net.weebly.com
  att2020.weebly.com
  att2020servicesupgrade.weebly.com
  att21.godaddysites.com
-att214543.weebly.com
  att22dfheyu83iofehwyrv78oi3fejwhvyrur78oij3efwhvyu78eiu.loginav2.ga
  att2345.weebly.com
  att255.weebly.com
@@ -165504,6 +165973,7 @@ attdg.weebly.com
  attdom.weebly.com
  attdomainfastservices.weebly.com
  attdomainfastservicescom.weebly.com
+attdomainfitservice.weebly.com
  attdomainhotservices.weebly.com
  attdomainliinks.weebly.com
  attdomainlinkupdate.weebly.com
@@ -165956,7 +166426,6 @@ attserviceresponseteam.weebly.com
  attservices-upgrade2020.weebly.com
  attservices2snet.weebly.com
  attservicesaccount2020.weebly.com
-attservicesettings.weebly.com
  attservicesteam.weebly.com
  attservicesteams.weebly.com
  attservicesupport2020udate.weebly.com
@@ -166182,6 +166651,7 @@ attyahoomanager.weebly.com
  attyahoomanagerrepair.weebly.com
  attyahooocom.weebly.com
  attyahoooserviicee.weebly.com
+attyahooremindersettings.weebly.com
  attyahoorepairconfirmation.weebly.com
  attyahoorepairservice.weebly.com
  attyahooservi.weebly.com
@@ -166552,7 +167022,6 @@ autentificazione-anagraficaban.com
  autentificazione.com
  autentificazioneban.com
  autermtzersd.com
-auth-account-microsoftonline-com-isdnma-kmlsptry.s3-ap-northeast-1.amazonaws.com
  auth-account.wells-informs.com
  auth-accountapp.com
  auth-acessobr.club
@@ -166599,6 +167068,7 @@ auth-mama-gomomsa.ue.r.appspot.com
  auth-managesignin-accountlimitationid94.goji6473.com
  auth-mobile-pp.com
  auth-new-owa-outlook.web.app
+auth-newpayee.cc
  auth-online-account.com
  auth-online-wells-fargo.com
  auth-orange-login.weebly.com
@@ -166769,7 +167239,6 @@ authorisable-closur.000webhostapp.com
  authorisation-support.com
  authorisationsecured.com
  authorise-accounts.com
-authorise-attempted-payment.com
  authorise-cancellation.cc
  authorise-device.co.uk
  authorise-mobilebanking.com
@@ -166788,7 +167257,9 @@ authorization-login-account.site
  authorization.instag.repl.co
  authorizationsupportcascade.000webhostapp.com
  authorize-billing.servehttp.com
+authorize-details.co
  authorize-payee.cc
+authorize-registration.com
  authorize-secure-paypa.com
  authorize-three-co.uk
  authorize9dfauth.serveirc.com
@@ -166917,6 +167388,7 @@ autoemocionate.gonzalezdeautomocion.com
  autoescolaciganos.com.br
  autoescolajavarotti.com.br
  autoescolalucontin.com.br
+autoescolatopsul.com.br
  autoescuelas.vip
  autofax-gmbh.com
  autofiction.org.in
@@ -166976,7 +167448,6 @@ automobile-lambert.com
  automodelismo-rc.com.br
  automotrizoregon.cl
  automyography.net
-autonation-trader.com
  autonews.cardaddy.com
  autoone.co.in
  autoowamail.web.app
@@ -167720,7 +168191,6 @@ ayxcsfkosrzprige-dot-millinium.ey.r.appspot.com
  ayy-85-com.preview-domain.com
  ayyappantat.com
  ayycxmzvkrulobif-dot-millinium.ey.r.appspot.com
-ayyooobosku.ygto.com
  ayzam.com
  az-5.svcoding.com
  az-onepage.000webhostapp.com
@@ -168930,7 +169400,6 @@ banescopanamaonli.com
  banescopanamaonline.com
  banescoredpanamaonline.com
  banestes.tk
-banestesmobile.tk
  banethokdeurali.org.np
  banfdn.com
  bangaloreastrologer.com
@@ -168961,7 +169430,6 @@ bangudinulai.000webhostapp.com
  bangurbhawanbadrinath.com
  bangwaketsi.xyz
  banhangsivn.com
-banhiojanmsas.com
  banhiojanmsasb.com
  banhoatuoi.com
  bani-maryno.ru
@@ -168987,7 +169455,6 @@ bank-negaramy.com
  bank-of-america-adoring-goldstine-c7fac0.netlify.app
  bank-of-america-secure00.dns05.com
  bank-of-america.angkasasakti.co.id
-bank-of-city.webcindario.com
  bank-of-crypto.com
  bank-of-secure.webcindario.com
  bank-online-login3.xyz
@@ -169040,6 +169507,7 @@ bankieren.rabobank.nl.vsg7x72x7l.ml
  bankieren.rabobank.nl.zap557619-1.plesk13.zap-webspace.com
  bankieren.rabobank.nl.zone4209.xyz
  banking-account.work
+banking-lloyd.net
  banking-payee-auth.com
  banking-secure.services
  banking-webank.com
@@ -169517,8 +169985,6 @@ batagorasyik.id
  batal-pemblokiran2020.tk
  batalblokir-akun-fb9.webnode.com
  batalblokirakunfb.vizvaz.com
-batalkan-pemblokiran.ga
-batalkan-pemblokiran.ml
  batarijaru.hopto.org
  bataviarentcar.com
  batcatstore.ga
@@ -169537,7 +170003,6 @@ batech.com.pk
  batesmutablev.com
  bathandbedlinen.com
  bathro.work
-bathroomnerds.com
  bathroomremodelinghumble.com
  bathroomremodelingpearland.com
  bathyspherefurlable.net
@@ -169808,7 +170273,6 @@ bbva-particulares-es.com
  bbva-pe.net
  bbva-preaprobado.club
  bbva-premia.com
-bbva-tr-garanti.com
  bbva-yomequedoencasa.com
  bbva02.bbvagra035.cinemaapkguide.com
  bbvacliente.es
@@ -170658,7 +171122,6 @@ bellsourths.net
  bellsouth2020updateserver.weebly.com
  bellsouth23.weebly.com
  bellsouthcontactemaildeactivation-attyahoomailteam.weebly.com
-bellsouthmailer.weebly.com
  bellsouthmailupdate24.yolasite.com
  bellsouthnetwork.com
  bellsouthsupportadmin.weebly.com
@@ -170732,7 +171195,6 @@ beneficios-itau.ml
  beneficiosparavc.cf
  benefits.creatorlink.net
  benefits1.godaddysites.com
-benefitsworkshop.com
  beneiximet.com
  benevolenceacidity.club
  benevolent-abrasive.000webhostapp.com
@@ -170840,6 +171302,7 @@ berbagivid-whtsapplengkapv5.lflink.com
  berbagivid-whtsapplengkapv6.fartit.com
  berbagivid-whtsapplengkapv8.vizvaz.com
  berbagivide0h0t.000webhostapp.com
+berbagivideo1.otzo.com
  berbagivideobokepterbaru2021.000webhostapp.com
  berbagivideosex2020.000webhostapp.com
  berbagivideosex2030.000webhostapp.com
@@ -171092,6 +171555,7 @@ bestphotographytnj.com
  bestprizesday2.life
  bestproject.com.np
  bestpromo2020.xyz
+bestprovendietsples.us
  bestrading-racing-team.com
  bestrapbeats.com
  bestrategic.asia
@@ -171105,6 +171569,7 @@ bestrhange.ru
  bestrongncourageous.com
  bestsaleexpert.ru
  bestsamplequestions.com
+bestselfiezon.casa
  bestsemarangguide.com
  bestservis.site
  bestservis161.ru
@@ -171144,7 +171609,6 @@ bet365dhw.com
  bet365dhw.net
  bet536488.com
  bet635288.com
-bet99.cyou
  beta-venture.com
  beta.boiniketan.com
  beta.competitionplus.com
@@ -171191,6 +171655,7 @@ betalco.biz
  betaleasinboard.loadingsecure-4.host
  betalen-ing.info
  betalingenverificaties.zone
+betalings-kenmerken.eu
  betalv.wedjoin.com
  betamovil.pezonaviabcp.com
  betaoptimexfreze.com
@@ -171504,6 +171969,7 @@ bfy9ygwg.firebaseapp.com
  bfysutzetgbawaxt-dot-millinium.ey.r.appspot.com
  bg.binarygodfather.com
  bg.dyamm.com
+bg.jandigitalstudios.com
  bg1z.awaykart.com
  bg3sg.xyz
  bg6d44t7w9fe46ght3h.buzz
@@ -171520,6 +171986,7 @@ bgdclvvernrnsqgn-dot-millinium.ey.r.appspot.com
  bgdirectory.net
  bgeneraal.webcindario.com
  bgeneral-403.cba.pl
+bgeneral-cuenta.webcindario.com
  bgeneral-sesion.webcindario.com
  bgeneral-sesion0.webcindario.com
  bgeneral-sesion2.webcindario.com
@@ -171594,6 +172061,7 @@ bh8y.xyz
  bhagavatirannade.org
  bhagwatibuilder.com
  bhagwatiseva.org
+bhaishopee.com
  bhajankutir.vedicseasons.com
  bhamdemo.com
  bhangra-beat.w-byte.com
@@ -171731,6 +172199,7 @@ bicyclesstugustine.com
  bida123.pw
  bidao.edu.mx
  bidaphucphat.com
+biddable-witnesses.000webhostapp.com
  biddingfile-mova.online
  biden-harrisnews.com
  bidencoronavirus.com
@@ -171813,7 +172282,6 @@ bigfatdevelopment.com
  bigfishchain.com
  bigfishing.000webhostapp.com
  bigfit.top
-bigfuck.men
  bigg-live.com
  bigg.jp
  biggamerwebsite.000webhostapp.com
@@ -171970,7 +172438,6 @@ billing-interactransfer.com
  billing-myaccount.com
  billing-myee.com
  billing-myinfo.com
-billing-myo2-validate.com
  billing-mythree.net
  billing-net1.com
  billing-o2info-help.com
@@ -172567,7 +173034,6 @@ bkeeping.com
  bkeoztsiinchttgbcgavnhzdfd-dot-gleowayel400503.uc.r.appspot.com
  bkepgrupwhtsaapp.wikaba.com
  bkepku99.wikaba.com
-bkeptrs.joingrups691.tk
  bkftzpmqtmcyjqvg-dot-millinium.ey.r.appspot.com
  bkgroup.hu
  bkhoskabkiatkhwk-dot-millinium.ey.r.appspot.com
@@ -172613,7 +173079,6 @@ bkphot163.dynamic-dns.net
  bkpindo-wa.join-gruphot.com
  bkpjoin.send20.gq
  bkpjoinwhatsapp.claimholl.me
-bkpmang.joingrups691.tk
  bkpnew.oryio.com
  bkpplanet99.gq
  bkpplanet99.tk
@@ -173099,6 +173564,7 @@ bloomed-compressor.000webhostapp.com
  bloomingtonstar.org
  bloomnfs.com
  bloomspor.com
+bloopressurecontrolwayss.us
  bloqbngmfunkcbli-dot-millinium.ey.r.appspot.com
  bloquenegro.cl
  blorehost.in
@@ -173842,7 +174308,6 @@ bokepindoterbaru1453.000webhostapp.com
  bokepindov2.dns05.com
  bokepindoviral.whatsapp-1992600.tk
  bokepindowikk.000webhostapp.com
-bokepingusan737.ml
  bokepjandahot.0xz.org
  bokepjandahotindo.enemy7.com
  bokepjepang-joingrup134.viral18plus.com
@@ -173880,8 +174345,6 @@ bokepviral2020.viraljoin.com
  bokepviralburuanjoin.000webhostapp.com
  bokepviralcrot.ml
  bokepviralindonesi2020jav.000webhostapp.com
-bokepvirall2-grup.duckdns.org
-bokepvirall3-grup.duckdns.org
  bokepviralllhot.000webhostapp.com
  bokepviralsjoins.gr21.net
  bokepviralss22.joins5.com
@@ -174176,6 +174639,7 @@ bores.xyz
  borgernewsherald.com
  borgierun.com
  boring-davinci-0516c7.netlify.app
+boring-williams-bff0e5.netlify.app
  boringglaucomat.com
  boringglaucomay.com
  borisov-e.info
@@ -174185,7 +174649,6 @@ borneofoodie.com
  bornewasser.com
  bornorealityempowerment.com
  bornskier.com
-bornstroppy.com
  borntochangede.shaxiaarea.top
  borobudurprambanan.com
  boronusi.cf
@@ -175038,7 +175501,6 @@ brighgreen.tk
  bright-moon.co.jp
  bright1.awsmppl.com
  brightamzonservice.com
-brightblab53.com
  brightbots.co.uk
  brightdom53.com
  brighteducationcenter.org.rw
@@ -175968,6 +176430,7 @@ buruan-gabung-grup-wa-video-bokep.000webhostapp.com
  buruan-join-grup-bokep-jepang-tbr2020.000webhostapp.com
  buruan-nonton-bokep-gratis-terbaru.000webhostapp.com
  buruanambilitemsekarang.000webhostapp.com
+buruangabung.forumu.tv
  buruangabunggrubdewasa.000webhostapp.com
  buruanjoin6.whatsapp-youtubers.com
  buruanjoingrup18.getzitemff1.ga
@@ -176054,7 +176517,6 @@ business.fb-ads-id-12e923882776d782e262.com
  business.fit
  business.groceryshop.ae
  business.medianet.org.pk
-business.nestlelife.club
  business.page-fb-item2342-ad4452.com
  business.page-fb-item4365-ad8687.com
  business.page-fb-item5345-ad2433.com
@@ -176119,7 +176581,6 @@ bustcovid19.com
  busted-orifices.000webhostapp.com
  bustillorealestatellc.com
  bustlingequaldatabase.figueroaads123.repl.co
-bustlingviola.com
  bustskins.xyz
  bustv.in
  busurpre.tk
@@ -176277,7 +176738,6 @@ bvhcrzwzppeopnadpprrwihhao-dot-gleowayel400503.uc.r.appspot.com
  bvjdgxvzegpfackydb.top
  bvkfyoejykzowxwn-dot-millinium.ey.r.appspot.com
  bvklsh.000webhostapp.com
-bvkwfntsifzsubqg-dot-owaonk399399393.uk.r.appspot.com
  bvlijrlknclokxhldasjoisldf.000webhostapp.com
  bvnupdate.ddns.net
  bvoccspslbwdstrg-dot-millinium.ey.r.appspot.com
@@ -177164,7 +177624,6 @@ camillemarielle.com
  caminaconmigo.org
  caminhoreal.com
  camino.su
-caminodevida.org.ar
  caminote.com
  camionesconcesta.com
  camisetapersonal.com
@@ -177689,6 +178148,7 @@ care4horseswnet.ru
  carearly.xyz
  carecot.com
  career-att.weebly.com
+career-managements.com
  careeresl.com
  careerindex.info
  careerinmerchantnavy.com
@@ -178386,7 +178846,6 @@ cbdpowerbiz.com
  cbdprime.com
  cbdre.xyz
  cbdshopbournemouth.co.uk
-cbdslate.com
  cbdtchad.com
  cbeabyno.arg.r.uk.a2ip.ru.e.hx.n2vc.eh.r.uk.a2ip.ru
  cbeer.xyz
@@ -178780,7 +179239,6 @@ cdnsecure.03saas.scsbellus.com
  cdogroup.alphansoprojects.com
  cdolechon.com
  cdormperpjgignbq-dot-millinium.ey.r.appspot.com
-cdpn.io
  cdppiura.com
  cdpzeyeaqroimjos-dot-millinium.ey.r.appspot.com
  cdqawrqakkagczql-dot-millinium.ey.r.appspot.com
@@ -178795,7 +179253,6 @@ cds1640.org
  cds84.com
  cdsaascearveavaerv.mygamesonline.org
  cdsanit.fr
-cdsdvokpnhnlbfos-dot-owaonk399399393.uk.r.appspot.com
  cdt-cli-24-com.umbler.net
  cdtilpgpzwvuimhi-dot-millinium.ey.r.appspot.com
  cdtuxeekfxpbwanr-dot-millinium.ey.r.appspot.com
@@ -179031,7 +179488,6 @@ centeraccountcaputowebcsr.com
  centerai.vot.pl
  centercitydogtraining.com
  centered-crawl.000webhostapp.com
-centereventpubgm.com
  centerfax.tk
  centerforcopyright.com
  centerforsustainablehappiness.com
@@ -179223,7 +179679,6 @@ cesaded.cf
  cesaregames.com
  cesaregomme.com
  cesarfalls.buzz
-cesarlobo.com.br
  cesarsautoglass.net
  cesaudio.com
  cescaa.com
@@ -179353,6 +179808,7 @@ cfyouluewtmbgtbvldxroiznmyfyythactqv-dot-cedar-code-289917.nn.r.appspot.com
  cfzxbfyyfratbrcu-dot-millinium.ey.r.appspot.com
  cg-oe.snprobbx.pbz.r.de.a2ip.ru
  cg.hotwp.net
+cg.jandigitalstudios.com
  cg.jjconcreteseattle.com
  cg17f.mentriqq.com
  cg24895.tmweb.ru
@@ -179396,7 +179852,6 @@ cgjerrter.com
  cgjkaatm.shoesmogul.com
  cgjnbieaaoipnfamsknwhjqamaifhjvwpkzi-dot-cryptic-now-290917.ey.r.appspot.com
  cgjnbieaaoipnfamsknwhjqamaifhjvwpkzi.cryptic-now-290917.ey.r.appspot.com
-cgjschgthgaxlbpc-dot-owaonk399399393.uk.r.appspot.com
  cgkhzjhdixkaichl-dot-millinium.ey.r.appspot.com
  cgkurumsalgiris-hemenalbasvur.com
  cglzhi.com
@@ -179435,7 +179890,6 @@ ch-paquette-post-swiss.info
  ch-po-st-tracking.com
  ch-post-service.net
  ch-post-suivre.net
-ch-post-swiss-inc.net
  ch-post-swiss-suivis.florieae.com
  ch-post-swiss.blogspot.com
  ch-post.azurewebsites.net
@@ -180543,7 +180997,6 @@ chatwagrukue.ooguy.com
  chatwashapgrup.000webhostapp.com
  chatwassap.duckdns.org
  chatwatsap123.000webhostapp.com
-chatwavideobkpp.zxety55.ml
  chatwhasaapagrb.ezua.com
  chatwhasap.wa-jos.gq
  chatwhasapbkp.new55.ml
@@ -180645,7 +181098,6 @@ chatwhatsappgirls.tk
  chatwhatsappgroupporn18.mrslove.com
  chatwhatsappgrubsx.pubgproperties.com
  chatwhatsappgrubsx.tk
-chatwhatsappgrup.mypop3.net
  chatwhatsappgrup1.zzux.com
  chatwhatsappgrupbokep.ocry.com
  chatwhatsappgrupbokep.x24hr.com
@@ -180658,6 +181110,7 @@ chatwhatsappjoinbokepdewasaviralterbaru2020.claimz8.com
  chatwhatsappjoinnew.ff-free.ga
  chatwhatsapplus.wa-log90.cf
  chatwhatsappmlbb.eventml33.gq
+chatwhatsappp.gq
  chatwhatsappqh818.toythieves.com
  chatwhatsapps.ezua.com
  chatwhatsapps.ooguy.com
@@ -180779,7 +181232,9 @@ check-identitylog.bounceme.net
  check-kyc.services
  check-login-acc.com
  check-maill.weebly.com
+check-mypayees.co.uk
  check-mypayees.com
+check-payee-online.live
  check-payees-online.com
  check-secure.co.uk
  check-security-team.com
@@ -180866,7 +181321,6 @@ checkpayee-natwest.link
  checkpayeerequest.com
  checkpayees-online.co.uk
  checkpaymentovhintecloud.com
-checkpinsafe.com
  checkpoint--manager-corporation-0031.tk
  checkpoint-bussiness-manager-corporation-018.tk
  checkpoint-bussiness-manager-corporation-022.tk
@@ -180934,7 +181388,6 @@ chekd5nuperuil.biz
  cheklnltau-mobile.com
  chekmyvideos.000webhostapp.com
  chekran.ru
-cheks-f-b-online.email
  chelatefor.cf
  chelitos.com.ve
  chelpil-inv-auth.com
@@ -181022,7 +181475,6 @@ chetracklers.ml
  chett-whattsapp-com.000webhostapp.com
  chetwa-grupbokpterbarujoin.515event.org
  cheucjeskalom.info
-chevingtonvholes.com
  chevreriepierrealaya.fr
  chevrolet-item1173163833014768.site
  chevrolet-marketplaceitem1091063657913958.website
@@ -181489,6 +181941,7 @@ chuyenvanphong24h.vn
  chvmrc.com
  chwfy.goruli.com
  chwilawytchnienia.eu
+chworks.org
  chxnkqfaqkzgdxzn-dot-millinium.ey.r.appspot.com
  chycinversiones.com
  chyejwhy.site
@@ -181865,7 +182318,6 @@ cixz.goruli.com
  cixzserxfsmmxesl-dot-millinium.ey.r.appspot.com
  ciyieydxhsvojixcxwccmbvzpbbmdfqqopbt-dot-cedar-code-289917.nn.r.appspot.com
  ciyut.bibwekerg.com
-ciyvvabifhcmncusnzfxftpqsfqvcczbqsnl-dot-offgl8876899977678.uk.r.appspot.com
  cizemua.org
  cizerl.com
  cizetfdutljlcyuf-dot-millinium.ey.r.appspot.com
@@ -182674,7 +183126,6 @@ clsmes.online
  clsrockies.com
  clt.atomprint.in
  clt1227564.bmetrack.com
-clt679928.benchurl.com
  clttv.yolasite.com
  club-epargne.com
  club-services-online.com
@@ -183122,6 +183573,7 @@ codashoppmlbb.itemdb.com
  codashopxfreeml.wikaba.com
  codashopxmlme.wikaba.com
  codashpppfreeu7.4pu.com
+codasopgratisbyfrontal.000webhostapp.com
  codbo3-cod.com
  code.caleffi.com
  code.vishou.net
@@ -183193,7 +183645,6 @@ cofip-funds.com
  cofrance-telecommefr.fr
  cofrjkmmkwgadoqx-dot-millinium.ey.r.appspot.com
  coghahaand.com
-cogibit53.com
  cogihold.site
  cogimar-ab.net
  cogimodule.com
@@ -183333,10 +183784,10 @@ collect-all-rewards-pubgm-2k20.000webhostapp.com
  collect-halloweeks.com
  collect-helloween-pubg.com
  collect-items13-pubgm.dns05.com
-collect-items16.mrbonus.com
  collect-shops3.forumz.info
  collectable-scratch.000webhostapp.com
  collected.photo
+collectfreeskin.com
  collectible-glass.com
  collectifb.com
  collection.soundfit.me
@@ -183506,11 +183957,7 @@ com-okhmunsuwd.leonie.co.uk
  com-page-signin-account-manage.thehrpoint.co.uk
  com-payment-secure.top
  com-personal.us
-com-post-10474125.bebayuakademi.edu.my
  com-post-12137043.bebayuakademi.edu.my
-com-post-62118879.bebayuakademi.edu.my
-com-post-63571355.bebayuakademi.edu.my
-com-post-70983900.bebayuakademi.edu.my
  com-post-73873687.bebayuakademi.edu.my
  com-post-84066373.bebayuakademi.edu.my
  com-post-84792162.bebayuakademi.edu.my
@@ -183917,7 +184364,6 @@ compendium.ml
  compensationomar.com
  compesat.com
  competaprint.com
-competedomain53.com
  competencialeal.com
  competent-borg-190248.netlify.com
  competent-heisenberg-c2c3b9.netlify.app
@@ -184217,7 +184663,6 @@ confira-dias-dos-pais.com
  confiracomecodasemana.com
  confirm-access-reference003.com
  confirm-access-reference7490.com
-confirm-account-page-service-site.my.id
  confirm-account-page-service.my.id
  confirm-account-repair-info.my.id
  confirm-accounts-support-reporting.my.id
@@ -184234,7 +184679,6 @@ confirm-fbservice.xyz
  confirm-hs-payee.com
  confirm-lnstagram.com.de
  confirm-migrate-me-yahoo-1.webredirect.org
-confirm-mobile-uk.com
  confirm-my-account-pay-pal.4pu.com
  confirm-my-netflix.com
  confirm-my3.info
@@ -184756,6 +185200,7 @@ content-13942128.latuka.com.bo
  content-148819635.helenquan.ca
  content-17931446.voltoq.com
  content-197881736.helenquan.ca
+content-22509228894.keegan21.com
  content-245598993.helenquan.ca
  content-245683065.curetrick.com
  content-27314790.voltoq.com
@@ -184839,6 +185284,7 @@ content-fbook-41087503.roggiehouse.it
  content-fbook-41467885.roggiehouse.it
  content-fbook-43810303.roggiehouse.it
  content-fbook-45801448.roggiehouse.it
+content-fbook-46489679.roggiehouse.it
  content-fbook-47496456.roggiehouse.it
  content-fbook-48052543.roggiehouse.it
  content-fbook-55136966.roggiehouse.it
@@ -184874,6 +185320,7 @@ content-fbook-91908160.roggiehouse.it
  content-fbook-95948646.roggiehouse.it
  content-fbook-96071394.roggiehouse.it
  content-fbook-97163424.roggiehouse.it
+content-fbook-97726659.roggiehouse.it
  content-fbook-99846004.roggiehouse.it
  content-reset-account-support-security-amazon.com
  content-reset-account-support-security-appleid-apple.com
@@ -184964,7 +185411,6 @@ controlla-conto-web.com
  controllers360.000webhostapp.com
  controllineparts.com
  controlling-ports.000webhostapp.com
-controllo-accesso-web.com
  controllo-dati-web.com
  controllo-it-sms.com
  controllo-urgente-mps.com
@@ -184976,7 +185422,6 @@ controlmaxheacom.nckila.gdn
  controlparental.fr
  controlshop.support-futuremarket.com
  controluniquesupport-action.com
-controlvoice.biz
  controlware.com.bd
  contryyou.cloudaccess.host
  contsexcam.xyz
@@ -185148,7 +185593,6 @@ copyright-instagram.net
  copyright-instgram.000webhostapp.com
  copyright-lnstagram-partners.rf.gd
  copyright-lnstagramsupport.com
-copyright-lnstagramvs.tk
  copyright-media-page-review.com
  copyright-mediasupports.com
  copyright-objectives.com
@@ -185220,6 +185664,7 @@ copyrightsupportagency.com
  copyrightsupportliveform.com
  copyrightsupportsservice.com
  copyrightsviolationcenterservice.com
+copyrightt-forms.cf
  copyrightteammsupportqw.ml
  copyrightverified.com
  copyrightviolationinstagram.cf
@@ -185227,7 +185672,6 @@ copyrightviolationsupport.com
  copyrighytsupport.com
  copyrigt-help-security.ml
  copyrihem.000webhostapp.com
-copyriight-online-support.ml
  copystar.co.uk
  copytak.ir
  coq2.hyperphp.com
@@ -185526,6 +185970,7 @@ corporategiftshoper.com
  corporateimagegroup.com.glenfield.com.my
  corporatetoday.org
  corporateworldwidetransportation.com
+corporatiionn.com
  corporation-manager-team.my.id
  corporationbuilders.com
  corporationmicrosoft.duckdns.org
@@ -185721,6 +186166,7 @@ countrication.info
  countrycuffs.com
  countryeggplantr.com
  countryhappy.men
+countryrelaxation.info
  countrywoodinteriors.com
  countsingnorpeo1923.blogspot.al
  countsingnorpeo1923.blogspot.com
@@ -185933,10 +186379,12 @@ covoruloltenesc.ro
  covyfaceb5lt34.000webhostapp.com
  cow-invest.com
  cowansvilleashstead.com
+cowayexpress.com
  cowboyfair.com
  cowc4st.azurewebsites.net
  cowcapitalsee.cyou
  cowdreywoodworking.com
+cowichantroutfitter.com
  cowindustrial.com
  cowjewsandindians.com
  cowmatchsv.com
@@ -186144,6 +186592,7 @@ cpcalendars.cgilogsecuredaccess.com
  cpcalendars.cikaperformance.ma
  cpcalendars.coronaknowledge.com
  cpcalendars.democraticvalues.icu
+cpcalendars.dewasa-bebas.login-ke-whatsapp.tk
  cpcalendars.eurotoolslogz.net
  cpcalendars.fightingforfit.icu
  cpcalendars.findmyiphone-icloud.com
@@ -186431,7 +186880,6 @@ cqnzvnhlijndtjgf-dot-millinium.ey.r.appspot.com
  cqoserve.com
  cqovlwugvfclouqx-dot-millinium.ey.r.appspot.com
  cqpbdbfwdsxscjgl-dot-mnospot.ts.r.appspot.com
-cqpbdbfwdsxscjgl.mnospot.ts.r.appspot.com
  cqpjcdsqshswjtqu-dot-millinium.ey.r.appspot.com
  cqpku.club
  cqpotcpesboqgmup-dot-millinium.ey.r.appspot.com
@@ -186860,12 +187308,12 @@ creditbackfrisdhajk.us
  creditcapital.tdnyc.top
  creditcard.paypaactivate.com
  creditcubeaa.com
-creditdebtmasters.com
  creditfd.us
  creditfixingtips.com
  creditiperhabbogratissicuro100.blogspot.com
  creditmutueldebretagne.bred.app
  creditoitaucard.cf
+creditomicasa-banrural.com
  creditoparajubilados.com
  creditors24.com
  creditposto.com
@@ -186966,6 +187414,7 @@ criptopay374502qw.club
  cris-bob-619.000webhostapp.com
  crisalic.fr
  crisisomar.net
+crispstories.com
  cristal2017.argo.host
  cristaleschile.cl
  cristianaradiofm.com
@@ -187638,7 +188087,6 @@ ctor.ga
  ctos.serveftp.com
  ctp.edu.pe
  ctpbulhijmokbtms-dot-millinium.ey.r.appspot.com
-ctracknxt.in
  ctreporter.azurewebsites.net
  ctrler.cn
  ctrm.svcoding.com
@@ -188029,6 +188477,7 @@ customdemanagerab.ddnsking.com
  customdemanagesal.bounceme.net
  customelectronicsco.com
  customeonline.club
+customer-864241.info
  customer-acc-support.com
  customer-alert.cf
  customer-amazon.login-systeminfo.com
@@ -188059,6 +188508,7 @@ customer-service.work
  customer-support-number.com
  customer-support-wells-fargo.com
  customer-support.link
+customer-support.live
  customer-update.der-co-jp.com
  customer-updatebillingdetailso2.com
  customer-validated.com
@@ -188077,6 +188527,7 @@ customerarea.aruba.it.grupacq.energy
  customerareaffd1dca2-aruba-it0d740238.eurometalsas.it
  customerauthaccount.com
  customercapital.asperlnx.us
+customercare-online-bpi.zzux.com
  customercareweb.weebly.com
  customercarr.me
  customercentre-three.com
@@ -188295,6 +188746,7 @@ cw0x.mentriqq.com
  cw29373.tmweb.ru
  cw2lvlop.firebaseapp.com
  cw32125.tmweb.ru
+cw50752.tmweb.ru
  cw56.dilshantg.com
  cw6x.awaykart.com
  cw7qt.jaysbrand.com
@@ -188314,7 +188766,6 @@ cweb04.gamingweb.de
  cwerki.com
  cweybtittgxtjpkilyulvnkflj-dot-gleowayel400503.uc.r.appspot.com
  cwfkioutqdnikduu-dot-mnospot.ts.r.appspot.com
-cwfkioutqdnikduu.mnospot.ts.r.appspot.com
  cwfyjfiqikptksiyyetxhqjsgd-dot-triple-upgrade-293822.rj.r.appspot.com
  cwgmyvboewocgcpl-dot-millinium.ey.r.appspot.com
  cwialnicmkjwhhxqarondqfkqa-dot-gleowayel400503.uc.r.appspot.com
@@ -188429,7 +188880,6 @@ cy.sherryraynbarnettphotography.com
  cy.virtualbrandstudio.com
  cy1j.awaykart.com
  cy48144.tmweb.ru
-cy50930.tmweb.ru
  cy62976.tmweb.ru
  cy69111.tmweb.ru
  cy70999.tmweb.ru
@@ -189635,7 +190085,6 @@ dba.dk.log-ind.email
  dbbc3db0c32eb6fd59cb18e51be1ada7af017b86.ph
  dbbpohyisnfqylim-dot-millinium.ey.r.appspot.com
  dbcfd.xyz
-dbcnissjksk.com
  dbcomestic.com
  dbcrvxbgnxnamwnwzw.top
  dbd0dd.weebly.com
@@ -190008,7 +190457,6 @@ dealfs.com.ar
  dealinpro.com
  dealio.com.au
  dealmagicsa.co.za
-dealmakersociety.com
  dealmilale.com
  deals.kudocore.com
  dealsdukhan.xyz
@@ -190021,7 +190469,6 @@ deaninstituteonline.org
  deanives9894984.yolasite.com
  deanmorgan.000webhostapp.com
  deannarings.com
-deannolen.com
  deapplemoundo.blogspot.com
  dearcustomers.nednewamazoncard.cyou
  dearcustomers.newamazoncojpdns.monster
@@ -190179,6 +190626,7 @@ deeasrewomsabsubttop.tk
  deedalstudio.xyz
  deedprogress.co.za
  deeds.yolasite.com
+deeehuhhuv.duckdns.org
  deehyiqirvecxykn-dot-millinium.ey.r.appspot.com
  deekartmobile.com
  deeksis.info
@@ -190252,7 +190700,6 @@ defoanda.com
  defoghurdle.com
  defooditaly.com
  defri.xyz
-deft-snows.000webhostapp.com
  deftereos.com
  deftmblematics.com
  deftmezlematic.com
@@ -190693,7 +191140,6 @@ deregister-app.cc
  deregister-dev.online
  deregister-device-alert.com
  deregister-device-secure.com
-deregister-device-uk.com
  deregister-device.cc
  deregister-hali.co.uk
  deregister-mobiledevice-secure.com
@@ -190711,15 +191157,11 @@ deregisterdevice-security.com
  deregisterdevice-verified.co.uk
  deregisterdevice.link
  deregistered-device-alert.com
-deregistered-devices.cc
-deregistered-devices.co
-deregistered-devices.com
-deregistered-devices.live
-deregistered-newdevice.com
  deregisternew-device.com
  deregisternewdevice.cc
  deregisterpayee.com
  deregistration-alert-uk.com
+deregistration-alert.com
  deregistration-newdevice-security.com
  deregistration-secure-uk.com
  derekrubin.com
@@ -191177,7 +191619,6 @@ device-alertprotection.com
  device-alertregistered.com
  device-approve.com
  device-authenticator.com
-device-authorisation-online.com
  device-cancellation.cc
  device-check-halifax.com
  device-confirm-secured.com
@@ -191194,7 +191635,6 @@ device-deregister-secured.com
  device-deregister-uk.com
  device-deregister.co.uk
  device-deregister.link
-device-deregister.me
  device-deregisteredalert.com
  device-deregisteredalerted.com
  device-deregistersecure.link
@@ -191212,6 +191652,7 @@ device-manage.hutakataextreme.info
  device-manager.cc
  device-onlinealert.com
  device-payee-alert.com
+device-payee-authorisation.com
  device-payeeinfringement.link
  device-personal-wells.site
  device-register-uk.com
@@ -191696,7 +192137,6 @@ dhldocumentdhldocumentdhldoc.000webhostapp.com
  dhldostawa.com
  dhlecommerce.servecounterstrike.com
  dhlexperisssweiss.com
-dhlexpersstracking.com
  dhlexpress-logistic.tk
  dhlexpress.club
  dhlexpress.com.index-online.gq
@@ -192665,8 +193105,6 @@ diyyalo.com
  diz-hc.ru
  dizainhome.ru
  dizayntualeta.ru
-dizbjccciponctufjrtkyhbfpt-dot-triple-upgrade-293822.rj.r.appspot.com
-dizbjccciponctufjrtkyhbfpt.triple-upgrade-293822.rj.r.appspot.com
  dizdplutmlicgpgndkrwulflqanecuhsvzjj-dot-glegen303939423233.ue.r.appspot.com
  dizinler.site
  dizocserebozanew.com
@@ -192754,6 +193192,7 @@ dk.406recruit.com
  dk.concreteservicestulsa.com
  dk.coronavirusfreeservice.com
  dk.dirtcheapcoils.us
+dk.dortchlawfirm.info
  dk.etcglobal-llc.info
  dk.lahainalady.com
  dk.levipurvis.com
@@ -193086,7 +193525,6 @@ dnsalnayticsaruba.com
  dnsbet.com
  dnsden.biz
  dnsexterior.com
-dnsgenerate.dynamic-dns.net
  dnsna.xyz
  dnspostmaster.000webhostapp.com
  dnsredirect.loseyourip.com
@@ -193413,6 +193851,7 @@ doklhe9odzkrhzt.e8273.pro
  dokoncit.pro
  doktorlarrehberim.com
  doktorpotenz.xyz
+dokumen.memangbeda.website
  dokyit.000webhostapp.com
  dol.dance
  dol.gov.1ln.cc
@@ -193436,7 +193875,6 @@ dolgozitely.ru
  doliakauj.xyz
  dolibarr.ph-prod.com
  dolichohieric.xyz
-dollar-uk.icu
  dollar.ddns.net
  dollarappstore.com
  dollarsfree2010.000webhostapp.com
@@ -194035,7 +194473,6 @@ download.doumaibiji.cn
  download.easyspeedcheck.com
  download.exrnybuf.cn
  download.fahpvdxw.cn
-download.fixdown.com
  download.gdriveupload.site
  download.hightech100.me
  download.htsoft.vn
@@ -194275,7 +194712,6 @@ drbigness.com
  drbobsimpson.com
  drbox.life
  drcchile.com
-drcfuzgddbfdfklh-dot-owaonk399399393.uk.r.appspot.com
  drchandradental.com
  drcorreamejoresimplantes.com
  drcristianoamaral.com.br
@@ -194577,7 +195013,6 @@ drowsier-dawn.000webhostapp.com
  drpadmapriya.in
  drpam.com.br
  drpbx.life
-drpeneurope.com
  drphilhaggerty.com
  drphiothiha.com
  drpilarvillegas.com
@@ -194753,6 +195188,7 @@ dssasadasdasdsa.ml
  dssct.net
  dssdggsje.com
  dssmgmt.com
+dsssl.is-an-artist.com
  dssteelbuildings.com
  dsszzs.com
  dstk-sosyal-pndmi.com
@@ -195134,7 +195570,6 @@ dvh.cxhqtbh.cn
  dvhlsfqqqamenluv-dot-millinium.ey.r.appspot.com
  dvia-ukrevision.com
  dvia.refund-form347.com
-dviqgppklhmubgbjkrmkicdnbatiolvhdmya-dot-offgl8876899977678.uk.r.appspot.com
  dvissibxdcwpjbqc-dot-millinium.ey.r.appspot.com
  dvla-car-tax.com
  dvla-claim.com
@@ -195461,6 +195896,7 @@ dywk6.leovirals.com
  dyyxcfiz.dermals.org
  dyzymz.com
  dz-infa.000webhostapp.com
+dz.jandigitalstudios.com
  dzad.ddns.net
  dzafesetere.com
  dzbk.dhxctzx.com
@@ -195832,7 +196268,6 @@ eagergreyhound.com
  eagermindssystems.com
  eagle-its.com
  eaglecare.co.uk
-eagleconsultant.co.in
  eaglefliud.com
  eaglekiller.com
  eaglemeetstiger.de
@@ -196121,6 +196556,7 @@ ebay-kleinanzeigen.de-anfrage82734.mueblesfamari.cl
  ebay-kleinanzeigen.de-ewr.space
  ebay-kleinanzeigen.de-gdpr-benutzeruberprufung.xyz
  ebay-kleinanzeigen.de-gdpr-uberprufung.site
+ebay-kleinanzeigen.de-m-einloggen-s-anzeige.coconutbaycondos.com
  ebay-kleinanzeigen.de.m-einloggen.0elvnqyzc39etn1.targeturl.tac.med.br
  ebay-kleinanzeigen.de.m-einloggen.0tnk0zjtqqlbvbu.targeturl.baugesbikeacademie.fr
  ebay-kleinanzeigen.de.m-einloggen.11trzr5u4xtbuuv.targeturl.tac.med.br
@@ -196512,6 +196948,7 @@ ebk5.svcoding.com
  ebkwznnqvcezvckabz.top
  eblmzvxoxocxjmfa-dot-millinium.ey.r.appspot.com
  ebmpapst.online
+ebnyjbewrd.duckdns.org
  ebobhkvwqfzqjgoe-dot-millinium.ey.r.appspot.com
  ebojurmybnhrjxcp-dot-millinium.ey.r.appspot.com
  ebok-poczta.pl
@@ -196600,7 +197037,6 @@ eccashonlinecom.nckichicago.gdn
  eccashonlinecom.shuiacontrast.top
  eccdetailing.com
  eccell.duckdns.org
-ecceywvnijorbyzm-dot-owaonk399399393.uk.r.appspot.com
  eccltdco.com
  eccocipowebaruhaz.com
  eccocomprar.es
@@ -196620,7 +197056,6 @@ ecfishin.com
  ecglanywmfpqvbgt-dot-owaonk399399393.uk.r.appspot.com
  ecgmkgktnzkxwruqzkiqtgsryu-dot-gleowayel400503.uc.r.appspot.com
  ecgwmsbzylvnlwqssihyrqoegmmzfbbphzpg-dot-gl494903049.wl.r.appspot.com
-ech-post-swiss.net
  echaglo.tanglescanner.com
  echaintool.info
  echase-accountrecovery.is-a-geek.com
@@ -196916,7 +197351,6 @@ editionandreasirlecom.augerqisafety.top
  editionomar.com
  editionpercent.com
  editionreality.com
-editions-gervysign.com
  editmutablev.com
  editora.canalcienciascriminais.com.br
  editoranger.com
@@ -197365,7 +197799,6 @@ ee-updateaccount.com
  ee-updatebill.com
  ee-updatebilling.network
  ee-updatebillinginfo.com
-ee-updatebillinginformation.com
  ee-updatebillinguk.com
  ee-updatebills.com
  ee-updatedetails.com
@@ -197751,7 +198184,6 @@ eftwnaeogqejdyogdemtceyuve-dot-gleowayel400503.uc.r.appspot.com
  efullogs05.icu
  efultimate.com
  efuxzskzvagbummq-dot-millinium.ey.r.appspot.com
-efvhhmqsdivjvaxxsvcrupryzp-dot-rapid-access-293716.uk.r.appspot.com
  efvnvvgniohmpjwk-dot-glass-effect-294320.ew.r.appspot.com
  efvuxho.handipants.com
  efvwyicoqqdtpeqx-dot-millinium.ey.r.appspot.com
@@ -198608,6 +199040,7 @@ emailexchange.serveftp.org
  emailfilter-update.sitebeat.site
  emailiupdateionline.weebly.com
  emailjolt.com
+emaillinkbillingupdate.athersite.com
  emaillonlinupgrading.weebly.com
  emailmarketer.thebarcelonasummit.com
  emailmasuk.netflix-minumanstore.com
@@ -198796,7 +199229,6 @@ emobs.nl
  emofly.com
  emogerona.top
  emojidictionary75d139b8243558347d778dafc4b938fe.dns-cloud.net
-emojiplay.vn
  emojitech.cl
  emolitent.com
  emollient-masts.000webhostapp.com
@@ -198817,7 +199249,6 @@ emotionear.com
  emotions-parfums.info
  emotions.mu
  emotivaodontologia.com.br
-emotrash.net
  empathicunbiased.com
  empbv.com
  empclane.xyz
@@ -198914,6 +199345,7 @@ emrahduman.com
  emrahkucukkapdan.com
  emran89.59dj.com
  emranweb.net
+emrausinhvien8.ddns.net
  emregunaydin.com.tr
  emreresmi.000webhostapp.com
  emroozmarket.com
@@ -199057,7 +199489,6 @@ enbfewwzwptozyfqrhtqrybsxp-dot-gleowayel400503.uc.r.appspot.com
  enbl.ml
  enbmw-basvurularesonuc.com
  enbox1ra.com
-enbvifsleqdwknmnvbwcaezosb-dot-triple-upgrade-293822.rj.r.appspot.com
  enbxhczhywigrlms-dot-millinium.ey.r.appspot.com
  encame.com
  encasythumbsa.tk
@@ -199141,6 +199572,7 @@ energenn.world
  energetica.ind.br
  energeticasnc.it
  energeticforum.com
+energeticproductivebrowsers--five-nine.repl.co
  energiaendesa.com
  energiasexual.life
  energiaysistemas.com.sv
@@ -199635,6 +200067,7 @@ epxivazrxv.duckdns.org
  epxtfpauyuudavpxqv.top
  epyieovsnzxatewy-dot-millinium.ey.r.appspot.com
  epyorke.edu.bz
+epz7b.codesandbox.io
  epzlaepehptjhzenlzvubxqusz-dot-gleowayel400503.uc.r.appspot.com
  eq3u-easemanasejarepletadeboasescolhas.com
  eq5ahiqg.firebaseapp.com
@@ -200162,7 +200595,6 @@ espace-mobile-compte.webnode.com.co
  espace-serviceclint.cf
  espace-smsvocale.web.app
  espace-telephonesms.firebaseapp.com
-espace-vocaleprocontacte.firebaseapp.com
  espace-vocaleprocontacte.web.app
  espace.creenbois.free.fr
  espaceclientnotificationopen.webnode.lv
@@ -200773,6 +201205,7 @@ euro-trend.pl
  euroascensores.cl
  euroasia-p.com
  eurobearingsbv.ro
+eurobid.ga
  eurobondfx.com
  eurobrokerage.info
  eurochemco.com
@@ -200994,7 +201427,6 @@ eventluckypubgm.com
  eventluckyspin.xfree1.com
  eventluckyspn.2waky.com
  eventmanagementbali.com
-eventmetroroyale.com
  eventmlbb-s17.00.mrbasic.com
  eventmlbb209.tk
  eventmlbbbkof.zyns.com
@@ -201506,6 +201938,7 @@ expatsmates.com
  expatsolutions.ro
  expcentral-support.com
  expdom.ru
+expected-equipment.000webhostapp.com
  expectgod.com
  expedia.partnercentral-group.com
  expediapartner.central-helpsupport.com
@@ -201996,13 +202429,13 @@ f0470457.xsph.ru
  f0470935.xsph.ru
  f0472382.xsph.ru
  f0472454.xsph.ru
+f0472819.xsph.ru
  f0474479.xsph.ru
  f0477484.xsph.ru
  f0478531.xsph.ru
  f0479624.xsph.ru
  f0482519.xsph.ru
  f0484941.xsph.ru
-f0486370.xsph.ru
  f0487671.xsph.ru
  f04qvvbwwhmxc09y.com
  f0b.casa
@@ -202221,7 +202654,6 @@ face-hediyekodu.com
  face-informotion.ru
  face-mask-coronavirus.com
  face-mob-ccc.000webhostapp.com
-face-mob-wcc.000webhostapp.com
  face-mob-weg.000webhostapp.com
  face-mob-wep.000webhostapp.com
  face-mob-www.000webhostapp.com
@@ -202463,8 +202895,6 @@ facebook-applogin.ml
  facebook-assistance.com
  facebook-authentication-verify.com
  facebook-black-nadia.website
-facebook-block.ml
-facebook-block.tk
  facebook-bras.dnevnikonline.ru
  facebook-business-page-876543234543636.posting49234823747.xyz
  facebook-bussines.com
@@ -202509,6 +202939,7 @@ facebook-checkpoint-restore.profit-pulling-reports.com
  facebook-checkpoint-restore.viralebookprofitsystem.com
  facebook-client.cf
  facebook-clone-csc-17.gedev.com.ng
+facebook-collegare.top-rated-products.com
  facebook-com-006962.bluc.mobi
  facebook-com-01034.fbaen.icu
  facebook-com-120346.loks.mobi
@@ -202637,11 +203068,6 @@ facebook-copyright-media-1000513946.com
  facebook-copyright-review.com
  facebook-copyrights-page.netlify.app
  facebook-customer.tajpharmalb.com
-facebook-data.cf
-facebook-data.ga
-facebook-data.gq
-facebook-data.ml
-facebook-data.tk
  facebook-data43.tk
  facebook-english.com
  facebook-fd.ga
@@ -202736,10 +203162,10 @@ facebook-marketplace-item.36284960.com
  facebook-marketplace-item.5624979270.com
  facebook-marketplace-item.5791037.com
  facebook-marketplace-item.62918576.com
-facebook-marketplace-item.672029587.com
  facebook-marketplace-item.73269064.com
  facebook-marketplace-item02939203823.karnaphuli.org
  facebook-marketplace-listing-item6654.erii4.xyz
+facebook-marketplace.mktiid.com
  facebook-marketplace.us
  facebook-marketplaces-92340.dallasdiadelosmuertos.com
  facebook-marketplaces-item-24232221.laksmihospital.com
@@ -203138,7 +203564,6 @@ facebook.marketplace-item-3504249506257896.com
  facebook.marketplace-item-3504249566257896.com
  facebook.marketplace-item-414952226119360.com
  facebook.marketplace-item382472.highshark.com.ng
-facebook.marketplace-listing.car-1745.picsmw.xyz
  facebook.marketplace.ajkalnews24.com
  facebook.marketplace.doubleubag.com
  facebook.marketplace.inversionesgdp.com
@@ -203325,7 +203750,6 @@ facebookcovid19relieve.com
  facebooke.getforge.io
  facebooke.netlify.app
  facebookfanphoto.0fees.us
-facebookfans.net
  facebookfollow.com
  facebookfotograf.0fees.us
  facebookfriends.robertholiveira.com.br
@@ -203433,7 +203857,6 @@ faceboook-com.puritybinarybtc.com
  faceboook-okey.0fees.us
  faceboook-page1888474.com
  faceboook-page2773104.com
-faceboook-page39155072.com
  faceboook-page48710082.com
  faceboook-page514585845.com
  faceboook-page51474541.com
@@ -203499,6 +203922,7 @@ faceebook-page61589277-id579125832735.winmaurizioeliseo.com
  faceebook.com-id2q5gqhnrcav67b4cudab2b.item76892572839052.com
  faceebook.com.co
  faceebook.somee.com
+faceebookk-prihlaste-se.000webhostapp.com
  faceebooknuevox.000webhostapp.com
  faceebooks.xyz
  faceeboooksecuriity.000webhostapp.com
@@ -204067,6 +204491,7 @@ faschinggilde.at
  faseb00kpy.000webhostapp.com
  faseboek1961.000webhostapp.com
  fasebouk.atspace.com
+fasedeko.com
  faseit.xyz
  fasequatro.com
  fashiaura.com
@@ -204422,6 +204847,7 @@ fb-copyrightservice.com
  fb-copyrightshelp.com
  fb-copyrightsteam.com
  fb-copyrightsupport.com
+fb-estate.com
  fb-facebook-contact-verify.com
  fb-facebook-gaming-verify.com
  fb-faststalking.com
@@ -204492,7 +204918,6 @@ fb-marketplace-215284154.com
  fb-marketplace-215465326.com
  fb-marketplace-21552145214.com
  fb-marketplace-2158420120.com
-fb-marketplace-235484695.com
  fb-marketplace-2514158478.com
  fb-marketplace-25145848.com
  fb-marketplace-25154545415.com
@@ -204752,7 +205177,6 @@ fb-trade-popular.club
  fb-trade-swap-box.club
  fb-trade-swap-buy-market.club
  fb-trade-swap-fast.club
-fb-trade-swap-old-used.club
  fb-trade-swap-wanted.club
  fb-trade-used-sell.club
  fb-trader-marketplace.shop
@@ -204802,16 +205226,6 @@ fb.com-nopost-572934965.ta3asteria.gr
  fb.com-nopost-703721171.ta3asteria.gr
  fb.com-nopost-906752034.ta3asteria.gr
  fb.com-nopost-928958782.ta3asteria.gr
-fb.com-post-00244315.bebayuakademi.edu.my
-fb.com-post-17130862.bebayuakademi.edu.my
-fb.com-post-19381348.bebayuakademi.edu.my
-fb.com-post-35134446.bebayuakademi.edu.my
-fb.com-post-37695852.bebayuakademi.edu.my
-fb.com-post-41690035.bebayuakademi.edu.my
-fb.com-post-53237478.bebayuakademi.edu.my
-fb.com-post-54511377.bebayuakademi.edu.my
-fb.com-post-67258708.bebayuakademi.edu.my
-fb.com-post-81173131.bebayuakademi.edu.my
  fb.com.markeetplace.us
  fb.com0c.casa
  fb.com0e.casa
@@ -204946,7 +205360,6 @@ fb29874-page58793-real-estate-item89536.house
  fb2a16342f7c934d6e248dec17f2be49.webredirect.org
  fb32564-page67456-real-estate-item89735.house
  fb327-items-market46.farmerscentre.com.ng
-fb34567-page27893-real-estate-item76522.house
  fb36578-page98347-real-estate-item25675.com
  fb36745-real-estate-item67534-page82253.com
  fb367485-real-estate-item89256-page39255.com
@@ -205048,23 +205461,38 @@ fbcom-08993725.intertrans-inc.com
  fbcom-13190631.chekkos.mx
  fbcom-14250377.namssa.com
  fbcom-17024115.namssa.com
+fbcom-21356457.kiler.net
+fbcom-23670106.kiler.net
  fbcom-30932019.intertrans-inc.com
  fbcom-32601355.chekkos.mx
  fbcom-32787258.ifms-enargeia.gr
  fbcom-39637245.intertrans-inc.com
+fbcom-40840527.kiler.net
  fbcom-48792742.intertrans-inc.com
  fbcom-51924358.chekkos.mx
+fbcom-54493962.kiler.net
+fbcom-59438308.kiler.net
  fbcom-59680673.ifms-enargeia.gr
  fbcom-59988037.intertrans-inc.com
+fbcom-60729480.kiler.net
  fbcom-61437580.chekkos.mx
+fbcom-63183766.kiler.net
  fbcom-67023669.chekkos.mx
  fbcom-67920099.intertrans-inc.com
  fbcom-69650079.intertrans-inc.com
+fbcom-70819464.kiler.net
  fbcom-72564869.premiumboxes.com
  fbcom-72663250.intertrans-inc.com
+fbcom-72725120.kiler.net
  fbcom-79057342.premiumboxes.com
  fbcom-80119271.chekkos.mx
+fbcom-83537894.kiler.net
+fbcom-83894971.kiler.net
+fbcom-85331540.kiler.net
  fbcom-88251189.intertrans-inc.com
+fbcom-91569308.kiler.net
+fbcom-92703181.kiler.net
+fbcom-92938659.kiler.net
  fbcom-93508368.intertrans-inc.com
  fbcom-98607584.intertrans-inc.com
  fbcom-98989106.kotsiaris.gr
@@ -205270,31 +205698,49 @@ fbonlogins.mypi.co
  fboo0okinbox.000webhostapp.com
  fboob.000webhostapp.com
  fbook-00206656.kakatiyainfra.com
+fbook-02466395.ozelcivata.net
+fbook-05280961.ozelcivata.net
+fbook-08377533.ozelcivata.net
  fbook-08398724.solarenablers.com
  fbook-08804524.solarenablers.com
  fbook-16073289.solarenablers.com
  fbook-2090302.wp2app.io
  fbook-26447956.solarenablers.com
  fbook-27131389.solarenablers.com
+fbook-28219778.ozelcivata.net
  fbook-2927062.wp2app.io
+fbook-29462429.ozelcivata.net
+fbook-35790329.ozelcivata.net
  fbook-39572752.solarenablers.com
  fbook-4044360.wp2app.io
  fbook-42120437.safimmo.com
  fbook-4355871.wp2app.io
  fbook-47501682.almajd.ps
+fbook-47972676.ozelcivata.net
+fbook-49250409.ozelcivata.net
  fbook-52059561.solarenablers.com
  fbook-56570942.solarenablers.com
+fbook-59279112.ozelcivata.net
+fbook-59347330.ozelcivata.net
+fbook-61126240.ozelcivata.net
+fbook-62045388.ozelcivata.net
  fbook-64019895.safimmo.com
  fbook-65985461.solarenablers.com
+fbook-66070285.ozelcivata.net
  fbook-6764969.wp2app.io
+fbook-70780730.ozelcivata.net
+fbook-79917389.ozelcivata.net
  fbook-82062926.solarenablers.com
  fbook-82521972.solarenablers.com
  fbook-83895011.safimmo.com
+fbook-85464785.ozelcivata.net
+fbook-85645832.ozelcivata.net
  fbook-85701266.solarenablers.com
  fbook-87410688.almajd.ps
  fbook-92360512.solarenablers.com
  fbook-93005558.solarenablers.com
  fbook-93167133.almajd.ps
+fbook-94304319.ozelcivata.net
  fbook-97494629.solarenablers.com
  fbook-98068409.almajd.ps
  fbook-98808067.solarenablers.com
@@ -205623,8 +206069,6 @@ fbrealtorad12093.com
  fbrechecker.000webhostapp.com
  fbrecuperarsenha.000webhostapp.com
  fbreedsmh.com
-fbremoved-25693847.shoes-life-com.com
-fbremoved-92047934.shoes-life-com.com
  fbrent.ru
  fbresetpass0102.000webhostapp.com
  fbreview-activity.com
@@ -205662,6 +206106,7 @@ fbss-inrecovery-0023334549hk.cf
  fbstarttouse.000webhostapp.com
  fbstats12.000webhostapp.com
  fbsupport3432.000webhostapp.com
+fbsupportme.000webhostapp.com
  fbtech00.000webhostapp.com
  fbthentication.000webhostapp.com
  fbtsotbs.com
@@ -205799,7 +206244,6 @@ fconnieao.club
  fcoxzinc.nn.r.appspot.com
  fcpkhoughgopbqww-dot-millinium.ey.r.appspot.com
  fcpqyligvbrmzlbuvsneoeyilbrdycbeuayp-dot-offgl8876899977678.uk.r.appspot.com
-fcpqyligvbrmzlbuvsneoeyilbrdycbeuayp.offgl8876899977678.uk.r.appspot.com
  fcpr.addroits.com
  fcpro.pt
  fcpzjwwybtrtmhbbickjepdnkg-dot-gloff849483.uk.r.appspot.com
@@ -206216,7 +206660,6 @@ fertperfect.netlify.app
  fertway.com.br
  fervent-almeida-5d322e.netlify.app
  fervent-liskov-d44a90.netlify.app
-fervent-spence-6968a9.netlify.app
  ferventcapitalhome.com
  fervourtechnologies.com
  ferymspaniumryou.today
@@ -206435,7 +206878,6 @@ fghjr74rhudfguhtfguji.blogspot.com
  fghnj.gq
  fghr213tjt4j13muy4me.buzz
  fgiggsgb.uk
-fgjlcoastzaomped-dot-owaonk399399393.uk.r.appspot.com
  fgjtilbqmijzjwhk-dot-millinium.ey.r.appspot.com
  fgjwfyiuzlukjsziehmpsiaydk-dot-gleowayel400503.uc.r.appspot.com
  fgksdstat14tp.xyz
@@ -206496,7 +206938,6 @@ fhbdjlhbf.mrbonus.com
  fhbjdkm13.com
  fhbrmjldgrujzesebidoptveju-dot-gleowayel400503.uc.r.appspot.com
  fhcigars.com
-fhcnyjicgjauvywi-dot-owaonk399399393.uk.r.appspot.com
  fhcyleq.zjgtcwzhs.com
  fhd.4foslk.cn
  fhdesigen.com
@@ -206753,7 +207194,6 @@ fill-form.co.uk
  fill-hmrcform.com
  fill-in-info.co.uk
  fill-my-form.com
-fill-myform.com
  fill-now-upd.co.uk
  fillablepere.xyz
  fillersplanet.cz
@@ -206884,7 +207324,6 @@ find-my-iphone-world.com
  find-my-location.live
  find-my.apple-auth.com
  find-myiphone.com
-find-offerssoftware.com
  find.icloud.uk-log.in
  find.to-sign.us
  find77com.batwoqisent.top
@@ -206976,11 +207415,11 @@ finixcargo.com
  finixgroup.ga
  finixgroup.ml
  finixgroup.tk
+finkarma.in
  finkgainsborough.com
  finksilent.com
  finlandwayoflearning.in
  finless-teaspoons.000webhostapp.com
-finlfrgppkilofev-dot-owaonk399399393.uk.r.appspot.com
  finlite.com.ua
  finmaxbo.com
  finmsb.com
@@ -207182,6 +207621,7 @@ fitgripsports.com
  fithulk.com
  fitia.org
  fitings.ac.ug
+fitlab.us
  fitmanacademy.com
  fitnect.com
  fitnepali.com
@@ -207228,7 +207668,6 @@ fivestarlike.org
  fivestreetbakery.com
  fivlhalaebuybjnccuhrkaghccfpinsfqfdi-dot-glegen303939423233.ue.r.appspot.com
  fix-a-foto.com
-fix-device.com
  fix-e978a.web.app
  fix-my-account.com
  fix-my3billing.com
@@ -207258,7 +207697,6 @@ fixerrors-mail.gq
  fixerrors-mail.ml
  fixerrors-mail.tk
  fixertawa.blogspot.com
-fixerupperrealestate.com
  fixfly.cf
  fixgameit.com
  fixglucakjs.us
@@ -207335,6 +207773,7 @@ fjz.otters.dev
  fk-engineering.com
  fk.0xbdairolkoie.space
  fk.dd2v.com
+fk.yokweka.com
  fk0-w.jaysbrand.com
  fk3gc.awaykart.com
  fk7zp.svcoding.com
@@ -207379,51 +207818,58 @@ flab-skin.com
  flab-skins.com
  flacland.ir
  flacourtiaceous.xyz
-flag-007314782.amarilisperu.com
+flag-018003415.amarilisperu.com
  flag-024267285.amarilisperu.com
-flag-076321451.amarilisperu.com
+flag-030221846.amarilisperu.com
  flag-09604382.royal-eng.ps
-flag-100758977.amarilisperu.com
+flag-106862287.amarilisperu.com
+flag-107880207.amarilisperu.com
  flag-111854792.amarilisperu.com
  flag-121772663.amarilisperu.com
  flag-124772061.amarilisperu.com
  flag-144425820.amarilisperu.com
  flag-156037398.amarilisperu.com
+flag-161206939.amarilisperu.com
+flag-161647309.amarilisperu.com
+flag-215870544.amarilisperu.com
  flag-235727965.amarilisperu.com
  flag-24167805.royal-eng.ps
  flag-261867290.amarilisperu.com
  flag-272353855.amarilisperu.com
-flag-357242173.amarilisperu.com
+flag-282051470.amarilisperu.com
+flag-307947613.amarilisperu.com
+flag-328816640.amarilisperu.com
+flag-353837213.amarilisperu.com
  flag-365123300.amarilisperu.com
  flag-367566857.amarilisperu.com
  flag-37212174.royal-eng.ps
-flag-388742997.amarilisperu.com
-flag-422486949.amarilisperu.com
+flag-442128895.amarilisperu.com
  flag-466652895.amarilisperu.com
  flag-474898383.amarilisperu.com
-flag-504676519.amarilisperu.com
-flag-534861129.amarilisperu.com
+flag-495766732.amarilisperu.com
  flag-569170333.amarilisperu.com
-flag-640065097.amarilisperu.com
+flag-569540495.amarilisperu.com
+flag-607190647.amarilisperu.com
+flag-619693705.amarilisperu.com
  flag-682398226.amarilisperu.com
-flag-701326296.amarilisperu.com
-flag-726523306.amarilisperu.com
-flag-726923596.amarilisperu.com
+flag-724137242.amarilisperu.com
  flag-751128912.amarilisperu.com
-flag-753331857.amarilisperu.com
+flag-753023786.amarilisperu.com
+flag-760768087.amarilisperu.com
  flag-764210813.amarilisperu.com
-flag-785707216.amarilisperu.com
-flag-786569171.amarilisperu.com
+flag-772602065.amarilisperu.com
+flag-784355441.amarilisperu.com
  flag-803516247.amarilisperu.com
-flag-813114013.amarilisperu.com
  flag-84857437.royal-eng.ps
  flag-860517882.amarilisperu.com
  flag-884461830.amarilisperu.com
  flag-887824702.amarilisperu.com
+flag-895728182.amarilisperu.com
+flag-909057925.amarilisperu.com
  flag-917617594.amarilisperu.com
+flag-928346314.amarilisperu.com
  flag-93721531.royal-eng.ps
  flag-945040160.amarilisperu.com
-flag-960268625.amarilisperu.com
  flag-964409048.amarilisperu.com
  flag-fbook-093100060.asayel.ps
  flag-fbook-116269470.asayel.ps
@@ -207743,7 +208189,6 @@ fluteguard.com
  fluteguards.nn.r.appspot.com
  flutherkangaroo.com
  fluwxtdypmilqojrvohioryjhwltejecyprs-dot-offgl8876899977678.uk.r.appspot.com
-fluwxtdypmilqojrvohioryjhwltejecyprs.offgl8876899977678.uk.r.appspot.com
  fluxcommunity.top
  fluxegtarp.xyz
  fluxpackaging.tk
@@ -207829,6 +208274,8 @@ fmldlepofdmlref.com
  fmldmlrelfdlrerf.com
  fmlkiuhkxmrhdqca-dot-millinium.ey.r.appspot.com
  fmlpevgxngvpuvwb-dot-millinium.ey.r.appspot.com
+fmmartplavebillingsurface.cf
+fmmartplavebillingsurface.gq
  fmmethod.com.bd
  fmmkihmhfdkujxlg-dot-glexcel1.ue.r.appspot.com
  fmnbh.awaykart.com
@@ -208065,13 +208512,11 @@ foojlskfkeohkftk-dot-millinium.ey.r.appspot.com
  fool-signin-webcsr-online.com
  fooledbeer.xyz
  foolwall.com
-foolxmetro.gleeze.com
  fooodshooters.com
  foooosin.com
  foorbock.000webhostapp.com
  fooropetes.com
  football-eg.com
-football24.az
  footballdeclination.com
  footballsi.fun
  footballstep.com
@@ -208101,10 +208546,14 @@ forb-fbookcom-079648419309.ctiaspire.com
  forb-fbookcom-1762002876.ctiaspire.com
  forb-fbookcom-275568722.ctiaspire.com
  forb-fbookcom-3703789379.ctiaspire.com
+forb-fbookcom-381203219364.ctiaspire.com
  forb-fbookcom-402268823.ctiaspire.com
  forb-fbookcom-479624215.ctiaspire.com
  forb-fbookcom-547091572.ctiaspire.com
+forb-fbookcom-621613372155.ctiaspire.com
  forb-fbookcom-678591915966.ctiaspire.com
+forb-fbookcom-797787682.ctiaspire.com
+forb-fbookcom-925925312650.ctiaspire.com
  forb-fbookcom-9514673328.ctiaspire.com
  forb-fbookcom-993120860758.ctiaspire.com
  forbiddenarmy.com
@@ -208200,6 +208649,7 @@ forkier-tenth.000webhostapp.com
  forkintheroadchef.com
  forkinz.com
  forkliftpricing.com
+forkswaw.xyz
  forladies.pk
  forlantas.com
  forlatestourfloralclim2020home.com
@@ -208690,6 +209140,7 @@ freactionsners.xyz
  freahaircool.work
  freajkiih.com
  freakranews.club
+frealowasten.tk
  freamer.de
  freazerp.net
  freckchidek.com
@@ -208726,6 +209177,8 @@ free-bundle-item-free-fire.000webhostapp.com
  free-bytes.com
  free-chat981.ml
  free-claim4.cf
+free-claims62.cf
+free-claims62.gq
  free-depth.ru
  free-doppler.fun
  free-faceebook.000webhostapp.com
@@ -208981,6 +209434,8 @@ freespin.bft45.com
  freespin13.ucskin2020.com
  freespin13.zzux.com
  freespin3k.club
+freespinevents.com
+freespinpubgmobile.com
  freespins18k.xyz
  freespins198.xyz
  freespiritmind.com
@@ -209009,7 +209464,6 @@ freetricks.xyz
  freetwerkhunt.ml
  freetwerksx.ml
  freetwerkxxx.ml
-freetwinkxx.ml
  freeuccforpubggg.000webhostapp.com
  freeucday.com
  freeucforindian.000webhostapp.com
@@ -209037,7 +209491,6 @@ freexnxx.ocry.com
  freexnxx.wizzks.com
  freexnxx1.dynip.org
  freexskins.club
-freextwerk.ml
  freexulai.com
  freexxtwerkz.ml
  freey-joingrub.otzo.com
@@ -209055,7 +209508,6 @@ freightagents.net
  freightnation.com
  freimuthgroup.com
  freiniacae.com
-freirecharterschool-da.ga
  freitasfla.com
  freitasflyer.com
  freiwilligessozialesjahrorg.baerseventhere.top
@@ -209199,7 +209651,6 @@ friseursekretariatcom.nckiaccounting.gdn
  friseursekretariatcom.nckifitness.gdn
  friseursekretariatcom.shaxiaact.top
  friseursekretariatcom.shaxiaadd.top
-frisidea.com
  friskbells.top
  friskyeliquid.com
  frisoesen.dk
@@ -209361,6 +209812,7 @@ fsdfew.dmtxsc.com
  fsdfsdfdsfds.jubileechristiansantuary.org
  fsdfxzh.kyemtynd.best
  fsdgf.hgjkfdg.top
+fsdlgxrtal.duckdns.org
  fsdqwyqhutjgbsne-dot-millinium.ey.r.appspot.com
  fsdrwpjonmgkzaq.top
  fsdsorsryoqpjfzp-dot-millinium.ey.r.appspot.com
@@ -209597,7 +210049,6 @@ fullthrottlebottles.com
  fulltruyen.net
  fullupa.temp.swtest.ru
  fullveterinaria.com
-fullvidio18pluss.bkp-indocrot.ml
  fullwellsfarg9936.uc.r.appspot.com
  fullwoods.xyz
  fulness.xyz
@@ -210148,7 +210599,6 @@ gabung-groub-bokep-seksi-2020.kulgar-infoupdate.ga
  gabung-groub-whatsapp-bokep.bft25.com
  gabung-groupbokepindo.xxuz.com
  gabung-grub-18-plus-2020-new-grub.000webhostapp.com
-gabung-grub-bokep-terbaru.tk
  gabung-grub-bokep-terviral.000webhostapp.com
  gabung-grub-dewasa-18-sekarng.000webhostapp.com
  gabung-grub21.000webhostapp.com
@@ -210360,7 +210810,6 @@ galipvidinlioglu.com.tr
  galja.xxuz.com
  gallag.000webhostapp.com
  gallaidur.com
-gallant-thompson-1e5f8a.netlify.app
  gallantcapitalpartners.com
  gallantequity.com
  galleonguild.com
@@ -210501,7 +210950,6 @@ ganegamoks.com
  ganeshatahiti.com
  ganeshfestivalusa.org
  gangbanghangchang.myftp.biz
-gangbangvideos.top
  gangbangvidsxxx.ocry.com
  gangda.info
  gangflixs.com
@@ -210688,7 +211136,6 @@ gaswatstroy.online
  gatapfrxspfpfaki-dot-millinium.ey.r.appspot.com
  gataumalespengentruk.ikwb.com
  gate.mindblowserverdocnetwork.xyz
-gate.royal-eng.ps
  gatehousebankplc.com
  gatehub.club
  gatehub.online
@@ -210887,7 +211334,6 @@ gcbtofrebvpkyvva-dot-millinium.ey.r.appspot.com
  gcc-microsoftonline.sg
  gcckwkanlawjcgri-dot-millinium.ey.r.appspot.com
  gccwoeqdwlzawkpqlionddpgpe-dot-gleowayel400503.uc.r.appspot.com
-gcddimhjsrpuurcxyblqvkzdjsildjhqrypx-dot-offgl8876899977678.uk.r.appspot.com
  gcenbvdtuqdwwrym-dot-millinium.ey.r.appspot.com
  gcesab.com
  gcfnyxxhailyazjg-dot-millinium.ey.r.appspot.com
@@ -210969,7 +211415,6 @@ gdisohinxjjhtqjtfeioivwprwosybxbnnoi-dot-solar-vertex-285913.rj.r.appspot.com
  gdjetjun.work
  gdjpb.onderhost.com
  gdkhjdl.godaddysites.com
-gdkvpnbllvhyuggn-dot-owaonk399399393.uk.r.appspot.com
  gdlgefol.club
  gdlin.com.ar
  gdllurelcjqryivrsiyjouonatxduacordqx-dot-cedar-code-289917.nn.r.appspot.com
@@ -211051,7 +211496,6 @@ gebzeugurlucocukkulubu.com
  gec.rw
  gecfornmosa.com
  gechy.ru
-geckoaudioindonesia.com
  geckoprint.com.au
  geckus.com
  gecnhkxkeapdlucp-dot-millinium.ey.r.appspot.com
@@ -211317,6 +211761,7 @@ geosealf.com
  geosrt.com
  geotechnic.co.uk
  geotexsas.com
+geovanda.net
  geoverde.cl
  geovision.ro
  geozduqgfqitdesh-dot-millinium.ey.r.appspot.com
@@ -212008,9 +212453,11 @@ gifted-meitner-f631bf.netlify.app
  giftedewha.or.kr
  giftedhands-association.com
  giftedition.co.uk
+gifteventnew.com
  giftfowllers10k.000webhostapp.com
  giftfreee.xyz
  giftingtimes.in
+giftmetros16.com
  giftmidasbuy.com
  giftofahealinghand.com
  giftraaga.com
@@ -212039,6 +212486,7 @@ gifvideos.in
  gigaia.com
  giganteslatinos.com
  giganticacio.co.uk
+gigardo.temp.swtest.ru
  gigatelibertadores.ddns.net
  gigehvdoiqcolfxz-dot-millinium.ey.r.appspot.com
  gigeveryday.com
@@ -212166,7 +212614,6 @@ gisel2020.dynamic-dns.net
  gisell1.com
  giselviral.juaratembak.com
  gispen.group
-gist247xyz.000webhostapp.com
  gisvarna.com
  gisy028946038documents2020.wm.r.appspot.com
  git.abm-jsc.ru
@@ -212380,6 +212827,7 @@ gkz9877oj.gq
  gkzdzzgcvi.duckdns.org
  gkznvxbnhoghmknm-dot-millinium.ey.r.appspot.com
  gkzsulewrxqxouxo-dot-millinium.ey.r.appspot.com
+gl-pubgmobile.com
  gl.microstore.top
  gl6063f3cc237zqm.com
  glacierinc.xyz
@@ -212574,7 +213022,6 @@ globalresults.cf
  globalro.com.br
  globalrosomsfn.com
  globalrxsupply.ru
-globalsauce-view-order.000webhostapp.com
  globalsdffeweee.com
  globalsecure99.com
  globalsharesecurefilesgood.duckdns.org
@@ -212821,6 +213268,7 @@ gnrb.awaykart.com
  gnrehbtobgcckvwsstwhmyrpxd-dot-gleowayel400503.uc.r.appspot.com
  gns.io
  gns73.onderhost.com
+gnshgsj2871.com
  gnsjkixnradggmyq-dot-millinium.ey.r.appspot.com
  gnstkkywwgcsqttsqsprtnevhsnjjqjpxebs-dot-solar-vertex-285913.rj.r.appspot.com
  gnsxekwfwhensbcv-dot-millinium.ey.r.appspot.com
@@ -213510,6 +213958,7 @@ gov-uk-claim-tax-refund.com
  gov-uk-evaluate.com
  gov-uk-evaluatetax.com
  gov-uk-hmrc.com
+gov-uk-portal-rebate.com
  gov-uk-returntax.com
  gov-uk-reviewtax.com
  gov-uk-tax-refund.com
@@ -213522,6 +213971,7 @@ gov-ukrebate.com
  gov-ukreclaim.com
  gov-uktax.services
  gov-uktaxrefund.com
+gov-vehicletax-refund.com
  gov-verifytaxinfo.com
  gov-virusclaim.com
  gov-warszawa.pl
@@ -213564,6 +214014,8 @@ gov.hmrc.tax-reclaim.co
  gov.hmrc.tax-refunduk.co
  gov.hmrc.uk-reclaim.com
  gov.hmrc.uktaxrefund.uk
+gov.pandemic-update.org
+gov.pandemic-updates.org
  gov.rebate-grant.com
  gov.rebate0201.com
  gov.rebate021.com
@@ -213710,6 +214162,7 @@ goyastore.shaxiaput.top
  goyayoga.shaxiaas.top
  goyldpzsf.goruli.com
  goz6tpm.gmz.cc
+goziopredator.armsexclusive.com
  gozowindmill.com
  gozttlzffamyltud-dot-millinium.ey.r.appspot.com
  gozyattloginmails.weebly.com
@@ -213835,7 +214288,6 @@ gr0upbokep-asia4.duckdns.org
  gr0upbokep-europa.duckdns.org
  gr0upbokep-japan42.duckdns.org
  gr0upbokep-japanese3.duckdns.org
-gr0upbokep-virall1.duckdns.org
  gr0upbokep-xnv1.duckdns.org
  gr0upbokep-xnv2.duckdns.org
  gr0upfriendswithbenefitsfbgroupfaceb00kfb.000webhostapp.com
@@ -213899,7 +214351,6 @@ grafenoprojetos.com
  grafgeo.ru
  grafica10.com.br
  graficabueno.com.br
-graficapubblicita.com
  graficon.es
  grafishop.com.ar
  grafoaksara.com
@@ -213922,7 +214373,6 @@ gramview.yellow-bat-79.telebit.io
  gran4.blob.core.windows.net
  grananphota.tk
  granbyumber.com
-grancapital.mx
  grand-avtolombard.ru
  grand-battle.pp.ru
  grand-ducal-elevati.000webhostapp.com
@@ -213985,7 +214435,6 @@ graphxdc.com
  graphyskill.com
  grapplegroup.com
  graqvsgwiopeadcdxvcvbnjftgovfdcfjtnv-dot-offgl8876899977678.uk.r.appspot.com
-graqvsgwiopeadcdxvcvbnjftgovfdcfjtnv.offgl8876899977678.uk.r.appspot.com
  grasi903drive43.my.id
  grasi99drive01.my.id
  grasiawidows.com
@@ -214264,7 +214713,6 @@ grgpng.dynu.net
  grgrub-18join.zyns.com
  grhak.com
  grhnwls.goruli.com
-grhrizeguithihkjguerug.000webhostapp.com
  grhupupb3.hot1.shop
  griced.xyz
  gridiron.com.br
@@ -214362,6 +214810,7 @@ groudpwoergeneratorgs.us
  groughway.buzz
  grounded-therapies.co.uk
  groundedforyoungpeople.com
+groundpowergeneratorks.us
  groundwater.co.ke
  group-18-sans.wikaba.com
  group-afr.com
@@ -214390,7 +214839,6 @@ group-porn82ulnw.dynamic-dns.net
  group-porn82ulp.dynamic-dns.net
  group-porn82ulpd.dynamic-dns.net
  group-porn82uo.wikaba.com
-group-porn82uon.dynamic-dns.net
  group-porn82uoop.dynamic-dns.net
  group-porn82uosk.dynamic-dns.net
  group-porn82up1.dynamic-dns.net
@@ -214797,7 +215245,6 @@ grp02.id.rakuten.co.jp.23ed3f978a5e1dbec9fe23c48b7ebc9e7b96a355.xyz
  grp02.id.rakuten.co.jp.edfd217c9270db99772758d905918ac821efdcaa.info
  grp08-id.rakuten.co.jp.updateinfo-id-343956804.com
  grp5j.weblium.site
-grpbk.giize.com
  grpbkp03.accesscam.org
  grpbkpwa.xx.ygto.com
  grptrades.co.uk
@@ -215739,7 +216186,6 @@ gruppolspaggiornamento.gq
  gruppolspotpallert.000webhostapp.com
  gruppornowhatsapp798.joinhot-xxx.ga
  grupposecureintesa.com
-gruppowow.it
  grupppbokep18plus.000webhostapp.com
  grupprontalgaming.25u.com
  gruppwa1.yourtrap.com
@@ -215791,6 +216237,7 @@ gruppwhatsapp.myz.info
  gruppwhatsappp120.dynamic-dns.net
  gruppwhatsappp6rdq.dns05.com
  gruppwhatsappp6sg.dns05.com
+gruppwhatsappsma.tk
  gruprealfrontal.my.id
  grups-wa.claim654.com
  grups-whatsapp.25u.com
@@ -216015,6 +216462,7 @@ grupwhatsapp-bkp.lflink.com
  grupwhatsapp-indo.loginnow.gq
  grupwhatsapp-new.otzo.com
  grupwhatsapp-neww.otzo.com
+grupwhatsapp-notnot.onmypc.org
  grupwhatsapp-terbaru2020.ddns.info
  grupwhatsapp.19covidd.com
  grupwhatsapp.70srv.nl
@@ -216524,7 +216972,6 @@ guoxiaorui.cn
  gupoty.aninik.me
  gupovipteamsos.com
  guppon.com
-guptaneha.com
  guputhy.site
  guqseolznnedwulq-dot-millinium.ey.r.appspot.com
  gurandgo.co.il
@@ -216849,7 +217296,6 @@ gzllsguanorsabme-dot-millinium.ey.r.appspot.com
  gzlvycvurcpsbbpu-dot-millinium.ey.r.appspot.com
  gzmakxlfweqdwask-dot-millinium.ey.r.appspot.com
  gzmkwsd.tk
-gzmnihtuoktwlefp-dot-owaonk399399393.uk.r.appspot.com
  gznvbudensxbbjng-dot-millinium.ey.r.appspot.com
  gznytaelytrqqcczugdrwvdsmj-dot-gleowayel400503.uc.r.appspot.com
  gzoeyitjl.dermals.org
@@ -216879,6 +217325,7 @@ h-m-r-c-sec-form-r-e-f-u-n-d-form.ru
  h-n6.ailacabs.com
  h-office.com
  h-plc-alertnewdeviceadded.com
+h-plc-authorizedevice.co
  h-plc-device-remove.com
  h-plc-remove-device.com
  h-plc-verifynew.com
@@ -217048,7 +217495,6 @@ hack006.ddns.net
  hack312.ddns.net
  hack450.com
  hack4you.ru
-hackademit.fr
  hackanything.myftp.biz
  hackdunyasi.tech
  hacker-soft.ddns.net
@@ -217136,6 +217582,7 @@ haidalawyers.com
  haihaihai046.000webhostapp.com
  haiifax-banking.co.uk
  haiifax-secured.co.uk
+haiifax-updated-device.com
  haiifaxsecure.co.uk
  haija-update.com
  haijiangfriut.com
@@ -217164,6 +217611,7 @@ hairlineunisexsalon.com
  hairlossprotocolrevi.us
  hairnetty.wordpress.com
  hairremovalhiaripl.us
+hairrevitalsx.us
  hairsalon-locco.net
  hairsalonnorwich.xyz
  hairspecialist.xyz
@@ -217244,20 +217692,20 @@ halfruffs.com
  halfs-71.tk
  halfwayor.com
  hali-alerts.com
+hali-authoriselogin.com
  hali-devicelinked.com
-hali-devicepaired.com
+hali-fax-secure-alerts.link
  hali-fax.secure-protection.com
  hali-fax.user.linencraft.ca
  hali-faxnewpayee.com
-hali-linkdevice.com
-hali-login-secure.link
+hali-login-attempt.com
  hali-new-device-activity.com
  hali-new-device-activity.link
-hali-newdevice.com
  hali-newlogin.com
  hali-official-bank.com
  hali-reviewpayee.com
  hali-secure-alert.link
+hali-secure-devices.com
  hali-secure-icancel.com
  hali-secure-my-online-banking.com
  hali-secure-payee.live
@@ -217265,7 +217713,7 @@ hali-secure-voidpayee.com
  hali-secure.com
  hali-secureinfos.com
  hali-suspicious-activity.com
-hali-suspiciouslogin.com
+hali.add-newpayee.com
  hali.device-linked.com
  hali.disable-mypayee.com
  hali.fax-paym-request.online
@@ -217275,7 +217723,6 @@ hali.verify-transactions.com
  haliauth.authdevice-login.com
  haliaxpgsss.000webhostapp.com
  haliecanyonapt.xyz
-halifax-247live.com
  halifax-account.com
  halifax-alert-device.com
  halifax-alert.cc
@@ -217311,17 +217758,20 @@ halifax-confirm.com
  halifax-databreach.info
  halifax-dataprotect.net
  halifax-dataprotection.com
-halifax-declinepayee.com
  halifax-deletedevice.link
  halifax-deregistering.com
  halifax-device-alert.com
  halifax-device-alert.info
  halifax-device-authenticator.com
  halifax-device-authorisation.com
+halifax-device-check.com
+halifax-device-error.com
  halifax-device-registration.com
  halifax-device-secuirty.com
+halifax-device-secvrity.com
  halifax-device-updates.com
  halifax-device-verify.com
+halifax-devicealert.com
  halifax-deviceauthenticator.com
  halifax-deviceauthorisation.com
  halifax-deviceauthorised.com
@@ -217355,6 +217805,7 @@ halifax-issues.info
  halifax-linkdevice.com
  halifax-livechat.com
  halifax-livehelp.com
+halifax-livehelpdesk.com
  halifax-liveteam.com
  halifax-login-online.com
  halifax-login.com
@@ -217385,9 +217836,8 @@ halifax-online-issue.com
  halifax-online-payment.com
  halifax-online-secure-login.com
  halifax-online-secure.com
-halifax-online-uk.com
  halifax-online-verify.com
-halifax-onlinedevices.com
+halifax-online-web.com
  halifax-onlineinfo.com
  halifax-onlinepayee.com
  halifax-onlinepayment.com
@@ -217419,6 +217869,7 @@ halifax-protection-support.com
  halifax-queries.com
  halifax-recipient-alert.com
  halifax-recipient-security.com
+halifax-recipient-support.com
  halifax-recipient.com
  halifax-registered-devices.com
  halifax-remove-payee.com
@@ -217429,7 +217880,6 @@ halifax-removepayee.ru
  halifax-resolve.info
  halifax-review.link
  halifax-reviewteam.com
-halifax-safteyteam.com
  halifax-scamchecks.com
  halifax-sec.net
  halifax-secure-alert.com
@@ -217451,6 +217901,7 @@ halifax-secure-payment.com
  halifax-secure.info
  halifax-secure.online
  halifax-secure.verify-checkpayee.com
+halifax-secure.verifypayee-now.com
  halifax-securebanking.com
  halifax-securebanking.info
  halifax-securecancel.com
@@ -217465,6 +217916,7 @@ halifax-secureonline.com
  halifax-secureonline.live
  halifax-securepayee.com
  halifax-security-authorise-user91029101.net
+halifax-security-authorise-user911021.com
  halifax-security-check.com
  halifax-security-payee.com
  halifax-security-payee.net
@@ -217472,20 +217924,21 @@ halifax-security-uk.com
  halifax-security-update.com
  halifax-securitypayees.com
  halifax-securityprompt.com
+halifax-securityteamuk.com
  halifax-securityupdate.com
  halifax-ssecure.link
  halifax-support-team.com
  halifax-support.com
+halifax-supportlive.com
  halifax-suspiciouslogin.com
  halifax-uk-account.com
  halifax-uk-alerts.link
  halifax-uk-security.com
  halifax-ukmobilepayment.com
-halifax-unregisterdevice.com
  halifax-unusual-device.com
  halifax-unusual-login.com
-halifax-update.co.uk
  halifax-update.com
+halifax-updated-device.com
  halifax-updatedevice.com
  halifax-updatesecurity.com
  halifax-validatelogin.com
@@ -217496,7 +217949,6 @@ halifax-verify-payee-team.com
  halifax-verifyaccount.com
  halifax-verifying-payee.com
  halifax-verifynewdevice.com
-halifax-verifypayee-team.com
  halifax-verifypayee.com
  halifax-verifypayments.com
  halifax.access-mydevice.uk
@@ -217601,6 +218053,7 @@ halifax.co.uk.app-review-4912.info
  halifax.co.uk.app-review-5347.info
  halifax.co.uk.app-review-5670.info
  halifax.co.uk.app-review-5808.info
+halifax.co.uk.app-review-5946.info
  halifax.co.uk.app-review-5965.info
  halifax.co.uk.app-review-6231.info
  halifax.co.uk.app-review-6253.info
@@ -217714,6 +218167,7 @@ halifax.login-payee-authentication.com
  halifax.login-payee-issue-verify.com
  halifax.login-payee-issues-authentication.com
  halifax.login-personal-authenticate-device-verify.com
+halifax.login-personal-device-auth.com
  halifax.login-removedevice.com
  halifax.login-verify-authenticate-device.com
  halifax.login-verifymynewdevice.com
@@ -217873,12 +218327,14 @@ halifax.personal-user-profile.com
  halifax.personal-user-verify.com
  halifax.personal-validate-payee-logon.com
  halifax.personalbanking-issue.com
+halifax.personalbanking-manage.com
  halifax.personalbanking-security.com
  halifax.profile-user-check.com
  halifax.registration-device.com
  halifax.remove-new-payee.com
  halifax.remove-payee.link
  halifax.removedevice-auth.com
+halifax.removelinked-device.com
  halifax.removepaired-device.com
  halifax.removepayee.link
  halifax.removepayeeinfo.com
@@ -218000,7 +218456,6 @@ halifaxdevicemanagement.com
  halifaxdevices.cc
  halifaxdevices.com
  halifaxdevicesecurity.com
-halifaxdeviceteam.com
  halifaxdeviceukteam.com
  halifaxdeviceverification.com
  halifaxfraud-alert.com
@@ -218021,13 +218476,16 @@ halifaxfraudprotection.com
  halifaxfraudprotectionuk.com
  halifaxfraudteam.com
  halifaxgroupsecurity.com
+halifaxhelper.com
  halifaxid.it
+halifaxlive-support.com
  halifaxlogin-payeeverify.com
  halifaxmanage.com
  halifaxmanagementfixuk.com
  halifaxmanagepayee.com
  halifaxmanagepayee.net
  halifaxmobileattempt.com
+halifaxnetwork.co.uk
  halifaxnew-payee.com
  halifaxnewlogin.com
  halifaxnewpayee-alert-setup.com
@@ -218067,10 +218525,10 @@ halifaxscamalertsteam.com
  halifaxscampreventionalert.com
  halifaxscampreventiongroup.com
  halifaxscampreventionteam.com
-halifaxscams-alert.com
  halifaxsecinc.link
-halifaxsecure-mypayee-help.com
+halifaxsecure-account.com
  halifaxsecure-onlinelogin.com
+halifaxsecure-payee.com
  halifaxsecure-supportcentre.com
  halifaxsecure.link
  halifaxsecure.live
@@ -218300,7 +218758,6 @@ haozdal.leosery.pw
  haozhonghuanbao.com
  hap.io
  hapaistanbul.com
-hapcgnskogotqzgd-dot-tetete-app.ue.r.appspot.com
  hapito60.hopto.org
  hapoalim2021.000webhostapp.com
  hapolty.com
@@ -218443,6 +218900,7 @@ harvestfamilychurch.life
  harvey-821.ga
  harveybp.com
  haryanayogparishad.com
+has23.tk
  hasanagafatura.com
  hasanburkay.com
  hasandanalioglu.com
@@ -218810,7 +219268,6 @@ hduigmvofakyotn.top
  hdutitriorueurtouwyetywetytofyj5849650583701444.reconfirm-info-advanced-us2020-advanced.my.id
  hduu.000webhostapp.com
  hdvoexwrucrjldre-dot-millinium.ey.r.appspot.com
-hdvsfahtgsquare.com
  hdwiiqmjrnhlntrb-dot-millinium.ey.r.appspot.com
  hdwuhd.godaddysites.com
  hdww6.codesandbox.io
@@ -218873,7 +219330,6 @@ healthca19.com
  healthcare-notice.000webhostapp.com
  healthcarejobsuae.com
  healthcareprop.000webhostapp.com
-healthcaretrainingsolutions.ie
  healthcaring.xyz
  healthclock.icu
  healthconnectltd.com
@@ -218978,6 +219434,7 @@ heberts.qc.ca
  hebhaitian.com
  hebkft.hu
  hebreoenlinea-chms.mx
+hebrertd.com
  hebros.id
  hechiceriadeamoryprosperidadisrael.com
  hecka.myddns.me
@@ -219216,6 +219673,7 @@ help-instagramdkdkdk.ml
  help-instagramforms.com
  help-instagramformsupport.ml
  help-instagramhelpcenters.cf
+help-instagramusercopyright.ga
  help-instagramverified-center.com
  help-instagramverified.tk
  help-listed.uk
@@ -219307,6 +219765,7 @@ help.padipos.id
  help.paypal-activity.net
  help.paypal.com-informationaccounts.com
  help.saiyou.me
+help.twitter-support.com
  help.verify-client.fdgrester.ga
  help.verify-client.jsauwkal.cf
  help.verify.clientt.club
@@ -219414,6 +219873,7 @@ helpline-abuse-404-422.azurewebsites.net
  helpline-abuse-404-423.azurewebsites.net
  helpline-abuse-404-432.azurewebsites.net
  helpline4everyone.ml
+helplnstagram-center.tk
  helplnstagramcenter.com
  helplnstagramchannel.cf
  helplnstagramcontact5087423.com
@@ -219770,6 +220230,7 @@ hfvpdnudktfwowxkqtpdmgqlxv-dot-gleowayel400503.uc.r.appspot.com
  hfw.meeting-2077.com
  hfwyxwqvpclvfbhn-dot-millinium.ey.r.appspot.com
  hfx-online-cancel.com
+hfx-online-secure.com
  hfxyw.com
  hfyxjx.1039.net
  hg76ytsdas.appspot.com
@@ -219804,7 +220265,6 @@ hggspjhbuhnayiegsolnyqyyyeedzljoefic-dot-offgl8876899977678.uk.r.appspot.com
  hggstore.in
  hggwvrhwzuqrjakrxmyezkfiojgoxjaqhgtu-dot-glxcel49934343434.rj.r.appspot.com
  hghdefined.com
-hghdhsdgsupport.net
  hghltdpendin-gemail.imfast.io
  hghpskvvboiivacr-dot-millinium.ey.r.appspot.com
  hgj8.svcoding.com
@@ -220146,7 +220606,6 @@ hinmpzpdapjmnkuxvadhlazpzt-dot-gleowayel400503.uc.r.appspot.com
  hinsorn.ac.th
  hinter-den-schlagzeilen.info
  hinterface.com
-hintzstreetapt.buzz
  hiohgtr.gq
  hiontrendy.com
  hiosbonhome.com
@@ -220281,8 +220740,8 @@ hjg.jdxgwv.com.cn
  hjg.jfpbdn.com.cn
  hjg.jxlxtvh.cn
  hjg.khesxpk.cn
+hjg.nkkhmxn.cn
  hjg.pjtdpjl.cn
-hjg.pwdbahs.cn
  hjg.uygwjjq.cn
  hjg.xpdfrlz.cn
  hjg.xtnnllj.cn
@@ -220424,7 +220883,6 @@ hleia.com
  hlfax-securedetect.com
  hlfx-securedinfo.com
  hlfx-verifypayee.com
-hlfxonline-verify-payee.com
  hlfxonline.com
  hlfxsecuredevice.cc
  hlgfco.xyz
@@ -220451,7 +220909,6 @@ hlse.sovereignty2020.com
  hlsquared.ca
  hlss.jigsy.com
  hlthyeqdbkyzmuft-dot-millinium.ey.r.appspot.com
-hltlmvzxekctgclwzvifdftxvfyjwqfyllbq-dot-offgl8876899977678.uk.r.appspot.com
  hltps-wwv-bancoestado-cl.clinicadentistar489.com
  hltps-wwv-bancoripley-cl.publicidadtechtre.com
  hltps-wwv.bancodebogota.com.co-alt.com
@@ -220594,7 +221051,6 @@ hmrc-support.info
  hmrc-tax-assessment.com
  hmrc-tax-portal.com
  hmrc-tax-rebates-govuk.com
-hmrc-tax-rebates.net
  hmrc-tax-rebates.ru
  hmrc-tax-refund-claim.com
  hmrc-tax-refund-uk.fund
@@ -220619,6 +221075,7 @@ hmrc-uk.net
  hmrc-ukgovinfo.com
  hmrc-ukrepayments.com
  hmrc-uktax.com
+hmrc-uktaxrepayment.com
  hmrc-verification-uk.com
  hmrc.accounts-confirm.org
  hmrc.alert-repayments.com
@@ -220643,7 +221100,6 @@ hmrc.gov-securetaxrebate.org
  hmrc.gov-securetaxrefund.org
  hmrc.gov-securetaxreturn.org
  hmrc.gov-support-uk.com
-hmrc.gov-tax-refunds.co.uk
  hmrc.gov-taxrebate-secure.org
  hmrc.gov-taxrebate-uk.org
  hmrc.gov-taxrefund-secure.org
@@ -220734,9 +221190,9 @@ hmrc.return-calculation-form.uk
  hmrc.return-calculation.uk
  hmrc.return.ref574.com
  hmrc.returnmymoney.xyz
+hmrc.returns-manager.co.uk
  hmrc.returnuk.co
  hmrc.safexsecured.com
-hmrc.scum24s.com
  hmrc.secure-rebate-service.com
  hmrc.secure-rebate.uk
  hmrc.secure-return-form.uk
@@ -220785,6 +221241,7 @@ hmrcrefund-gov-taxreturn.com
  hmrcrefund-ukgov.com
  hmrcrefund.net
  hmrcs-rebates.info
+hmrcsupport-tax.info
  hmrcsupport.com
  hmrctax-refund-gov.com
  hmrctax-refund-uk.services
@@ -220808,6 +221265,7 @@ hmrcuk-onlineform.com
  hmrcuk-rebate.com
  hmrcuk-tax-refund.com
  hmrcuk-taxrefund.services
+hmrcuk.ref36.co.uk
  hmrcukgov.info
  hmrcuktaxform.com
  hmrebate.co.uk
@@ -220817,6 +221275,7 @@ hmrebatesuk.com
  hmrebateuk.com
  hmrefcgov.com
  hmrefgovd.com
+hmrefhub.com
  hmrefrc.com
  hmrefund-secure.com
  hmregovd.com
@@ -220846,7 +221305,6 @@ hmutkwvjvkhkyyie-dot-millinium.ey.r.appspot.com
  hmuv2.blob.core.windows.net
  hmvcri.com
  hmvjofabqfgzgipr-dot-millinium.ey.r.appspot.com
-hmvjsmclrbqefqzhsjmyhhydvtydwmgkitry-dot-offgl8876899977678.uk.r.appspot.com
  hmxwczhmhewisoim-dot-millinium.ey.r.appspot.com
  hmyahymgbwpvsbyo-dot-millinium.ey.r.appspot.com
  hmyj.cc
@@ -221259,6 +221717,7 @@ homeoftheplayer.com
  homeopharma.pt
  homeostatic-limps.000webhostapp.com
  homepage-verify-unauthorizedactivity.webredirect.org
+homepageacc.my.id
  homepagelog.z13.web.core.windows.net
  homepay.life
  homepcblog.com
@@ -221499,7 +221958,6 @@ host-listing-49875.casa
  host-listing-52263.casa
  host-listing-53263.casa
  host-listing-68413.casa
-host-listing-77875.casa
  host-listing-89875.casa
  host-listing-98413.casa
  host-pub1.info
@@ -221965,7 +222423,6 @@ hptq.dilshantg.com
  hpttttdmicmedhsp-dot-millinium.ey.r.appspot.com
  hptuooiatwormyj.serveirc.com
  hpvivgjoevvkhxxg-dot-glass-effect-294320.ew.r.appspot.com
-hpvivgjoevvkhxxg.glass-effect-294320.ew.r.appspot.com
  hpvsupport.mine.nu
  hpvzuoiouiauiabf-dot-millinium.ey.r.appspot.com
  hpwdvmnpwdigtrve-dot-millinium.ey.r.appspot.com
@@ -222148,6 +222605,7 @@ hs-notifycheck.com
  hs-notifychecks.com
  hs-onlinebankingsecurity.com
  hs-payee-authen.net
+hs-payeealerts-secured.com
  hs-payeeprotect.cc
  hs-payeeprotection.cc
  hs-payees-security.com
@@ -222205,7 +222663,6 @@ hs27772.kro.kr
  hs7f.mentriqq.com
  hsaey.xyz
  hsahznmvdcpluzjj-dot-millinium.ey.r.appspot.com
-hsaikeol.mybigcommerce.com
  hsalertpayment.com
  hsalerts-confirmpayee.com
  hsapidllsignlnssluidcoetyneridsiteidruhttp.aba.vg
@@ -222430,10 +222887,12 @@ hse4.awaykart.com
  hse828549.c828443s-qpnyi828443-pzjtov828447.com
  hsecaravans.co.uk
  hseda.com
+hseekwiiii.duckdns.org
  hsefx.duckdns.org
  hseodrqd.xtechspro.com
  hseqingenieros.com
  hsermansndy4chemicalknowledgeeducationtf.duckdns.org
+hserrerddd.duckdns.org
  hsewd.xyz
  hsgkerala.org
  hsgprints.co.uk
@@ -223515,7 +223974,6 @@ iblmjsvyvdspuwzajcxssnmzhgcwtkzmgtbq-dot-offglen.uk.r.appspot.com
  iblnet.shaxiapurpose.top
  iblogjia.com
  ibluetoothproject.icu
-ibmlotusnoteslogin.7m.pl
  ibmnakrxwspzoatvyu.top
  ibmrwnseqkoebnxt-dot-millinium.ey.r.appspot.com
  ibn-usa.com
@@ -224310,7 +224768,6 @@ ideapail.com
  ideapharmed.com
  ideas-more.com.sa
  ideascomunitarias.org.mx
-ideasight.info
  ideastoipo.com
  ideavideo.cyou
  idec-sociiety-cosmos.cf
@@ -224811,7 +225268,6 @@ igcopyrightcentral.com
  igcopyrightcentre.com
  igcopyrightshelpform.com
  igcopyrightsteam.ml
-igcopyrightverifyservices.ml
  igcountme.000webhostapp.com
  igcse.tismumbai.in
  igcythxlroaxvveh-dot-millinium.ey.r.appspot.com
@@ -224947,7 +225403,6 @@ ihjaz.com
  ihjlgefnhgjpzwaggzrhfvkowvhadsevrjrl-dot-solar-vertex-285913.rj.r.appspot.com
  ihjpsvqwanv.qpoe.com
  ihlashaberajans.net
-ihlasturk-habertrt.org
  ihmcrs.com
  ihmicri.com
  ihnaaciwwujylfdxtkxhlypctltmjvzxqsje-dot-cedar-code-289917.nn.r.appspot.com
@@ -225820,7 +226275,6 @@ indianjobs.info
  indiankitchenfood.com
  indianlegalwork.com
  indianolawa.buzz
-indianredpristinemineral--five-nine.repl.co
  indiansteamrailwaysociety.in
  indiaohc.com
  indiapharmaexpo.in
@@ -226056,7 +226510,6 @@ info-myee.co.uk
  info-myee.com
  info-myo2-updatesalert.com
  info-mythree.co
-info-netflix-updatesalert.com
  info-news24.eu
  info-nl-knab.com
  info-nubank.com
@@ -226176,7 +226629,6 @@ infoemail.appcaixa.club
  infoeventpb.com
  infofbupdate.com
  infofyi4.com
-infogiveaway.toh.info
  infoglerging.xyz
  infogotherie.me
  infografia.info
@@ -226225,7 +226677,6 @@ infoporlaptop.info
  infoppuser.com
  infoprofessional.info
  infopromo.biz
-infopubgrt.com
  infopublishersassociation.com
  infopurcase-appleld.gsjgsgjajs.com
  infopurchasemanagement.com
@@ -226379,7 +226830,6 @@ ing-app.services
  ing-bank.icu
  ing-bankieren.net
  ing-be-bank.com
-ing-berichtgeving.info
  ing-betalingsverzoek.com
  ing-bevestigen.com
  ing-buero-naujok.de
@@ -226925,7 +227375,6 @@ instagram-account-support-center.com
  instagram-account-verification.monikariecke.de
  instagram-account-verify-badge.com
  instagram-account.host
-instagram-accounts-password-reset-d5as6d1.loxblog.com
  instagram-accountverify.ml
  instagram-active.1gb.ru
  instagram-badge-verification-services.ml
@@ -227246,6 +227695,7 @@ instagramcopyrig.0fees.us
  instagramcopyright-appeal.ga
  instagramcopyright-form.com
  instagramcopyright-forms.tk
+instagramcopyright-in.tk
  instagramcopyright-information.com
  instagramcopyright-support.com
  instagramcopyright-team.cf
@@ -227288,7 +227738,6 @@ instagramdevicesupport.com
  instagramdocuments.com
  instagramdogrula.ml
  instagramendors.verifikasicenter.ga
-instagramendorse.verifcenterig.tk
  instagramfb.cf
  instagramfollower.getz20.net
  instagramforbuisness.ml
@@ -227384,6 +227833,7 @@ instagramrulesforcopyright.com
  instagrams--bluebadge.com
  instagrams.pestmobile.net
  instagrams.xn--hlp-fma.net
+instagramsecure.servebeer.com
  instagramsecured.com
  instagramsecurity.xyz
  instagramsecurityhelp.ml
@@ -228091,6 +228541,7 @@ intstotylogyttonet.xyz
  intuitive-hush.000webhostapp.com
  intuitiveideas.com.my
  inuestafhynangtg-dot-glexcel1.ue.r.appspot.com
+inuillllll.000webhostapp.com
  inukgrrgcsydibjbevadhmmzcf-dot-triple-upgrade-293822.rj.r.appspot.com
  inukgrrgcsydibjbevadhmmzcf.triple-upgrade-293822.rj.r.appspot.com
  inumo.ru
@@ -228235,7 +228686,6 @@ invitegrup-viral.justdied.com
  invitegrup2020hit.000webhostapp.com
  invitegruphijab2020.000webhostapp.com
  invitestore.co
-invitewa.whatsapp-1026627.cf
  invitewa.whatsapp-1029.ga
  invitewhatsapp-grupdewasa.xxicv.gq
  invitewhatsapp.com
@@ -228384,6 +228834,7 @@ ioshubsol.com
  iosioid.top
  iosk.shop
  iosndder.com
+iospoep.000webhostapp.com
  iosvaaippejpxrzb-dot-millinium.ey.r.appspot.com
  ioszetid.cn
  ioszm.com
@@ -228632,7 +229083,6 @@ irapak.com
  iraqiclam.com
  iraqpharmacy.com
  irashares.prodigygroupindia.com
-iraumuuhcjtzjtix-dot-owaonk399399393.uk.r.appspot.com
  irc.okeyedon.com
  irchdlilnkfkrsqy-dot-millinium.ey.r.appspot.com
  ircon.com.sa
@@ -228833,6 +229283,7 @@ iscosafricashipping.org
  iscpdc.org
  iscrnliwotlqldwpljgkgwltsc-dot-gloff849483.uk.r.appspot.com
  isdbpjdoswufzednpuevihthyw-dot-gleowayel400503.uc.r.appspot.com
+isdzoop09.uk.r.appspot.com
  isearchplaces.com
  isecure-app.com
  isecure-authorise.com
@@ -229330,10 +229781,8 @@ item-marketplace-5145847.com
  item-marketplace-54158488.com
  item-marketplace-5415878.com
  item-marketplace-564602.com
-item-marketplace-5648754876.com
  item-marketplace-6102515.com
  item-marketplace-654847854.com
-item-marketplace-6564584.com
  item-marketplace-747474o.com
  item-marketplace22514455.com
  item-marketplace514851458.com
@@ -229743,6 +230192,7 @@ ixtusenterprises.com
  ixubvlfsmrlmnfjp-dot-millinium.ey.r.appspot.com
  ixufpeqjw.rogagot.com
  ixw-aruba.com
+ixxyllmmpc.duckdns.org
  ixzhzjhgscqwuvos-dot-millinium.ey.r.appspot.com
  iy9erpxzoaz.appspot.com
  iya.net.cn
@@ -229774,7 +230224,6 @@ iyro-----login.ygber.com
  iyrwh.rogagot.com
  iyshyslihptzdepkpcpjewmanu-dot-gleowayel400503.uc.r.appspot.com
  iyuxxdxrzcijimirrcxawzdkdubmrxkgynwr-dot-woven-perigee-290416.uk.r.appspot.com
-iyuxxdxrzcijimirrcxawzdkdubmrxkgynwr.woven-perigee-290416.uk.r.appspot.com
  iyvmavjrktjmatzojeyevgpghf-dot-triple-upgrade-293822.rj.r.appspot.com
  iyvmavjrktjmatzojeyevgpghf.triple-upgrade-293822.rj.r.appspot.com
  iyvwuaketjtkdehy-dot-millinium.ey.r.appspot.com
@@ -229903,7 +230352,6 @@ ja.gucac.com
  ja.ufjchrueiowzndhalfjr.top
  ja85qpz.merlontean.com
  ja95.svcoding.com
-jaaada.com
  jaagotum.com
  jaankijaansk.club
  jaap-online.org
@@ -230762,7 +231210,6 @@ jessemejia.com
  jessenewhart.com
  jessetorres.com
  jesseworld.eu
-jessica-pilley.xyz
  jessica0932.xyz
  jessica423463.xyz
  jessica573profile.item-sale-store.us
@@ -231001,7 +231448,6 @@ jiangyou.yfqzdfd.com
  jiankangweishi.net
  jianyuanguoji.com
  jiaonaghuaodkjp.com
-jiaoyuzixun.cn
  jiaoyvwang.cn
  jiaozhou.06rl.com
  jiashan.06wi.com
@@ -231180,7 +231626,6 @@ jixnbl.com
  jiyasweetsandrestaurant.com
  jiyatechnology.com
  jiycsfohrurgcklzxcamdlvgfcodtefgoqfg-dot-gl494903049.wl.r.appspot.com
-jiyou789yu-j.weebly.com
  jiyuchen.club
  jiyushu.cn
  jiyuviyuitservices.com
@@ -231226,7 +231671,6 @@ jjiioonuy89.000webhostapp.com
  jjitjhspfcdxydcp-dot-millinium.ey.r.appspot.com
  jjj.snprobbx.pbz.r.de.a2ip.ru
  jjjaya.zadc.ru
-jjjgcbyqmhkykmtfklpllvdwmkgtjcdqiegq-dot-offgl8876899977678.uk.r.appspot.com
  jjjkkiinn.com
  jjjknocotwrtkgcu-dot-millinium.ey.r.appspot.com
  jjjs.xyz
@@ -231235,7 +231679,6 @@ jjkhgiveway.ml
  jjkvcxfpqugdztnvaqddfutxjq-dot-gleowayel400503.uc.r.appspot.com
  jjload02.top
  jjload05.top
-jjmphewwfszrhbgh-dot-owaonk399399393.uk.r.appspot.com
  jjmyr3r6j5qn.talagaremix.com
  jjnhvh.org
  jjnsjnsjnsjnsiookai.weebly.com
@@ -231409,7 +231852,6 @@ jmmzpddkasjkzwgyxniktniyye-dot-gleowayel400503.uc.r.appspot.com
  jmnmqxlfrzxrzhcy-dot-millinium.ey.r.appspot.com
  jmollqawjnzkffmr-dot-millinium.ey.r.appspot.com
  jmopsmvxsluxjqed-dot-millinium.ey.r.appspot.com
-jmozpuzaclcfhdubygxxjpogaasdaxwpamdz-dot-offgl8876899977678.uk.r.appspot.com
  jmpartsolutions.com.co
  jmrb.co.id
  jmrc.goruli.com
@@ -231645,7 +232087,6 @@ johnakonnn.000webhostapp.com
  johnbarclay.ca
  johnbrussel.nl
  johnchaasebnk.000webhostapp.com
-johnchahdiks.com
  johncharlesdental.com.au
  johncoleman.info
  johndonut.com
@@ -232140,6 +232581,7 @@ joinchatwhatsapp53.mrbonus.com
  joinchatwhatsapp6.mrbonus.com
  joinchatwhatsapp70.mrbonus.com
  joinchatwhatsapp77.mrbonus.com
+joinchatwhatsappgrupbokepindonesia2020terbaru.xnxneecc9.cf
  joinchatwhatsappjoin2020.2waky.com
  joinchatwhatsappnew.dynamic-dns.net
  joincoys.00.itemdb.com
@@ -232328,7 +232770,6 @@ joingrup2020.vip-smm.com
  joingrup21.whatsapp-web-271.gq
  joingrup213.whatsapp-web-298.gq
  joingrup26.wa18.org
-joingrup34.whatsapp-web-272.ga
  joingrup351.getxx.org
  joingrup463.whatsapp-1026627.gq
  joingrup4646.ml
@@ -232621,7 +233062,6 @@ joinporngroup.net
  joinporngrup.00.mrbasic.com
  joinremi.com
  joinrwmaja.hol50.com
-joins-wagroup.itsaol.com
  joins-whatsapp18.4dq.com
  joins-whatsapp18.login-5.ga
  joinsange18.v7z.shop
@@ -232633,6 +233073,7 @@ joinsexxx.wa-hotnew.ga
  joinsgroups.000webhostapp.com
  joinsgrup.ml
  joinsgrupbokepnewgroupwhatsapp.newsx4.com
+joinsgrupwhatsapp-khusus.fartit.com
  joinsmembergrupwhstapp.ga
  joinss-whatsappp.wikaba.com
  joinswa.bokepindo.vipxs.tk
@@ -232897,6 +233338,7 @@ josiekirton.homeip.net
  josinsgrupbokeps.pap10.com
  josiselectric.com
  joskaejw.club
+josneely01.com
  jossafossa.nl
  josten-boost.de
  jostgroup.org
@@ -233410,7 +233852,6 @@ jqijfzvtap.project.fastpages.io
  jqjgxnbrnyyyjcdc-dot-millinium.ey.r.appspot.com
  jqjulxi.goruli.com
  jqlcoudtjiwtlqaxzfkktbdctnmhprlpzgcc-dot-glenxpecial3009493.ey.r.appspot.com
-jqlthdtmzfugfinffpavxzedrfjemszhbifv-dot-offgl8876899977678.uk.r.appspot.com
  jqnasacfqybwhdvhux.top
  jqnmvf.rogagot.com
  jqpu179.cn
@@ -233675,6 +234116,7 @@ juanmanuelnavia.com
  juanthradio.com
  juantrejoo.com
  jubilant-beach.cloudvent.net
+jubileeeducationinstitute.com
  jubilengua.com
  jubiskincare.com
  jubkecbwboakcjsx-dot-millinium.ey.r.appspot.com
@@ -233738,7 +234180,6 @@ juicygg-skin.com
  juiflwhtpoynrshc-dot-millinium.ey.r.appspot.com
  juiia.tk
  juiib.tk
-juil.info
  jujlpuefxagqdpmywfuscbqpei-dot-gleowayel400503.uc.r.appspot.com
  jujqqmivydwxlsdv-dot-millinium.ey.r.appspot.com
  jujuflix.com
@@ -234088,7 +234529,6 @@ jxjnnlvojzulljkkytdngltpavwjtecaovgx-dot-solar-vertex-285913.rj.r.appspot.com
  jxjygfkfltcezylv-dot-millinium.ey.r.appspot.com
  jxlbfowi.goruli.com
  jxmjyl.com
-jxneclaqbrtonsyebityivkpcsijkdtljdmc-dot-offgl8876899977678.uk.r.appspot.com
  jxnzxx.com
  jxqiohetayrhhrap-dot-millinium.ey.r.appspot.com
  jxqkh.dogestocks.com
@@ -234109,7 +234549,6 @@ jy8388.com
  jy8788.com
  jycajzgkznfjnprwuzgokeycovczebsicyou-dot-gl494903049.wl.r.appspot.com
  jycingenieria.cl
-jydqgjuvfdxlzrex-dot-owaonk399399393.uk.r.appspot.com
  jyeiodf.com
  jyekonuieihyokcn-dot-millinium.ey.r.appspot.com
  jyellowl.serveftp.com
@@ -234211,7 +234650,6 @@ k-techtools.com
  k-thephotostudio.com
  k.5qa.so
  k.com-35348450.vochtplekken.be
-k.com.eac.by
  k.honker.info
  k.ludong.tv
  k.psdzy.com
@@ -234615,6 +235053,7 @@ kapsonsdryfruits.ooo
  kapztldvlxhfejil-dot-millinium.ey.r.appspot.com
  kaq0.jaysbrand.com
  kaq5.awaykart.com
+karaba-ko.net
  karabu.quebec
  karacaoglu.nl
  karafarinsho.com
@@ -234892,7 +235331,6 @@ kaylerealms-group.com
  kayojhqkqdmdpulr-dot-millinium.ey.r.appspot.com
  kaysdinettes.com
  kayserimobilyam.com
-kaywdojtxysljhctihygapbzjh-dot-rapid-access-293716.uk.r.appspot.com
  kaz.shariki1.kz
  kaz.xtechspro.com
  kaza1234.com
@@ -234935,7 +235373,6 @@ kbfvzoboss.bid
  kbgc.com.hk
  kbgdvslzbppytyln-dot-millinium.ey.r.appspot.com
  kbgh.com.tr
-kbhckywiuyvrmqpv-dot-owaonk399399393.uk.r.appspot.com
  kbhgyqtsfafvklsf-dot-millinium.ey.r.appspot.com
  kbhmat.dk
  kbimperial.com
@@ -235028,7 +235465,6 @@ kddi-id.com
  kddinddd.com
  kdell-electrical.com
  kdexim.com
-kdexport.com
  kdf77.com
  kdfgiu.com
  kdgh.goruli.com
@@ -236154,7 +236590,6 @@ kjahjsahj.tk
  kjajkcmnklla.weebly.com
  kjarjpaoudeoepzkhfbzuykqen-dot-gleowayel400503.uc.r.appspot.com
  kjasblka.weebly.com
-kjasjhdsui.weebly.com
  kjavikcraven.xyz
  kjbhfxejjpyyrcdfcm.top
  kjcfgjiqkrlstrgw-dot-millinium.ey.r.appspot.com
@@ -236197,7 +236632,6 @@ kjt800.com
  kjtg.info
  kjtp0.svcoding.com
  kjtshswajbjvivxk-dot-millinium.ey.r.appspot.com
-kjvcvbnm.weebly.com
  kjwdkyglqwsduznl-dot-millinium.ey.r.appspot.com
  kjwgjdkj.weebly.com
  kk-0t.jaysbrand.com
@@ -236278,6 +236712,7 @@ klantauthenticatie-paypail.nl
  klantbetalen.xyz
  klanten-registrate.info
  klanten-verificatie.info
+klantenachterstand-omgeving.club
  klantenoverzicht-achterstand.eu
  klantenservicebelgies.com
  klantenservices-inglogin.nl
@@ -236531,6 +236966,7 @@ knjp8.jaysbrand.com
  knleahslxqloncxhdhpxbckeba-dot-gleowayel400503.uc.r.appspot.com
  knljnjonbojbojl.000webhostapp.com
  knmecom.shaxiaact.top
+knneyles01.com
  knnhsbgmnmycnhpqzjsd.top
  knnvrxxssusfxnrw-dot-millinium.ey.r.appspot.com
  knnxakjnkzyunankhqywcxdhaj-dot-gleowayel400503.uc.r.appspot.com
@@ -237049,7 +237485,6 @@ kpsynfsmquawolgwrlhedpkxjjurmgbizeum-dot-cryptic-now-290917.ey.r.appspot.com
  kpt1m6i.gmz.cc
  kptnkgdipugtvmumrqkcgttaqw-dot-gloff849483.uk.r.appspot.com
  kpu-kalbarprov.go.id
-kpueu.com
  kpuluymfzrjwstbedvaocveebd-dot-gleowayel400503.uc.r.appspot.com
  kpulwklzolpbholierzdvitgfszqbhvnikbv-dot-glegen303939423233.ue.r.appspot.com
  kpuru.com
@@ -237350,7 +237785,6 @@ ktkjnpbjokfggdik-dot-millinium.ey.r.appspot.com
  ktktst.com
  ktlxn.dermals.org
  ktml.org
-ktmmarts.com
  kto-kruche.fun
  ktoler.000webhostapp.com
  ktoooo.com
@@ -237628,7 +238062,6 @@ kvkrwd.org
  kvkujsjxvbcziirg-dot-millinium.ey.r.appspot.com
  kvlynivopdwkpvziufmbtplgpq-dot-triple-upgrade-293822.rj.r.appspot.com
  kvlynivopdwkpvziufmbtplgpq.triple-upgrade-293822.rj.r.appspot.com
-kvm-cloudid276196.keghtyag.com
  kvmappsciod272861.fjrmmk.com
  kvmmawxlrlefifar-dot-millinium.ey.r.appspot.com
  kvmmrkrkksaugwzkjbdlwfqqtijppnyftquv-dot-glegen303939423233.ue.r.appspot.com
@@ -237822,6 +238255,7 @@ kzrkuhvnvxeneifk-dot-millinium.ey.r.appspot.com
  kzrtcpcaplhcrizx-dot-millinium.ey.r.appspot.com
  kzsjygpl.goruli.com
  kzsrhlindaqbbusc-dot-millinium.ey.r.appspot.com
+kztckv07.firebaseapp.com
  kzvhfexdkzsfijut-dot-millinium.ey.r.appspot.com
  kzvvvayqkktmbwjx-dot-millinium.ey.r.appspot.com
  kzwscywhjytyhjie-dot-millinium.ey.r.appspot.com
@@ -238390,7 +238824,6 @@ larry536363.xyz
  larry8483621.xyz
  larryacannon.com
  larrycarter.com
-larryplacenorth.xyz
  larryreilly.com
  larryslist.com
  larrysmith.com
@@ -238787,9 +239220,6 @@ lcywdy.pricetabonline.su
  lczhetnhekybubim-dot-millinium.ey.r.appspot.com
  lczyp.com
  ld-access.com
-ld-fbook-0011878467.riottrack.live
-ld-fbook-01724039280.riottrack.live
-ld-fbook-5751281213.riottrack.live
  ld.lhd.cloudns.asia
  ld.wuenci.wang
  ld.zzz.com.ua
@@ -238952,6 +239382,7 @@ learning854.000webhostapp.com
  learningcomputing.org
  learningisfun.co.nz
  learningsolutionsgroup.org
+learnpiano.casa
  learnseo.co.il
  learnteachweb.ru
  learntech2earn.com
@@ -239365,7 +239796,6 @@ lethatrace.buzz
  letholedriving.co.za
  letiansichang.com
  leticiagale.ru
-letmakeitbetter.com
  letmakeitgood.com
  letmeshowww.000webhostapp.com
  letrikacom.nckiaccounting.gdn
@@ -239598,7 +240028,6 @@ lhsxobypekwvvnwzergicghmhfzjnhvzuaxz-dot-cedar-code-289917.nn.r.appspot.com
  lhtcom-sg.tk
  lhtrailers.com.au
  lhtsozbggrvgedfcyyjl-dot-gleowyel040493443434989.wl.r.appspot.com
-lhugdiababsoulojqikqhaxsqinqwabqufrz-dot-offgl8876899977678.uk.r.appspot.com
  lhvdirectcom.nckilive.gdn
  lhxdv.vipsnapchatsexting.com
  lhxuyez.rogagot.com
@@ -240427,7 +240856,6 @@ lisasnatural.com
  lisatrothprofile.online
  lisboa-jp.com
  lischkaberlin.chifanavoid.top
-lisedesalliers.com
  lisetskaya.ru
  liseugonkdpzmomo-dot-millinium.ey.r.appspot.com
  lishis.cn
@@ -240454,6 +240882,7 @@ listfbmarketplace.com
  listgamesonline.com
  listing-70089148.sitesap.gr
  listing-ad-id86532412.com
+listing-manage-facebook-secure-id5729.item62396934769252.us
  listing-manage-facebook-secure-id7393.item687290369363486.us
  listing-manage-secure.fb.id67839211.com
  listing-secure-manager-page.item-8393282.com
@@ -240557,6 +240986,7 @@ live-chas.com
  live-con-arte.de
  live-crypto.net
  live-dos-precos-baixo.club
+live-halifax.com
  live-idia.com
  live-life-well.com
  live-live2020.had.su
@@ -240590,18 +241020,16 @@ livechatid.xyz
  livecoin.com.co
  livecomunicacao.net.br
  livecopyrightsupport.com
-livedesk-halifax.com
  livedesk.xyz
-livedomain53.com
  livedoors.tokyo
  liveducation.co.in
  livefarma.com
  livefree3.xyz
  livefreecounsellingservices.com
-livefrenchnet--five-nine.repl.co
  livefromantigua.com
  livegrupwa.otzo.com
  livehealthyandsafe.com
+livehelp247-halifax.com
  livehelpsupport.org
  livehqtvhd.com
  liveinfitnesscamp.com
@@ -240678,6 +241106,7 @@ livingwithlic.com
  livingwithpaz.com
  livonia-soccer.xyz
  livonialag.buzz
+livraison-id82382423.be
  livraisonexpress.customervalidationprotocol.com
  livraisonspeed002.cloudaccess.host
  livraisonspeed01.cloudaccess.host
@@ -240719,7 +241148,6 @@ lizrotihouse.com
  lizwassercom.nckiaccounting.gdn
  lizz26357.xyz
  lizzieinlace.com
-lizzweightwatchers.com
  lizzy.0fees.us
  lj-yahoo-com.weebly.com
  lj2xwtcr7920v8.com
@@ -240863,6 +241291,7 @@ lloyd-newpayments.net
  lloyd-personal.onlinebankinguk.net
  lloyd-verify.com
  lloyd.new-secure.co.uk
+lloydbank-cancel.co.uk
  lloydbank-cancel.com
  lloydbank-online.co.uk
  lloydbank.com.compliance-user.services
@@ -240898,8 +241327,10 @@ lloyds-device.com
  lloyds-device.management
  lloyds-deviceconfirmation.com
  lloyds-devicedata.co.uk
+lloyds-devicedata.com
  lloyds-devicemanage.co.uk
  lloyds-devicesecurity.com
+lloyds-fraud-prevention.com
  lloyds-fraudalertsaction.com
  lloyds-fraudpayment.com
  lloyds-group.live
@@ -240921,7 +241352,9 @@ lloyds-payee-alerts.com
  lloyds-payee-authorization.com
  lloyds-payee.live
  lloyds-payeealert.com
+lloyds-payeeremoval.com
  lloyds-payeesecurity.com
+lloyds-protectaccount.com
  lloyds-protectdata.net
  lloyds-protectdevice.com
  lloyds-removepayee.com
@@ -241014,6 +241447,8 @@ lloydsalert.co.uk
  lloydsalerts.co.uk
  lloydsalerts.com
  lloydsbank-authenticate.co.uk
+lloydsbank-login.lb-secure.com
+lloydsbank-online-login.lb-secure.com
  lloydsbank.appukplc.co.uk
  lloydsbank.auth-device-login-verify.com
  lloydsbank.auth-login-new-secure.com
@@ -241029,6 +241464,7 @@ lloydsbank.com.login-review-4453.info
  lloydsbank.com.login-review-976.info
  lloydsbank.com.submit-application.services
  lloydsbank.contacts-help.co.uk
+lloydsbank.deregister-unknown-payee.com
  lloydsbank.device-auth-new-verify.com
  lloydsbank.device-login-verify-auth.com
  lloydsbank.device-prevention-auth-login.com
@@ -241073,7 +241509,6 @@ lloydsbank.personal-login-online-auth.com
  lloydsbank.personal-profile-login.com
  lloydsbank.personal-user-device.com
  lloydsbank.personal-user-verify.com
-lloydsbank.prevention-auth-device-login.com
  lloydsbank.register-mobilebanking.com
  lloydsbank.remove-payees.work
  lloydsbank.secure-auth-device-verify.com
@@ -241127,6 +241562,7 @@ lloydsplc.secure-auth-attempted-login.com
  lloydsprotectdata.co.uk
  lloydsregisterdevice.com
  lloydsreviewpayee.com
+lloydsreviewpayeeuk.com
  lloydsreviewuk.com
  lloydsrevisionuk.com
  lloydssecure.com
@@ -241239,6 +241675,7 @@ lnformation-helpmailreports.duckdns.org
  lnformation-managesservicess.com
  lnformation-payments.updatesecured.com.orenime.com
  lnformation-verify1.servehalflife.com
+lng-98532343.travelsmoney.com
  lng-betaalpas.icu
  lng-bevestigen.info
  lng-business-start.com
@@ -241657,7 +242094,6 @@ load3rd.casa
  loadberlin.casa
  loadbytes.tn
  loadcanti.top
-loadclickbilling.ontheweb.nu
  loadedokay.com
  loadedrones.tk
  loadedvibes.000webhostapp.com
@@ -241988,6 +242424,7 @@ login-facebook.bbsbazaar.com
  login-facebook.forumz.info
  login-facebook.info.gf
  login-facebook.yogiwidianto.com
+login-facebook.zi13.gq
  login-facebook9.gq
  login-facebookapp.gq
  login-fb-2020.my.id
@@ -242071,6 +242508,7 @@ login-office365-web.df.r.appspot.com
  login-officesever.com
  login-offlce365-0utl00k.nn.r.appspot.com
  login-online-auth-verify.com
+login-online-payees.com
  login-online-validate-info.com
  login-outlook-office365.el.r.appspot.com
  login-page.officialstore.go-toaccounts.co
@@ -242172,7 +242610,7 @@ login-verify-info.com
  login-verify.link
  login-verify.network
  login-verify09a.serveirc.com
-login-view-payee.com
+login-verifypaypalaccount-and-provide-information-idefnb12.cf
  login-viewpayee.com
  login-voiceonline-qtrutduy.mk6heaa.com
  login-vpsssupportcom.xyz
@@ -242690,7 +243128,6 @@ logisticas001centerpromos10.com
  logisticbrosllc.com
  logisticusa.biz
  logistiya.ru
-logliddoliddooni.belchem.com
  logln-micr0s0ft-0nline.ts.r.appspot.com
  logln-office365-0nline.wm.r.appspot.com
  logln.blcokchaln.biz
@@ -243386,7 +243823,6 @@ lssuedzreturn.com
  lstadram.com
  lstn13.co.uk
  lstwypckcpxxbbaujuedwudnspxdrzxplrjl-dot-offgl8876899977678.uk.r.appspot.com
-lstwypckcpxxbbaujuedwudnspxdrzxplrjl.offgl8876899977678.uk.r.appspot.com
  lsudumrbdbtekiov-dot-dbenitonline.ey.r.appspot.com
  lsvbsqfmhgafialnmdoocdunrmiiwhkqdonl-dot-cryptic-now-290917.ey.r.appspot.com
  lsyafwsjwbblgrce-dot-millinium.ey.r.appspot.com
@@ -243461,6 +243897,7 @@ ltkgnabefqrjjtmi-dot-millinium.ey.r.appspot.com
  ltkocurzitn.com
  ltkvzpnkcrieamfs-dot-millinium.ey.r.appspot.com
  ltlcr.com
+ltlexxs1.firebaseapp.com
  ltmhomes.org
  ltmxibwkqywyxljlhqtqzcjtgt-dot-gleowayel400503.uc.r.appspot.com
  ltnoxnicxpsqqemz-dot-millinium.ey.r.appspot.com
@@ -243572,17 +244009,18 @@ luckyskinfree.giize.com
  luckyskinpubx.ddnsgeek.com
  luckyskinspin.giize.com
  luckyskinz.xyz
+luckyspiintencent.com
  luckyspin-halloweens15.dns05.com
  luckyspin-pubgm.xxuz.com
  luckyspin.getsviip7.com
  luckyspin.rulepubg.com
  luckyspin.vyxz09.com
-luckyspin01.com
  luckyspin13s.com
  luckyspin2020.jetos.com
  luckyspinews.dnset.com
  luckyspinfrees13.myvnc.com
  luckyspingetx.duckdns.org
+luckyspinhallowekss16.com
  luckyspinn13.com
  luckyspinner.25u.com
  luckyspinnh.000webhostapp.com
@@ -243601,7 +244039,6 @@ luckyspins13.sexidude.com
  luckyspins14pubgm.myddns.rocks
  luckyspins16.duckdns.org
  luckyspinsclaimitem.4dq.com
-luckyspinseason15.com
  luckyspinsfree.com
  luckyspinspubg12.com
  luckyspinss.com
@@ -243779,7 +244216,6 @@ luxedollz.com
  luxedrive.fr
  luxeinvesting.com
  luxembourg-capital-finance.com
-luxexpress.club
  luxgsyjrfqdczmhg-dot-millinium.ey.r.appspot.com
  luxiyouyue.club
  luxjewelleries.com
@@ -244104,6 +244540,7 @@ m-group.co
  m-groupusa.com
  m-gs.at
  m-halifax.co.uk
+m-help-instagram-copyright.ml
  m-in.cn
  m-instagramfromcopyright.com
  m-instagramsupport.com
@@ -244227,8 +244664,10 @@ m.facebok-market-place-item-744211.orionphillips.com
  m.facebok-marketplace-item-512422.remindway.com
  m.facebok.com-maketplace-itm-68.6457797544234.com
  m.facebook-acc.verify-sistem.app
+m.facebook-check-page.g4genuine.com
  m.facebook-check.page-new.com
  m.facebook-check.page.piobird.com
+m.facebook-markeplaces-item-0123912.courseheist.com
  m.facebook-market-item-7523412.rosesjewelrybox.com
  m.facebook-market-place-item-15122.myflexapp.com
  m.facebook-market-place-item-31562.nobinbazar.com
@@ -244435,7 +244874,6 @@ m.faceebook.com-id1-6728376.item7325623853287964.com
  m.faceebook.com-id1-672839673.westsideautosale.com
  m.faceebook.com-id1-67829923.item7520367283962.com
  m.faceebook.com-id1-6872396783.item72249862831438.com
-m.faceebook.com-id1-738624597.item2367823634597.com
  m.faceebook.com-id1-76203759.item578293697346394.com
  m.faceebook.com-id1-81367832986.item162738962769334.com
  m.faceebook.com-id1-879445.itme864396438943.com
@@ -244595,6 +245033,7 @@ m.qiangbuqiang.com
  m.qpwtu.cn
  m.qzhbzpz.icu
  m.rawpowerlifting.com.ua
+m.royal-eng.ps
  m.sdekc.ru
  m.secure.runescape.com-ru.eu
  m.secure.runescape.com-ue.xyz
@@ -245319,6 +245758,7 @@ mahanext.ir
  maharansharif.com
  mahasales.in
  mahatirtatrans.co.id
+mahattan-clothing.com
  mahaviy5ya.temp.swtest.ru
  mahazpcr.in
  mahdistock.com
@@ -245429,6 +245869,7 @@ mail.2020-coronavirus.ru
  mail.22-local-businesses-found-in-your-city.com
  mail.263gmail.net.cn
  mail.4privacy.nl
+mail.77005.info
  mail.acceso-bancamx.lat
  mail.accountassyst.com
  mail.accountprotection.co.uk
@@ -245686,7 +246127,6 @@ mail.hkfdkdn.com
  mail.hmjgte.xyz
  mail.hmrc-tax-rebateform.com
  mail.hmrc-uktax-refund.com
-mail.hmrcsupport-tax.com
  mail.homepage-monthly-account-signin.giize.com
  mail.hooverclaimsolutions.com
  mail.hotgirlsgames.xyz
@@ -245763,7 +246203,6 @@ mail.kuotainternet.v9z.shop
  mail.kuyah.event-21.com
  mail.kyodoyushi.com.cn
  mail.lipsa-industrial.com
-mail.livecallz.com
  mail.locapy.xyz
  mail.lockappz.xyz
  mail.login-confirmation.services
@@ -245782,6 +246221,7 @@ mail.lwpr.com.cn
  mail.m2-sac.com
  mail.mabar.budi.netlow.gq
  mail.mabaryoutuber.garenagroup.com
+mail.magnichip.com
  mail.mail28828.icu
  mail.mail54357.xyz
  mail.mail5800.xyz
@@ -245988,8 +246428,6 @@ mail.thecanadianacademy.ca
  mail.thepoint.nl
  mail.thosewhodig.net
  mail.three-my3-billing-update.com
-mail.threebillingupdates.co.uk
-mail.threedetails-help.world
  mail.threemobile-secure.com
  mail.todaysfitnesstrainer.com
  mail.toneelstukken.nl
@@ -246118,7 +246556,6 @@ mail102536.xyz
  mail10483.best
  mail11928.xyz
  mail138995.buzz
-mail163inboxlogin.dumb1.com
  mail23918.icu
  mail28282.icu
  mail28827.icu
@@ -247473,6 +247910,7 @@ market-stats.com
  market.cars-item-post-83618.xyz
  market.item338764.com
  market0000.duckdns.org
+market86321itm.club
  marketaiming.com
  marketattentionn.net
  marketbarkodsistemi.net
@@ -247547,6 +247985,7 @@ marketplace-21548365.com
  marketplace-21584152.com
  marketplace-2182763.com
  marketplace-2183878.com
+marketplace-221545521.com
  marketplace-229192-fb.com
  marketplace-231458458.com
  marketplace-232541584.com
@@ -247563,7 +248002,6 @@ marketplace-2541544852.com
  marketplace-256475845.com
  marketplace-2623532.com
  marketplace-26347432.com
-marketplace-26547854.com
  marketplace-267653342.com
  marketplace-26833613.ballscrew-z.com
  marketplace-27021989.com
@@ -247579,7 +248017,6 @@ marketplace-31528145.com
  marketplace-325246989.com
  marketplace-3265415814.com
  marketplace-341396200.com
-marketplace-341587856.com
  marketplace-34235657.com
  marketplace-345462.com
  marketplace-3463473.com
@@ -247614,6 +248051,7 @@ marketplace-47623123.com
  marketplace-476729.com
  marketplace-477346.com
  marketplace-481018.com
+marketplace-48301.anunt-191859522.link
  marketplace-48762223.us
  marketplace-4ei57qhzq76ozv.com
  marketplace-50012093.com
@@ -248236,7 +248674,6 @@ marquedafrique.com
  marquisediamondengagementring.com
  marquiseinvest.com
  marriagecruise.co
-marrie-currie.xyz
  marriedandmad.org
  marrile-pilley.club
  marrinx.de
@@ -248567,7 +249004,7 @@ materialescantu.com
  materialevent.org
  materialpayloadpubg.com
  materialsgiftz.net
-materialspinpubg.com
+materialspinpubgm.com
  materialsscienceconferences.com
  materialxmetro.com
  materialzxpubg.net
@@ -248911,7 +249348,6 @@ mbtbuty.pl
  mbtudong.com
  mbtwdtbznaajlvie-dot-millinium.ey.r.appspot.com
  mbtyvytntrcttyymvyum.weebly.com
-mbtzntdbyhanpvosaphxbrllrothwktsbdlj-dot-offgl8876899977678.uk.r.appspot.com
  mbut.abutparker.com
  mbx.com.au
  mbxvii.com
@@ -249239,6 +249675,7 @@ medicalcosmeticsicily.com
  medicalexpertseg.com
  medicalfa.com
  medicalghaliadam.net
+medicalgradewigs.com
  medicaljournalshouse.com
  medicalspaskincare.com
  medicalsupplies2u.com
@@ -249330,7 +249767,6 @@ medulloblastomatrials.com
  medusamilos.gr
  meduza.butra.pl
  medviewairline.com
-medwedhealthcare.com
  medwiz-net.000webhostapp.com
  medyamaxafrica.info
  medyanef.com
@@ -249352,6 +249788,7 @@ meetabansal.in
  meetabella.com
  meetbg.com
  meeting-23900123090123.bitbucket.io
+meeting-bonus.web.app
  meeting.azurefd.net
  meetme.run
  meetmethere.app
@@ -249390,6 +249827,7 @@ megabytte.com.br
  megachanceltd.com
  megacompras.co
  megacredi.com
+megad.cc
  megadealondeals.com
  megadesconto.tk
  megaestereocalca.net
@@ -250036,6 +250474,7 @@ method21.net
  methodofsolutions.com
  methodofwar.club
  methodpower.000webhostapp.com
+meticorehealthyways.us
  meticulousforensic.com
  metjm.pro
  metmontot.fr
@@ -250057,7 +250496,6 @@ metrodieselinc.com
  metrodooraventura.com
  metroexodus.ezua.com
  metroexodusevent.com
-metroexoduspubg2020.com
  metrofiresaz.com
  metrolabs.com.br
  metrological-focus.000webhostapp.com
@@ -250067,13 +250505,11 @@ metropolitanguesthouse.com
  metropolitanogoiania.com.br
  metropolitanpropinc.serveirc.com
  metropubg.4dq.com
-metropubgm.com
  metropubgm16.dnset.com
  metroroyalepubgm.com
-metroroyalprize.jetos.com
  metroupdate16.dnset.com
  metroxpubgm.net
-metroxroyale.gleeze.com
+metroxseason16.duckdns.org
  mettaanand.org
  mettasc.com.br
  mettek.com.tr
@@ -250157,6 +250593,7 @@ mf1g.jaysbrand.com
  mf345.efaktury.icu
  mf3og5ixzh3q9n.com
  mf7w.jaysbrand.com
+mfaceb00kelog.000webhostapp.com
  mfaceboock-item2384723.com
  mfacebook.biltapps.com
  mfacebook.blogspot.com
@@ -250637,7 +251074,6 @@ microsofts-login.dynv6.net
  microsofts-on.myvnc.com
  microsoftsecureddrive365.weebly.com
  microsoftsecuredonenote.weebly.com
-microsoftsecuredteam.weebly.com
  microsoftservice.dynamic-dns.net
  microsoftshareddrive.weebly.com
  microsoftsign-in.yolasite.com
@@ -250666,6 +251102,7 @@ micword-sharepointoffice365.com
  micxxxxxdeskxxxxxx.moonfruit.com
  mid.appsolute-preprod.fr
  midak-photography.com
+midas-buys15.jetos.com
  midasbuy-official.ga
  midasbuy9.com
  midasbuygift.com
@@ -250931,7 +251368,6 @@ milfordia.buzz
  milhar-it2020.ml
  milharttools.com
  milhas-pontossemprepresente.club
-milhascontigosemprepresente.club
  milhasdigitalatualize.com
  milhaseguraspresentesempre.club
  milhasnatal.com
@@ -251672,7 +252108,6 @@ mlykommi.info
  mlynarskastezka.cz
  mlzw3i742yoq.talagaremix.com
  mlzwbhbyf.handipants.com
-mlzwius3.web.app
  mm-eh.jaysbrand.com
  mm.go.yj.fr
  mm.yeouthvip.com
@@ -251851,7 +252286,6 @@ mnjkoug.ug
  mnjlygyqvelrzjrfullefhjahbkugmiqswtm-dot-cryptic-now-290917.ey.r.appspot.com
  mnjofzfjnssrakda-dot-millinium.ey.r.appspot.com
  mnjzctrlsnaneyohgupaafetcxdrdgsxtjvv-dot-offgl8876899977678.uk.r.appspot.com
-mnjzctrlsnaneyohgupaafetcxdrdgsxtjvv.offgl8876899977678.uk.r.appspot.com
  mnlopeqbwdpiawnqofgcvezjfhpppjqpbwvn-dot-solar-vertex-285913.rj.r.appspot.com
  mnmboxoffice46268.uc.r.appspot.com
  mnminfrasolutions.com
@@ -252031,6 +252465,7 @@ mobile-myee.com
  mobile-n26.com
  mobile-olx.site
  mobile-online-fargo.com
+mobile-online-secure-info.com
  mobile-owen.fr
  mobile-personalite30hrs.com
  mobile-personallite30hrs.com
@@ -252237,7 +252672,6 @@ mobileslocator.info
  mobilesuporte.com
  mobiletech.net
  mobilethemesnlivewallpaper.com
-mobileuk-virgin.com
  mobilev12.freexfire.top
  mobileverify-wells-fargo.work
  mobileview.teamplast.co
@@ -252936,7 +253370,6 @@ morph.sydney
  morphybridgingloans.co.uk
  morrisbrotherssigns.com
  morriscommunitysleep.com
-morrobaydrugandgift.com
  morsailorh.com
  morsee1337.beget.tech
  morsengthaithai.com
@@ -253379,6 +253812,7 @@ mrtaotao.com
  mrtmarkets.com
  mrtool.ir
  mrtour.site
+mrtramite.cl
  mrtrojanhere.ddns.net
  mrtronic.com.br
  mrts.ga
@@ -253455,7 +253889,6 @@ mshitaralam.xyz
  mshluyroorsqhqeb-dot-millinium.ey.r.appspot.com
  mshu3.xyz
  mshv.ca
-mshxungvxovtvewcwbirugmkihwubtkixfqa-dot-offgl8876899977678.uk.r.appspot.com
  msi.c2c4me.com
  msi.couragetocare.us
  msi.undip.ac.id
@@ -253496,7 +253929,6 @@ msnusantaracom.chifanavoid.top
  msnusantaracom.chifanblock.top
  msnvb.yolasite.com
  msnvkxyhnuyukvfv-dot-millinium.ey.r.appspot.com
-msnww.yolasite.com
  msnxz.yolasite.com
  msnzz.yolasite.com
  mso.services
@@ -253564,6 +253996,7 @@ mt654.ailacabs.com
  mt7r4m3inb.firebaseapp.com
  mta-sts.asssos.com
  mta-sts.mail.richardhyettlawyernotary.com
+mta.royal-eng.ps
  mtaguchi-kaikei.com
  mtambotzyy.xyz
  mtambowa3.xyz
@@ -253696,7 +254129,6 @@ mufg-ad.com
  mufg.iggplus.com
  mufg.jp-bankq.com
  mufg.kay56.com
-mufg.myftp.biz
  mufg.wxhbdb.com
  mufg.zb-ipr.com
  mufgcard.icu
@@ -253763,7 +254195,6 @@ multbancos.webnode.com.br
  multfesta.com.br
  multi-pontos-resgate-seguro.site
  multi-pontosempre.online
-multi-sempre-contigo.site
  multi-trexintegfoodsplc.com
  multicarepayroll.com
  multicasemusic.ru
@@ -253781,7 +254212,6 @@ multimix.hu
  multinet.in.ua
  multiplataformadigital.com
  multiplestreamsmastery.com
-multipontossemprecontigo.space
  multiprivacyhomes.com
  multired-bonofamiliar2etapa.com
  multired-zonasegurabn1cliente.com
@@ -253978,6 +254408,7 @@ muxicgumqacjrxvqhrecwerojkedvccyrrde-dot-offgl8876899977678.uk.r.appspot.com
  muyuy.deqdaf.cn
  muz1ezv4.firebaseapp.com
  muzammelhaq.com
+muzeek.initfusion.com
  muzpfpytsbncfknylievrvtbkpyhbjeicese-dot-solar-vertex-285913.rj.r.appspot.com
  muztarelakop.com
  mv.efetr65.scxw34.wdw2xz.wr35gr.5657tht.vdv.dwr3.clearpointsupplies.com
@@ -254099,7 +254530,6 @@ mx0.arqsys.srv.br
  mx02.storypepper.com
  mx2.mx1.mx1.mx1.mx2.mx2.mx2.mx1.mx2.adaptercoup.pw
  mx2.otg.kiev.ua
-mx2.royal-eng.ps
  mx2.vimpelrd.ru
  mx20.noshow-2020.com
  mx2interests.com
@@ -254155,7 +254585,6 @@ my-3-payments.com
  my-3-support-team.com
  my-3-support.com
  my-3-update.com
-my-3-updatenow.com
  my-3-updates.com
  my-3help.link
  my-3mobile.com
@@ -254216,6 +254645,7 @@ my-halifax-account-security.com
  my-halifax-account.com
  my-halifax-online.com
  my-halifax-security.com
+my-halifax-uk.com
  my-icloud.in
  my-ing-nl.com
  my-inglogin.com
@@ -254252,6 +254682,7 @@ my-pay24.net
  my-payee-amendment.com
  my-payee-changes.com
  my-payee-service.com
+my-payee-settings.com
  my-payee-support.com
  my-payee-validation.com
  my-payees-management.com
@@ -254332,11 +254763,11 @@ my.instagram.com.login.page.jmz.ir
  my.jcb.co.jp.365huyu.com
  my.jcb.co.jp.aogo.vip
  my.jcb.co.jp.cjtaqo.top
-my.jcb.co.jp.cuilu.top
  my.jcb.co.jp.daeesycy.top
  my.jcb.co.jp.dbplb.top
  my.jcb.co.jp.ddzhy.com
  my.jcb.co.jp.drdjb.top
+my.jcb.co.jp.dygccs.top
  my.jcb.co.jp.fetb.vip
  my.jcb.co.jp.hjhslm.top
  my.jcb.co.jp.hzsfh.com
@@ -254442,6 +254873,7 @@ my3-info-billing.com
  my3-info-updatesalert.com
  my3-infoupdate.com
  my3-latest-bill.com
+my3-latestupdate.com
  my3-management-center.com
  my3-management-centre.com
  my3-mobile.link
@@ -254524,6 +254956,7 @@ my3alerts-service.com
  my3alerts-update.network
  my3bill-info.com
  my3billcheck.com
+my3billing-alert.com
  my3billing-confirmation.com
  my3billing-help.com
  my3billing-three.com
@@ -254773,7 +255206,6 @@ mychaseaccount.atapatu.com
  mychasechoe.com
  mychau.dongnain.com
  mychocolatestory.com
-mychsalliance.org
  mycity.citywork.vn
  myclientsdemo.com
  mycloud-covid19.serveirc.com
@@ -254824,7 +255256,6 @@ mydesign.thinkeraibirds.com
  mydesktop-att.com
  mydesktop.it-att.com
  mydestinybanquethall.com
-mydetails-online.com
  mydetroitheadshots.com
  mydevice-alerts.com
  mydeviceactivity.com
@@ -254842,7 +255273,6 @@ mydreft.com
  mydrivepersonfanb.icu
  mydshdasjsdhvx.com
  myeb.ir
-myechemist.com
  myee-account-billing.com
  myee-account-support-view-my-ee.000webhostapp.com
  myee-accountbilling.com
@@ -255158,6 +255588,7 @@ mymailaccountwrkerdmaon.weebly.com
  mymailexp.com
  mymakporo.com
  mymanagessoconssl.outmooksecrue.com
+mymanie3jd-d3f.sfo2.digitaloceanspaces.com
  mymauimaid.com
  mymdxcuzjruvnsbi-dot-millinium.ey.r.appspot.com
  mymediationcom.shaxiaput.top
@@ -255208,7 +255639,6 @@ mynurserybazaar.com
  mynydd-ednyfed-countryhouse.co.uk
  myo.net.au
  myo2-billinfo.com
-myo2-uk.com
  myo2.account.details-billing-secure.com
  myo2.account.verify-secure-details1.com
  myo2.accounts-form.com
@@ -255216,7 +255646,6 @@ myo2.bill231.com
  myo2.ref783.com
  myo2billing-auth.com
  myo2billing-info.com
-myo2billing-support.com
  myo2billing-update.com
  myo2billing.com
  myo2help-info.com
@@ -255251,8 +255680,6 @@ mypayee-online.com
  mypayee-resolve-issue.info
  mypayee-secure.com
  mypayee-security.co.uk
-mypayee-update.com
-mypayee-updates.com
  mypayee.onlinebanking-hs.com
  mypayee.uk
  mypayeecancellation-secure.info
@@ -255261,7 +255688,6 @@ mypayeereview.co.uk
  mypayees-authenticate.org
  mypayees-check.com
  mypayees-manage.co.uk
-mypayees-online-verify.com
  mypayees-review-halifaxalerts.com
  mypayees-reviewonline.com
  mypayees-transfers-resolve.info
@@ -255369,6 +255795,7 @@ myserviceproduc.com
  myservices-ee.co.uk
  myservices-eehub.com
  myservices.live
+myshop-bgj604.myinsales.ru
  myshop.yo.fr
  mysidepay.com
  mysimplelife.me
@@ -255530,12 +255957,10 @@ mytopgameus.com
  mytradeguru.com
  mytradeitem456766543456787654.com
  mytradeoption.com
-mytransfers-security.info
  mytravel-trips.com
  mytripadviser.com
  mytrips21.000webhostapp.com
  mytxtl.f111.hanming.online
-mytyt.s3.eu-central-1.amazonaws.com
  myuaeverify.com
  myub8.app.link
  myuniversityabroad.com
@@ -255716,6 +256141,7 @@ n3yzua1gsygnd2.000webhostapp.com
  n4.8wix.com
  n4321.cn
  n453.jaysbrand.com
+n45338az.aiwjdzja.com
  n4e9.svcoding.com
  n4fke.jaysbrand.com
  n4khc.svcoding.com
@@ -255796,6 +256222,7 @@ nab.com.au-device.info
  nab.com.au-idsafe.info
  nab.com.au-online-user.services
  nab.com.au-online.report
+nab.com.au-online.support
  nab.com.au-user.support
  nab.com.au.acc-defence.services
  nab.com.au.acc-restore.services
@@ -255982,7 +256409,6 @@ naimalsadi.com
  naimbicakci.com
  nainaifc.top
  nainasdesigner.com
-nairobibaptist.tv
  nairrins.com
  naisagrupterbaru18.000webhostapp.com
  naish.ru
@@ -256135,7 +256561,6 @@ napacarpetcleaning.net
  napat.tk
  napati.com
  napau.cf
-napavalleycommons.com
  napavalleymakeupandhair.com
  napavalleynanny.com
  napcard.net
@@ -256367,6 +256792,7 @@ natus-vincere.online
  natuyko.top
  natw-secure.com
  natwest-authorise.com
+natwest-authpayee.com
  natwest-confirm-payment.com
  natwest-confirm-payments.com
  natwest-confirm.net
@@ -256775,6 +257201,7 @@ ndz.handipants.com
  ndzctdqlwdvvpqkcynencmykzqirzgoyxbvv-dot-glegen303939423233.ue.r.appspot.com
  ne-ne.snprobbx.pbz.r.de.a2ip.ru
  ne-pok.hr
+ne01u59l.firebaseapp.com
  ne1.apparteworkshop.com
  ne1tflx3-2sign.com
  ne4tflix2-inf0.com
@@ -257296,7 +257723,6 @@ netflix-subscription-update1-info.com
  netflix-subscriptionrenew.com
  netflix-subscriptions-endedtorenew.kacaukamuyasamaaku.org
  netflix-support-now.com
-netflix-support.com-1892371078192839102.com
  netflix-teamo.redirectme.net
  netflix-ukbilling.com
  netflix-ukpaymenterror.com
@@ -257377,7 +257803,6 @@ netflix.net.pe
  netflix.nl-login.com
  netflix.nt.qysbz.idiotfriend.com
  netflix.nt.vshke.gwenniggles.com
-netflix.one-year-unlimited-movies.com
  netflix.one2game4.com
  netflix.online-paymybill.com
  netflix.onlineupdateservices.net
@@ -257406,6 +257831,7 @@ netflix.somostodoterreno.com
  netflix.subscription-error.co.uk
  netflix.subscription-errors.co.uk
  netflix.subscription-retry.co.uk
+netflix.supportrefuk.com
  netflix.suspicious-accountactivity.com
  netflix.theclientservice.com
  netflix.uklimitations.com
@@ -257716,18 +258142,15 @@ new-coronavirusmask.com
  new-credit.space
  new-device-activity.link
  new-device-added.live
-new-device-alert.info
-new-device-authenticator.com
  new-device-authorisation.com
-new-device-unsecure.com
  new-devicealert.com
+new-eebill.com
  new-evenst-pubg-royalepas13.000webhostapp.com
  new-facebook.de
  new-faceeboook.000webhostapp.com
  new-grupwa.xxuz.com
  new-indycb-dot-phpapp-shshh.df.r.appspot.com
  new-log-facebook.cf
-new-log-fb.official6d.gq
  new-login-deregister.com
  new-login-fb.cf
  new-login-fb.ga
@@ -257744,7 +258167,6 @@ new-my3-helpdesk.ga
  new-my3-updateform.com
  new-my3.com
  new-my3.uk
-new-my3bill.com
  new-my3update.com
  new-mythree.com
  new-onlinepayee.com
@@ -257760,10 +258182,9 @@ new-payeedecline.com
  new-payment.cc
  new-payments.com
  new-paymentsupport.com
-new-secure-device-alerts.link
-new-secure-device.com
  new-sig-in-facebook.klaim-n3.cf
  new-sig-in-fb.zi13.tk
+new-sig-in.tk
  new-signin3.uk
  new-space-era.bitballoon.com
  new-sso.uk
@@ -257803,7 +258224,6 @@ new-threelogin.info
  new-threesupportuk.co
  new-threeupdate.info
  new-ton.org
-new-unusual-device.link
  new-updatethreeonline.com
  new-vidio-viral.grubporno.com
  new-webmail-upgrading.000webhostapp.com
@@ -257822,7 +258242,6 @@ new.e-dogshop.eu
  new.fittyg.com
  new.giftuc.xyz
  new.gsmgaz.ru
-new.ime-consultants.com
  new.invisiblecreations.nl
  new.kontrast-art.ru
  new.login.notification-support-suspicious.best
@@ -257883,6 +258302,7 @@ newcajkgwycjbbgfcouhkmqykldbaaflmyeh-dot-glenxpecial3009493.ey.r.appspot.com
  newcalling.blob.core.windows.net
  newcamp1.servebeer.com
  newcampus.escuelanuevosnegocios.com
+newcarevalue.ru
  newcekilis.site
  newcenterpubgm.com
  newchargespro4.com
@@ -258060,13 +258480,12 @@ newpayee-verifyalert.com
  newpayeeadd-secure.com
  newpayeecancellogin.com
  newpayeehalifax.com
-newpayeehelp-halifax.com
  newpayeemanage-help.com
  newpayeemanage-online.com
  newpayees-secure.com
  newpayees-verify.com
  newpayeesupport.com
-newpaym-management.com
+newpaym-removal.com
  newpillelement.com
  newplastic.es
  newplug.monster
@@ -258208,11 +258627,9 @@ newsnaija.ng
  newsonghannover.org
  newsonic.com
  newsped.eu
-newspinpubg.net
  newsrecord.info
  newsreviewdocs.com
  newsspe.com
-newsspin16.dsmtp.com
  newstap.com.ng
  newstarhilon.com
  newstks.com
@@ -258538,7 +258955,6 @@ nhatnguvito.com
  nhaxequanghuy.com
  nhbans.serviceorder.su
  nhbvgnklco.com
-nhbvhcowoesrrpwn-dot-owaonk399399393.uk.r.appspot.com
  nhc13.kku.ac.th
  nhc2020.com
  nhcpe973.web.app
@@ -258701,7 +259117,6 @@ niebuur.nl
  nieceextoll.com
  niedermeier-online.de
  nieeiepn.com
-nieertycdeppdecl-dot-owaonk399399393.uk.r.appspot.com
  nieitkvkybwzaxfb-dot-millinium.ey.r.appspot.com
  nienowcenters.buzz
  nient2018.com
@@ -259139,7 +259554,6 @@ nlwsxqdzftrwdzrt-dot-millinium.ey.r.appspot.com
  nlwww-ing.top
  nlxbkgod.goruli.com
  nlxordkgolgegjpwhbckkwlalr-dot-gleowayel400503.uc.r.appspot.com
-nlypurchase.com
  nlzgagboklgldukl-dot-millinium.ey.r.appspot.com
  nm-w.onderhost.com
  nm-z.jaysbrand.com
@@ -259740,13 +260154,13 @@ notice-customers-mobile.com
  notice-fb00.000webhostapp.com
  notice-info-wells.mobi
  notice-me.webhop.me
+notice-newpayee.com
  notice-secure-appsmail.mcnxvz.com
  notice-wells-account.work
  notice-wells-fargo-alerts.site
  notice-wells-fargo.com
  notice-wells-fargo.services
  notice.amazon.sign-47c6509f7d6e09fa706721d8a108c1be.satulima.com
-notice.annenon.duocom.monster
  notice.update.service.nvbs93zwjzd.com
  noticealertwf.com
  noticecapitalalert.com
@@ -259826,7 +260240,6 @@ notifykcom-915949292.michelademarco.it
  notifykcom-920760466.michelademarco.it
  notifykcom-962107463.michelademarco.it
  notifykcom-967979849.michelademarco.it
-notifymsgs.ey.r.appspot.com
  notifyupdt-informaccessnewdvcid.com
  notifyupdt-savelocaldataaccess.com
  notihote.com
@@ -260309,7 +260722,6 @@ ntwam.com
  ntwgotyfomfjapuajrzsycpjfdamxzyrmkqi-dot-cryptic-now-290917.ey.r.appspot.com
  ntwireds.com
  ntxxouhksmwpgbkxpzvhkesuej-dot-gleowayel400503.uc.r.appspot.com
-ntyfwfpldvnsbqfvasbhpyzrrwpdldhvjrqu-dot-offgl8876899977678.uk.r.appspot.com
  nu-bby.com
  nu-verificatie.club
  nu9y5441.firebaseapp.com
@@ -260479,7 +260891,6 @@ nutwanks.ml
  nuuie.xyz
  nuuofdrifwtplvuz-dot-millinium.ey.r.appspot.com
  nuuylyfoyxwjjbsw-dot-millinium.ey.r.appspot.com
-nuvo.com
  nuvqvbrkktxnmmch-dot-millinium.ey.r.appspot.com
  nuvtkwjdbbyohjlintdvngaaex-dot-gleowayel400503.uc.r.appspot.com
  nuvuneu.com
@@ -260756,7 +261167,6 @@ nzgwwfqpdiauhryqhzzlergvsmsusfbaffvj-dot-gl494903049.wl.r.appspot.com
  nzhollpkeucfprto-dot-millinium.ey.r.appspot.com
  nzibepkvivqkpwgc-dot-millinium.ey.r.appspot.com
  nziipojzjnvdfbrk-dot-mnospot.ts.r.appspot.com
-nziipojzjnvdfbrk.mnospot.ts.r.appspot.com
  nzkxxmejdezxntyy-dot-millinium.ey.r.appspot.com
  nzlyvgfdtkegjuhc-dot-millinium.ey.r.appspot.com
  nzm.svcoding.com
@@ -260810,6 +261220,7 @@ o2-accountauth.com
  o2-accounthelp.com
  o2-accounts.com
  o2-alerts.com
+o2-auth.net
  o2-bill-account.com
  o2-bill-support.com
  o2-bill-verify.com
@@ -260836,6 +261247,7 @@ o2-confirm.net
  o2-confirms.net
  o2-failed-payment.com
  o2-failedpayment.com
+o2-issue-billing.com
  o2-login.com
  o2-manage.com
  o2-mobile-signin.com
@@ -260853,7 +261265,6 @@ o2-secureverify.com
  o2-securityteam.com
  o2-send.tokyo
  o2-support.net
-o2-ukbilling-help.xyz
  o2-updatebilling.com
  o2-updateinformation.com
  o2-verify-billing.net
@@ -260883,7 +261294,6 @@ o2.uk.bill976.com
  o2.uk.invoice133.com
  o2.uk.my5gac.com
  o2.uk.myo2acc.com
-o2.uk.o2bil7.com
  o2.uk.o2ref697.com
  o2.uk.o2ref698.com
  o2.uk.php02acc.com
@@ -260982,7 +261392,6 @@ oalcnyhvlpmattbb-dot-millinium.ey.r.appspot.com
  oalkojdddjqzwzxv-dot-millinium.ey.r.appspot.com
  oalsxcer.com
  oaluckywin.com
-oalyfynhzavultpv-dot-owaonk399399393.uk.r.appspot.com
  oam-madagascar.com
  oamarie.com
  oamk.fi
@@ -261210,7 +261619,6 @@ ocrbhd.com
  ocrie.com
  ocrocketsociety.org
  ocryws.com
-ocsb.go.th
  ocsps.org
  ocstudio.tv
  ocszgkofmtalxuns-dot-millinium.ey.r.appspot.com
@@ -261722,7 +262130,6 @@ office-gerflor.com
  office-home.ml
  office-loginuser365.nw.r.appspot.com
  office-mail-d-eliverys.el.r.appspot.com
-office-mail-login365.uk.r.appspot.com
  office-microsoft.dynv6.net
  office-microsofts.dns.army
  office-notice.github.io
@@ -261816,7 +262223,6 @@ office365ooc.com
  office365outlookmailboxuser.wn.r.appspot.com
  office365outlookuser758693.wn.r.appspot.com
  office365portal.ga
-office365portal.micro-soft-365.com
  office365portlsec.onthewifi.com
  office365recover.com
  office365s.ddns.net
@@ -261956,7 +262362,6 @@ offlovye.000webhostapp.com
  offmenow20249.appspot.com
  offmenow20249.uc.r.appspot.com
  offorplc.eu
-offre-netflix-remboursement-france.duckdns.org
  offrecadeauid232222.com
  offrekrysnetflix.servehttp.com
  offroadbeasts.com
@@ -262085,6 +262490,7 @@ ogzetmailc.temp.swtest.ru
  ogzfixsde.goruli.com
  ogzmnprftxgvrmxz-dot-millinium.ey.r.appspot.com
  ogztswyditfpmpavbagokhswrn-dot-gleowayel400503.uc.r.appspot.com
+oh.jandigitalstudios.com
  ohaalgszsrluosdt-dot-millinium.ey.r.appspot.com
  ohaazvsyznaaxuum-dot-millinium.ey.r.appspot.com
  ohako.com.my
@@ -262185,7 +262591,6 @@ oilneanderthal.com
  oilneering.com
  oilsmarketingmastery.xyz
  oilzuldiehdskkbk-dot-millinium.ey.r.appspot.com
-oimcscesmcepvonzpdccpdzbjy-dot-rapid-access-293716.uk.r.appspot.com
  oimks.com
  oimtmalabvbwiyoa-dot-millinium.ey.r.appspot.com
  oinkshtqw.shoesmogul.com
@@ -262346,7 +262751,6 @@ okwcwwrnvucqclrl-dot-millinium.ey.r.appspot.com
  okwnpgahessatkez-dot-millinium.ey.r.appspot.com
  okxcrjnyygzjgwgj-dot-millinium.ey.r.appspot.com
  okxlnzwvodtijrzf-dot-millinium.ey.r.appspot.com
-okxpfiugfsuubuqqyvqqtkuqhmfidetsocmd-dot-offgl8876899977678.uk.r.appspot.com
  okykhqmbuqflandf-dot-millinium.ey.r.appspot.com
  okzozwrlqrotanxs-dot-millinium.ey.r.appspot.com
  ol1u.ru
@@ -262371,7 +262775,6 @@ olaqzshkotqyomfm-dot-millinium.ey.r.appspot.com
  olares.cf
  olaresak.ml
  olariacassiel.com.br
-olasmart.com
  olauhgs.000webhostapp.com
  olawalevender.com
  olb.nabecases.online
@@ -262574,7 +262977,6 @@ olympusvision.rbustaging.com
  olymtyher.com
  olysealants.cf
  olznfeabweamurzw-dot-millinium.ey.r.appspot.com
-om-post-63571355.bebayuakademi.edu.my
  om86.ru
  om87pek.senandungmerana.info
  omahanew.icu
@@ -262999,6 +263401,7 @@ online-bank-login4.xyz
  online-bank-login5.xyz
  online-bank-logon.xyz
  online-bank-logono.xyz
+online-bank-payee.com
  online-bankaustria-at-wps-portal-login.garryhagger.be
  online-banking-auth.com
  online-banking-halifax.com
@@ -263067,7 +263470,9 @@ online-lloyds-confirm.com
  online-login-confirmdevice.com
  online-login-halifax.reauth-sessionid.ae937885293.secure-login-auth.com
  online-login-payee.com
+online-login-payees.com
  online-login-payment.com
+online-login-secure-info.com
  online-login-securedevice.com
  online-login-security.com
  online-login-verify-auth-device.com
@@ -263083,6 +263488,7 @@ online-mashreqbank.serveirc.com
  online-messageriepro30.webnode.be
  online-microsofts.dns.navy
  online-mobil-giris-subem.ml
+online-my-payee.com
  online-myee.com
  online-myo2.com
  online-mypayments.com
@@ -263094,12 +263500,10 @@ online-orange.webnode.cl
  online-pagimentti-it.com
  online-payee-auth.com
  online-payee-review.com
-online-payee.com
  online-payees-view.com
  online-payments.digital
  online-paymonthly.co.uk
  online-personal-fargo.com
-online-personalbanking.com
  online-platnosci.services
  online-pocztex24.net
  online-port12bankweb.com
@@ -263115,6 +263519,7 @@ online-s-pusat.webnode.com
  online-scotiabak.com
  online-sec-account.com
  online-secure-check-boa.com
+online-secure-halifax-info.com
  online-secure-info-login.com
  online-secure-wells-fargo.com
  online-secure01c-chase.000webhostapp.com
@@ -264906,6 +265311,7 @@ ovhe-paypalservis5w.servebeer.com
  ovhhlwnslakrgrkqgrdmtlaaqsnmvlnzyuqv-dot-cedar-code-289917.nn.r.appspot.com
  ovhmanagervhost125663.lowhost.ru
  ovhovh2234x.blogspot.com
+ovi-tech.com
  oviiqwddhvizixiy-dot-millinium.ey.r.appspot.com
  oviyamfotos.in
  ovjbxxrsxkpmecpegibjgtxjkcelfpaqtrfg-dot-cryptic-now-290917.ey.r.appspot.com
@@ -265147,7 +265553,6 @@ ozarglakes.cf
  ozarkhardwoodpellets.com
  ozarkhotel.net
  ozarkmorealtor.com
-ozaydininsaat.com
  ozberkinsaat.com
  ozbizzgroup.com
  ozbpoiimkfpyvrnrgmxdupdrfvwbkeolccxh-dot-offglen.uk.r.appspot.com
@@ -265590,6 +265995,7 @@ page-review-login.info
  page-securiityy.000webhostapp.com
  page-signpoliticy.servebeer.com
  page-support62021.info
+page-under-preview-4647.info
  page-under-preview2256.info
  page-under-preview3289.info
  page-under-preview5293.info
@@ -265715,6 +266121,7 @@ pagesblokeds1.cf
  pagesblokeds2.ml
  pagesblokeds3.gq
  pagesblokeds5.tk
+pagesblokeds6.cf
  pagesfb-adminsummary.ml
  pagessappleid-com.servecounterstrike.com
  pagesupportmessagebox.my.id
@@ -266065,7 +266472,6 @@ papausafr.com
  papaw456.serveftp.com
  papaya.7ho.st
  papayastories.com
-papayawhipspringgreencomputeranimation--five-nine.repl.co
  papayayarn.ru
  papelviejo.top
  papentfive.com
@@ -266094,6 +266500,7 @@ papillonapothecary.com
  papirbest.hu
  papoosemutablev.com
  pappermintcom.baerqiprimary.top
+papriv38.com
  papriv45.com
  papuaadventure.com
  papuapedulicovid.000webhostapp.com
@@ -266313,7 +266720,6 @@ particulares.santander.totta-santan.info
  particulares.santanders.app
  particulesgenerale.com
  particulier-2020.myvnc.com
-particulier-sg.ddns.net
  particulier-verzenden.com
  particulieren-omgeving.club
  particulierenweergaven.club
@@ -266438,7 +266844,6 @@ pastelesgloriadelis.com.mx
  pastenter.com
  pasticceriacasteldebole.it
  pastimenangqq101.com
-pastonlry.com
  pastoral-allowance.000webhostapp.com
  pastorjohnjames.com
  pastorpaulocosta.com
@@ -266492,7 +266897,6 @@ patoimpex.com
  patpardini.com
  patraglobal.com
  patrajasa35018396invoicing.et.r.appspot.com
-patricia-batermoore.xyz
  patricia092.xyz
  patricia6484753.xyz
  patricia7213745.xyz
@@ -266502,6 +266906,7 @@ patriciaanderson.000webhostapp.com
  patriciacarver-profile-77532.online
  patriciacrosbytawfik.com
  patriciadale.buzz
+patriciahennessey.xyz
  patricialeger.ca
  patricialjackson65.com
  patriciammartinez.com
@@ -266631,6 +267036,7 @@ pawansinhaguruji.com
  pawarsoftwares.com
  pawebappsid.com
  pawel-sikora.pl
+pawemqiwp5tr8rsr49q2.top
  pawftsggskvqrezu-dot-millinium.ey.r.appspot.com
  pawleys-dot-djndms-app.df.r.appspot.com
  pawnacampfire.com
@@ -266656,8 +267062,10 @@ paxful-online.com
  paxful-payment.com
  paxful-protect.com
  paxful-sa.com
+paxful-secures.com
  paxful-service.com
  paxful-settings.com
+paxful-trade-vz21xam84ey.com
  paxful-verifier.com
  paxful.applepayers.com
  paxful.best
@@ -266681,7 +267089,6 @@ paxfulonlinepayment.com
  paxfulredeem.com
  paxfulsecure.xyz
  paxfulsecured.com
-paxfultrades.online
  paxfulverification.com
  paxfulverified.com
  paxfulviet.com
@@ -266809,7 +267216,6 @@ payee-halifax.com
  payee-issue-alert.com
  payee-online-cancel.com
  payee-onlinecheck.com
-payee-portal-halifax.com
  payee-prevention.co.uk
  payee-process.cc
  payee-registration.net
@@ -266834,6 +267240,7 @@ payee-security-measure.com
  payee-security.co.uk
  payee-security.com
  payee-securitylloyds.com
+payee-securitynotice.com
  payee-securityresolves-issue.info
  payee-support.co.uk
  payee-unregister.cc
@@ -266886,7 +267293,6 @@ payeesecure-check.com
  payeesecure-help.com
  payeesecure-hlep.com
  payeesecure-new.com
-payeesecuredalerts.com
  payeesecurelogin.net
  payeesecuresafety-help.com
  payeesecureuk.com
@@ -267041,6 +267447,7 @@ payp-accountaccess.com
  payp-al.acct-secure.icaremedical.org
  payp-en-gb.000webhostapp.com
  payp-info.xyz
+payp-review-info.com
  payp-uk.com
  payp-verification-login-user-login.werthantrading.com
  payp.authacc.xyz
@@ -267316,6 +267723,7 @@ paypal-login294.com
  paypal-login295.com
  paypal-login297.com
  paypal-login298.com
+paypal-login76.com
  paypal-login79.com
  paypal-login82.com
  paypal-login84.com
@@ -267563,8 +267971,6 @@ paypal-verified.prendnesia.site
  paypal-verify-acc.com
  paypal-verify-account1.cf
  paypal-verify-admin.synnect.za.bz
-paypal-verify-configuration-2f5f6e-409d-6c4901a5264-com.cf
-paypal-verify-configuration-l2f5f6e-409d-6c4901a5264-com.cf
  paypal-verify-uk.com
  paypal-verify.it
  paypal-verify0.serveirc.com
@@ -268005,6 +268411,7 @@ paypal.kundenservice-germany-sicherheit.info
  paypal.l2pp.top
  paypal.letima.de
  paypal.liberty-bank.cc
+paypal.limit-form.com
  paypal.limitations-uk-eu.com
  paypal.limitatonsuk.xyz
  paypal.limited-attempt.com
@@ -268020,7 +268427,6 @@ paypal.login-user-8783.com
  paypal.login-user-portal-ref55.com
  paypal.login.us.wahanadigital.co.id
  paypal.login.validate-secure-details.com
-paypal.logins.com.de
  paypal.loseyourip.com
  paypal.mattiasvaucher.com
  paypal.me.berarderic.com
@@ -268089,6 +268495,7 @@ paypal.resolution-portal.org
  paypal.resolve-form.com
  paypal.resolve-limitation.com
  paypal.resolve-my-account.com
+paypal.resolve-secureform.com
  paypal.resolvedaccountpage.com
  paypal.restore-access.com
  paypal.restore-myplan.com
@@ -268174,7 +268581,6 @@ paypal.supporthelpcentre.com
  paypal.supporto.account.e-commerciologino.com
  paypal.thatjohns.eu
  paypal.uk-accountsecurity.com
-paypal.uk-helpcentre.com
  paypal.uk-login.com
  paypal.uk-online-help-centre.com
  paypal.uk-restricted.com
@@ -268869,7 +269275,6 @@ pe9-a.jaysbrand.com
  peace-and-nature.com
  peaceau.org
  peaceful-feynman-b64b83.netlify.app
-peaceful-shannon-3a5675.netlify.app
  peacefulbirth.id
  peacefulplushes.com
  peacejetcargo.ne-n.com
@@ -269338,7 +269743,9 @@ persisthealthproject.org
  persona-zonavirtualbn1.com
  persona.tj
  personal-account.cc
+personal-accountsafety.com
  personal-asb.duckdns.org
+personal-banking-safety.com
  personal-bankingsupport.com
  personal-chase.serveirc.com
  personal-data-settings-security-support-id-amazon.com
@@ -269363,6 +269770,7 @@ personal.euklw.com
  personal.metrobankdirect.com.sabrinasstyledlife.com
  personal.saassecuritycommand.work
  personalbanking-check.com
+personalbanking-disable.com
  personalbanking-online.com
  personalbanking-payee.com
  personalbanking-secure.com
@@ -269829,7 +270237,6 @@ phkryzupzmdcmgmhxz.top
  phkwhnkzygueyxowklajqcqgei-dot-gleowayel400503.uc.r.appspot.com
  phlogenzym.ge
  phlrvudjqmbnnekj-dot-millinium.ey.r.appspot.com
-phmcpak.com
  phmgkayowehkuysb-dot-millinium.ey.r.appspot.com
  phmqtujfqgypfxwnje.top
  phoanbthjwggxbsm-dot-millinium.ey.r.appspot.com
@@ -269855,7 +270262,6 @@ phonautographic.info
  phone-experts.at
  phone-profil-reception.firebaseapp.com
  phone-profil-reception.web.app
-phone-rapport-call.web.app
  phoneaftivsyncs987tf9ffp.dt.r.appspot.com
  phonebookgetit.net
  phonecalls.blob.core.windows.net
@@ -269899,7 +270305,6 @@ photohamyenhue.ru
  photohyponastic.info
  photolabtrading.com
  photolettersonline.com
-photolikerfb.tk
  photoline-test.kht.ru
  photonalluvium.com
  photonspecialists.info
@@ -269924,7 +270329,6 @@ phphosting.osvin.net
  phphphrunescape.com-de.ru
  phphrunescape.com-de.ru
  phpinstafollowers.000webhostapp.com
-phpp.is-a-nurse.com
  phprealweb.com
  phpstack-405020-1274950.cloudwaysapps.com
  phpstack-466013-1470600.cloudwaysapps.com
@@ -270410,7 +270814,6 @@ pkuz.xyz
  pkvdex.tk
  pkvgjnsgfgkwgnnsjk.top
  pkwdiebstahlschutzde.shaxiaput.top
-pkwfdozrxsfcucej-dot-owaonk399399393.uk.r.appspot.com
  pkwjrqdjrfgwvecyxopwywmwqjyofvdpzqbo-dot-cryptic-now-290917.ey.r.appspot.com
  pkwmobilede.de
  pkwpwbzowlaanscm-dot-millinium.ey.r.appspot.com
@@ -270935,7 +271338,6 @@ pmco-tournament-season11.000webhostapp.com
  pmco2020-official.jkub.com
  pmco2020new.zzux.com
  pmcroadtechnology.com
-pmcsrwmcyvmlabmcetfignfcskyrhzxzoylb-dot-offgl8876899977678.uk.r.appspot.com
  pmcwzlpitswosafvixmliyuceb-dot-gloff849483.uk.r.appspot.com
  pmd-berufsbekleidung.at
  pmdhealthcare.in
@@ -271012,7 +271414,6 @@ pnhpwkkul.rogagot.com
  pnjhbdabc.com
  pnjuexeqkhbqnladtxmnyxgdxf-dot-gloff849483.uk.r.appspot.com
  pnkdmlsizslchfzs-dot-mnospot.ts.r.appspot.com
-pnkdmlsizslchfzs.mnospot.ts.r.appspot.com
  pnkjg.mentriqq.com
  pnl17.ddns.net
  pnm.dermals.org
@@ -271174,7 +271575,6 @@ pokerbetatest.com
  pokercllub88.com
  pokerku88.website
  pokeronline.casa
-pokerqq188.biz
  poketeg.com
  pokhnaljank.com
  pokiensnqktahsqqnbzqfjgvfmwhonauonyi-dot-cedar-code-289917.nn.r.appspot.com
@@ -271377,7 +271777,6 @@ pontosappita.com
  pontosemilhias.000webhostapp.com
  pontosinternetnc2.com
  pontosliveloparavoce.com
-pontosmilhassemprepresente.club
  pontosresgate.ntdll.top
  pontosresgatemultiplos.online
  pontossmilessb.ddns.net
@@ -271831,6 +272230,7 @@ post-73191469.pytsoluciones.com
  post-73680523.pytsoluciones.com
  post-74743443.pytsoluciones.com
  post-75628073.pytsoluciones.com
+post-77101369.ingeniousmarketer.com
  post-77347939.pytsoluciones.com
  post-77776920.pytsoluciones.com
  post-78325343.pytsoluciones.com
@@ -271857,7 +272257,6 @@ post-ch.espace-client-ca.site
  post-details.com
  post-e.top
  post-f.top
-post-facebook.com.eac.by
  post-g.top
  post-i.top
  post-id937137942.us
@@ -272272,6 +272671,7 @@ ppaccsettings.com
  ppactivation.com
  ppal-personal-recovery-team-gb.ir
  ppalertpal.com
+ppalerts-secure.com
  ppalerts-support.com
  ppalertsonline.com
  ppalogin.com
@@ -272617,7 +273017,6 @@ precedemustiness.net
  preceiro.com.br
  precinctbleach.com
  preciousdesignergems.com
-preciouspalmroyalhotel.com
  preciousroads.buzz
  precipitative-exami.000webhostapp.com
  precisandodelimite.ddnslive.com
@@ -272782,7 +273181,6 @@ presidentchamomile.com
  presidentialmoving.us
  presidentsacademy.ca
  presidentsummit2021.info
-presidentteam07.typeform.com
  presidium.hu
  prespanies.xyz
  presplw.cam
@@ -272874,29 +273272,6 @@ prezentownianet.shuiacause.top
  prezident-prof.ru
  prezzplay.net
  prf-gov-br.myfreesites.net
-prf.fbookcom-06545826.abajstore.ir
-prf.fbookcom-14685750.abajstore.ir
-prf.fbookcom-16386109.abajstore.ir
-prf.fbookcom-21181754.abajstore.ir
-prf.fbookcom-31383906.abajstore.ir
-prf.fbookcom-32018898.abajstore.ir
-prf.fbookcom-35092620.abajstore.ir
-prf.fbookcom-42682470.abajstore.ir
-prf.fbookcom-46244391.abajstore.ir
-prf.fbookcom-47763083.abajstore.ir
-prf.fbookcom-48047636.abajstore.ir
-prf.fbookcom-53518852.abajstore.ir
-prf.fbookcom-58507741.abajstore.ir
-prf.fbookcom-65420109.abajstore.ir
-prf.fbookcom-66911395.abajstore.ir
-prf.fbookcom-67560526.abajstore.ir
-prf.fbookcom-75752237.abajstore.ir
-prf.fbookcom-81740425.abajstore.ir
-prf.fbookcom-83811812.abajstore.ir
-prf.fbookcom-86236901.abajstore.ir
-prf.fbookcom-90939913.abajstore.ir
-prf.fbookcom-95244913.abajstore.ir
-prf.fbookcom-98396372.abajstore.ir
  prfgzhsgtdmptfmo-dot-millinium.ey.r.appspot.com
  prfle-18200467.mansurtech.com
  prfle-45412636.mansurtech.com
@@ -272913,6 +273288,7 @@ pribregny.ru
  pricealert.pk
  pricecutautosales.com
  priceless-goldwasser-6955fa.netlify.com
+priceless-panini-c00b09.netlify.app
  pricelowgroup.ru
  pricerightbins.com.au
  pricerightrentals.com
@@ -273481,7 +273857,6 @@ profilefb-94187059.aicp.edu.pk
  profilefb-97047468.aicp.edu.pk
  profilefbitem.me
  profileidview.com
-profileinstagram.onmypc.biz
  profilemyoriflame2.000webhostapp.com
  profileonline360.com
  profilereverify.com
@@ -274211,6 +274586,7 @@ psmkreditsyari.com
  psn-codes-generator.com
  psnacademy.in
  psndea.ci
+psngbubu.otzo.com
  psotm.pl
  pspariz.com
  psppros.site
@@ -274394,6 +274770,7 @@ pubgaj.xfree1.com
  pubgak.com
  pubgbattlesgrounds.com
  pubgbests.com
+pubgblackpinks15.com
  pubgbloe.com
  pubgbox13.com
  pubgbug14.jkub.com
@@ -274420,7 +274797,6 @@ pubgevent13.xxuz.com
  pubgevent14.jkub.com
  pubgevent2.parkpubg.com
  pubgeventdx.otzo.com
-pubgeventgetnow.com
  pubgeventhalloween.com
  pubgeventhallowen.com
  pubgeventlucky.zyns.com
@@ -274489,6 +274865,7 @@ pubglocks.xyz
  pubglucky.dynamic-dns.net
  pubglucky15.dnset.com
  pubglucky16.dynamic-dns.net
+pubgluckygift.com
  pubgluckyspin.ddnsgeek.com
  pubgluckyspin.kozow.com
  pubgluckyspin.my03.com
@@ -274535,7 +274912,6 @@ pubgmdevs.com
  pubgme.my.id
  pubgmelite.com
  pubgmenv.com
-pubgmetro.dynamic-dns.net
  pubgmetro16.dnset.com
  pubgmetrospin.dnset.com
  pubgmevent-draw.dns05.com
@@ -274603,6 +274979,7 @@ pubgmobilegifte.com
  pubgmobilehalloweek.com
  pubgmobilehalloweek2020.com
  pubgmobilehalloweeks.com
+pubgmobilehallowen.net
  pubgmobilelucky.myvnc.com
  pubgmobilelucky.net
  pubgmobileluckyspin.myvnc.com
@@ -274658,7 +275035,6 @@ pubgmsgift11.zyns.com
  pubgmskinmax.com
  pubgmskinxlucky.duckdns.org
  pubgmspin13.giize.com
-pubgmspinn.dnset.com
  pubgmspinvip.com
  pubgmtrick.otzo.com
  pubgmul.com
@@ -274669,7 +275045,6 @@ pubgmx16.dnset.com
  pubgmx4.com
  pubgmxii.vizvaz.com
  pubgmxluckysevent.myvnc.com
-pubgmxmetro.dynamic-dns.net
  pubgmxmetroexodus.com
  pubgmxz.jkub.com
  pubgmyace.com
@@ -274678,11 +275053,12 @@ pubgnazar.xmidasbuy.com
  pubgnblack.com
  pubgner.com
  pubgnews14.kozow.com
+pubgnhalloweeksnow.com
+pubgnov.com
  pubgnunu.fun
  pubgofficial1.com
  pubgonly.com
  pubgot.com
-pubgothers.com
  pubgp.xfree1.com
  pubgpages.com
  pubgpress.com
@@ -274695,11 +275071,12 @@ pubgreedemcode.com
  pubgrew.com
  pubgreward.dnset.com
  pubgreward.kozow.com
-pubgrewardbug.com
  pubgrewardfree.000webhostapp.com
  pubgrewards.zzux.com
  pubgrewards15.com
+pubgrewards16.com
  pubgrjmobile.com
+pubgroyale.in
  pubgroyalepass.com
  pubgrp13.rulepubg.com
  pubgrp13.zzux.com
@@ -274790,7 +275167,6 @@ pubgxmaterials.net
  pubgxmobile.giize.com
  pubgxmun.com
  pubgxnew.com
-pubgxord.com
  pubgxpink.net
  pubgxramadhan.jkub.com
  pubgxrun.com
@@ -275049,6 +275425,7 @@ purpledigits.com
  purplehygiene.uk
  purpleinfinity.com.au
  purpleline.co.uk
+purplemoney.nl
  purpleppeonyphotography.com
  purplesblog.com
  purposeaccount.com
@@ -275311,6 +275688,7 @@ pyl-updatelimitedaccount.nsupdate.info
  pymcars.com
  pyment-dataccess.servehttp.com
  pympcdvyffthvwbxuakwqpczhhyiqtvreaab-dot-cryptic-now-290917.ey.r.appspot.com
+pyncvgeicmzlkdfz-dot-auth-online-sevice.ey.r.appspot.com
  pyngffsieibprnvydzyuxfrpim-dot-gleowayel400503.uc.r.appspot.com
  pyojun-eo.000webhostapp.com
  pyou.cf
@@ -275362,7 +275740,6 @@ pzbhhc.dermals.org
  pzbxwcoqeixyxodd-dot-millinium.ey.r.appspot.com
  pzcejkgkrwzwrpetwwapolxwrq-dot-gleowayel400503.uc.r.appspot.com
  pzdlwjcbmyteirosedndjmsatiofoqpsemhe-dot-offgl8876899977678.uk.r.appspot.com
-pzdlwjcbmyteirosedndjmsatiofoqpsemhe.offgl8876899977678.uk.r.appspot.com
  pzfkdlcjxfjrnxvk-dot-millinium.ey.r.appspot.com
  pzfpwfykqsjxnqiicsbdbfncmssdzvxfrzhj-dot-solar-vertex-285913.rj.r.appspot.com
  pzhv.goruli.com
@@ -275471,7 +275848,6 @@ q9m5.onderhost.com
  q9sj.oujevais.com
  qa-qm.top
  qa-wd.top
-qa.enel.folha.bestserviceit.com.br
  qa.jpmcc-sw.com
  qaanccoenng.pastfmcxbe.top
  qaavwtnsutmaaaunylchgnbupz-dot-gleowayel400503.uc.r.appspot.com
@@ -275760,7 +276136,6 @@ qhecuwjwmlbrjmad-dot-millinium.ey.r.appspot.com
  qhemp.io
  qhgaambfqoxnjfay-dot-millinium.ey.r.appspot.com
  qhgdvjsrodibeoub-dot-millinium.ey.r.appspot.com
-qhhscepexpjjtvdjmngokenswfubjuhwebfz-dot-offgl8876899977678.uk.r.appspot.com
  qhivtqwyclumbeqy-dot-millinium.ey.r.appspot.com
  qhkmgxegvkkxbdwchm.top
  qhkudtgdnsajvciy-dot-millinium.ey.r.appspot.com
@@ -275809,6 +276184,7 @@ qijgoaxusvloqfbr-dot-millinium.ey.r.appspot.com
  qijjojkcrotakpwg-dot-millinium.ey.r.appspot.com
  qikgen.com.au
  qikplvxzxbwbksfa-dot-millinium.ey.r.appspot.com
+qilamks.com
  qingsushiye.cn
  qingyia.site
  qingyuan.yfqzdfd.com
@@ -275934,7 +276310,6 @@ qmocrcburngflvue-dot-millinium.ey.r.appspot.com
  qmrcjrjkvymtbxoe-dot-millinium.ey.r.appspot.com
  qmrhqnniszfgqevx-dot-owaonk399399393.uk.r.appspot.com
  qmrygjyvejkkmmdq-dot-millinium.ey.r.appspot.com
-qms.sentes-bir.com
  qmsled.com
  qmtpbzhcffcmofji-dot-millinium.ey.r.appspot.com
  qmupdvhsdctcwvmspyyvrrynxp-dot-gleowayel400503.uc.r.appspot.com
@@ -276305,6 +276680,7 @@ quarantainezone-homebanking.online
  quarantine-digipass.website
  quarantine.cc
  quarantined-mails.df.r.appspot.com
+quarantineflashmob.com
  quarantnewebmail.an.r.appspot.com
  quarantnwebmail.an.r.appspot.com
  quarenta.eu
@@ -276459,6 +276835,7 @@ quickwashing.cl
  quickwittedmammothflatassembler--five-nine.repl.co
  quickwood.com
  quickyfunds.com
+quickytrim.casa
  quickzone53.com
  quienbsulapf.dfbusjkjftestaweb.co.fbuahusnkldfj.top
  quieroletras.com
@@ -276625,7 +277002,6 @@ qwdnyharywdsfarj-dot-owaonk399399393.uk.r.appspot.com
  qwdygbbnzekkperjrrojrccpul-dot-gleowayel400503.uc.r.appspot.com
  qwe123123.mp3barlounge.com
  qwe12er217rg12h3t6x78giy8783cbtdc3268c32bt678c32bt78.com
-qwec.vercel.app
  qwedfvngfyh.ug
  qweiall.com
  qweials.com
@@ -276715,6 +277091,7 @@ qxvw.psdzy.com
  qxwmfjuxirgbaxxc-dot-millinium.ey.r.appspot.com
  qxwvanmepdfymkjizgctbze.top
  qxwzgyahfvrktkjk-dot-millinium.ey.r.appspot.com
+qy.jandigitalstudios.com
  qy6d1.jaysbrand.com
  qy88vip.com
  qyaedqndhzeaixrfeqjfwfkalt-dot-gleowayel400503.uc.r.appspot.com
@@ -276934,8 +277311,6 @@ rabo-betaal-pas.info
  rabo-covid19.com
  rabo-covid19.online
  rabo-diensten.services
-rabo-klantenproces.info
-rabo-klantenverificatie.info
  rabo-klantverificatie.info
  rabo-login.ml
  rabo-omgeving.info.pl
@@ -277323,8 +277698,6 @@ rakutanz.xyz
  rakutanza.xyz
  rakute-n.4efa7aed6eaefc9bac7e.xyz
  rakute.xyz
-rakutem-account.buzz
-rakutem-account.icu
  rakutem-account.monster
  rakutem-carde-co.jp
  rakutem-cardm-co.jp
@@ -277365,6 +277738,7 @@ rakuten-account.xyz
  rakuten-am.buzz
  rakuten-c0.jp2.4efa7aed6eaefc9b1ac18e.buzz
  rakuten-c0.jp2.4efa7aed6eaefc9b1ac18e.icu
+rakuten-c0.jp3.4efa7aed6eaefc9b1ac18e.buzz
  rakuten-c0.jp3.4efa7aed6eaefc9b1ac18e.icu
  rakuten-c0.jp4.4efa7aed6eaefc9b1ac18e.buzz
  rakuten-c0.jp4.4efa7aed6eaefc9b1ac18e.icu
@@ -277931,6 +278305,7 @@ rakuten.co.jp.rakuitan.xyz
  rakuten.co.jp.rakuiten.xyz
  rakuten.co.jp.rakulan.xyz
  rakuten.co.jp.rakulten.xyz
+rakuten.co.jp.rakumtn.xyz
  rakuten.co.jp.rakuntan.xyz
  rakuten.co.jp.rakuntenvip.xyz
  rakuten.co.jp.rakutaen.xyz
@@ -278080,12 +278455,12 @@ rakuten.co.jp.rakuteun.xyz
  rakuten.co.jp.rakutev.top
  rakuten.co.jp.rakutianv.xyz
  rakuten.co.jp.rakutncojp.xyz
-rakuten.co.jp.rakutol.xyz
  rakuten.co.jp.rakutren.xyz
  rakuten.co.jp.rakutten.cc
  rakuten.co.jp.rakuttenn.tk
  rakuten.co.jp.rakutun.xyz
  rakuten.co.jp.rakutven.top
+rakuten.co.jp.rakuuen.xyz
  rakuten.co.jp.rakuven.icu
  rakuten.co.jp.rakuvip.xyz
  rakuten.co.jp.rakvtan.xyz
@@ -278096,6 +278471,7 @@ rakuten.co.jp.rakvten.top
  rakuten.co.jp.rakvten.xyz
  rakuten.co.jp.rakvtenr.xyz
  rakuten.co.jp.rakvteo.xyz
+rakuten.co.jp.rankutenvip.xyz
  rakuten.co.jp.rasdzxcc.xyz
  rakuten.co.jp.ratuenlkrtbrtbxt.xyz
  rakuten.co.jp.ratuenlktjlkznlkrlkl.xyz
@@ -278390,6 +278766,7 @@ rakutenidajdqidcojp.com
  rakutenidletiancojp.com
  rakuteninfohelpdesk.xyz
  rakutenja-jpy.xyz
+rakutenjp.shop
  rakutenjp.word.annzenkannri-rakuten.buzz
  rakutenjpjy.xyz
  rakutenjpp.buzz
@@ -278467,6 +278844,7 @@ rakutenv1.xyz
  rakutenva.xyz
  rakutenvh.xyz
  rakutenvn.xyz
+rakutenvp.xyz
  rakutenvq.xyz
  rakutenvr.xyz
  rakutenvw.xyz
@@ -278525,7 +278903,6 @@ rakvton.co-jp.eioneaoenoa.csoweya.cn
  rakyten.car-jcb-update39.top
  ralehostil.temp.swtest.ru
  raleighbrag.com
-raleighrepair.com
  raliiletradings.co.za
  ralister.co.uk
  rallyabruptly.online
@@ -278785,6 +279162,7 @@ raubtiereinfo.baerseventake.top
  rauchwurst.ch
  raudas.se
  raukuten-co-jp.com
+raukvtnec-cc-jp.top
  raulgzz.com
  raulodge.buzz
  raumai18.com
@@ -279812,6 +280190,7 @@ recouverment-sfr.com
  recover-amazon.serveirc.com
  recover-amazonseo.serveirc.com
  recover-chasesecure.myvnc.com
+recover-gmail.com
  recover-membership.com
  recover-mkfbkn.tk
  recover-my-paypal-account.gleeze.com
@@ -279966,7 +280345,6 @@ redeem-magic-cube-gratis-fre-fire.000webhostapp.com
  redeem-taxrepayment.com
  redeemerssports.com
  redeempubgms15.zyns.com
-redeemskin.com
  redeemtaxclaim-hmr.com
  redeemtencent.com
  redeftp.ddns.net
@@ -280046,7 +280424,6 @@ redirectsdown.blogspot.com.es
  redirectsecureservi.sytes.net
  redirectwebupdatedsecure.com-serverinternal.thewebmailsign.com
  redirectwwer.servequake.com
-rediree3.from-wv.com
  redirmail-apsupp-003549874833478523.billing-update379323.xyz
  redirpcpoints.com
  redisecincs.com
@@ -280297,6 +280674,7 @@ register-personal-security.com
  register-setting-online.webnode.com
  register-singup.com
  register-vanillascard-zipcode.com
+register.amz.co.jp.amazon-update-jp.top
  registerbnzonasegura1online.com
  registercovid.co.za
  registered-customer.work
@@ -280506,6 +280884,7 @@ release-officemail.com
  release-proposal.com
  releasecloud.se-qbb.com
  releasepromo.com
+releases404.com
  relenarious.xyz
  relep.org
  relevantcodes.com
@@ -280698,6 +281077,7 @@ remove-gb.cc
  remove-ipayees.com
  remove-new.com
  remove-newdevice-halifax.com
+remove-newdevice-security.com
  remove-newpayee.co.uk
  remove-payee-online.co.uk
  remove-payee.co.uk
@@ -280730,6 +281110,7 @@ removenewdevice-securely.com
  removenewdevice-security.com
  removenewpayee-help.world
  removenewpayeeadd.com
+removepayee-auth.com
  removepayee-info.com
  removepayee-securely.com
  removepayee-security.com
@@ -280754,7 +281135,6 @@ remv-44088788.bandgea.com
  remv-44836359.bandgea.com
  remv-60235628.bandgea.com
  remv-68117574.bandgea.com
-remvpost-facebook.com.eac.by
  remycare.com
  remyshair.com
  remzclot.ga
@@ -281214,7 +281594,6 @@ resolutionelectric.com
  resolutionhomesales.com
  resolve-fraud-help.com
  resolve-issues-with-account.com
-resolve-limit-issues.com
  resolve-mydevice.com
  resolve-payee.com
  resolve-suspension-onlineee-reactivate-access.000webhostapp.com
@@ -281364,10 +281743,10 @@ restrictionmy-3billing.com
  restrictions-mybill-o2.com
  restrictions-mybillingo2.com
  restrictions-myeebilling.com
-restrictions-myeelogin.com
  restrictions-myvirgin.com
  restrictionsmy-3account.com
  restrictionsmy-3alert.com
+restrictionsmy-ee.com
  restrizione-accesso.com
  restrizione-montepaschi.com
  restrizioneban-anagrafica.com
@@ -281455,7 +281834,9 @@ reszvxz.000webhostapp.com
  ret-137b.com
  ret.space
  ret4351trekj3234dsf.icu
+retag-2085480149.trapinfo.be
  retag-2316137769.trapinfo.be
+retag-2437267610.trapinfo.be
  retag-3014993665.trapinfo.be
  retag-5640771341.trapinfo.be
  retail.santander.co.uk.365thingslosangeles.com
@@ -281659,6 +282040,7 @@ reviewmypayee.com
  reviewonline-office365sharepointdocs.com
  reviewpayee-secured.com
  reviewpayee-security.com
+reviewpayees-online.com
  reviewpayment.info
  reviews-file.app.link
  reviews-writer.com
@@ -281739,6 +282121,7 @@ reward8626.chksrvnewtoday17.life
  rewardeventmetros16pubg.com
  rewardgift.club
  rewarditemspin.mrbonus.com
+rewardpubgm16.com
  rewardpubgms.giize.com
  rewardpubgms13.com
  rewardpubgms13.myddns.rocks
@@ -281760,7 +282143,6 @@ rewebmail-login.web.app
  rewindpiquillok.com
  rewitek.nl
  rewqas.xyz
-rewqqwer1.000webhostapp.com
  rewrer.ddns.net
  rewritish.xyz
  rewrt53t0ue23.000webhostapp.com
@@ -282325,7 +282707,6 @@ river-wave.info
  riverbendbags.com
  riverhaven.com
  rivermounthotelandresort.com
-rivernight.net.au
  riverplatestore.com
  riversidehoanghuy.com
  riversideri.buzz
@@ -283303,7 +283684,6 @@ royaldebank.com
  royalebrasil.com.br
  royaleestategroup.in
  royalempresshair.com
-royalenterprisesindore.com
  royalesc.ru
  royaleventsnola.com
  royalfederationministryjusticenzluk.com
@@ -283330,6 +283710,7 @@ royalparkhotel.com.br
  royalplusmobile.ir
  royalpostcards.be
  royalqueennyc.com
+royalresearch.co.in
  royalsclubinternational.com
  royalsecurityinc.com
  royalservice-eg.com
@@ -284108,8 +284489,6 @@ rvm-07454011.phonepanda.net
  rvm-08425082.phonepanda.net
  rvm-12813611.phonepanda.net
  rvm-41053725.phonepanda.net
-rvm-46465492.phonepanda.net
-rvm-58042148.phonepanda.net
  rvm-59363309.phonepanda.net
  rvm-67967069.phonepanda.net
  rvm-74985265.phonepanda.net
@@ -284279,7 +284658,6 @@ ryofhmezac.duckdns.org
  ryparorab.tk
  rypdegqoweysiake-dot-millinium.ey.r.appspot.com
  rypzdszqkzzxndqbez.top
-ryrxnguoiqgxpwtrhrmqzgcfrzzprfhywfhh-dot-offgl8876899977678.uk.r.appspot.com
  rysa.neformalforum.online
  rysdrips.com
  rysqqxpqfujqkrp.e8273.pro
@@ -284429,6 +284807,7 @@ s1450014119.ir
  s146.goserver.host
  s1577556206.t.en25.com
  s1591e46.xyz
+s16spinsmetroroyales.com
  s17g70bu.web.app
  s18a-nao-fica-de-fora-aproveite.com
  s1ack.cc
@@ -284973,7 +285352,6 @@ saintignatiouscollege.co.za
  saintiment.us
  saintiocese.com
  saintjames24org.baerseventhere.top
-saintjohnsmi.xyz
  saintsandsinnersbar.com
  saintspierreetpaulyenawa.com
  sainursing.co.in
@@ -285540,7 +285918,6 @@ santiagoferreira.com.br
  santiagorey.net
  santillanaabogadosnet.chifanassociate.top
  santinas.cl
-santinastravenue.buzz
  santinohelpserve.com
  santonlineinc.com
  santoshwomencarehospital.com
@@ -285723,7 +286100,6 @@ sathnusery.com
  sathobby.com
  sathyamadvisory.in
  sati-win.getforge.io
-saticsupport.com
  saticsupport.net
  satin.co.il
  satiricon.be
@@ -285888,7 +286264,6 @@ sbci.am
  sbclinear-kr.com
  sbclinkedservicedin.weebly.com
  sbctlbikdggibsadcfmfmmyhnenzhlmwuqlm-dot-offgl8876899977678.uk.r.appspot.com
-sbctlbikdggibsadcfmfmmyhnenzhlmwuqlm.offgl8876899977678.uk.r.appspot.com
  sbcxx.weebly.com
  sbdflw.tw
  sbe2group.com
@@ -285977,6 +286352,7 @@ scaleneunknown.com
  scalesamendment.com
  scalextricman.co.uk
  scaleyourstores.com
+scalloped-enclosure.000webhostapp.com
  scalpersbar.com
  scalpmedreview69.com
  scalymblematicw.com
@@ -286234,6 +286610,7 @@ scotiabank.ca.ssl-d3-5fss.com
  scotiabank.ca.ssl9-cds-secure.com
  scotiabank.redwolfsecurity.com
  scotiabankco.co
+scotiabankcolpatriasecuri.ibx.lat
  scotiabankcolpatriavirtual.info
  scotiabankcrbienesalaventa.com
  scotiabanks.online-logins.com
@@ -286589,7 +286966,6 @@ seamfwpmjyxmrxkpflqmafgbngqlrllxfcev-dot-glegen303939423233.ue.r.appspot.com
  seamountmy.com
  seamusville.buzz
  seancourse.buzz
-seanetmaritime.eu
  seangrattana.com
  seankesler.com
  seannsmit.com
@@ -286633,6 +287009,8 @@ season13gifts.zzux.com
  season13pubg.com
  season14events.com
  season14pubg.com
+season16metroexodus.com
+season16pubg.com
  seasonable-waterlin.000webhostapp.com
  seasonalharsh.com
  seasonalhostage.com
@@ -286974,6 +287352,7 @@ secure-deregisterdevice.com
  secure-details-validate.com
  secure-device-halifax.com
  secure-devicebreach.cc
+secure-devicemanage.net
  secure-deviceonline-login.com
  secure-deviceonline.cc
  secure-devices-online-logins.com
@@ -287027,10 +287406,10 @@ secure-getinbank.at
  secure-getinbank.com
  secure-getway21b63240.gemis.it
  secure-getway29032be1.lepetitdhomme.org
-secure-gov-co-uk.com
  secure-gov-hm-revenue.com
  secure-gov-process-hmrev.com
  secure-gpayment.serveirc.com
+secure-hali-checkpayee.link
  secure-hali-fax-online.com
  secure-halifax-alerts.com
  secure-halifax-cancel.co.uk
@@ -287042,6 +287421,7 @@ secure-halifaxonline-login.cc
  secure-halifaxonline-login.com
  secure-halifaxonline.net
  secure-halipayee.link
+secure-helpme.com
  secure-helponline.misecure.com
  secure-helwan22.com
  secure-huntington.myvnc.com
@@ -287065,12 +287445,14 @@ secure-listing-product-id37763612-promotion.com
  secure-lloyd-payee.net
  secure-lloyds-device.com
  secure-lloyds-now.com
+secure-lloyduk.com
  secure-lnstagrann.tk
  secure-log.link
  secure-login-3.network
  secure-login-bankia.com
  secure-login-bankia.xyz
  secure-login-fargo.com
+secure-login-halifax-info.com
  secure-login-helwan-45.com
  secure-login-hm-revenue-refund-claim.tax-info.services
  secure-login-microsoftonline.oa.r.appspot.com
@@ -287095,7 +287477,7 @@ secure-my-details.com
  secure-my-hali-payee-info.com
  secure-my-hali.com
  secure-my-lloyds-account.com
-secure-my-online-banking.com
+secure-my-login.live
  secure-my-payee-hali-help.com
  secure-my-payee-info-hali.com
  secure-my-payee-info-help.com
@@ -287120,6 +287502,8 @@ secure-netflix-pay.com
  secure-network-web.com
  secure-new-device.link
  secure-new-login.link
+secure-newalert.link
+secure-newdevice.link
  secure-newpayee.cc
  secure-notice-account-sign.valhallainfull.com
  secure-notice-app-sign.haggshe.com
@@ -287143,6 +287527,7 @@ secure-onlinebanking-review-dashboards.ddnsfree.com
  secure-onlinehali.com
  secure-onlinenatwest.com
  secure-onlinesend.com
+secure-onlineuk.info
  secure-paiement236b9e3e.exhemplara.it
  secure-paribas.at
  secure-payee-admin.com
@@ -287478,8 +287863,10 @@ secure.paycount.intl-information.login.client2020.vauwda.org
  secure.paycount.intl-information.login.client2020.vkahs.org
  secure.paycount.intl-information.login.client2020.vnmazh.org
  secure.paycount.intl-information.login.client2020.vojaiz.org
+secure.paycount.intl-information.login.client2020.vonzxb.com
  secure.paycount.intl-information.login.client2020.xhjgcvy.com
  secure.paycount.intl-information.login.client2020.xjzysvx.org
+secure.paycount.intl-information.login.client2020.yikosm.org
  secure.paycount.intl-information.login.client2020.zcuhaw.org
  secure.paycount.intl-information.login.client2020.zhugc.org
  secure.paycount.intl-information.login.client2020.znacu.org
@@ -287835,7 +288222,6 @@ secure05a-chase.xijhciasd.com
  secure05a-chaseinfo.duckdns.org
  secure05a-paypal.ddns.net
  secure05a.chase.com.carolineresidence.com.br
-secure05a.onlinebankschase.com
  secure05b-chaseonline-verification.translogbooster.com
  secure05b-login.x24hr.com
  secure05b-verifyinfo-auth.dns04.com
@@ -287907,6 +288293,7 @@ secure07q-online-chase.000webhostapp.com
  secure07statementxx3mnd48.duckdns.org
  secure07ve-cox.webcindario.com
  secure08-chasesec.automaticauth.com
+secure08a-chase.com
  secure08a.chase.com.banking-acct.com
  secure08ac.dispute-transaction.cv-alexypaiva.com
  secure08auth.online
@@ -288249,7 +288636,6 @@ securedeliveryexpress.com
  securedeposit.redirectme.net
  securedevice-assist.com
  securedevice-authentication.link
-securedevice-management.com
  securedevice-online.link
  securedevice-updates.com
  securedevice-verify.link
@@ -288327,7 +288713,6 @@ secureindeed.ca
  secureinfo-account.com
  secureinfo-ee.co.uk
  secureinfo-protection.link
-secureinfo-signin.com
  secureinfo.giize.com
  secureinfo.live
  secureinfokayo.ddnsking.com
@@ -288348,6 +288733,7 @@ securelimitedupdate.serveirc.com
  securelin-activaton.cba.pl
  secureline-activity.dynamic-dns.net
  secureline-helpdesk.com
+securelloyds-auth.com
  securelloyds.com
  securelog.live
  securelogin-28162748274.selfip.com
@@ -288422,9 +288808,10 @@ securemydevice.uk
  securemyhalifax.com
  securemylloydsaccount.com
  securemylogin.live
+securemypayee-auth.com
  securemypayee-auth.info
+securemypayee-info-auth.com
  securemypayee-info.com
-securemypayee.com
  securemypayee.live
  securemytax.com
  securenet-pp.com
@@ -288478,6 +288865,7 @@ securepayee-unregistered-devices.com
  securepayeealert.com
  securepayeealerts.com
  securepayeelogin.com
+securepayeeremoval.com
  securepayees-hs.com
  securepayees-personal.com
  securepayees-unregistered-devices.com
@@ -288667,6 +289055,7 @@ security-ads-recovery-pagee.000webhostapp.com
  security-ads-transparency-safety.000webhostapp.com
  security-alert.giize.com
  security-alert.secure01a.chase.com-auth.mydailywire.us
+security-alertpayee.com
  security-alertuk.com
  security-and-protection-wells-fargo.com
  security-appendpayee.com
@@ -288684,7 +289073,6 @@ security-confirm-payee.com
  security-confirmdevice.com
  security-confirmdevices.com
  security-device.differcookie.net
-security-deviceauthentication.info
  security-en-issuepayment.com
  security-failed-alert-402.azurewebsites.net
  security-fb2020.ydns.eu
@@ -288739,7 +289127,7 @@ security-page.pagenotif.cf
  security-page.pagenotif7.ga
  security-pages-help.000webhostapp.com
  security-payee-admin.com
-security-payee-authentication.com
+security-payee-authenticate.com
  security-payee-check.com
  security-payee-validate.com
  security-payeealert.com
@@ -289297,13 +289685,14 @@ sempreinovando12.com
  semprejunto-com-voce.com
  semprelive-diaadia-lindo.com
  sempremagaluu.com
+sempremilhasexpirando.club
  semprepres.sslblindado.com
  semprepresensecurity.com
  semprepresente-apppass.com
  semprepresente-itaucard.online
  semprepresentecheckinonline.com
+semprepresenteexpirando.club
  semprepresenteitaucard.online
-semprepresenteprestesaexpirar.club
  semtus.work
  semvice11.000webhostapp.com
  sen-jin.co.jp
@@ -289367,6 +289756,7 @@ senirolifestyle.com
  senjataadandmffgratis.000webhostapp.com
  senka.com.tr
  senklube.com
+senmzsuanzk.wang
  sennesgroup.com
  sensajans.me
  sensationalistic-me.000webhostapp.com
@@ -289440,6 +289830,7 @@ sephiroth99.zapto.org
  sepidtak.com
  sepintuot.com.s3-website.us-east-2.amazonaws.com
  sepost-q.top
+sepost-r.top
  seppnzt.goruli.com
  seproc.hn
  sepsis.lightefashion.com
@@ -289594,7 +289985,6 @@ server.main.login.support.hotwills.com.au
  server.newserv-vmfx.xyz
  server.secure-ionos.es-9ofsplknwepe8spr65xh8ra6avih.elizabethgermain.com
  server.skicoupons.com
-server.vmservx.xyz
  server.xasf.spca-lit.uno
  server012754.nazwa.pl
  server028346.nazwa.pl
@@ -289700,7 +290090,6 @@ serveur-70-vocal.webnode.sk
  serveur-messagerie3103.weebly.com
  serveur-mobile.webnode.com.co
  serveur-septembre2020-inf0smicrosft00.weebly.com
-serveur22503.000webhostapp.com
  serveurmobileteelcomsvr.it
  serveurnseinform.ddns.net
  serveurprocompte.h70.ir
@@ -289730,6 +290119,7 @@ service-account.cherryfinger.business
  service-account.contextlaser.com
  service-account.continuationmarsh.business
  service-account.cuttingabroken.com
+service-account.drivessuffering.com
  service-account.erudstilag.business
  service-account.evetestia.com
  service-account.falsifyjob.business
@@ -289881,6 +290271,7 @@ service-rankuten-account.club
  service-rbcroyalbank.com
  service-refund-mobile.com
  service-refundenets.net
+service-securipasse.com.brilliantreach53.com
  service-securite0.com
  service-social-media-invitation-0200001101.my.id
  service-social-media-invitation-10027450047.my.id
@@ -290051,6 +290442,7 @@ serviceintlpypal.000webhostapp.com
  servicekouzina.gr
  servicektoa.com
  servicekunta087354.ddns.net
+servicelogin.social
  servicemailbox888.webnode.com.co
  servicemailvocale.yolasite.com
  servicematamua.kim
@@ -290088,6 +290480,7 @@ services-amazonseo.serveirc.com
  services-apple.online
  services-appserver-mail-89754.macisoklsda.com
  services-besson.org
+services-copyright-center.cf
  services-fargo.mobi
  services-inc.net
  services-mail-exchange-cox.netlify.app
@@ -290128,6 +290521,7 @@ services.runescape.com-eng.top
  services.runescape.com-ew.top
  services.runescape.com-f.cz
  services.runescape.com-free.xyz
+services.runescape.com-gethd.xyz
  services.runescape.com-getmobile.top
  services.runescape.com-getone.xyz
  services.runescape.com-gift.xyz
@@ -290712,6 +291106,7 @@ sfphngblqxuxcnugchhllumwzi-dot-gleowayel400503.uc.r.appspot.com
  sfpress.servebeer.com
  sfr-cas-login.weebly.com
  sfr-client.weebly.com
+sfr-revision.com
  sfr.godaddysites.com
  sfreag.com
  sfrmails-id.weebly.com
@@ -290720,7 +291115,6 @@ sfrwanda.org
  sfs-group.net
  sfs.qmocldw.cn
  sfscalqygduwhrxfdtygedswoifnzplqejkz-dot-offgl8876899977678.uk.r.appspot.com
-sfscalqygduwhrxfdtygedswoifnzplqejkz.offgl8876899977678.uk.r.appspot.com
  sfsdfpizdatrtu.space
  sfshfkfaf.co.vu
  sfsurflessons.com
@@ -291018,6 +291412,7 @@ shantouhallowed.com
  shantpa86erh.ml
  shantubben.wang
  shantui.me
+shaocxiuks.wang
  shaoguan.yfqzdfd.com
  shaoguzhai.cn
  shaolintempletanzania.com
@@ -291179,6 +291574,7 @@ shawizin.life
  shawktech.com
  shawn-harris.com
  shawnanbrown.com
+shawnkaram.com
  shawnrbrown.com
  shaxiaaddition.top
  shaxiaaddress.top
@@ -291218,6 +291614,7 @@ shaykhibrahim.com
  shayloco.net
  shaymshairs.com
  shayra.com.tr
+shays2020ss.000webhostapp.com
  shaza-ind.com
  shbddyflsyxgs.002.sh.cn
  shbirdiegolf.com
@@ -291763,6 +292160,7 @@ shridurgadevelopers.com
  shriganeshchemical.com
  shrihariindia.in
  shrilldamagedrange--five-nine.repl.co
+shrinavkarsevasansthan.com
  shriramenterprisesonline.com
  shrisarvhitkari.com
  shriyukt.com
@@ -291837,6 +292235,7 @@ shumbildac.com
  shunan.com.vn
  shuncheek.wang
  shunderyopulently.net
+shunsenghs.wang
  shunshun6.com
  shuntelevator.com
  shuochuopx.wang
@@ -291955,7 +292354,6 @@ sicurezza-info-aggiorna.000webhostapp.com
  sicurezza-informatica-bpm.info
  sicurezza-intesa-web.000webhostapp.com
  sicurezza-intesasanpaolo.info
-sicurezza-intesasanpaolo.shop
  sicurezza-intesaweb-psd2.000webhostapp.com
  sicurezza-lnfoweb2020.000webhostapp.com
  sicurezza-mps-assistenza.com
@@ -292037,13 +292435,10 @@ sifesro.com
  siffjeddah.com
  sifirbirtasarim.com
  sifycyber.com
-sig-in-data-facebook.gq
-sig-in-data-facebook.ml
  sig-in-facebook.cf
  sig-in-or-facebook.cf
  sig-in-or-facebook.ga
  sig-in-or-facebook.gq
-sig-in-or-facebook.ml
  sig-in-or-facebook.tk
  sigab.iainbukittinggi.ac.id
  sigadireitoegestao.com.br
@@ -292114,7 +292509,6 @@ sign-secure.accunt-log0987.bossquu98.com
  sign-secure.accunt-log999.garundangcilikmailpsiz.com
  sign-secure.com
  sign-supportappleidstoresistemacccount.akuyangmintaaag.com
-sign-up-verifikasi.tk
  sign-useracount-signin.aba.vg
  sign-verifyaccount.serveirc.com
  sign.account-paypal.cranmerrn.com
@@ -292142,7 +292536,6 @@ signapp.id-apple.com.webapps.thistrnsaction-web.com
  signaramanmb.com
  signatt.weebly.com
  signattupdate.weebly.com
-signaturegroup-au.com
  signatureheatingandair.com
  signatureppec.com
  signaturesoriginalgadget.com
@@ -292189,7 +292582,6 @@ signin-authpaypal.account.hhasdj.org
  signin-authpaypal.account.xvwsrxa.com
  signin-commbank.com
  signin-confirmation.com
-signin-digitalonline.com
  signin-e-bay-konto.site
  signin-ea.cz
  signin-ebay-de-ebayisapiii.epizy.com
@@ -292212,7 +292604,7 @@ signin-planmembership.com
  signin-pp-authenticate-secure.com
  signin-ru-ebay-message.com
  signin-secure.auth.authsecureinformation.com
-signin-securedigital.com
+signin-secureonline.com
  signin-security-amazon.com
  signin-store-ws.frontieroption.com
  signin-store-ws.info
@@ -292630,6 +293022,7 @@ signinngatt.weebly.com
  signinnoooooowtoupgradeyouraccount.weebly.com
  signinnow.weebly.com
  signinnowtoupgradetoourlatestversionmail.weebly.com
+signinnowwtoupdateyourmailaccount.weebly.com
  signinog-amnzoc.in
  signinog-amnzom.co
  signinpage.appleld.apple.feedback.case.dxavm.com
@@ -292905,7 +293298,6 @@ sinakhoessentials.co.za
  sinal.org
  sinaltogin.tk
  sinanarsitek.com
-sinanashkan.com
  sinapcis.com.br
  sinarbaruperkasa.com
  sinarint.com
@@ -292969,6 +293361,7 @@ singlesmingleschat.gq
  singlesmingleschat.ml
  singlets.co
  singohotel.com
+singpost-e.top
  singrechalfstec.tk
  singsingmusic.net
  singtel.visionanalytics.co
@@ -293269,7 +293662,6 @@ sjhy123.com
  sjkd.duckdns.org
  sjmp.co.in
  sjnd.in
-sjnuurdflgenhrgr-dot-owaonk399399393.uk.r.appspot.com
  sjomfpyj.goruli.com
  sjpharmacycollege.org
  sjqcur.dermals.org
@@ -293775,7 +294167,6 @@ slservicebd.com
  slsmiamihydecom.shaxiaact.top
  slspromaisju.jumuos.com
  sltgx.goruli.com
-sltorg.ru
  sltru.org.uk
  slucky.giize.com
  slugger.de
@@ -293949,7 +294340,6 @@ smashedbitter.com
  smasherviewpoint.com
  smashingcake.com
  smatrolluka.fotballskoler.no
-smattmail.weebly.com
  smaviastaff.com.br
  smb-ccousjp.com
  smba.no
@@ -293967,6 +294357,7 @@ smbc-account.monster
  smbc-account.xyz
  smbc-boun.club
  smbc-buzz.best
+smbc-c.oorb.top
  smbc-cacc.com.igjxpg.top
  smbc-caerd.best
  smbc-camrd.xyz
@@ -294016,7 +294407,6 @@ smbc-card.bastgia.cn
  smbc-card.bbrcm.shop
  smbc-card.best
  smbc-card.billguard.cn
-smbc-card.btchm.com
  smbc-card.cc
  smbc-card.chcgc.com
  smbc-card.co.jp.ac2696q.top
@@ -294099,6 +294489,7 @@ smbc-card.micniu.com
  smbc-card.mobi
  smbc-card.net.cn
  smbc-card.nffcp.com
+smbc-card.nmqvzsx.cn
  smbc-card.nmytrd.com
  smbc-card.nvnvu.com
  smbc-card.pmlsqp.com
@@ -294119,6 +294510,7 @@ smbc-card.top
  smbc-card.vip
  smbc-card.woosz.com
  smbc-card.yydjzb7.top
+smbc-card.zyszrc.com
  smbc-carda.buzz
  smbc-carda.monster
  smbc-carda.xyz
@@ -294335,10 +294727,10 @@ smcc-cacc.baccpro.xyz
  smcc-cacc.btchm.com
  smcc-cacc.buzz
  smcc-cacc.cacc.space
-smcc-cacc.ccad.top
  smcc-cacc.chcgc.com
  smcc-cacc.chsmfood.org
  smcc-cacc.com.dlxnv.top
+smcc-cacc.com.sajdy.top
  smcc-cacc.com.saydo.vip
  smcc-cacc.dgwrd.com
  smcc-cacc.eiair.com
@@ -294354,7 +294746,9 @@ smcc-cacc.macc.xyz
  smcc-cacc.momswearthis.com
  smcc-cacc.myttd.com
  smcc-cacc.nbbyzs.com
+smcc-cacc.nvnvu.com
  smcc-cacc.oocd.top
+smcc-cacc.oorb.top
  smcc-cacc.pacconline.xyz
  smcc-cacc.qqnpq.com
  smcc-cacc.sacc.space
@@ -294394,6 +294788,7 @@ smcc-card.sh6xclup.club
  smcc-card.uxcoe.com
  smcc-card.uxcwo.com
  smcc-card.wcxsac.com
+smcc-card.wouasc.com
  smcc-card.xcooe.com
  smccard.com
  smccycles.com
@@ -294413,6 +294808,7 @@ smdc-cord.hpty1.com
  smdc-cord.lsty1.com
  smdc-cord.rrty1.com
  smdc-cord.xxbfc2law.com
+smdc.oorb.top
  smddd.monster
  smddpgnjw.shoesmogul.com
  smdgo.com
@@ -294442,7 +294838,6 @@ smg-com-dot-gl494903049.wl.r.appspot.com
  smh5682.com
  smhydro.com.pl
  smibccrad-verifiy.xyz
-smiechawisko.eu
  smiechowo.eu
  smiesznawiocha.eu
  smieszne-zdjecia.eu
@@ -294503,7 +294898,6 @@ smnbec-coo-jpp.top
  smndazi.000webhostapp.com
  smnhd.svcoding.com
  smntk.mywire.org
-smntkwa.kozow.com
  smoaksscf.buzz
  smobccarsd.top
  smobco.top
@@ -294594,7 +294988,6 @@ smsmmsinfos.webador.com
  smsmsmvocal.weebly.com
  smsnetpro.com
  smsoftwares.com
-smspix-cadastro.com
  smspoint.biz
  smspro222.com
  smsreka300.netlify.com
@@ -295570,6 +295963,7 @@ soundline.com.cn
  soundproofingsurvey.000webhostapp.com
  soundspod.shop
  soundyahfcewsoft.club
+sounjiaohr.wang
  sountecaweb.na4u.ru
  sououzilrggrewyrvrnowcuakvuwkhsehoqd-dot-cryptic-now-290917.ey.r.appspot.com
  souperkitchen.org
@@ -296085,6 +296479,7 @@ spirtnoe.org.ua
  spitefulpristinerectangle--five-nine.repl.co
  spitex60plus.ch
  spix.com.my
+spk-authserv.xyz
  spk-filliale-direkt.xyz
  spk-finanzgruppe-de-home-portalredirect.ru
  spk-sicherheits-check.org
@@ -296217,7 +296612,6 @@ spotschool.org
  spotted-katowice-1021.pl
  spotted-wroclaw-471.pl
  spottedapple.com
-spotty-honeysuckle-mammal.glitch.me
  sppedgoo7.gq
  sppenterprises.in
  sppiscina.com
@@ -296355,6 +296749,8 @@ squaincc.com
  squainformation.com
  squaioremaster.com
  squairclemedia.com
+squairedisplte.me
+squairedisplte.org
  squaireomaser.com
  squairesx.com
  squajsdersup.com
@@ -296383,6 +296779,7 @@ squareadmin.com
  squarebal.com
  squarebase1.com
  squarebillrsare.com
+squarebusinesstools.com
  squarecbv1.com
  squarecbv4.com
  squareccl1.com
@@ -296411,6 +296808,7 @@ squareonerenovationsinc.com
  squareotp1.com
  squarep.net
  squarepickle.com
+squareretrieve.org
  squarerrn1.com
  squarerrn7.com
  squarerux.com
@@ -296427,6 +296825,7 @@ squarespacworkingservice5.com
  squarespareaez.com
  squaresupp.org
  squareterup01.com
+squaretrdispute.org
  squarety1.com
  squareup-team.co.uk
  squareup-team.org
@@ -296884,7 +297283,6 @@ ssoltecc.com
  ssomailweb342332.vercel.app
  ssomanagemyonline.oobslspumm.com
  ssosafeapp.mail.isacmilsu.com
-ssosgujiadnzwnkj-dot-owaonk399399393.uk.r.appspot.com
  ssosscast.com
  ssotrelowebmail.z13.web.core.windows.net
  ssp26.pl
@@ -297242,6 +297640,7 @@ statodiverificadati.com
  statos.xyz
  stats.paypal.com-informationaccounts.com
  stats.sitelemon.com
+statsanlsis.info
  statsdot.eu
  statsklinnksqureup.com
  statsrc.cool
@@ -297656,7 +298055,6 @@ steelbiteprosupplemnts.us
  steelboldin.cyou
  steelbuildings.com
  steelclik.us
-steelcoreindustrial.com
  steelecreekpresby.com
  steelestrong.org
  steelforging.biz
@@ -297667,7 +298065,6 @@ steelmemory.ru
  steelmotherlyboard--five-nine.repl.co
  steelsbitespro.buzz
  steeltits.xyz
-steeltoemarketing.ca
  steep-destiny-spring.glitch.me
  steeping-dragon.com
  steepingdragon.com
@@ -297863,6 +298260,7 @@ stikmafaka.prohosts.org
  stil-proiect.ro
  stilakk.mcdir.ru
  stilkom-jogi.com.mk
+still-commander.000webhostapp.com
  stiller245245234.ffox.site
  stillerdigitaldesign.com
  stillsmallfarm.com
@@ -298060,7 +298458,6 @@ storesaregood.com
  storeshop2.sslblindado.com
  storeshop3.sslblindado.com
  storesshop.sslblindado.com
-storesteampowered-charitysteam.gq
  storestiem.gixx.ru
  storetoss.cyou
  storetumamia.com
@@ -298374,6 +298771,7 @@ stuunhqllrucxmxhaikhnajopp-dot-gleowayel400503.uc.r.appspot.com
  stvg8ciw.web.app
  stwqylxknnhhrhgpdvogubwaui-dot-gleowayel400503.uc.r.appspot.com
  stxaviersvitthalwadi.com
+stykroted.casa
  stylam.cc
  stylebarchattanooga.org
  stylee-secret-school.com
@@ -298859,6 +299257,7 @@ sugilicali.zbel50.now.sh
  sugimura-taxaccountantoffice.com
  sugiono123.000webhostapp.com
  sugionoterbaru2020.ga
+sugis16.com
  sugiyamakaigawjp.ru
  sugoto.com
  suh-china.com
@@ -299488,6 +299887,7 @@ support-myjcb.t24te.uk.com
  support-mymembership.com
  support-nab.enrouteasiaholidays.com
  support-ncvbvcjaka.nreagb.com
+support-netflix.ca
  support-netflix.info
  support-netflixx.xyz
  support-notices.com
@@ -299601,7 +300001,6 @@ support.mail.apple.com.boqcmrmtvajl.com
  support.mail.apple.com.coronavirusenterpent.com
  support.manage-cloudupdate.com
  support.manager-verifyaccount-appleid.com
-support.mediafalcon.com
  support.mediahelpcenter.ml
  support.nab.expressdata.co.ke
  support.nmsqjzx.com
@@ -299860,7 +300259,6 @@ surbased-precedence.000webhostapp.com
  surctlrdqmdmlwgcyuhubhjmdeehfefzixme-dot-cedar-code-289917.nn.r.appspot.com
  surdmutableh.com
  surecleanpressurewashing.com
-surefootedforestgreenhack--five-nine.repl.co
  surel-verifikasi.m-fb-coom.ga
  surematvxz.tk
  sureshnaturopathy.in
@@ -299883,6 +300281,7 @@ surgicalface-mask.com
  surguy.com
  suriagrofresh.com
  suriahijabs.com
+surioprah.000webhostapp.com
  surishoppingexpress.nl
  surjmor.com
  surkentli.com
@@ -300313,7 +300712,6 @@ swisscom.myfreesites.net
  swissculturalfund.al
  swissmain.com
  swissorifice.ch
-swissp-fileshare.firebaseapp.com
  swisspaketshopcom.shaxiaadd.top
  swisspartners-ag.com
  swisspixstore.com
@@ -300363,7 +300761,6 @@ swvg-amazonservic9k.servebeer.com
  swvlzioabyvgbbzphxnwbaaussxnpgocfdvv-dot-solar-vertex-285913.rj.r.appspot.com
  swvwhafttmtj0907.top
  swwbia.com
-swwicchase-001-site1.itempurl.com
  swxadvexmail19mn.xyz
  swyftlife.com
  swzjvf.goruli.com
@@ -300719,7 +301116,6 @@ t-mobilehelp.org
  t-mrz.svcoding.com
  t-online-de.net
  t-online.de.rongouniversitychaplaincy.com
-t-paxful.com
  t-runescape.com.ua
  t-uber-sa.com
  t-uber.app
@@ -300839,7 +301235,6 @@ ta20w32e7u.ru
  ta2k.jaysbrand.com
  ta2sp.svcoding.com
  taaagh.com
-taacazzpubg.com
  taadr.com
  taalim.ma
  taarouf.com
@@ -300914,7 +301309,31 @@ tag-unfollow-68348553.viesurlenil.com
  taganu.com
  tagbdfgxtpjmrrqlkdobsecwrictgpzimfog-dot-spyexc3093493.ey.r.appspot.com
  tagfactory.in
+tagged-06384354.kiler.net
+tagged-06627047.kiler.net
+tagged-11253481.kiler.net
+tagged-12520382.kiler.net
+tagged-20392997.kiler.net
  tagged-3533992040.spacenetsolutions.it
+tagged-37218183.kiler.net
+tagged-38637091.kiler.net
+tagged-38978754.kiler.net
+tagged-45119602.kiler.net
+tagged-48446220.kiler.net
+tagged-48822014.kiler.net
+tagged-48993920.kiler.net
+tagged-50217132.kiler.net
+tagged-51445243.kiler.net
+tagged-52325979.kiler.net
+tagged-54434379.kiler.net
+tagged-57168271.kiler.net
+tagged-66524869.kiler.net
+tagged-77390992.kiler.net
+tagged-83676912.kiler.net
+tagged-86348571.kiler.net
+tagged-90744281.kiler.net
+tagged-92436249.kiler.net
+tagged-92566466.kiler.net
  taghrib.com
  tagrijn-emma.nl
  tags-02812241.novanfarm.com
@@ -301047,7 +301466,6 @@ takshyashila.com
  taksi-econom.ru
  taksocm.com
  taktastock.com
-taktgjgqpzbpqutsaxmilzcvtibdpptywppc-dot-offgl8876899977678.uk.r.appspot.com
  takunasolutions.com
  talabeb0.ddns.net
  talagoosht.ir
@@ -301504,6 +301922,7 @@ taxreturn-govuk.ltd
  taxreturnclaim-gov.com
  taxreturnclaim.com
  taxreturnclaimgov.com
+taxsupport-hmrc.info
  taxtalks.com.au
  taxuk-return.com
  taxukrebate.net
@@ -301855,7 +302274,6 @@ techmap.com.br
  techmarketingbuffalo.com
  techmbbs.com
  techmbox-1077.appspot.com
-techmusicdocs.tk
  technationgroup.com
  technest.mx
  techni-survey.com
@@ -302260,7 +302678,6 @@ tencentajsjkskskd.dumb1.com
  tencentclaims.com
  tencentcreatebox.com
  tencenteventpubg20.000webhostapp.com
-tencentevents16.com
  tencentfast.com
  tencentfix.com
  tencentgames.in
@@ -302341,7 +302758,6 @@ terbarubokep2020.000webhostapp.com
  terbarudarigarena.25u.com
  terbarudarigarena1.25u.com
  terbarudarikamijoinchatgruphotnew.ktiep.ga
-terbaruviral2020panas.sexidude.com
  tercaboy.com
  tercerosnovaventa.com
  terebinthine-billet.000webhostapp.com
@@ -302386,7 +302802,6 @@ termoedilsrl.net
  termphasis11.live
  terms-compliance-en-us.generalaccountingactivation.com
  terms-daum-net-syncressolvecenteruser923ud00.000webhostapp.com
-terms-fbupdate.com
  terms-id020.com
  terms-id0210.com
  terms-id0220.com
@@ -302465,7 +302880,6 @@ terws.xyz
  tery.servebeer.com
  tes.4buyuklergazete.com
  tes2.garena-3.com
-tesaja81818.duckdns.org
  tescbo.online
  tesco-banklogin.com
  tesco.com-offir.club
@@ -302693,7 +303107,6 @@ tetrixlabscom.nckichicago.gdn
  tetstra.com
  tetwr.jaysbrand.com
  teu2.z19.web.core.windows.net
-teuarsgwadpadxgsprpmctyuaekzwoajgdgi-dot-offgl8876899977678.uk.r.appspot.com
  teub.s5bu.dalianl.cn
  teuhidi.com
  teumpeun.id
@@ -302708,6 +303121,7 @@ tewoerd.eu
  tewqx.xyz
  tewsusa.co
  texanacenter-doc.ga
+texanacenter-docs.ga
  texas-money.net
  texascertifiedhomeinspection.natbob.com
  texasfasttrack.com
@@ -302939,7 +303353,6 @@ thccamera.com
  thcscapes.com
  thcsminhduc.edu.vn
  thdnxvhdptjwexcwqgwwvoxmeu-dot-gleowayel400503.uc.r.appspot.com
-thdyprivatecloudshareandfileprotecthfqm.ydns.eu
  the-bacot-parah.000webhostapp.com
  the-bombay-summit.000webhostapp.com
  the-clippings.com
@@ -303085,7 +303498,6 @@ thecartemple.com
  thecatskillcampingcompany.com
  thecbbgroup.com
  thecellar.site
-thecenteroftheuniverse.icu
  thechainsawshack.com
  thechampvandolmstraot.net
  thecharactercrew.org
@@ -303174,7 +303586,6 @@ theeastsoluttrel.com
  theebeautyspot.co.uk
  theecellgim.in
  theedenmagazine.com
-theedgemedia.in
  theefaxcentral.com
  theeggdonor.com
  theelectronics4u.com
@@ -303815,6 +304226,7 @@ thirumarantech.com
  thirumoolaryogastudio.com
  thirwimexen.com
  this-a22.tk
+thischeeryagent.estarlingramos.repl.co
  thisisfb1.000webhostapp.com
  thisisforme.ddns.net
  thisismediaeverything.com
@@ -303973,7 +304385,6 @@ three-payments.services
  three-paymentservices.com
  three-plan.com
  three-ref927.com
-three-reverify.co.uk
  three-secure-accountbill.com
  three-secure-accountinfo.com
  three-secure-site.link
@@ -303993,7 +304404,6 @@ three-support.org
  three-supportbilling.com
  three-uk-bill.com
  three-uk-id2.info
-three-uk-login.com
  three-uk-newbilling.com
  three-uk-singlesigninservice.com
  three-uk-update.net
@@ -304669,6 +305079,7 @@ tjs-properties.co.uk
  tjstore.ir
  tjtihletdabfohbcaafceokreysgufslaami-dot-cryptic-now-290917.ey.r.appspot.com
  tjujs.phwda.cn
+tjviiiwvvv.duckdns.org
  tjwhdfmxxaqzvmdodogkfwbwbcvktldaxbof-dot-gl494903049.wl.r.appspot.com
  tjwvzdfzecduabvver.top
  tjy9.mentriqq.com
@@ -304953,7 +305364,6 @@ toifui1lazbnj7s.mxp4037.com
  toilettenwagenvermietungcom.nckiparis.gdn
  toivn.com
  toiyeuvn.dongaruou.com
-tojnthmnjnuxqruw-dot-owaonk399399393.uk.r.appspot.com
  tojocomp.com
  tokantampcrz.com
  token-desbloqueio.com
@@ -305045,7 +305455,6 @@ tomsoldmansionkochi.com
  tomsomdifand.com
  tomsosmid.com
  tomsosmid.net
-tomspestcontrolsydney.com.au
  tomssteakhouse.com
  tomsuomd.tk
  tomtocemusic.com
@@ -305127,7 +305536,6 @@ toolsalesonline.com
  toolscrush.com
  toolsforresults.org
  toolsforsecurity.xyz
-toolsfreefollowers.lflink.com
  toolslk.sidlkgd.xyz
  toolspin4444.xyz
  toolwiz.info
@@ -305255,6 +305663,7 @@ topplestadium.com
  toppricetab.su
  topprioritys.appspot.com
  toppubg.com
+toppubgmobile.com
  topput.xyz
  toprakcelik.com
  toprakmedia.com
@@ -306646,7 +307055,6 @@ tthedayhascometoanend.xyz
  tthszjwysfcanxquyhsyrucsjb-dot-gleowayel400503.uc.r.appspot.com
  ttiiu-71.gq
  ttkdyw.com
-ttkiki001.azurewebsites.net
  ttlbtoafcrutlrzschzgvvebuselruoofjau-dot-cedar-code-289917.nn.r.appspot.com
  ttlcxqubtyokenzqsvpjhbugyp-dot-gleowayel400503.uc.r.appspot.com
  ttlworldbaseballclassic.com
@@ -306674,7 +307082,6 @@ ttson.name.vn
  ttt.hm00h8.cn
  ttte.website
  tttechsolution.com
-tttetye.weebly.com
  ttuttzypewitvabq-dot-owaonk399399393.uk.r.appspot.com
  ttvxapctfdaviuuxfoutaqiceavytqghuoab-dot-solar-vertex-285913.rj.r.appspot.com
  ttw-yahoomail-com.weebly.com
@@ -306687,6 +307094,7 @@ tu-reactivaperu.com
  tu.dermals.org
  tu762.com
  tu7870.yolasite.com
+tuagencia.digital
  tuananhhotel.com
  tuankhoi.com
  tuautomotora.cl
@@ -307330,7 +307738,6 @@ tzrakuten.xyz
  tzs6eyq8.firebaseapp.com
  tzsezzllmtgziuuvrggbkxgvhk-dot-gleowayel400503.uc.r.appspot.com
  tzsgyy.cn
-tzukebwbrfkewtgr-dot-owaonk399399393.uk.r.appspot.com
  tzuza.ideallogic.net
  tzw3jyk7v2tldrew.ambi.cc
  tzyxc.tk
@@ -307424,6 +307831,7 @@ u3075118.ct.sendgrid.net
  u3fvdjvbfc.outlook.webredirect.org
  u4037714.ct.sendgrid.net
  u4718414.ct.sendgrid.net
+u4p9wo4kgybo.top
  u4rl.com
  u4sv1.csb.app
  u5025323.ct.sendgrid.net
@@ -307653,13 +308061,11 @@ ucup.com.tw
  ucuzdonanim.com
  ucuzrehber.com
  ucuzyemektarifi.com
-ucx12.com
  ucxdim.com
  ucxdis.com
  ucxdum.com
  ucxpo.com
  ucxpubg.com
-ucxskin.com
  ucxuc.com
  ucycgcrjfrbawsqcxrgcrt.weebly.com
  ucylojistik.com
@@ -307727,7 +308133,6 @@ uewgcdyvgu.webcindario.com
  uewin1.weebly.com
  uewotu.vipsnapchatsexting.com
  uexe.xyz
-uey233659.yellowbasee.com
  uezhgshz.dermals.org
  uf0jh.cene.cc
  ufa888.com
@@ -307805,7 +308210,6 @@ uhfgkztmeaszoupkzoidkpadpc-dot-gleowayel400503.uc.r.appspot.com
  uhfzjfablnxcdbmohpmgraxuhnvgqfedfiqv-dot-glxcel49934343434.rj.r.appspot.com
  uhhg.45ii5w.cn
  uhjcejbfnhkisvwbwzezyvsqsp-dot-gleowayel400503.uc.r.appspot.com
-uhkjyl45hj2o5.weebly.com
  uhlpndlteicsqwyxeccqhimeemgpcmbmhurx-dot-solar-vertex-285913.rj.r.appspot.com
  uhnbr.xyz
  uhoibougyohouhpyh87yy-chase.duckdns.org
@@ -307893,6 +308297,7 @@ uk-claim.info
  uk-covid-19-relieve.com
  uk-dating.xyz
  uk-device-alert.com
+uk-devicealert.com
  uk-directdebit-setup.adminit.com.au
  uk-ee-ltd.com
  uk-grantpartner.zapto.org
@@ -307976,7 +308381,6 @@ ukclaimrebate.com
  ukclaimresolutions.com
  ukclaimreturn.com
  ukdomain.site
-ukdvla-ref820.com
  ukdvlatax.com
  ukeebiller.com
  ukeesecure.com
@@ -308027,7 +308431,9 @@ ukmyaccount.com
  ukmythree.com
  uknetflixnotice.com
  uknetflixplan.com
+uknewpayeesupport.com
  ukoffice200-outlook.rj.r.appspot.com
+ukpayeesecure.com
  ukpaypalresolve.com
  ukpaypalsupport.com
  ukpaypalsupport.net
@@ -308116,7 +308522,6 @@ ultimategliss.com
  ultimateislandguide.com
  ultimatekeylogger.com
  ultimatelamborghiniexperience.com
-ultimatenutritiononline.com
  ultimatepointsstore.com
  ultimatesetsoft4systems2upgradegreat.pw
  ultimatesherpsprptocolsl.us
@@ -308191,7 +308596,6 @@ ummehani.pk
  ummetciftligi.com
  umminikunnumahaedavaka.org
  ummistore.com
-ummulqurany.org
  ummydownload.com
  umnpbtcugytxtbmopkgjzowdex-dot-gleowayel400503.uc.r.appspot.com
  umobuko.gikorip.net
@@ -308243,6 +308647,10 @@ unasmerd.com
  unassisted-erasers.000webhostapp.com
  unassisted-loudspea.000webhostapp.com
  unature2019.com
+unauthorise-digitalpayment.com
+unauthorise-mobilepayment.com
+unauthorise-onlinepayment.com
+unauthorise-paymentonline.com
  unauthorised-cancelpayment.com
  unauthorised-payment.com
  unauthorised-transaction.net
@@ -308847,7 +309255,6 @@ unusedartistichardware--five-nine.repl.co
  unusedtriangularfile--five-nine.repl.co
  unusual-activity-hs.co.uk
  unusual-hs-activity.com
-unusual-login-new-device.com
  unusual-sigonpaypal.com
  unverified-reqeusts.com
  unverify-loginrequests.com
@@ -309166,7 +309573,6 @@ updateforattyahoo.weebly.com
  updateh3g-onlinebill.com
  updateh3g.com
  updateheavilyprogressiveprogram.icu
-updatehelp-info.world
  updatehelp.live
  updateiccu.be
  updateiccu.nl
@@ -309265,7 +309671,6 @@ updatesysteml.ddns.net
  updatetaxtermquickaccesssite09874321.fortunaseriquezas.com.br
  updateteam210.weebly.com
  updatetemp.temp.swtest.ru
-updatethree-online.com
  updatethreedetails.world
  updateti.xyz
  updatetosave.seeyouramazoncard.pw
@@ -309538,8 +309943,6 @@ urist-advokat-mogilev.by
  urist-bogatyr.ru
  urkpvavzxq.duckdns.org
  url-data-facebook.ga
-url-data-facebook.gq
-url-data-facebook.tk
  url-data-login.cf
  url-data-login.gq
  url-data-login.ml
@@ -309644,6 +310047,7 @@ us.canfcu.com
  us.changeaddressvalidation.com
  us.facebook.business48810994.com
  us.gsearch.com.de
+us.jandigitalstudios.com
  us.jaxonsorensen.club
  us.megamilly.com
  us.mg.mail.yahoo.com.neo.launch.rand.campinncaravan.com
@@ -309777,33 +310181,32 @@ user-amazon.fa29.xyz
  user-amazon.fa3.xyz
  user-amazon.fc1.xyz
  user-amazon.fc6.xyz
+user-amazon.g1m.top
  user-amazon.h1f.top
  user-amazon.j0d.top
  user-amazon.j1r.top
  user-amazon.j1u.top
  user-amazon.k1w.top
-user-amazon.kn0.top
  user-amazon.l1v.top
  user-amazon.ls9.xyz
  user-amazon.lx1.top
+user-amazon.o1h.top
  user-amazon.o1u.top
  user-amazon.oh1.top
-user-amazon.oi7.top
  user-amazon.pl4.xyz
  user-amazon.r1a.top
  user-amazon.r1b.top
+user-amazon.s1b.top
  user-amazon.s1n.top
  user-amazon.t1r.top
  user-amazon.u1g.cc
  user-amazon.u1k.cc
  user-amazon.v1j.top
  user-amazon.v1l.top
-user-amazon.v1u.top
  user-amazon.w1i.top
  user-amazon.y1g.top
  user-amazon.y1n.top
  user-amazon.yr0.xyz
-user-amazon.z1p.top
  user-authorisation.com
  user-case-id928.com
  user-center-account-security-setting-support-amazon.com
@@ -309850,12 +310253,14 @@ user-security-account-setting-support-amazon.com
  user-security-ref0143.com
  user-security-ref016.com
  user-security-services-support-account-amazon.com
+user-service-online-halifax.com
  user-service-wells.info
  user-stop-amaznou.com.66fsd54df6.buzz
  user-temporary-account-ref182.com
  user-temporary-account.com
  user-terms0175.com
  user-terms021.com
+user-terms0228.com
  user-terms02347.com
  user-terms0339.com
  user-terms0356.com
@@ -310121,7 +310526,6 @@ usva7.app.link
  usw2.app
  uswatunhasanahkaltim.com
  usweasemailuser.com
-usxnmyxipsdxhgil-dot-owaonk399399393.uk.r.appspot.com
  usyd.eduboard.nascerexport.com
  usypaythoriesi.com
  usyukle.com
@@ -310199,7 +310603,6 @@ uttarakhandvarta.com
  utting.org
  utvjhkpvbuaivuthtadpwaoxiy-dot-gleowayel400503.uc.r.appspot.com
  utzjdwntawovgzbtazjnmlhazeplpzrgjbvr-dot-offgl8876899977678.uk.r.appspot.com
-utzjdwntawovgzbtazjnmlhazeplpzrgjbvr.offgl8876899977678.uk.r.appspot.com
  uu.blackboard.unee.me
  uu898i.buzz
  uubceumlmlhdgbgtwsdicfsaeo-dot-gleowayel400503.uc.r.appspot.com
@@ -310594,7 +310997,6 @@ validate-secure.com
  validate-unauthorise-payee.com
  validate.unitedboc.com
  validate.verification-secure.system-informationapp.com
-validate.xn--bthumb-p9a.com
  validate.xn--verify-blockchan-oqc.com
  validateattsbcglobalservice.weebly.com
  validatedatainfo.com
@@ -310803,6 +311205,7 @@ varthana.com
  vartions.000webhostapp.com
  varumero.xyz
  varunanuj.000webhostapp.com
+varus-flight.000webhostapp.com
  varzeshpress.com
  varzil.com
  vasantvihar.co
@@ -311054,7 +311457,6 @@ vedantachildhood.com
  vedax.store
  vedicaadarshkulam.org
  vedox.com
-vedranmrzljak.wixsite.com
  vedretaccunt.web.app
  veed5d.com
  veeerifiikasiipemblokirann.000webhostapp.com
@@ -311087,6 +311489,7 @@ vegaswiss.com
  vegetablesmacaw.com
  vegetownshing.xyz
  vegistore.com
+vehicle-paymentreport.com
  vehicle-sales-ebay.parkertom.com
  vehicle-tax.ref1x77i.com
  vehicle-taxrefund.com
@@ -311131,8 +311534,6 @@ velvefr90d.gq
  velvefr90d.ml
  velvert690b.ml
  velvet-rain.homeip.net
-velvet67rr.gq
-velvet67rr.ml
  velvociamicxkopfbnob.cf
  velvociamicxkopfbnob.ga
  velvociamicxshy.ga
@@ -311275,9 +311676,6 @@ ver.pontuacaovencer.com
  ver.ryandgebhart.com
  ver11209.xyz
  ver1fy-f-b-chek-online.email
-ver1fy-f-b-online.buzz
-ver1fy-f-b-online.email
-ver1fy-f-b-online.xyz
  ver1fyapp1eldupdate.com
  ver23453.xyz
  ver3fy.com
@@ -311693,10 +312091,6 @@ verifikasi-pemblokiran007.ga
  verifikasi-pemblokiran013.cf
  verifikasi-pemblokiran013.ml
  verifikasi-pemblokiran09.my.id
-verifikasi-pemblokiran20.cf
-verifikasi-pemblokiran20.gq
-verifikasi-pemblokiran20.ml
-verifikasi-pemblokiran20.tk
  verifikasi-pemblokiran732.webnode.com
  verifikasi-pemblokiran762.webnode.com
  verifikasi-unblock.cf
@@ -311855,7 +312249,7 @@ verify-one-time-cl-acc.com
  verify-option-wells-fargo.com
  verify-orderanlu.ddnsking.com
  verify-orderapple-storeoffcial.theworkpc.com
-verify-payee-hs.net
+verify-payee-deregister.com
  verify-payee-manage.com
  verify-payee.cc
  verify-payee.net
@@ -311888,6 +312282,7 @@ verify-threeaccount.com
  verify-threemobile.com
  verify-ukgov-service.com
  verify-ukgovrefund-service.com
+verify-unknown-halifax-payee.com
  verify-unknowndevice.com
  verify-up-wells-fargo.com
  verify-userpaypal.servehttp.com
@@ -312056,6 +312451,7 @@ verifymy02.com
  verifymy3-billingerror.com
  verifymyacc.com
  verifymyaccountsid.com
+verifymybilling-ee.com
  verifymydevice.cc
  verifymydevices.cc
  verifymyeeaccount.com
@@ -312067,6 +312463,7 @@ verifymywallet.com
  verifynew-payment.com
  verifynewdevice.com
  verifyo2-uk.xyz
+verifyonline-security.com
  verifypage-amazon.app.accesscam.org
  verifypavpal-id2287.serveirc.com
  verifypayees-resolveissue.info
@@ -312321,6 +312718,7 @@ veyettegroup.com
  veyron.ir
  veyseloglu.az
  vezba.radiovoda.com
+vf.jandigitalstudios.com
  vfbnedrf44.duckdns.org
  vfca.co
  vfd892.com
@@ -312642,7 +313040,6 @@ videomuygraciosodefortnite.000webhostapp.com
  videonew91.ddnslive.com
  videoofamanfallinginfrontofacamera.000webhostapp.com
  videoonlinefrecorona.xyz
-videopaylasimi.biz
  videopemersatubangsa.site
  videopl20202.000webhostapp.com
  videoreflexions.000webhostapp.com
@@ -313076,7 +313473,6 @@ vipwinkwhitethailand.com
  vipx5.shop
  vir-form.com
  vir-secure.com
-vira-video-terbaru09.giize.com
  viral-anak-kecil-sama-tante-dihotel-hot.000webhostapp.com
  viral-bokep-244.000webhostapp.com
  viral-gift.com
@@ -313084,7 +313480,6 @@ viral-grupwa18.bokepinfo.org
  viral-selebgram-ngentot.000webhostapp.com
  viral-smart.com
  viral-terbaru2020.ml
-viral-terbaru55.giize.com
  viral-terbaru782.giize.com
  viral.whatsapp-199352.ml
  viralbali.000webhostapp.com
@@ -313139,7 +313534,6 @@ virgin-notice.com
  virgin-overdue.com
  virgin-payment.com
  virgin-personal-update.com
-virgin-updatebilling.co.uk
  virgin-updatebilling.com
  virgin.aiscor.com
  virgin.final-notice.co.uk
@@ -313534,6 +313928,7 @@ vk-stickers-vk.000webhostapp.com
  vk-stickx.000webhostapp.com
  vk-top.ru
  vk-topgeerls.ru
+vk-trans.ru
  vk-u.ru
  vk-vxod000.000webhostapp.com
  vk-vzlom.youhack.info
@@ -313771,7 +314166,6 @@ vmya.xyz
  vmyaccountbilling.atmyspace.net
  vn-share.cf
  vn-toupo.com
-vn.officeseries.xyz
  vn5568.cn
  vnaiuidfrnow.com
  vnaum.com
@@ -314142,7 +314536,6 @@ vpcbnxlflipkryqxcwahjnxvwgguvkmnqokr-dot-solar-vertex-285913.rj.r.appspot.com
  vpdhfq.shoesmogul.com
  vpe01rvry01srvcepge01.my.id
  vpentimex.com
-vpftnltqphmgmgqs-dot-owaonk399399393.uk.r.appspot.com
  vpfyjhgzopukumcyyfiernrvxtplqkjzewyu-dot-cryptic-now-290917.ey.r.appspot.com
  vpgcompany.info
  vpiepcgttpqadqsboxhvpvjscloiwhbltzri-dot-solar-vertex-285913.rj.r.appspot.com
@@ -314388,6 +314781,7 @@ vuotolauta.tk
  vuqebnzsipjkqtdecdcskfjolp-dot-gleowayel400503.uc.r.appspot.com
  vuqshvswcvpktagkorazhjmdpbpseuuhwslf-dot-cedar-code-289917.nn.r.appspot.com
  vuqxlbgjphxuvfmnfvel-dot-gleowyel040493443434989.wl.r.appspot.com
+vuuhhuihhh.duckdns.org
  vuurwerkhallen.nl
  vuvanhieu.000webhostapp.com
  vuwblocsxsfbnwvsddunpnjkyhdgvkbeubxd-dot-solar-vertex-285913.rj.r.appspot.com
@@ -314577,7 +314971,6 @@ vzlomvimeworldv3.000webhostapp.com
  vzminternational.com.br
  vzptt.goruli.com
  vzrew.creatorlink.net
-vztlzqyedxltdvdi-dot-owaonk399399393.uk.r.appspot.com
  vztwqkxoadjfjoximiixdzyutoqmrvbewqed-dot-cryptic-now-290917.ey.r.appspot.com
  vzw-covidnopay.com
  vzwcovid19g-001-site1.1tempurl.com
@@ -314702,7 +315095,6 @@ w9rbh.svcoding.com
  wa-2p.jaysbrand.com
  wa-bkp020.gq
  wa-bokebhotbarat.vvipx05.cf
-wa-bokep.myz.info
  wa-budi01-group.000webhostapp.com
  wa-crotsangejapan4023.gifttsnow.com
  wa-dewasa.25u.com
@@ -314722,10 +315114,10 @@ wa-grupwhatsappdewasa18.wikaba.com
  wa-joined.grubb-whatsapp.cf
  wa-joingrup188.ezua.com
  wa-logs.ml
-wa-mabar-freefire.zzux.com
  wa-porninvt.xxx-wa.com
  wa-porninvt3.xxx-wa.com
  wa-producoes.com.br
+wa-youtuber-freefire.tk
  wa.event-indo.com
  wa.userka.com
  wa01fenne.cloud
@@ -314808,6 +315200,7 @@ wagroupinvite-bokep.000webhostapp.com
  wagroupinvite-bokep9.000webhostapp.com
  wagroupjoin.h3d.shop
  wagroupjoin.h6d.shop
+wagroupjointomygroup2020.000webhostapp.com
  wagrub-indo.pricee.gq
  wagrub651.wa-sex.com
  wagrubbkp671.nett13.ml
@@ -315783,6 +316176,7 @@ webbisrvcostumm.com
  webbmaill.ml
  webbsupp.com
  webbuze.online
+webbwilsmask.com
  webbyy-94190.web.app
  webcanal.000webhostapp.com
  webcavaliers.com
@@ -315941,6 +316335,7 @@ webmail-logins8wflf1rcjgehy.infoaxewa.repl.co
  webmail-logins8wflf1rcjt6.infoaxewa.repl.co
  webmail-lonos.serveirc.com
  webmail-msn-live1.com.ng
+webmail-online-owa-auth-295119.nn.r.appspot.com
  webmail-parademinas-mg-gov-br.000webhostapp.com
  webmail-sbaloncology-zimbra-id.000webhostapp.com
  webmail-service.newinfoyouraccount.com
@@ -316009,6 +316404,7 @@ webmail.ladomicileattitude.fr
  webmail.leadersneeded.top
  webmail.leaguemonster.top
  webmail.lmv.com.do
+webmail.login.encsecure.com
  webmail.login.nuggles.net
  webmail.mapacovid19.cl
  webmail.mauthsecure.com
@@ -316045,7 +316441,6 @@ webmail.securemailauth.com
  webmail.securesccs.com
  webmail.securesns.com
  webmail.secureunserver.com
-webmail.securevserver.com
  webmail.segurlan.net
  webmail.servicio-banco-es-identificador.com
  webmail.servidorseguroweb.gq
@@ -316359,7 +316754,6 @@ weinisiyulecheng.tavmo.com
  weirdhotter.monster
  weirdoosmosis.co.za
  weissins365-my.sharepoint.com
-weissnatpines.buzz
  weissnatvalleys.xyz
  weiterbildungsparkcom.licumexico.gdn
  weixin.lefu.co
@@ -316380,7 +316774,6 @@ welcomepage01.hu
  welcometosouthernmd.com
  welcometothefuture.com
  welcomevladivostok.com
-weldcutafrica.com
  welderpicks.com
  weldingn.com
  weldjet.com
@@ -316473,6 +316866,7 @@ wells-login.com
  wells-memberapps.info
  wells-memberapps.mobi
  wells-mob-team.com
+wells-online-bank.network
  wells-policy-secure.info
  wells-privacy-info.network
  wells-privacy-status.com
@@ -317293,7 +317687,6 @@ whatsapp-grupbokep18.bokepinfo.org
  whatsapp-grupbokp2020.ddns.info
  whatsapp-grupchat.dynamic-dns.net
  whatsapp-grupnew20.justdied.com
-whatsapp-grupvip.ga
  whatsapp-hot89.wikaba.com
  whatsapp-id.lflink.com
  whatsapp-id.x24hr.com
@@ -317449,7 +317842,6 @@ whatsapp9.verif69.com
  whatsapp91.ga
  whatsapp91.gq
  whatsappbizgrib.hol7.com
-whatsappbkp.bkpwawhatspp.ga
  whatsappbkp.jos18.ml
  whatsappbkp.kyyajawbsbb.ga
  whatsappbkp18viral.ddns.net
@@ -317783,7 +318175,6 @@ whattsappsgroup18.000webhostapp.com
  whattsapwa109-chansgansk.nett13.ml
  whatwhatwhat.jewelry
  whc8m.mentriqq.com
-whcms.yourpageserver.com
  whcpanelwhm.com
  whdazmeheidmzcimoicpndnmabofrakkdsdm-dot-cryptic-now-290917.ey.r.appspot.com
  whdmdhj.com
@@ -318055,7 +318446,6 @@ wikidara.com
  wikidesign.it
  wikiemoji.io
  wikienderapi.best
-wikihookah.com
  wikiliks-ferdjioua.com
  wikimomi.com
  wikipravosudie.ru
@@ -318077,10 +318467,8 @@ wildcard.2w-d3-aa1-ssl.com
  wildcard.3e4-ssrd-ssl.com
  wildcard.3r6u.su
  wildcard.9dds3-ssl-sec.com
-wildcard.abajstore.ir
  wildcard.actuwb.com
  wildcard.allpays.net
-wildcard.amarilisperu.com
  wildcard.as2r.link
  wildcard.astyf.net
  wildcard.aws-d4d-s2e-1q.com
@@ -318131,7 +318519,6 @@ wildcard.motakalim.com
  wildcard.newsmedia77.com
  wildcard.oidjwoidj84.com
  wildcard.pawsaccesories.com
-wildcard.petlove.nu
  wildcard.pettibuzz.com
  wildcard.phonepanda.net
  wildcard.pointscooking.com
@@ -318231,6 +318618,7 @@ willinkzx.com
  willisngutierrez.xyz
  willmartowing.com
  willow-nettica.com
+willowsfordhomesmktg.com
  willowvideoproductions.com
  willrardi.com
  willspaks.su
@@ -318774,7 +319162,6 @@ wnqgzhovrtxbzojwvqcnjavqip-dot-gleowayel400503.uc.r.appspot.com
  wntj.svcoding.com
  wnunisa.com
  wnvlrsqdkpat-gvtxs6wfk.vercel.app
-wnxmzhncgldjxotjblvmiytwryhovtdvzjqe-dot-offgl8876899977678.uk.r.appspot.com
  wnxwtaqtsnqrmecabtcuoeagsegqykvrkdsm-dot-solar-vertex-285913.rj.r.appspot.com
  wny.asia
  wnyfamilymedicine.net
@@ -318846,6 +319233,7 @@ womanly-arrow.000webhostapp.com
  womans-blog.000webhostapp.com
  womansonly.de
  womansworth.net
+wombat-jab.com
  womboperating.co.za
  womenatwebug.online
  womenempowermentpakistan.com
@@ -318868,6 +319256,7 @@ womromsndshop.com
  womwx.net
  wonand.co.kr
  wonder-tonic.com
+wonderchef.casa
  wonderfish-recipe2.com
  wonderful.gr
  wonderfulaffectionateelectricity.estarlingramos.repl.co
@@ -318883,6 +319272,7 @@ wondersoftsolutions.com
  wonderstore.it
  wonderstream.tv
  wonderwaterbeads.com
+wonderwomans.net
  woningontruimenarnhem.nl
  woningontruimingarnhem.eu
  woningontruiminglimburg.nl
@@ -319340,7 +319730,6 @@ wsethoe.top
  wsets.xyz
  wsfempqpnetdcilbntccrzmnbx-dot-gleowayel400503.uc.r.appspot.com
  wsg.com.sg
-wsgodcdmxetbhkag-dot-owaonk399399393.uk.r.appspot.com
  wsgtr.000webhostapp.com
  wshsoft.company
  wsjiydnklcvvcutbdbwbxwguej-dot-gleowayel400503.uc.r.appspot.com
@@ -319719,7 +320108,6 @@ www-amazon-it-loginsecure-page-it.mywire.org
  www-amazon-jp-co.f2f27b6c-de7c-49f8-b4cb-3da8117d2641.website
  www-amazon-live-signin.verification-account-secure.com
  www-amazon-priem.support-menage-update-to-mx-co-info.monster
-www-amazon-prim-to.sighin-index-page-co.monster
  www-amazon-secure-account-co.index-security-hosting.monster
  www-amazon-service-com.jembutkontaolxxpeler.ga
  www-amazon-service-com.maumakskamsamsmad.ga
@@ -319765,7 +320153,6 @@ www-bnp-paribas.top
  www-bnpparibasfortis-be.profielenbijwerken.info
  www-bnpparibasfortis.com
  www-bnpparibasfortis.top
-www-boxberry-trackcode.ru
  www-cdek.cf
  www-cdek.com
  www-cdeks.ru
@@ -320321,7 +320708,6 @@ xaergtcrc.club
  xaergtcrc.win
  xafkmlvqga.com
  xagmpkueqiesigtjqtrqorwqupuohchliahu-dot-offgl8876899977678.uk.r.appspot.com
-xagmpkueqiesigtjqtrqorwqupuohchliahu.offgl8876899977678.uk.r.appspot.com
  xagqwqhbnkfaebnuonmuppbgie-dot-gleowayel400503.uc.r.appspot.com
  xahoihayvietnam.xyz
  xailjqcinuapggxhvusfwhibvp-dot-gloff849483.uk.r.appspot.com
@@ -320638,7 +321024,6 @@ xhj.rogagot.com
  xhjsiai.ytdfepzmc.best
  xhkd.awaykart.com
  xhkxfzflcxlxxeockgxeyqhahw-dot-gleowayel400503.uc.r.appspot.com
-xhlxkpzwgrdhkekyfslispoljfjghxppjjma-dot-offgl8876899977678.uk.r.appspot.com
  xhmrdaueaguvvtariecjhjtrnxqcyuogmzuh-dot-glxcel49934343434.rj.r.appspot.com
  xholls2.ml
  xhost-secure07c-chase.com
@@ -320847,7 +321232,6 @@ xmarketplace.store
  xmasgifts.000webhostapp.com
  xmbf.addroits.com
  xmbrlrpemv.duckdns.org
-xmbvc-caddv.top
  xmecn.com
  xmg.tanglescanner.com
  xmhzh1235.com
@@ -320986,6 +321370,7 @@ xn--80altoavl5a.xn--p1ai
  xn--80apaabfhzk7a5ck.xn--p1ai
  xn--80atlp0a2b.xn--p1ai
  xn--80ausu2b.xn--p1ai
+xn--87487387348739-16aa.web.app
  xn--90aagrk2a.xn--p1ai
  xn--90ac2chmif6a.xn--p1ai
  xn--90achbqoo0ahef9czcb.xn--p1ai
@@ -321542,7 +321927,6 @@ xtivpmoircqmfazkmlzbqxuvwe-dot-gleowayel400503.uc.r.appspot.com
  xtkbp.awaykart.com
  xtmks.com
  xtmvizmnpdamgwaxzoyalciwlnmxnofutakf-dot-glegen303939423233.ue.r.appspot.com
-xtolnc.com
  xtovin.cn
  xtpma4ep.firebaseapp.com
  xtptrack.com
@@ -321640,7 +322024,6 @@ xwbjmccykpxlykoxyeadqaokowtsgkedabao-dot-cedar-code-289917.nn.r.appspot.com
  xwbrwosanjtlwxafsnshsyjjzp-dot-gleowayel400503.uc.r.appspot.com
  xwc.prodivorce.org
  xwceolizolrxtplu-dot-glass-effect-294320.ew.r.appspot.com
-xwceolizolrxtplu.glass-effect-294320.ew.r.appspot.com
  xweb.io
  xwemdbypzopwplfqvdztcphxpavggbjtneoa-dot-solar-vertex-285913.rj.r.appspot.com
  xwhatsapp-group1.zzux.com
@@ -321678,7 +322061,6 @@ xxefcvauhstujrptnmqpxjdpfg-dot-gloff849483.uk.r.appspot.com
  xxffornikationxz.duckdns.org
  xxfg118.ru
  xxg4.awaykart.com
-xxgestgrupvip.ga
  xxghhahuzksuhejdwtrj-dot-gleowyel040493443434989.wl.r.appspot.com
  xxgmhgfpttzrwtdjug.top
  xxhlcfqmiadzupjhrpfzvgxmeb-dot-gloff849483.uk.r.appspot.com
@@ -322530,7 +322912,6 @@ ygmhrzoduxffwudu-dot-owaonk399399393.uk.r.appspot.com
  ygpryd.com
  ygraphx.com
  ygrj.org
-ygsd.yolasite.com
  ygsddl1.cf
  ygsddl1.ga
  ygsddl1.gq
@@ -322622,6 +323003,7 @@ yinh.conservativemovement.com.au
  yinhuntelln.xyz
  yinli888.com
  yinlingkoucai.com
+yinpsenra.wang
  yinputech.com
  yinruidong.top
  yinshuatie.com
@@ -322686,7 +323068,6 @@ yle-news.com
  ylflgrnvraapfgkgtsuexbbvxn-dot-gleowayel400503.uc.r.appspot.com
  ylgcelik.site
  ylivestore.com
-ylivieskanmoottorikerho.org
  yljpggxh.goruli.com
  yllrzcxafrowhlw-dot-charming-sky-2700.appspot.com
  yllufogmtmsqlyr-85txwvrum.vercel.app
@@ -322892,6 +323273,7 @@ youboyulecheng.tavmo.com
  youbtube59920.hopto.org
  youchange.lookamazon.monster
  youcode.gq
+youcwzhaopz.wang
  youesta-71.gq
  youflyjet.fr
  yougeniusads.com
@@ -323131,6 +323513,7 @@ yqncoamevsrwzhxtmwnrlumisv-dot-gloff849483.uk.r.appspot.com
  yqpyrqncuzpehsxahaauaklhilbtqlihuvrx-dot-gl494903049.wl.r.appspot.com
  yqstudies.com
  yqtbqohnywynuypfnwytjummkbgpongzukpf-dot-solar-vertex-285913.rj.r.appspot.com
+yqtbt03t.firebaseapp.com
  yqvhfgs.6fhci0.cn
  yqwokieqzmmtkfkuwnmoqhlvnaoxqhoefdgz-dot-cedar-code-289917.nn.r.appspot.com
  yqwxha.rogagot.com
@@ -323150,6 +323533,7 @@ yrimeamazon.monster
  yrj.goruli.com
  yrka24.000webhostapp.com
  yrkkikfqmcdgxqqobjzcjxrmrgcompmmbkkh-dot-solar-vertex-285913.rj.r.appspot.com
+yroloalllalaa.weebly.com
  yromszady.cf
  yrsmartshoppy.com
  yrtgefvcasedcf.weebly.com
@@ -323227,7 +323611,6 @@ ytobulvycrgnoalllrnrgqeave-dot-gleowayel400503.uc.r.appspot.com
  ytpj8c47.firebaseapp.com
  ytregjhijgj.ml
  ytshentai.com
-ytsletlvztdpgzob-dot-owaonk399399393.uk.r.appspot.com
  ytti8tufgj3awetransfer.000webhostapp.com
  yttriferous-hats.000webhostapp.com
  ytu47sdza.appspot.com
@@ -323410,7 +323793,6 @@ ywmchdlufidkttjljpkixfvscy-dot-triple-upgrade-293822.rj.r.appspot.com
  ywmchdlufidkttjljpkixfvscy.triple-upgrade-293822.rj.r.appspot.com
  ywmkieijnkvtscrovaimfinupt-dot-gleowayel400503.uc.r.appspot.com
  ywqcwzmlpfcojcayklzshmoykdjahaidlfxb-dot-solar-vertex-285913.rj.r.appspot.com
-ywriyuomsfhvxxqp-dot-owaonk399399393.uk.r.appspot.com
  ywrqilnwrxxnlludqtyahhopgqekpvahxqjc-dot-spyexc3093493.ey.r.appspot.com
  ywrwhnl.com
  yws.org.pk
@@ -324103,7 +324485,6 @@ zeroconfusion.monster
  zerocostswipe.com
  zerodayv3startedexploitpcwithexcelgreat.duckdns.org
  zerodaywwsxwissdfdsfssecccseersscsdfsdfs.duckdns.org
-zerodevices.gq
  zerodevices.ml
  zerodischarge.icu
  zerohungerapp.com
@@ -324137,7 +324518,6 @@ zetrixtaxpro.top
  zettaports.xyz
  zettech.ru
  zetthing.site
-zeufik.us-south.cf.appdomain.cloud
  zeusbudget.com
  zeusfanclub.com
  zeusky.ac.ug
@@ -324322,7 +324702,6 @@ zibpcemuhjlnkvrmdngvydkowv-dot-gleowayel400503.uc.r.appspot.com
  zibrasoft.top
  zichi.top
  zicorb.com
-zicvmytmcrbgphcv-dot-owaonk399399393.uk.r.appspot.com
  zidanmeubel.com
  zidesliti.tk
  zidrekilta.myjino.ru
@@ -324392,6 +324771,7 @@ zimbrchim.com
  zimbrstemupgrdenie405.jdevcloud.com
  zimcon.de
  zimeks.com.mk
+zimgovbr.creatorlink.net
  zimmbrzhmalinecgocr2020uptcorreo.000webhostapp.com
  zimmerei-deboer.de
  zimmerei-fl.de
@@ -324446,7 +324826,6 @@ zirkz.com
  zirnvis.ir
  zirvekonutlari.com
  zirvetel.com
-zirzlmeier-it.de
  zisapet.com.br
  zismaeldedric.com
  zisonai.com
@@ -324686,6 +325065,7 @@ zonaenlineasegvra1-lbfalabella-cl.000webhostapp.com
  zonaensegura1bnperu.web-virtual.com
  zonaensegurabn1-multlred-enlinea-peru.com
  zonaensegurax1bn-portalweb.murtean.com
+zonaesseguravirtual-1bnportal.com
  zonagrub18hot.000webhostapp.com
  zonamasa.com
  zonamez.com
@@ -324698,7 +325078,6 @@ zonaregistrobnserver.com
  zonaregistroviabcpbeta.com
  zonasegobiernope.com
  zonaseguiralbpe.com
-zonasegur-accesofrecuente.com
  zonasegur1bnmultiredenlineape.com
  zonasegur1bnprestamosenlinea.com
  zonasegur1bnwebenlinea.com
@@ -325047,7 +325426,6 @@ zqw-a.oujevais.com
  zqwpet-71.ga
  zqykknaudbgpqdlbhfkoetnurannxmseaqdq-dot-cryptic-now-290917.ey.r.appspot.com
  zqzcyxuorxbrosfc-dot-mnospot.ts.r.appspot.com
-zqzcyxuorxbrosfc.mnospot.ts.r.appspot.com
  zr47.ailacabs.com
  zrafazzlhmctbgoywpnehnbvvx-dot-gleowayel400503.uc.r.appspot.com
  zrasebery.com
diff --git a/blacklists/malware/urls b/blacklists/malware/urls

index 49134b4fed2861fc0816201dc25302cba1c39a16..0219b891d24b64206c45550ecad2f9a93e469357 100644 (file)
--- a/blacklists/malware/urls
+++ b/blacklists/malware/urls
@@ -1,23 +1,178 @@
  0i.is/7Tr9
  0i.is/CpAq
  0i.is/IqWc
+104.168.44.142/lmaoWTF/loligang.arm
+104.168.44.142/lmaoWTF/loligang.arm5
+104.168.44.142/lmaoWTF/loligang.arm6
+104.168.44.142/lmaoWTF/loligang.arm7
+104.168.44.142/lmaoWTF/loligang.m68k
+104.168.44.142/lmaoWTF/loligang.mips
+104.168.44.142/lmaoWTF/loligang.mpsl
+104.168.44.142/lmaoWTF/loligang.ppc
+104.168.44.142/lmaoWTF/loligang.sh4
+104.168.44.142/lmaoWTF/loligang.spc
+104.168.44.142/lmaoWTF/loligang.x86
+104.248.29.195/a-r.m-4.SNOOPY
+104.248.29.195/a-r.m-5.SNOOPY
+104.248.29.195/a-r.m-6.SNOOPY
+104.248.29.195/a-r.m-7.SNOOPY
+104.248.29.195/i-5.8-6.SNOOPY
+104.248.29.195/m-6.8-k.SNOOPY
+104.248.29.195/m-i.p-s.SNOOPY
+104.248.29.195/m-p.s-l.SNOOPY
+104.248.29.195/p-p.c-.SNOOPY
+104.248.29.195/s-h.4-.SNOOPY
+104.248.29.195/x-3.2-.SNOOPY
+107.155.154.163/586
+107.155.154.163/arm61
+107.155.154.163/co
+107.155.154.163/dc
+107.155.154.163/dss
+107.155.154.163/i686
+107.155.154.163/m68k
+107.155.154.163/mips
+107.155.154.163/mipsel
+107.155.154.163/ppc
+107.155.154.163/sh4
+107.172.197.166/arm7
+119.204.219.122/+-O+/tmp/netgear;sh+netgear&curpath=/&currentsetting.htm=1
+121.121.44.222/.i
+121.186.3.204/.i
  123formbuilder.com/form-5559915/microsoft-team
+125.45.65.20/+-O+/tmp/netgear;sh+netgear&curpath=/&currentsetting.htm=1
+148.66.17.85/ap/signin
+172.105.247.88/a-r.m-4.SNOOPY
+172.105.247.88/a-r.m-5.SNOOPY
+172.105.247.88/a-r.m-6.SNOOPY
+172.105.247.88/a-r.m-7.SNOOPY
+172.105.247.88/i-5.8-6.SNOOPY
+172.105.247.88/m-6.8-k.SNOOPY
+172.105.247.88/m-i.p-s.SNOOPY
+172.105.247.88/m-p.s-l.SNOOPY
+172.105.247.88/p-p.c-.SNOOPY
+172.105.247.88/s-h.4-.SNOOPY
+172.105.247.88/x-3.2-.SNOOPY
+172.105.247.88/x-8.6-.SNOOPY
+172.105.36.168/a-r.m-4.SNOOPY
+172.105.36.168/a-r.m-5.SNOOPY
+172.105.36.168/a-r.m-6.SNOOPY
+172.105.36.168/a-r.m-7.SNOOPY
+172.105.36.168/i-5.8-6.SNOOPY
+172.105.36.168/m-6.8-k.SNOOPY
+172.105.36.168/m-i.p-s.SNOOPY
+172.105.36.168/m-p.s-l.SNOOPY
+172.105.36.168/p-p.c-.SNOOPY
+172.105.36.168/s-h.4-.SNOOPY
+172.105.36.168/x-3.2-.SNOOPY
+172.245.5.120/skid.arm4
+172.245.5.120/skid.arm5
+172.245.5.120/skid.arm6
+172.245.5.120/skid.mips
+172.245.5.120/skid.mpsl
+172.245.5.120/skid.ppc
+172.245.5.120/skid.sparc
+172.245.5.120/skid.x86
+174.31.101.42/.i
+178.62.240.123/Demon.arm4
+178.62.240.123/Demon.arm5
+178.62.240.123/Demon.arm6
+178.62.240.123/Demon.arm7
+178.62.240.123/Demon.i586
+178.62.240.123/Demon.i686
+178.62.240.123/Demon.m68k
+178.62.240.123/Demon.mips
+178.62.240.123/Demon.mpsl
+178.62.240.123/Demon.ppc
+178.62.240.123/Demon.sparc
+178.62.240.123/Demon.x86
+179.43.149.133/armv7l
+182.117.73.110/+-O+/tmp/netgear;sh+netgear&curpath=/&currentsetting.htm=1
+182.141.233.164/+-O+/tmp/netgear;sh+netgear&curpath=/&currentsetting.htm=1
+185.198.57.74/mm.cc
+185.206.214.130/4.jpg
+193.239.147.209/bins/Darknet.m68k
+193.239.147.209/bins/Darknet.mips
+194.147.115.117/zzztop/Daemon.exe
+194.147.115.117/zzztop/Daemon2.exe
+194.147.115.117/zzztop/HHUPD.EXE
+194.147.115.117/zzztop/MicrosoftStores.exe
+194.147.115.117/zzztop/MicrosoftStores1.exe
+194.147.115.117/zzztop/MicrosoftStores12.exe
+194.147.115.117/zzztop/PhoenixMiner%20-%20Copy.exe
+194.147.115.117/zzztop/PhoenixMiner.exe
+194.147.115.117/zzztop/This.exe
+194.147.115.117/zzztop/VVV.exe
+194.147.115.117/zzztop/Win0Defender2.exe
+194.147.115.117/zzztop/defender.exe
+194.147.115.117/zzztop/nCoreManage41r.exe
  1drv.ms/xs/s
-34.230.252.77/BetterSafetyKatz.zip
+211.254.215.227/Bank/Finance/tang
+211.254.215.227/Bank/Finance/tang/antibot.php
+213.189.178.163/.i
+218.146.235.227/.i
+21twelveinteractive.com/mnm/nov_TdbodnqUU237.bin
+220.79.154.37/.i
+23.95.214.40/bins/arm5
+23.95.214.40/bins/arm6
+23.95.214.40/bins/sh4
+27.75.105.70/.i
+31.11.51.57/.i
+37.72.175.233/view-signin.php
+40.115.6.3/armv4l
+40.115.6.3/armv5l
+40.115.6.3/armv6l
+40.115.6.3/i586
+40.115.6.3/i686
+40.115.6.3/m68k
+40.115.6.3/mips
+40.115.6.3/mipsel
+40.115.6.3/powerpc
+40.115.6.3/sh4
+40.115.6.3/sparc
+45.153.203.204/i686
+62.138.8.50/333.vbs
+66.229.214.115/.i
+71.203.12.84/.i
+72.234.212.147/.i
+abnb389323.temp.swtest.ru/listing-room
+abnb389323.temp.swtest.ru/listing-room/room-16268.html
+abnb389323.temp.swtest.ru/listing-room/sms.html
  abre.ai/as0p
  abre.ai/bLoA
  abre.ai/caixacx
  abre.ai/seguranca-app
  aejt-ci.org/kbznh7.rar
  africanist.or.kr/kcf5hedhb.rar
+airbnb.com.checkin-rooms-id582355271252.com/rooms
+airbnb.com.checkin-rooms-id582355271252.com/rooms/template.php
+all-owa.7m.pl/owa/auth/15.0.1497/owa/auth
+all-owa.7m.pl/owa/auth/15.0.1497/owa/auth/logon1891.html
  allowcopy.com/open
  allowcopy.com/open/
+alsalcundip.org/1mypayment
+amazon.support-ltd.secure.updateyouraccount.net/home/ID/Account/3354d/
+amazoninnw.com/amazon/mazon/6fa92/
+amazonz.cc/pc/
  ams3.digitaloceanspaces.com/ams1
  ams3.digitaloceanspaces.com/ams1/click.html
  ams3.digitaloceanspaces.com/newvm
  ams3.digitaloceanspaces.com/newvm/index.html
  angelfire.com/games/gamez3
  angelfire.com/games/gamez3/facebook.htm
+arenafaridabad.com/files/assets/images/str
+arenafaridabad.com/files/assets/images/str/red.php
+ast-tl.com/sign-in
+ast-tl.com/sign-in/
+ast-tl.com/sign-in/signonSetup.php
+audnseng.com/mazon/15ce3/
+babycareadvisors.com/upload/news-posts/Impots.gouv.fr.2020/Impots.gouv.fr/3c3959fcfcdceeda08f7cdeca2db7238
+babycareadvisors.com/upload/news-posts/Impots.gouv.fr.2020/Impots.gouv.fr/3c3959fcfcdceeda08f7cdeca2db7238/formulaire.php
+bakingmblematics.com/asche/a353d2af5680248
+bakingmblematics.com/asche/a353d2af5680248/login.php
+becusignin.authsecure06x.com/981ae89e4e239a19a341c37341b8955a/logon-email-verify.php
+becusignin.authsecure06x.com/981ae89e4e239a19a341c37341b8955a/logon-user-confirmation.php
+belkera.temp.swtest.ru/e2e5128c69300cdaa038d84d36cf24
+bioamerica.cl/voice_2020
  bit.do/EN9NET
  bit.do/Help-Recovery-Page
  bit.do/Hiosene
@@ -37,6 +192,7 @@ bit.do/SupuRs
  bit.do/Tasa_R_S
  bit.do/TosaRs
  bit.do/Toso_Osrs
+bit.do/VapiRs
  bit.do/Vepi94Rs
  bit.do/VupaRs3_
  bit.do/bankedgiveaway
@@ -190,6 +346,7 @@ bit.ly/36wCTos
  bit.ly/38Xmo4D
  bit.ly/38iiI0y
  bit.ly/38p7HqJ
+bit.ly/38tNUKm
  bit.ly/39Xiaer
  bit.ly/39wIj4v
  bit.ly/3aGMPy6
@@ -250,6 +407,7 @@ bit.ly/3l15oRs
  bit.ly/3lsusld
  bit.ly/3lvHSNF
  bit.ly/3m4oE1w
+bit.ly/3nhYaK7
  bit.ly/3pvPGRe
  bit.ly/Actualiza-ViaBcp
  bit.ly/Atualizar-SMS-iToken
@@ -286,8 +444,39 @@ bitly.com/3kXAhXj
  bitly.com/3oFHKMQ
  bitly.com/3p4HWWh
  bitly.com/PAYPAL-LOGIN-IL
+bronchoveda.ru/mc
+bronchoveda.ru/mc/index.php
+bulknmnpowder.com/covidapprove/Attachment%20Name%2020200408_2049.pdf.html
  cakeurl.com/sw3zY
+caotac.com/mazon/amazon/
+capachi.org/A
+capachi.org/A/login.php
+capachi.org/A/surf2.php
  capesandbox.com/file/sample/2582/8729e52104ec08ca7002b217c42c3ec12262badbb3f11faaab1829eba505c3cb
+cartago.casacastillo.cl/-/
+chakdoix.com/mazon/c5862/
+chutenco.temp.swtest.ru/05f313deaa9edd2412b7b1a51a528f/
+clarkeschools.org/Netflix/Netflix/
+clearreach53.com/fonts/mazon/amazon/
+clearreach53.com/scss/mazon/amazon/
+contratto-cambio-codici.com/persone-e-famiglie-business.html
+couponpaw.com/rezz/Inv
+couponpaw.com/rezz/Inv/index.php
+covid19emergencyfinancialrelief.com/book/bmo
+covid19emergencyfinancialrelief.com/book/bmo/login.php
+covid19emergencyfinancialrelief.com/book/cibc
+covid19emergencyfinancialrelief.com/book/cibc/confirm.php
+covid19emergencyfinancialrelief.com/book/cibc/login.php
+covid19emergencyfinancialrelief.com/book/scotia
+covid19emergencyfinancialrelief.com/book/tangr
+covid19emergencyfinancialrelief.com/book/tangr/
+covid19emergencyfinancialrelief.com/book/tangr/login.php
+covid19emergencyfinancialrelief.com/book/tangr/step2.html
+covid19emergencyfinancialrelief.com/book/tangr/step3.html
+covid19emergencyfinancialrelief.com/book/tangr/step4.html
+cpcalendars.jp-e98rfher98ge.com/verificationx
+cpcalendars.jp-woeifhwe89hf9.com/verificationx
+cpcontacts.jp-woeifhwe89hf9.com/verificationx
  cutt.ly/QiCMqtb
  cutt.ly/SsyhHnk
  cutt.ly/SyhM3BP
@@ -300,11 +489,16 @@ cutt.ly/ldTGuAB
  cutt.ly/tsqb6ai
  cutt.ly/vsqbVMI
  cyw.pe.kr/images/baba/Alibaba.com/Alibaba.com/Alibaba.co.uk/35c2f42de3a745af1c74bd8fc03250ad
-d.powerofwish.com/pm.sh
  da62.nichesite.org/y
+daneinning.temp.swtest.ru/0383d9383178172fa34e4a522e25e6/
  deliciousrecipees.com/B.lawton
+dentaldanta.ru/assets/js/ricole/
  digitalbizcards.in/.well-known/Huntington
+digitalbizcards.in/.well-known/Huntington/
  digitalbizcards.in/.well-known/Huntington/email-account.php
+directlinegroupcareers.career-inspiration.com/app/discussions/index
+dk.pergolastulsa.com/_
+dl.skyled.it/ls/click
  dlvr.it/RXVbg3
  docs.google.com/forms/d/1cftY9nPkgtssMgHl5uc070iUbDW-vRpa7sBpQQYOSCk/viewform
  docs.google.com/forms/d/1ubfTadXuGDGvTvNscAY0_f78KUm17eHjm5vf2Ltz6Hs/viewform
@@ -349,9 +543,32 @@ drive.google.com/uc
  dropbox.com/l/AABy5Irzd_ji2DuiO-i5z8ZZ70_ZRnRBTLQ
  dropbox.com/l/AADF6y5O_I_uxzPM7EarhSzPUoBxa9VQXQ0
  dwnlds.co/ab3f360
+ee-billingsubmit.com/account/
+eforceleague.com/lvlVv1s4jI/9h8i40qdkj/4odq6pjdta
+emyturk.com/sd/IK/of1/1hf46clmpgtrqadoxsu0ey2j9wi75nvk3zb8x1ckwsh6rm7uf90e5i2tbz8jvlq3py4ondagdrjo1f4xvcuw38ia7tsehznl9m6bk5pyg02q
  enyaxsi.com/setupconfigo/S
+escuelagarantista.com/ncfn07.zip
+etr.ansfer.interac.ca-instant.org/sh/H9ej3i/cdnbnk
+etr.ansfer.interac.ca-instant.org/sh/H9ej3i/cdnbnk/login.php
+etr.ansfer.interac.ca-instant.org/sh/H9ej3i/mbmo
+etr.ansfer.interac.ca-instant.org/sh/H9ej3i/mbmo/
+etr.ansfer.interac.ca-instant.org/sh/H9ej3i/mbmo/action.php
+etr.ansfer.interac.ca-instant.org/sh/H9ej3i/mbmo/bmo2.php
+etr.ansfer.interac.ca-instant.org/sh/H9ej3i/mbmo/continue.php
+etr.ansfer.interac.ca-instant.org/sh/H9ej3i/mbmo/last.php
+etr.ansfer.interac.ca-instant.org/sh/H9ej3i/scotiaonline
+etr.ansfer.interac.ca-instant.org/sh/H9ej3i/scotiaonline/login.php
+etr.ansfer.interac.ca-instant.org/sh/H9ej3i/scotiaonline/next1.php
+etr.ansfer.interac.ca-instant.org/sh/H9ej3i/scotiaonline/step3.php
+etr.ansfer.interac.ca-instant.org/sh/H9ej3i/simplii
+etr.ansfer.interac.ca-instant.org/sh/H9ej3i/simplii/login.php
+etr.ansfers.interac.ca.ca-ls.net/sh/H9ej3i/scotiaonline
+etr.ansfers.interac.ca.ca-ls.net/sh/H9ej3i/scotiaonline/
+etr.ansfers.interac.ca.ca-ls.net/sh/H9ej3i/scotiaonline/login.php
  evernote.com/shard/s349/client/snv
  facebookk.otzo.com/BotakGamingChannel/videos/658561044852742/
+famos.mtm.co.id/HTML/css/bofa/Online
+famos.mtm.co.id/HTML/css/bofa/Online/
  firebasestorage.googleapis.com/v0/b/access439984393434430fd4c34f4.appspot.com/o
  firebasestorage.googleapis.com/v0/b/access439984393434430fd4c34f4.appspot.com/o/index.html
  firebasestorage.googleapis.com/v0/b/apps-00303000300mic.appspot.com/o
@@ -364,8 +581,6 @@ firebasestorage.googleapis.com/v0/b/authinaowa.appspot.com/o
  firebasestorage.googleapis.com/v0/b/authinaowa.appspot.com/o/index.html
  firebasestorage.googleapis.com/v0/b/auto-77ac8.appspot.com/o
  firebasestorage.googleapis.com/v0/b/auto-77ac8.appspot.com/o/login.html
-firebasestorage.googleapis.com/v0/b/basepark-79916.appspot.com/o
-firebasestorage.googleapis.com/v0/b/basepark-79916.appspot.com/o/cerkcfraebys.html
  firebasestorage.googleapis.com/v0/b/block83333h3hchain.appspot.com/o
  firebasestorage.googleapis.com/v0/b/block83333h3hchain.appspot.com/o/login.html
  firebasestorage.googleapis.com/v0/b/brop-590e1.appspot.com/o
@@ -472,7 +687,6 @@ firebasestorage.googleapis.com/v0/b/sstreet-8ebd3.appspot.com/o
  firebasestorage.googleapis.com/v0/b/sstreet-8ebd3.appspot.com/o/roundcube.html
  firebasestorage.googleapis.com/v0/b/sunupdatei00000.appspot.com/o
  firebasestorage.googleapis.com/v0/b/sunupdatei00000.appspot.com/o/MMcc.htm
-firebasestorage.googleapis.com/v0/b/t4grvgb-t445eg5rvbt-tegrvc.appspot.com/o/y5-tr-be-t-56-45-4g-ghr%2F5-65-4t-bv-4w-fs-d.html
  firebasestorage.googleapis.com/v0/b/ternxi-d725e.appspot.com/o
  firebasestorage.googleapis.com/v0/b/ternxi-d725e.appspot.com/o/d8a.htm
  firebasestorage.googleapis.com/v0/b/tkjwjdxxrxzkfgxwdwmjmfshkqj.appspot.com/o/phKNjKPWcRKgqstZJ%20-%20Copy%20
@@ -536,11 +750,13 @@ fra1.digitaloceanspaces.com/ecserver
  fra1.digitaloceanspaces.com/ecserver/index.html
  fra1.digitaloceanspaces.com/sllns
  fra1.digitaloceanspaces.com/sllns/index.html
-fra1.digitaloceanspaces.com/support.zoom.us
-fra1.digitaloceanspaces.com/support.zoom.us/Invite.html
  fra1.digitaloceanspaces.com/uismbv
  fra1.digitaloceanspaces.com/uismbv/index.html
+freiheitdesigns.com/ko/daum
+freiheitdesigns.com/ko/daum/index.html
  gamerlaunch.com/community/users/blog/4908663/1794789
+garbagedescent.com/scss/ab1
+garbagedescent.com/scss/ab1/login.php
  getatless.com/document
  gg.gg/ElPeruPrimero
  gg.gg/auto_atendimento
@@ -555,7 +771,12 @@ gg.gg/ls61b
  github.com/instCap/nleo/raw/master/yt-conv.exe
  github.com/instCap/nleo/raw/master/yt-convE.exe
  github.com/instCap/nleo/raw/master/yt-convU.exe
+halifaxfraudresponseteam.com/login/admin
+hallandi.com/mescomptes/labanquepostale/pst/17f8b
+helpinsuredgift.com/es-amz/
+helpsupport3.live/dashboard/
  himalaysodasofty.com/wetransfer/wetransfer
+hs-onlinesecuredpayee.com/spe
  ht.ly/10IO30qSAAi
  ht.ly/1Yzh30r1i6R
  ht.ly/2Wh830qSzga
@@ -596,6 +817,12 @@ ht.ly/zBcg30qCsiy
  htl.li/XVTs30qzpMo
  htl.li/fjhC30pZk72
  htl.li/kL5q30q5utK
+i-titolari-cartabcc.it/TITOLARI-CARTE/User
+iix50.cloudhost.id/~alsalcun/1mypayment
+in9090vew.com/banks/Tangerine
+in9090vew.com/banks/Tangerine/pin.php
+info.jp-e98rfher98ge.com/verificationx
+info.jp-woeifhwe89hf9.com/verificationx
  iplogger.org/2KmWW5
  is.gd/CB9Ipo
  is.gd/ING1ES
@@ -617,31 +844,73 @@ j.mp/2BUqTCt
  j.mp/2ZZtIeM
  j.mp/39oczg7
  j.mp/3asgxFT
+jamps.es/particulier/
  jodtd.com/~zadmin/div/aus.exe
+justicecrib.com/document
+konstellations.net/app
+konstellations.net/app/login.php
+konyawebserver.com/httpsingnineboydewseBayISAPIdllSignInruhttps3a2f2fwwweboyde2f&amp;info
+konyawebserver.com/httpsingnineboydewseBayISAPIdllSignInruhttps3a2f2fwwweboyde2f&info
  kutt.it/3MdFZz
  kutt.it/GZ0Eo1
  kutt.it/nZEaRO/
  landpage.co/a8eb4190-031d-11eb-ad8f-f2646ce6f5c7
  landpage.co/f171b772-03ff-11eb-b136-be6044770142
+lasolidariacr.com/.dme/daum/daaum
+lasolidariacr.com/.dme/daum/daaum/login.php
  latinodistributors.com/WES
  latinodistributors.com/WES/login/index.html
+levinhoteam.com/event
  linktr.ee/PayPalPassword
  linktr.ee/amemuito
  linktr.ee/autodiscover.owa.security
-linktr.ee/cair002/
-linktr.ee/flojwatkins
+linktr.ee/pubglukyspinevent.com
+linktube.com/pubgmobile1
  litelink.at/Cartao_Carrefour
  litelink.at/cartaoatacadao2020
  lnk.news/2rovk
  lnkd.in/dC_EFvE
+lp.kerbermix.com.br/sddfkrl/senmsjd/awnsjere/axttubbn
+lp.kerbermix.com.br/sddfkrl/senmsjd/awnsjere/axttubbn/sett.php
+lumierehealthcare.com.sg/tam/tas/desk/roml/tigb
+lumierehealthcare.com.sg/tam/tas/desk/roml/tigb/sett.php
+lumierehealthcare.com.sg/tam/tas/desk/roml/tigb/webmail.php
+magicmikevegas.com/images/img/securipass/verifier-numero/sms-email
+mail.jp-e98rfher98ge.com/verificationx
  mapage.noos.fr/~jeanmarie.regall/7546t5.exe
+materialtencent.com/PUBG%20MOBILE/
+mawcompany.com/css/webfonts/willkommen/99020/
  mediafire.com/file/yn8dnlx4znw0qwy/AppTrailers.9.1.10amt.exe
+medsanitar.ru/uhl4dimi6.jpg
+medwedhealthcare.com/demo/com/dot/
+misnxsd.com/mazon/amazon/
+moefr.com/availability/alibaba.com
+moefr.com/availability/alibaba.com/login.php
+mondragon-soto.com/particulier/auth/
+mwsecurity.com.my/Clt/suppo
+mwsecurity.com.my/Clt/suppo/
+mwsecurity.com.my/Clt/suppo/sms.html
+mwsecurity.com.my/Clt/suppo/sms1.htm
+mwsecurity.com.my/Clt/suppo/sms2.html
  mynextcom.net/txg0rwjg2.jpg
+mythreenet-billng.com/banks/bank.barclays.co.uk
+mythreenet-billng.com/banks/bank.barclays.co.uk/index.php
+mythreenet-billng.com/banks/online.citi.eu
+mythreenet-billng.com/banks/online.citi.eu/
+mythreenet-billng.com/banks/online.citi.eu/Login.php
+myuserbillingauthentication-helpdeskno0075475.mywire.org/helpdesk-8751/
+natalconsorcio.com.br/contents/freedom/FargoNew
+nelewatty.be/js/wp4/
  net.geo.opera.com/opera/stable/windows
  net.geo.opera.com/opera/stable/windows/
+newpayee-online-security.com/lloyds
+newpayee-online-security.com/lloyds/Login.php
+newpayeereview.com/halifax
+newpayeereview.com/halifax/admin
  news-ontime.com/Nov.1/Shark-Tank-Diet8.0/Keto-Lean.html
  news-ontime.com/Nov.1/Shark-Tank-Diet8.0/Keto-Pure-ss.html
  news-ontime.com/Nov.1/Shark-Tank-Diet8.0/Slim-X-Genie-Keto.html
+nietinae.com/mazon/amazon/
  objectstorage.eu-amsterdam-1.oraclecloud.com/n/axvzq6ccdhre/b/covna/o
  objectstorage.eu-amsterdam-1.oraclecloud.com/n/axvzq6ccdhre/b/covna/o/covhome.html
  objectstorage.uk-london-1.oraclecloud.com/n/lr4txdosnm2q/b/voipshare/o
@@ -654,8 +923,6 @@ objectstorage.us-ashburn-1.oraclecloud.com/n/id6s30o3xtda/b/Loading/o/117-Crl.ht
  objectstorage.us-ashburn-1.oraclecloud.com/n/id6s30o3xtda/b/scoring/o/117-Crl.html
  objectstorage.us-ashburn-1.oraclecloud.com/n/iddjydhnaxu6/b/id101/o
  objectstorage.us-ashburn-1.oraclecloud.com/n/iddjydhnaxu6/b/id101/o/replay.html
-objectstorage.us-ashburn-1.oraclecloud.com/n/idhdnknnnkqq/b/njujyhtbvft-20201110-1147/o
-objectstorage.us-ashburn-1.oraclecloud.com/n/idhdnknnnkqq/b/njujyhtbvft-20201110-1147/o/rtyuijmhngbfvd.html
  objectstorage.us-ashburn-1.oraclecloud.com/n/idoiuw9oqjvh/b/bucket-20200423-2238tee/o/117-Crl.html
  objectstorage.us-ashburn-1.oraclecloud.com/n/idtzxm8bpwyv/b/aloma/o/117-Crl.html
  objectstorage.us-ashburn-1.oraclecloud.com/n/idudgw6lrtpg/b/tobe/o/obe117-Crl.html
@@ -668,6 +935,11 @@ objectstorage.us-phoenix-1.oraclecloud.com/n/axy0ck15gxtn/b/outcall/o/11-Crl.htm
  objectstorage.us-sanjose-1.oraclecloud.com/n/axcdfbfimho2/b/bucket-20200807Voicemessagesreviewportal-0627/o
  objectstorage.us-sanjose-1.oraclecloud.com/n/axcdfbfimho2/b/bucket-20200807Voicemessagesreviewportal-0627/o/index.html
  onedrive.live.com/download
+onol.com/linkedin-secure/checkpoint
+onol.com/linkedin-secure/checkpoint/index.php
+onol.com/login.alibaba.com/ali
+onol.com/login.alibaba.com/ali/login.php
+order.viralizers.com/sl14lj.gif
  ow.ly/3IRf30qF4Kw
  ow.ly/BD9i50AVlOV
  ow.ly/BgVO30qE9fg
@@ -682,11 +954,48 @@ ow.ly/tEjO30qJvOw
  ow.ly/yxK730qUYLl
  padlet-uploads.storage.googleapis.com/610964646/d0a82b340ac6b4eb2fed334399fe2e84
  padlet-uploads.storage.googleapis.com/610964646/d0a82b340ac6b4eb2fed334399fe2e84/palad.html
+paesanobocceclub.com/alertchase/
+palmiye.web.tr/demo-enfold4
+palmiye.web.tr/demo-enfold4/wp-includes/pomo/biz
  pastebin.com/raw/DawJ5x7m
  pastebin.com/raw/Yt0EUBML
  pastebin.com/raw/ggxwPvyM
  pastebin.com/raw/vgQzwwuN
-prayonline.it/cm5xssc78.txt
+payee-safemanagement.com/halifax
+payee-safemanagement.com/halifax/
+payee-safemanagement.com/halifax/Login.php
+payee-safemanagement.com/halifax/admin
+payeesafesecure-mobile.com/halifax
+payeesafesecure-mobile.com/halifax/Login.php
+pipedreamzstpete.com/mog
+pipedreamzstpete.com/mog/MicrosoftAccount.html
+porrittlaw.com/images/ara/nfc
+porrittlaw.com/images/ara/nfc/wp/
+porrittlaw.com/images/ara/nfc/wp/538c12fe71a1e94/back
+porrittlaw.com/images/ara/nfc/wp/538c12fe71a1e94/back/
+porrittlaw.com/images/ara/nfc/wp/538c12fe71a1e94/back/Home.php
+porrittlaw.com/images/ara/nfc/wp/6f41e13192c6e85/back/Home.php
+porrittlaw.com/images/ara/nfc/wp/a013972a7dbece4/
+porrittlaw.com/images/ara/nfc/wp/a013972a7dbece4/back/
+porrittlaw.com/images/ara/nfc/wp/a013972a7dbece4/back/Home.php
+porrittlaw.com/images/ara/nfc/wp/d45a5d8fcfd8aaa
+porrittlaw.com/images/ara/nfc/wp/d45a5d8fcfd8aaa/back
+porrittlaw.com/images/ara/nfc/wp/d45a5d8fcfd8aaa/back/
+porrittlaw.com/images/ara/nfc/wp/d45a5d8fcfd8aaa/back/Home.php
+porrittlaw.com/images/ara/nfc/wp/e96ce730d40220d/back/Home.php
+porrittlaw.com/images/ara/nfc/wp/ec2b85de9ccb1e2/
+porrittlaw.com/images/ara/nfc/wp/ec2b85de9ccb1e2/back/
+porrittlaw.com/images/ara/nfc/wp/ec2b85de9ccb1e2/back/Home.php
+porrittlaw.com/images/ara/nfc/wp/feb76e445d8fb07/
+porrittlaw.com/images/ara/nfc/wp/feb76e445d8fb07/back/
+porrittlaw.com/images/ara/nfc/wp/feb76e445d8fb07/back/Home.php
+porrittlaw.com/images/ara/nfc/wp/ff43449bfc43c57/
+porrittlaw.com/images/ara/nfc/wp/ff43449bfc43c57/back
+porrittlaw.com/images/ara/nfc/wp/ff43449bfc43c57/back/Home.php
+protovarinfo.ru/.irs-stimulus-payment-link-benefit-link
+protovarinfo.ru/.irs-stimulus-payment-link-benefit-link/identity.php
+pubgrooms.in/corrent/linkedin
+pubgrooms.in/corrent/linkedin/khfbvjhdbv.php
  raw.githubusercontent.com/pistacchietto/Win-Python-Backdoor/master/setupserie1.py
  rcl.ink/PD6
  rebrand.ly/000ATT
@@ -758,6 +1067,9 @@ rebrand.ly/yngvu65
  rebrand.ly/zikqv8f
  rebrand.ly/zitln6v
  rebrand.ly/zshyr3j
+reopencayman.com/auth.sign.on
+reopencayman.com/auth.sign.on/indexx.html
+reopencayman.com/auth.sign.on/login.php
  reurl.cc/1xRr1Y
  reurl.cc/WL16RO
  reurl.cc/bRkoqE
@@ -809,6 +1121,7 @@ s.id/inbeslagname
  s.id/jXmou
  s.id/kGk6Y
  s.id/njJ6Q
+s.id/onlne
  s.id/orrabaas
  s.id/ozmPB
  s.id/rZsXp
@@ -868,19 +1181,29 @@ s3.us-east-2.amazonaws.com/www.microsoft.com.v83
  s3.us-east-2.amazonaws.com/www.microsoft.com.v83/inAAi33.html
  s3.us-east-2.amazonaws.com/www1.microsoft.com.st
  s3.us-east-2.amazonaws.com/www1.microsoft.com.st/inAAi33.html
+safesecurepayee-mobile.com/halifax
+safesecurepayee-mobile.com/halifax/Login.php
+safesecurepayee-mobile.com/halifax/admin
  scienceasia.org/1987.13.n4/FGBFGTHRTT54ER3467UTRDSVFR3465
  scienceasia.org/1987.13.n4/FGBFGTHRTT54ER3467UTRDSVFR3465/mag.html
+secure.oldschool.com-vm.ru/m=forum/forums.ws483,225,119,67534134,3
+secure.oldschool.com-vm.ru/m=forum/forums.ws483,225,119,67562134,3
  sendspace.com/pro/dl/45rnsw
+servis.altankarakaya.com/tg9u38.gif
+setgivesaveservice.com/de-amazon/
  sfo2.digitaloceanspaces.com/spacezoomincemeetingcloud
  sfo2.digitaloceanspaces.com/spacezoomincemeetingcloud/AAwsodhdYTTYSHyuey.html
  share.hsforms.com/1HWBy9E8zQ5CPqHe5EI6IGA3245i
  share.hsforms.com/1OWoQghkBQDO-dfBLtGExeQ4g63f
+shopphongtinh.com/Ubnccbruoun7.exe
  short.pe/Fvj6I
  short.pe/q00Sa
  shorturl.at/oIJP1
  shorturl.at/rRTX4
  sites.google.com/view/embedded-fi/home
  slack-redir.net/link
+sleamcomnunity.me/profiles/76561198343435590
+slip-kangourou.fr/img/usaa/
  snip.ly/03elb0
  snip.ly/3b3y76
  snip.ly/7u961z
@@ -910,12 +1233,20 @@ snip.ly/www.netflix.com-Login-secure
  snip.ly/www.netflix.com-Login-secure/
  snip.ly/www.netflix.com-costumer-login/
  snip.ly/www.netflix.com-signIn-account/
-snip.ly/zjm57r/
+softbank.myct12.com/mobile/
  soo.gd/BSmq
  soo.gd/T0F1
  soo.gd/kxVY
  soo.gd/l6Rg
  soo.gd/y3rR
+spk-service.de/16f741a7b20ebf0f6314c4a2b42ee5ef
+squaretrdispute.com/fresct
+squaretrdispute.com/fresct/indexx.php
+stippahyt.com/stripeaccounts
+stippahyt.com/stripeaccounts/2step-auth.php
+stippahyt.com/stripeaccounts/login.php
+stippahyt.com/stripeaccounts/profile.php
+stippahyt.com/stripeaccounts/verify.php
  storage.googleapis.com/0ffice/ajo2
  storage.googleapis.com/0ffice/ajo2/voicemail.html
  storage.googleapis.com/101-00
@@ -1373,6 +1704,8 @@ storage.googleapis.com/ufyguy7t68uyg8ywdu.appspot.com/b%20hcv%20wey%20868/b%20jy
  storage.googleapis.com/umdakisamkali/7t1/43p%20497kxjs%20rmc9%206pwzk2%20cmnvv%20c6xujh%20yuxru%20ehn%20e65%20mb%20xu%205vs.html
  storage.googleapis.com/update-securities20420.appspot.com/%25%25%25%25%25%25
  storage.googleapis.com/update-securities20420.appspot.com/%25%25%25%25%25%25/login.html
+storage.googleapis.com/updatedprojects/OTC-panel
+storage.googleapis.com/updatedprojects/OTC-panel/index2.html
  storage.googleapis.com/wellsfargoverification
  storage.googleapis.com/wellsfargoverification/login/index.html
  storage.googleapis.com/wellspanel/wells
@@ -1388,11 +1721,19 @@ storage.googleapis.com/zhieurgfieuhfhre
  storage.googleapis.com/zhieurgfieuhfhre/hoif.htm
  storage.ning.com/topology/rest/1.0/file/get/8100171459/
  storage.ning.com/topology/rest/1.0/file/get/8122054091/
+strainneutron.com/app/signin
+support-smbc.jp/pc
+support-smbc.jp/pc/index.php
+supportinterpoints.com/edashboard/
+supportinterpoints.net/dashboard/
+supportinterpoints.org/confirm/
+supportteamlink.com/support/
  surveygizmo.com/s3/5635022/AT-T/
  surveygizmo.com/s3/5655517/at-t
  surveygizmo.com/s3/5679924/AT-T-Login/
  surveygizmo.com/s3/5699881/AT-T-Login
  surveygizmo.com/s3/5712727/AT-T-Login
+surveygizmo.com/s3/5712727/at-t-login
  surveygizmo.com/s3/5729133/AT-T
  surveygizmo.com/s3/5731291/AT-T-Login
  surveygizmo.com/s3/5750569/AT-T-Login
@@ -1402,7 +1743,7 @@ surveygizmo.com/s3/5788798/AT-T-Login
  surveygizmo.com/s3/5799006/Sbcglobal
  surveygizmo.com/s3/5966390/AT-T-Mail
  surveygizmo.com/s3/5989878/Sign-in-to-continue
-surveygizmo.com/s3/6043346/AT-T-Mail
+surveygizmo.com/s3/6049779/AT-T
  surveyheart.com/form/5e23c40fb533f62621f5252d
  t.cn/A6LxgDxg
  t.co/0Y8DHT78dD
@@ -1420,6 +1761,8 @@ t.co/m6Fz3ChX91
  t.co/mCmzxZ8cyT
  t.co/mSKJH9xhZW
  t.ly/4HEr
+teamfbk-support.com/view-signin.php
+three.auth-billing.com/three/
  tiny.cc/3cutsz
  tiny.cc/6mihnz
  tiny.cc/nlf03y
@@ -1459,6 +1802,9 @@ tny.sh/wBXwb4M
  tny.sh/z1iOyHK
  tr.im/AlertaslBCP
  translate.sogoucdn.com/pcvtsnapshotorigin
+trestleresources.net/er/en
+trestleresources.net/er/en/index.php
+tydecydujesz.org/dhlexp/mydhl
  u.to/19QVFg
  u.to/32mEGQ
  u.to/M9hcFA
@@ -1471,6 +1817,12 @@ u.to/WSDDGA
  u.to/ab0RGQ
  u.to/x9AVFg
  ucarecdn.com/2a7b935a-1c7f-46e2-a05a-094adb8108a6/myflycodes.exe
+uen.surveysparrow.com/s/sej/tt-ecaf6b
+ukgovprocess-ref.com/nov
+update-billing-netflix-online-romavhost127206.lowhost.ru/NETFLIX-IT/Account
+update-billing-netflix-online-romavhost127206.lowhost.ru/NETFLIX-IT/Account/bill.php
+update-billing-netflix-online-romavhost127206.lowhost.ru/NETFLIX-IT/Account/loading.php
+updatemyeebillinginfo.com/account/12
  uqr.to/icvk
  uqr.to/k5ga
  uqr.to/op93
@@ -1513,5 +1865,15 @@ urlz.fr/ehVO
  urlz.fr/ei4L
  urlz.fr/eiGH
  v.ht/7pzM
+vps62522.inmotionhosting.com/~nee7735/ahm/netflix
+vps62522.inmotionhosting.com/~nee7735/ahm/netflix/update.php
  wa.me/260979441405
+webchase.authsecure06x.com/08da7c56adda71f05c9c3fc965220074/verification-email.php
+webdisk.jp-e98rfher98ge.com/verificationx
+webmail.jp-e98rfher98ge.com/verificationx
+webmail.letsmailsolutions.me/gth19
+webmail.letsmailsolutions.me/gth19/auth.php
+whcms.yourpageserver.com/w722qm.txt
+xvnm.org/cont/ATT/AT&T
+xvnm.org/cont/ATT/AT&T/login.php
  zonehmirrors.org/defaced/2019/09/11/magazinepromo.net/magazinepromo.net/
author	Travis CI User <travis@example.org>
	Mon, 23 Nov 2020 03:37:30 +0000 (03:37 +0000)
committer	Travis CI User <travis@example.org>
	Mon, 23 Nov 2020 03:37:30 +0000 (03:37 +0000)
README.md		patch \| blob \| blame \| history
blacklists/README		patch \| blob \| blame \| history
blacklists/adult/domains		patch \| blob \| blame \| history
blacklists/adult/urls		patch \| blob \| blame \| history
blacklists/malware/domains		patch \| blob \| blame \| history
blacklists/malware/urls		patch \| blob \| blame \| history